Issuu on Google+

Bin yılın kenti - City of a thousand years K A ZA N D o ğ u ’ n u n ç a r ş ıla r ı - T h e b a z a a rs of th e E a st B ir ç o c u k lu k m a s a lı - A c h ild h o o d tale G A Z L A M B A L A R I / KEROSENE LAMPS


DARKMElSf DARKVVIN

C

/

ACCADEMIA


DARKMEh/ D A R K W IN

ACCADEMIA

w w w . d a r k m e n . c o m .t r


skylife YÖNETİM / M ANAGEM ENT Yönetim Kurulu Başkanı Chairman o f the Board Candan Karlıtekin Türk Hava Yolları Adına Sahibi Publisher on behalf o f Turkish Airlines Genel Müdür ve Yönetim Kurulu Üyesi CEO and Member o f the Board Temel Kotil Tanıtma ve Halkla İlişkiler Başkanı Director o f Public Relations and Advertising Hamdi Irmak Tel: [0212] 463 63 6 3 / 1150 Halkla İlişkiler Müdürü Public Relations Manager Mehmet Dinler Tel: [0212] 463 63 63 / 1164 - 2078 Dicle Yürür dyurur@thy.com Ceyda Taşpolatoğlu ctaspolatoglu@thy.com Türk Hava Yolları Genel Yönetim Binası Atatürk Hava Limanı 34149 İSTANBUL YAYIN / PU BLICATIO N

KAPAK / CO VER SERKAN GEZER

co \ -

z LU O

o cc

Yapım / P ro d u c tio n Genel Yayın Yönetmeni Publishing Director Dr. Arif Nihat Dursun nihat.dursun@ cordisgroup.com.tr

LU _

30

l

Yayın Koordinatörü (Sorumlu) / Editorial Coordinator Bahar Kalkan bahar.kalkan@diskus.com.tr Editörler / Editors Füsun Akay fusun.akay@diskus.com.tr Barış Doğru baris.dogru@diskus.com.tr Sanat Yönetmeni / A rt Director Feyza Yapulu feyza.yapulu@diskus.com.tr Grafiker / Graphic Assistant Ulaş Karatağ ulas.karatag@diskus.com.tr Fotoğraf Editörü / Photograph Editör Kurtuluş Gökalp kurtulus.gokalp@diskus.com.tr İngilizce Editörleri / English Editors Virginia Taylor Saçlıoğlu, Fred Stark R eklam / A d v e rtis in g Genel Koordinatör / General Coordinator Tülin Çim tulin.cim@rekand.com.tr Direktör / Director Ebru Üçer Yönezer ebru.ucer@rekand.com.tr Tel: [0212] 269 45 27 Fax: [0212] 269 45 28

LU

û

Z

48

Bin yılın kenti City o f a thousand years Kazan Resim ve heykelle bir ömür A life in painting and sculpture Zühtü Müridoğlu

o 56

Renklerin nehri River o f many colors Kura / The Kura

w cordis jo u p

SB 3B

B

d is

Levent Mah. 4. Gazeteciler Sitesi Ebulula Mardin Cad. Ülgen Sok. 18 A/1 Akatlar / İstanbul skylife@cordisgroup.com.tr http://w ww.cordisgroup.com .tr Tel: [0212] 325 01 5 0 - 5 1 - 52 Fax: [0212] 325 01 43 B a s k ı-C ilt / P rin tin g -B in d in g Doğan Ofset Yayıncılık ve Matbaacılık A.Ş. Tel: [0212] 622 19 00 http://w ww.doganofset.com Skylife dergisine internette, www.thy.com üzerinden SKYLİFE ikonuna tıklayarak ulaşabilirsiniz. / Access SKYLİFE magazine on the internet by clicking the SKYLİFE icon in www.thy.com Skylife dergisi ile ilgili öneri ve şikayetleriniz için customer@thy.com adresine mail gönderebilirsiniz. / Any suggestions or complaints about Skylife magazine are welcomed and should be addressed to customer@thy.com. Dergimizde yayımlanan yazı ve fotoğraflardan yayıncının izni alınmadan, kaynak belirtilmeden tam veya özet alıntı yapılamaz. Neither. text nor photographs t rom this publication may be reproduced either in tull or summary without acknowleding the source and without prior permission from the publisher. Skylife, THY tarafından ayda bir yayımlanır. Skylife is published monthly by Turkish Airlines.

6 Cityscope 136 Rehber / Guide 166 Bilgi / Info 198 Test


68

82

Doğu’nun çarşıları The bazaars of the East Posta pullarında Türk havacılık tarihi The story o f Turkish aviation as told by postage stamps

Zamanın aynasında Fteflections in the mirror o f time Limyra Sakıp Sabancı Müzesi The Sakıp Sabancı Museum

Bir çocukluk masalı A childhood tale Gaz lambaları Kerosene lamps

Ayağa kalkan sular When water gets up on its hind legs Çağlayanlar / Waterfaiis

200 Oyunlar / Puzzie 202 Video ve Müzik / Video and Music 208 Ayın Konuğu / Guest o f the Month


^Dünyanın hattını açıyoruz! o

H ELSİN K İ

M tN Ş K

ST . P E T E R SB U R G

$

®

® Y E K A T E R İN B U R G LU BtY A N A

B E LG R A D ®

DUBLİN

KAZAN ® D İN Y E PE R (g, D pN ETSK '

v

İSTANBUL IlA R T U M

%

®

® R O ST O V

®

o sa k a

T E B R İZ

■®

® ®

D U ŞA N B E

® DOHA L A G O S (§)

SA N A ®

A D İSA BA BA

BOM BAY

® ABU DABİ

®

® M U SK A T

401

Wlltd.lWlİİ»pı'E

Türkiye'nin bayrak taşıyıcısı Türk Hava Yolları, ulaştığı 100’den fazla uçuş noktasına 23 yeni nokta daha ekliyor. LUBİYANA, DUŞANBE, ABU DABİ, ROSTOV, D O NETSK, DİNYEPER, SANA, KAZAN, M İNSK, BOMBAY, TEBRİZ, DOHA, BELGRAD, DUBLİN, ST. PETERSBURG, HELSİNKİ, MUSKAT, YEKATERİNBURG, HARTUM, ADİSABABA, LAGO S, RİGA, OSAKA seferleri başlıyor! iyi uçuşlar...

TU RK HAVA YOLLARI w w w .th y .co m | 4 4 4 O 8 4 9


HOŞGELDİNİZ VVELCOME ABOARD

Sayın Konuklarımız,

Dear Guests,

Türk Hava Yolları olarak yeni yıl itibari ile başlattığımız atılımlarımızdan biri olan hat açılışlarına Şubat ayı içerisinde de devam ettik. Sivil havacılıkta ‘bölgesel bir güç’ değil, 'global bir marka’ olmayı amaçlayan bir kurum olarak, hedeflerimize adım adım ilerlemenin kıvancını yaşıyoruz. Titizlikle planlanarak Şubat ayı içinde açılması sağlanan yeni noktalardan Rostov, Donetsk, Tebriz ve Kazan’a, Türk Hava Yolları güvencesi ile direkt uçabilirsiniz. Mart ayında diğerlerinin de izleyeceği bu yeni hatlarımızın, ülkemiz adına dostluk, kardeşlik, kültürel ve ekonomik bağları artıracağına inanıyoruz. Türk Hava Yolları olarak böylesine önemli bir misyonu üstlenmekten dolayı duyduğumuz gururu sizlerle paylaşmaktan dolayı mutluyuz. Kiev, Simferopol ve Odessa'dan sonra Ukrayna'daki dördüncü sefer noktamız Donetsk; Moskova’dan sonra Rusya Federasyonu’ndaki ikinci ve üçüncü uçuş noktalarımız olan Rostov ve Kazan seferleri ile ülkeler arası ilişkilerin en üst düzeye ulaşacağı inancındayız. Bu üç önemli şehrin yanı sıra; Iran İslam Cumhuriyeti’nin başkenti Tahran'dan sonra, Tebriz'i de Türk Hava Yolları’nın ulaşım ağına eklemenin mutluluğunu yaşıyoruz. Uçuş ağını ve filosunu yaptığı yatırımlarla her geçen gün büyüten Türk Hava Yolları, Tebriz'de varolan ekonomik potansiyeli başta Avrupa'ya, ardından tüm dünyaya ulaştırmak üzere bu hattı açma kararını almıştır. Önemli bir ticaret ve üretim merkezi olan Tebriz'e uçmaya başlamamızın, iki ülke arasında uzun yıllara dayanan ekonomik ve kültürel alandaki dostluğu daha ileriye götüreceğine de inanıyoruz. Değerli yolcularımız, bir taraftan sizleri yeni ülkeler ile buluştururken, diğer taraftan da Türk Hava Yolları olarak yıllardan beri hassasiyetle üzerinde durduğumuz güvenlik ve emniyet konuları ile ilgili çalışmalarımızı devam ettiriyoruz. Türkiye'de uçak, motor ve komponentlerine bakım yetkisi bulunan tek kuruluş olan Türk Hava Yolları'nın 'Uçak Bakımı Yetki Belgesi'nin yenileme denetlemesi, ABD Sivil Havacılık Dairesi (FAA) tarafından 23-27 Ocak 2006 tarihleri arasında yapıldı. Bakım tesislerinde FAA yetkililerince gerçekleştirilen detaylı denetimler sonucu, bakım standartlarımız, FAA standartlarına ve kurallarına uygun bulundu ve övgüyle söz edilerek bakım tesislerimizdeki her çalışanın üstün bir bakım bilincinde olduğu ifade edildi. Çalışanlarımızın özverili çabalarıyla, Ortaklığımızın dünyadaki sayılı havayolu şirketleri arasındaki yerini pekiştirmek için hedeflerimizi daha geliştireceğiz. Hepinize iyi yolculuklar dilerim.

İn one of the many irıitiatives it launched in the new year, Turkish Airlines continued to inaugurate more new routes in the month of February. As a company that aims to be not just a 'regional power' but a 'global trademark' in civil aviation, we are therefore proud to be moving step by step tovvards our goals. You may now fly direct, with the Turkish Airlines' guarantee, to Rostov, Donetsk, Tabriz and Kazan, the new destinations that were introduced in February after much careful planning. We believe that these new routes, vvhich are to be follovved by stili others in March, will strengthen our nation's cultural and economic ties as well as our bonds of friendship and brotherhood with the other countries in the region. İt therefore gives us great pleasure to share with you our pride in undertaking such an important mission. M/e are confident that our flights to Donetsk, our fourth destination in Ukraine foiiovving Kiev, Simferopol and Odessa, and to Rostov and Kazan, our second and third destinations in the Russian Federation after Moscow, are going to raise relations between our countries to the highest possible ievei. İn addition to these three majör cities, we are also happy to be adding to the Turkish Airlines' transport network another city in the Islamic Repubiic of Iran, Tabriz, foiiovving the Capital Tehran. The decision to introduce this route was taken for the purpose of connecting this city, with its vast economic potential, first with Europe and then with the rest of the world. We believe that our decision to fly to Tabriz, a majör çenter of commerce and manufacturing, is going to take the already long-standing friendship betvveen our two countries in the economic and cultural arena to even greater heights. As we bring you in touch with new countries on the one hand, on the other we are also pursuing our efforts with regard to safety and security, issues on vvhich Turkish Airlines has placed special importance över the years. As the sole company in Turkey authorized to maintain airplanes and aircraft engines and their components, Turkish Airlines underwent an inspection from 23 to 27 January by the U.S. Federal Aviation Authority (FAA) for renevval of its ‘Aircraft Maintenance Authorization Certificate'. Following the detailed inspections that were conducted by FAA officials at the maintenance facilities, we are proud to announce that our maintenance standards were said to be in complete compliance with FAA standards and regulations, and each and every one of our service personnel to have a highly developed concept of maintenance. Through the selfless efforts of our dedicated employees, we intend to set our sights even higher in order to consoüdate our Company's place among the vvorld's most respected airtines. I wish you ali a pleasant flight.

Doç. Dr. Temel KOTİL Genel Müdür ve Yönetim Kurulu Üyesi

Temel KOTİL, Ph.D. CEO and Member of the Board


CİTYSCOPE

SERGİ EXHIBITIONS

Kadınlar, Resimler, Öyküler’ ‘VVomen, Paintings, Stories’

'Uçmayı Düşleyen Romantik Heykeller’ 'Romantic Statues That Dream Of Flying’ Hayattan çekip çıkardığı duygu devinimlerini, heykellerinin bedenlerinde izleyiciye aktaran Nadia Arditti, 2-25 Mart tarihlerinde dem -art Sanat Galerisi’nde... 'Uçmayı Düşleyen Romantik Heykeller’ başlıklı heykel sergisinde Nadia Arditti; ‘Sen ve Ben’ , ‘Aşk Sanatı’, ‘Ayrı Beraberlik’ ve ‘Ayışığı’ adlı çalışmalarını sanatseverlerin beğenisine sunacak. Tel: (0212) 287 78 67 6 SKYLIFE 3 /2 0 0 6

Nadia Arditti, who corıveys the emotionat upheavals in her life in the bodies o f her sculptures, is exhibiting her work at the dem -art Art Gallery from 2 to 25 March. A t the exhibition, vvhich is entitled ‘Romantic Statues That Dream Of Flying', A rd itti is presenting art iovers with her works, ‘You and M e ’, ‘The A rt o f Love', ‘Separate Togetherness' and 'Moonlight'. Tel: (0212) 287 78 67

Gün geçtikçe çok heyecan verici bir bilim dalı haline gelen sanat tarihinin, kendi ana malzemesine her gün yeni ve taze bakışlarla bakması, ‘yeni okumalarla’ ele alması gerektiği, daha iyi anlaşılıyor. Pera Müzesi salonlarında açılan ‘Kadınlar, Resimler, Öyküler / Modernleşme sürecindeki Türk resminde ‘Kadın’ imgesinin dönüşümü’ adlı sergi de, böyle bir bakış açısının ürünü. Sanat tarihçisi Doç. Dr. Zeynep Yasa Yaman ın danışmanlığında hazırlanan sergi, izleyenleri II. Meşrutiyet’ten Cumhuriyet dönemine (1908-1923), resim sanatımızın çağdaşlaşma yıllarına götürürken; ‘kadın’ imgesinin dönüşümü gibi çok özel, ama birçok açıdan çok anlamlı bir tema çerçevesinde yeniden kat ediyor bu dönemi. Çeşitli kamu kurumlarından ve özel koleksiyonlardan seçilerek bir araya getirilen elliyi aşkın resmin bulunduğu sergi, 9 Nisan’a kadar ziyaret edilebilir. Tel: (0212) 334 99 00

A rt history, vvhich is getting nnore exciting by the day as it takes a fresh, new took a t its material, has to be approached from the standpoint o f ‘new readings'. A nd the exhibition nevviy opened at the Pera Museum and entitled, ‘VVomen, Paintings, Stories / The transformation of ‘wom an’s image in Turkish painting during the modernization process’, is the p ro d u ct o f ju s t such an approach. This exhibition, vvhich has been m ounted by the museum in consultation vvith Assoc. Prof. Dr. Zeynep Yasa Yaman, transports visitors back to the period from the Second Constitution up to the Republic (19081923) when Turkish painting entered the modern age, and reinterprets the period in the context o f very meaningfui, and in many ways very special, themes. Including more than fifty paintings assembled from various governm ent institutions and private coilections, the exhibition runs until 9 April. Tel: (0212) 334 99 00


S İfş m f

aydınlık bir dünya için

illumirıate your vvorld.

Uluslararası kalite standartlarında fonksiyonel ve estetik bir anlayışla tasarlanan EL-Bİ elektrik anahtarları, ideal bir çözümdür. EL-Bİ elektrik ürünleri, modern, şık ve zengin renk seçenekleriyle farklı dekorasyon tarzlarına uyum sağlar. Geniş yelpazede elektrik tesisatı malzemeleri ve aksesuarları sunan EL-Bİ, aydınlık bir dünya için m ükem m el bir seçim.

www.el-bi.com


CİTYSCOPE

SERGİ EXHIBITIONS

Nadide eserler müzayedesi Auction of rare artifacts Alif Art Antikacılık, 5 Mart’ta Esma Sultan Yalısı’nda ‘Osmanlı ve Karma Sanat Eserleri’ başlıklı bir müzayede düzenliyor. Sanatsal, kültürel ve tarihi özellikler taşıyan 315 eserin açık artırma ile satışa sunulacağı müzayededeki parçalardan bazıları şöyle: Ünlü oryantalist Fabius Brest’in büyük boyutlu İstanbul’ tablosu, Fausto Zonaro'nun ‘Eminönü’ temalı eseri; Sultan Abdülmecid’in torunu Naciye Sultan’a ait mücevherler ve 17. yüzyılın ünlü hattatlarından Ramazan Bin İsmail’e ait, orijinal tezhipli, çok değerli bir Kur’an-ı Kerim... Tel: (0212) 225 00 69

‘1951 mezunları’ buluşuyor The class of '51 together again Türk çağdaş resminin beş usta ismi; Şadan Bezeyiş, Adnan Çöker, Turan Erol, Abdurrahman Öztoprak ve Orhan Peker’in seçkin yapıtları, 17 Mart’ta iş Sanat Kibele Sanat Galerisi’nde ziyarete açılıyor. İstanbul Devlet Güzel Sanatlar Akademisi’nden 1951 yılında mezun oldukları için ‘1951 Mezunları/Çağdaşlar’ adını taşıyan sergi, 29 Nisan’a kadar gezilebilecek. Tel: (0212) 316 15 80

8 SKYLIFE 3 /2 0 0 6

Selected works by five leading names in contem porary Turkish painting, Şadan Bezeyiş, Adnan Çöker, Turan Erol, Abdurrahman Öztoprak and Orhan Peker, are going on display a t the iş Sanat Kibele Art Gallery on 17 March. Dubbed ‘The Class o f ‘51/C ontem poraries’ since ali these painters graduated from the İstanbul Academy o f Fine Arts in that year, the exhibition runs until 29 April. Tel: (0212) 316 15 80

Antique deaier Alif Art Antikacılık is holding an auction, ‘Ottoman and Assorted VVorks of A rt’, at the Esma Sultan Yalı on 5 March. To be auctioned are 315 items o f artistic, cultural and historical value, among them celebrated orientalist Fabius Brest's largescale 'İstanbul' painting: Fausto Zonaro's work based on the district o f ‘Eminönü’; jevvelry that belonged to Sultan Abdülmecid's grand-daughter Naciye Sultan; and an originai illuminated manuseript o f the ûuran, vvritten by the famous 17th century calligrapher Ramazan Bin İsmail. Tel: (0212) 225 00 69

Daniel Colagrossi’nin 'hilalleri Daniel Colagrossi’s ‘crescents’ İtalyan asıllı Fransız sanatçı Daniel Colagrossi, Türkiye’deki ‘Hilali’ adlı ikinci resim sergisini, 1 Mart’ta C.A.M. Galeri’de açıyor. Colagrossi sergideki eserlerinde, Osmanlı çintemanilerinden ‘hilal’ motifini ön plana çıkararak, Türk sanat estetiğinin dünden bugüne evriminin kendisi üzerinde yarattığı duyguları resimliyor. Üstelik kendi bulduğu özel bir teknikle... Fotoğraf kâğıdı üzerine çini mürekkebiyle yapılmış ve asit banyosundan geçirilerek sabitlenmiş resimler, sanatçının ve biraz da tesadüfün eseri olarak izleyenleri büyülüyor... Sergi, 2 Nisan’a kadar gezilebilir. Tel: (0212) 245 79 75

A French artist o f Italian descent, Daniel Colagrossi is opening his second painting exhibition İn Turkey, ‘The Crescent’, at the C.A.M. Gallery on 1 March. İn this exhibition, in vvhich he singles out the ‘crescent’ motif among the Ottoman chintemanis, the artist paints the emotions generated in him by the evolution o f Turkish aesthetics from yesterday to today. And he does so using a special technique o f his own invention. The paintings, vvhich were done on photographic paper in India ink and fixed in an acid bath, mesmerize visitors as the vvork both o f the artist and, a little too, o f chance. Until 2 April. Tel: (0212) 245 79 75


m SERGİ BKHIBITIONS O O ^ O

Filiz Karsan resim sergisi Filiz Karsan painting exhibition

Yurtiçinde ve yurtdışında pek çok sergiye katılan Filiz Karsan, kendisiyle özdeşleşen suluboya eserleriyle 14 M art'tan itibaren Hobi Sanat Galerisi’nde... 7 Nisan’a kadar ziyaret edilebilecek sergide Karsan, sanatseverleri İstanbul, Paris ve Peru arasında duygusal bir yolculuğa çıkaracak. Tel: (0212) 225 23 37

M ik e r ' ı

Yedi yıldır Türkiye’de yaşayan Amerikalı sanatçı Mike Berg, 3 M art’tan itibaren İstanbul

B O rC I . n | ıı

baleri Nev Cle Mike Berö at , . .

ualeri I\İ0V

Filiz Karsan, who has taken part in a number of exhibitions both in Turkey and abroad, is exhibiting the water colors that are synonymous with her name at the Hobi Art Gallery from 14 March. A t the exhibition, vvhich runs to 7 April, Karsan will take art lovers on an emotional journey to İstanbul, Paris and Peru. Tel: (0212) 225 23 37

Galeri Nev'de eserlerini sergileyecek. Sanatçının, 'You can’t say it that way anymore’ başlıklı sergisinde; önce çizimle başlayıp sonra bronz levhaları kesip çıkarmasıyla, yer yer Picasso ve Matisse'in kâğıt kesme tekniği eserleri ile modernist bağlamda ilişki kurduğu yapıtlarını gözlemleyebilirsiniz. Tel: (0212) 231 67 63

Ernst Barlach’ın eserleri İstanbul’da VVorks of Ernst Barlach in İstanbul

Alman ekspresyonizminin en tanınmış sanatçılarından heykeltıraş, ressam ve edebiyatçı Ernst Barlach’ın eserleri, 21 Mart30 Nisan tarihlerinde Tophane-i Amire’de ve Goethe Institut’da sanatseverlerle buluşuyor. Ernst Barlach Vakfı, İstanbul Mimar Sinan Üniversitesi Mezunları Derneği, Akbank Sanat ve Goethe Institut Istanbul-Ankara işbirliğiyle gerçekleşen sergide; Blach'ın, Almanya'nın çeşitli kamusal mekânlarından ve özel koleksiyonlarından toplanan ellinin üzerinde plastik ve yüzün üzerinde grafik eseri yer alıyor. Goethe Institut’daki sergide de sanatçının, Goethe’nin Faust’u ve Goethe'nin şiirleri için yaptığı resimlemeleri izleyebilirsiniz. Tel: (0212) 252 16 00

The American artist Mike Berg, who has lived in Turkey for seven years, is exhibiting his vvorks in an exhibition entitled, 'You c a n ’t say it that way any more', opening at İstanbul Galeri Nev on 3 March. Among the vvorks in the exhibition, the tablets the artist has cut from bronze after starting with dravvings on paper make reference to the cut-outs o f Matisse and Picasso in a m odernist setting. Tel: (0212) 231 67 63

The vvorks o f sculptor, painter and literary figüre Ernst Barlach, one o f the best knovvn artists o f German Expressionism, will be on exhibition at the Goethe Institute and the Ottoman Imperial Cannon Foundry from 21 March t o 30 April. M ounted jointly by the Ernst Barlach Foundation, the Alumni Association o f İstanbul Mimar Sinan University, Akbank Sanat, and the Goethe Institute Istanbul-Ankara, the exhibition ineludes över fifty plastic and över hundred graphic vvorks by Barlach collected from various public institutions and private collections in Germany. Visitors to the exhibition at the Goethe Institute can also see the paintings that were made by the artist for Goethe ’s Faust and other Goethe poems. Tel: (0212) 252 16 00


Sheraton Ankara, Sheraton H eliopolis C airo, Sheraton Dead Sea. " h e r a tS ^ S la l,* S h e r a t ö n .J e r t ^ ^ G ! Righa Royal H otel VVaSeda, Righa Royal H otel Osaka, Portopıa Hotel Osaka. Conrad London, Conrad Şrussete,., Conrad İstanbul, Conrad Dublin, Grand Hotel Royal Budapest, Holiday Inn Disney Paris, Intencontinental Bethlehem, David Intercontinental Telaviv, Intercontinerital Amman, Intercontinental Astana, Carlton Telaviv, Le Meridien VVten, H y a tt Regency İstanbul, Grand H yatt Amman, Hyatt Regency Mainz, Hyatt Regency Dead Sea, Xanthe Resort, Hyatt Regefft?/.J^aku, Hanshin Fukushima Hotel OsaKs,'Keihan Hotel Osaka, The Regent Almaty, Movenpıck İstanbul, Sandy Lane HoteT'Bac^ados, A d a G o lf Club Stockholm, C ornelia Antalya, King David H o tel Jerusalem, Svviss H o te l Istalabul, H iltö fr İstanbul, H ilton W arsaw , The Regent Esplanade Zagreb, Style H o te l W ie n L ara R e s o rtS p a & S ü ite ^ R e n a is s itP T fe  k ta u H o t e l, R en aissan ce A ty ra u H o t e l , L e M e r i d i e n B a r c e l o n a ' İ S T A N B U L

T;

A N K A R A ***** T :

»”0

2 1 2 3 2 4 3 6 0 0

9 0

3 1 2

8 4 7

5 0

4 0

^

‘ - ___

M O B @ M O B . C O M

TV R

W W W . M O B . C Ö ’m . T R


CİTYSCOPE

SERGİ EXHIBITIONS 'Su ve çağrıştırdıkları. Water and its associations...

‘Arınma isteği, suyun içinde olma durumu ve gövdenin yalnızlığı’ , Gürhan Yücel’in Tem Sanat Galerisi nde açtığı ‘Su’da’ başlıklı sergisinde... 15 Mart-8 Nisan tarihlerinde gezilebilecek sergide sanatçı; yaşam kaynağı su ile arınma, yalnızlık, belirsizlik, zaman algısı, insanın varolma/yokoluş serüvenini ele alıyor ve sizi su ile bilinmeyenin derinliklerine doğru yola çıkarıyor. Tel: (0212) 247 08 99

‘The desire for purification, the state o f being in water and the loneliness o f the body’ are the themes o f Gürhan Yücel’s exhibition, ‘İn VVater’, at the Tem Art Gallery. At the exhibition, vvhich runs from 15 March to 8 April, the artist considers purification by life-source water, loneliness, uncertainty, the perception o f time and the story o f human existence and death, taking viewers to the depths o f the unknown through vvater. Tel: (0212) 247 08 99

Beş sanatçı ve beş oda,,. Five artists, five rooms...

Özdemir Altan retrospektif sergisi Özdemir Altan retrospective Türkiye’nin plastik sanatlar ortamının avant-garde sanatçısı Özdemir Altan, çeşitli dönemlerinden seçtiği eserlerini Kare Sanat Galerisi’nde bir araya getiriyor. ‘Köpek Gezdirme Alanları Projesi’ , ‘Soyağacı’ ve ‘İstanbul’ ; sanatçının 10 M art’a kadar gezilebilecek retrospektif sergisinde yer alan eserlerinden birkaçı... Tel: (0212) 240 44 48

12 SKYLIFE 3 /2 0 0 6

An artist in the vanguard o f Turkey’s plastic arts scene, Özdemir Altan is joining art lovers a t the Kare Art Gallery this m onth with vvorks from his various periods. The art İs t’s ‘Dog VVaiking Area P roject’, 'Family Tree' and ‘İstanbul’ are ju s t a few of the vvorks in this retrospective, vvhich runs to 10 March. Tel: (0212) 240 44 48

Bayram Candan, Kurucu Koçanoğlu, Leyla Sakpınar, Raziye Kubat ve Şirin İskit'in birbirlerinden habersiz ve bağımsız olarak düzenledikleri odaları, Galeri A pel’de izleyebilirsiniz. ‘Kendine Ait Bir Oda? Beş Sanatçı, Beş Oda’ başlıklı sergi, 18 M art’a dek gezilebilecek. Virginia VVoolf’un kaleme aldığı ‘Kendine Ait Bir O da’dan esinlenerek adı konulan sergi hakkında sanatçılar şöyle diyor: “ Kısmen de olsa kendimize ait olmayan bir başlıktan yararlandık; ancak Virginia VVoolf’un kitabı üzerine kurgulanmış bir sergi olmadığını ayrıca belirtmek istiyoruz” . Tel: (0212) 292 72 36

At the Galeri Apel this month you can see five rooms designed entirely individually and İndependently o f each other by artists Bayram Candan, Kurucu Koçanoğlu, Leyla Sakpınar, Raziye Kubat and Şirin İskit. The exhibition, dubbed ‘A Room Of One’s Own: Five Artists, Five Rooms’, runs until 18 March. Commenting on the exhibition, vvhose titie was inspired by Virginia VVoolf’s novel o f the same name, the artists say: “İn part at least we made use o f a titie that is not our own; but we would iike to point out that this is not an exhibition based on Virginia VVoolf’s book. ” Tel: (0212) 292 72 36


HOLDİNG


CİTYSCOPE

SERGİ EXHIBITIONS Sualtından Türkiye... Turkey Undervvater

'Ağıtlar ve Anıtlar’ ‘Laments and Monuments’ Sakarya milletvekili ve fotoğraf sanatçısı Süleyman Gündüz, 15 ülkede çektiği 120 kareyi, 15 M art15 Nisan tarihleri arasında izleyicilerin beğenisine sunuyor. TBMM Milli Saraylar Daire Başkanlığı’na bağlı Dolmabahçe Sarayı Sergi Salonu’nda gerçekleşecek sergi, ‘Ağıtlar ve Anıtlar’ adını taşıyor. Gündüz, fotoğraf sergisinin içeriğini şu sözlerle anlatıyor: “Yeryüzünde her ağıt, bir başka anda bir anıta dönüşür. Doğunun ve güneyin ağıtları, batının ve kuzeyin anıtlarıdır” ... Tel: (0212) 236 90 00

14 SKYLIFE 3 /2 0 0 6

Photographer and MP for Sakarya province Süleyman Gündüz is presenting art lovers with 120 photographs that he shot in fifteen different countries. Entitled ‘Laments and Monuments’, the exhibition opens at the Dolmabahçe Palace Exhibition Hail on 15 March and runs until 15 April. Gündüz describes the content of the photographs as follows: “Every lament on the face o f the earth is transformed in another instant into a monument. The laments o f the east and south are the monuments o f the north and west. ” Tel: (0212) 236 90 00

Sualtı fotoğrafçısı Tahsin Ceylan, dünya tarihini değiştiren Çanakkale Zaferi'nin 91. yıldönümünde, 18 Mart'ta, beşinci kişisel sergisini açıyor. Çanakkale Onsekiz Mart Üniversitesi Kültür Evi’nde gerçekleştirilecek sergide yer alan fotoğrafların büyük bölümü, Çanakkale sualtı yaşamı ve savaş batıklarından oluşuyor. 30 Mart’a kadar sürecek sergide ayrıca üç tarafı denizlerle çevrili olan Türkiye'nin pek çok bölgesindeki sualtı yaşamına da şahit olacaksınız. Tel: (0286) 212 93 05

Underwater photographer Tahsin Ceylan is opening his fifth solo show on 18 March, the 91st anniversary o f the Turkish victory at Gallipoli, which changed the history of the world. The majority of the photographs in the exhibition, vvhich is being held at the Culture Çenter of Çanakkale Onsekiz Mart University, depict undervvater life and sunken battleships. You may also get a glimpse o f undervvater life in several regions o f Turkey, vvhich is surrounded by sea on three sides, at this exhibition, vvhich runs until 30 March. Tel: (0286) 212 93 05

Eşret Üren resim sergisi Eşref Üren painting exhibition Bedri Rahmi’nin, “Ankara Kalesi’ne tutunan tecrübeli bir kartal, bir top kır çiçeği, Anadolu’da kaybolmuş bir köy, bir dere, bir karamuk, bir ardıç fidanı gibiydi” diye tarif ettiği Eşref Üren, Ankara Helikon Sanat Galerisi’nde anılıyor. Sanatçının izleyenlere mutluluk aşılayan, çeşitli koleksiyonlardan sağlanan yapıtlarını, 8 Mart-4 Nisan tarihlerinde görebilirsiniz. Tel: (0312) 441 78 01

Painter and poet Bedri Rahmi Eyüboğiu compared Eşref Üren to "a seasoned old eagle clinging to the Ankara Citadel, a bouquet o f vvild flovvers, a lost village in Anatolia, a stream, a corncockle, a juniper sapling. ” Now the artist is being remembered at the Ankara Helikon Art Gallery in an exhibition o f his vvorks assembled from various collections. From 8 March to 4 April. Tel: (0312) 441 78 01


L a fa rg e T ü rk iy e ve T o p lu m G ö n ü llü le ri Vakfı " Ş im d i O k u llu O ld u k " p ro je s i için e l ele... Lafarge Türkiye, Türkiye'nin eğitim ve kültür dünyasına katkılarını artırarak sürdürecek. Okullarımız yaşasın, eğitim dostu ortamlar gelişsin,

FARGE

çocuklarımız iyi eğitim alsın diye...


CİTYSCOPE

M ÜZİK MUSIC iş Sanat’tan zengin program A rich program at iş Sanat

16 SKYLIFE 3 /2 0 0 6

iş Sanat, Mart ayında Klasik Müzik’ten Türk Sanat Müziği’ne dopdolu bir program sunuyor. Ayın ilk konuğu, 20. yüzyılın en uzun soluklu oda müziği topluluklarından Camerata Salzburg... Ünlü şef Trevor Pinnock’un yönetimindeki topluluk; Mozart, Ibert ve Mendelssohn’un eserlerinden oluşan bir repertuvarla 1 M art’ta müzikseverlerin kulağının pasını attıracak. Geçtiğimiz yıl ‘En iyi Caz Vokalisti' dalında Grammy Ödülü'ne aday gösterilen Dee Dee Bridgevvater, yeni albümü ‘J ’ai Deux Am ours’daki aşk şarkılarıyla 4 M art’ta sahne alıyor. Çok sesli koro müziği alanında yaptığı çalışmalarla Türkiye’yi tüm dünyada başarılı şekilde tanıtan Orfeon Oda Korosu da, şef Elnara Kerimova yönetiminde 11 M art’ta dinleyiciyle buluşacak. Türkiye’nin değerli sesi Emel Saym’ın Senfoni Orkestrası eşliğinde yorumlayacağı Münir Nurettin Selçuk şarkıları ise, 17-18 M art’ta... ‘Çocuklar için Klasik Müzik Projesi' çerçevesindeki ‘Hayvanlar Karnavalı’, 12 Mart; Tunca Doğu ve Berke Okman'ın; Mozart, Danzi, Kalliwoda ve Faure gibi sanatçıların eserlerinden oluşan repertuarı, 14 Şubat; İncesaz ve Dromos grubundan ‘Aynı Telden Şarkılar’ , 21 Mart ve usta viyolonsel sanatçısı Hienrich Schiff’in piyanist Olli Mustonen ile vereceği konser, 25 M art’ta iş Sanat’ta... Tel: (0212) 316 10 83

İş Sanat is offering a rich program in March with everything from western classical to Turkish art music. The first guest o f the month is the Camerata Salzburg, one o f the 20th century’s m ost long-lived chamber m usic ensembles. Under renovvned conductor Trevor Pinnock, the group will delight music lovers on 1 March with a program o f vvorks by Mozart, Ibert and Mendeissohn. On 4 March, Dee Dee Bridgevvater, vvho was nom inated last year for a Grammy in the category ‘Best Jazz Vocalist’, vvill take the stage vvith love songs from her new albüm 'J ’ai Deux A m ours’. The Orfeon Cham ber Chorus, vvhich is prom oting Turkey throughout the vvorld vvith its poiyphonic choral music, vvill perform on 11 March under conductor Elnara Kerimova. Meanvvhile, on 17 and 18 March, one o f Turkey’s all-tim e favorite singers, Emel Sayın, vvill interpret the songs o f Münir Nurettin Selçuk, accom panied by the symphony orchestra. To be follovved by Camille Saint-Saens' ‘Carnival of the Anim als’ in the ‘Classical Music Project for C hildren' on 12 March; Tunca Doğu and Berke Ok m an 's program o f vvorks by Mozart, Danzi, KaHivvoda and Faure on 14 March; ‘Aynı Telden Şarkılar' by the İncesaz and Dromos Group on 21 March; and a concert by cellist Heinrich Schiff and pianist Olli Mustonen on 25 March. A li at İş Sanat... Tel: (0212) 316 10 83


I i^ n c il ik


CİTYSCOPE

M ÜZİK MUSİC Müziğin her tonu SGM’de... Music of every stripe at SGM...

Sanat danışmanlığını Yekta Kara’nın yaptığı Sabancı Üniversitesi Gösteri Merkezi (SGM), Mart ayında dopdolu bir programla sanatseverleri ağırlıyor. Kendine özgü, çabuk tüketilmeyen şarkılarıyla beğeniyle dinlenen Feridun Düzağaç, 1 Mart’ta müzikseverlere bir konser verecek. Yaptıkları dizi müzikleriyle tanınan; Murat Aydemir, Derya Türkan ve Cengiz Onural’ın yedi yıl önce kurduğu incesaz grubu ise, 2 Mart’ta sahne alacak. Solistliğini Dilek Türkan’ın yaptığı grup, bazen bir tanbur sesiyle neşelendirecek, bazen de bir kanunla hüzün verecek... SGM’deki diğer konserler ise şöyle: Akustik tınılı ve çok sesli pop-rock grubu Badem, 15 Mart; Akbank Oda Orkestrası, ‘Ustalar ve Çıraklar’, 21 Mart ve Türkiye’deki etnik müziğin en genç temsilcilerinden Sefarad grubu, 28 Mart... Tel: (0216) 483 90 26

Ustalar ve Çıraklar Masters and Apprentices

Cem Mansur yönetimindeki Akbank Oda Orkestrası’nın ‘ Dünden Bugüne’ dizisi, Mart ayında müzik tarihinde önemli bir yeri olan usta ve çırak ilişkisine değiniyor. 18. ve 20. yüzyılların büyük bestecilerini bu çerçevede bir araya getiren program, günümüzün en önemli viyolonsel virtüözlerinden Natalie Clein’in solistliğinde gerçekleştirilecek. Konserde; F. Bridge’in Süit, J. Haydn’ın Re majör viyolonsel konçertosu, W. A. M ozart’ın Danslar ve B. Britten’in Frank Bridge Çeşitlemeleri seslendirilecek. 'Ustalar ve Çıraklar’ı 22 M art’ta, Kadıköy Halk Eğitim M erkezi’nde ve 23 M art’ta, Cemal Reşit Rey Konser Salonu’nda (CRR) dinleyebilirsiniz... Kadıköy Halk Eğitim Merkezi tel: (0216) 450 36 00 CRR tel: (0212) 232 98 30

18 SKYLIFE 3 /2 0 0 6

The Sabancı University Show Çenter (SGM), under artistic consultant Yekta Kara, is welcoming music lovers with a rich program in March. Feridun Düzağaç, who charms listeners vvith his unique songs, vvill give a concert on 1 March. Meanvvhile the İncesaz group, formed seven years ago by Murat Aydemir, Derya Türkan and Cengiz Onural, vvill take the stage on 2 March. With Dilek Türkan as soloist, this group vvill, in turn, cheer listeners vvith the sound o f the tambur and evoke sadness vvith the strains o f the kanun. Other concerts at SGM inciude: Badem, a polyphonic pop-rock group vvith an acoustic sound, on 15 March; an Akbank Chamber Orchestra concert, ‘Masters and Apprentices’, on 21 March; and the Sefarad group, Turkey’s youngest representatives o f ethnic music, on 28 March. Tel: (0216) 483 90 26

The concerts series ‘From Yesterday to Today', given by the Akbank Chamber Orchestra under conductor Cem Mansur, in March is taking up the master-apprentice relationship, vvhich has played such a key role in the history o f music. The program, vvhich brings together in this context the great composers o f the 18th and 20th centuries, vvill feature Natalie Clein, one of today’s most celebrated çello virtuosos, as soloist in a concert o f vvorks including Frank Bridge’s Süite, Haydn’s Çello concerto in D Majör, Mozart’s Dances and Benjamin Britten’s Frank Bridge Variations. ‘Masters and Apprentices' vvill be given at the Kadıköy Adult Education Çenter on 22 March, and at the Cemal Reşit Rey Concert Hail (CRR) on 23 March. Kadıköy Adult Education Çenter tel: (0216) 450 36 00 CRR tel: (0212) 232 98 30


Şehrin trafiğine girmeden, işten eve dönmek istersiniz... İstediğiniz anda istediğiniz yere uçmak istersiniz... Düşlemeyin yaşayın.

Sınırsız leasin Sınırsız güç... Güç sizin elinizde...

Biz düşlerinizi gerçekleştirmek için varız. Gücümüzü paylaşmak, gücünüze güç katmak arzumuz... Sîzlerden aldığımız güçle daha da büyüyen kurumumuzun artan gücü, yine sizin hizmetinizde...

rtL

Yani güç sizin elinizde... % 100 finansman, düşük maliyet, hızlı ve net çözümler, size özgü bütçeleme, uzman kadro, sektör deneyimi... Hepsinden yararlanmak sizin elinizde! Sınırsız leasing fırsatını yaşamak için T e le F O N 'u arayın. G ü c ü n ü z ü ka tlayın .

Güç sizin elinizde !

www .fonleasing.com

FON L E A S İN G

teleFON

444 O 366

"Sınırsız Leasing"


CİTYSCOPE

M ÜZİK MUSİC Roy Ayers Babylon’da Roy Ayers at Babylon

Mart ayında da müziğin her rengine yer veren Babylon’un ilk konuğu, D oğu’ya özgü Sufi müziğinin ilahi geleneğini çağdaş müziğin tınılarıyla incelikli bir biçimde harmanlayan Mercan Dede... Sanatçı, 1, 2, 3 ve 4 M art’ta, birbirinden tamamen farklı projeleriyle sahne alacak. 1960’lardan bu yana caz, funk ve r&b dünyasının en önemli vokalistlerinden biri olmayı sürdüren Roy Ayers da, Babylon’da İstanbullu müzikseverlerle buluşacak... 70 ve 8 0 ’lerde dünya müzik listelerinin zirvesinden inmeyen sanatçının vereceği konser, 10 ve 11 M art’ta... Babylon’un Mart ayındaki konuklarından bazıları ise şöyle: İlkay Akkaya, 7 Mart; S em a’dan ‘Efsane Hanımlar' konseri, 8 Mart; Them Shepherds, 16 Mart; Selen G ülün-Just About Jazz, 22 Mart; DJ Shantel’den özgür Balkan melodileri, 25 Mart... Tel: (0212) 292 73 68

This month ’s fırst guest a t Babylon, which is bringing a wide gamut o f music in its March program, is Mercan Dede, who combines the Sufi music o f the East vvith contemporary sound in a refined blend. Taking the stage on 1,2, 3 and 4 March, the artist vvill present a different program each night. Roy Ayers, one o f the leading vocaiists o f the jazz, funk and r&b scene since the 1960s, is also joining İstanbul music lovers at Babylon in March. The concerts by this artist, who topped vvorld music charts in the 70s and 80s, are on 10 and 11 March. Other guests at Babylon in March include: İlkay Akkaya, 7 March; a ‘Legendary Ladies’ concert by Sema, 8 March; Them Shepherds, 16 March; Selen Gülün: Just About Jazz, 22 March; and DJ Shantel’s free-wheeling Balkan melodies, 25 March. Tel: (0212) 292 73 68

CRR’de Mart March at CRR

Cemal Reşit Rey Konser Salonu’nun (CRR) bu ayki ilk etkinliği, ‘Flamenco Turco / Mutlu Torun Buluşmalar-2’. 1 M art'ta gerçekleştirilecek konserde; Mutlu Torun (ud-gitar), Erkan Oğur (kopuz-gitar), Hüseyin Sarısaltıkoğlu (gitar), Erdal Akyol (kontrabas) ve Ferruh Y a kın ’dan (perküsyon) oluşan topluluk, Mutlu Torun'un Türk Müziği'nin yanı sıra, Klasik Batı Müziği, caz ve flamenko gibi müzik türlerine uzanan eserlerinden oluşan bir programla müzikseverlerle buluşacak. CRR’nin Mart programından bazı seçkiler de şöyle: CRR Senfoni Orkestrası, 4 Mart; İdil Biret piyano resitali, 6 Mart; Mischa Maisky viyolonsel resitali, 11 Mart; Borodin Ouartet, 17 Mart ve Şirin Pancaroğlu arp resitali, 24 Mart... Tel: (0212) 232 98 30

This m onth’s first event a t the Cemal Reşit Rey Concert Hail is ‘Flamenco Turco / Mutlu Torun Buluşmalar-2’. The g ro u p ’s concert, on 1 March, features Mutlu Torun (oud and guitar), Erkan Oğur (kopuz and guitar), Hüseyin Sarısaltıkoğlu (guitar), Erdal Akyol (counterbass) and Ferruh Yakın (percussion). Besides Mutlu Torun’s Turkish music, the program also includes a vvide range o f vvorks from vvestern classical to such genres as jazz and Flamenco. Other selections from CRR’s March program: the CRR Symphony Orchestra, 4 March; a piano recital by Idil Biret, 6 March, a çello recital by Mischa Maisky, 11 March; the Borodin Ouartet, 17 March, and a harp recital by Şirin Pancaroğlu on 24 March. Tel: (0212) 232 98 30

20 SKYLIFE 3 /2 0 0 6


I B iz uçm uyoruz! Yorum katmadan, abartmadan, en yalın şekliyle haberi okuyucularımıza iletiyoruz.

Mau^tta S e s l e r f a r k lı, ş a r k ı aynı: " " S Î n İuT Ö z g ü r lü k ç ü C um huriyet

'S 'S N D

Society for News Design - 2004 Zaman’a 1 gümüş 4 ayrı mükemmellik ödülü Dünyanın önde gelen 29 ülkesinden önemli gazeteler, 15.020 say fa tasarım ıyla yarışm aya katıldı.

W W W .Z a iT ia n .C O m .t r


CİTYSCOPE

HABER NEVVS En yeni kısa İngiliz filmleri The latest English short films

Ingiltere’de yapılan en yeni kısa filmleri izlemek istiyorsanız, ‘5. Ingiliz Kısa Film Günleri’ni kaçırmayın. British Council ve Ankara Sinema Derneği’nin işbirliğiyle düzenlenen etkinlik; 2-4 M art’ta Ankara’da Türk-lngiliz Kültür Demeği Salonu ile Ankara ve Gazi Üniversitelerinin iletişim Fakültelerinde; 6-7 M art’ta Mersin Üniversitesi Merkez Konferans Salonu’nda; 10-11 M art’ta Sivas Cumhuriyet Üniversitesi Kültür Merkezi’ nde; 22-23 M art’ta İzmir Güzelyalı Kültür Merkezi ve Benal Nevzat Salonu’nda; 25-26 M art’ta Diyarbakır Sanat Merkezi Çok Amaçlı Salon’da gerçekleştiriliyor. Etkinlik kapsamında ayrıca, Türkiye ve Avrupa'dan genç yönetmenlerin filmleri de yer alıyor. Tel: (0312) 466 34 84

Mozart'ın anısına,,, Remembering Mozart...

Kısa bir ömür sürmesine rağmen, klasik müziğin şaheserleri arasında sayılan çok sayıda eser bırakan besteci VVolfgang Amadeus Mozart, doğumunun 250. yılında ‘Ülker Müzik Günleri’ ile de anılıyor. Üç gün sürecek etkinliğin ilki, 11 Mart’ta Atatürk Kültür Merkezi’nde gerçekleştirilecek ‘Mozart’la Sonsuzluğa Yolculuk’ konseri. Konserde, Türkiye’nin ünlü keman virtüözü Cihat Aşkın, dünyanın tanınmış piyanistlerinden Torleif Torgersen ve meşhur keman yapımcısı Ammon Weinstein olacak. Konserin heyecan verici bir yanı da, Cihat Aşkın’ın, 1763’te yapılan ve Mozart’ın babası Leopold Mozart’ın orkestrasında kullanılan tarihi keman; Torleif Torgensen’in de o devrin özelliklerini taşıyan piyano ile konser verecek olması. 13 Mart’ta Lütfi Kırdar Kongre ve Sergi Sarayı’nda gerçekleşecek konserde de, Mozart’ın koro eseri ‘Grand Messe’, şef Hakan Şensoy yönetiminde seslendirilecek. Avrupa Korosu ve Filarmonia İstanbul da, aynı gün sahneye çıkacak. Cemal Reşit Rey’de 19 Mart’ta verilecek konserde ise, ünlü keman virtüözü Shlomo Mintz, İstanbul Oda Orkestrası eşliğinde, Mozart’ın keman konçertolarını seslendirecek. Tel: (0212) 275 18 19

M ozart'la _

w

s o n s u z lu g y o l c u l u k ! snv/s

25 IV V V . •• .. \

22 SKYLIFE 3 /2 0 0 6

■•> . V.

If you’d like to see some o f the most recent short films made in England, don ’t miss the 5th English Short Film Festival. This event, vvhich is being organized jointly by the British Council and the Ankara Cinema Society, is being held at the Turkish-English Culture Association and the Gazi University Faculty of Communications in Ankara on 2-4 March; at the Mersin University Central Conference Hail on 6-7 March; at the Sivas Cumhuriyet University Culture Çenter on 10-11 March; at the İzmir Güzelyalı Culture Çenter and Benal Nevzat Hail on 22-23 March; and at the Diyarbakır Art Çenter’s Multi-purpose Hail on 25-26 March. Films by young directors from Turkey and Europe vvill also be shovvn in the festival. Tel: (0312) 466 34 84

VVolfgang Amadeus Mozart is a composer who, despite his brief life, left behind a large number of masterpieces in classical music. The composer is being remembered this year, on the 250th anniversary of his birth, in the ‘Ülker Music Festival’. The first event o f the three-day festival is the ‘Journey into Infinity vvith Mozart’ concert, to be given at Atatürk Culture Çenter on 11 March vvith celebrated Turkish violin virtuoso Cihan Aşkın, world-renowned pianist Torleif Torgersen and famous violin-maker Ammon VVeinstein. Another exciting feature o f this concert is that Aşkın vvill be playing an historic violin that was made in 1763 and used in the orchestra o f the composer’s father, Leopold Mozart. İn another concert, to be held at the Lütfi Kırdar Convention and Exhibition Hail on 13 March, Mozart’s choral work, the ‘Grand Messe’, vvill be performed by Filarmonia İstanbul and the Europe Chorus vvith Hakan Şensoy conducting. The third concert, at Cemal Fteşit Rey on 19 March, features the distinguished violin virtuoso Shlomo Mintz playing Mozart’s violin concertos, accompanied by the İstanbul Chamber Orchestra. Tel: (0212) 275 18 19


MOSKOVA İŞ KULELERİ LEVENT MAXI ÇENGELKÖY

Merkez mahallesi Atatürk Caddesi Ülker sokak No: 2,81270 Taşdelen Ümraniye İSTANBUL TURKEY T: +90 216.429 7600 F: +90 216.3124862 Proletarskaya Simonovskiy Val Street 9.109044 MOSCOVV RUSSIA T: +95.589 0098 589 0097 589 0096 F: +95.674 2947 'Sugarfree' is a registered trade mark of Seda Giyim 109044, r. M ocKBa(M ). n p o /ıe ıa p cK a a Y/ı. C mm ohobckm İî Ba/ı. flo M 9 POCCH51 'Sugarfree' 6 p e H fl 4>a6pw<n Seda Giyim

www.sugarfree.com.tr


CİTYSCOPE

KİTAP BOOKS

İSTANBUL TOPOĞRAPrALARi Vjf vr vıyyn omdcto ki*ürtnın m*as

ZEYTİN BURNU ^ <0

T'

Zeytinburnu'nu keşfedin,.. Discover Zeytinburnu

'* *1|

Beykent Universitesi’nin İstanbul Büyükşehir Belediyesi desteğiyle yayımladığı ‘Sur ve Suyun izindeki Kültürlerin Mirası / İstanbul Topografyaları: Zeytinburnu’ adlı kitap, İstanbul’un sur dışında, ancak yakınında olmasına karşın, Zeytinburnu'nun belli noktaları dışında keşfedilmemiş yönlerini ortaya koyuyor. Prof. Dr. Ertan Özkan’ın danışmanlığında Ali Konyalı'nın fotoğrafları ile Zeytinburnu Pilot Projesi çerçevesinde hazırlanan kitap; ilçenin tarihi ve kültürel varlıklar ile mimari mirasının tespiti, korunması ve değerlendirilmesine yönelik araştırma projesi niteliğinde...

A book entitled, ‘Legacy of Cultures on VValls and VVater / İstanbul Topographies: Zeytinburnu’, published by Beykent University vvith sponsorship by the İstanbul Metropolitan Municipality, reveals the unexplored corners o f Zeytinburnu, vvhich lies outside b u t very near the İstanbul city vvalls. The book, vvhich was com piled as part o f the Zeytinburnu Pilot Project vvith Prof. Dr. Ertan Özkan as consultant and photographs by Ali Konyalı, is in the nature o f a research project aimed at identifying, preserving and exploiting the d is tric t’s historical and cultural assets and architectural heritage.

Atatürk Havalimanından kareler... Shots of Atatürk Airport...

24 SKYLIFE 3 /2 0 0 6

Mardin’in büyüleyen güzellikleri The spellbinding beauty of Mardin Yüzlerce yıl boyunca pek çok uygarlığa ev sahipliği yapan Mardin’in büyüleyici güzellikleri ‘Taşın Belleği Mardin’ adlı kitapla gözler önüne seriliyor. Gabriyel Akyüz, Murathan Mungan, Metin Sözen, Füsun Alioğlu, Melih Duygulu ve Haluk Eldem gibi 24 yazarın kalemiyle işlediği kitap; ‘Tarihçe’, ‘Kent Dokusuyla Mardin’, ‘Gezginlerin Gözünden Mardin’, ‘Kültür Tarihi’, ‘Yazarların Mardini', ‘Ekonomisiyle Mardin' ve ‘Mardin'in Yarını' olmak üzere kenti her yönüyle tanıtmayı amaçlayan bölümlere ayrılmış. Yapı Kredi Yayınları tarafından yayımlanan kitap; Özgür Nizam, Akgün Akova ve Nevin Soyukaya gibi fotoğrafçıların objektifine yansıyanlarla da okuyucuyu içine çekiyor...

Her türlü duygunun yaşandığı yerlerdir havalimanları... Bir tarafta kavuşmanın sevinciyle gözyaşlarına hakim olamayanlar vardır; bir tarafta da ayrılığın hüznünü yaşayanlar... İstanbul Atatürk Havalimanı da her dakika böyle anlara sahne olan bir yer. Ve fotoğrafçı Selim Seval, objektifiyle havalimanındaki zamanı durdurmak, o anları görüntülemek için bastı deklanşöre... Ortaya çıkan nefis fotoğrafları da, Tepe Akfen Vie (TAV) tarafından albüm haline getirildi. Albüm, zamanın hızla akıp gittiği İstanbul Atatürk Havalimanı’ ndan ‘dondurulm uş’ karelerle, insanı bambaşka bir yolculuğa çıkarıyor...

The spellbinding beauty o f Mardin, host to numerous civilizations över the centuries, is now the subject o f a book entitled ‘Stone’s Memory Mardin’ vvith contributions by 24 writers including Gabriyel Akyüz, Murathan Mungan, Metin Sözen, Füsun Alioğlu, Melih Duygulu and Haluk Eldem. Chapter titles o f the book, vvhich aims to introduce the city in ali its aspects, are: ‘A Brief History’, ‘The Urban Texture o f Mardin’, ‘Mardin Through the Eyes o f Travelers’, ‘A Cultural History’, ‘The VVriters’ Mardin’, ‘Mardin and İts Economy’ and ‘The Future of Mardin’. Published by Yapı Kredi Yayınları the book’s attractiveness is further enhanced by the photographs of Özgür Nizam, Akgün Akova and Nevin Soyukaya.

Airports are places vvhere the full gam ut o f human emotions is experienced. From the jo y o f reunion to the tears o f separation.. And Istanbul’s Atatürk Airport is no exception. N ow photographer Selim Seval has made time stand stili by capturing some o f these moving scenes on film, and the superb photographs that have emerged have been assembled in an albüm by Tepe Akfen Vie (TAV). Through photographed scenes ‘frozen in tim e ’ from this bustling airport, the albüm takes readers on a very different journey...


Cezve” de pişe kahvenin kokusu t

Arzum 'dan yepyeni bir ürün:

Arzum Cezve Türk Kahvesi Robotu

.arzum.com.tr

zarif ve kullanışlı tasarımıyla kahve keyfinize keyif katacak.


size b akan bu g ö z le r için

kalbinizde yer açın...

T.C. BAŞBAK ANLIK SOSYAL HİZM ETLER vc ÇOCUK ESİRGEME KU RUM U

Daha

Değişiyoruz

^


Türk Hava Yollarfndan sevgililere armağan A Valentine’s Day present from Turkish Airlines

Türk Hava Yolları, 14 Şubat Sevgililer Günü nedeniyle, 9-14 Şubat tarihleri arasında seyahat eden yolcuları için özel promosyon fiyatı uyguladı. İstanbul’dan Avrupa, Türk Cumhuriyetleri, Ortadoğu ve Kuzey Afrika’ya Ekonomi Class’ta bir kişi gidiş-dönüş 199 Avro’ya seyahat ederken, beraber yolculuk yaptığı ikinci kişi sadece 1 Avro ödedi. Yine İstanbul’dan Amerika ve Uzakdoğu’ya Ekonomi Class’ta gidişdönüş 399 Avro’ya seyahat eden yolcular, yanlarındaki bir kişi için 1 Avro ödediler.

İn honor of Valentine’s Day, Turkish Airlines introduced special promotional fares for passengers traveling between 9 and 14 February. While a single, round-trip Economy Class fare from İstanbul to Europe, the Turkic Republics, the Middle East and North A f rica was 199 Euros, the accompanying passenger paid only 1 Euro. Similarly, a single, round-trip Economy Class fare from İstanbul to the U.S. or the Far East was 399 Euros; the accompanying passenger again paid just 1 Euro.

Türk Hava Yollan’ndan özel ücretler Special fares from Turkish Airlines

Türk Hava Yolları, 31 Mart’a kadar geçerli olmak üzere Türkiye’den Madrid ve Barselona’ya özel ücretler uyguluyor. İstanbul'dan Madrid ve Barselona'ya, gidiş-dönüş 118 Avro’ya; Ankara ve İzmir'den, 158 Avro’ya; Türkiye’nin diğer noktalarından ise 218 Avro'ya seyahat edebilirsiniz. Türk Hava Yolları, İstanbul’dan Avrupa, Ortadoğu ve Afrika’da bulunan uçuş noktalarına Business Class’ta uçmak isteyen yolcularına da özel ücretler sundu. Gidiş-dönüş bilet fiyatı 333 Avro olarak belirlenen bu promosyondan 27 Şubat’a kadar biletlerini almış olanlar, seyahatlerini Nisan 2006 sonuna kadar tamamlayabilecekler. Özel ücretlerle ilgili ayrıntılı bilgileri Türk Hava Yolları'nın satış ofislerinden, www.thy.com.tr adresli internet sitesinden veya 444 0 849 (THY) no’lu telefondan alabilirsiniz.

Turkish Airlines is offering special fares from Turkey to Madrid and Barcelona, available through 31 March. You can fly round-trip to Madrid or Barcelona from İstanbul for 118 Euros, from Ankara or İzmir for 158 Euros, and from other points in Turkey for 218 Euros. Turkish Airlines is also offering special fares for passengers vvishing to fly Business Class from İstanbul to points in Europe, the Middle East and Africa. Passengers who purchase such tickets at the round-trip price o f 333 Euros by 2 7 February m ust complete their travels by April 2006. For details regarding these special fares, please contact a Turkish Airlines sales Office, visit the vvebsite at www.thy.com, or cali 444 0 849 (THY).

FAA denetimleri başarıyla tamamlandı Turkish Airlines passes FAA inspection vvith flying colors

Türkiye’de uçak, motor ve komponentlerine bakım yetkisi bulunan tek kuruluş olan Türk Hava Yolları’nın ‘Uçak Bakımı Yetki Belgesi’nin yenileme denetlemesi, ABD Sivil Havacılık Dairesi (FAA) tarafından 23-27 Ocak tarihlerinde yapıldı. FAA yetkililerince gerçekleştirilen denetimler sonucunda, Türk Hava Yolları'nın ulaştığı bakım standartları uygun bulunarak övgüyle söz edildi; tesislerdeki her çalışanın üstün bir bakım bilincinde olduğu da ifade edildi. Türk Hava Yolları tarafından ilk defa 1974 yılında alınan bu belgenin sürekliliğini sağlamak üzere FAA denetimleri her yıl periyodik olarak yapılıyor ve denetim sonuçlarına göre belge yenileniyor.

Sabiha Gökçen Havalimanından servisler Bus service from Sabiha Gökçen Airport

Türk Hava Yollan, 20 Şubat’tan itibaren Sabiha Gökçen Havalimanı ile şehir merkezi arasında ücretli servisler gerçekleştirmeye başladı. İki farklı güzergâhta hizmet veren servislerin hareket saatleri ise şöyle: Kozyatağı ve Bostancı’dan Havalimanı’na: 04:30, 05:30, 06:00, 07:00, 08:00, 09:00, 10:00, 13:30, 14:00, 15:30, 16:00, 18:30, 19:00. Havalimanı’ndan Kozyatağı ve Bostancı’ya: 08:15, 09:20, 09:50, 11:20, 13:45, 14:30, 15:10, 17:00, 19:30, 19:45, 21:45, 22:15, 23:40. Ayrıntılı bilgiyi (0212) 465 79 75 no’lu telefondan ya da www.thy.com.tr internet adresinden alabilirsiniz.

As the sole company in Turkey that is authorized to maintain airplanes and airplane engines and their components, Turkish Airlines must pass periodic inspections for renewal of its ‘Aircraft Maintenance Authorization Certificate’. On 23-27 January of this year the airline successfully passed the most recent inspection by the U.S. Federal Aviation Authority (FAA). Following the inspection, which is conducted by FAA officials, Turkish Airlines was declared to be in full compliance with maintenance standards and to have passed with flying colors. Each and every employee at the airline’s facility was said t o have a highly deveioped concept of maintenance. FAA inspections are carried out annually to ensure that the airlines’ certificate, which it first received in 1974, does not expire. Penewal o f the certificate is based on the outcome o f the inspection. Starting on 20 February Turkish Airlines is offering bus service between Sabiha Gökçen Airport and the İstanbul city çenter. Departure times for the buses, which will follow two different routes, are as follows: from Kozyatağı and Bostancı to the Airport: 4:30, 5:30, 6:00, 7:00, 8:00. 9:00 and 10:00 in the morning and 1:30, 2:00, 3:30, 4:00, 6:30 and 7:00 in the afternoon and evening hours. Bus service from the Airport to Kozyatağı and Bostancı is at: 8:15. 9:20, 9:50, 11:20 in the morning, and at 1:45. 2:30, 3:10, 5:00, 7:30, 7:45, 9:45, 10:15 and 11:40 in the afternoon and evening hours. For details, cali (0212) 465 79 75 or visit the website at www.thy.com.


NEVVS

TURK HAVA YOLLARI HABERLER 28 SKYLIFE 3 /2 0 0 6

Dört yeni hat daha açıldı Turkish Airlines inaugurates four new routes Türk Hava Yolları, yenilenen ve büyüyen filosuyla geçtiğimiz aylarda açılacağını duyurduğu hatları hizmete sokmaya devam ediyor. Dünyanın dört bir yanından farklı şehirleri, 2006 yılının ilk çeyreğinde uçuş ağına ilave edeceğini açıklayan Türk Hava Yolları, Şubat ayı içerisinde dört hattı daha uçuş noktalarına ekledi.

With its renewed and expanding fleet, Turkish Airlines is continuing to put into service the new routes it announced in recent months. The airline, which has declared that it will add different cities around the world to its flight network in the first quarter o f 2006, added four o f them already in February.

Rusya’da yeni bir hat: Rostov Türk Hava Yollan, uçuş ağına ekleyeceği hatlar arasında yer alan, Rusya Federasyonu’na bağlı Rostov’a tarifeli seferlerine 5 Şubat’ta başladı. Önemli bir ticaret, üretim ve kültür merkezi olan kent, Don bölgesinde, Rusya’nın güneyinde yer alıyor. Türk Hava Yolları’nın Istanbul-Rostov tarifeli seferleri, perşembe ve pazar günleri olmak üzere haftanın iki günü karşılıklı olarak yapılıyor. Sefer saatleri ise şöyle: İstanbul'dan Rostov, perşembe günleri 17:00 ve pazar günleri, 07:00; Rostov’dan İstanbul, perşembe günleri 21:15 ve pazar günleri, 11:15. Rostov hattının İstanbul çıkışlı gidiş-dönüş bilet ücretleri (vergiler hariç); Ekonomi Class’ta, 319 ile 539 Avro arasında değişirken, Business Class’ta, 699 Avro olarak belirlendi.

New route in Russia: Flostov Among the new routes to be added to its flight network, Turkish Airlines started scheduled flights to Rostov in the Russian Federation on 5 February. An important çenter o f commerce, manufacturing and culture, Rostov is located in Southern Russia, in the Don basin. Turkish Airlines’ scheduled Istanbul-Rostov flights are roundtrip twice vveekly on Thursdays and Sundays. Times are as follovvs: IstanbulRostov, 5 p.m. on Thursdays and 7 a. m. on Sundays; Rostov-lstanbul, 9:15 p.m. on Thursdays and 11:15 a.m. on Sundays. Round-trip tickets (tax excluded) from İstanbul vary between 319 and 539 Euros in Economy Class and 699 Euros in Business Class.


Ukrayna’da dördüncü nokta: Donetsk Şubat ayında açılan hatlardan İkincisi, 7 Şubat’ta hizmete giren Donetsk oldu. Türk Hava Yolları’nın Ukrayna’ya gerçekleştirilen Kiev, Simferopol ve Odessa tarifeli seferlerinin ardından dördüncü uçuş noktası olan Donetsk, Ukrayna’nın doğusunda, nüfusu bir milyonun üzerinde, büyük bir sanayi kenti. Önemli bir iş gücüne, güçlü bir alt yapıya, kendi enerji kaynaklarına ve geniş bir ulaşım ağına sahip olan Donetsk, ülkenin de dördüncü büyük kenti... Türk Hava Yolları’nın Istanbul-Donetsk uçuşları haftada iki gün, salı ve cuma, karşılıklı olarak gerçekleşiyor. Sefer saatleri ise şöyle: İstanbul’dan Donetsk, 12:20; Donetsk’den İstanbul, 15:15. Türk Hava Yolları, yeni hattın açılışı için özel ücretler de uyguluyor. 30 Nisan’a kadar geçerli olan tarifeye göre İstanbul’dan Donetsk’e, Ekonomi Class'ta, 209 Avro'dan başlayan fiyatlarla ve Business Class’ta, 629 Avro’ya uçabilirsiniz. Türk Hava Yollan, Tahran'dan sonra Tebriz’de Türk Hava Yolları, uçuş ağına Iran İslam Cumhuriyeti’nin başkenti Tahran’dan sonra Tebriz’i de ekledi. Geçmişte tarihi ipek Yolu'nun önemli noktalarından biri olan Tebriz, bugün de canlı ticaret hayatı ile işadamları için cazibe merkezi olmaya devam ediyor. Kentte varolan ekonomik potansiyeli, başta Avrupa'ya, ardından tüm dünyaya ulaştırmak üzere Istanbul-Tebriz hattını açmaya karar veren Türk Hava Yolları'nın tarifeli seferleri 15 Şubat’ta başladı. İstanbul’dan Tebriz’e, çarşamba, cuma ve pazar günleri, 23:55’te; Tebriz’den İstanbul’a, pazartesi, perşembe ve cumartesi günleri, 05:15’te uçabilirsiniz. Tebriz hattının

209 Euros in Economy Class and for 629 Euros in Business Class.

İstanbul çıkışlı gidiş-dönüş bilet ücretleri (vergiler hariç); Ekonomi Class'ta, 209 ile 399 Avro arasında değişirken, Business Class’ta, 599 Avro olarak belirlendi. Rusya’da üçüncü uçuş noktası: Kazan Türk Hava Yolları’nın Rusya Federasyonu'ndaki üçüncü uçuş noktası olan Kazan’a tarifeli seferler 28 Şubat’ta başladı. Geçmişte Kazan Hanlığı’nın başkenti olan Kazan, bu tarihten beri önemli bir ticaret merkezi. Özerk Tataristan’ın başkenti olan Kazan, Rusya Federasyonu’nun önemli şehirleri arasında yer alıyor. Türk Hava Yolları’nın tarifeli seferleri ile İstanbul’dan Kazan’a, salı ve cuma günleri, 20:40’ta; Kazan’dan İstanbul’a ise çarşamba ve cumartesi günleri, 03:30’da uçabilirsiniz. Yazıda verilen tüm saatler, yerel saatlerdir.

Fourth destination in Ukraine: Donetsk The second o f the new routes opened in February was Donetsk in the Ukraine, vvhich went into service on 7 February. Turkish Airlines' fourth destination in the Ukraine following Kiev, Simferopol and Odessa, Donetsk is a large industrial city o f över one million people, located in the east o f the country. Donetsk, vvhich has a sizable labor force, a povverfui infrastructure, its own energy sources and an extensive transportation netvvork, is also Ukraine’s fourth largest city. Turkish Airlines' roundtrip Istanbul-Donetsk flights are tvvice weekly on Tuesdays and and Fridays. Flight times are: IstanbulDonetsk, 12:20 p.m., Donetsk-lstanbul 3:15 p.m. Until 30 April, you can fly from İstanbul to Donetsk for

Turkish Airlines adds Tabriz to its destinations in Iran Turkish Airlines recently added Tabriz to its flight netvvork following Tehran, capital o f the Islamic Republic o f Iran. Once an important city on the historic Silk Road, vvith its vibrant commercial life Tabriz continues to be an attractive çenter for businessmen today. Turkish Airlines started scheduled flights on 15 February in order t o connect this city and its economic potential first vvith Europe, then vvith the entire world. You can fly from İstanbul to Tabriz on VVednesdays, Fridays and Sundays at 11:55 p.m. and from Tabriz to İstanbul on Mondays, Thursdays and Saturdays at 5:15 a.m. Round-trip tickets from İstanbul (tax excluded) vary between 209 and 399 Euros in Economy Class and 599 Euros in Business Class. Destination number three in Russia: Kazan Turkish Airlines began scheduled flights to Kazan, its third destination in the Russian Federation, on 28 February. Former capital o f the Kazan Khanate, Kazan has been an important çenter o f trade ever since and remains one o f the Russian Federation ’s majör cities today as capital o f the Autonomous Republic of Tatarstan. Turkish Airlines' scheduled flights are: Istanbul-Kazan, Tuesdays and Fridays at 8:40 p.m., and Kazan-lstanbul, VVednesdays and Saturdays at 3:30 a. m. Ali times given are local times. 3 / 2 0 0 6 SKYLIFE 2 9


2005 yılında 1000. kuruluş yılını kutlayan Kazan, kuleleri, müzeleri, eski mahalleleri, ihtişamlı yapılarıyla hem tarihi, hem de modern bir kent. The Russian city of Kazan, vvhich celebrated its millennium year in 2005, is at once modern and historic vvith its tovvers, museums, old guarters and magnificent buildings. dil (Volga) Nehri’nin yorgun akan sularına arkamızı dönüp, önümüzde göz yaylımı uzanan Kazan Kremlini’ne bakıyoruz. Idil’de tembel tembel akıp giden derme çatma salları görür gibiyiz. Aklımızda Kul Ali’ler, Puşkin’ler, Abdullah Tukay’lar, Tolstoy’lar... Gözlerimiz, eni konu Barok, ama bir o kadar da yerel çizgili binaları aşıyor ve ovalara takılıyor. Ufuk çizgisinin nerede başlayıp, nerede bittiği belli olmayan ovada, kalın bir yalnızlık her şeyin hakimi. Bir de bakıyoruz, Cengiz Sülalesi'nden Batu Han, Moğol çerilerini peşine takmış rüzgâr gibi geliyor. Derken ovanın öteki 3 2 SKYLIFE 3 /2 0 0 6

urrıing our backs on the weary Idil (Volga), we gaze at the Kazan Kremlin, vvhich spreads before us as far as the eye can see. We can almost discern the jerry-built rafts floating on the lazy river waters, and our thoughts turn to Kul Ali, Pushkin, Abdullah Tukay, and Tolstoy. Looking beyond the buildings, thoroughly Baroque yet vvith a local touch, our gaze fixes on the steppe beyond. An intense solitude permeates everything here, vvhere it’s impossible to teli vvhere the horizon begins and ends. We look again, and vvhat do we see but Batu Khan, o f Genghis’ lineage, galioping like the vvind in the wake o f the Mongol horde. From the other end o f the steppe, the Khan o f the Golden Horde t>

T

Kazan Kremlini’nin sınırları içinde birbirinden benzersiz mimari örnekleri bir arada görebilirsiniz (üstte). Kazan'ın kimliğinde özel bir yeri olan Süyümbike Kulesi de bunlardan biri (en sağda). İnside the Kazan Kremlin you can see outstanding examples ot the local architecture (above). Süyümbike Tower, vvhich has a special significance for the city, is just one of them (far right).


Anadolu’nun doğal taş güzelliği, 8 bin yı Dünyanın en kaliteli, en fazla çeşide sahip doğal taşları Türkiye’de bulunmaktadır. Türkiye, 2005 yılında yaklaşjj yüzlerce çeşit ve desendeki mermeri, başta Amerika, J| 140’tan fazla ülkeye ihraç etmiştir. Doğal Taş H arikan DOĞAL (TAS i HARİKALAR 1 a\ ri DİY/ARI f / t .'i*-

P

ar Dolar değerinde, ve Çin olmak üzere

Diyarı’na hoş geldiniz, j

K

I

‘ Üç Tanrıça Heykeli (Üç Güzeller): Dünyadaki ilk güzellik yarışması AnadoRrda düzenlenmiştir. Yarışmanın güzelİİR tanrıçası Afrodit, finalistler Hera ve Athena. Üç Güzeller Heykeli'nin orijinali Antalya Arkeoloji M üzesi'nde bulunmaktadır.


| The beauty of Anatolian natural stone has g r a t^ j

UPPCsfor 8.0'

Turkey’s rich reserves of marble are the highest quality in tJ a « |P Ş lm lrin ğ the widest range stone varieties available anyvvhere. İn 2005, Turkey expqjpEPundreds of varieties worth approximately US$ 1 billion to more than 140 countries worldwide, incIudinc^^H, United Kingdom and China. VVelcome to the VVonderiand of Natural Stone^ffş *Statue of Three Goddesses (The Three Beauties): The world’s first beauty contest was held ın Anatölia. Aphrodite was chosen the Goddess of Beauty, and the finalists were Hera and Athena. The original statue of The Three Beauties is part of the collection of the Antalya Museum of Archeology.

-•fiiSRı-'a*' «'jsjkv ( ,-V;. < V•x> '■ « V';/ t

V

www.turkishstones.org


ucundan bu kez, Altın Orda Hanı boy gösteriyor. Bulgar Hanlığı’na göz diken Han, beyaz atının üzerinde pek ihtişamlı. Hayalimizdeki ovalarda koşturan koşturana... Önümüzdeki Kazan şehrinin ak minareli mahallelerinden güzelim Tatar ağzıyla söylenen yanık türküler yükseliyor. Tarihe karışıp gidiyoruz. Kulaklarımızda Çuvaşça, Karakalpakça, Başkurtça, Kazan Tatarcası, Rusça, Fince konuşmaların muhteşem korosu. Bu dillerin hepsi bir zamanlar burada, Rusya Federasyonu’na bağlı Tataristan Özerk Cumhuriyeti’nin başkenti

36 SKYLIFE 3 /2 0 0 6

Kazan’da konuşulmuş ve bir kısmı da halen konuşuluyor. Kazan, Büyük Idil Yolu üzerinde peyda olan kadim bir şehir. 300 yılı aşkın bir süre Idil Bulgar devleti adına Rus prenslikleriyle ticari ve kültürel bir bağ kuran Kazan, sonraki bir yüz yıl boyunca da Altın Orda’da Rus ‘knyaz’ltklarıyla (prenslik) ilişkilerini devam ettiren bir Beyliğin merkezi... 1428-1552 yılları arasında Kazan Hanlığı’nın başkenti; 150 yıl boyunca Rus devletinin doğu kapısı, İslam ve Hıristiyan kültürlerinin buluştuğu yer; 1708 yılından itibaren 200 yıl boyunca

Kazan Kalesi (Kremlin), Idil (Volga) Nehri’ne bakıyor (üstte). Kazan Limanı, kenti Idil boyunca diğer Tatar ve Rus şehirleriyle birleştiriyor (altta solda). 2005 yılında 1000. yaşını kutlayan Kazan, son birkaç yıldır hızla onarılıyor (altta sağda). The Kazan Kremlin overlooks the Volga (above), and the port of Kazan links the city vvith the other Russian and Tatar cities on its banks (belovv left). Kazan, vvhich celebrated its millennium year in 2005, has undergone a rapid restoration in recent years (belovv left).

hoves into view, making a splendid sight as he dashes off on his white horse, his sights set on the Bulgar Khanate. Horsemen race across the steppe in our mind's eye. Before us, from the vvhite minareted quarters o f the city of Kazan, a mournful folk song rises, sung in a haunting Tatar accent. Blending into the history that surrounds us, we forge on. A magnificent chorus of conversations in Chuvash, Karakalpak, Bashkurt, Kazan Tatar, Russian and Finnish rings in our ears. There was a time when ali these languages were spoken here in Kazan, capital city of the Autonomous Republic o f Tatarstan, which is part of the Russian Federation, and some of them stili are. Kazan is an ancient city on the banks o f the mighty Volga. After maintaining commercial and cultural ties vvith the Russian princedoms on behalf o f the Volga Bulgar State for över three hundred years, it was later, for a century, capital of a principality that cultivated relations vvith the Russian princedoms in the Golden Horde. Capital o f the Kazan Khanate from 1428 to 1552, Kazan was the Russian state's gatevvay to the East for 150 years, situated at the meetı'ng point o f Islamic and Christian cultures. Capital o f >


Akdeniz’in büyüsü ile golf ve thalasso tutkusu, Delek’te Kempinski Hotel The Dome kaÜtesiyle buluşuyor.

m

H

Mediterranean pleasures, Thalasso and Golf meet Kempinski quality in Belek.

H O T E L IE R S S İN C E 1897

Kempinski Hotel The Dome Üç Kumtepesi Mevkii 07500 Belek - Antalya Tel: +90 242 710 13 00 Faks: +907255575 www.kempinski-belek.com

©

global hotel aliance-

www.globalhotelalliance.com


Kazan province for 200 years starting from 1708, it has been the capital of the Republic of Tatarstan for the last hundred.

Kazan ‘Gubernya’sının (eyaletinin) merkezi; son yüz yıldır ise Tataristan'ın başkenti olmuş Kazan. KAZAN MELİKESİ SÜYÜMBİKE Ovalardaki uzak nal seslerini, Batu Han’ın ‘yarlığ’ını, Bulgar ve Altın Orda devletlerini tarihteki yerlerine bırakıp, günümüze dönüyoruz. Tam önümüzde Kazan Kremlini var. Kazan şehrinin incisi sayılan bu mekân, Haziran 2001 ’de UNESCO tarafından Dünya Kültür Mirası’nın bir parçası ilan edilmiş. Elimizdeki tanıtım broşüründe ortadaki sivri kule için ‘Süyümbike Kulesi’ denilmiş. Bir anda, biraz önce terk ettiğimiz tarihe yeniden gömülüyoruz. Son Kazan hanlarından Safa Giray’ın ölmesi üzerine, oğlu Ötemiş henüz üç yaşında olduğu için mecburen tahta geçen annesi Süyümbike’yi, bu güzeller güzeli Tatar 3 8 SKYLIFE 3 /2 0 0 6

Kazan Üniversitesi, Rusya’nın sayılı üniversitelerinden biri (altta). Üniversitenin bugün kütüphane olarak kullanılan binası ziyarete değer (üstte). Kazan University, one of Russia's most highly respected institutions of learning (belovv). The building that houses the university library is definitely vvorth a visit (above).

SÜYÜMBİKE, ANGEL OF KAZAN As the thump o f hoofbeats recedes across the steppe, we leave behind Batu Khan’s ‘yarlık’, the Bulgar Khanate, and the successor states of the Golden Horde and return to the present. The Kazan Kremlin stands directly in front o f us. This ‘pearl o f the city' was declared part o f the World Cultural Heritage by UNESCO in June 2001. According to our guidebook its tali Central spire is called the ‘Süyümbike Tower'. Instantly we are plunged once again into the history we just left behind. When Safa Giray, the last o f the Kazan khans, died, his son Ötemish was only three years old. So the boy's mother, Süyümbike, a stunning Tatar beauty, took the throne. We recall how Kazan was conquered in a war waged in 1552, how Süyümbike, who fought fiercely alongside the men on the city vvalls, was taken prisoner and how, as she was boarding the ship that would take her into exile in faravvay

lands, she lamented: “Kazan... Distressed and blood-stained city... Your crovvn has fallen. Remember your ancient fests and days, and weep as I do." Here we are in Kazan vvith Süyümbike, angel o f Kazan, and her memory. We stroll through the city, one o f the vvorld’s most beautifui, vvith mixed feelings o f pain, joy and yearning. The Bulgar Turks founded Kazan as a commercial capital. Follovving an initiai golden era, the city was later dragged into a history dominated by war. Batu Khan's Mongols defeated the Bulgar Turks, the Golden Horde captured the city, and the Tatars fought among themselves and were later exiled to regions far from their beautifui city. During generations o f exile they never stopped singing to each other: “Wait for me. I shall return. ” As the snow turned to dust, they never gave up hope, and in the end they returned to their homeland. ISTANBUL’S ‘SISTER CITY’ Dominated for three centuries by states such as the Khanate o f the Volga t>


www.euroncap.com

JUJl/lUflOS

GRANDEPUNTO ÖZGÜRLÜĞÜN YOLUNU AÇ.

HAYATINIZDAKİ ENGELLERİ K IR M A K İÇİN GELDİ ARTIK GERÇEK ÖZG ÜRLÜĞ Ü YAŞAM AYA BAŞLAYIN Giugiaro'nun baştan çıkarıcı tasarımıyla 3 ve 5 kapı seçenekleri • Sınıfının zirvesinde dış ve ıç ölçüler • 2 Multıjet dizel, 2 benzinli m otor seçeneği • Standart ABS+EBD, ön hava yastıkları, klima, elektrikli ön camlar ve dikiz aynaları, direksiyondan kumandalı CD çalar ve 15" jantlar • Sınıfında ilk kez çift bölgeli otom atik klima • İsteğe bağlı ESP, Hillholder, yan, perde ve diz hava yastıkları, MP3 çalar ve Hi-Fi müzik sistemi, elektrikli arka camlar, park sensörü, Skydome ve 16" alüminyum jantlar

Çağrı M erkezi: 444 22 55

ww w.grarKlepunto.com .tr


kadınını düşünüyoruz. 1552’de yapılan savaşta Kazan'ın ele geçirilişini, surlarda erkeklerle birlikte çatır çatır savaşan Süyümbike’nin esir düşmesini ve uzak yerlere sürgüne gönderileceği gemiye binerken, “Kazan... Kaygılı, kanlı şehir... Başından tacın düştü... Eski günlerini, bayramlarını hatırlayıp, benim gibi ağla artık” diye konuşmasını hatırlıyoruz. Kazan Melikesi Süyümbike'nin anısı ile birlikte Kazan'dayız. Dünyanın en eski şehirlerinden biri olan Kazan'ı, özlem, acı, sevinç gibi karmakarışık duygularla dolaşıyoruz. Kazan’ı Bulgar Türkleri bir ticaret merkezi olarak kurmuşlar. Önce parlak bir dönem geçiren Kazan, daha sonra savaşların hakim olduğu acıklı bir tarih koridoruna girmiş. Batu Han’ın Moğolları, Bulgar Türklerini yenmiş, Altın Odalılar şehri ele geçirmiş, Tatarlar kendi içlerinde savaşlar yapmışlar, Kazan’dan çok uzak bölgelere sürgün edilmişler. Sürgündeyken kuşaklar boyunca birbirlerine ‘‘döneceğim bekle beni” diye seslenmişler. Karlar tozarken, 40 SKYLIFE 3 /2 0 0 6

hiç kimse beklemezken beklemişler ve sonunda 'vatan’a dönmüşler. İSTANBUL’UN KARDEŞ ŞEHRİ Kazan şehrinin içinde bulunduğu coğrafi bölge, 3. yüzyıldan itibaren Idil Bulgar Hanlığı, Altın Orda ve Kazan Hanlığı gibi devletlerin hakimiyet sahası; daha sonra da Rusya için büyük bir öneme sahip olmuş. Tatarların idil, Rusların Volga dedikleri nehir, Çanakkale ve İstanbul boğazlarının bazı yerlerinden daha geniş ve Hazar Denizi'ne kadar ulaşıyor. Bunun sonucu olarak bugün gemilerle Kazan’dan, ‘Kardeş Şehri’ İstanbul’a gelmek mümkün. Kazan şehri, ünlü Altın Orda devletiyle birlikte tarih sahnesine çıkmış. Bugün eski Kazan olarak anılan şehir, Kazan’ı ikiye bölen Kazansu (Kazanka) Irmağı'nın çok daha yukarısında yer alıyormuş. Daha sonraki yıllarda şehir Kazansu’nun Idil Nehri'ne karıştığı şimdiki yere taşınmış. Kendilerine 'Konukçu' ya da ‘Mihmandar’ diyen Tatar dostlar, Kazan’da görülmesi gereken en önemli yerlerden birinin, Kazan Hanlığı'nı

Kısa bir süre önce ibadete açılan, sekiz minareli Kul Şerif Camii, Kazan’ın yeni simgesi (altta). Kazan’s newest symbol, the eight-minaret Kul Sherif Mosque, recently opened for vvorship (belovv).

Bulgars, the Golden Horde and the Kazan Khanate, the geographical region vvhere Kazan is located later became very important for Russia as weil. VVİder in places than the Bosphorus or the Dardaneiles, the river that the Tatars cali the Idil and the Russians the Volga empties into the Caspian Sea. As a result, it is possible today to travel by ship from Kazan to its ‘Sister City' İstanbul. The city of Kazan first appeared on the stage o f history together with the empire o f the famed Golden Horde. The city remembered today as old Kazan was situated much further up, along the upper reaches o f the River Kazansu (Kazanka), vvhich divides the city in haif. İn subsequent years the city was moved to its present iocation at the confluence o f the Kazanka and the Volga. Our Tatar hosts teli us that the Süyümbike Tower, a memento of the Kazan Khanate, is a must- >


M ©DE

KÜÇÜK DEĞİŞİKLİKLERLE HAYATINA RENK KATMAYI SEVER, BUNUN İÇİN UYGUN ORTAMLAR YARATIR...

"Yeni tarz, yeni mekan"

V?!

BU, ONUN SEÇİMİ.

V EN E TO L -2 1 0 0 K O L T U K T A K IM I / B YC A S T KAH V E DERİ

■ m

LİVORNO 2441 TEKLİ KOLTUK / L-2902 D KIRMIZ! DERİ

LİVORNO 2441 ÜÇLÜ K O L T U K /L -2 9 0 2 D KIRMIZI DERİ

Serinin ikili ve üçlü koltuk takım ların ın her bölümü, özel m ekanizm ası ile bağımsız olarak

LİVORNO 2441 KOLTUK TAKIMI / L-2902 D KIRMIZI DERİ AKSESUARLAR: DECO HALI TRENDY GRUBU 3303 ORTA SEHPA / 450-825 SEHPA / MULTİ ZİGON SEHPA DECO M L41015-7A AYAKLI LAMBADER

yatabiliyor. Tekli koltuk ise, bir TV koltuğunun tüm konforuna ve işlevselliğine sahip.

HwHH33HH (H w w .istikbal.com

O

Boydak

Mode Line’ın tüm koleksiyonu ile tanışmak için lütfen broşür isteyiniz.

istikKal GERÇEK DERİNİN ADRESİ


42 ::ÎKYL II I 3 /2 0 0 6

T raf iğe kapalı olan Bauman Caddesi’nin girişini süsleyen bir havuz (üstte). Caddenin üzerinde Rus Çariçesi Katerina'nın, Kazan şehrine girerken kullandığı at arabasının bir kopyası duruyor (altta).

A pool adorns the entrance to Bauman Avenue, which is closed to vehicle traffic (above). Standing on the avenue is a replica of the carriage used by the Russian Empress Catherine as she rode into the city (belovv).

'

hatırlatan Süyümbike Kulesi olduğunu söylüyorlar. Hikâyesini özetlediğimiz Süyümbike'nin adının verildiği yedi katlı kule, kırmızı tuğladan yapılmış ve 58 metre yüksekliğinde. Kazan Üniversitesi'nln ana binası, Devlet Müzesi, Tatarların en meşhur şairi Tukay adına kurulan müze, Milli Kütüphane, Musa Celil’in adını taşıyan opera binası, kültür merkezi, Tatar tiyatrosu, sirk, kentin en eski camilerinden Mercani, Apanay Camii, Ecim Camii, Burnay Camii, Saint Paul ve Saint Peter katedralleri, Gorki Parkı, Kazan'da görülmesi ve ziyaret edilmesi gereken yerler arasında. Ayrıca şehir merkezindeki bazı sokaklar 19. yüzyıldaki halleriyle korunan evlerle dolu. Kazan'ın kenar mahallelerindeki ahşaptan yapılmış süslü Tatar evleri de mutlaka görülmesi gereken yerlerden. Kazan’daki en önemli yapılardan biri de Kremlin Sarayı. Yüksek duvarların çevrelediği sarayın ana kapılarına eskiden ‘kurtarıcı’ denirmiş. Sarayın sınırları içinde benzersiz mimari örnekleri, kiliseler ile camileri bir arada görmek mümkün. Kazan’ın yeni simgesi ise bir

see. Named for the queen whose story we summarized earlier, it is a seven-storey tower, 58 meters tali and built o f red brick. The main building o f Kazan University, the State Museum, the museum built in honor o f Tukay (the most illustrious Tatar poet), the nationai library, the opera buitding (named for Musa Jeiil), the culture çenter, the Tatar theater, the circus, the city's oldest mosques—Merjani, Apanay, Ejim and Burnay, the cathedrals o f Saint Peter and Saint Paul, and Gorky Park are among the many places to be seen and visited in Kazan. Some streets in the city çenter are lined vvith houses preserved exactly as they were in the 19th century, and the elaborately decorated Tatar houses o f timber construction in the city's outlying districts are also vvorth a visit. But the most important building in Kazan is surely the Kremlin Palace. Surrounded by high vvalls, its main gate was formerly called ‘the savior’. Here, vvithin the bounds o f the palace, it is possible to see t>


how much pressure can you stand ?

LNG transport and storage tanks

&ISISAN

LPG transport and storage tanks Cryogenic transport and storage tanks(oxygen,hydrogen, carbon dioxide, ammonia ete.) Tanks for freon, polyol, isocyanate,TDI, C-Pentane ete.

Quality Ç enter for industrial heating systems and pressure vesels

Separator tanks and heat exchangers for petroleum industry Waste heat recovery boilers for Co-generation plants Turn key plants for industrial steam, hot water produetion

ISISAN ISI SAN. TiC. A.Ş. O.S.B 21. Cad.No.6 Kayseri/TURKEY Tel: +90 352 321 13 43 (Pbx) Fax: +90 352 321 14 13

C.rtHltd ISO 9001 try

ü te n

UK AS wv? « İ m»ni

«M

m f /A!

V<r>V

s jfu

fS j

W W W .is is a n .C O m .tr

İ n f o @ İ 5 İ s a n . C O m .tr


Türk inşaat firması tarafından yaptırılan ve kısa bir süre önce ibadete açılan Kul Şerif Camii... Cami, Kazan Kremlin Cumhurbaşkanlığı Sarayı ’nın hemen yanı başında bir anıt gibi yükseliyor. Kazan şehri, Idil-Ural bölgesinin en önemli kültür merkezi. 1804 yılında kurulan ve Rusya’nın sayılı üniversitelerinden olan, Tolstoy, Lobachevskiy ve Lenin gibi ünlü isimlerin de eğitim gördüğü

44 SKYLIFE 3 /2 0 0 6

idil Nehri'nin bir kolu, şehrin eski ve yeni mahallelerini birbirinden ayırıyor (üstte). Nehirle iç içe yaşayanlar, teknelerini balıkçı bannaklarına bağlıyorlar (altta). A branch of the Volga divides the old and new sectors of the city (above). River dvvellers moor their boats in the fishermen’s coves (belovv).

mosques and churches as well as outstanding examptes o f the local archltecture. And Kazan’s nevvest symbol, the Kul Sherif Mosque, built by a Turkish construction company and recently opened for worship, rises like a monument itself immediately next to the Kazan Kremlin's Presidential Palace. The city o f Kazan is the cultural capital of the Volga-Ural region. Kazan University, founded in 1804 and one o f Russia’s most highly respected institutions of higher learning where prominent figures like Tolstoy, Lobachevsky and Lenin studied, stili attracts a large number o f students from both Russia and abroad. Great importance is given to the arts in Kazan, as is evidenced by the city's seven professional theaters, four State orchestras, dance and music ensembles, thirteen museums, and the Hermitage-Kazan, the only existing branch of St. Petersburg's famous Hermitage museum, as well as

five exhibition halis and galleries, several art schools and the second largest concert hail in Russia. Furthermore, the city boasts three entertainment centers, 330 libraries, seven movie theaters and a host of cultural institutions. NOT BEFORE VISITING A ‘MUNCHA’ Almost every Tatar house in the city’s outlying districts and surrounding viilages has a ’muncha'. Counterparts to the more familiar sauna but in this case Tatar-style, munchas are coal-powered, generating heat o f up to 80 degrees Centigrade. Like ancient Roman baths, munchas play a central role in Tatar social life. The Tatars are justly proud of their cuisine. Dishes such as belish, peremech, uch puchmak, gubediye and kistibiy are truly delicious. Post-prandial tea is de rigueur here, and the sweet known as ’chek chek’ that accompanies >


R ig h t ch o ice fo r w ise investm ents izopoli is proud to have one o f th e m ost e fficie n t continuous production lines in Europe vvith an annual capacity o f 2 m illion sqm. izopoli products quality is guaranteed by our strict adherence to the usage o f the to p quality ravv materials and o ur high Standard technological equipm ents as well as our experienced professionals.

nM

You have many reasons to use our products: Quality through economical industrial production Stability Easy to Assemble Virtually Maintenance Free Light Weight High Thermal Insulation Hygienic Diffusion Proof We are looking forvvard to serving you our guality vvith our affordable prices

r j iz o p o L i İZOPOLİ C o ld Store , R o o f & W a ll Pane ls P hone:+ 90 21 2 2 3 6 60 32 p b x Fax +90 2 1 2 2 3 6 0 5 41 in fo @ iz o p o li.c o m

www.izopoli.com


Idil Nehri, Kazan'a hayat veriyor. Nehrin üzerindeki adacığın üzerinden Rus askerleri için bir anıt mezar yükseliyor. The Volga is Kazan’s vital artery. A monument to fallen Russian soldiers rises on an island in the river.

Kazan üniversitesi, şehre Rusya Federasyonu’nun içinden ve dışından çok sayıda öğrenci çekiyor. Kazan’da sanata büyük önem veriliyor. Kentteki yedi profesyonel tiyatro, dört devlet orkestrası, dans ve müzik toplulukları, 13 müze, St. Petersburg'taki ünlü Hermitage’ın tek şubesi olan Hermitage-Kazan, beş sergi salonu, sanat okulları ve Rusya’nın en büyük ikinci konser salonu bunun bir göstergesi. Ayrıca üç eğlence merkezi, 330 kütüphane, yedi sinema salonu ve pek çok kültür kurumu da kentte faaliyet gösteriyor. ‘MUNÇA’YA GİRMEDEN OLMAZ Kazan’ın dışındaki mahallelerde ve köylerde hemen her Tatar’ın evinde bir ‘munça’ var. Bildiğimiz saunaların aynısı olan bu munçalar, taş kömürü ile ısıtılıyor ve böylece

80 dereceye kadar ulaşan bir sıcaklık elde ediliyor. Munçalar, eski Roma imparatorluğu’ndaki hamamlar gibi, Tatarların sosyal hayatında önemli bir yer tutuyor. Tatarlar mutfaklarıyla haklı olarak övünüyorlar. Beliş, peremeç, üç puçmak, gübediye ve kıstıbıy gibi yemekleri hakikaten çok güzel. Yemeğin üstüne de mutlaka çay içiliyor ve çayın yanında verilen 'çek çek' tatlısı da bir harika. Japonların ünlü çay törenlerini aratmayan Tatar çay saatlerinde, çayın yanında mutlaka çeşitli reçeller, ballar, kuruyemişler, çikolatalar ve undan yapılmış tatlılar sunuluyor. Seyahat bitiyor. Türk Flava Yolları’nın yeni başlayan tarifeli seferlerinden biriyle dönüşe geçiyoruz. Kulaklarımızda Tatar ezgileri... Idil boylarında atlılar koşturuyor. Idil Nehri, usul usul Kazan’a doğru akıyor...

Türk Hava Yolları’nın İstanbul’dan Kazan’a salı ve cuma günleri; Kazan’dan İstanbul'a ise çarşamba ve cumartesi günleri seferleri bulunuyor.

it is nothirıg short of scrumptious. A variety o f jams, honeys, biscuits, chocoiates and other pastries are alvvays offered at Tatar tea time, vvhich is in no way inferior to the famous tea ceremonies o f Japan. Our journey ended, we prepare to return on one o f the scheduled flights recently introduced by Turkish Airlines. Strains o f haunting Tatar melodıes echo in our ears, and horsemen gallop along the banks o f the Volga, flovving quietly into the heart o f Tatar Kazan... □

Turkish Airlines fiies from İstanbul to Kazan on Tuesdays and Fridays and from Kazan to İstanbul on VVednesdays and Saturdays.

N O V O S A V IN O V S K IY

K A ZA N K A RİVF.R G R IV K A

ia^N■*..

AOP

_

■ Adminlstralion House K R E M L İ N B Slyumbike Towsr Clrcuta ■Kul-Sharıll Mosque

GorUPark

' t¥ i İJh s a n ^ ta » *

IG U M N O V O

Staiion

»

V f(*V

V o

OSM I

OM ETEVO v

R l-C H IO Y l'O R n Matdzffani V O K H t T O V S K IY

/ 4 6 SKYLIFE 3 /2 0 0 6

Gürbüz YAYINLARI

(021b) 574 24 44

- - 0awskaja.Su Kazan Fak

' '

,


HACCP

ISO 9001

IS014001 OHSAS18001

O naylı "İLK ŞEKER

HELİN GIDA PAZ. SAN. VE TİC. LTD. ŞTİ. Cemal Ulusoy Cad. No:43 Yenibosna-B.evler / İstanbul Tel: (0 2 12) 696 00 00 Fax: (0 2 12) 696 00 0 1


PORTRE PORTRAİT

Resim ve heykelle bir ömür / A life in painting and sculpture

Zühtü Mürido“ | |

Ö M E R F A R U K Ş E R İF O Ğ L U


Türk heykelinin büyük ustası Zühtü Müridoğlu, doğum unun 100. yıldönümü dolayısıyla Yapı Kredi Kâzım Taşkent Sanat G alerisi’nde açılan retrospektif bir sergi ile anılıyor. The great Turkish sculptor Zühtü M üridoğlu is being rem em bered on the 100th anniversary of his birth in a retrospective at Yapı Kredi Kâzım Taşkent Art Gallery. eksen yıllık yaşamı boyunca, taşa, çamura, ahşaba ve madene biçim veren Zühtü Müridoğlu, Türk heykel sanatının öncü kurucularındandır. Birçok malzemeden yararlanarak soyut ve figüratif heykel ve heykelciklerin yanı sıra, Anıtkabir'deki bazı kabartmaları ve Beşiktaş’taki Barboros Anıtı’nı da gerçekleştiren Müridoğlu, 21 Ağustos 1992’de ölmüştü. 26 Ocak 1906'da İstanbul’da doğan Zühtü Müridoğlu, 1924’te Sanayi-i Nefise Mekteb-i Âlisi'nin Resim Bölüm ü’ne girer. Daha sonra Heykel Bölümü’ne geçer. 1927-1928 yılının Akademi bitirme ödülünü alan Müridoğlu, dönemin sanat merkezi Paris’e gitme hakkını kazanır. Colarossi Akademisi’nde Marcel G im ond’un (1894-1961) atölyesinde çalışmaya başlar. Modernleşme azminde olan bir ülkenin genç sanatçısı olarak, Paris yıllarının birikimi ile sanat anlayışı derinden etkilenir. Çağdaşlık ve modernizm, Zühtü Müridoğlu için adeta bir misyona dönüşür. Değişmek isteyen bir kuşağın tem silcisidir o artık!.. Sık sık “Şimdiye kadar öğrendiğimi unutmak istiyorum” diyerek heykel sanatıyla, figürle ilgili akademik bilgilerden uzaklaşarak, yepyeni deneylere, ufuklara açılmak ister. Paris’teki hocası Gim ond’dan öğrendiklerini kolay kolay unutamaz. Paris döneminin ve hocasının etkileri onun en başarılı olduğu alana, büstlerine yansır.

S

ühtü Müridoğlu, who spent eighty years o f his life givlng shape to stone, day, wood and metal, was one o f the pioneers o f the art of sculpture in Turkey. Besides the abstract and representational sculptures large and small that he created using a wide array o f materials, Müridoğlu was also responsible for the Barbaros Monument at Beşiktaş in İstanbul and for some o f the reliefs on Atatürk’s Mausoleum (Anıtkabir) in Ankara. He died on 21 August 1992. Zühtü Müridoğlu, who was born in İstanbul on 26 January 1906, entered the Painting Department o f the Imperial Academy o f the Fine Arts in 1924, transferring later to the Department o f Sculpture. As the recipient o f the Academy's graduation prize for 1927-28, Müridoğlu earned the right to study in the then world art capital o f Paris, vvhere he began vvorking in the atelier of Marcel Gimond (1894-1961) at the Colarossi Academy. As a young artist from a country bent on modernizing, Müridoğlu’s concept o f art was profoundly influenced by the experiences o f his Paris years. Modernism became a Virtual mission for Müridoğlu, who from now on vvas the representative o f a generation that craved change. As he would say repeatedly, "I want to forget everything l ’ve learned up to now!" Indeed, he vvanted to get as far away as possible from the academic approach to the figüre and the art o f sculpture in general, and open himself up to fresh experiments and new horizons. İt is in his busts that the impact of Müridoğlu’s Paris period and the influence o f his teacher there find their most notevvorthy expression.

Z


Kağıt üzerine karışık teknikle yaptığı bir deseni (solda). Ali Hâdi Bara ile ortaklaşa gerçekleştirdiği Barbaros Anıtı’nı çalışırken (altta). A drawing on paper using an eclectio technique (left). The Barbaros monument, designed jointly vvith Ali Hâdi Bara (belovv).

TÜRKİYE’NİN İLK HEYKEL SERGİSİ Fransa’daki eğitim süresi tamamlanınca, 1932 yılının Ocak ayı başlarında trenle İstanbul’a döner ve Samsun Lisesi'ne resim öğretmeni olarak atanır. Ancak taşra yaşamıyla uyuşması zordur. Heykel çalışmaları kişisel bir sergi açacak düzeye gelince, arkadaş ve hocalarının da katılımıyla, Türkiye’de ilk heykel sergisi olarak kabul edilen, Gülhane Parkı’nın girişindeki Alay Köşkü’nde sergisini düzenler ve ardından Samsun’a döner. Evdeki kedisinin modellik ettiği ‘Karalamalar’ını orada sürdürür; bu çizimler arasında yeni tanıştığı kişilerin portreleri de vardır. Yarattıkları küçük çevrelerinde, birbirlerini destekleyen görüşleriyle bu zorluğu aşma çabasına girmiş genç sanatçılardan olarak, 1933’te Zeki Faik Izer, Nurullah Berk, Cemal Tollu, Abidin Dino ve Elif Naci'den oluşan beş ressam arkadaşıyla birlikte ‘D Grubu’nun kurucu üyeleri arasında tek heykeltıraş olarak yerini alır. Zühtü Müridoğlu; Ali Hâdi Bara (1906-1971), Nusret Suman (1905-1978), Ratip Aşir Acudoğu (1898-1957), Hüseyin Gezer (1920), Mehmet Şadi Çalık (19171984) ve Ilhan Koman (1921SKYLIFE 3 /2 0 0 6

1986) ile birlikte Cumhuriyet kuşağının ilk heykel sanatçılarını oluşturur. Bu isimler bireysel araştırma ve çıkışlarıyla, Cumhuriyet döneminin kültürel yaşamda benimsediği çağdaşlaşma anlayışı paralelinde, öncü niteliğinde atılımlarıyla Türk heykel sanatının erken modern örneklerini vermişlerdir. BÜYÜK ANITLARIN YARATICISI Öğrencilik yıllarından itibaren tasarladığı anıtlar, ona bir dizi ödül getirir. Müridoğlu'nun Hâdi Bara ile ortaklaşa gerçekleştirdiği Barbaros Anıtı (1939-1944), büyük kalitesi olan bir anıt çalışmadır. II. Dünya Savaşı öncesi yıllara rastladığından bronz döküm fiyatları, geçen zamanla birlikte ikiye katlanmış, masraflar artmıştır. Ünlü Türk denizcisi Barbaros Hayreddin Paşa ile iki levendi, onlardan birinin taşıdığı bayrakla gösteren anıt, Müridoğlu’nun anılarında dile getirdiği gibi çok zor koşullar altında gerçekleşir. Ali Hâdi Bara ile ortaklaşa gerçekleştirdikleri anıt bağlamında yaptığı diğer çalışmalar Zonguldak Atatürk Anıtı (1941-1946), Anıtkabir kabartmalarından Dumlupınar (1951-1953), Muş’taki Atatürk Anıtı (1963-1965) ve Büyükada’daki Atatürk Anıtı

TURKEY’S FIRST SCULPTURE EXHIBITION Upon completing his training period in Paris, Müridoğlu returned to İstanbul by train at the beginning o f January 1932 and was appointed as a high school painting teacher in the town o f Samsun on the Black Sea coast. But adapting to life in the provinces came hard after Paris, and when his work matured to the point that he couid hold a one-man show, he organized, with the help o f his colleagues and teachers, an exhibition, the first sculpture exhibition in Turkey, at the Alay Köşkü, an Ottoman pavilion near the entrance to Gülhane Park. Immediately afterwards he returned to Samsun, vvhere he continued making the ‘Sketches’ for vvhich his cat posed as model. Among them are also portraits o f some o f his nevv acquaintances. Among the young artists who vvere struggling to overcome hardship by forming small circles o f mutual support,

Müridoğlu was the sole sculptor among the founding members o f the ‘D Group', vvhich was formed in 1933 by himself and five painter frlends: Zeki Faik Izer, Nurullah Berk, Cemal Tollu, Abidin Dino and Elif Naci. Zühtü Müridoğlu together vvith Ali Hâdi Bara (1906-1971), Nusret Suman (1905-1978), Ratip Aşir Acudoğu (18981957), Hüseyin Gezer (1920-), Mehmet Şadi Çalık (19171984) and Ilhan Koman (19211986) vvere the first sculptors o f Turkey’s Republican generation. Parallel vvith the concept o f modernization that they espoused in the cultural life o f the nevv Republic, these artists produced the first pioneering examples o f modern Turkish sculpture through their individual quests and initiatives. CREATOR OF MAJESTIC MONUMENTS The monuments that Müridoğlu designed beginning in his student years earned >


♦ BETC EURO RSCC

|$ M C

LACOSTE

un p e u d ’ air s u r t e r r e

RenĞ L a c o s te 1 9 2 7


Müridoğlu, ağaç dallarıyla başladığı soyut heykel anlayışını küpler serisiyle sürdürür. Soyut çalışmalannda toprak, ahşap, bakır, demir ve alçı dahil olmak üzere birçok malzemeden yararlanır. İn his ’cube’ series, Müridoğlu pursues the concept of abstract soulpture that began with his tree branches. Clay, oopper, iron and plaster are some of the materials he employs.

(1964-1965) olur. 1936 yılında İstanbul Arkeoloji Müzesi'ne atanmasıyla, İstanbul serüveni yeniden başlar. Sabahattin Eyüboğlu’nun da Ankara'da bulunduğu bir dönemde, hocalık göreviyle bir süre de başkentte çalışır. 1950’de atandığı Akademi’deki Heykel Bölümü hocalığı onun son durağı olur. SANATLA OYUN

Zühtü Müridoğlu’nun modernden anladığı, başlangıçta soyuttur. Onun ilk soyut çalışmaları 1950'li yılların başlarına rastlar. O zamana kadar sürdürdüğü figüratif anlayış, yerini yavaş yavaş figüre bağlı olmayan yönelimlere bırakır. Sanatçı ahşap yontu alanında da büyük ustalığa sahiptir. 1934 tarihli ‘Savaş’ rölyefi onun bu alandaki başyapıtı sayılabilir. Figürün görünümünden çok, 52 SKYLIFE 3 /2 0 0 6

hareketiyle ilgilenen sanatçı 1960’ların bazı minimalist ahşap heykellerinde de aslında bu hareket etkisini arar. Sunulan ister bir küre olsun, ister bir insan başı. Gözler, burun ve dudaklar değil, biçimlerdir konuşan yontuda. Bu doğrultuda bakıldığında, Zühtü Müridoğlu’nun figüre dönüşünü bir ‘geriye dönüş’ olarak görmek yanlış olur.

him a series of awards. The Barbaros Monument (1939-1944), which he created joirıtly with Ali Hâdi Bara, is a magnificent work of very high quality. Its cost doubled when the price of cast bronze skyrocketed during the Second World War. This monument, depicting the renovvned Ottoman admiral Barbaros Hayreddin Pasha together with two sailors, one of them bearing the national flag, was realized under conditions of extreme hardship as described by Müridoğlu in his memoirs. Other projects of a monumental nature undertaken by Müridoğlu jointly with Bara inciude the Atatürk Monument at Zonguldak on the Black Sea coast (1941-1946), the Anıtkabir relief ‘Dumlupınar’ (1951-53), which commemorates a great battle in the Turkish War of Liberation, the Atatürk Monument in the eastern town of Muş (1963-1965) and the Atatürk Monument on Büyükada, an island in the Sea of Marmara near İstanbul (1964-1965). Müridoğlu resumed his life in İstanbul upon being appointed to the Archaeological Museum in 1936. He also worked for a time as a teacher in the capital Ankara during the

period when the great Turkish cultural figüre Sabahattin Eyüboğiu was active there as weli. A teaching position in the Sculpture Department of his alma mater, which he took up in 1950, would be his final post. ART AS A FORM OF PLAY

What Zühtü Müridoğlu understood by ‘modern' was, at the outset, the abstract. His first abstract studies date to the 1950s when the representational approach that he had foilowed up to that time gradually gives way to a tendency away from the figüre. The artist vvas also a great master of wood carving. His ‘Warrior’ relief from 1934 can be regarded as his masterpiece in this genre. Concerned more with the >


un p e u d â&#x20AC;&#x2122; air s u r t e r r e

w w w .la c o s te .c o m


Ancak, bu figüratif yapıtlarında 1950 -6 0 ’ların cesur biçim/hacim /uzam araştırmalarıyla karşı karşıya olmadığımızı da belirtmek gerek. M üridoğlu’nun doğrudan soyut olarak tasarladığı, ahşabı bakır ve demir ile birlikte kullandığı heykellerini 1980’lerde dans eden bronz kadın figürleri izlemiştir. Zarif ve uçucu bir deseni, çamurda taze, canlı, duyarlı, yaşayan biçimler oluşturan bir modlaj üslubu vardır. Ahşapta düz perdahlanmış alanlardan kaçınır; ürperen, titreşimli yüzeyleri yeğler. Sanatı bir oyun olarak algılamış ve öyle uygulamıştır. Desen, sanatçının her döneminde varolmuş, hem heykellerinin düşünsel hazırlık aşamalarını oluşturmuş, hem de başlı başına bağımsız bir ifade aracı olarak kullanılmıştır. Son yıllarında gerçekleştirdiği baskıları ve 1992’de öldüğü yıl yayımlanan ‘Zühtü Müridoğlu Kitabı’ bunun en belirgin örnekleridir. Adı ‘sarı fizikçi’ olarak geçen ve M üridoğlu’nun ısrarlı çalışmalarında ona verdiği destekle tanınan eşi Seniha Hanım’ın önemli katkısına da değinmek gerek. Geride kalan 78 defter dolusu eskiz ve çizimlerden de anlaşılacağı gibi Müridoğlu için heykel, her şeyden önce bir tasarım nesnesidir. Ölümünden sonra İstanbul Resim ve Heykel Müzesi’nin envanterine geçen bini aşkın deseni ve bu arada 160 civarındaki son etütleri, onun yorulmaz bir güçle bağlandığı mesleğine ilişkin özverili ve aralıksız çalışma kapasitesi hakkında fikir verecektir. Görsel malzemelerin sağlanmasındaki katkılarından dolayı Yapı Kredi Yayınları’na teşekkür ederiz. 54 SKYLIFE 3 /2 0 0 6

Sanatçının iki bronz heykeli: ‘Uyanış’ (en üstte) ve ‘Koşucu’ (üstte); Özel Koleksiyon. Two of the artist's bronze statues: 'The Avvakening' (top) and ‘The Runner' (above); Private Collection.

movement than the mere appearance of the figüre, the artist sought to convey movement in some of the minimalist wooden scuiptures he created in the 1960s. VVhether the object in question is a sphere or a human head, it is the shape that speaks in his carvings, not the eyes, nose or mouth. While it would be wrong to regard Zühtü Müridoğlu's return to the figüre as retrogressive, it is nevertheless essential to point out that his representational vvorks do not exhibit the same bold quest for form, volüme, and extension that characterizes his creations of the 1950s and 60s. The scuiptures that Müridoğlu designed as pure abstractions using copper and iron alongside wood vvere follovved by bronze figures of dancing vvomen in the 1980s. His dravving was elegant and deft, and his modelling style engendered fresh and dynamic sensitive, iiving forms in day. He avoided smooth polished areas on wood, preferring instead rippling, vibrating surfaces. Art for him vvas a form of play, and he practiced it as such. Dravving vvas alvvays there in ali of the artist's periods, both in the conceptual

phase preparatory to his scuiptures and as a means of expression in its own right. The most outstanding examples of this are the prints that he produced in his last years and the Zühtü Müridoğlu Book’ that vvas published in 1992, the year of his death. Müridoğlu's vvife Seniha Hanım, knovvn to her friends as ‘the blond physicist’, vvas famous for her unfailing support of his persistent efforts, and it is only appropriate that we mention her very significant contribution here. As is evident from the 78 notebooks fulI of sketches and drawings that he left behind, sculpture for Müridoğlu vvas above ali else a matter of design. Över a thousand of his dravvings, induding his close to 160 last studies, vvhich vvere donated to the İstanbul Museum of Painting and Sculpture follovving his death, give some notion of this artist's capacity for non-stop vvork and his selfless devotion to the profession to vvhich he vvas bound vvith indefatigable enthusiasm. □ W e are grateful to Yapı Kredi Publications for supptying the vlsual materials.


Size bir iss teklifimiz var.

Uzun D önem O tom ob il Kiralama

Uzun Dönem Kiralama

Şirket yöneticileriniz için istediğiniz BMW modellerini 3 yıla kadar uzun dönem kiralayın, trafik sigortası, kasko, vergi, taşıt vergisi, bakım, onarım gibi işlemlerinizle biz uğraşalım. Borusan Otomotiv

Bilgi için: (0212) 412 00 00 ve borusanotomotiv.com

BMW D istribütö rü

Sheer D riving Pleasure


Ardahan’da hayat bulan, huzurla ve usulca akan Kura Nehri, çevresindeki renkli yaşamlarla bütünleşip bir gökkuşağına dönüşüyor... Arising in Ardahan in Turkey’s northeast, the Kura River flovvs quietly, in perfect harmony vvith the bustling life along its banks...

Y

avaş yavaş yükselen yayvan tepelerin arasından, yüksek platolardan geçerken tuhaf bir duygu kapladı içimi. Ayrı bir gezegen gibi sonsuza uzanan yeşil topraklar üzerinde, kara, ince bir yolda ilerlerken, eksik kalan yeşil bir ton aradı gözlerim. Yerden yükselen dallı budaklı bir yeşil, bir ağaç... Ufka kadar nafile taradım düzlükleri. Aracımız tepenin sırtına çıktı. Ümidini yitirmiş biri, karşısına ansızın bir dost, bir sevgili çıktığında nasıl hafiflerse, ben de öyle hafifledim. Hayal gibi uzanan 58 SKYLIFE 3 /2 0 0 6

strange feeling came över me as we wound our way slowly through the low-lying hills and över the high plateaux. As we made our way along the dark, narrow road through verdant lands that seemed to stretch into infinity İlke another planet, my eyes sought for one shade of green that was mlssing. The green of a tree vvith branches and knots, tovvering över the earth. I scoured the plains as far as the horizon. Then our vehicle climbed to the top of a ridge, and suddenly I went light as a

A

Kura Nehri, volkanik dağlardan doğarak suyuna kattığı küllerle gri renge bürünüyor (üstte). Kura Vadisi kıyısındaki verimli otlaklar Yürükler tarafından da kullanılıyor (karşı sayfada en üstte). Arising in voloanio mountains, the Kura River takes on a grey color from the ash in its waters (above). The fertile pastures along the banks of the Kura are used by the local herdsmen (facing page, top).


-

zümrüt yeşili ormanlar kaplamıştı her yanı. Başımı camdan uzattım ve sarıçamların o nefes kesen kokusunu içime çektim. Doğu’nun hayatta kalabilmiş bir avuç ormanıydı burası. Ardahan’dan Çıldır ilçesine gidiyordum. Son sürat giden minibüsün sessizliğini bozdu sesim: “İnecek var!” Yolcuların bakışı bir anda bende odaklandı. Tuhaf bir şüpheye büründü gözler. Ne yapacak ki bu dağ başında... Şoför, söylene söylene minibüsün üstüne çıktı. Sırt çantamı çözüp uzatırken, “Kurt neyim saldınr, gel vazgeç, dağ başında kalınır mı; ne işin ola ki

ormanda?” dedi. Ormanın kıyısındaki köyü kestirmiştim gözüme... "Şu köyün adı nedir?” “Altaş.” “Oraya gideceğim.” Şoför, pek tekin biri olmadığıma karar verdi ve minibüsüyle orman içinden geçen yolda kayboldu. Heyecanla daldım ormana. Nasıl uzun, nasıl düzgün ağaçlarla kaplıydı dağlar. Sanki özenle hazırlanmış bir saray bahçesi. Her yer mis kokulu, rengârenk çiçeklerle bezenmiş. Orman yavaşça yükselip bir dağı çevreliyor ve dağın sivri, karlı tepesi pamuk pamuk bulutları deliyordu. Öyle ıssız ki orman. Burada aylarca

feather, like one who has lost ali hope and is relieved to catch sight of an old friend or sweetheart. Like a mirage, emerald green forests spread as far as the eye could see. I stuck my head out the window and inhaled the breathtaking fragrance of the Scotch pines. This was the East's last handful of surviving forest. I was on my way from Ardahan to the township of Çıldır. My voice broke the silence of the speeding minibüs: "Let me off here!" Instantly ali eyes were on me, ali of them clouded with a strange suspicion. VVhat was he going to do out here in the

middle of novvhere? Grumbling under his breath, the driver ciambered on top of the minibüs. As he unfastened my backpack and handed it down to me, he said, “You’ll be attacked by wolves. Give it up. VVhoever heard of stopping in a place like this? VVhat business have you got in this woods anyway?” I caught sight of a village at the edge of the forest. “VVhat's the name of that village?” I asked. "Altaş," he answered. I said I was going there. Having decided I was bad news, the driver and his minibüs vanished from view down the forest road. I plunged enthusiastically into t> 3 /2 0 0 6 SKYLIFE 59


PLATINUM NEVV Y O R K

®

I *

* -

*

• •

ü 4 ••••

ı • •*

»• • •

t t

M lı

t*

• MM

••

M * ••

• *

@ w o rld

.

«

»

«

i

9*


YAPI ^ KREDİ


i

\aSâ

i.

},

*

a t

>k

Kura Vadisi boyunca yer alan köylerde çok sayıda kaz yetiştiriliyor. Geese are raised in large numbers in the viilages of the Kura Valley.

yaşasam, kimse bulamaz beni hissine kapıldım. Derinden bir uğultu yükseliyordu. Derin kayalıklardan yankılanan bir uğultu. Merakla ilerledim. Dümdüz uzanan orman birden büyük bir boşlukla kesilip tekrar devam ediyordu; gürültü de o boşluktan geliyordu. Kayalığa yaklaştım ve ürperdim. Üç yüz metrelik bir kanyonun kıyısındaydım. Kavisler çizerek, homurdanıp köpürerek çağlıyordu Kura Nehri. Kanyonun duvarlarında inatla tutunmuş çam ağaçlarına, çıkıntılara basa basa indim nehir kıyısına. Kanyon tabanındaki kayalıklardan sanki püskürerek akan kaynak sularından içtim kana kana. O gece Kura Nehri’nin kıyısında Altaş köyünün yakınına kurdum çadırımı. KARBEYAZ VE Z Ü M R Ü T YEŞİLİ

İnsanın içini ısıtan bir renk karnavalının ortasından 62 SKYLIFE 3 /2 0 0 6

usulcacık akıyordu nehir. Dağların karlı zirvelerinden püsküren bulutlar, top top olup pamuk tarlasına dönüştürüyordu göğü. Sabahın ilk ışıklarıyla köylerinden ayrılan sığır sürülerinin kaldırdığı tozlar kızıla boyanıyordu. Atlı çobanların önüne kattığı koca hayvanlar da, dağların tepelerindeki taze otla kaplanmış meralarına koşturarak ilerliyordu, haylaz çocuklar gibi. Salına salına yürüyen paytak kazlar küçük çobanlarının önlerinde, Kura Nehri'nin kıyısına kadar yaklaşıp beyaz gövdelerini serin sulara bıraktılar. Gölün sığlıklarındaki nilüferlerin altın sarısı çiçekleri arasından yükselen kurbağa seslerine karıştı kazların coşkulu vakvaklan. Altaş köyünün delikanlıları sırtlandıkları serpme ağlarıyla nehir kıyısına ulaştı. Nehrin kuytu köşeleri gözlendi dikkatle. “İşte, işte!” diye haykırdı biri. Ağ ustalıkla saçıldı

the woods. VVİth what straight, tali trees these mountains were covered! As if they had been carefully planted, as in a palace garden. The earth was a solid carpet of sweetsmelling flovvers of every color imaginable. The forest rose slowly to envelope the mountain, whose sharp, snow-covered peak pierced the cottony clouds. So deserted a place it was... I got the feeling that if I stayed here for months no one would find me. A loud hum was audible from somewhere. A roar echoing from a deep rocky chasm. Curious, I trudged on. The forest that stretched so regularly in every direction was suddenly interrupted by a vast clearing before spreading again; and the roar was coming from that clearing. I approached the rock cliffs and was taken aback. I was standing on the edge of a three-hundred-meter-deep

canyon. Tracing sharp curves, the Kura River roared below, churning up foam as it rushed along. Finding a footing on the outcroppings and the pine trees that clung stubbornly to the canyon walls, I inched my way down to the bank of the river, where I quaffed great gulps of the spring vvaters that were fairly bursting from the rocks on the canyon floor. That night I pitched my tent near the village of Altaş on the banks of the Kura. SNOW VVHITE AND EM ERALD GREEN

The river flovved gently through a heart-warming carnival of colors. Clouds scattered by the mountains' snowy peaks turned the sky into a fieid of cotton bails. The dust kicked up by the herds of cattle ieaving the viilages in the first iight of dawn was stained gradually red in the glow of the rising sun. And, like unruly O


Three Diamonds... For yourpast, present andfuture

A magical touch on magical diamonds M a g ic a l D ia m o n d s "

A f覺rst in the World Atasay paten ted M agical D iam onds簧 collection offers you the op p ortu n ity to turn your d ia m o n d into different pieces o f jevvellery with on e sim ple move. A m arvelou s ring vvith three d iam o n d s tu rn s into a set o f solitaire ring com pleted with m atchin g m arvelous earrings.

A u n iq u e d ia m o n d c o lle c tio n w ith v a rie ty o f concepts and fu ll o f su rp rise s vvaits fo r y o u at Atasay.

P a rtn e r o f

2006 T r i a

c a m p a ig n

www.atasay.com

for the store nearest you, please cali +90(212) 652 33 66 / 421 ext.


Kura’ya. “Tüh, kaçtı!’’ Olsun, yine de öğle yemeğine yetecek kadar balık avladı balıkçılar. Ormandan toplanan odunla ateş yakıldı, közde nar gibi kızaran balıklar, kaymaklı tandır ekmeğine yeşil soğan eşliğinde sarıldı. O eşsiz lezzetini sundu Kura, emeklerinin karşılığı olarak. Hava ne sıcak, ne soğuk, insanoğlunun tam arzu ettiği ılıklıkta. Güneş tam tepeye yükselse de hafif hafif esen dağ rüzgârı hararetini kesiyor. Rakım iki bin metre. Türkiye’nin en yüksek yerleşim yerlerinden, Ardahan’ın köylerinin kıyısından sakince akıyor Kura. Yaşam Kura kadar sakin, Kura kadar huzur dolu burada. En uzun, en sert kışların yaşandığı bölgede iki mevsim var zaten. Biri kış, biri bahar. Kışın rengi karbeyaz, baharınki zümrüt yeşili. Göğün rengi ise derin mi derin mavi. Bir de Kura var göğün mavisini kıskanıp yansıtan. Pamuk bulutlardan süzülen yağmur dahi güneşle yağıyor dağlara. Hemen her gün dağlan taçlandırıyor gökkuşağı. YABAN HAYATI ÇOK ZENG İN

Kura Nehri, Ardahan’ın üç bin metrelik zirvelerinden süzülen kar ve kaynak sularıyla büyüdükçe büyüyor. Göle'den, Posof’tan, Çıldır’dan sinesine aldığı derelerle coştukça coşuyor ve Gürcistan sınırına doğru derin bir kanyona giriyor, sarıçamlarla kaplı karlı dağların ortasından uğuldayarak veda ediyor topraklarımıza. Doğu’nun en bakir ormanlarıyla çevrili Kura Vadisi’nde kalem gibi dümdüz, uzun sarıçam ormanlarında yaban hayvanlarının yürürken çıkardığı çıtırtılar eksik olmuyor. Dikkatle atılan adımların, etrafı süzen ürkek, kömür karası gözlerin, tereddütle oynaşan koca kulakların sahibi dünya güzeli karacalar, ormanda çete gibi dolaşan kurtlar, her gece Kura kıyısına homurdanarak inen domuz sürüleri, nehir kıyısındaki yaban ördekleri, gece gündüz fare peşinde koşan tilkiler, dağların yüksekliklerindeki mağaraların sakinleri ayılar, Kura Vadisi’ndeki yaban hayatı zenginliğinin en 64 SKYLIFE 3 /2 0 0 6

Kura Nehri’nin bir kolu üzerinde yer alan Şeytan Kalesi, sarp bir vadide bulunuyor (üstte). The Devil's Castle stands in a deep valley on one of the tributaries of the Kura (above).

children, the enormous arıimals being driven by villagers on horseback trotted headlong into mountain pastures carpeted vvith fresh grass. Bandy-iegged geese waddled in front of the liftle shepherds. Reaching the banks of the Kura, they ducked their piump white bodies in its icy waters. The croaks of frogs rising from the golden yellovv of the iily pads in the shallows of the lake mingled vvith the enthusiastic honking of the geese. Young men from the village of Altaş arrived at the riverbank vvith fishing nets on their backs and set to observing its remote recesses attentively. "Here!" yelled one. The net vvas tossed expertiy into the Kura. “Shucks, it got away!" But never mı'nd, the fishermen stayed there fishing tili midday. A fire was Ut vvith wood gathered from the forest, and the fish vvere griiled golden brovvn and vvrapped in flat 'tandır' bread to the accompaniment of clotted cream and green onions— these unsurpassed tastes the Kura’s revvard for the fishermen's labors. The vveather vvas perfect, neither hot nor cold. A soft mountain breeze brought relief even at high noon. At an altitude of 2000 meters, the Kura flovvs quietly beside the

villages of Ardahan, one of Turkey's highest places of settlement. And life here is as placid and peaceful as the Kura. There are just two seasons in this region, vvhere the vvinters are the longest and harshest in Turkey: vvinter and spring. VVinter is snow vvhite, spring emeraid green, and the sky is a deeper than deep blue that is also reflected in the vvaters of the envious Kura. Even the rain drizzling dovvn from the cottony clouds falls vvith sunlight on the mountains, vvhich are crovvned by a rainbovv almost every day. RİCH İN VVILDLIFE

The Kura River is svvelled by natural springs and the melting snows of Ardahan ’s three thousand meter peaks. Gathering the vvaters of the Göle, the Posof and the Çıldır, it rushes wildly, entering a deep canyon near the Georgian border, vvhere it roars through snovv-capped mountains covered in Scotch pine and bids farevvell to our lands. The silence is broken by the crackling sounds made by wild animals as they tread through the forest of tali, pencil-straight Scotch pines in the Kura Valley, vvhich boasts the East’s most Virgin timber. >


büyük tanığı. Sınır bölgesi olduğundan bu ormanlarda av yasağı uzun yıllardır uygulanıyor. Kura Vadisi’ndeki köylerin tek geçim kaynağı hayvancılık olduğundan, halkın yaban hayvanları üzerinde av baskısı bulunmuyor. BİR ÇADIR YETERLİ...

Kanyon içlerinde teraslar halinde yükselen köy kalıntıları, değirmen taşları göze çarpıyor. Geçmişten günümüze pek bir şey kalmamış. Sapasağlam ayakta kalan en görkemli yapı, Ardahan’ın Çıldır ilçesinden gelip Kura’ya karışan derenin bulunduğu derin, kayalık vadideki Şeytan Kalesi. Çıldır’dan yedi kilometre uzaklıktaki Yıldırımtepe köyünden bir patikayla ulaşılabilen kale, metrelerce yükseklikteki kayalıkların tepesinde ürperten bir görünüm sunuyor. Kura Vadisi’ni tüm güzellikleriyle yaşayabilmeniz için çadırınızı yanınıza almanız en güzel seçenek. Özellikle ArdahanPosof yolu üzerindeki Altaş köyü, orman ve Kura Nehri’nin buluştuğu noktada yer alıyor. Yöre halkının misafirperverliğinden de yararlanabilirsiniz. Altaş köyünden günübirlik yürüyüşlerle Kura Kanyonu’nun derinliklerine ulaşmanız mümkün. Sportif balık avına meraklıysanız, Kura'da çoğu bu

Türkiye-Gürcistan sınırı boyunca uzanan gür sarı çam ormanlarında az sayıda karaca yaşıyor. A handful of gazelles inhabit the dense Scotch pine forests along the TurkeyGeorgia border.

nehre özgü endemik balık türleri yaşıyor. Oltayla bol miktarda balık avlayıp, nehir kenarında yakacağınız ateşin közünde pişirip yeme zevkini tadabilirsiniz. Biraz sabırlı ve dikkatli olursanız ve gözleriniz de keskinse orman içlerinde bir çift kara gözle, karaca ile karşılaşabilirsiniz. "Karacayla göz göze gelirsen sakın kımıldama ve bekle” demişti Altaşlı bir köylü. Ben de öyle yaptım. Zaten o güzellikten insan nasıl gözünü alabilir ki? Titrek narin bacaklarıyla yaklaştı, yaklaştı ve beş metre karşımda öylece durdu. Dakikalarca seyrettik birbirimizi. Ve o gözlerine vurulduğum karaca, her yıl beni çağırdı renklerin nehri Kura’ya...

Graceful gazelles with shy coalblack eyes and enormous ears that tvvitch with hesitation as they step gingerly, wolves that roam the forest in packs, herds of grunting boar that trundle down to the banks of the Kura by night, wild ducks that vvaddle along its banks, foxes that chase mice night and day, and bears that inhabit the high mountain caves—ali bear testimony to the Kura Valley’s rich wild life. And this being a border region, hunting has been banned in these mountains foryears. Nordoes the human population pose any threat to the wildlife since their livestock are the viliagers' sole source of livelihood. ALL YOU NEED IS A TENT...

Millstones and remnants of villages rising in terraces are discernible inside the canyon. Yet littie from the past remains today. The most impressive structure stili standing is the Devil's Castle in a deep, rocky valley where a stream that arises in the Ardahan tovvnship of Çıldır joins the Kura. This castle, which can be reached by a path from the village of Yıldırımtepe seven kilometers from Çıldır, makes a startling appearance at the top of a rock cliff many meters high. 66 3KYLIFE 3 /2 0 0 6

Your best bet for experiencing ali the beauty of the Kura Valley is to take along a tent. The village of Altaş in particular on the Ardahan-Posof road is situated at the point vvhere the Kura and the forest meet. As well as enjoying the hospitality of the local people here, you can also delve into the depths of Kura Canyon on daily hikes from the village. If you're interested in fishing as a sport, several species, most of them indigenous to the Kura, are found this river. With just a hook and üne you can make a plentiful catch, cook the fish över coals on the riverbank and then sit back and enjoy the pleasure of eating them. If you’re alert and patient and have sharp eyesight, you might even meet a pair of black eyes in the depths of the forest. “If you do encounter a gazelle, for heaven's sake stand perfectly stili and wait," cautioned an Altaş villager. And so I did. How can a person take his eyes off such beauty anyway? İt approached on elegant, trembling iegs and stood opposite me, just five meters away. We gazed at each other for several minutes. And the gazelle, transfixing me with its eyes, invited me to return to the colorful Kura everyyear... □


P

3

>

Petrol Ofisi

FORMULA TE

ÂDIMIZI VERDİK FO R M U LA 1 “ PETROL OFİSİ TU R K İSH GRAND P R IX 2005'te seyirci değil, oyuncuyuz demiştik. Bu yolda ilk adımı F1™pilotu olmaya aday genç yetenekleri destekleyerek attık. Şimdi de bu yıldan itibaren F F 'in Türkiye ayağı bizim adımızı taşıyacak. Artık Türkiye'de F1™PO ile anılacak.


TRAVEL Ç£» 1=1

( i)

VELDA BAL ER


Sesleri, renkleri ve kokularıyla sizi bir anda içine alıveren D oğu’nun çarşıları, geçmişin derinliklerinde yolculuğa çıkartıyor... With their myriad sounds, colors and smells, the markets of the East immediately draw you in, taking you on a journey deep into the past. arkets are life itself in the cities of the East that lie between Mesopotamia and the Mediterranean. And the trade routes that pass through these cities at the intersection of the roads running east, west and north from the Mediterranean have determined the history of the region 's civilization and its cultural development. Their markets and bazaars are vvhere one experiences the colorful and bustling life of the cities of the East in particular, vvith their unique historical identities, their architecture, their traditions, their craftsmen and shopkeepers.

M

ile Akdeniz arasında yer alan M ezopotamya Doğu’nun şehirlerinde, çarşılar yaşamın ta

STORİES GALORE...

kendisidir. Akdeniz'den doğuya, kuzeye ve batıya giden yolların kavşağında olan bu şehirlerden geçen ticaret yolları da, bölgenin uygarlık tarihine ve kültürel gelişimine yön vermiştir. Tarihi kimlikleri, mimarileri,

The pounding of hammers lures you in to the narrow lanes of the coppersmiths’ market in Gaziantep. The sharp smell of the tin and the designs that materialize on a copper tray at each blow of the hammer stick in the memory... What

70 SKYLIFE 3 /2 0 0 6

Yıllarca derinin doğal rengi kullanıldıktan sonra Gaziantep'in renkli dünyasına ayak uydurmuş yemeniler; turuncu, kırmızı, mor, tütün yeşili olmuş (üstte). Gaziantep'ten yayılan panltıdır sedefkâri (solda). After the natural color of leather vvas used for years, these traditional flat-heeled shoes are finally in step vvith Gaziantep's ovvn colorful vvorld, in shades of orange, red, purple and green (above). The gleam of mother-of-pearl inlay at Gaziantep (left).


Yıllarını yemeni yaparak geçiren Recep Usta “Çek kızım, çek” diyor (altta). Recep Usta, a master cobbler for years, assisting a customer (below).

gelenekleri, esnafları ve zanaatkârlarıyla, özellikle Doğu şehirlerinin canlı ve renkli yaşantısının en çok hissedildiği yerler çarşılardır. NİCE Ö Y K Ü ...

Doğu çarşılannın en çekici mekânları alev alev biberlerin, salkım saçak kurutulmuş sebzelerin satıldığı baharat dükkânlarıdır (altta). One of the most attractive aspects of eastern markets are their spice shops selling fiery red peppers and clusters of dried vegetables (below).

Gaziantep Bakırcılar Çarşısfndaki çekiç sesleridir, sizi çarşının sokaklarına çağıran. Çekicin her darbesiyle oluşan bakır tabaktaki desenler, kalayın keskin kokusu yapışır zihinlere. Rafların arasındaki eski ve mühürlü bir tasın, bir mırra cezvesinin ne öyküsü vardır dinleseniz... Sonra sedef atölyelerinden birine girin mutlaka. Sedef kakma yapan ustaların ellerinin maharetini izlerken, işin tüm inceliklerini öğrenin. Bakırcılar Çarşısı’ndan sonra Saraciyeciler, Habbabçılar, Külekçiler ve Kavafiyeciler çarşıları gelir

peşi sıra. At koşum takımlarını yapanlara 'saraç', satıldığı yerlere de ‘saraciyeciler’ denir. Tahta takunya yapımcıları ‘habbab’ , içine bal, yağ ve yoğurt konan tahta kovaları yapanlar ‘külekçi’ , çarık ve yemeni üretenler de ‘kavaftır. Dükkânının tavanına astığı yemenilerde Hayri Usta ne hikâyeler saklamıştır kim bilir? Hanların birinin içinde kutnu dokuması yapan Cevdet Eldemir’in nasırlı ellerinde nelerin izi vardır? Her ustanın yanında durup konuşmaya ne günler yeter, ne de ömür... Bu çarşıları geçip aşağılara indiniz mi, Baharatçılar Çarşısı'na ve Peynirciler'e gelirsiniz; ki bu kez birbirine karışan baharat kokuları başınızı döndürür. Gaziantep Çarşısı’nın en güzel mekânlarından biri Tahmis Kahvesi’dir.

stories could the long-handled pot for making bitter Turkish coffee (mırra), or the old bowl with a seal standing on the sheives, teli if you only had time to listen? When you’ve had your fiil of the coppersmiths, be sure to visit the mother-of-pearl workshops. Learn ali the secrets of the trade as you watch the skilled hands of the master craftsmen producing mother-ofpearl inlay. The coppersmiths’ market is followed in turn by the saddlers, the makers of vvooden bath clogs, the makers of vvooden pails for oil and yoghurt, and the makers of rawhide sandals. Who knows what stories Hayri Usta has conceaied in these traditional flat-heeled shoes that are piled high to the ceiling of his shop? Who can fail to be moved by the scars that score the calloused hands of Cevdet Eldemir, who ıveaves the coarse cotton cloth known as ‘kutnu’ in one of the iarge commercial buıldings known as >


Türkiye'nin en seçkin yaşam projesi hayata geçiyor. Kaliforniya mimarisinin görkemi, Akdeniz'in romantizmi ve Anadolu'nun yaşam kültürünü birleştiren başka bir dünya:

Galerili, görkemli salonlar, iç avlular, özgür ve geniş hobi alanları, ferah bahçeler, bağımsız havuzlar, Büyükçekmece Gölü ve Marmara Denizinin birleştiği noktada nefesleri kesen bir manzara... Pelican Hill, eşsiz peyzajı ve çok iyi tasarlanmış rekreasyon alanlarıyla size hayallerinizdeki yaşamı sunuyor.

Pelican Hill...

Bu dünyada yerinizi alın.

Kelesoğlu, Kameroğlu. ortak girişimidir.

satış o rısı: 0212 886 5495

w w w .pe lica nh illevle ri.com


Yıldızlar peüucan Hiü/de Buluştu M im a ri konsep t, A m e rik a ’ dan:

Kaliforniya'nın en yaratıcı mimarlık ofislerinden RNM Architecture... P eyzaj, İta ly a ’ dan:

Avrupa'nın sayılı peyzaj mimarlarından Paolo Spaziani... İç mimari, T ü rkiye’ nin en ünlü iç mimarlarından:

Mahmut Anlar, Hülya Döşer, Hakan Helvacıoğlu, Dara Kırmızıtoprak, Haşan Mingü, Eren Talu, Mustafa Toner ve Eren Yorulmazer... Birbirinden değerli bu isimler, sizin için göz kamaştırıcı bir yaşam yarattılar.

Başka bir dünya..


Menengiç kahvenizi söyleyip, nargilenizi fokurdatmaya başladınız mı, kahvenin geçmişini dinlemenin zamanı da gelmiştir. 1640’ta IV. Murad döneminde yapılan bu kahvenin havasını solumak, bir köşesinde oturmak bile, insanı tarihin taa içlerine götürmeye yetiyor. Buraya kadar gelmişken, kahvenin hemen yanında bulunan ve 1638'de inşa edilen Tekke Camisi’ni görmeyi unutmayın. M ASA LSI VE ETK İLE Y İC İ: URFA Ç A RŞISI

Diyarbakır'ın Sipahi Çarşısı'na gelince; keçeci, takunyacı ve semercileri izlerken, yüzyıllar öncesinden kalmış bir çarşıda yürüyormuş hissine kapılabilirsiniz. İpek Yolu üzerindeki yerleşimlerden olan Diyarbakır’da tarihin izlerini taşıyan hanlar ünlüdür. Çiftehan, Yeni Han, Deliller Hanı ve Haşan Paşa Hanı mutlaka görülmesi gereken, eski günlerde olduğu gibi şimdi de gümüş işleyen usta ellere, halı ve kilim dokuyucularına rastlayacağınız hanlardır. Mardin Kapısı’na doğru ilerlediğinizde Peynirciler Çarşısı’na gelirsiniz. Çarşının girişindeki 7 4 SKYLIFE 3 /2 0 0 6

kahvehanede ya da otele dönüştürülmüş kervansarayın avlusunda içeceğiniz kahvenin kokusuna, Fırat’ın kokusu yoldaşlık edecektir... D oğu’nun çarşıları arasında en etkili ve masalsı güzelliklere sahip yerlerin başında Urfa Çarşısı gelir. Çarşının sokaklarını dolaşırken önünüze çıkan tarihi yapılar, hanlar, buradaki zanaatkârlar ve satılan her eşya, üzerlerine düşen ışık huzmeleri altında büyüleyicidirler. Çarşının sekiz kapalı çarşısı, bir de yeraltı çarşısı vardır. 1562’de yapılan Kazzaz Pazarı’ndaki ipekli dokumalar, işlemeli kumaşlar ve şallar, renkleriyle; Attar Pazarı kokularıyla sarar sizi. Kazancı Pazarı'ndaki çekiç sesleri, Demirci Pazarı'nda demiri eriten ateşin parlaklığı, Halıcı Pazarı’nda halı ve kilimler derken en ilginç yerlerden biri de Güvercin Pazarı'dır. Günün erken saatlerinde hararetli pazarlıkların yapıldığı bu pazarda güvercinlerin en güzellerini görebilirsiniz. Urfa Çarşısı'na geldiğinizde mezatı da mutlaka izleyin. Pazarların çoğunda eskiden olduğu gibi, mesleğini ortaya koyan fazla sayıda usta bulmak mümkün değil

khans. Even a lifetime vvould not suffice for pausing to chat with every master craftsman here. When you’ve made your way through ali the khans and go downstairs, you will come to the spice merchants’ market, and the cheesemakers. And this time your head will spin with the pungent scent of the spices. The Tahmis coffeehouse is one of the most delightful venues in the Gaziantep bazaar. When you've ordered your ‘Menengiç’ coffee and have started puffing on your hookah, it’s time to sit back and listen to the story of coffee. Just taking a seat in a corner of this coffeehouse, vvhich was built in 1640 during the reign of Sultan Murad IV, and breathing its air is enough to transport a person back into the recesses of time. And since you've come this far, don't forget to see the Tekke Mosque, built in 1638, vvhich stands adjacent to the coffeehouse. >

Midyatlı telkari ustasının elinde şekillenen incecik gümüş teller (üstte solda). Eskilerin gümüş takılarını Mardinli antikacılarda bulmanız mümkün (üstte sağda). Semercinin alın teri koluna bağladığı bez parçasında, kuvveti avcunun içinde (altta). Fine silver wire being vvrought into shape by a tiligree master from Midyat (above left). You can find old silver jewelry in the antique shops of Mardin (above right). The sweat of the saddler’s brow on the rag tied round his arm, and in his hand his strength (belovv).


inside

Intel Xeon™ İşlem ci ile ihtiyaç du yd u ğ u n u z an g ü v e n ilirlik Başka b ir ifadeyle, her zaman.

Intel® Xeon™ İşlemci tabanlı SI\IC Sunucular ile, kurumsal açıdan kritik bilgi işlem çözümlerinin yüksek bulunabilirlik seviyesine güven duyabilirsiniz.

CARDFİNANS

*

CARDFİNANS SAHİPLERİNE PEŞİN FİYATINA ( j 0 ( O 2 1 6 ) 528 01 İM

TAKSİT AVANTAJI

© 2003 Intel Corporation Tüm hakları saklıdır Intel. Intel İnside. Intel İnside logo. Intel Centrino. Intel Centrino logo. Intel Xeon, Intel SpeedStep. Itanium. Pentium ve Pentium III Xeon Intel Corporation tescilli markalarıdır

3 YIL YERİN D E GARANTİ


Işık huzmeleri Urfa Çarşısı’nda masal dünyası yaratıyor (üstte solda). Gümrük Han’ın asırlık ağaçları altında oturan Urfalı emekliler büyük bir dikkat ve heyecanla domino oynarlar (üstte sağda). Urfa Çarşısı'nda ahşap atölyeleri (altta). Rays of light slanting down from above create the fairy-tale world of the Urfa bazaar (above left). Sitting under the centuryold trees of the Gümrük Khan, Urfa retirees enjoy an engrossing game of dominoes (above right). The woodworking shops in the Urfa bazaar (belovv).

ne yazık ki. Koltukçu Pazarı, Pamukçu Pazarı, Çulcu Pazarı, Tenekeci Pazarı, Kasap Pazarı, Tütün Pazarı, Hüsniye Çarşıları, Kavafhanı Çarşısı da, Urfa Çarşısı’nda gezilmesi gereken yerler. Bu çarşılar, sadece Urfa’nın değil, bence tüm Doğu’nun en etkileyici mekânlarından biri olan Gümrük Han’ın etrafında toplanmışlardır. Yaklaşık 500 yıllık bu handa asırlık çınar ve dut ağaçları altında alçak taburelere oturmuş, dama ve domino oynayan Urfalılar, Doğu çarşılarına ait masalların birer parçası olarak yer edecek zihinlerinizde. Aynı mekânda bir bardak çay yudumlarken domino taşlarını kavrayan nasırlı eller, yerdeki taşları görmeye çalışan yaşlı gözler ve oyunu izleyen yüzlerdeki mimikler asla unutamayacağınız görüntüler arasında yer alacak... G E Ç M İŞ İ G ELECEĞE TAŞIYAN ELLER

Taşa şiirler yazan M ardin’in daracık sokaklarından çıkıp 76 SKYLIFE 3 /2 0 0 6

LIKE A FAIRY TALE: THE URFA BAZAAR

When you come to Diyarbakır's Sipahi Bazaar, you may have the illusion that you are strolling through a marketpiace left from centuries ago as you observe the feltmakers, clogmakers and saddlers at work. Diyarbakır, which was one of the cities on the historic Silk Road, is famous for its khans bearing traces of the past. The Çiftehan, Yeni Han, Deliller Hanı and Haşan Paşa Hanı are mustsees, khans where you will encounter weavers of carpets and kilims and the hands of masters deftly tooling silver, now just as in the old days. As you proceed to the Mardin gate, you will come to the cheesemakers ’ market. The scent of the Euphrates wiil accompany the aroma of the coffee you sip at the coffeehouse by the bazaar entrance or in the courtyard of the caravanserai that has been converted into a hotel. But among the markets of the East, it is the Urfa bazaar that surpasses them ali as a place of haunting, fairy-tale beauty. The historic buildings and khans

that appear before you as you stroil through the streets of this market, the artisans themselves and ali the items sold here are spellbinding in the rays of suniight slanting down from above. This market has eight covered bazaars and one underground bazaar. The silk textiles and embroidered fabrics and shawls will surround you with their colors and the herbalists’ market with its scents at the Kazzaz Bazaar, which was built in 1562. Besides the beating of the hammers in the cauldronmakers' bazaar, the glow of the fire for melting iron in the ironsmiths' bazaar, and the rugs and kilims of the carpetmakers’ bazaar, one of the most fascinating places here is the pigeon bazaar. You can see the most beautiful pigeons in the world here, where hard bargaining takes place in the early morning hours. When you come to the Urfa bazaar, don't miss the auction. İn most of the markets it is unfortunately impossible to find as many artisans practicing their trades as there were in the past. The bazaars of the t>


MASSIVE PROJECTS NEED MASSIVE EXPERIENCE Heavy Transports - Project Transports - Logistics Engineering - Customs Clearance & Consultancy - FTL/LTL Services

ilifllSIIU!

Light Rail and Metro Projects

>>>

We are not only experts at providing complete logistics of Refinery, Pipe Line and Metro Projects, but we are also the turn-key logistics solution provider for Cogeneration, Natural Gas, Thermic, Hydroelectric and Wind Povver Plants as well as Factory Investm ent and Renovation Projects. Our 40 years of experience, combined vvith a wide range of specialized transportation equipment, enable us to bring even the thoughest and most com plex projects to successful completion.

Phone: +90.312.231 71 50 Fax: +90.312.231 01 50

w w w .m a g d e n li.c o m .tr


çarşısına yöneldiniz mi, yüreğinize başka şiirler düşürür gördükleriniz. Sokulbakar Çarşısı’ndan başlayıp Bezzazlar’a; Sobacılar ve Kasaplar çarşılarını geçerek geldiğiniz Ulu Cami’den devam ederseniz, Dellallar Çarşısı’na; Kazancılar Çarşısı'na ve benim en sevdiğim yerlerden biri olan Bakırcılar Çarşısı'na gelirsiniz. Semerci, takunyacı ve tahta oymacılarının önünden geçtikten sonra, Bakırcılar'da bakır döven aksakallı dedeyi gördünüzmü mutlaka durun. Yaptığı işten nasıl keyif aldığını izleyin. Dayanamayacak ve 78 SKYLIFE 3 /2 0 0 6

konuşmaya başlayacaksınız. O size kendini anlatırken az ötedeki dükkânda torunu Yusuf’un cam altına Şahmeran resimleri yaptığını anlatacak. Yusuf’un yüreğindeki heyecan sizi de saracak, dedesini de... Bileceksiniz ki 15 yaşındaki bu delikanlı yaşadığı kentin, bölgenin tarihini, geçmişinin izlerini, kültürünü yıllar sonrasına taşıyacak ve dedesinin kopyası olacak. Şehrin içinden geçen ana caddenin üzerindeki antikacılarda saatlerinizi geçirebilirsiniz. Burada bulacağınız eski telkâri işlemelerinin nasıl yapıldığını görmek isterseniz, atölyelerden birine girin.

upholsterers, the cotton merchants, the cloth merchants, the tinsmiths and the butchers, the tobacco bazaar, the Hüsniye Bazaars, and the Kavafhanı Bazaar are other must-see places in the Urfa bazaar. These markets surround the Gümrük Khan, one of the most impressive buildings not only in Urfa but, to my mind, in the entire East. The Urfa natives who sit on iow stoois and piay checkers or dominoes under the muiberry trees and the century-oid piane tree in this 500-year-oid khan wiil ciing in your memory as one tiny aspect of the magic that permeates this space. And as you sip a giass of tea here, the caiioused hands that hoid the dominoes, the aged eyes that strain to see them on the ground and the expressions on the oid men's faces as they pursue the game wiil be >

Çuvallar dolusu bademleri kıran Mardinli esnaflar, kimini şekere bulayacak kiminin yağından sabun üretecekler (üstte solda). Nazardan koruyan üzerlikler; ister yakın ister asın (en üstte). Rengârenk yazmalar kadınların süsleri (üstte sağda). Cracking almonds by the sackful, the shopkeepers of Mardin use some of them for sugared almonds and extract the oil of others for making soap (above left). Decorations made of harmala seeds for vvarding off the evil eye; you can bum them, or hang them up (top). These gaily colored prints are wom by the local women (above right).


Senin odan, senin hayat覺n


Mardin Çarşısı'nda işinin ehli iki usta; dede bakır döverken, torun cam altına Şahmeran resimleri yapıyor (üstte). Günün keyfini bir bardak çayda ve fokurdattığı nargilesinde bulur Mardinli usta (altta). Two generations of master craftsmen in the Mardin Bazaar: vvhile grandfather is busy beating copper, grandson makes pictures of the legendary Serpent Oueen under glass (above). A Mardin master finds his daily pleasure in a glass of tea and a hookah (belovv).

80

İK Y l IFE 3 /2 0 0 6

O ateşin önünde uçuşan gümüş tozlara neler olduğunu, incecik gümüş tellerin nasıl kıvrılıp şekil aldığını göreceksiniz. D oğu’nun çarşılarını gezerken, ustalarından ya da babalarından öğrendikleri zanaatlarını yaşatmaya çalışan güzel insanlarla tanışacaksınız. Attıkları her ilmekte, vurdukları her çekiçte, mangala koydukları her mırra cezvesinde geleceğe geçmişi taşıyan güzel insanlarla...

among the unforgettable memories you take away with you... BRINGING THE PAST TO THE PRESENT

VVhen you leave the narrow lanes of Mardin, where poetry is vvritten on stone, and turn to the marketplace, you 'II be inspired with poetry yourself. If you start from the Sokulbakar Bazaar and continue on to the Great Mosque passing the Bezzazlar, stovemakers' and butchers’ markets on the way, you will come to the brokers bazaar, the boilermakers' bazaar, and, my favorite of ali, the coppersmiths' bazaar. Passing by the saddlers, the clogmakers and the wood carvers, be sure to stop when you see the hoary old man with a long beard pounding copper. Notice what pleasure he takes in his work. You won't be able to resist stopping to chat with him. As he telis you about himself, he will also describe the pictures of the ‘Şahmeran’ (a legendary serpent-queen who lived underground) under glass that

his grandson Yusuf makes in a nearby shop. Like his grandfather, you too wiii be fired with Yusuf's infectious enthusiasm. You wiii know that this 15-year-oid youth is going to preserve the history of the city and region where he iives, its culture and the traces of its past for years to come, becoming a true chip off the oid biock. You can spend hours as weii in the antique shops aiong the main avenue through the city. if you want to see how the oid fiiigree that you wiil find here was made, just step into one of the workshops to see what happens to the grains of siiver that dance before the fire and how the fine siiver wires are bent into shape. As you stroii through the markets of the East, you are going to meet wonderfui people who are struggiing to keep alive the crafts they iearned from their masters or fathers. VVonderful people who are transmitting the past to the future with every beat of the hammer, every carpet knot cast, and every Turkish coffee pot set to boil on the brazier. □


19 - 23 April

İstanbul Furniture Fair C

ONREXPO

İ STANBUL

s, r .

UT I M em ber

Yeşilköy 3 4 14 9 İstanbul, TURKEY Tel: + 9 0 (212) 4 6 5 7 4 7 5 Fax: + 9 0 (212) 4 6 5 7 4 7 6 - 7 7 www.itf-imob.com info@ itf-im ob.com This fair is organized with the petmission of The Union of Chambers and Commodify Exchanges of Turkey, in accordance with the law number 5 1 74

A S S O C IA T IO N OC T U R K İS H C U R N IT U R E M A N U P A C T U R E R S


TÜRKİYE Cm

Kustu;

MîlLETlHUtASI RAVACÎUS

FEDERASYONU »

{f .\JÜ

«*

i i t m

The story of Turkish aviation as told by postage stamps


eçm işte posta gönderilerinin üzerine yapıştırılan kimi pullar, bugün Türk havacılık tarihini yansıtan minik birer belge niteliğinde... The postage stamps that we used to stick on envelopes before mailing them document the history of Turkish aviation in miniature... U | 17 ^ 7 T U R G A Y T U N A

A

ldığınız mektupların veya kartpostalların üzerlerindeki pullara hiç dikkatlice baktınız mı? Zarflara yapıştırılan; kimi zaman bir kentten bir başka kente, kimi zaman da bir ülkeden bir başka ülkeye seyahat eden pullar üzerinde neler yok ki... Geldiği ülkenin para birimi, ne şekilde yönetildiği, ulusal günleri, coğrafyası, doğasında barındırdığı hayvan ve bitkileri, tarihi ören yerleri, anıtları, kostümleri ve daha pek çok şeyi sergiler posta pulları... Kısacası, bu cicili bicili küçük kâğıtlar,

ave you ever taken a close look at the stamps on the letters and postcards that arrive in your mailbox? These stamps, vvhich are stuck on envelopes and then travel from city to city, sometimes even from country to country, are a Virtual gold mine of information. The currency unit of their country of origin, its form of government, its geography, its endemic plants and animals, its historical ruins and monuments, and its national costumes are just a fevv of the things

H


Posta pullarında, Hezarfen Ahmed Çelebi'nin Galata Kulesi’nden Üsküdar’daki Doğancılar Meydanı’na uçuşunu gösteren temsili resimler (altta ve en altta). Stamps with scenes depicting Hezarfen Ahmed Çelebi's flight from the Galata Tower to Doğancılar Square at Üsküdar (below and bottom).

S S

S S

s

s s

s

s

s

*s

s

* i İW P

t ü r k İ ye C U M H U R İY E Tİ P O S T » l» H I

Türk Hava Kurumu’na ait bir planör göklerde süzülürken (en üstte sağda). Türk Hava Kurumu’nun bastırdığı yardım pulunda Eskişehir İnönü’deki Türk Kuşu Uçuş Pisti (üstte sağda). A Turkish Aviation Society glider gliding through the sky (top right). The 'Turkish Bird' Air Field at İnönü in Eskişehir province depicted on a special stamp issued by the Turkish Aviation Society for assistance (above right).

ait oldukları ülkelerin tarihini yansıtan minik birer belgesel doküman niteliği taşırlar. Biz de bu yazımızda, posta pulları üzerinde sergilenen Türk havacılık tarihini yansıtacağız.

XV. BÜYÜK KONGRE 5 .1 2 .1 9 5 7

EN H IZ LIS I 'HAVA P O S TA S I’

İlk kez 1840 yılında İngiltere’de kullanılır posta pulları. Bu tarihten 63 yıl sonra da, ‘uçak’ adını verdiği aygıtla göklerde dolaşmaya başlar insanoğlu. 17 Aralık 1903 tarihinde Amerika’da VVright Kardeşler tarafından motorlu uçakla gerçekleştirilen ilk uçuş, kısa bir süreç içinde öteki gelişmiş ülkelerin de bu alanda atılımlar gerçekleştirmelerini sağlar. Fransa, Almanya, İngiltere, İtalya gibi ülkeler ilk havacılık teşkilatlarını oluştururlar. Türklerde havacılık tarihinin, 17. yüzyılda kartal tüylerinden yaptığı kanatlarla Galata Kulesi’nden Üsküdar’daki Doğancılar Meydanı’na başarılı bir uçuş gerçekleştiren Hezarfen Ahmed Çelebi ile başladığı kabul edilir. Gerçek anlamda Türk havacılık tarihinin başlangıcı ise, 1911 yılıdır. Bu tarihte, dönemin Harbiye Nazırı Mahmut Şevket Paşa’nın girişimleriyle ilk uçaklar satın alınıp, Osmanlı Hava Kuvvetleri kurulur. Dönemin en yeni teknolojisiyle

2 0 KURUŞ

TÜRK

HAVA

KURUMU

HAVA

KURUMU

i

■SSm ImHİm iİ

TÜRK

stamps can teli us. İn short, these colorful liftle pieces of gummed paper are like miniature documents chronicling the history of their land of origin. Here we are going to teli the history of Turkish aviation as recorded on the country’s postage stamps. ‘AIR M A İL ’ IS

|------------

T ü r k i y e c u m h u r iy e t *

475 KUPUS

84 SKYLIFE 3 /2 0 0 6

THE FASTEST

Postage stamps were first used in England in 1840. And 63 years later man began to fly through the air in a contraption called the ‘airplane’. The first flight in an engine-powered plane, made by the VVright brothers in the United States on 17 December 1903, soon led to further initiatives in the field in the other advanced nations of

the world. Countries like England, France, Germany and Italy developed the first airline companies. Among the Turks, the history of aviation is regarded as having commenced with Hezarfen Ahmed Çelebi, who in the 17th century made the first flight from the Galata Tovver on the European side to Doğancılar Square at Üsküdar on the Asian shore of the Bosphorus on wings made of eagie feathers. But the beginning of aviation in the true sense of the word dates to 1911 when the first planes were purchased at the instigation of the then-VVar Minister, Mahmut Şevket Pasha, and the Ottoman Air Force was founded. Planes manufactured with the latest technology were


üretilen uçaklar satın alınır, pilotların yetiştirilmesine önem verilir ve yepyeni hava meydanları açılır... Dünya genelinde havacılık alanında tüm bu gelişmeler yaşanırken, uçaklar, ülke savunmasının yanı sıra bir başka görevi daha üstlenirler: ‘Posta taşıyıcılığı’ . Havacılık teşkilatlarını kuran ülkeler, bir yerden kilometrelerce uzaktaki bir başka yere gönderilen postaların ‘hızlı’ ulaşımını sağlamak için uçakları kullanmaya yönelirler. Ve böylece ‘hava postası' uygulaması başlatılmış olur. Model uçakçılık ile ilgili bir posta pulu (üstte). Atatürk, bir manevra sırasında Hava Kuvvetleri’ne ait uçakların geçişini izlerken (altta). A postage stamp with model airplanes (above). Atatürk watching a flyover by Turkish Air Force planes during a maneuver (belovv).

Eskişehir’deki Türk Kuşu tesislerinde yapılan gösterilerde Atatürk (sağda). Postadan geçmiş Atatürk resimli kartpostalın üzerinde yine Atatürk kompozisyonlu bir posta pulu var (altta sağda). Atatürk at an air shovv at the 'Turkish Bird' installation in Eskişehir (right). A cancelled Atatürk postage stamp on a postcard vvith a picture of Atatürk (belovv right).

İLK UÇAK POSTASI L E FK E -B İLE C İK A R A SIN D A

Dünyanın ilk resmi uçak postası, 18 Şubat 1911 tarihinde Hindistan’da taşınır. ‘Humber-Somm er’ tipi uçakla, altı bin mektup ve posta kartı Allahabad’dan alınarak beş mil uzaklıktaki Naini’ye götürülür. Türkiye'nin ilk uçak postası ise, 12 Şubat 1914 tarihinde, Pilot Yüzbaşı Nuri ve Gözlemci Yüzbaşı İsmail Hakkı beylerin kullandığı Prens Celaleddin adlı uçakla Lefke-Bilecik arasında taşınır. Normal posta ücretinden biraz daha yüksek tarifeli olan hava postası iletilerindeki pullarda; uçak, balon, zeplin ve kuş gibi

-v W W V W

bought, emphasis was put on training pilots to fly them, and new airports vvere opened right and left. VVhile similar developments in aviation vvere under way ali över the world, airplanes vvere also taking on a nevv responsibility beyond that of the national delense, namely ‘carrying the mail’. Countries that had founded airlines began using planes to ensure ‘speedy’ delivery of mail being sent from one place to another many kilometers away. And thus the phenomenon of ‘air mail' came into being.

T U R K E Y ’S FIRST AIR M AİL BETW EEN LEFKE AND B İLECİK

The vvorld's first official airmail vvas carried in India on 18 February 1911 vvhen some six thousand letters and postcards vvere transported by a 'HumberSommer'- type aircraft from Allahabad to Naini five miles avvay. The first airmail in Turkey traveled from Lefke to Bilecik on a plane called ‘Prens Celaleddin’, flovvn by pilot Captain Nuri and navigator Captain İsmail Hakkı on 12 February 1914. Planes, balloons, zeppelins and birds vvere the usual > 3 /2 0 0 6 SKYLIFE 85


Kaptanın seyir defterinden... YTL M ily o n

3 1 .1 2 .2 0 0 4

3 1 .1 2 .2 0 0 5

Artış

A ktif Büyüklüğü

8 .0 7 2

1 1 .9 7 6

%48

N akit Krediler

3 .2 1 4

6 .1 7 3

%92

G a yrin a kit Krediler

2 .4 9 6

3 .2 1 1

% 29

M evduat

5 .1 0 9

6 .9 8 0

% 37 %65

Dönem Karı

137

226

O zk a y n a k

873

1.091

%25

Serbest Serm aye

548

763

% 39

Sermaye Yeterlilik Rasyosu

% 1 7 .8 3

% 1 4 .6 9

Ort. O zkaynak Getirisi

% 18.61

% 2 3 .0 6

B a ğ ım s ız denetim kuruluşu ta ra fın d a n d en etlen m iş, BDDK ta r a fın d a n y a y ın la n a n M U Y 'n e u yg u n o la r a k h az ırla n m ış k o n so lid e ra k a m la rd ır.

C Q ) zorlu


D e n iz B a n k ... D ü n y a n ın , ö z k a y n a k la r ı en h ız lı b ü yü yen 8 . bankası* Ülke ekonomisinin finansmanı amacıyla uluslararası piyasalardan 3,4 milyar YTL kaynak sağladı. Türk ekonomisinin temel taşı küçük ve orta ölçekli işletmelerimize turuncu destek; 120.000 işletmeye 1,6 milyar YTL kredi desteği sundu.

1$ Tarım işletmelerimize bereket habercisi oldu; 250 milyon YTL kredi desteği ile 40.000 üreticimizin yüzü güldü. Toplam kredileri %64 büyüdü; denizcilik, turizm, enerji, sağlık, eğitim ve özelleştirme projeleri başta olmak üzere ülke ekonomisinde önemli yeri olan sektörlere kredi desteği sağladı. 246 şubesiyle hizmet verdiği bireysel müşteri sayısı 1 milyon 400 bini aştı. -0 - Lufthansa Hava Yolları'nın resmi mil programı olan Miles & More ile Türkiye kredi kartı pazarına DenizBank Miles & More Visa kartını sundu. DenizYatırım, EkspresYatırım ile birlikte, toplam 43,5 milyar YTL işlem hacmi ile 107 aracı kurum arasında son 3 yıldır sahip olduğu birinciliği bu yıl da kimseye kaptırmadı. Avusturya'daki iştiraki DenizBank AG'nin bilanço büyüklüğü 1 milyar ABD $'nı geçti. ■DenizLeasing, %139 artışla sektörün işlem hacminde en hızlı büyüyen şirketi oldu. * The Banker Dergisi Temmuz 2005 sayısında açıklanan "Dünyanın En iyi Bankaları" listesinde, 1. kuşak sermaye ve aktif artışına göre 222 basamak yukarı çıkarak dünyanın en hızlı büyüyen 8. bankası oldu.

Şimdi yeniden tam yol ileri!

Hakan ATEŞ

DenizBank^ F İ N A N S A L HİZMETLER GRUBU

w w w .denizbank.com 444 O 800


Dünyanın ilk kadın askeri pilotu Sabiha Gökçen (üstte). 1914’te ilk Türk Uçak Postası’nı taşıyan ‘Prens Celaleddin’ adlı Deperdussin TT tipi uçak (üstte sağda) ve bu postanın damgası (sağda). The world's first vvoman pilot, Sabiha Gökçen (above). ‘Prens Celaleddin', the Deperdussin TT type aircraft that carried Turkey’s first air mail in 1914 (top right) and the stamp commemorating it (above right).

t Ork

KAVA KUVVETLER» 1911-1*71

200 KURUŞ

x "v v

88 SKYLIFE 3 /2 0 0 6

temalar kullanılır genelde, insanları cezbeden uçma eylemi, hava posta taşımacılığının başlamasıyla birlikte, pul toplayan koleksiyonerlerin de büyük ilgisini çeker. Kısa bir süre sonra da ‘filateli’ olarak da adlandırılan pul koleksiyonculuğunda ‘aerofilateli’ adı verilen bir dal ortaya çıkar. Üzerinde havacılık temasının bulunduğu ilk resmi uçak posta pulu, 1917 yılında, İtalya Posta idaresi tarafından, Torino-Roma deneme uçuşu anısına bastırılır. Bunları diğer ülkelerin çıkardığı pullar izler ve hava postası adı verilen uçak pullarının çıkartılması günümüze dek devam eder.

nJİV

C U M H U * îT m

TÜ R K HAVA Y O L L A R I’NIN İLK SEFERLERİ A N IS IN A ...

Türkiye’de tedavüle çıkartılan ilk uçak posta pulları, 1934 yılında Devlet Hava Yolları’nın gerçekleştirdiği istanbulAnkara seferi nedeniyle hazırlanan Birinci Uçak Serisi’dir. Beş pulluk bu seri, aslında 1930 yılında çıkartılan 22 parçalık posta serisinden arta kalan parçalar üzerine yapılan uçak resmi ve yeni ücret şeklindeki sürşarjlardan oluşur. Üzerinde uçak teması bulunan ilk seri ise,

İ1 K U Ç A K POSTASI - 1 9 1 4 ____ |

themes appearing on the stamps used for air mail letters, vvhich cost slightly more than normal postage rates. With the introduction of air mail, the captivating notion of flight began to draw the attention of stamp collectors as well, and vvithin a short time a nevv branch of philately emerged knovvn as ‘aerophilately’. The first official postage stamp on the aviation theme vvas issued in 1917 by the Italian Postal Service to commemorate a test flight betvveen Rome and Turin. This vvas follovved by issues of more stamps in other countries, and the issuing of air mail stamps continues to this day.

İN M E M O R Y OF THE FIR ST T U R K İS H A IR LIN ES FLİG HTS

The first air mail stamps issued in Turkey are the ‘First Airplane Series brought out to coincide vvith the Istanbul-Ankara flight made by the State Airline in 1934. This series of five stamps consists of a picture of an airplane and a price surcharge printed on some stamps remaining from a 22-stamp series actually issued in 1930. But the original series on the theme of aviation is a four-stamp series printed for the Türk Tayyare Cemiyeti (Turkish Aviation Society), or Türk Hava Kurumu as it is knovvn today. These stamps, vvhich vvere either affixed to C>


TOPLU UPHILL COURT B H E

TOKİ iştiraki Emlak GYO A.ş. Kaynak Geliştirme Uygulamaları Kapsamında Yapılmaktadır.

İstanbul’un s s yükselen değeri!

ne kadar yüksek! Peki, ya beklentileriniz?

Şimdi İstanbul’un

yükselen değeri

Uphill Court’ta hayalleriniz kadar yüksek bir yaşam başlıyor! Gelin, siz de bu yüksek standartta yerinizi alın!

Hadi, yükselin!

Batı Ataşehir0 2 1 6 4 4 4 0 ▼

VARYAP V A R L I

E M L A K G Y O A .Ş . T .C. Başbakanlık TOKİ İştirakidir.

2 5 5 www.uphillcourt.com

O

R

T

A

K

COURT

<|| TEKNİK YAPI

B A Ş L A R

G

İ

R

İ

Ş

..................... .

İ

“Gözümüz yükseklerde!”


1926 yılında Türk Tayyare Cemiyeti, günümüzdeki adıyla Türk Hava Kurumu için bastırılan dört pulluk yardım pullarıdır. Milli bayramlar gibi özel günlerde mektupların üzerindeki normal posta pullarının yanına yapıştırılan, ayrıca tapu belgelerinden noterlik kağıtlara kadar birçok resmi evrak üzerinde kullanılan bu pullar, ’aerofilateli' koleksiyonlarında önemli bir yer oluşturur. 1926 yılından bu yana Türkiye’de gerek posta, gerekse Türk Hava Kurumu pulları olmak üzere havacılıkla ilgili 140 kadar pul çıkarılır, bunun yanı sıra, çoğunluğu Türk Hava Yolları’nın ilk sefer uçuşları anısına elliden fazla özel filatelik damga da kullanılır. Bunlardan birçoğu hava postasında kullanılırken bir kısmı da Sivil Havacılık etkinliklerinden hava sporlarının tanıtımına dek, geniş bir yelpaze içinde yer alan anma pulları olarak basılır. İlk özel filatelik damga da, Devlet Hava Yolları’nın 1 Temmuz 1933 tarihinde gerçekleştirmiş olduğu,

1937’de tedavüle çıkarılan İkinci Uçak Posta Serisi (üstte). 1914’te gerçekleştirilen Türk havacılık tarihinin ilk uzun uçuş denemesinin kahramanları Fethi, Sadık, Nuri ve İsmail Hakkı beylerin anma pulları üzerinde yer alan portreleri (altta). The Second Airplane Stamp Series, issued in 1937 (above). Commemorative stamps with portraits of Fethi, Sadık, Nuri and İsmail Hakkı, the heroes of the first long-range flight in the history of Turkish aviation, made in 1914 (below).

envelopes atongside normal postage stamps on special occasions like national holidays or used as revenue stamps on a broad array of official papers from ownership deeds to notarized documents, occupy an important place in ‘aerophilately’ collections. Some 140 stamps on the aviation theme have been issued in Turkey since 1926 either as postage stamps or as Turkish Aviation Society stamps. Furthermore, more than fifty special philatelic stamps, most of them commemorating inaugural flights by Turkish Airlines, are also in use today. VVhile many of these are used for air mail, several vvere also printed as commemorative stamps for a wide range of occasions from key events in civil aviation to the promotion of air sports. The original special philatelic stamp vvas issued around the time of the first IstanbulRome flight, undertaken by the State Airline on 1 July 1933. Letters sent vvith these first flight stamps are therefore some of the most rare >

TÜ R K İY E C L’M H U R İY E I|

450.000

J y e c u m iV r iy l t

RKİYF.CUJ

300.000 90 SKVLIFE 3 /2 0 0 6

1935’te İstanbul'da yapılan Uluslararası Kadın Kongresi'nin anısına basılan anma pullanndan biri (üstte ortada). 1950'de tedavüle çıkartılan uçak posta pulunda, İstanbul Boğazı üzerinden geçen Türk yolcu uçağı (sağda). One of the commemorative stamps printed in honor of the International VVomen's Congress, held in İstanbul in 1935 (above çenter). A Turkish passenger plane flying över the Bosphorus, on a postage stamp issued in the 1950s (above).

İM m KURUM 8 ! . BÜYÜK KONGRESİ *

KURU}

X II- C0 NCRİS SUmUCISTE MTERNAIKNUL, İSTANBUL »M

t

r\ '

+

n r J\ /

T U B K I Y E C U M M U P fY E T l PO STALARI


fle xica rd .co m .tr g a ra n ti.c o m .tr 444 O 333 A lo G aranti

G aranti

G a ra n ti'd e n in a n ılm a z esnek b ir k re d i k a rtı. H er is te d iğ in iz şekle g iriy o r, size g ö re esniyor; adı ü s tü n d e Flexi C ard...

A r tık k re d i k a rtın ız ın fa iz o ra n ın a siz k a ra r v e re b ilirs in iz . H an g i m ağazada, ne ka d a r ta k s it im k â n ı sunacağına da. N erede, ne k a d a r b o n u s k a z a n d ıra ca ğ ın a d a !

Sizin için taksit mi önemli? O zaman bol taksitli bir Flexi Card seçin. Ya da taksit yerine bol bol bonus kazanmayı mı tercih ediyorsunuz? Öyleyse sizin Flexi'niz, bol bonuslu olsun.

ister flexicard.com .tr'yi tıklayarak kendi Flexi Card'ımzı kendiniz oluşturun, ister hazır Flexi seçeneklerinden birine karar verin

Yeni Flexi Card'ımzı, flexi günlerde kullanın.

A yrıca 5 0 'n in ü s tü n d e Flexi Card ta s a rım ın d a n is te d iğ in iz i s e ç e b ilirsin iz. Y ok, "B e n d a h a da fle x i o lm a k is tiy o ru m " d iy o rs a n ız , k e n d i k a rtın ız ı k e n d in iz ta s a rla y ın .

Taksitine, faizine, bonusuna, hatta şekline bile, sizin karar verdiğiniz ilk kredi kartı: Flexi Card.


Istanbul-Roma arasında yapılan ilk uçuş sırasında kullanılır. İlk uçuş damgalarıyla gönderilmiş mektuplar, günümüzde nadir ve değerli filatelik belgeler arasında yer almaktadır. Havacılık temalı Türk posta pulları üzerindeki kompozisyonlarda, Hezarfen Ahmed Çelebi’nin kartal kanatlarıyla gerçekleştirmiş olduğu ilk uçuştan Türk Hava Kuvvetleri ve Türk Hava Yolları’nda kullanılmış değişik tipteki uçaklara; Hava Kurumu'nun spor etkinliklerinden hava meydanlarına, havacılık kongrelerinden Hava Akrobasi Timi’ne dek Türk havacılık tarihi ile ilgili pek çok detay yansıtılmakta, kimi pulların üzerinde de uçmanın sembolü ‘kuş’ kompozisyonları yer almaktadır. İşte bu pullara bakarak havacılıkta kaydedilmiş olan gelişim konusunda bilgi sahibi olmak mümkün. Hava taşımacılığının git gide yaygınlaşması ve teknolojinin getirdiği süpersonik (sesten hızlı) uçakların kullanımıyla, artık birçok ülkenin postalarında mektup türü gönderiler için normal ya da uçak tercihi gibi bir ayrım kalmadı. Dolayısıyla, özel uçak posta pullarının azalmasıyla, bu tür pullar artık sadece koleksiyonlarda yaşıyor. Ama havacılık ve uzay temalı pullar ne mutlu ki her zaman var olmaya devam edecek...

T Ü R K İ Y E POSTALAR? 1926’da Türk Tayyare Cemiyeti tarafından çıkarılan yardım pulları, Türkiye’nin havacılık temalı ilk pullarıdır (en üstte). 1949’da Devlet Hava Yolları’nda kullanılan uçaklardan örnekler (üstte). Cumhuriyet Türkiyesi’nin ilk uçak posta pulları, 15 Ağustos 1934’te çıkartılmıştı (altta). The special stamps issued by the Turkish Aviation Society in 1926 to raise money are Turkey's first stamps on the theme of aviation (top). Examples of the planes used by the State Airline in 1949 (above). The first postage stamps of the Republic of Turkey were issued on 15 August 1934 (below).

and valuable collectors’ items annong philatelists today. Turkish postage stamps on the aviation theme document a host of detaiis about the history of Turkish aviation, from Hezarfen Ahmed Çelebi’s first flight on eagle ’s wings and the various types of aircraft used by the Turkish Air Force and Turkish Airlines to aviation conventions, the sports activities of the Aviation Society and the Air Acrobatics Team. Stili others display compositions involving birds, those guintessentiai symbois of

flight. Indeed, these stamps constitute a veritable history of the development of aviation. With the continuous spread of air transport and the use of hi-tech supersonic planes today, any distinction betvveen regular mail and air mail has iong since become a thing of the past in many countries. The consequent decline in special air mail stamps means that they iive on only in collections. Happily however stamps on the themes of aviation and outer space will alvvays be with us. □

ir T İ İ R H İ V I T V . ; C U m H U R İT C T I | t.

92 SKYLIFE 3 /2 0 0 6


b n

l t f

u t h e

ç f h

a

n jin

h s

a

c &

h

e

r p e t

k

İs

m

s

i k

is

s

!

ir t g

!

ÖZGÜN

o

i r

A L F E M

O*

satış n o k ta la rın d a

www.carpe.iand.com t,

C

^

r

p

e

't i^

d

D ü n y a n ı n h a lıs ı. H a l ın ın d ü n y a s ı.


GELENEKSEL TRADITIONAL


Bir çocukluk masalı / A childhood tale

Gaz lambaları Kerosene lamps Günümüzde sadece nostaljik bir obje haline gelen gaz lambaları, pek çoğum uzun çocukluk gecelerinin yareni; anılara saklanan eski bir dostudur. Little more than nostalgic knick-knacks today, kerosene lamps are the erstvvhile companions of our childhood nights, old friends imbued vvith pleasant memories.

E

YEŞİM GÖKÇE

ski çocukların, eski gecelerinden kalma bir anıdır idare lambaları ya da yaygın adıyla 'gaz lambaları’ . Evin annesi, dadısı veya hizmetçisi, geceleri çocuklara bakmak için uyandığında, yollarını bulmalarını sağlayan, evleri aydınlatan, uyuyanların başuçlarında en azından ‘idareten’ bir aydınlık veren gaz lambaları, günümüzde daha çok süs veya koleksiyon amaçlı olarak kullanılıyor. Gaz lambalarının ilk ortaya çıkışı, 18. yüzyılın başlarına denk gelir. Yassılaştırılmış bir fitili gaz tankının içinden geçirerek, en üste ise koruyucu bir şişe ekleyerek gaz lambalarına ilk formunu İsviçre vatandaşı Argand vermiştir. Tabii, 1775’te Leger ve Alstroemer tarafından ayrı ayrı bulunan yassı fitilin de, bu buluşun ortaya çıkmasına katkısı büyüktür. Türkiye’de ise, 1800’lü yılların sonlarına doğru ev, dükkân ve kahvehanelerde gaz lambaları ile aydınlatma yapıldığını biliyoruz. Kudret

oryesterday's childrerı, kerosene lamps, or ‘gas lamps ’ as they are commonly knovvn, are a nostalgic reminder of nights in the old days. These lamps that Ut the way for mothers, nannies or servants rising in the night to look after a child, that illumined homes or provided at least a modicum of light at the bedside of a sleeping person are either used decoratively or vvind up in collections today. Kerosene lamps made their first appearance at the beginning of the 18th century vvhen a Svviss by the name of Argand gave them their original form by passing a Hat vvick through a fuel tank and adding a chimney on top to protect the flame from vvind. The flat vvick, vvhich vvas invented independently by Leger and Alstroemer in 1775, made a majör contribution of course to the invention of the lamp. We knovv that kerosene lamps vvere used as lighting in homes, shops

F

DOLMABAHÇE PALACE ARCHIVE

Dolmabahçe Sarayı'nın eşsiz koleksiyonları arasında gaz lambaları da bulunuyor. Bunlardan iki örnek (solda ve üstte). Two examples of kerosene lamps from peerless collections of Dolmabahçe Palace (left and above).


‘Iran işi’ adı verilen, eski havası verilmiş gaz lambaları (sağda). Kerosene lamps fashioned in the old style known as ‘Iran work’ (right).

Adalet Ağaoğlu koleksiyonundan renkli ve desenli cam üzerine, şişe camı kalınlaştırılmış bir gaz lambası (üstte). A kerosene lamp with a chimney of thick glass över a tank of colorful, decorative glass, from the colleotion of Adalet Ağaoğlu (above).

96 8KYLIFE 3 /2 0 0 6

Emiroğlu'nun ‘Gündelik Hayatımızın Tarihi' başlıklı eserinden de, 1900’lü yılların ortalarında Türkiye’de beş milyona yakın gaz lambası tankı ve şişesi üretildiğini öğreniyoruz. Ancak bu tarihlerde üretimine devam edilen bir diğer gaz lambası çeşidi daha vardı. Bunlar şişesi olmayan, ancak yine gaz yardımı ile ateşlenen lambalardı. Bu tip lambalar, içine gaz konulan bir tanktan, fitilin dışarı uzanmasına yarayan delik veya deliklerden oluşur ve daha çok ‘kandil’ adıyla anılırdı. Gaz lambaları beş parçadan oluşur. En altta küçük bir gaz tankı, hemen üzerine eklenmiş bir gaz ayar çarkı, çarkı da içine alan gaz deposu, çarkın içinden geçerek şişenin içine giren bir fitil ve en üstte, alevi koruyacak ince ve kırılgan gaz lambası şişesi. Aslında gaz lambaları ile ilgili en önemli ayrıntılardan birisi de bu şişelerdir... Çünkü bir gaz lambasının şişesini değiştirmek veya yenilemek lambanın orijinalliğini bozacaktır. C ILIZ IŞIĞA Ö DENEN BORÇ...

Gaz lambaları konusunu; hem yazar kimliği ile önemli başarılara imza atan, hem de yıllardır Türkiye’nin ve dünyanın çeşitli ülkelerinden gaz lambaları toplayan Adalet Ağaoğlu ile görüştük. Ağaoğlu, gaz lambalarını biriktirmeye nasıl başladığını şöyle anlattı:

and coffeehouses in Turkey towards the end of the 1800s. From Kudret Emiroğlu's book, ‘A History of Everyday Life in Turkey', we also iearn that ciose to five million kerosene lamp tanks and glass chimneys were produced in the country in the mid-1900s. There was also another type of kerosene lamp that continued to be produced at that time, namely, a lamp that had no chimney but nevertheless burned kerosene. Lamps of this type consisted of a fuel tank and a hole or holes from which the wick extended. Such lamps are more commonly known as ‘kandil’ or oil lamps. Kerosene lamps consist of five parts. A small fuel tank at the bottom, the burner, to whose collar a small knob is attached for adjusting the kerosene, and a wick that extends through the collar and into a chimney made of

delicate glass that sits on top to protect the flame from wind. Indeed, these chimneys are one of the most important details of kerosene lamps. For changing or replacing a lamp's chimney destroys its authenticity. PAYING OFF A DEBT TO THEİR DIM LIGHT

I asked the celebrated Turkish novelist Adalet Ağaoğlu about kerosene lamps since she has been collecting them for years both in Turkey and from other countries around the vvorld. Ağaoğlu explained how she got started collecting the lamps: “As a person who lacks a strong proprietary sense, I somehow felt protective of this small, grimy thing without a chimney that had long since failen out of favor. Ever since that day it was as if I wanted to pay off a debt I felt I ov/ed to its dim yellovv


DOLMABAHÇE PALACE ARCHIVE

“Sahiplik duygusu hiç gelişmemiş olan ben, çoktan gözden düşmüş bu şişesiz, kirli küçük şeye sahip çıktım. O günden başlayarak da, çocukluk gecelerimde beni hiç yalnız bırakmamış, sonuçta gölgeleriyle de dostluk kurduğum bu cılız ışığa borcumu ödemek istedim sanki. Nerede, hangi biçimini görsem, eski bir dostuma rastlamışım gibi, evime buyur ediyordum. Ama her birinin ya başı gitmiş, ya kolu kopmuştu. Yarım karış boyundaki şişeleri, yuvarlakları, ince uzunlarıyla yok olmuştu. O şişeler... Sırçadan, kolaycacık kırılır şeyler...” Ağaoğlu’na, gaz lambalarını toplayarak bir koleksiyon kurgulamakla, kelimeleri ve anıları toplayarak öyküleri kurgulamak arasında bir bağ olup olmadığını sorduğumuzdaysa şu cevabı verdi: “Kendi adıma gaz lambaları ile ilgilenmek ile yazarlık arasındaki bağın kaynağının, romanda yapmaya çalıştığım 'zamanla oynamak’ ile ilgili olduğunu düşünüyorum. Bu, benim tiyatro yazarlığından roman yazarlığına geçişimin nedeni aslında. Gaz lambalarının görünmeyeni aydınlatması gibi, romanda görünmeyen, o ana ait olmayan zamanın aydınlatılması, zamanla oynanması arasında bir benzerlikten, bir bağdan söz edebiliriz. Gaz lambaları nasıl ki

Porselen lambanın üzeri bitkisel motifler ve kuş figürleri ile süslü, Dolmabahçe Sarayı koleksiyonu (solda). A. Ağaoğlu koleksiyonunun en renkli parçalarından biri, büyük boy gaz lambası (sağda). A porcelain lamp deoorated vvith vegetal motifs and birds, Dolmabahçe Palace collection (left). A large kerosene lamp, one of the most colorful pieces in A. Ağaoğlu's collection (right).

light, vvhich never deserted me on my childhood nights and vvith whose shadovvs I had in the end forged a friendship. Wherever I saw one, vvhatever its shape, I feit as if I had stumbled upon an old friend, so I invited it into my home. But every one of them had something wrong vvith it or vvas missing some part. Ali those different chimneys— large, small, cylindrical—had been broken. Such fragile little things...” I asked Ağaoğlu if there vvas any connection betvveen putting together a collection of kerosene lamps and putting together a story vvith vvords and memories: "İn my case I think that the connection

betvveen vvriting and being interested in kerosene lamps has to do vvith the 'playing vvith time’ that one does in a novel. İn fact, that's the reason why I svvitched from being a playvvright to being a novelist. We might speak of a connection, a similarity, betvveen playing vvith time— illuminating the time that is invisible in the novel, the time that does not belong to that particular moment—and the vvay that kerosene lamps illuminate what we othervvise vvould not be able to see. Just as kerosene lamps light up the darkness, albeit only a small patch of it, so does a novel make it possible to play vvith time, through flashbacks for example. t> 3 /2 0 0 6 SKYLIFE 97


Yeni nesil Toyota RAV4. Entegre Aktif Sürüş Sistemi ile. £ M <4^scV .......

ENTEGRE AKTİF SÜRÜŞ SİSTEMİ

Yeni Toyota RAV4, sınıfında bir ilk olan Entegre Aktif Sürüş Sistemi (İADS) ile rakipsiz. Aktif Tork Kontrollü 4WD Sistemi, Elektronik Kontrollü Direksiyon Sistemi (EMPS) ve Araç Denge Kontrol Sistemi'nin (VSC) bütünleşmesiyle oluşturulan Entegre Aktif Sürüş Sistemi en zorlu koşullarda daha fazla kontrol ve performans

TOYOTA 0 ©

sağlıyor. 152 PS benzinli, 136 PS dizel motor seçenekleri ve benzersiz iç kabin teknolojisiyle şimdiye kadar üretilen en lüks RAV4 ile tanışmaya hazır mısınız? Bu deneyimi mutlaka yaşayın ve RAV4'ün ne kadar heyecan verici olduğunu gözlerinizle görün... Yeni Toyota RAV4, şimdi Toyota Plazalarda.

Toyota iletişim Merkezi: (0212) 354 0 354


www.toyotasa.com.tr

TODAY TOMORROVV TOYOTA


karanlığı aydınlata b iliyo r,

«L «

W

X

M etal gaz lambası (üstte) ile renkli cam üzerine, şişesi alev çatlamalarına karşı korunaklı gaz lambası (altta), A. Ağaoğlu koleksiyonundan... A metal kerosene lamp (above) and a kerosene lamp of colored glass with a chimney protected against shattering (below). From the collection of A. Ağaoğlu.

100 SKYLIFE 3 /2 0 0 6

karanlıkta küçük bir alan açabiliyorsa, roman da zamanla oynamalara, geri dönüşleri aktarmaya alan tanıyordu. Kurgu yapmak konusuna gelince; gaz lambalarını toplamaktaki sıkıntılardan birisi de, çoğu zaman gaz lambalarının şişe kısımlarının kırılmış olmasından kaynaklanıyordu. Bunun için yıllardır pek çok yere gidip, tanklara uygun şişe aradım; hatta lambalar üzerine kitaplara bakındım, kendi dönemlerine göre şişesinin ne olduğunu bulabilmek için. Ancak neticede gaz lambalarının tarihini gösterecek bir eser bulamadım. Kaynak bulamayınca da, ağız numaralarına dikkat ederek kendim bazı birleştirmeler yaptım. Hayalimde canlandırarak uygun tanklar ile şişeleri birleştirmeye çalıştım. Gaz lambaları biçimlenebilsin, birbirine uyabilsin, hakiki olabilsin diye. İşte ben o şişe uydurma bahsinde biraz yazarlık ettim, biraz uydurmalık ettim...” KALANAG’IN SİHİRLİ LAMBASI

Gaz lambalarının ‘aydınlatma’ ve ‘yol gösterme’ işlevi, günümüzde bir hayli değişmiştir. Onlar artık, seri üretimle çoğaltılan örnekleriyle, sadece tüketime yönelik bir obje haline gelmiştir. Bu çağrışım değerlerinin değişmesi ile birlikte, Adalet Ağaoğlu da, kim bilir hangi evlerde, hangi anılara şahit olmuş bu birbirinden değerli gaz lambalarını toplamayı bırakmıştır. Ancak yine de gaz lambalarına birçok yerde rastlamak mümkün. Örneğin, Dolmabahçe Sarayı’nda... Daha çok süs amaçlı kullanılmış, eşsiz güzellikte pek çok paha biçilmez gaz lambası bulunuyor sarayda. Gaz lambalarına rastladığımız bir başka yer ise, illüzyon sanatı... 20. yüzyılın önemli sihirbazlarından Kalanag (asıl adıyla Helmut Ewald Schreiber),

As for the connection with inventing a plot, one of the main problems with collecting kerosene lamps was that most of the time their chimneys were broken. So I had to go to a lot of places to find chimneys to fit the burners. I even consulted books about lamps in order to find chimneys authentic to the period. But in the end I couldn 't find a single book that gave a history of kerosene lamps. So, at that point I started paying attention to the diameters of the collars of the burners and did some experimenting myself. I tried to imagine how certain tanks and chimneys would look together. İt was then that I tapped in to my vvriterly side and did a little ‘inventing. KALANAG’S M AG IC LAMP

The job of kerosene lamps to ‘lluminate’ or ‘light the way’

has changed considerably today when they have degenerated into mere mass-produced items of consumption. And with this change in vaiues, Adalet Ağaoğlu too has given up collecting these unique lamps, each one different from ali the others, that once vvitnessed so many of life's moments in so many different homes. But it is stili possible to come across kerosene lamps in a number of places. İn Dolmabahçe Palace, for example, vvhich has many priceless ones of unmatched beauty that were used more for decoration. Another context in vvhich we encounter kerosene lamps is in the art of illusion. Kalanag (his real name was Helmut Ewald Schreiber), one of the most famous magicians of the 20th century, used kerosene lamps in his performances, in one >


Hem hayatınız, hem yatırımınız "artı" değer kazanabilir mi? Sorun, bilgi alın, karşılaştırın... ' ■" w »

Alacağınız ev güvenli, planlı gelişen bir bölgede mi?

^

Mimarisiyle, çevresiyle, sosyal olanaklarıyla üstün bir kalite düzeyine sahip mi?

Deneyimli, başarısını her projesiyle kanıtlamış bir "markanın" eseri mi?

B ütün bu so ru ları "E v e t" diye c e v a p la y a b ile c e ğ in iz bir s e ç e n e k var: Is ta n b u lB is . Sizi her gün ku tlam aya değer bir yatırım kararı alm aya da vet ediyoruz: Akılcı fiy a tla r ve 2 4 0 aya v a ra n cazip YTL ve dö viz kred isi s e ç e n e k le riy le Istan b u lB is sizi b e kliy o r. H e n ü z bu ö n e m li e s e rd e ye r a lm a fır s a tın ız v a rk e n g e c ik m e d e n , bu g ü n ara y ın .

bis G

Ö

K

T

Ü

R

K

Satış Ofisi: İstanbul İstanbul. Göktürk Beldesi. İstanbul Cad. Kemerburgaz 3 4 0 7 5 İstanbul Tel: (0 2 1 2 ) 3 2 2 0 2 0 2 pbx Faks: (0 2 1 2 ) 3 2 2 0 2 0 6 w w w .is ta n b u lb is .c o m

Y a p ı K redi K oray, uluslararası profesyonellerce ödüllendirilen değerli projeler yaratır. Gücü, deneyimi ve yönlendirici duruşuyla; Türkiye gayrimenkul sektöründe öncülük misyonunu taşır. 2001 Elit Residence, MIPIM Avvards Finalisti 20 02 İstanbul İstanbul, MIPIM Avvards Dünya Birincisi 2003 ULI Avvards for Excellence Finalisti 2003 Türkiye CRM Oskarı Sahibi 20 05 Türkiye'nin En Gözde Gayrimenkul Kuruluşu. w w w .y a p ik re d ik o ra y .c o m

Ya pi K r e d İ Ko r a y GAYRİMENKUL

YATIRIM

ORTAKLIĞI

AŞ.


illüzyon gösterileri sırasında gaz lambalarını kullanmıştır. Ünlü illüzyonist, sıkça tekrarladığı bir gösterisinde gaz lambasını şu şekilde kullanmıştır: Kalanag, sahneye getirilen gaz lambasının fitilini tutuşturur, sigarasını da lambanın aleviyle yakar. Lambayı camdan yapılmış sehpanın üstüne koyar; lambanın üstüne ise ortası delikli, ince bir ipekli örtü örter. Lambanın camını da bu delikten dışarı çıkacak şekilde açıkta bırakır. Kalanag, lamba ile seyircilere iyice yaklaşır ve örtüyü hızla kaldırır. Örtünün kalkması ile birlikte lamba yok olur. Kalanag, gösterinin sonunda elinde kalan örtüyü seyircilere fırlatır. Aslında bu gösteri, gaz lambalarının ışığından duvarlara yansıyan gölgeler ile yaptığı masum illüzyon gösterilerini çağrıştırmakta, sihirlere ve masallara hayretler içerisinde inandığımız o geçmişteki günlerden kalma hoş anılara bir gönderme yapmaktadır. Peki gaz lambalarını bu kadar

özel ve unutulmaz kılan nedir? Sadece görünmeyeni aydınlatması mı, yoksa kendiliğinden anılarımıza kattığı hüzün mü? Gaz tankına yeterli miktarda gaz konulur, çarkın yardımı ile fitil bir miktar yukarı çekilir ve ateşlenir. Alevin ani sıcaklığı ile patlamaması için önceden elde ısıtılmış şişe, çarkın üstüne geçirilir ve gaz lambasının aydınlığında gece başlar. Çocukluğumuzdan geriye kalan anıları, zayıf ışığı ile belli belirsiz aydınlatan gaz lambalarının gecesi... Sofrayı aydınlatan, merdivenli ahşap evlerin basamaklarını aydınlatan, masal anlatıcısının yüzünü aydınlatan gaz lambalarının duvarlarda yaptığı gölge oyunları ile devam eder gece... Gaz lambalarının titrek ışığı, aklımızda artık belli belirsiz yer eden çocukluğumuzu çağrıştırır. Şişelerinin kırılganlığı ise hüznü... Tıpkı yitirdiğimiz anılarımızın çağrıştırdığı hüzünler gibi...

Eski gelinlerin çeyizlerinden kalma, gaz tankı camdan bir gaz lambası (solda). Gaz tankı seramikten, tümüyle orijinal bir gaz lambası (üstte). A kerosene lamp with a fuel tank made of glass, once part of a bride's trousseau (left). An authentic kerosene lamp with a ceramic fuel tank (above). 102 SKYLIFE 3 /2 0 0 6

particular trick, for example, that he performed över and över again. Kalanag would light the wick of a kerosene lamp that he brought on stage with hlm and then light a cigarette from the wick. He would then place the lamp on a glass tripod and cover it with a fine silk cover with a hole in the çenter in such a way that the lamp's chimney was exposed. Approaching close to his audience vvith the lamp in his hand, Kalanag would rapidly vvhisk off the cover. As he did so, the lamp vvould disappear. At the end of his performance, he vvould fling the cover at the spectators. This trick, vvhich is reminiscent of the innocent illusions created by the shadows of kerosene lamps reflected on walls, brings back warm memories of the good old days when we stili believed in magic and fairy tales. So what is it that makes kerosene lamps so special and unforgettable? Is it simply that they illuminate the invisible, or do they inevitably add a dash of wistfulness to our memories? The tank is filled vvith a sufficient amount of kerosene, the wick is turned up vvith the help of the knob and then iit. The chimney, vvhich has been warmed in the hands in advance so it won't shatter vvith the sudden heat of the flame, is piaced över the burner, and a night by iamplight begins. İt continues vvith the play of shadovvs created on the walls by its flickering glow, vvhich illuminated not only the dinner table and the stain/vell in old wood frame houses, but also the face of the storyteller... Today that flickering light of the kerosene iamp conjures up associations vvith childhood in the hidden recesses of our brain. And the fragility of its chimney, sadness... Just like the sadness evoked by lost memories... □


... think once! C hoosing the right partner is crucial w hen you need assistance in w o rld w id e integrated logistics. That's where Om san Lojistik's

OMSAN

customer focused service perception and extensive know-how, a id e d by advan ced İT applications, can m ake ali the difference:

K

Letting you stay focused on your main business.

r a

OMSAN TÜRKİYE

■ ■

OMSAN GERMANY

|

|

OMSAN FRANCE

IN N O V A T IV E LOGİSTİCS PARTNER

g g g

OMSAN BULGARIA

H ü

RUSSIAN FEDERATION

T u g a y Y o lu N o : 1 0 C e v iz li 3 4 8 4 6 M a lte p e , İs ta n b u l - T ü rk iy e Tel: + 9 0 ( 2 1 6 ) 4 5 8 5 5 5 5

I I

0M SA N R 0M A N IA

F a x: + 9 0 ( 2 1 6 ) 4 5 8 5 4 5 4

O M S A N LOJİSTİK A .Ş . is a subsidiary of <Sî Âk)

OMSAN AZERBAIJAN

w w w .o m s a n .c o m .t r


Likya’nın en eski kentlerinden biri olan Limyra, portakallarıyla ünlü Finike’de, Tocak Dağı’nın eteklerine kuruluydu. One of the oldest cities of Lycia, Limyra lies in the foothills of Mount Tocak at Finike, famed for its oranges.

sürekli kendisiyle uğraşır durur. İ nsanoğlu Felsefe ile benliğinin derinliklerini, kozmolojiyle geleceğini ve arkeoloji ile geçmişini arar. Hayatı kolaylaştırma, ilerleme ve teknoloji adına, giderek estetik kaygılardan ve sadelikten uzaklaşır bu arada. Bir an için geçmişin eserleriyle günümüzün binalarını karşılaştıralım. Bir yanda çelik konstrüksiyon ve postmodern beton yapılardan oluşan gökdelenler, diğer yanda altın tapınaklar, dev piramitler, heykeller ve anıt mezarlar. Yapıldığı zamanın teknik olanaklarını da düşünürsek, görselliğin ön plana çıktığı antik eserlere olan hayranlığımız bir kat daha artar. Tocak Dağı’nın eteklerindeki bir terasta bulunan Likya kralı Perikle'nin (Atinalı ünlü Perikles’le karıştırılmamalı) anıt mezarının önünde düşünüyorum tüm bunları. Anıt mezarı ilginç kılan en önemli şey, kuzey ve güney yanlarında çatı kirişlerini tutan sütunlar yerine karyatid (Yunan mimarisinde heykel biçiminde kadın figürleri) kullanılmış olması. Prof. Jürgen Borchhardt’a göre çatı, 106 SKYLIFE 3 /2 0 0 6

an strives perpetually to understand himself, seeking the roots of the self in philosophy, the future in cosmology, the past in archaeology. /\s he does so, his concern for simplicity and aesthetic considerations gradually recedes into the background in the name of progress, technology and making life easier. Let us compare for a moment the buildings of our day with those of the past. On the one hand, skyscrapers, those leviathans of Steel girders and post-modern concrete; on the other, golden temples, giant pyramids, statues and monumental tombs. And when we consider the technical possibilities that were available in the period when they were built, then these monuments from antiçuity, when the visual took precedence över ali else, are even more awesome. I am thinking these thoughts as I stand before the monumental tomb of the Lycian king Peride (not to be confused with the famous Athenian orator), on a terrace in the foothills of Mount Tocak. What makes this

M

Likya lahitleri içerisinde önemli bir yer tutan Katabura anıtı (üstte solda). Sahnesi yıkılmış küçük tiyatro, Tocak Dağı'nın eteklerinde yer alıyor (üstte ortada). Kentin en önemli yapısı olan Perikle’nin mezarı, Finike Ovası'na hakim bir noktada (üstte sağda). The Katabura monument occupies a key place among the Lycia sarcophagi (above left). İts stage destroyed, the small theater is situated in the foothills of Mt Tocak (above çenter). Pericle’s tomb, the city’s paramount structure, on a spot overlooking the Finike Plain (above right).


Likya mimarisi stilinde olmayıp, Perikle’nin kahramanlık mertebesine yükseltilişini sembolize etmek amacıyla bir Yunan tapınağı biçiminde yapılmış. Bir kısmı restore edilen bu değerli buluntular, bugün Antalya Müzesi’nde sergileniyor. Güçlü bir deprem sonucu yıkılan anıt mezardan geriye kalan harap kaide, portakal ve limon bahçeleriyle dolu bir ovaya ve Akdeniz’e bakıp görkemli geçmişini düşlüyor sanki. LİKYA’NIN BAŞKENTİ

Kumluca-Turunçova arasında, Tocak Dağı’nın eteklerinde kurulan Limyra’nın adından, tarih sayfalarında ilk kez Strabon ve Plinius söz eder. Kentin varlığı MÖ 6. yüzyıla kadar uzanır. MÖ 4. yüzyıla tarihlenen sikkelerde adına rastlanan Likya kralı Perikle’nin egemenliğinde, Limyra başkent olur ve altın çağını yaşar. Adı Likya dilindeki yazıtlarda ‘Zemuri’ olarak geçen Limyra, Likya Birliği’ni oluşturan diğer

yetmiş kent gibi otonomiye sahiptir. MÖ 1. yüzyılda Roma hakimiyetine giren şehrin baştanrısı, adına atletizm yarışmaları düzenlenen Zeus’tur. Limyra, Bizans döneminde psikoposluk merkezi olan yirmi beş Likya şehrinden biridir aynı zamanda. MS 8. yüzyılda Arap akınlarıyla önemini kaybeden kent, daha sonra sırasıyla Selçuklu, Menteşe Beyliği ve Osmanlı egemenliğine girer. Viyana Üniversitesi öğretim görevlisi Prof. Borchhardt başkanlığında 1966’da başlayan kazı ve restorasyon çalışmaları sonucu, antik yerleşimin önemli bir bölümü ortaya çıkarılmış günümüzde. Ören yeri, Turunçova’ya 3 kilometre uzaklıktaki Yuvalı Köyü’nün Saklısu Mahallesindeki yerleşimin arasına gizli. Yıllar önce bölgeye yerleştirilen yörükler tarihle iç içe bir yaşam sürmekteler bugün. Antik kenti gezmekten yorulanlar, bu sıcakkanlı insanların evlerine konuk olup çay sohbetleri

tom b irıteresting is the way that caryatids (statues o f women in Greek architecture) were used instead o f columns to support the ro o f beams on the north and south sides. According to Prof. Jürgen Borchhardt, the roof is not in the Lycian styie at ali but rather was built in the form o f a Greek temple to symboiize Pericie’s elevation to the status o f a hero. These valuable finds, one portion o f vvhich is currently under restoration, are on exhibit in the Antalya Museum today. The ruined base left from the monumental tomb, vvhich was destroyed in a povverful earthquake, seems to gaze down on the Mediterranean and the plain belovv, bursting vvith orange and lemon groves, and dream o f its splendid past. CAPITAL OF LYCIA Founded in the foothills o f M t Tocak betvveen Kumluca and Turunçova, Limyra is first mentioned in the pages

o f Strabo's and Pliny's histories. The city's existence dates back to the 6th century B.C. Under the rule o f the Lycian king Peride, vvhose name is encountered on coins dating to the 4th century B.C., Limyra became the Lycian Capital and enjoyed a golden age. The city, vvhose name appears as ‘Zem uri’ in inscriptions in the Lycian language, had autonomy like the other seventy cities that com prised the Lycian League. The chief god o f the city, vvhich came under Roman rule in the 1st century B.C., was Zeus, in vvhose name athletic contests vvere organized. Limyra was also one o f twenty-five Lycian cities that became seats o f bishoprics in the Byzantine era. The city, vvhose importance vvaned vvith Arab raids in the 8th century A.D., later came under the rule, in turn, o f the Seljuks, the Menteşe Principality and finally the Ottomans. A m ajör part o f this ancient settlement has t> 3 /2 0 0 6 SKYLIFE 107


Kentteki değişimi fark ettiniz mi! My World Satış Ofisi T Ü R K İY E ’N İN H E R Y E R İN D E N UUU 6 777 w w w .m yw orld.com .tr


Değişim 2U yıl önce, Ağaogtu'nun konut ve turizm sektörlerine girm esiyle başladı. Bugün, 1 milyon m etrekareyi bulan yaşam alanlarında, binlerce Ağaoğlu sakininin m odern, doğanın içinde ve m ü ke m m e l şekillenen yaşam larının tanıklığıyla sürüyor. Ağaoğlu, farklı yaşamlara, farklı bütçelere göre tasarlanmış ve "benim" diyeceğiniz kadar benimseyeceğiniz MY konseptü yaşam alanları kuruyor. Ağaoğlu sakinle ri, sizin kentte fa rk ettiğiniz heyecan verici değişim i, gü nlük hayatlarında yaşıyor. ilk günün heyecanını taşıyor olm aktan mutluyuz. Bundan sonra da kent yaşamına katacaklarım ızla Yaşam Mimarınız olmayı sürdüreceğiz.

My Country Satış Ofisi 0216 642 03 53 pbx www.agaoglu.com .tr


Göksu Irmağı n ı n ^ kaynağı, aJntik kentin » yeryüzüne çıkıyor.

M erm er döşeli antik cad de berrak suların altında kolaylıkla görülebiliyor.

The Göksu river arises from an underground source smack dab in the çenter of the ancient city.

The marble-paved ancient way is readily visibie belovv the surface Öl the jıyater.

tam ortasından

yapabilirler. Karayolunun sağ tarafında kalan surların ardındaki yapılar, Roma ve Bizans dönemine tarihleniyor. Kentin ana merkezini oluşturan bu alanda, Göksu (Limyros) Deresi’nin berrak kaynağı bulunuyor. Tarihi mekânı serinleten Göksu, kısa bir süre sonra Aykırıçay’la (Arykandos) birleşip Akdeniz’in mavi sularına karışıyor. Dere üzerindeki köprü geçildiğinde, sular altındaki taş döşemeleri seçilebilen antik cadde çıkıyor karşımıza. Ptolemaion anıtı, zafer takı, psikoposluk sarayı, kilise, hamam ve doğu kapısı, kentteki diğer önemli yapılar arasında yer

alıyor. Kuşkusuz surlar içindeki bu alanın en önemli eseri, Suriye seferinden dönerken Limyra’da ölen Gaius Ceasar adına yapılmış olan anıt mezar. Memleketinden uzakta, taşrada ölen bir kişinin anısını yaşatma amacıyla yapılan, fakat içinde ölüyü barındırmayan bu tür yapılara kenotaph (konuk mezar yapı) deniliyor. Gövdesi kabartmalarla bezeli bu yapıda, Ceasar’ın Doğu’da yaptığı yararlı işler betimlenmiş. AKDENİZ MANZARALI

Kent girişinde anayolun kenarında yer alan tiyatro, MS 2. yüzyılda şehrin en zengin olduğu dönemde Ptplemaıori

grffiına ait sütoıY başlarından biri.

The^capıtal of a colutnn from the Ptolepıaioh _ möhument.

110 SKYLIFE 3 /2 0 0 6

now been brought t o light in the excavations and restorations undertaken in 1966 under the direction o f Prof. Borchhardt, a faculty member at the University o f Vienna. The ruins are concealed amidst a modernday settlement in the quarter o f Saklısu in the village of Yuvalı, three kilometers from Turunçova. The nomads who vvere settled in this region years ago live cheek by jo w l with history today. Visitors who vveary o f exploring the ancient city can chat över tea in the homes o f these eminently hospitable people. The structures behind the vvalls stili standing on the right-hand side o f the highvvay da te t o the Roman and Byzantine periods. The crystal clear Göksu (Limyros) River also has its source in this area, vvhich vvas once the city çenter. Refreshing the historical site vvith its cool waters, the Göksu joins the Aykırıçay (Arykandos) a little further on before emptying into the Mediterranean. Crossing the bridge över the stream, we come upon an ancient avenue whose stone

slabs are ju s t discernible under the vvater. Among the city's other majör structures are the Ptolemaion monument, the arch o f triumph, the bishop 's palace, the church, the public bath and the eastern gate. But undoubtedly the most important structure vvithin the city vvalls is the monumental tomb built for Gaius Caesar, who died in Limyra vvhile returning from his Syrian campaign. Such structures, vvhich are built to honor the memory o f a person who died in the provinces far from home but vvhich do not actually contain the dead body, are called cenotaphs. This one is decorated vvith reliefs depicting the beneficial deeds Caesar perform ed in the East. WITH A MEDİTERRANEAN VIE W The theater, vvhich is situated beside the main road at the entrance to the city, vvas built in the 2nd century A. D. when the city was at its vvealthiest. Opramos, a rich man from Rhodopolis, assisted in the repairs to this two-storey >


Doğal simetri

S Y M M E T K İC A L . S İM E T R İK S Ü R E K Lİ D Ö R T ÇEKER

Üstün yol tutuş Mükemmel denge Kusursuz güvenlik

Simetri... Doğanın kendi içindeki mükemmel döngüsünün ve kusursuz dengesinin en somut göstergesi... Doğa, simetriktir! İşte Subaru'yu diğer tüm otomobil markalarından ayıran üstün ve benzersiz teknolojinin temelinde bu simetri anlayışı yatar. Tüm Subaru otomobillerinde Simetrik Sürekli Dört Çeker teknolojisi (Symmetrical AWD) standarttır. Motor gücünü dört tekerleğe eşit oranda dağıtarak otomobilin sürücüyle uyum içinde hareket etmesini sağlayan bu teknoloji, Subaru'nun mükemmel yol tutuşunun ve eşsiz güvenliğinin kaynağıdır. Şimdi Subaru Yetkili Satıcıları’na gelip dilediğiniz Subaru otomobiliyle bir test sürüşü yapın, size tüm kaygılardan uzak, güvenli ve keyifli bir yolculuk sunacak bu teknolojiyi daha yakından tanıyın.

T h i n k . Feel. D r i v e .

^ [ j T j M a d e in JAPAN!

torkiyegeneldistribütörü

H

Baytur IS 8ayrakt□r

www.subaru.com.tr

SUBARU


Limyra’yı Rhodopolis’e bağlayan Alakır Çayı üzerindeki eski köprü, portakal bahçeleri arasında kaybolm uş (solda). Bir süre sonra Aykırıçay'la buluşacak olan Göksu Deresi, ören yerini ikiye bölüyor (altta).

Lost among the orange groves, this old bridge över the Alakır river linked Limyra with Rhodopolis (left). The Göksu river, vvhich joins the Aykırıçay a little further on, divides the ruins in half (below).

inşa edilmiş. Rhodopolisli zengin Opramos, MS 141 ’deki depremde yıkılan iki katlı yapının onarımı için yardım etmiş. Tiyatronun arkasında akropole doğru yükselen antik yolu takip ediyoruz. Kıvrımlar yaparak devam eden taş yol, adım adım geçmişe götürüyor bizi. Akropolün hemen üstünde bulunan 315 metre yüksekliğindeki kaleden geriye surlar kalmış sadece. Kaybolan bir uygarlığın görkemli yapılarından Perikle heroonu ve sarayı, akropolün hemen altında yer alıyor. Tocak Dağı’nın güney yamacındaki bu noktadan tüm antik kent, Gelidonya Burnu’na kadar uzanan uçsuz bucaksız yirmi kilometrelik kumsal ve bir zamanlar Limyra'nın limanı olan Finike (Phoinikos) görülüyor. Şimdilerde önemli bir turizm merkezi ve portakal diyarı olan Finike, kalesi ve gemiler için sığınmaya elverişli Gökliman’ı ile Limyra’ya hizmet ediyormuş bir zamanlar. Limyra’nın ilgi çekici bir diğer özelliği de, sayıları beş yüze yaklaşan ve beş ana bölgeye yayılan kaya mezarları... Hiçbir Likya kentinde 112 SKYLİFE 3 /2 0 0 6

nekropolis alanı bu derece dağınık planlı değil. Nekropol 1, Finike-Elmalı yolu üzerindeki Arykanda Vadisi'nin sırtlarında konumlanıyor. Limyra’ya yaklaşık on kilometre uzaklıktaki sarp bir yamaca oyulan yedi kaya mezarı, heybetli görünüşleriyle yan yana duran kartal yuvalarını çağrıştırıyor. Nekropol 2 ve Nekropol 3, kentin iki yanında, batı ve doğu kapılarında yer alıyor. Nekropol 2, sahip olduğu çok sayıda kaya mezarıyla Limyra’nın en büyük mezar alanlarından biri. Bölge, Likya mezar geleneğinin farklı örneklerinin sergilendiği görsel bir şölen sunuyor gezginlerine. Özellikle Sidarios ve Tebursseli ailelerine ait kabartmalı mezarlar dikkat çekici. Antik kentin belki de tek lahit mezarı, tiyatronun hemen doğusundaki ünlü Katabura anıt mezarıdır. Lahdin batı yüzünde, soylu Katabura iki rahip arasında betimlenir. Yamaçlara doğru anayolun kenarında dizi dizi devam eden mezarlar, birkaç kilometre arayla Nekropol 5’e kadar uzanır. Psikoposluk merkezi olan kent, daha sonraki

structure, vvhich was destroyed in an earthquake in 141 A. D. We now foliovv the ancient vvay that climbs to the acropoiis behind the theater. This tvvisting stone road takes us step by step into the past. Oniy the vvaiis remain o f the 315-m eterhigh citadei that stands atop the acropoiis. The heroon and palace o f Peride, magnificent remnants o f a lost civilization, stand directly belovv the acropoiis. From this vantage point on the Southern slopes o f Mt Tocak, the entire ancient city, the tvventy-kilometerlong beach stretching ali the vvay to Cape Gelidonya, and the town o f Finike (Phoenikos), once Limyra's port, can be seen. Finike, now a majör çenter o f tourism as well as an orange-growing region, once served Limyra vvith its citadei and its harbor, the Gökliman (literaily ‘Biue P o rt’), vvhich provided a safe haven for ships. Another interesting feature o f Limyra is its rock tombs, numbering close t o five hundred and scattered över five principal areas. No other necropolis in any Lycian city is so strung out. Necropolis 1 is situated

along the crest o f the Arykanda Valley on the Finike-Elmalı road. These seven majestic rock tombs carved into a steep slope about ten kilometers from Limyra are reminiscent o f a string o f eagle’s nests. Necropolis 2 and Necropolis 3 are located on either side o f the city at its eastern and vvestern gates. With its extremely large number o f rock tombs, Necropolis 2 is one o f the m ost extensive such areas in Limyra. The region offers travelers a visual feast in the many different examples it displays o f the tom b tradition. Particuiariy notevvorthy are £>


Gaius C easar adına yapılan kenotaph’ın (konuk mezar) kalıntıları (sağda). Nekropol 2'd e bulunan Xuw ata mezarının üzerindeki savaşçı kabartması (altta).

Ruins of the cenotaph built for Gaius Caesar (right). Relief of a warrior on the Xuwata tomb at Necropolis 2 (below).

dönemlerde dinsel bir simge olarak varlığını devam ettirir tarih sayfalarında. Antik yerleşimin yakınlarında, Osmanlı dönemine tarihlenen bir kervansaray ve en eski Bektaşi tekkelerinden biri olarak kabul edilen Kafi Baba türbesi yer alır. 1617 yılında bölgeyi ziyaret eden Evliya Çelebi, limon, portakal ve nar ağaçları arasındaki bir cennet mekânda yaşayan Bektaşilerden söz eder yazılarında. Aykırıçay, Göksu ve Alakır gibi nehirlerle çevrilmiş olan şehirde ulaşım çeşitli köprülerle sağlanmaktaymış. Hasyurt yolu üzerinde

bulunan 28 kemerli antik köprü, Limyra’yı Korydalla ve Rhodopolis’e bağlayan önemli bir geçit noktasıymış. Kemerleri yarı yarıya toprağa gömülen, seralar ve portakal bahçeleri arasındaki bu yaşlı köprü hâlâ kullanılıyor. Kentin Finike bağlantısını sağlayan güneydeki küçük köprülerinse sadece ayakları kalmış günümüze. Az sonra güneş taşların üzerinde gölge oyunları yaparak batacak. Ve Limyra’nın kalıntıları, yorgunca yaslandığı dağın yamaçlarında bir günü daha geride bırakıp geceye hazırlanacak usulca.

Doyran

o G ölova

VuvH-

E lm a lı Beldibi

Düden ki

A ltm y a k a c

y Ö lim p o s » /B e y d a ğ ia rı ç K e m e r 1ÖfiîİT;Parkı î'i »Çam yuva

krykanda

•Tekirova

P h a se lis

ALAÇ ADA< ■ \

Tufunçova)

..

^Olympos

Saiı.ihp.-ı/Limyra o7 * rm luca

'Kasaba

Köşkerler

ly ■

ı ■■

*, > T in ik e _Beymele(yy^ ~ r „ , ı , : , k? D e m r e

114 SKYLIFE 3 /2 0 0 6

Finike Körfezi

«,Mavikent *Beykonak

the relief-carved tombs o f the Sidarios and Tebursseli families. Directly east o f the theater is perhaps the onty sarcophagus in the ancient city, the famous monumental tomb o f Katabura on whose western facade this Lycian aristocrat is depicted betvveen two priests. The tombs, which continue in rows along the main road in the direction o f the slopes, spread at intervals o f a few kilometers ali the w ay t o Necropolis 5. The seat o f a bishopric in later periods, the city sustained its existence in the annals o f history as a religious symbol. Near the ancient settiement are a caravanserai from the Ottoman period and the tomb o f Kafi Baba, considered to be one o f the oldest Bektashi lodges. The renovvned Ottoman traveler Evliya Çelebi, who visited the region in 1617, mentions Bektashis who dvvelled here in a Virtual paradise surrounded by lemon, orange and pomegranate trees. A series o f bridges afforded circulation through the city, vvhich is crisscrossed by rivers such as the Aykırıçay, the Göksu and the Alakır. The ancient

bridge with 28 arches on the road to Hasyurt was an important point o f passage linking Limyra with Korydalla and Rhodopoiis. İts arches now partially buried under the earth, this aged bridge amidst the greenhouses and orange groves is stili in use. Meanwhile, onty the abutments o f the small bridges to the south that link the town to Finike remain standing today. Casting its play o f shadows över the stones, the sun wili soon sink belovv the horizon. And the ruins o f Limyra, leaving behind yet another day on the slopes o f the mountain where it leans vvearily, will quietly make ready for night. □


ffl mesanurolbahçeşehirevleri

Şehir yaratma geleneğimizi sürdürüyoruz... İstanbul’un vazgeçemediğiniz tüm ayrıcalıklarına yakın, sıkıntılarına uzak bir yaşam... Modern bir şehrin tüm ayrıcalıkları, konforu içinde karmaşası dışında yaşamak. Bu hayali siz kurdunuz, 10 yıl önce MESA-NUROL ayrıcalığıyla Bahçeşehir’de gerçek oldu. Ama bitmedi... Yeni bir başlangıç arayanlar, yeni bir şehir hayatı bekleyenler için gelenek devam ediyor.

Bahçeşehir mimarının elinde büyüyor! 2. Etap satışlarımız başladı. M e sa N u ro l B a h ç e şe h ir E v le ri S a tış O fisi G ölet M e vkii B ah çe şe h ir İSTANBUL

Tel: 0 2 12 669 06 00 Faks: 0 2 1 2 669 06 10

B a h çe şe h ir Ş a n tiy e si PK.81 B a h çe şe h ir İSTANBUL Tel: 0 2 12 669 02 10 - 669 05 10 Faks: 0 2 12 669 05 18 w w w .m e sa -n uro l.co m


SmmBfflmıtıtım

Kültürlerin buluşma noktası / Hub of world cultures

Sakıp Sabancı Müzesi The Sakıp Sabancı Museum


Her açtığı sergisi yankı uyandıran, paha biçilmez bir hat ve resim koleksiyonuna sahip olan Sabancı Üniversitesi Sakıp Sabancı M üzesi’nin amacı, dünya kültürlerini bir araya getirm ek... With a permanent collection of priceless paintings and calligraphy, Sabancı University’s Sakıp Sabancı Museum aims to bring vvorld cultures together through its fine exhibitions. d İ FÜSUN AK AY 0

UMUT G Ö K A LP

ahçesindeki büyük, bronz at heykelinden aşinaydık ona. Bu yüzden Atlı Köşk olarak tanıdık bildik. Emirgan Korusu’nu İstanbul Boğazı'na bağlayan tepedeki tarihi yapı, inşa edildiğinden itibaren prenslere, prenseslere ev sahipliği yapmıştı. Şimdiyse, kapıları herkese açık. ‘Sabancı Üniversitesi Sakıp Sabancı Müzesi' (SSM) olarak... Dört yıl önce Sabancı Üniversitesi çatısı altında kurulan müze; kendine ait koleksiyonları, heyecan uyandıran ve ses getiren sergileri, türlü aktiviteleri, uzman kadrosu ve dünya standartlarındaki teknik donanımıyla, çağdaş müzecilik şartlarına tamı tamına uyuyor. Yaşayan, sürekli devinen, elindekiyle yetinmeyen müzeyi, tam da 20. yüzyılın dâhilerinden Picasso gelmişken gezdik...

B

20. yüzyılda Italyan mimarisi stilinde yapılan Atlı Köşk, 2002 yılından bu yana Sabancı Üniversitesi Sakıp Sabancı Müzesi olarak hizm et veriyor.

Built in 20th century Italianate architectural style, the Sabancı Mansion became the Sabancı University Sakıp Sabancı Museum in

2002.

AİLE EVİNDEN MÜZEYE

20. yüzyılın başlarında Italyan mimarisi stilinde yapılan Atlı Köşk, 1951'de ailesi için yazlık konut arayan Hacı Ömer

t vvas familiar to us already from the large bronze horse in its garden. A mansion on a hill in İstanbul’s Emirgan Park, overlooking the Bosphorus and playing host to princes and princesses since the day it was built. Now its doors are open to ali, as the Sabancı University Sakıp Sabancı Museum (SSM). Founded four years ago under the auspices of Sabancı University, it is a state-of-the-art modern museum vvith its own permanent collections, stunning exhibitions, a wide range o f activities, an expertly trained staff and technical equipment to meet world standards. We timed our recent tour of this dynamic and ambitious living museum to coincide vvith the Picasso exhibition.

İ

FROM MANSİON TO MUSEUM The Sabancı Mansion, vvhich vvas built in the Italianate architectural style at the beginning of the 20th century, vvas purchased by Hacı Ömer Sabancı in 1951 as a summer home for his family. Sabancı also purchased a bronze horse, made by a Parisian sculptor, from an auction held at Mahmud Muhtar Pasha's


Sabancı tarafından alınır. Hacı Ömer Sabancı, Mahmud Muhtar Paşa'nın Moda’daki Mermer Konağı'nda yapılan müzayededen, Parisli bir heykeltıraşın yaptığı bronz atı alıp köşkün bahçesine koyar; böylece burası ‘Atlı Köşk’ olarak anılmaya başlar. Hacı Ömer Sabancı’nın vefatından sonra ailenin daimi konutu olarak kullanılır. Sakıp Sabancı da 1999’da tabiri caizse 'ceketini alıp çıkar’. Köşk, müze gibidir. Hacı Ömer Sabancı tarafından oluşturulmaya başlanan sanat eserleri koleksiyonunu, oğlu Sakıp Sabancı zenginleştirmiştir. “Bu evden ayrılmak zooor, ama gayet güzeeel...” der Sakıp Sabancı. Ve müze yapılmak üzere, Sabancı Üniversitesi’ne armağan eder. 2002 yılında kapılarını ziyaretçilerine açan müze, iki bölümden oluşuyor. Atlı Köşk ve en ileri teknolojiyle donatılarak ona eklenen galeri. Köşkün giriş katındaki üç oda, Sabancı Ailesi’nin burada yaşadığı dönemde kullandığı mobilyalar, 18. ve 19. yüzyıl sanat eserleriyle göz kamaştırıcı. Kristal avizeler, altın yaldızlı devasa aynalar, Sevres vazolar, Berlin’de üretilmiş porselenler, tablolar... Bu kattaki bir bölüm de Sakıp Sabancı’nın anısına hazırlanmış. Odanın bir duvarında, Sabancı’nın Fidel Castro, Ronald Reagan gibi pek çok devlet adamıyla çekilen fotoğrafları bulunuyor. Sabancı'ya verilmiş onur nişanları, hizmet madalyaları ve fahri doktora beratları; kullandığı ajandalar ve kendisinin kaleme aldığı kitaplar da görülebilecek diğer objeler arasında. 600 YILLIK GEÇMİŞ

Köşkün ikinci katında ise, Sabancı Koleksiyonu’ndaki Osmanlı hat sanatı eserlerinin 118 SKYLIFE 3 /2 0 0 6

Türk resminin belli bir kesitini sunabilecek zengin bir resim koleksiyonuna sahip olan Sakıp Sabancı Müzesi; Osman Hamdi, Şeker Ahm ed Paşa, Nazm i Ziya ve Fausto Zonaro gibi değerli sanatçıların eserlerine ev sahipliği yapıyor.

Sakıp Sabancı Museum's rich collection represents a significant segment of Turkish painting, including works by such prominent artists as Osman Hamdi, Şeker Ahmed Paşa, Nazmi Ziya and Fausto Zonaro.

‘Marble Pavilion' in Moda on the Asian shore, and had it erected in the garden. Sabancı’s mansion wouid be known henceforth as the ‘Atlı Köşk’, or ‘Mansion vvith a Horse'. Follovving Hacı Ömer Sabancı’s death, his family made it their permanent residence. But the mansion, aithough beautiful, was difficult to maintain, and in 1999 Hacı Ömer's son, businessman Sakıp Sabancı, vvho had further enriched the collections begun earlier by his father, gave up the family home and made a gift o f it to Sabancı University. The museum, vvhich opened its doors to visitors in 2002, consists of two sections: the mansion itself and an annexed gallery outfitted vvith the latest in modern museum technology. The three rooms on the entrance level dazzie the eye vvith the opulent furnishings used vvhile the Sabancı family resided here and their collection o f art vvorks from the 18th and 19th centuries: crystal chandeliers,

enormous gilded mirrors, Sevres vases, porcelain manufactured in Berlin and, ofcourse, paintings... One section on this level has also been dedicated to the memory of Sakıp Sabana himself. On the wall are photographs o f him vvith Fidel Castro, Ronald Reagan and numerous other heads o f State. Among these items are also the orders of merit, service medals, and honorary doctorate that vvere bestovved on Sabancı, as well as the diaries he kept and the books he wrote. A 600-YEAR HİSTORY The museum's second floor is devoted to a display of a portion o f the Ottoman calligraphy in the Sabancı Collection. This rich, carefully chosen collection is important for the overvievv it provides o f the Ottoman art of calligraphy during its 600-year history. Besides handvvritten Ourans and prayer manuals, there are framed inscriptions, calligraphic collages, deeds of trust, decrees bearing the stylized signature o f the sultan, and documents such as titles of


bir bölümü sergileniyor. Özenle seçilmiş bu zengin koleksiyon, OsmanlI’nın 600 yıllık hat sanatına geniş bir bakış açısı sunması açısından çok büyük bir öneme sahip. Elyazması Kur’an-ı Kerimler ve Dua kitaplarının yanı sıra bu bölümde; Levhalar, Murakkalar, Vakfiyeler, tuğralı Ferman, Berat ve Menşur gibi belgeler ile hattat aletleri bulunuyor. Divanî hat ile yazılmış II. Mehmed tuğralı, 1459 Aralık tarihli ferman; II. Bayezid’in oğlu Şehzade Korkut’un yazdığı Kuran; Kanuni döneminin ünlü hattatlarından Ahmed Karahisarî'nin sülüs hatla veciz sözleri meşk ettiği karalaması; 17. yüzyılın usta hattatı Hafız Osman’a ait seçkin eserler ile gümüş hokka takımları, divitler ve daha pek çok eser... Müzenin resim koleksiyonu da, Türk resim sanatının tarihsel evrimini gözler önüne sermesi açısından büyük önem taşıyor. Osman

Köşkün giriş katındaki üç oda, m obilyalar ve 18. ve 19. yüzyıl sanat eserleriyle göz kamaştırıcı (üstte). Bahçesindeki bronz attan dolayı, tarihi yapı ‘Atlı Köşk’ olarak anılıyor (altta).

The three rooms on the mansion’s ground floor dazzle the eye with furnishings and art objects from the 18th and 19th centuries (above). The house was dubbed the 'Mansion with a Horse' because of the large bronze statue of one in its garden (below).

privilege and royal patents, as well as calligraphic instruments on exhibit here, including, for example, a decree, dated December 1459, mitten in the Divanî script and bearing the signature o f Mehmed the Conqueror; a Ouran penned by Bayezid II ’s son, Crown Prince Korkut; a verse panegyric vvritten for Bayezid II; a calligraphic exercise in the Thuluth script by Ahmed Karahisarî, a renowned calligrapher from the period of Süleyman the Magnificent; a silver inkpot and vvriting set belonging to the 17th century calligraphic master, Hafız Osman; pen-cases, and many otheritems. Themuseum’s painting collection is also of outstanding importance for documenting the historical development o f the art of painting in Turkey. Osman Hamdi, Şeker Ahmed Paşa, Fausto Zonaro, İbrahim Çallı, Feyhaman Duran, Nazmi Ziya Güran and Fikret Mualla are just a few of the painters whose works you can see here.

THE PICASSO EXHIBITION THROUGH 26 MARCH The 4000-square-meter new gallery, vvhich is equipped with the most advanced museum technology, is currently hosting Turkey’s first-ever large-scale exhibition o f a Western artist in the form o f 135 works, culled from various museums and collections and encompassing ali o f the painter’s periods, including dravvings he made in his early youth. SSM Director, Dr. Nazan Ölçer, a worldrecognized authority on Turkish museology, had this to say about the exhibition: “We have made it our purpose to bring the vvorld’s great collections to Turkey, for the Turkish people to see. We can no longer remain invvard-oriented, contented with and proud of— even though we have good reason to be proud—works that were produced in the past; we also need to know vvhat's going on in the vvorld. Works from abroad will, first o f ali, liberate the Turkish people from their egocentric point o f view and give them an opportunity to > 3 /2 0 0 6 SKYLIFE 119


Hamdi, Şeker Ahmed Paşa, Fausto Zorıaro, İbrahim Çallı, Feyhaman Duran, Nazmi Ziya Güran ve Fikret Mualla, eserleriyle yüz yüze gelebileceğiniz isimlerden sadece birkaçı. PİCASSO SERGİSİ 26 MART’A KADAR

İleri teknoloji ile donatılmış, 4000 metrekarelik yeni galeri, Türkiye’de Batılı bir sanatçıya ayrılan ilk büyük sergiye ev sahipliği yapıyor. Picasso’nun, çeşitli müze ve koleksiyonlardan bir araya getirilmiş; ilk gençlik yıllarına ait çizimlerinin de bulunduğu, tüm dönemlerini kapsayan 135 eserine... Türk müzeciliğinin dünyaca tanınan ismi, SSM Müdürü Dr. Nazan Ölçer, “Dünyanın büyük koleksiyonlarını, Türk insanıyla buluşturmayı amaç edindik. Sadece içine kapanmış, geçmişinde üretilmiş eserleriyle övünüp -ki övünmekte hakkımız varyetinmekle kalmayıp bu dünyada ne olup bittiğini de bilmemiz gerekiyor. Yurtdışından gelen eserler, öncelikle Türk insanını benmerkezcilikten uzaklaştıracak, onlara yeni ufuklar açma imkânını sağlayacak. Ziyaretçilerin Picasso gibi bir dâhinin elinden çıkmış eserlerle baş başa kalabilmesi buna bir

120 SKYLIFE 3 /2 0 0 6

Hat koleksiyonunun sergilendiği ikinci katta, elyazması Kur’an-ı Kerimler ve dua kitaplarının yanı sıra, değerli belgeler ile ünlü hattatlara ait aletler sergileniyor.

Besides handvvritten Qurans and prayer manuals, valuable documents and calligraphic instruments are displayed in the calligraphy collection on the second floor.

discover nevv horizons. Getting a chance to view, first-hand and up close, vvorks produced by a genius like Picasso is just one exampie o f this." A reminder to readers: the Picasso exhibition continues through 26 March. Dr. Ölçer points out that the museum's education depanment also provides an important service: “Making a work in an exhibition comprehensible is not just a question o f hanging informative panels on the wall. İt can also be done through small vvorkshop projects, lectures, films and gallery chats." Another purpose o f the

museum is not merely to display the fine arts, painting and history isolated in a beli jar but to present them together vvith the other branches o f art. "Two concerts o f Renaissance music, played on period instruments, vvere given, for example, in conjunction vvith the exhibition, 'Ottoman Splendor in Florentine Palaces’. And at our Picasso exhibition, pieces by Eric Satie, a close friend and contemporary of the artist’s, are played as background music. Films about Picasso are also being shown. You'II find a number o f familiar names, like vvriter and director Jean t>


CNR EXPO: TEXGATE INTERNATIONAL TEXTILE AND ACESSORIES FAIR 9-1 i

İ p IİİİM M P ş Ip

■flit m M m km

Manufacturing for the fashion trends of future years, our company continues to knit the future for you departing from its established success, manufacturing experience, quality standards, capacity and in-house technology.

Knitting is in our nature

m

m

m

m

m

lifi mm m

m

-

N A Z O R M E K U M A Ş V E T E K S T İL SA N A Y İ A.Ş. Dereboyu Caddesi No: 48 P.K. / P.C 34600 Halkalı - İSTANBUL - TURKEY Phone: +90 212 696 55 17 pbx F a x : +90 212 696 57 01 Web: www.naztextile.com e-mail: info@naztextile.com


Cocteau and poet Guillaume Apollinaire, vvhich immediately draw you in to the atmosphere." Ölçer explains that she hopes to put the museum's restoration department into operation very soon as well, adding, “We are also going to open a Çenter for Museum Studies, vvhich will enable us to offer lectures and other events in conjunction vvith the exhibitions on a regular basis." GENGHIS KHAN IS COMING!

örnek” diyor. Hatırlatalım; Picasso sergisi 26 Mart’a kadar devam edecek. Dr. Ölçer, müzenin ‘Eğitim’ bölümünün de çok önemli bir hizmet sunduğunu vurguluyor. “Sergideki bir eseri anlaşılır kılmak, sadece duvara asılan bilgi panoları ile değil, küçük atölye çalışmalarıyla, konferanslarla, filmlerle, galeri sohbetleriyle mümkün olabiliyor”. Müzenin bir başka amacı da; güzel sanatların, resmin, tarihin kendi cam fanusları içinde değil, sanatın diğer alanlarıyla bir arada sunulması. Örneğin ‘Floransa Saraylarında Osmanlı Müzenin kurucusu Sakıp Sabancı’nın anısına hazırlanmış bölüm de, Sabancı’nın ünlü devlet adam lanyla fotoğrafları, kullandığı ajandalar, kendisine verilen nişan ve m adalyalar ile yazdığı kitaplar bulunuyor.

İn the section dedicated to the memory of the museum's founder, the late Sakıp Sabancı, are photographs of him vvith famous heads of state, diaries he used, honors and medals bestovved on him, and books that he vvrote. 122 SKYLIFE 3 /2 0 0 6

Görkemi’ sergisinde, Rönesans dönemi müziğiyle iki konser verildi, o dönemin çalgılarıyla. Picasso sergimizde de, arka planda Picasso’nun çağdaşı ve yakın dostu Eric Satie’nin parçaları çalıyor. Picasso ile ilgili filmler oynuyor. Bakıyorsunuz birçok tanıdık isim; yazar ve yönetmen Jean Cocteau, şair Apollonaire gibi. Onlar da birden sizi sarıp sarmalamaya başlıyor." Müzenin restorasyon bölümünü de yakında eğitim verebilecek duruma getirmeyi hedeflediklerini söyleyen Ölçer, “Müze

Since its inception in 2002 the Sakıp Sabancı Museum has brought Turkish art lovers a number o f first-rate exhibitions: ‘Partnership o f Povver: Man and Horse', ‘Three Centuries of European Fashion’, and 'The Image o f Turks in Europe in the 17th Century', to name just a few. Two years ago, the exhibition, ‘From the Medicis to the Savoias: Ottoman Splendor in Florentine Palaces', was a vvatershed for the museum. “The Uffizi Gallery in Florence is regarded as one o f the world’s most difficult museums," explains Ölçer. “They lend their works only vvith great reluctance, or not at ali. Mounting an exhibition on this scale vvith works from them was a turning point. İt was their endorsement, I believe, that gave >

Osm anlI’nın altı yüz yılını gözler önüne sermesi açısından, müzenin hat koleksiyonu büyük önem e sahip.

The museum’s calligraphy collection is important for documenting the development of this Ottoman art över a span of six hundred years.


Anı yakalayın ve saklayın. Sıcacık bir gülüm sem eyi dondurup saklayın, düzenleyin, gönderin ya da kablosuz ve kaliteli bir şekilde baskı alın. 2 megapiksel kamera, e-posta ve Web uygulam aları sayesinde m obil yaşamla tanışın. Yeni N70 ile bilgisayarın bir cep telefonuna nasıl dönüştüğüne şahit olun.

www.nokia.com.tr

Nokia Nseries See new. Hear new. Feel new. Xpress 3rirıt

Xpressrransfer

Telif hakkı © 2005 Nokia. Tüm hakları saklıdır. Nokia ve Nokia Connecting People. N okia C orporation'ın tic ari veya te scilli tica ri m arkalarıdır.

|y

|

/ \

Connecting People


Etütleri Merkezi de açacağız. Böylece, gelen sergiler çerçevesinde yapılan sunum ve konferansların sistemli hale gelmesi sağlanacak" diyor. CENGİZ HAN GELİYOR

Bugüne kadar pek çok önemli sergiyi sanatseverlerle buluşturdu Sakıp Sabancı Müzesi. 'Doğada Güç Birlikteliği: İnsan ve At’, 'Avrupa Modasının Son Üç Yüzyılı’, ‘17. Yüzyıl Avrupası'nda Türk imajı' bunlardan birkaçı, iki yıl önce ‘Mediciler’den Savoylar’a, Floransa Saraylarında Osmanlı Görkemi’ adlı sergiyse müze için büyük bir dönüm noktası olmuş. “Floransa’daki Uffizi, dünyanın en zor müzeleri arasında sayılır. Çok zor eser verirler, ya da hiç vermezler. Onlardan gelen

bu çapta bir sergi de, burası için bir milattı. Onun referansıyla müzenin önü açıldı sanıyorum.” Şimdi, müzede önümüzdeki aylarda, yıllarda gerçekleşecek heyecan verici sergilerden bahsedelim kısaca. Nisan ayında açılacak ‘Portekiz’de Bir OsmanlI’nın Koleksiyonu’ sergisi, Lizbon’daki ünlü Gulbenkian koleksiyonundaki Osmanlı örneklerini İstanbullularla tanıştıracak. Ardından, usta heykeltıraş Rodin'in sergisi geliyor. Yıl sonunda ya da 2007 yılı başlarında ise, ‘Cengiz Han' sergisi gerçekleşecek. “Bu, bir anlamda Londra'da açtığımız ‘Türkler’ sergisinin devamı gibi olacak. Cengiz Han ve ardından gelen sülalenin, dünyanın dört tarafına dağılmış imparatorluğun küçük devletçiklerinin hikâyesini çok zengin bir malzemeyle sunabileceğiz. Daha fazla anlatmayayım, heyecanı kaçmasın.’’ Dr. Ölçer, 2007 yılı içinde de Avrupa sanatının ünlü ressamlarını sırayla getirmeyi hedeflediklerini de söylüyor. Dünya kültürleriyle buluşmak, hoş sürprizlere tanık olmak istiyorsanız, Sakıp Sabancı Müzesi’ne mutlaka düşürün yolunuzu...

our museum the boost it needed. ” Let us now merıtion briefly some o f the exciting exhibitions that are going to come to the Sakıp Sabancı Museum in the months and years ahead. 'An Ottoman Collection in Portugal', scheduled to open in Aprii, wili bring İstanbul residents Lisbon’s famous Gulbenkian Collection, which also includes Ottoman vvorks. This exhibition will be followed immediately by vvorks o f the great sculptor, Rodin. And at the end o f the year or at the beginning o f 2007, Istanbulites will be treated to the ‘Genghis Khan’ exhibition. “İn a sense this is a continuation o f ‘The Turks' exhibition that we mounted in London last year. We are going to present, in extremely rich materials, the story o f the small successor states that were scattered to the four corners o f the earth from the empire o f Genghis Khan and his lineage. But I won ’t give away any more so as not to spoil the suspensel" Dr. Ölçer says too that she intends to bring the famous painters o f European art to İstanbul one by one in 2007. So, ifyou want to experience vvorld cultures, just head for the Sakıp Sabancı Museum, where you're always in for a pleasant surprise. □

24 Kasım’d a Sakıp Sabancı M üzesi’nde açılan ‘Picasso İstanbul'da’ sergisini, Şubat ayına kadar 115 bin sanatsever ziyaret etti. 26 M a rt’a kadar sürecek sergide, 20. yüzyıla dam gasını vuran sanatçının 135 eseri bulunuyor.

Up to February, some 115,000 art lovers had visited the 'Picasso in İstanbul’ exhibition, which opened at the Sakıp Sabancı Museum on 24 November. The exhibition includes 135 vvorks by this artist, who put his stamp on the 20th century.


Küçü\<*ü

Yurtdışına yapacağınız gönderilerde daima doğru çözümler sunan, hızlı, güvenilir, deneyimli ve ekonomik paket taşımacılığı... işbirliğiyle, tüm Yurtiçi Kargo şubelerinden gönderi yapabilme kolaylığı...

GeoPost Yurtiçi Kargo ile Dünya artık çok küçük...

yurliçkorgo www.geopostyurtici.com.tr info@gyk.com.tr


A yağa kalkan sular / VVhen w a te r gets up on its hind legs

Çağlayanlar VVaterfalls İlkbahar yağmurları, sadece çiçeklenm eye hazırlanan tohumları değil, eriyen karlarla karışan akarsuları da harekete geçirir ve çağlayanlara yol verir. S pring rains not only a ctiva te the se e d s vvaiting to bu rst into bloom ; th e y also svvell rivers and stre am s vvith m elting snovvs, cre ating vvaterfalls, i ®

nadolu’yla ilgili gerçeküstü bir film çekseydim, ilk görüntüler Ece Ayhan’ın dizelerinden çıkardı: “Uç Doğu. / Anadolu'yu anlatacaktır öğretmen. / Haritayı asar. / Bütün sınıf korkmuştur; göller, ırmaklar dökülecekleri”. Coğrafyayı da, çocukluğun o saf dünyasını da aşan bir şiirdir “Dökülecekleri". Dizeler müthiş bir imge sağanağını başlatır. Sınıf duvarına asılan bir haritadan aşağı doğru dökülen onlarca ırmak, göl, deniz... Ve doğuracakları bir sürü çağlayan... Bu şiiri ilk okuduğumda içimdeki sularda şöyle bir tümce yaratmıştı: “Çağlayanlar;

A

Kapuzbaşı Ç ağ layan larına giderseniz, bir su bayramı yaşayacaksınız (solda). Borçka-Cam ili yolu çağlayanların beşiği gibi (üstte).

The Kapuzbaşı VVaterfalI will greet you with a veritable water fest (left). The Borçka-Camili road is lined with vvaterfalls (above).

AKGÜN AKO VA

f I were to shoot a sürrealistte film about Arıatolia, it would open vvith these lines from poet Ece Ayhan: “Extreme East. / The teacher is giving a lesson on Anatolia. / He hangs up a map. / The whole elass is scared to death that the lakes and rivers are going to spill down the wall!" But this is a poem that goes far beyond mere geography or the naive vvorld o f childhood. İts lines precipitate a cascade o f images— scores o f lakes, rivers and seas, ali rushing down from a map hung on a classroom wall, and the slew o f vvaterfalls they create. VVhen I first read this poem, a picture distilled in my

I


nehirlerin, ırmakların, derelerin ayağa kalkmış halidir!” Evet, çoğu insan için çağlayanlar ‘düşen sular'dır; benim için ise, ‘ayağa kalkan sular’... Ayağa kalkarlar ama, kışın buzdan dişleri herkesi durdurduğu gibi onları da durdurur. Nehirler, çaylar ve dereler, Anadolu coğrafyasını milyonlarca yıldan beri şekillendirip durdular. Güçlendiklerinde taştılar, yatak değiştirdiler. Denize 128 SKYLIFE 3 /2 0 0 6

dökülmeden önce çok parmaklı eller gibi açıldılar, bölündüler, deltalar yarattılar. Bereketi taşıdılar, hayat verdiler ovalara ve tarlalara. Onlara Göksu dedik, Kızılırmak dedik, Çoruh dedik, Eşen dedik... Suları azaldığında endişelendik, çünkü bazen bir pınardan kana kana su içmekti yaşam, bir yolcu için. Zaten hepimiz “devrandan gelip geçen birer yolcu değil miydik”? Sular, baharla birlikte,

mind: “VVaterfalls are streams and rivers rearing up on their hind legs!" Most people think o f vvaterfalls literally as ‘falling water’, but not me. They rear up, but v/inter's teeth o f ice stop them, as they stop ali o f us. Brooks, streams and rivers have been shaping the geography o f Anatolia for millennia. Gathering strength, they overflovved and changed their course. Before emptying into the sea they spread out like many-fingered hands,

Kurşunlu, A ntalya’ya yakınlığı nedeniyle D üden’le birlikte en çok turist çeken çağlayan (üstte solda).

Like the Düden, Kurşunlu vvaterfall attracts numerous tourists for its proximity to Antalya (above left).


Düden, A kdeniz’e karışana dek yeryüzünde bir görünüp bir kaybolur.

The Düden disappears underground and reappears several times before emptying into the Mediterranean.

eriyen karları ve yağmurları yüklenip dağlardan çağlayanlarla gürül gürül indiler. Deniz gücünü nasıl dalgalarla gösterirse, onlar da çağlayanlarla sınadı varoluşlarını. Yükseklerden düştüler, geçitler ve kanyonlar açtılar kayaları aşındıra aşındıra. Geçtikleri yerlerin kıyılarında ağaçlar bitti, çiçekler açtı. Köprüler kuruldu. Başlarına, “Ey yolcu, su içtiğin bu hayratı Veliler köyünden ...’’ diye başlayan yazılar kazınan

çeşmeler yapıldı. Yolcuların duasını almak isteyenler, önce onların dudaklarını ıslattılar. Ve bir gün bir ç a ğ la y a n ın b a ş ın d a

yorgunluk atan bir bilge, şöyle mırıldandı: “Gücüne kanma! Bir taşı delen, suyun gücü değil, damlaların sürekliliğidir.” O günden sonra, Anadolu’da akarsular bereketi hakça paylaştırmak için kollara ayrıldılar, dört bir yana aktılar, aktılar, aktılar... Bu yazı da, onlara selam olsun diye yazıldı.

giving rise to deltas. They brought life and fertility to fields and meadovvs. l/l/e gave them names: Göksu, Kızılırmak, Çoruh, Eşen... VVhen they dried up we were anxious, because, for a traveler, gulping water from a natural spring can mean the difference between life and death. And wasn ’t each one o f us 'a traveler on life’s road'? VVith the arrival o f spring, the rivers svvelled vvith rains and melting snows, roaring down

the mountainsides as vvaterfalls. And ju s t as the sea demonstrates its povver in waves, so do rivers test their strength in vvaterfalls. Falling from great heights, they wore down rocks to carve out canyons and mountain passes. Trees sprouted and flovvers bloomed aiong their banks. Bridges were thrown up and fountains built, carved vvith inscriptions declaring, “Oh traveler, this fountain vvhere you drink is a gift of the O 3 /2 0 0 6 SKYLIFE 129


A PO LLO N’UN GÖZYAŞLARI

Antakya, “dili olsa da konuşsa” dediğim kentlerden biri... Orada dillendirilen söylencelerden biri de, ‘ayağa kalkan sular’la ilgili. Toprak Ana, Antakya’da yalnızca gelincik tohumlarını saklamakla kalmaz, Irmak Tanrısı’nın kızı Daphne ile Apollon’un öyküsünü de saklar. Aşk bu ya, Apollon Daphne'ye tutulduğunda kız onu reddetmiş. Apollon pes eder mi, bırakmamış peri kızının peşini. Daphne kaçmış, Apollon kovalamış; Daphne kaçmış, Apollon kovalamış. Yakalanacağını anlayan peri kızı, Toprak Ana'ya, “Beni sakla, kurtar şu Apollon’dan!” demiş. Toprak Ana, peri kızını hemen oracıkta, daha doğrusu Harbiye’de bir ağaca dönüştürmüş. O ağaca biz o

Uçan Çağlayanı’nın : suları ilkbahar yağmurlarıyla renk J değiştiren G ö kd e re if! karışıyor. The waters of the Uçan cascade mingle with those of the Gökdere, which changes color with the spring rains.

village o f Veliler". To solicit the good will o f passersby, they first moistened their lips and slaked their thirst. Therı one day a sage, pausirıg to rest near a vvaterfall, mumbled under his breath: “Don’t let your strength fool youl What bores through stone is not the mighty vvaterfall but the persistent tiny drops." From that day forvvard, to apportion their strength equitably, the rivers o f Anatolia divided up into tributaries, flovving away in ali directions... I write this as a tribute to them. THE TEARS OF APOLLO

Toroslar'da uçurum lar kendi çağlayanlarını yaratır. The precipices of the Taurus çreate their own waterfalls.

Antakya (ancient Antioch) is one o f those cities one vvishes had a tongue and could speak. A vvidespread legend there concerns the ‘vvaters that rise up on their hind legs’. Not only did the Earth Mother store her poppy

gün bugündür Defne diyoruz. Sevdiğinin ağaca dönüştüğünü gören Apollon’un gözyaşlarından da Harbiye Çağlayanları oluşmuş. Harbiye’de defne yağı ve yaprağından üretilen sabunlar peri kızı Daphne’nin güzelliğine sahip olmak isteyenlerce satın alınıyor. Sinop içinse, 'Karadeniz’in incisi’ diyorlar; gerçekten bir inci Sinop. Ama henüz istiridyesi açılıp içinden çıkarılmamış, keşfedilecek nice ışıltısı olan bir inci... ilçesi Erfelek ise, bir dizi çağlayanı, istiridyelerin değil, ormanların içinde saklıyor. Erfelek Çağlayanları, bir kanyon içinde birdirbir oynayarak akan Şamı Deresi’nin çocukları. 28 tane olduğu söyleniyor ama, saymaya kalkarsanız, eminim şaşıracaksınız, ilk şelaleden yürümeye başlayıp

seeds in Antakya, she also preserved the story o f Apollo and Daphne, daughter o f the River God. Apollo was smitten with Daphne, but she rejected him. That’s love for you. But Apollo didn’t give up. Undaunted, he continued to pursue the fairy child. The faster Daphne ran, the faster Apollo chased after her in hot pursuit. When she realized she would eventually be caught, she pleaded with the Earth Mother, “Hide me, save me from this Apollo!” And then and there, more properly in the place known as Harbiye, the Earth Mother turned the fairy child into a tree, the tree that we cali the laurel or bay tree today. And the Harbiye VVaterfalls ıvere formed by the tears Apollo shed when he saw his beloved transformed into a tree. Today at Harbiye, vvomen who covet the beauty t>


Şimdilik 110 noktadayız. We are on 110 spots for now. Sanayi ve Ticaret Bakanlığı Tüketici Memnuniyetini İlke Edinen Firma Obülü-2004’ Miniitry o f Industry jn d Traae Vustomeı Satisfaction Focused Company Avvard-2004'

%ıooGIDA GÜVENİLİRLİĞİ

www.kiler.c^m.tr

S kiler Kazançlı Alışveriş


Yedidere Çağlayant'nın kayaçlarına, yumuşak yapısından dolayı halk ‘çürük taş' adını

Th^massrve rock clitfs Of ^fedidere Falls are knoton 'among the locals as ‘rotten stone' due to their soft, malleable : ’ structure.

iki kilometrelik yolun sonunda kaynağa ulaştığınızda 300 metre yükselmiş olacaksınız. Bu yolculuk, dizlerinizin dermanına ve hava şartlarına bağlı olarak iki-üç saat arasında değişiyor. Ama doğa ve fotoğraf tutkunu iseniz, altı-yedi saatten önce geri dönmeniz olanaklı değil. İlçe, Sinop'a 30 kilometre uzaklıkta, Erfelek’ten sonra 15 kilometre daha giderek düşen sulara ulaşacaksınız. TOROS DAĞLARI’ND A...

Toros Dağları, Doğu Karadeniz’le birlikte çağlayanların beşiğidir. Çağlayan görmek için önereceğim ilk rota, AlanyaTaşkent-Hadim hattı. Uçurumların kıyısından geçerken bazen aşağı bakmaya korkacağınızı, Taşkent'e vardığınızda kayaların arasında yerleşmiş bu garip kasabanın 132 SKYLIFE 3 /2 0 0 6

Alara Çağlayanı doğduktan sonra uzun bir yol kat ederek Manavgat’ta denize kavuşur (altta). The Alara flows a considerable distanoe from its source before eventually reaching the sea at Manavgat (below).

o f Daphne buy the oil o f the laurel and the soaps manufactured from its leaves. And then there is Sinop, ‘pearl o f the Black S e a A n d a pearl it is indeed, but a pearl stili hidden in its oyster, so many o f its gleams stili waiting to be discovered. The Sinop tovvnship o f Erfelek harbors a whole host o f vvaterfalls, concealed not in oysters but in its forests. The Erfelek vvaterfalls are the offspring o f the Şamı River vvhich plays leapfrog as it flovvs through the canyon. There are said to be 28 of them, but Tm sure you'd soon lose count if you tried to list them ali. If you start from the first vvaterfall and walk two kilometers to the spring at the end o f the road you will have climbed to an elevation o f 300 meters. This journey could take up to two or three hours depending on vveather conditions and the

State o f your knees. But if you're a nature and photography buff, then you won 't get back in less than six or seven hours. And if you continue 15 kilometers beyond Erfelek, a tovvnship 30 kilometers from Sinop, you vvill come to the falling vvaters. İN THE TAURUS...

Like the Black Sea, the Taurus range is a Virtual cradle o f vvaterfalls. The first route l ’m going to recommend for seeing them is the one through Alanya, Taşkent and Hadim. I knovv you're going to be afraid to glance dovvn sometimes as you negotiate the brinks of the precipices and that, when you reach Taşkent, this strange town nestled among the rocks is going to remind you o f the landscapes in Amin Maalouf's novels. The Uçan or ‘Flying’ VVaterfali on this >


Son 6 y ı l ı n Dakar Şampiyonu

M IT S U B IS H IP A J E R O E n g e lle r, zor k o ş u lla r , ra k ip le r. 0, b u n la rın h iç b ir i n i ta n ım ıy o r. T ıp k ı bu y ı l Dakar'da üst ü ste a lt ı n c ı şa m p iyo n lu ğ u n u k a za n ırk e n y a p t ığ ı g ib i. 0, şe h ird e de tüm b a k ış la r ı ü z e rin e to p lu yo r, parmak ıs ır t ıy o r . Çünkü o, M it s u b is h i Pajero. 1 1 . K E Z DAKAR Ş A M P İY O N U . Y E N İ M IT S U B IS H I w w w .t e m

s

a

MITSUBISHI MOTORS

.c o m . t r

o o


Amin Maalouf’un romanlarındaki coğrafyaları anımsatacağını biliyorum. Bu yolda bulunan Uçan Çağlayanı da, kayalıklardan Gökdere’ye düşerken gökkuşağı yaratma ustasına dönüşüyor. İkinci önerim, Güzelbağ-Gündoğmuş hattı üzerinden Köprülü’ye gitmeniz. Orada Alara Çayı’nın doğum yeriyle karşılaşacaksınız. Baharda küçük bir kanyonun ağzında patlayan Alara Çağlayanı, unutulmaz bir su bayramı yaşatacak size. SULARI YUTAN DELİK

Şiir yalnızca sözcüklerle yazılmaz; görüntülerle de yazılır. Antalya’daki Kurşunlu Çağlayanı da bu görüntülerden birini yaratıyor. Ağaçların arasından yürüyerek aşağıya indiğinizde, birden 12 metreden damlalarını

road is a past master at creating rainbows as it cascades över the rocks into the Gökdere below. My second recommendation is that you go to Köprülü via Gülbağ and Gündoğmuş, vvhere you will find the source o f the Alara River. A nd the Alara VVaterfalI, which bursts from the mouth o f a small gorge in spring like an unforgettable water festival, will positively delight you. A SW ALLO W HOLE

A yder Çağlayanı, Çamlıhemşin’in zengin flora ve faunasına eklenen bir su kolyesi (üstte). Ayder Falls adorns the rioh flora and fauna of Çamlıhemşin like a crystal necklace (above). 134 SKYLIFE 3 /2 0 0 6

Poems are not vvritten only with words; they are also written vvith images. A nd the Kurşunlu VVaterfalI at Antalya on the Mediterranean coast conjures up one o f those images. As you stroll amidst the trees, you will suddenly come upon a vvaterfall falling from a height o f 12 meters, as if keeping its promise to the voı'd. Meanvvhile its

aşağıya bırakan çağlayan ile karşılaşıyorsunuz. Boşluğa verdiği sözü tutmak için dökülür gibidir... Kurşunlu’nun ‘kardeşi’ Düden Çağlayanı da, Kırkgözler’de kendini yeryüzüne verip sonra, defalarca kaybolup yeniden ortaya çıkıyor. Düden, ‘su yutan delik’ anlamına geliyor. Yanındaki merdivenlerden büyük bir kayanın içine doğru inerken, uğultu gitgide artıyor. Birden kendinizi çağlayanın altında buluyorsunuz; altında dediğim, bir mağara ağzının üzerinden dökülen çağlayanın içindeymiş gibi... Hangi birini anlatayım? Kapuzbaşı’nı mı, Samandere’yi mi; Tortum’u mu, Ulukaya’yı mı? Hasanboğuldu’yu mu, Yerköprü’yü mü; Ayder’i mi, Gelintülü’nü mü? Bir 'su bayramı’ nasıl anlatılır? İyisi mi çağlayanların türküsünü dinlemek için yollara düşün siz.

cousin, the Düden (the word means ‘swallow hole’) vvaterfall, goes underground at Kırkpınar and then plays hide and seek vvith you, disappearing and reappearing över and över again. As you make your way down the adjacent steps and into a large rock, the roar gradually increases and you suddenly find yourself under the vvaterfall. I say 'under' but it feels as if you are actually inside a vvaterfall pouring över the mouth o f a cave. A nd that's not ali; there are many more: Kapuzbaşı, Samandere, Tortum, Ulukaya, Hasanboğuldu, Yerköprü, Ayder, Gelintülü. VVhich one to describe? How can one p u t a ‘festival o f vvater’ into vvords anyvvay? İf you want to hear the song o f the vvaterfalls, there's only one thing to do. And I think you knovv vvhat it is... □


Ankara Gereç, Teknolojileri, Donanımları, İhtiyaçları ve Trafik Ekipmanları 26-30 Nisan 2006 • Altınpark-ANKARA M

U

N

K

J P

Apnl 26-30,2006

F A

U U

T

A Y

R F

A

IR

Altınpark-Ankara/TÜRKİYE

Kent yaşamına kalite katanlar Ankara'da buluşuyor...

Thepeoplethatcontribute tothequality ofcitylife mevtinAnkara...

www.belediyefuari.com O rg a n iz a s y o n /O rg a n iz a tio n

FORZA

FORUM

AiSÎFA

FUARCILIK VE GELİŞTİRME A.Ş.

FAİRS S PROMOTIOHS CO. INC. www.foaimfuar.com

www.forumfair.com

FUARCILIK VE O RG ANİZASYON HİZMETLERİ A.Ş.

FAİRS S ORGANIZATION SERVICES CO. INC.

Meşrutiyet Cad. No: 44/5 06420 Kızılay-Ankara/TÜRKİYE Phone: +90 (312) 430 70 00 (pbx) • Fax: +90 (312) 430 70 03 www.forzafuar.com.tr • e-mail: info@forzafuar.com.tr

8u fu a r 5 1 7 4 sayılı K anun g ere ğ ince T ürkiye O dalar ve 8orsalar Birliği (TOBB) izni ile d ü z en le nm e kted ir.


■ H otels / Oteller

AKG Ü N İS T A N B U L

D E D E M A N İS T A N B U L

H O TE L (*****)

r*~)

H İLT O N İS T A N B U L

M Ö V E N P İC K HO TEL İS T A N B U L (*****)

88

T e l [212] 534 48 79 (20 Hat / Lines) Fax [212] 534 91 26 A d re s / A d re s s e s Adnan Menderes

T e l [212] 274 00 F a x [212] 275 11 00 A d re s / A d re s s e s Yıldız Posta Cad.

T e l [212] 315 60 00 F a x [212] 240 41 65 A d re s / A d re s s e s Cumhuriyet Cad.

T e l [212] 319 29 29 F a x [212] 319 29 00 A d re s / A d re s s e s Büyükdere Cad.

Bulvarı (Vatan Cad.) Topkapı İstanbul sales@akgunhotel.com http://www.akgunhotel.com

50 34340 İstanbul istanbul@dedeman .com.tr http://www.dedemanhotels.com

80200 Harbiye/İstanbul sales. istanbul@hilton.com http://www.hilton.com

4. Levent 34330 hotel.istanbul@moevenpick.com http://w ww.moevenpickistanbul.com .tr

R A D IS S O N SAS B O S P H O R U S

B A R C ELÖ ERESİN

D İVAN İS T A N B U L

H Y A T T R E G E N C Y İS T A N B U L

TO P K A P I H O TE L (*****)

O TELİ (*****)

m

H O TE L, İS T A N B U L (*****)

T e l [212] 631 12 12 F a x [212] 631 37 02 A d re s / A d re s s e s Millet Cad

Tel [212] 315 55 00 pbx F a x [212] 315 55 15 A d re s / A d re s s e s Cumhuriyet

T e l [212] 368 12 34 F a x [212] 368 10 00 A d re s / A d re s s e s Taşkışla Cad.

T e l [212] 260 57 57 F a x [264] 260 65 55 A d re s / A d re s s e s Çırağan Cad.

No: 186. 34104 Topkapı/'lstanbul eresintopkapi@barcelo.com

Cad. No:2 34437 Elmadağ / İstanbul divan@divan.com .tr http://www.divan.com.tr

No. 1 34437 Taksim istanbul@hyattintl.com

No:46 34349 Ortaköy/lstanbul

htt p ://w w w .barceloeresi ntopkapi.com

http://w ww.İstanbul.hyatt.com

ortakoy.istanbul@radissonsas.com http://www.radissonsas.com

C EYLA N IN T E R C O N T IN E N T A L

ELİT HOTELS

KAYA R A M A D A P LA ZA OTEL

RADISSON SAS C ONFERENCE &

O TEL (*****) T e l [212] 368 44 44 Fax [212] 368 44 99 A d re s / A d re s s e s

D RA G O S T e l [216] 441 61 60 F a x [216] 441 38 81 A d re s / A d re s s e s Piri Reis Cad. No:4

ve K O N G R E M E R K E Z İ (*****)

AIR PO R T HOTEL, İSTANBUL (*****)

T e l [212] 84 00 F a x [212] 17 85 A d re s / A d re s s e s £5 Otoyolu

T e l [212] 425 73 73 F a x [212] 425 73 63 A d re s / A d re s s e s E-5 Karayolu Üzeri

Asker Ocağı Cad. No:1 Taksim is:anbul@interconti.com. tr http://w ww.interconti .com.tr

Maltepe/İstanbul

Tııyap Yanı Büyükçekmece info@kayaramada.com http://www.kayaramada.com

34295 Sefaköy/lstanbul istanbul.turkey@radissonsas.com http://w ww.İstanbul.radissonsas.com

Ç IN A R O TEL

G R A N D C EV A H İR O TE L ve

K LA S SİS R E SO R T H O TE L

R A M A D A PLA ZA İS T A N B U L

(™ )

K O N G R E M E R K E Z İ (*****)

(*“ )

r*~)

T e l [212] 663 29 00 F a x [212] 663 29 21 A d re s / A d re s s e s Şev<etiye Mah.

T e l [212] 314 42 42 F a x [212] 314 42 44 A d re s / A d re s s e s Darülaceze Cad.

Tel [212] 727 40 50 F a x [212] 727 04 17 A d re s / A d re s s e s

T e l [212] 444 02 72 A d re s / A d re s s

Fener Mevkii 34149 Yeşilköy reservation@cinarhotel.com. tr http://www.cinarhotel.com.tr

No:9 Şişli / İstanbul sales@gch.com.tr http://www.gch.com.tr

Kargaburun mevkii. 34570 Silivri marketing@klassis.com.tr

Osmanbey-Şişli/lstanbul-Türkiye info@ramadaplazaistanbul .com

http://www.klassis.com.tr

http://www.ramadaplazaistanbul.com

info@hotelelite.net http://www.hotelelite.net

886 886

<S> Telephone:

In te rn a tio n a l c o d e fo r T u rk e y : 90. İstanbul area codes: E u ro p e a n s id e 212, A s ia n s id e 216. For intercity calls within

T u r k e y fir s t d ia l 0', then the area code, and then the local number.

F o r in te m a tio n a l c a lls first dial ' '.

00

136 SKYLIFE 3 /2 0 0 6

Halaskargazi Cad. No: 139-151 34373


R IC H M O N D NUA VVELLNESS

TH E R IT Z -C A R L T O N ,

A N T İK H O TEL

H O LID A Y IN N İS T A N B U L

SP A S A P A N C A (*****)

İS T A N B U L (*•***)

İS T A N B U L (****)

C IT Y TO P K A P I (****)

T e l [264] 582 21 00 F a x [264] 582 21 01 A d re s / A d re s s e s

T e l [212] 334 44 44 F a x [212] 334 44 55 A d re s / A d re s s e s Süzer Plaza,

T e l [212] 638 58 58 F a x [212] 638 58 65 A d re s / A d re s s e s Ordu Cad.

T e l [212] 530 99 00 F a x [212] 530 99 24 A d re s / A d re s s e s

Sahilyolu Sapanca

Elmadağ 34367 Şişli / İstanbul rc .istrz.reservations@ritzcarlton.com

Sekbanbaşı Sok. No: 10 Beyazıt info@antikhotel.com

http://www.ritzcarlton.com

http://www.antikhotel.com

Millet Cad. 187 Topkapı İstanbul info@hiistanbulcity.com http://www.hiistanbulcity.com

info@richmondnua.com http://www.richmondnua.com

S Ü R M E L İ İS T A N B U L H O TEL

G R A N D Ö Z T A N IK H O TEL

r*~)

D İVAN C IT Y İS T A N B U L

H O TE L VİLLA S Ü İTE

(****)

(****) T e l [212] 252 96 00 (20 hat) F a x [212] 249 70 77 A d re s / A d re s s e s Sıraselviler Cad

T e l [212] 272 11 60 Fax [212] 266 36 69 A d re s / A d re s s e s Prof.Dr.Bülent

T e l [212] 361 60 90 F a x [212] 361 60 78 - 79 A d re s / A d re s s e s Topçu Cad.

T e l [212] 337 49 00 F a x [212] 337 49 49 A d re s / A d re s s e s Büyükdere Cad.

Tarcan Sok. No:3 Gayrettepe/İstanbul

No:9/11 Taksim/İstanbul sales@grandoztanik.com

No:84 34398 Gayrettepe/İSTANBUL divancity@divan.com .tr

http://www.grandoztanik.com

http://www.divan.com.tr

salesist@surmelihotels.com nttp://www.surmelihotels.com

SVVISSÖTEL THE BOSPHORUS,

P O IN T H O TEL

İSTANBUL (***")

No:49 Taksim / İstanbul reservation@hotelvillaist.com http://www.hotelvillaist.com

ELITE H O TELS

K E R V A N SAR A Y H O TE L

m

m

T e l [212] 313 50 00 F a x [212] 313 50 30 A d re s / A d re s s e s

T e l [216] 388 87 87 F a x [216] 417 78 A d re s / A d re s s e s Cumhuriyet Cad.

T e l [212] 235 50 00 Fax [212] 253 43 78/79 A d re s / A d re s s e s

ask-us.istanbul@swissotel.com istanbul@swissotel.com nttp://www.swissotel.com.tr

Topçu Cad. No:2 Taksim/İstanbul info@pointhotel.com

Tan Sok.No:4 Küçükyalı/İstanbul info@hotelelite.net

Şehit Muhtar Cad. No: 61 .Taksim

http://www.pointhotel.com

http://w ww.hotelelite.net

TH E M A R M A R A

A IR P O R T A DELA

ER ES İN TA X İM HO TEL

LARESPARK HOTEL

İS T A N B U L (*****)

H O TEL (****)

(****)

(“ )

T e l [212] 251 46 96 F a x [212] 244 05 09 A d re s / A d re s s e s

T e l [212] 503 31 33 F a x [212] 503 42 72 A d re s / A d re s s e s

T e l [212] 256 08 03 F a x [212] 253 22 47 A d re s / A d re s s e s ropçu Cad. 34,

T e l [212] 254 51 00 F a x [212] 254 71 60 A d re s / A d re s s e s

Taksim Meydanı Taksim ıstanbul -info@themarmarahotels .com

Londra Asfaltı No:38, Ataköy info@adelahotel.com .tr htt p ://w w w .adelahotel.com .tr

Taksim Istanbul/Turkey eresin@eresintaxim.com .tr

Topçu Cad. No: 23 Taksim

Tel [212] 326 11 00 Fax [212] 326 1122 A d re s / A d re s s e s Bayıldım Cad. No:2 Maçka 34357 Beşiktaş

nttp://www. themarmarahotels.com

86

34437

http://www.eresintaxim.com.tr

kervansaray@kervansarayhotel.com http://w ww.kervansarayhotel .com

istanbul@laresparkhotel.com http ://w w w .laresparkhotel.com

3 /2 0 0 6 SKYLIFE 137


İSTANBUL GUIDE

E0E

R IC H M O N D İS T A N B U L

Y E N İŞ E H İR PALAS

B EBEK O TEL

ER ESİN C R O W N H O TE L (S)

m

m

(S)

T e l [212] 252 54 60 F ax 1212] 252 97 07 A d re s / A d re s s e s

T e l [212] 252 71 60 (10 Hat-10 Lines) F a x .'212] 249 75 07 A d re s / A d re s s e s Meşrutiyet Caddesi

T e l [212] 358 20 00 F a x [212] 263 26 36 A d re s / A d re s s e s Cevdetpaşa Cd.

T e l [212] 638 44 28 F a x [212] 638 09 33 A d re s / A d re s s e s

İstiklal Cad. No: 445 Tünel Beyoğlu

Oteller Sk. No: 1 -3 80050 Tepebaşı

info@richmondhotels.com .tr http ://w w w .richmondhctel s .com .tr

yenisehirpalas@yenisehirpalas.com http://www.yenisehirpalas.com

No: 34 80810 Bebek İstanbul bebekhotel@bebekhotel .com .tr

Sultanahmet İstanbul, TURKEY eresin@eresincrown.com.tr

http://www.bebekhotel.com.tr

http://www.eresincrown.com.tr

TA K S İM M ETR O P A R K

A K G Ü N H O TEL

B E N T LE Y OTEL

KG & CC HOTEL (S)

H O TEL (****)

r*)

(S)

T e l [212] 292 62 00 F a x [212] 292 51 11 A d re s / A d re s s e s Gümüşsüyü Mah.

T e l [212] 291 77 30 (pbx) F a x [212] 291 77 40 A d re s / A d re s s e s Halaskargazi Cad.

T e l [212] 239 70 10 F a x [212] 239 73 76 A d re s / A d re s s e s

İnönü Cad. Osmanlı Sok. No: 14

T e l [212] 638 28 38 F a x [212] 638 28 60 A d re s / A d re s s e s Ordu Cad.

34870 Taksim/İstanbul satis@taksimmetropark.com http://www.taksimmetropark.com

Hazinedar Sok. N o Beyazıt İstanbul akgunlaleli@superonline.com http://www.akguntravel.com

No: 75 80220 Harbiye

TA K S İM SQ U A R E

A İR P O R T HO TEL

BOSPHORUS PALACE HOTEL

H O TEL (****)

TA V (S)

(S)

G A Y R E TTE P E (S)

T e l [212] 292 64 40 pbx Fax [212] 292 64 49 A d re s / A d re s s e s

T e l [212] 465 40 30 F a x [212] 465 47 30 A d re s / A d re s s e s Atatürk Havalimanı

T e l [216] 422 00 03 F a x [216] 422 00 12 A d re s / A d re s s e s Yalıboyu Cad.

T e l [212] 288 95 90 F a x [212] 273 09 84 A d re s / A d re s s e s

Sıraserviler Cad. No: 15, Taksim

Dış hatlar Terminali Yeşilköy/İstanbul

No:64 Beylerbeyi 34676

info@taksimsquarehotel.com .tr http ://www. taksimsguarehotel.com .tr

airporthotel@bta. com .tr http://www.airporthotelistanbul.com

reservation@ bosphoruspalace.com h ttp ://w w w .bosphoruspalace.com

Rüştübey Sok. No:2 Gayrettepe/İstanbul info@residencegayrettepe.com http ://www. residencegayrettepe.com

:6

istanbul@bentley- hotel.com http://w ww.bentley-hotel .com

Küçük Ayasofya Cad. 40

Kemer Golf & Country Club, KG & CC Kampüsü Kemerburgaz/İstanbul hayatreception@ kemercountry.com h ttp ://w w w . kg -c c .com

TH E R E S ID E N C E

mm ■ Em ergency Am bulance

Tel: 112 (Ali över Turkey) Poliçe

Tel: 155 (Ali över Turkey) Fire TH E M A R M A R A PERA

138 S kY LİF E 3 /2 0 0 6

A N SEN 130 S U ITE S H O TEL

B O U T IO U E H O TE L RİVA (S) T e l [212] 343 97 57 (pbx) F a x [212] 343 97 67 A d re s / A d re s s e s Rumeli Cad. No: 15

m

& R E S TA U R A N T (S)

T e l [212] 251 46 46 F a x [2^2- 249 80 33 A d re s / A d re s s e s Meşrutiyet Cad.

T e l [212] 245 08 F a x [212] 245 71 79 A d re s / A d re s s e s Meşrutiyet Cad

Tepebaşı 34430 pera -info@themarmarahotels.com

Ansen 130 34430 Tepebaşı Tünel info@ansensuites.com

http ://w w w .themarmarahotels.com

http://www.ansensuites.com

88

34371 Nişantaşı/İstanbul riva@rivahotel.com .tr http://w ww.rivahotel.com .tr

Tel: 110 (Ali över Turkey) Tourism poliçe

Tel: 527 45 03 G end arm e

Tel: 156 (Ali över Turkey) C o a st Guard

Tel: 158 (Ali över Turkey)


■ Tourism Information

Turizm Danışma

The first personal Modem Art Museum of Turkey. / Türkiye'nin ilk kişisel Modem Sanat Müzesi.

Atatürk Airport

Atatürk Havaalanı (Yeşilköy) Tel: 663 07 93 Harbiye Tourism Information

Tel: 233 05 92 Karaköy Sea Port

Karaköy Limanı, Tel: 249 57 76 Sirkeci Tourism Information

Sirkeci Turizm Danışma Müdürlüğü, Tel: 511 58 88

Haghia Sophia

Ayasofya Müzesi Sultanahmet, Tel: 522 09 89 A Byzantine church for close to 1000 years, an Ottoman mosque for 500, this historic treasure has been a museum since 1935. Bin yıla yakın Bizans'ta kilise, yaklaşık 500 yıl OsmanlI'da cami, 1935'ten beri de müze olan bir tarih hâzinesi.

Sultanahm et Square

Sultanahmet Meydanı, Tel: 518 18 02 Association of Turkish Travel A gencies / Türkiye Seyahat

Acentalan Birliği (TURSAB) Dikilitaş Beşiktaş, Tel: 259 84 04 tursab@tursab.org.tr The Turkish Touring and Autom obile Club

Türkiye Turing ve Otomobil Kurumu (Head Office - Merkez) Tel: 282 81 40

■ Museums / Müzeler Archeological Museum

İstanbul Arkeoloji Müzelen Osman Hamdi Bey Yokuşu Gülhane, Tel: 520 77 40 09,00-16.30, closed Mondays / pazartesi kapalı The museums, each of which consists of a main building and annex, house rich collections extending from prehistory to Byzantium and including the sarcophagus of Alexander the Great as well as finds unearthed at Troy. Ana bina ve ek bina olmak üzere iki ayrı yapıdan oluşan müzeler, prehlstoryadan Bizans'a uzanan, aralannda İskender Lahti'nin ve Troya buluntularının da yer aldığı çok zengin bir koleksiyona sahip. Atatürk Museum

Atatürk Müzesi Şişli, Tel: 240 63 19 Byzantine Great Palace Mosaic Museum

Büyük Saray Mozaikleri Müzesi Torun Sokak, Arasta Çarşısı, Sultanahmet, Tel: 518 12 05 Calligraphy Museum

Hat Sanatları Müzesi Beyazıt, Tel: 527 58 51 Church of St. Saviour in Chora

Kariye Müzesi Edimekapı, Tel: 631 92 41 Doğançay Museum

Doğançay Müzesi Beyoğlu, Tel: 244 77 70

İstanbul Modern

Meclis-i Mebusan Cad. Liman İşletmeleri Sahası Antrepo No: 4 Karaköy, Tel: 243 43 18 10.00-18,00, closed M ondays/ pazartesi kapalı

The Post, Telephone and Telegraph (PTT) Museum

PTT Müzesi Postane Sok. Hobyar Mah. Zaptiye Cad. Eminönü (Büyük Postane'nin içinde / in the Great Post Office) Tel: (0212) 519 19 99 Rahmi M. Koç Industrial Museum

Rahmi M. Koç Sanayi Müzesi, Hasköy Tel: 256 71 53-54 Ottom an Bank Museum

Osmanlı Bankası Müzesi Voyvoda Cad. (Bankalar Caddesi) Karaköy, Tel: 334 22 70 Sakıp Sabancı M useum

Sakıp Sabancı Müzesi Emirgân, Tel: 277 22 00

Military Museum

Askeri Müze Harbiye, Tel: 232 16 98 09.00-16.30, closed Mondays and Tuesdays / pazartesi ve salı kapalı This museum is host to regular concerts by the Mehter band playing Ottoman military music. Müzede düzenli olarak Mehter takımı konser veriyor. Museum of Caricature and Humour

Karikatür ve Mizah Müzesi Fatih, Tel: 521 12 64

Sadberk Hanım Museum

Sadberk Hanım Müzesi Sarıyer, Tel: 242 38 13

500. Yıl Vakfı-Türk Musevileri Müzesi, Karaköy, Tel: 292 63 33

B lue M o s q u e

Sultanahmet Camii Tel: 518 13 19 The Blue Mosque takes its name from the İznik tiles that adorn its interior, / Mavi Cami olarak da bilinen yapı, adını içini süsleyen mavi İznik çinilerinden alır. S ü le y m a n iy e M o s q u e

Süleymaniye Camii Prof. Sıddık Sami Onar Cad. Vefa, Tel: 514 01 39 Designed and built by Mimar Sinan, the most famous of Ottoman architects, this mosque was erected for Süleyman the Magnificent and is the largest mosque in İstanbul. OsmanlI'nın en ünlü mimarlarından Mimar Sinan’ın eseri olan cami, Kanuni Sultan Süleyman için yaptırılmıştır. İstanbul'un en büyük camisidir. Y eni M o s q u e

The Aşiyan M useum

Aşiyan Müzesi Bebek, Tel: 263 69 86 The City M useum Şehir Müzesi Yıldız, Tel: 258 53 44 The Tanzim at Museum

Tanzimat Müzesi Gülhane Parkı, Tel: 512 63 84 Topkapı Palace Museum

Museum of Turkish Jew sThe 500th Year Foundation

■ Mosques / Camiler

Topkapı Sarayı Müzesi Sultanahmet, Tel: 512 04 80

Yeni Cami Yeni Cami Meydanı Eminönü Among the most majestic of the 'sultan' mosques on the seashore, this mosque is also knovvn for the pigeons which crowd its courtyard, and for the people who feed them. Deniz kıyısındaki sultan camilerinin en görkemlilerinden olan yapı, avlusundaki güvercinler ve onlara yem verenlerle de bilinir.

■ C hurches and synagogues

TÜRVAK C inem a and Television M useum / TÜRVAK Sinema ve

Kilise ve sinagoglar

Televizyon Müzesi Beykoz, Tel: 425 19 00

Resim ve Heykel Müzesi

A yios Y e o rg io s (G re e k O rth o d o x P a tria rc h a l C hurch o f S t. G eorge)

VVomen’s Library and

Beşiktaş, Tel: 261 42 98 This museum, which houses the most comprehensive collectlon of Turkish painting,

Information Ç enter Foundation

Sadrazam Ali Paşa Cad. 35 Fener, Tel: 531 96 70-6

Kadın Eserleri Kütüphanesi ve Bilgi Merkezi, Haliç, Tel: 534 95 50

T h e C rim e a n M e m o rial

Museum of Painting and Sculpture

also has sculpture, ceramios and original prints. Türk Resim Sanatfyla ilgili en kapsamlı koleksiyonu barındıran müzede heykel, seramik ve özgün baskılar da yer alıyor.

Yıldız Palace Museum

Yıldız Sarayı Müzesi Beşiktaş, Tel: 258 30 80

C h ris t C h u rc h , (A nglican)

Serdarı Ekrem Sok. 82, Tünel, Tel: 251 56 16 (Behind the Swedish Consulate) Holy Eucharist Sundays 10:00 a.m. D utch C h a p e l (U nion C hurch)

■ Palaces / Saraylar Beylerbeyi Palace

İstiklal Caddesi, Dutch Consulate Beyoğlu, Tel: 244 52 12 Sunday service in English.

Museum of Turkish and Islamic Art / Türk ve İslam Eserleri Müzesi

Beylerbeyi Sarayı,

Beylerbeyi, Tel: 321 93 20

İs ta n b u l P res b yte ria n C hurch

İbrahim Paşa Sarayı Sultanahmet, Tel: 518 18 05-06 08.30-16.30, closed Mondays / pazartesi kapalı

Dolmabahce Palace

Yusuf Kamil Paşa Sok. Moda, Tel: 449 39 74

Naval M useum / Deniz Müzesi

Beşiktaş, Tel: 327 43 45 Pera M useum / Pera Müzesi Meşrutiyet Cad. No: 141 Tepebaşı Beyoğlu Tel: (0212)334 99 00

Dolmabahçe Sarayı Beşiktaş, Tel: 258 55 44 Ihlamur Kasir / Ihlamur Kasrı Beşiktaş, Tel: 261 29 91 Maslak Kasirs / Maslak Kasırları Maslak, Tel: 276 10 22 Yıldız Kiosks: Şale, Malta and Çadır Yıldız Köşkleri: Şale, Malta ve Çadır, Yıldız Parkı, Tel: 276 10 22

N eve S h a lo m (S ynagog ue)

Şişhane, Tel: 244 75 66-293 87 95 San A n to n io di P a d o v a (C ath o lic)

Beyoğlu, Tel: 244 09 35 Sunday service in English, Italian, Polish. S t. M a ry ’s C a th e d ra l (A rm enian P a tria rc h a te )

Kumkapı, Tel: 516 25 17 3 /2 0 0 6 SKYLIFE 139


A -:

G Ü N EŞLİ

KOC* , S İN A N

/

NS. ’’ X

"

J

(0216) 125 78 74

T M YAYINLARI

Gürbüz

YE Ş İL K Ö Y

.

( A IR P O R T )

ATATÜRK HAVALİMANI &

ATAKÖY

r ^ râ ö a

SOPAfl/

Bakırköy

H^NfeDAR

G Ü N E Ş T ^jP E

Y E N İG Ü N

AJ-İBEYI

EYÜP/

\V

KARLITEP;

pazarı

Yn.Di^TAq

•ŞILI^N^

FEVZİ Ç A K M A K

Ç IR Ç IR

BAYRAMPAŞA

GUNGC

'•« A Ğ C IL A R

B A H C E L IE V L E R

MtriKŞZ •'

_ v

>

BAĞCILAR

^^AffVlUTBEY

[^(GOZTEPF

S U L t N Ç İF T LİĞ İ

GAZI> • ' ’

G A Z İO S M A N P A Ş A

CEBE<3 & f Ş | x ğ k

G A Z İO S M A N I H ABİBL,£f

:ER(KOY,

PİYAtEPA^AV

B E Y O G L U 'j

K Mustafa Paşa İst.

Karaköy. Em inönü

M EC İD IYE KÖ V

XAĞLAYAN

W:\ yBJRTUu|âj H & IC I O Ğ I U

-

~ İR G A N İ

IM O D /

Si

f

6

Bostancı

,_Suadryeİst .6U A D İYÖ

ÇAVUŞ!

H eybelıada

Maltepe İst

. ÎP E A L T K P E ' ^Sûreyyapaşa İst

Cevı/liİst

GÜ LS U YU

FERHAT

Ç ekm ek öy

K A YtfcDA Ğ ! ı

ıLTEPE

«Ü Ç U K Y A Ü

ÜMRANİYE

KO ZY ATAG İ

SAM^YICEDif'

_

F ne«yol^j Ckhtepeİtt.

'B U L Ö U R U J ,

B U R u iİY B

ÜSK ÜD AR

KÜPLÜGE"^B

Vantköy

1'

P A 5A O A H Ç E

bukuJ BEYK O Z

V A N İK Ö y '

■ A n jİM

:M san\ ^

İC A D I

H aydarpaşa Kadıköy v_

‘.KOY-

*

K

Beykoz Paşaba/lçe

i i K A N L IC A /fo n /;«

A rn b vu tko y T

FjfS B E T lY E ’

A K A ÎL A R ’

- ^

. Istin ye

!U

yÇnıköy İS T İN Y E ;-

// Tarahya f j TARABYA • i

^ s T k ir e ç b u r n u

KAĞITHANE

B a h çekö y

'j^İYlRBASl

Sarıyer

Karta!

Rahmanlar İst.

KARTAL

Sarıgazi

Ş a m a n d ıra

Yenidoğan

1

3

0

G Ü LLU f

EYLİ

Otoyol Numarası (RoadNum bers)

Otoyol (Motorvvay)

Tramvay (Tramvvay) Dem iryolu (RalKvay)

H afif Metro (LightTube) Metro (Metro)

KM

I- - .......

0

İSTANBUL J

Tren Durağı (TrainStation)

Tramvay Durağı (Tramvvay Stop)

M etro Durağı (M etro Stop)

H afif Metro Durağı (LightTube Stop)

(Turkish Airlines Sales O ffice) Cadde (Road)

THY Satış Ofisi


MobilBağlantı Paketi İnternete kablosuz bağlan, özgürlüğü yaşa

AVEA KURUMSAL A vea’dan Kurum lara Özel MobilBağlantı Paketi Artık dizüstü bilgisayarınızla, istediğiniz yerden şirketinizin kurumsal ağına bağlanabilir, e-postalarınızı kontrol edebilir ve internette gezinebilirsiniz. Üstelik Kablosuz WLAN destekli GC89 PC Kartı sayesinde Wi-Fi noktalarına girdiğinizde yüksek hızda veri alışverişi yapabilir, Avea’nın EDGE kapsama alanı içinde GPRS’den 3 kata kadar daha hızlı kablosuz veri iletişimi sağlayabilirsiniz. Avea VVİreless Manager yazılımı sayesinde ise bağlantı ayarlarıyla vakit kaybetmeden kolayca bağlantı kurabilirsiniz. MobilBağlantı Paketi ile ilgili daha fazla bilgi almak için Avea Kurumsal Müşteri Hizmetleri’ni (444 1 550) arayabilirsiniz. Avea MobilBağlantı Paketi'nin içindekiler • • • •

Sony Ericsson GC89 PC Kartı (EDGE/GPRS WLAN destekli) Avea VVİreless Manager yazılım CD'si MobilData tarifesi ile sunulan Avea SİM kartı ve hattı 24 ay boyunca 25MB’lik GPRS/EDGE kullanımı

avea 64‘

25M B

Şimdi konuşma zamanı Avea Kurum sal

i H izm etleri


■ H otels / Oteller

A K T İF M E TR O P O LIT A N

B Ü Y Ü K A N A D O LU

SVVISSOTEL ANK A RA

H O TE L (* ** " )

H O TE L (" * * * )

r***)

H O TE L (****)

T e l [312] 295 45 45 F a x [312] 284 42 42

T e l [312] 841 64 64 F a x [312] 841 62 30 A d re s / A d re s s e s Esenboğa Havaalanı

T e l [312] 409 30 00(Pbx) F a x [312] 409 33 99 A d re s / A d re s s e s Yıldızevler Mah.

T e l [312] 287 60 65 F a x [312] 284 44 34 A d re s / A d re s s e s

Yolu 27. Km Akyurt/Ankara-TURKEY

21. Sok. No: 2 06550 Çankaya Ankara

info@buyukanadoluhotel.com http://w ww.buyukanadoluhotel .com

reservations.ankara@swissotel.com http://www.ankara.swissotel.com

Konya Yolu No: 84 Balgat reserv@hotelcapitalplaza.com http://www.hotelcapitalplaza.com

A N K A R A ETAP

D E D EM A N

AKAR IN T E R N A T IO N A L

D E D E M A N ANK A RA

A LTIN E L H O TE L (**•**)

C A P P A D O C IA (“ ***)

H O TE LS (****)

m

T e l [312] 231 77 60 F a x [312] 230 23 30 A d re s / A d re s s e s GMK Bulvarı No. 151

T e l [384] 213 99 00 F a x [384] 213 21 58 A d re s / A d re s s e s

T e l [312] 232 10 10 F a x [312] 232 20 06 A d re s / A d re s s e s Gazi Mustafa Kemal

T e l [312] 417 62 00 F a x [312] 417 62 14 A d re s / A d re s s e s Akay Cad.

Tandoğan / Ankara

Ürgüp yolu 2. km. 50200 Nevşehir kapadokya@dedeman .com .tr

Bulvarı No: 111 Maltepe Ankara info@akarhotel.com http://www.akarhotel.com.tr

ankara@dedeman.com .tr

Adres / AdressesOğuzlar Mah. 48. Sok. No.28 06520 Balgat-Ankara info@metropolitanhotel.com.tr http://www.metropolitanhotel.com.tr

info@altinelhotels.com .tr http://www.altinelhotels.com.tr

http ://www. dedemanhotels.com

C A P ITA L PLAZA

Büklüm Sokak 1 06660 Ankara http://w ww.dedemanhotels.com

m

A NK A RA H İLT O N S A

S H E R A TO N H O TE L &

r***)

C O N V E N T IO N Ç E N T ER (*•***)

T e l [312] 455 00 00 Fax [312] 455 00 55 A d re s / A d re s s e s

T e l [312] 468 54 54 F a x [312] 467 36 A d re s / A d re s s e s

Tahran Cad. No. 12, 06700 Ankara sales .ankara@hilton.com

Noktalı Sok. Kavaklıdere 06700 Ankara

195 Atatürk Bulvarı Kavaklıdere

No:89 Maltepe/Ankara

sheraton@sheratonankara.com http://www.sheraton.com/ankara

reservation@besthotel.com.tr http ://w w w .besthotel.com .tr

ankara@hotelickale.com http://www.ickale.com

BİLKENT OTEL VE

S Ü R M E L İ A NK A RA H O TE L

A P A R T H O TE L BEST

H O TE L M İD A S

KONFERANS MRK. (***")

(

m

(****)

http://w ww.ankara.hilton .com

11

A NK A R A H O TE L B EST (****)

H O TE L İÇKALE

T e l [312] 467 08 80

m

[312] 444 best (2378)

F a x [312] 467 08 85 A d re s / A d re s s e s

T e l [312] 231 77 10 F a x [312] 230 61 33 A d re s / A d re s s e s G.M.K Bulvarı

© Telephone:

In te r n a tio n a l c o d e fo r T u rk e y : 90. Ankara area code: 312. For intercity calls within

T u r k e y fir s t d ia l 0 ’, then the area code, and then the local number.

F o r in te rn a tio n a l c a lls first dial ’OO'. 142 SKYLIFE 3 /2 0 0 6

86

)

T e l [312] 266 46 F a x [312] 266 46 79 A d re s / A d re s s e s

T e l [312] 231 76 60 pbx - 10 hat F a x [312] 229 51 76 A d re s / A d re s s e s

T e l [312] 446 80 80 F a x [312] 446 80 90 A d re s / A d re s s e s

T e l [312] 424 01 10 F a x [312] 424 05 20 A d re s / A d re s s e s Tunus Cad. No.20

Bilkent 1 .Cad. 06800 Bilkent/Ankara info@bilkentotel.com.tr http://www.bilkentotel.com.tr

Cihan Sok. No 06430 Sıhhiye/Ankara salesank@surmelihotels.com http://www.surmelihotels.com

Uğur Mumcunun Sok. 71, G.O.P reservation@bestapart.com .tr http ://w w w .bestapart.com .tr

Kavaklıdere 06680/Ankara midas@hotelmidas.com http://www.hotelmidas.com

:6


H O TE L M İD İ

P E R İS S İA HO TEL

A N K A R A O Ğ U L TÜ R K

İLCİ R E S ID E N C E H O TE L

(****)

C A P P A D O C IA (****)

H O TE L (***)

(S)

T a l [312] 409 64 34 F a x '312] 409 64 00 A d re s / A d re s s e s

T e l [384] 341 29 30 F a x [384] 341 45 24 A d re s / A d re s s e s

T e l (312] 309 29 00 Fa* [312] 311 83 21 A d re s / A d re s s e s Rüzgarlı

Tel [312] 230

Karyağdı Sok. No: 40 Çankaya

PK 50401 Ürgüp / Nevşehir info@perissia.com.tr

reservation@ogulturk.com

No: 135 06570 Maltepe Ankara info@ilciresidence.com

http://www.perissia.com.tr

http://www.ogulturk.com

http://www.ilciresidence.com

LIM A K A M B A S S A D O R E

rez@midihotel.com http://vwwir.midihotet.com

.68

Eşdost Sok. No

:6Ulus

8686

F a x [312] 229 23 24 A d re s / A d re s s e s G.M.K Bulvarı

HO TEL STA R GAP

R A D IS S O N SAS H OTEL,

C A P P A D O C IA CAVE

r~)

ANK A RA (****)

S U IT E S (S)

B O U TIO U E H O TE L (S)

T e l [312] 310 48 48 F a x 312] 309 36 90 A d re s / A d re s s e s istiklal Cad. No:20

T e l [384] 271 28 00 F a x :384] 271 27 99 A d re s / A d re s s e s Gafferli Mah.

T e l [312] 428 48 48 F a x (312] 428 34 34 A d re s / A d re s s e s Boğaz Sokak

06030 Ulus/Ankara info@radissonsas.com

Ünlü Sok. No: 19 Göreme Nevşehir info@cappadociacavesuites.com

http://www.radissonsas.com

http://www.cappadociacavesuites.com

No: 19 06700 Kavaklıdere Ankara ambassadore@limakhotels.com http://www.ambassadorehotel.com

T e l [312)310 24 1 5 - 3 1 0 46 91 Fax [312] 311 79 79

A d re s / A d re s s e s Kazım Karabekir Cad. No:74/1 Ulus/Ankara info@stargaphotel.com http://www.stargaphotel.com

K APA D O K YA LO DG E

R A M A D A ANK A RA

G O R D IO N HO TEL

M E G A R E S ID E N C E

C O U N T R Y C LU B (****)

m

(S)

H O TE L A N K A R A (S)

T e l [384] 213 99 45

T e l [312] 428 20 00 F a x [312] 428 47 27 A d re s / A d re s s e s Tunalı Hilmi Cad.

T e l [312] 427 80 80 F a x [312] 427 80 85 A d re s / A d re s s e s Tunalı Hilmi Cad.

T e l [312] 468 54 00 Fax [312] 468 54 15 A d re s / A d re s s e s

Büklüm Sok. No:59 Kavaklıdere/Ankara

Tahran Cad. No:5 Kavaklıdere

efidan@gordionhotel.com http://w w w .gordionhotel.com

ankara@megaresidence.com http://www.megaresidence.com

Fax [384] 213 50 92

A d re s / A d re s s e s P.O. Box 48, TR-50200 Nevşehir/Türkiye kapadokya@kapadokyalodge.com http://www.kapadokyalodge.com

:66

No Kavaklıdere/Ankara ramadaankara@ramadaankara.com http://www.ramadaankara.com

r

r

n

n

n

n

T jm rn rn n □ n a □ □

ı

n

i

t

3 1

□ □ □ □

PERİ TO W ER HOTEL

SERGAH

G Ü L KON AK LA R I

M U S E U M H O TE L

CAPPA D O C IA (****)

HO TEL (****)

(S)

(S)

T e l [384] 212 16 F a x [384] 213 90 28 A d re s / A d re s s e s Adnan Menderes Blv.

T e l [312] 310 85 00 F a x [312] 311 31 00 A d re s / A d re s s e s Çankırı Cad.

T e l [384] 353 54 F a x [384] 353 54 87 A d re s / A d re s s e s Sümer Mah.

T e l [384] 219 22 20 F a x [384] 219 24 44 A d re s / A d re s s e s Tekelli Mah.

Otel Cad. No: 13 Nar Kasabası Nevşehir info@peritcwer. com http://www.peritcwer.com

No:48 Ulus/Ankara info@sergah.com

50420 Mustafapaşa-Ürgüp Nevşehir info@rosemansions.com

http ://w w w .sergah.com

www.rosemansions.com / www.dinler.com

No. 1 50240 Uçhisar / Nevşehir info@museum-hotel.com http://www.museum-hotel.com

88

86

3 /2 0 0 6 SKYL FE 143


GUIDE

- KAPADOKYA ANKARA

■ Em ergency A m b u la n c e

Tel: 112 (Ali över Turkey) Poliçe

M useum o f th e R epublic

Ankara Citadel / Ankara Kalesi

Independence M useum

Cumhuriyet Müzesi II. Türkiye Büyük Millet Meclisi Binası Cumhuriyet Caddesi, No: 22 Ulus, Tel: 310 53 61 09.00-17.00, closed Mondays / pazartesi kapalı The Meeting Hail of the National Assembly vvith its original fumishings, the chambers vvhere the Atatürk reforms were hammered out, and documents and certain personal objects reflecting the periods of the first three presidents, Atatürk, İsmet İnönü and Celal Bayar. Özgün eşyaları ile Meclis Toplantı Salonu, Atatürk ilke ve inkılaplarının anlatıldığı odalar, ilk üç cumhurbaşkanının, Atatürk, İsmet İnönü, Celal Bayar dönemlerini yansıtan belgeler ile bazı şahsi eşyaları

Hisarparkı Caddesi The castle, vvhich has guarded the city for centuries, is now a Symbol of Ankara and its history is as old as the city itself, Today vvithin the castle vvalls there are a number of Ottoman-style houses dating as far back as the 17th century. / Asırlardır kentin bekçiliğini yapan ve tarihi kentin tarihi kadar eski olan Ankara Kalesi, kentin sembolüdür. Kale içinde 17, yüzyıldan bugüne kalan ve Osmanlı mimarisini yansıtan Ankara evlerini görebilirsiniz.

Atatürk ve Kurtuluş Savaşı Müzesi Anıtkabir Komutanlığı Anıttepe, Tel: 231 79 75

Tel: 155 (Ali över Turkey) Fire

Çengelhan Rahmi M . Koç

Tel: 110 (Ali över Turkey)

M useum / Çengelhan Rahmi M. Koç Müzesi Sutepe Mah. Depo Sok. No: 1 Altındağ, Tel: 309 68 00

To u ris m po liçe

Tel: 527 45 03 G e n d arm e

Tel: 156 (Ali över Turkey) C o a s t G uard

Tel: 158 (Ali över Turkey)

■ T o u rism In fo rm a tio n

Turizm Danışma M in is try o f C u ltu re and

Ethnographic Museum

Etnografya Müzesi Talat Paşa Bulvan Ülkü Sok. No: 4 Opera, Tel: 311 30 07 08.30-12.30; 13.00-17.00, closed Mondays / pazartesi kapalı

To urism

Kültür ve Turizm Bakanlığı Bahçelievler, İsmet İnönü Bulvarı 5, Tel: 212 83 00

Gordion Museum

Gordion Müzesi Yassıhöyük köyü Polatlı, Tel: 638 21 88

sergileniyor.

08.30-17.00, open daily / her gün W a r o f In d e p e n d e n c e

P rov in c ia l D ire c to ra te / A n k a ra İl Tu rizm M üd ürlüğ ü

MTA, Natural History Museum

M useum

Eski Adliye Binası Anafartalar Cad. No: 65 Ulus, Tel: 310 68 18

MTA, Tabiat Tarihi Müzesi Eskişehir Yolu, Balgat, Tel: 287 34 30 09.00-17.00, open daily / her gün The museum exhibits fossils, minerals and rock examples from ali geological eras. Here you can see the assembled original skeleton of the Maraş elephant (Elephas indicus) dating from the second half of the first millenium BC, and the fossilized footprints found in Manisa belonging to people who lived in Anatolia approximately 25,000 years ago. Müzede, yerbilimlerinin tüm evrelerine ait fosil, mineral ve kaya örnekleri sergileniyor. Burada MÖ 1000. yılın ikinci yansında yaşamış olan Maraş filinin (elephas indicus) orijinal iskelet montesi ile yaklaşık 25 bin yıl önce Anadolu’da yaşamış insanlann, Manisa'da bulunan fosil ayak izlerini görebilirsiniz.

Kurtuluş Savaşı Müzesi I. Türkiye Büyük Millet Meclisi Binası Cumhuriyet Caddesi No: 14 Ulus, Tel: 310 71 40 08.30-12.00 / 13.30-17.00, closed Mondays / pazartesi kapalı.

To urism In fo rm a tio n

Turizm Danışma Maltepe G.M.K Bulvarı 121, Tel: 231 55 72 E s e n b o ğ a A irp o rt In te rn a tio n a l T e rm in a l /

Esenboğa Havaalanı Dış Hatlar Terminali Tel: 398 00 00 / 1578 398 03 48 To urism P o liç e / Turizm Polisi

Ankara Emniyet Müdürlüğü, Tel: 384 06 06

■ M u se u m s / Müzeler Ankara S tate M useum of Painting and Sculpture

Ankara Devlet Resim ve Heykel Müzesi Opera - Ulus, Tel: 310 20 94 09.00-12.00; 13.00-17.00, olosed Mondays / pazartesi kapalı Atatürk’s Mausoleum

Anıtkabir Müzesi Anıtkabir Komutanlığı, Anıttepe, Tel: 231 79 75 09.00-16.00, open daily / her gün A museum devoted to various objects belonging to Atatürk and the gifts presented to him by visiting men of State. Atatürk'e ait çeşitli eşyalar, kendisini ziyaret eden yabancı devlet adamlarının sunduklan armağanlann sergilendiği bir müze. 144 SKYLIFE 3 /2 0 0 6

Atatürk and the W ar of

Museum of Anatolian

■ S ig h tseein g Gezinti Ahi Elvan M o s q u e

Ahi Elvan Camii Ahi Elvan Mah. Pirinç Sok. Koyun Pazarı The mosque vvas built after the Seljuks, either in the Akhi or early Ottoman periods (the end of the 14th and beginning of the 15th century). The mosque's pulpit is interesting because of its wood carving and form, Selçuklulardan sonra Ahiler veya OsmanlIların ilk devirlerinde (14. yy sonu, 15. yy başı) yapılmıştır. Caminin minberi ahşap işçiliği ve şekliyle ilgi çekicidir.

Civilisations

Anadolu Medeniyetleri Müzesi Gözcü Sok. No: 2 Ulus, Tel: 324 31 60-62 08.30-17.00, open daily / her gün Anatolian archaeological remains starting from the Palaeolithic Period are exhibited at the museum in chronological order, and include artifacts from the Neolithic city of Çatalhöyük, and sites dating from the Hittites and Urartians. Müzede, aralarında Çatalhöyük, Hitit ve Urartulara ait buluntulann da yer aldığı Anadolu arkeolojik eserleri, Paleolitik çağdan başlayarak günümüze kadar kronolojik bir sırayla sergileniyor.

Beypazarı

Located 99 km from Ankara, Beypazarı’s history goes back to the Hittites and Phyrgians. This charming district is famous for its historical houses, silver craftsmen and for its carrots. Ankara'ya 99 km uzaklıkta bulunan Beypazan'nın tarihi Hitit ve Friglere kadar uzanır. Bu şirin ilçe, tarihi evleri, gümüş işçiliği ve havucu ile ünlüdür. Hacıbayram M osque

Hacıbayram Camii Ulus, next to the temple of Augustus / Antik Augustus tapınağının yanı This mosque vvas built in the early 15th century in Seljuk style, in honor of Hacı Bayram Veli. 15. yüzyılın başlannda, Hacı Bayram Veli adına yaptırılan cami, Selçuk stilindedir. Roman Baths / Roma Hamamları Çankın Caddesi, Ulus, 08.30 - 1 2 .3 0 /1 3 .3 0 - 17.00, closed Mondays / pazartesi kapalı The baths, built in the 3rd century AD in honor of Asklepion, the god of medicine, sit on a platform about 2.5 m above the Street. Caddeden 2.5 metre kadar yükseklikte yer alan Roma Hamamı, MS 3. yüzyılda sağlık tanrısı Asklepion adına yapılmış.

A slan h an e M osqu e

Aslanhane Camii Ahi Şerafettin Mah. Atpazarı Yokuşu The interior of this 13th century mosque is in contrast to the restrained exterior, and it is one of the most beautifui examples of Seljuk mosques. The stucco mihrap vvith its faience mosaic is spectacular. 13. yüzyılda yaptırılan caminin iç mekanı, dış görünüşünün mütevazılığına tezat, Selçuklu camilerinin en güzellerinden birini teşkil eder. Mozaik çinili, alçı mihrabı göz kamaştırır

St. Paul’s Church (Catholic)

Atatürk Bulvan No: 118 Kavaklıdere (İn the grounds of the Italian Embassy), Service times: 18,00, Saturdays and Sundays Tel: 426 65 18 Sam anpazarı Synagogue

Sakalar Mah. Birlik Sok. 8, Samanpazarı, Tel: 311 62 00 St. Nicholas Church (Anglican)

Şehit Ersan Cad. No: 46, Çankaya (İnside the Embassy of Great Britain) Sunday service at 10.00 Tel: 468 62 30 / 32 85


ANTEKS ^ V m v o ıM J ik T to meet you atnhe follovving fairs 1-3 March 2006 Interstoff Mosrn • Mosm, Bussia 28-30 March 2006 Hail: 71 Booth Nr: E09-E11 lntertextile Beijing 2006 • Beijing, China


■ E m b a ssie s / Elçilikler A fg h a n is ta n

~T

Afganistan

Çankaya. Tel: 442 25 23

W

|■ J

Çankaya, Tel: 441 61 03

S lo v e n ia / Slovenya Gaziosmanpaşa, Tel: 405 60 07

Gaziosmanpaşa, Tel: 446 40 56

G e o rg ia / Gürcistan Çankaya, Tel: 442 65 08

1 *1

M e x ic o / Meksika Çankaya, Tel: 442 30 33

S o u th K o re a / Güney Kore Çankaya, Tel: 468 48 21-23

pn1

M o ld o v a

S p a in / Ispanya

Gaziosmanpaşa, Tel: 446 55 27

Çankaya, Tel: 438 03 92

G re e c e Yunanistan Gaziosmanpaşa, Tel: 436 60

M o n g o lia / Moğolistan Gaziosmanpaşa, Tel: 446 79 77

Sudan

Tel: 491 16 81-83

H u n g a ry / Macaristan Yıldız-Çankaya, Tel: 442 22 73

M o ro c c o / Fas Gaziosmanpaşa, Tel: 437 60 20-21

Kavaklıdere, Tel: 466 45 58 (pbx)

B a n g la d e s h / Bangladeş Çankaya, Tel: 439 27 50-51

In d ia / Hindistan Çankaya. Tel: 438 21 95-98

N e th e rla n d s

S v v itz e rla n d

Hollanda Yıldız. Tel: 409 18 00

B e la r u s / Beyaz Rusya Çankaya Tel: 441 67 69-70

In d o n e s ia / Endonezya Çankaya, Tel: 438 21 90-92

Yeni Zelanda Kavaklıdere, Tel: 467 90 54

B e lg iu m / Belçika Gaziosmanpaşa

Ira n / Iran Kavaklıdere, Tel: 468 28 21 (pbx)

N o n /va y Norveç Çankaya, Tel: 405 80 10

Gaziosmanpaşa, Tel: 446 16 02

I I

A u s tr a lia / Avustralya

1 F e d e ra l R e p . o f G e rm a n y

Gaziosmanpaşa, Tel: 4 5 9 95 00

1 Almanya 1 Kavaklıdere, Tel: 455 51 00

Kavaklıdere, Tel: 419 04 31-33

Oran,

Tel: 446 82 50

m

88

A z e rb a ija n / Azerbaycan

l& H

M a c e d o n ia / Makedonya Gaziosmanpaşa, Tel: 446 92 04-05

Slovak Cumhuriyeti Kavaklıdere, Tel: 467 50 75

66

S o u th A fr ic a / Güney Afrika

A u s tr ia / Avusturya

S lo v a k R e p u b lic

M a la y s ia / Malezya

Gaziosmanpaşa, Tel: 446 20 61-62

9

L ith u a n ia / Litvanya Gaziosmanpaşa, Tel: 447 07

Gaziosmanpaşa, Tel: 446 35 47-8

A rg e n tin a / Arjantin

;j

| H

F ra n c e / Fransa

Çankaya, Tel: 468 77 19

-•

H

Kavaklıdere, Tel: 455 45 45

A lg e r ia / Cezayir

D

|

F in la n d ' Finlandiya Gaziosmanpaşa, Tel: 426 19 30

A lb a n ia / Arnavutluk

E s to n ia Estonya Gaziosmanpaşa, Tel: 405 69 70

■ ■ ■ ■ ■

Nevv Z e a la n d

Çankaya, Tel: 441 38 84-85

S vve d en / İsveç

İsviçre Kavaklıdere, Tel: 467 55 55-56

S y ria Suriye Çankaya, Tel: 4 4 0 96 57-58 T a jik is ta n / Tacikistan

B o s n ia & H e rz e g o v ia

C o o r d in a tio n B u re a u o f lra q

O m a n / Umman

T h a ila n d / Tayland

Bosna Hersek Gaziosmanpaşa, Tel: 427 36 02

Irak Koordinasyon Bürosu Gaziosmanpaşa, Tel: 468 74 21

Gaziosmanpaşa, Tel: 447 06 30-31

Gaziosmanpaşa, Tel: 467 34 09

Ire la n d İrlanda Gaziosmanpaşa, Tel: 446 61 72

P a k is ta n / Pakistan Gaziosmanpaşa, Tel: 427 14 10-13

T u n is ia / Tunus

Is ra e l / İsrail Gaziosmanpaşa, Tel: 446 36 05

S ta te o f P a le s tin e

Kavaklıdere, Tel: 467 20 71

Filistin, Gaziosmanpaşa, Tel: 436 04 23

T u r k is h R e b u p lic o f N o rth e rn C y p ru s / Kuzey Kıbrıs Türk Cumhuriyeti

C a n a d a / Kanada Gaziosmanpaşa, Tel: 459 92 00

Ita ly / İtalya Kavaklıdere, Tel: 426 54 60-63

P h ilip p in e s / Filipinler Gaziosmanpaşa, Tel: 446 58 31

T ü r k m e n is ta n / Türkmenistan

C h ile / Şili

J a p a n / Japonya

Gaziosmanpaşa, Tel: 447 35 82

Gaziosmanpaşa, Tel: 446 05 00

P o la n d / Polonya Kavaklıdere, Tel: 467 56 19

U k ra in e Ukrayna Çankaya, Tel: 441 54 99

P o r tu g a l / Portekiz Gaziosmanpaşa, Tel: 446 18 90-91

Birleşik Arap Emirlikleri Gaziosmanpaşa, Tel: 447

Q a ta r / Katar Oran, Tel: 441 13 65

U n ite d K in g d o m / Büyük Britanya ve Kuzey İrlanda Birleşik Krallığı Çankaya, Tel: 455 33 44

R o m a n ia / Romanya Çankaya, Tel: 427 12 43

Amerika Birleşik Devletleri Kavaklıdere, Tel: 455 55 55

B ra z il / Brezilya Gaziosmanpaşa, Tel: 448 18 40-41-43

I I

] B u lg a ria i Bulgaristan

C h in a / Çın Halk Cumhuriyeti Gaziosmanpaşa, Tel: 436 06 28

C r o a tia / Hırvatistan Gaziosmanpaşa, Tel: 446 08 31

I I ■ ■ m

J o r d a n / Ürdün

m ■ m ttK İ

Çankaya, Tel: 440 20 54

-------_____

C u b a / Küba Çankaya, Tel: 442 89 70-71

1

K a z a k h s ta n / Kazakistan Oran, Tel: 491 91 00 (pbx) K u v va it / Kuveyt Gaziosmanpaşa, Tel: 445 05 76-80

C z e c h R e p u b lic

1

1

1

Gaziosmanpaşa, Tel: 437 78 12

Gaziosmanpaşa, Tel: 446 01 85

Çankaya. Tel: 441 71 22-24

U n ite d A ra b E m ira te s

U n ite d S ta te s o f A m e r ic a

K y rg y z R e p u b lic

T h e R u s s ia n F e d e ra tio n

U z b e k is ta n

Kırgızistan Yıldız, Tel: 491 35 06

Rusya Federasyonu Çankaya, Tel: 4 3 9 21 22

Özbekistan Çankaya, Tel: 441 38 71-72

D e n m a rk / Danimarka Gaziosmanpaşa, Tel: 468 77 60 (5 Lines)

L e b a n o n / Lübnan Gaziosmanpaşa, Tel: 446 74 85-8

Suudi Arabistan

E g y p t / Mısır Kavaklıdere, Tel: 468 22 40

L ib y a

S e rb ia a n d M o n te n e g ro

Y em en

Çankaya, Tel: 438 11 10-14

Sırbistan-Karadağ Kavaklıdere, Tel: 426 02 36

Gaziosmanpaşa, Tel: 446 31 78

Çek Cumhuriyeti Gaziosmanpaşa, Tel: 446 12

44

146 SKYLIFE 3 /2 0 0 6

M M

68 61-62

S a u d i A ra b ia G.O.P, Tel: 468 55 40-42


Isınma sanatı Türkiye'nin ilk ve tek Desenli Panel Radyatörü DemirDöküm'den. Üstelik her zevke uygun desen

MÜŞTERİ İLETİŞİM MERKEZİ O 800 211 33 33 (ü c re ts iz )

O G R O U P

w w w .d e m ird o k u m .c o m .tr

ÖMÜR BOYU SERVİS GARANTİSİ TÜRKİYE NİN HER KÖŞESİNE SERVİS SÜREKLİ YEDEK PARÇA


Tren Durağı (TrainSiatlon)

ETİM ESG UT

Tramvay Durağı (TramvvayStop)

M etro Durağı (Metro Stop)

Hafif Metro Durağı (UghtTubeStop)

Cadde (Road)

THY Satış Ofisi (Turkish Airlines Sales O ffice)

O toyol Numarası (Road Numbers)

\

(State Road)

Otoyol (Molorvvay) Dev let Yolu

Dem iryolu (RalKyay)

(UjjhtTube) Metro (Metro)

H afif M etro

ANKARA

\ V-'- ■

ıOf*TAt

A V C IL A R

Onı;

ÇUKUJ

İK O P R l

(mÂto.

IS E ji/U L U Ç

OSM)

j

T ÇANKAYA

's o y AK A»

.E M R E

emniyet .

:NİÇA<

GAyRjpr

iftM ETCSOl

tŞIYAKA

iK«£i.reı

AKKUi

■VIİT^

JATORYt

ŞSNLİ

JEHIT I rOPEL «AR TU

70 l

HÜaetfNi

(A IB P O R T )

ESEN BO Ğ A H AVALİM AN I

(0216) 325 78 74

Gürbüz YAYINLARI


"Since

1 9 7 9

"

with health and confidetı ",s a ğ l ı k l a ,

g ü v e n le ”

RAFİNE VİNTERİZE YEMEKLİK

AYCİCEK YAĞI ay

orkide

İLDAŞ Creative

D

BS EN IS O 9 0 0 1 :2 0 0 0 O U A L IT Y M A N A G E M E N T S Y S T E M C E R T IF IE D FIR M

f f

KÜÇÜKBAY

YAĞ

ve

DETERJAN

S A N A Y İİ

A .Ş .

A nkara

C ad.

No:

102

B ornova

-

İzm ir

-

TÜ R K İY E

Tel: (+ 9 0 .2 3 2 ) 3 8 8 25 57 Pbx Faks: (+ 9 0 .2 3 2 ) 3 8 8 37 92 w w w .o rk id e .c o m .tr • e -m a il:o rkid e@ o rkid e.com .tr


■ H otels / Oteller

LU O 3

CD GC N û

z

A L T IN Y U N U S

C R O W N E P L A Z A İZ M İR

H O L ID A Y R E S O R T (H V 1 )

(*“ **)

Tel [232] 723 12 50

Tel [232] 292 13 00

Tel [256] 618 15 30

Fax [232] 723 22 52

Fax [232] 292 13 13

Fax [256] 618 11 10

Fax [258] 271 40 78-271 43 05

A d res / A dresses Boyalık Mevkii. Çeşme İzmir

A d res / Adresses

Adres / Adresses Gazi Beğendi

A d res / A dresses

Inciraltı Mah. 10 Sokak, No: 67 Balçova reservation@cpizmir. com

Mevkii 09400 Kıışadası/TÜRKİYE info@korumar. com .tr

Karahayıt PamiKkale Denizli

http://www.cpizmir.com

http://www.korumar.com.tr

AOUAFANTASY AOUAPARK

F A N T A S IA H O T E L D E L U X E

R IC H M O N D E P H E S U S

İZ M İR P A L A S O T E L

& C L U B O T E L (***•*)

K U Ş A D A S I (*•***)

RESO RT (*"**)

D

Tel [232] 893 11 11 (pbx)

Tel [256] 622 05 50-622 06 00

Tel [232] 893 10 60

Tel [232] 465 00 30

Fax [232] 893 11 10

Fax [256] 622 07 65

Fax [232] 893 10 54-55

Fax [232] 422

Adres / Adresses Ephesus Beach (Pamucak Oteller Bölgesi) Selçuk

Adres / Adresses v avansu Mevkii, Söke

A d res / Adresses

A d res / A dresses

Yolu, 5. Km. PK 134 90400 Kuşadası

Pamucak-Selçuk

Vasıfçınar Bulvarı No: 2 Alsancak

info@aduafantasy.com http://www.aquafantasy.com

info@fantasia.com .tr http://www.fantasia.com.tr

ephesus@richmondhotels.com .tr http://www.richmondhotels.com.tr

info@izmirpalas.com .tr http ://www. izmirpalas.com .tr

info@altinyunus.com .tr http ://w w w .altinyunus .com.tr

=D

KO RU M AR HO TEL

R IC H M O N D P A M U K K A L E T E R M A L (**“ ) Tel [258] 271 42 94 pbx

info@richmondhotels.com .tr http://www.richmondhotels.com.tr

o cc <

68 70

C L U B IL IC A H O T E L

G RAN D HO TEL O NTUR

S Ü R M E L İ E FES R E S O R T H O T E L

K İL İM O T E L

r***)

m

& C O N V E N T IO N Ç E N T E R (*~ **)

r*)

Tel [232] 723 31 31

Tel [232] 724 00 11

Tel [232] 893 10 96

Tel [232] 484 53 40

Fax [232] 723 34 84

Fax [232] 724 92

Fax [232] 893 11 29

Fax [232] 489 50 70

Adres / A dresses

Adres / Adresses Cumhuriyet Mah.

A d res / Adresses Efes Antik Şehir Plajı

A d res / Adresses Atatürk Blv. Kazım

Boyalık Mevkii Ilıca Çeşme

4330/3 Sok. No:63/A Dalyan Çeşme-lzmir

info@ilicahotel.com ht:p://www. ilicahotel.com

sales@onturcesme.com http://www.onturcesme.com

Pamucak Mevkii. 35920 Selçuk/İzmir salesefes@surmelihotels.com http://www.surmelihotels.com

Dirik Cad. No:1 Alsancak/lzmir kilim@kilimotel.com.tr http://www.kilimotel.com.tr

66

© Telephone: In te rn a tio n a l c o d e fo r T u rke y: 90. İzmir area code: 232. Kuşadası (area code for province of Aydın): 256. For intercity calls within T u rk e y firs t d ia l ',

0

then the area code, and then the local number. F or in te m a tio n a l c a lls first dial ' '.

00

150 SKYLIFE 3 /2 0 0 6

CO LO SSAE T H E R M A L

H İL T O N İZ M İR

O T E L K Â Y A P R E S T IG E

OTEL KARACA

H O TEL (-***)

r*~ )

m

r* )

Tel [258] 271 41 56 pbx

Tel [232] 497 60 60

Tel [232] 483 03 23

Tel [232] 489 19 40

Fax [258] 271 42 50

Fax .232] 497 60 00

Fax [232] 489 22 99

Fax [232] 483 14 98

A d res / A dresses

A d res / A dresses

Karahayıt - Pamukkale Mevkii/DENİZLİ colossae@colossaehotel.com http://www.colossaehotel.com

Gaziosmanpaşa Bulvarı 7, 35210 sales.izmir@hilton.com

A d res / Adresses 1371 Sk. No:7 Çankaya/İzmir

Adres / Adresses 1379 Sk. No:55 Alsancak/lzmir

info@kayaprestige.com .tr http://www.kayaprestige.com.tr

info@otelkaraca. com .tr http://www.otelkaraca.com.tr

http://w ww.İzmir, hilton .com


■ E m e rg e n c y

B e rg a m a M u s e u m

costumes and camel

B a lç o v a T h e rm a l S p rin g s

Bergama Müzesi

accessories.

Balçova Kaplıcaları

A m b u la n c e

Zafer Mah., Cumhuriyet Cad.

Arkeoloji Müzesi'nin yanında yer

İzmir province abounds in

Tel: 112 (Ali över Turkey)

No: 6 Bergama,

alan müzede, Bergama ve

mineral and thermal springs,

P o liç e

Tel: 631 28 83 0 8 .0 0 -1 2 .0 0 / 13.00-17.00,

Gördes halı koleksiyonu, yöresel kıyafetler ve develere takılan

those at Balçova being just

Tel: 155 (Ali över Turkey) Fire

closed Mondays / pazartesi

aksesuvaların da yer aldığı

centre.

Tel: 110 (Ali över Turkey)

kapalı

geleneksel el sanatları

İzmir çevresinde çok sayıda

sergileniyor.

kaynak suyu ve kaplıca

15 kilometer from the city

T o u ris m p o liç e

The museum vvith a large

Tel: 527 45 03

collection of material from

G e n d a rm e

Stone Age to Byzantine times,

M u s e u m o f P a in tin g an d

kaplıcaları kent merkezine

Tel: 156 (Ali över Turkey)

is in the centre of the modem

S c u lp u re

sadece 15 km uzaklıkta ve kent

C o a s t G u a rd

town.

İzmir Resim ve Heykel Müzesi

içi toplu taşıma araçlarıyla

Tel: 158 (Ali över Turkey)

Şehir merkezinde yer alan

Mithat Paşa Cad.

ulaşmak mümkün.

müzede, Erken Tunç

No: 94 Konak,

■ T o u ris m Inform ation

döneminden Bizans'a kadar

Tel: 482 03 93

B e a c h e s / Plajlar

değişik dönemlere ait arkeolojik

08.00-17.00.

Turizm Danışma

eserler sergileniyor.

closed Sundays / pazar kapalı

The province of İzmir has a huge coastline on the Aegean, with

A dnan M e n d e re s A irp o rt

Ephesus M useum

Ö d e m iş A rc h e o lo g ic a l

vvatersports easily accessible

Tel: 274 22 14 - 274 21 10

Efes Müzesi

M useum

Atatürk Mahallesi,

Ödemiş Arkeoloji Müzesi

from the city by private or pubiic transport from Üçkuyular bus station. Good beaches include

bulunuyor. Bunlardan Balçova

beaches and areas for

P rov in c ia l D ire c to r of

Kuşadası Caddesi, Selçuk,

Birgi yolu,

To urism II Turizm Müdürlüğü

Tel: 892 60 10

No: 88 Ödemiş,

Selçuk-Pamucak, Urla,

Tel: 483 51 17-483 62 16

Tel: 545 11 84

Alsancak

0 8 .30-12.00 / 13.00-16.30, open daily / her gün açık

0 8 .0 0 -1 2 .0 0 /1 3 .0 0 -1 6 .3 0 ,

Gülbahçe, Çeşme- Ilıca, Altınkum, Foça and Dikili.

Tel: 445 73 90 - 489 92 78

The most visited museum in

closed Mondays / pazartesi

Ege Denizi'ne çok uzun kıyısı

Bergama,

İzmir exhibits artifacts found in

kapalı

bulunan İzmir'in plajları su

Tel: 631 28 51

excavations of the ancient city of

The museum is 60 km east of

sporlarına da olanak tanır.

Çeşme,

Ephesus. The museum is

İzmir and displays regional

Plajlara özel araçla ya da

Tel: 712 66 53

organised into the Hillside

Foça,

Houses and the House Artifacts

artifacts. İzmir'in 60 km doğusunda yer

taşıtlarla rahatlıkla ulaşabilirsiniz. Selçuk-Pamucak, Urla,

Üçkuyular garajından kalkan

Tel: 812 12 22

Room, the Coins and Treasury

alan müzede bölgeye ait

Selçuk,

Section, the Tomb Artifacts

etnografik ve arkeolojik eserler

Gülbahçe, Çeşme-llıca,

Tel: 892 63 28 - 892 69 45

Room. the Ephesus Artemis

sergileniyor.

Altınkum, Dikili ve Foça, çıkanlar plajlar arasındadır.

kumsallarının güzelliği ile öne

T o urism P o liç e / Turizm Polisi

Room and the Emperor Cults

Turizm Şube Müdürlüğü,

Room, and there are numerous

■ S ig h ts e e in g

Tel: 417 37 85

architectural elements and

Gezinti B irg i Ç a k ıra ğ a M a n s io n

scuiptures in the inner and central gardens. İzmir’in en çok ziyaret edilen

A ls a n c a k O u a rte r

Birgi Çakırağa Konağı

This perfectly lovely guarter

Birgi, Ödemiş, Tel: 531 52 05

müzesinde Efes antik kentinde

contains restored traditional

0 8 ,0 0 -1 2 .0 0 / 13.00-17.00

Arkeoloji Müzesi Bahri Baba Parkı, Konak,

yapılan kazılarda bulunan eserler

houses as vvell as

closed Mondays / pazartesi

sergileniyor. Yamaç Evler ve Ev

amusements and entertainment

kapalı

Tel: 483 72 54

Buluntuları Salonu, Sikke ve

including bars, cafes and

Çakırağa Mansion is one of the

0 9 .0 0 -1 2 ,0 0 / 13.00-17.00,

Hazine Bölümü, Mezar

closed Mondays / pazartesi

Buluntuları Salonu, Efes Artemisi Salonu, imparator Kültleri Salonu

restaurants. Kentin en canlı eğlence ve

Aegean style architecture

ticaret merkezlerinden biri olan

that has been preserved

olarak düzenlenen müzenin iç ve

bu popüler bölgede restore

to this day. Especially the

edilmiş çok sayıda Levanten ve

woodcarving and the panoramas

including the statues of

orta bahçelerinde de çeşitli mimari eserler ve heykeller yer

Rum evleri de bulunuyor.

Poseidon and Demeter that

alıyor.

depicted on the walls are outstanding.

A s a n s ö r (E le v a to r)

Ege Bölgesi'ne özgü mimari

Located in the heart of Izmir's old Jewish quarter, the elevator

üslubu günümüze kadar korunmuş ender yapılardan birisi

■ M u s e u m s / Müzeler A rc h e o lo g ic a l M u s e u m

kapalı The museum houses a superb collection of antiguities

once stood in the Agora of E th n o g ra p h ic M u s e u m

rare buildings in the unique

ancient Smyma. Değerli antika eserlere sahip olan müzenin koleksiyonu içinde,

Etnografya Müzesi Bahri Baba Caddesi

is housed in a 50 m high brick

olan Çakırağa Konağı, özellikle

zamanında antik Smyra kentinin

No: 4 Konak,

tovver which contains a cafe on

agorasında duran Poseidon ve

Tel: 483 72 54

the top fioor and exhibits the

ahşap işçiliği ve duvarlarına resimlenen panoramalarıyla

original hydraulios on the ground floor. Eskiden Musevi Mahallesi olarak

dikkat çekiyor.

Kuş Cenneti city, it consists of islets,

Demeter heykellerini de

09 .00-12.00 / 13.00-17.00,

görebilirsiniz.

closed Mondays / pazartesi

A ta tü rk M u s e u m

The Ethnographic Museum that

kapalı

B ird P a ra d is e

Atatürk Müzesi

is situated next to the

da anılan tarihi bir semtte bulunan Asansör, 51 metre

Birinci Kordon, 148,

Archaeology Museum contains

yüksekliğindeki bir kulenin içinde

Tel: 464 48 05

foikloric artefacts. vvhich include

yer alıyor. Üst katta bir restoran,

marshes, deltas and meadovvs.

09.00-17.00, closed Mondays

a fine collection of Bergama and

giriş katında ise asansörün

At various times of year över

pazartesi dışında her gün

Gördes carpets, tradîtional

orijinal düzeneği bulunuyor.

190 species of bird can be

Situated on the outskirts of the

3 /2 0 0 6 SKYLIFE 151


İZMİR GUIDE AROUND

seen here. Adalar, sazlıklar, deltalar ve

K a d lfe k a le F o rtre s s

ayakta duran sağlık merkezi her

Only open on principal feast days.

Kadifekale

gün 8.30-18.30 arasında ziyarete

Yalnız büyük bayramlarda açık.

gözaiabiidiğine uzanan

The fortress overlooking İzmir has

açık.

düzlüklerde 190'ı aşkın türde

sections dating from Hellenistic,

milyonlarca kuşu barındırdığı için

Roman and Byzantine times.

dünya çapında bir 'kuş cenneti'

The 20-25 metre high walls vvere

sayılıyor.

originaliy 6 km in length. Today

H is a r M o s q u e Hisar Cami

B e t Is ra e l S y n a g o g u e

■ M o s q u e s Camiler

Mithatpaşa Cad., 265 Tel: 425 16 28

the fortress is a famous excursion

Hasanağa Mah.

H o u s e o f th e V irg in M a ry

E p h e s u s / Efes

spot vvith pleasant tea gardens,

Hisarönü Mevkii 899 Sok. Konak

Efes, Selçuk,

Within easy reach of İzmir

commanding a fabulous vievv of

The mosque was constructed in

Tel: 892 60 08

(72 km) and Kuşadası (18 km), the spectacular buildings and

the city.

the 16th century and is one of the

İzmir'in içinde, kente hakim bir

most imposing in İzmir. The

streets of ancient Ephesus have

tepedeki bu kale Helenistik,

interior is one of the best

(C a th o lic )

an unforgettable charisma.

Roma ve Bizans izlerini taşıyor.

examples of Ottoman decorative

81 Sokak, 10, Göztepe,

Established in 3000 BC and

Yüksekliği 20-25 metre olan

art. The vvooden mimber is inlaid

Tel: 246 11 45

including remains from the lonic,

duvarlarının uzunluğu eski

vvith mother-of-pearl.

Open daily / Her gün açık.

Lydian, Roman, Byzantıne and

dönemlerde 6 km'yi buluyordu.

16 yüzyılda inşa edilen cami,

Seljuk periods, Ephesus is a sight

Günümüzde çay bahçeleri ve

İzmir'in en gösterişli camilerinden

N ö tre D a m e d e S t. R o s a re i

not to be missed. İn nearby

olağanüstü kent manzarasıyla ünlü

biridir. İç mekân Osmanlı süsleme

(C a th o lic )

Selçuk there is the basilica of

bir gezinti yeri.

sanatının en güzel örneklerinden

1481 Sokak, 8, Alsancak,

birini sergilemektedir. Ahşap minberi sedef kakmalıdır.

Tel: 421 66 66 Open daily. / Her gün açık.

K e m e ra ltı M o s q u e

S a n ta M a ria (C a th o lic )

St. John (6th century), a superb

N ö tre D a m e de L o u rd e s

museum and Isa Bey Mosque.

K ü ltü rp a rk

Also in the vicinity is the House of

The huge Kültürpark in the city

the Virgin Mary, and the Cave of the Seven Sleepers.

centre is one of the most densely green areas in İzmir, covering 30

Kemeraltı Camii

Halit Ziya Bulvarı, 67

İzmir'den (72 km) ve

hectares. VVithin it there is a zoo,

The entrance to Kemeraltı Bazaar

Tel: 484 86 32

Kuşadası'ndan (18 km) kolaylıkla

an artificial lake, an open-air

/ Kemeraltı çarşı girişi

Open daily / Her gün açık.

ulaşılabilen olağanüstü ilginç,

theatre, sports and entertainment

This 17th century structure has

caddeleri ve yapılarıyla bugün de

tacilities, and it is the main

beautiful illumlnations dating from

S t. A n th o n y o f P a d u a

benzersiz bir atmosfere sahip antik

recreation area for the citizens of

the 18th century.

(C a th o lic )

kent. MÖ 3000 yıllarında kurulan

İzmir, This has been the venue of the International İzmir Fair every

17. yüzyılda inşa edilen yapının

1610 Sokak, 5, Bayraklı,

18. yüzyıldan kalma kalem işi

Tel: 341 06 16

August since 1936. 30 hektarlık Kültürpark, İzmir'in

süslemeleri görülmeye değer.

Open daily / Her gün açık.

taşıyan Efes'i gezmeye mutlaka vakit ayrılmalı. Efes'in çok yakınında St, Jean Bazilikası,

kent içinde yeşilin en yoğun

S a le p ç io ğ lu M o s q u e

S t. J o h n ’s C a th e d ra l (C a th o lic )

olduğu alanlarından biridir.

Salepçioğlu Camii

Şehit Nevres Bulvarı, 29,

Meryem Ana Evi, Yedi Uyurlar

Hayvanat bahçesi, yapay gölü,

850 Sok. No. 48 Konak

Alsancak,

Mağarası, Selçuk Isa Bey Camii

açık hava tiyatrosu, spor ve

Izmir's largest domed mosque was

Tel: 484 53 60

gibi başka tarihsel ve turistik gezi

eğlence tesisleriyle İzmirlilerin

built by Salepçizade Hacı Ahmet

Open daily / Her gün açık.

yerleri bulunuyor.

başlıca rekreasyon alanıdır. Park,

Efendi in 1906 and features an

1936 yılından beri her yıl ağustos

elegant slender minaret.

H o u s e o f th e V irg in M a ry

ayında düzenlenen Uluslararası

1906 yılında Salepçizade Hacı

1390 Sokak, 4,

Meryem Ana Evi

İzmir Fuarı'na da ev sahipliği

Ahmet Efendi tarafından İzmir’in en

Alsancak

The Virgin Mary came to Ephesus vvith St. John, and spent the

yapıyor.

büyük kubbeli camisi olarak inşa

remainder of her life here. The

P e rg a m u m / Bergama

house built in the 4th century at

The ruins of Pergamum, a majör

ve lon, Lidya, Roma, Bizans, Selçuklu dönemlerinin izlerini

S haar A sham ayan S ynagogue

edilen yapı, ince yapılı, zarif bir

S in y o ra Iv e r e t S y n a g o g u e

minareye sahip.

927 Sok, 7 Mezarlıkbaşı

the place vvhere she died was

centre of civilisation of the ancient

Ş a d ırv a n M o s q u e

S t. J o h n (A n g lic a n )

recognised as a shrine by the

vvorld, are situated 105 km from

Şadırvan Camii

Talatpaşa Bulvarı,

Vatican in 1957. Mass is celebrated here every morning at

İzmir. The acropolis and amphitheatre perched on a tovvering hilltop, and on the

Ahmetağa Mah. Şadırvanaltı Mevki 912 Sok. Konak

Alsancak, Tel: 464 57 52

7.30

and on Sunday mornings

Şadırvan Mosque is one of the

at 10.30. Aziz Yuhanna ile birlikte Efes'e

outskirts of the town of

mosques on the old inner harbour

S t. J o h n th e B a p tis t (C a th o lic )

Bergama the Asklepion or health

gelen Meryem Ana'nın hayatının

centre dedicated to Asklepios the

front and gets its name from the fountains underneath and next

Tel: 420 08 42

son dönemini geçirip öldüğü yerde

god of health are in a remarkable

4. yüzyılda inşa edilen ev.

State of preservation.

1957'de Vatikan'ın onayından sonra kutsal ziyaret yeri olan Meryem Ana Evi ve Kilisesi

to it. Eski iç liman kıyısındaki camilerden

Open daily / Her gün açık.

The site is open daily between

biri olan Şadırvan Camii, adını

S t. H e le n (C a th o lic )

08.30 and 18.30. İzmir’in 105 km kuzeyindeki bu

yanında ve altında bulunan

1729 Sokak, 53

şadırvanlardan alıyor.

Karşıyaka,

İzmir’den 80 km, antik Efes

ilçesinde antik çağın büyük

kentinden 7 km uzaklıkta, çam,

uygarlık merkezi Pergamon’un

çınar ve zeytin ağaçlarıyla bezeli

kalıntıları bulunuyor. Görkemli bir tepedeki akropolis ve amfiteatrın

yüksek bir tepe olan Bülbül Dağı'nda bulunuyor. Her sabah 7.30’da, pazar sabahları 10.30'da ayin düzenleniyor.

152 SKYLIFE 3 /2 0 0 6

Kemalpaşa Cad., 15, Buca

Tel: 364 36 22

■ C h u rc h e s and s yn ago g u es

October-May, June-September. Ekim-Mayıs, Haziran-Eylül.

Kiliseler ve sinagoglar S t. M a ry M a g d e le n a

yanı sıra, ilçenin girişinde sağlık Tanrısı Asklepios adına inşa edilen

A ya F o tin i (O rth o d o x )

(P ro te s ta n t)

ve günümüzde bütün özellikleriyle

Alsancak, Tel: 421 69 92

Hürriyet Cad. 18, Bornova


77 ülkede 100 m ily o n m üşteriye hizm et verm ek... Başka bir deyişle, her gün m ilyonlarca farklı bakış açısıyla karşılaşm ak, biri için beyaz olanın b ir başkası için siyah olabileceği fikrin e daim a açık o lm ak demek. Bizim için her farklı bakış açısı sizi yakından tanım ak, ü rü n le rim izi, hizm e tle rim izi ve bankacılık anlayışım ızı g e liştirm e k için b ir fırsat. Çünkü biliyo ru z, farklı bakış açıları dünyam ızı ze n g in le ştirir.

w w w .h sb c.co m .tr - 444 0 111

HSBC İZ> D ü n y a n ın y e re l b an kası H S B C B an k A .Ş . tarafın d an yayım lanm ıştır.


Ç IĞ L I

E ğ rid e re Köyü

K ARŞIYAKA

IKKU-1

R E F İK Ş E V K ) KIZILAY

M U H rrrw i FU A T 6 D İP B A K S I

ATAK El *A T A K £ N '

*B o s ta n lı

Alsancak

İZM İR KÖRFEZİ

HAL KA PI f Y E N İŞ E H İR

G Ü R P IN A R

ISULTAN

BUCA Ü ç k u y u la r G ö z te p e

ÇANI UFU K SIR IN K A P 1

B O ZK A 'A < W

UĞURgWMÖI*

LÇOVA Ç A M LI K U LE

AYDIN

UZUI

G A Z IE M IR YEŞİL,

FATİH

İZMİR Metro (Metro) D em iryolu (RaiKvay) Otoyol (Motorvvav) Devlet Volu (State Road) Otoyol Numarası (RoadNum bers)

THY Satış Ofisi (Turkish Airlines Sates O ffice) Cadde (Road) M etro Durağı (Metro Stop) Tramvay Durağı (TramwayStop) Tren Durağı (Traln Station)

TORBALI ADNAN M ENDERES H A V A L İM A N I (A IR P O R T ) K ıs ık K ö y ü

G ü rb ü z YAYINLARI (0216)

574 24 44


bazıları at biner...

bazılan heyecan arar..

bazıları yelken sever...

bazılan da i . . . hepsini ister...

ALKEN T 2 0 0 0

I I I . F A Z GÖL M ALİKANELERİ

Pttfoggio, Çjımdeflfia, zJampa, oM«gn$co, A (M h , gagana, D rA n Burası Alkcnt 2000... Büyükçekmece gölünün kıyısı... Yeşil ve maviyle

63 aile daha rahat ve keyifli bir yaşama adım atıyor. 1200 m1 ’ye

kucak kucağa... Keyifli ve ayrıcalıklı bir yaşam... Sörf, yelken, binicilik

varan malikaneler, 5000 m ’ye varan yüzme havuzlu bahçeler.

ve golf alanlanna çok yakın. Cennet gibi bir yer... 800 seçkin aile yallardır Alkem 2000 i. ve II. fazlarda huzur dolu bir hayat yaşıyor. Şimdi sıra III. fazda. 63 malikane Büyükçekmece Gölü’nün hemen yakınında inşa ediliyor.

Anaokulundan üniversiteye çevresindeki eğitim kurumlan, 24 saat güvenliği, geniş bulvarları, 63 malikaneye özel rekreasyon alanı... Alkent 2 0 0 0 III. fazda hayat başlıyor. Siz de böyle bir hayat islemez misiniz?

hep?,i büıbüınden olağanüstü 7 jpftkÇı madikane...

E ]& IL & I3 IİC @

GYO projesidir.

ALKENT 2 0 0 0

Tel: 0212 889 04 35 pbx Fax: 0212 889 08 74 Gsm: 0532 767 99 12 www.alkent2000.com.tr


■ H otels / Oteller

LU

O

0 < > _ l

A T T A L E IA H O L ID A Y

S U N R IS E R E S O R T H O T E L

B L U E VV A TE R S

C O R N E L IA D E L U X E

<

V IL L A G E (H V 1 )

(H V 1 /** * * * )

C L U B & R E S O R T (*•* * *)

R E S O R T (***•*)

H Z

T e l (242] 725 43 01 F a x [242] 725 43 24 A d re s / A d re s s e s

T e l [242] 748 70 10 F a x [242] 748 70 31 -37 A d re s / A d re s s e s Side - Kızılağaç

T e l [242] 756 94 64 F a x [242] 756 95 56 - 57 A d re s / A d re s s e s Titreyen Göl Mevkii

T e l [242] 710 15 00 F a x [242] 715 25 05 A d re s / A d re s s e s

<

07500 Taşlıburun Mevkii, Belek

07600 ANTALYA info@sunrise.com .tr http://www.sunrise.com.tr

Sagun, 07601 Manavgat bw@bluewaters.com.tr

ileribaşı Mevkii, Belek

attaleia@attaleia.com .tr http ://w w w .attaleia.com .tr

C L U B T U R T L E ’S

ULUSOY KEMER

C A TAM AR AN RESORT

DEDEMAN ANTALYA

M A R C O P O L O (H V 1 )

H O L ID A Y C L U B (H V 1 )

H O T E L (*****)

(

T e l [242] 824 63 36 pbx F a x [242] 824 63 46 A d re s / A d re s s e s

T e l [242] 815 14 50 F a x 242] 815 14 65 A d re s / A d re s s e s

T e l [242] 824 97 77 F a x [242] 824 96 A d re s / A d re s s e s Bahçecik Mevkii.

T e l [242] 316 20 20 F a x [242] 316 20 30 A d re s / A d re s s e s

Çamyuva, Kemer info@marcopolo.com.tr http://www.marcopolo.com.tr

Göynük, Kemer info@kemerholidayclub.com.tr

Lara yolu 07100 Antalya antalya@dedeman.com .tr

http://www.kemerholidayclub.com.tr

Beldibi/Antalya/Türkiye info@catamaranhotel .com .tr http ://www. catamaranhotel,com .tr

http: / / www.bluewaters.com.tr

88

sales@comel iaresort.com http://www.corneliaresort.com

)

http://www.dedemanhotels.com

KAYA SELEC T RESORT &

A D O R A G O LF RESORT

C LU B HO TEL SERA

D E L P H IN P A L A C E D E L U X E

S P A (H V 1 )

r***)

C IT Y & R E S O R T H O T E L (*****)

C O L L E C T İO N E L IT E C L A S S { * * " * )

T e l [242] 725 54 90 Fax [242] 725 55 40 A d re s / A d re s s e s

T e l [242] 725 40 51 F a x ;242] 725 40 71 A d re s / A d re s s e s Belek Turizm Merkezi

T e l [242] 349 34 34 (pbx) F a x [242] 349 A d re s / A d re s s e s Lara Beach

T e l [242] 352 25 52 F a x [242] 352 25 50-51 A d re s / A d re s s e s Lara Beach

Üçkum Tepesi, Belek select@kayatourism .com,tr http ://w w w .kayatourism.com .tr

07500 Serik/Antalya-Türkiye info@adora.com.tr http://www.adora.com.tr

07003/Antalya info@clubhotelsera.com.tr http://www.clubhotelsera.com.tr

Antalya/Türkiye

S IM E N A H O L ID A Y

BAR U T HO TEL LARA RESORT

CO NC O R DE RESORT &

D İV A N A N T A L Y A

R E S O R T & S P A (H V 1 )

S P A & S U IT E S (*****)

S P A (*****)

T A L Y A (*****)

T e l [242] 824 51 11 F a x [242] 824 51 10 A d re s / A d re s s e s

T e l [242] 352 22 00 F a x 242] 352 22 22 A d re s / A d re s s e s 07100 Lara

T e l [242] 352 26 26 F a x [242] 352 26 00 A d re s / A d re s s e s Lara Turizm Merkezi

T e l [242] 248 00 F a x 242] 241 54 00 A d re s / A d re s s e s -evzi Çakmak

P.O Box . 07981 Çamyuva-Kemer/Antalya http://www.simenahr.com

Antalya/Türkiye lara@baruthotels.com

Lara-Antalya/TÜRKİYE info@concordehotel.com .tr http ://w w w .concordehotel.com .tr

Caddesi No: 30/ANTALYA info@talya.com.tr http://www.talya.com.tr

34 54

info@delphinpalace.com http://www.delphinpalace.com

© Telephone:

In te r n a tio n a l c o d e fo r T u rk e y : 90. Antalya area code: 242. For intercity calls within

T u r k e y fir s t d ia l O’, then the area code, and then the Iccal number.

F o r In te rn a tio n a l c a lls first dial ' '.

00

156 SKYLIFE 3 /2 0 0 6

6

http: / / www.baruthotels.com

68


E M İR H A N H O TELS

H IL L S ID E SU HO TEL

XA N T H E R ESO R T (*****)

86

K E M E R R E S O R T HO TEL

LIM A K LARA DE LUXE

r*n

H O TE L & R E S O R T (****•)

T e l [242] 763 00 Fax [242] 763 82 72 A d re s / A d re s s e s Evrenseki Mevkii

T e l [242] 249 07 00 F a x [242] 249 07 07 A d re s / A d re s s e s

T e l [242] 814 31 00 Fax [242] 814 55 30 A d re s / A d re s s e s

T e l [242] 352 27 00 F a x [242] 352 26 58 A d re s / A d re s s e s

Side/Antalya

Konyaaltı su@hillside.com.tr http://www.hillsidesu.com

Atatürk Bulvarı Kemer resort@kemerresort.com

Lara / Antalya

http://www.kemerresort.com

http://www.larahotel.info

info@emirhanhotels.com http://www.emirhanhotels.com

info@larahotel.info

FA N TA SIA H O TEL

H O TE L S IL LY U M

LA R E SPAR K HOTEL

LIM A K LIM R A

DE LU XE K EM ER (“ ***)

r***)

r*~ )

H O TE L & R E S O R T (*****)

T e l [242] 824 51 51 Fax [242] 824 51 73 A d re s / A d re s s e s

T e l [242] 715 21 00 F a x [242] 715 21 69 A d re s / A d re s s e s

T e l [242] 352 00 11 Fax [242] 352 00 55 A d re s / A d re s s e s

T e l [242] 824 53 00 F a x [242] 824 77 78 A d re s / A d re s s e s

PK. 15 07981 Çamyuva-Kemer/Antalya

ileribaşı Mevkii, Belek info@hotelsillyum.com http://www.hotelsillyum.com

Güzeloba Mevkii, Lara Sahili info@laresparkhotel.com

No: 15 Kiriş Kemer / ANTALYA

kemer@fantasia.com .tr http://www.fantasia.com.tr

G LO R IA G O LF R ESO R T

KAYA B ELEK OTEL

r***)

http://w ww.laresparkhotel .com

info@limrahotel.info http://www.limrahotel.info

LIM AK ARCADIA GO LF &

M IR A C L E R E SO R T

SPO R T RESORT (“ ***)

H O TE L {****•)

T e l [242] 710 06 00 Fax [242] 715 15 25 A d re s / A d re s s e s

T e l [242] 725 55 00 F a x [242] 725 52 27 A d re s / A d re s s e s

T e l [242] 715 11 00 F a x [242] 715 10 80 A d re s / A d re s s e s

T e l [242] 352 21 21 Fax [242] 352 21 11 A d re s / A d re s s e s

Acısu Mevkii Belek/ANTALYA

Üçkum Tepesi, Belek

İskele Mevkii, Belek / ANTALYA

Kopakçayı Mevkii Lara/Antalya

info@gloria.com.tr http://www.gloria.com.tr

belek@kayatourism.com .t r http://www.kayatourism.com.tr

info@arcadiahotel.info http://www.arcadiahotel.info

info@miracleotel.com http://www.miracleotel.com

M İR A DA DEL M AR HOTELS

G LO R IA VER D E

KAYA S İD E O TEL

LIM A K A TLA N TIS

R E S O R T& SPA (***“ )

r***)

H O TE L & R E S O R T (***•*)

T e l [242] 710 05 00 Fax [242] 715 24 19 A d re s / A d re s s e s

T e l [242] 756 90 90 F a x [242] 756 90 95 A d re s / A d re s s e s

T e l [242] 710 07 00 F a x [242] 715 23 75 A d re s / A d re s s e s

Tel [242] 815 14 80 F a x [242] 815 14 99 A d re s / A d re s s e s PK. 07980

İleribaşı Mevkii. Belek/ANTALYA info@gloria.com.tr http://www.gloria.com.tr

Titreyengöl Mevkii P.K: 26 Manavgat side@kayatourism.com.tr

İleribaşı Mevkii, Belek / ANTALYA

Göynük- Kemer/Antalya info@miradahotels.com http://www.miradahotels.com

http://www.kayatourism.com.tr

info@atlantishotel.info http://www.atlantishotel.info

3 /2 0 0 6 SKYLIFE 157


GUIDE ANTALYA

ORANGE CO U NTY

R IXO S H O TE L TE K İR O VA

TITA NIC DELUXE

RESORT HOTEL (*****)

(

BEACH & RESORT (*****)

DE LUXE R E S O R T H O TE L (S)

T e l [242] 814 72 00 F a x [242] 814 72 33 A d re s / A d re s s e s Atatürk Bulvarı

T e l [242] 821 40 32 Fax [242] 821 40 44 A d re s / A d re s s e s Tekirova Beldesi

T e l [242] 351 17 17 F a x [242] 351 17 18 A d re s / A d re s s e s

Tel [242] 824 00 00 F a x [242] 824 97 55 A d re s / A d re s s e s Çifteçeşmeler

Yenimahalle Kemer/Antalya sales@orangecounty.com.tr

PK: 137 07995 Kemer/Antalya sales@rixos.com

Kopak Çayı Mevkii, Lara info@titanic.com.tr

Mevkii 1. Beldibi-Kemer Antalya

http://vwwv.orangecounty.nl

http://www.rixos.com

http://www.titanic.com.tr

http ://www. sungatehotels. com

)

S U N G A T E P O R T R OYAL

info@portroyalantalya.com

■ E m e rg e n c y A m b u la n c e

Tel: 112 (Ali över Turkey) P o liç e

Tel: 155 (Ali över Turkey) F ire

Tel: 110 (Ali över Turkey) T o u ris m p o liç e

Tel: 527 45 03

O T IU M H O TELS

S İL E N C E BEACH

T Ü R K İZ H O TE L &

IN TE R N A T IO N A L ( * * * " )

R E S O R T (*— *)

TH A LA S S O C E N T R E (****•)

G e rıd a rm e

T e l [242] 725 41 80 (For Reservation) F a x 242] 725 43 72 / 725 43 74 A d re s / A d re s s e s Otium Hotel Art- Kemer

T e l [242] 748 76 76 F a x [242] 748 76 A d re s / A d re s s e s

Tel [242] 814 41 00 F a x [242] 814 28 33 A d re s / A d re s s e s Yalı Cad. No.3

Tel: 155 (Ali över Turkey)

Otıum Hotel Zeynep-Belek

Kızılağaç Manavgat/Antalya

sales@otiumhotels.com http://www.otiumhotels.com

info@silencebeachresort.com http://www.silencebeachresort.com

07980 Kemer / Antalya-TÜRKİYE turkiz@turkiz.com.tr

66

http://www.turkiz.com.tr

C o a s t G u ard

Tel: 158 (Ali över Turkey)

■ T o u ris m In fo rm a tio n

Turizm Danışma T o u ris t In fo rm a tio n P ho ne

Alo Turist Hattı Tel: O 800 511 07 07 O 800 511 07 08 P rov in c ia l D ire c to r of To urism

II Turizm Müdürlüğü Tel: 343 27 60-61 PORTO BELLO HOTEL

SHERATO N VOYAGER ANTALYA

X A N A D U R ES O R T

A n ta ly a,

D E L U X E B E A C H & R E S O R T (*****)

HOTEL, RESORT & SPA (*****)

H O TE L (****•)

T e l [242] 259 40 41(30 Hat) Fax [242] 259 28 21 -259 24 47 A d re s / A d re s s e s

T e l [242] 238 55 55 F a x [242] 238 55 70 A d re s / A d re s s e s

T e l [242] 710 00 00 F a x [242] 715 17 33 A d re s / A d re s s e s

100. Yıl Bulvarı, Konyaaltı Beach 07050

Acısu Mevkii, PK 49 Serik Belek

Cumhuriyet Mahallesi Tel: 241 17 47 A la n y a , Çarşı Mah., Tel: 513 12 40 K aş, Cumhuriyet Meydanı

reservations.voyager@starwoodhotels.com http: //w w w .sheraton.com/antalya

sales@xanaduresort.com .tr http ://www. xanaduresort.com .tr

Akdeniz Blv.

6.Sok Konyaaltı/Antalya

info@portobello.com .tr http://vwvw.portobello.com.tr

Tel: 836 12 38 K em er, Belediye Binası Tel: 814 15 36-814 11 12 To urism P o liç e / Turizm Polisi Kaleiçi Yatlimanı, Tel: 243 10 61

■ S ig h ts e e in g Gezinti

R E N A IS S A N C E A NTALYA BEACH R E S O R T & SPA (***" )

158 SKYLIFE 3 /2 0 0 6

TH E M A R M A R A A NTALY A

BEST VVESTERN KHAN

r***)

m

T e l [242] 824 84 31 F a x [242] 824 84 30 A d re s / A d re s s e s

T e l [242] 249 36 00 F a x [242] 316 81 04 A d re s / A d re s s e s Eski Lara Cad. No: 136

T e l [242] 248 38 70 F a x [242] 248 42 97 A d re s / A d re s s e s Elmalı Mah. Kazım

P.O. BOX: 654 07004 Beldibi, Kemer

Şirinyalı 07100 Antalya/Türkiye

Özalp Cad. No:55/ANTALYA

ınfo@renaissanceantalya.com http ://vwwv. renaissancehotels .com/aytrn

antalya -info@themarmarahotels .com

info@khanhotel.com http://www.khanhotel.com

http ://w w w .themarmarahotels.com

A la n y a C ita d e l / Alanya Kalesi This spiendid Byzantine citadel surmounting the rocky peninsula is vvalled (8 km). The 'Red Tower' was built by the Seljuk's Sultan Keykubad in 1226. Today it is a small museum containing etnographical collections. Bizans zamanından kalma, 'Kızıl Kule’si 1226‘da Sultan


Alaaddin Keykubad tarafından inşa ettirilen görkemli Alanya Kalesi şehri ikiye ayıran bir yarımadanın üzerinde yer alıyor. Kızıl Kule, bugün etnografik eserlerin sergilendiği küçük bir müze.

visited the city in 130 A.D. MS 130 yılında imparator Hadrianus'un Antalya'ya gelişi onuruna yapılan üç kemerli kapının oyma ve kabartmaları olağanüstü. K öprülü C an yo n

A n ta ly a M useum

N atio n a l P ark

Antalya Müzesi Kenan Evren Bulvarı, Konyaaltı, Tel: 241 45 28 08.30-17.30, olosed Mondays / pazartesi kapalı The province of Antalya is endovved vvith the richest historic treasures of Turkey. Antalya Museum covers an area of 30.000 square metres vvith thirteen galleries, an open-air gallery, a children’s gallery (where children may be left) and a vvide yard. Approximately five thousand aroheological vvorks are displayed in chronological order. The museum receive an avvard from the Council of Europe as the Museum of the Year in 1988. Antalya bölgesi arkeolojik, tarihsel hâzineleri bakımından belki de Türkiye’nin en zengin

Köprülü Kanyon Milli Parkı The Köprülü Canyon National Park is vvithin the boundaries of Manavgat, a 14 km long and 100 m vvide valley betvveen Bolasan village and Beşkonak.lt is thickly covered in cedar trees and its resemblance to the ’fairy chimneys' of Cappadocia, albeit in the from of nature, is striking. Manavgat sınırları içerisinde yer alan park, Bolasan köyü ile Beşkonak arasında 14 km uzunluğunda, 100 metre derinliğinde bir vadidir. Gür sedir ormanları ile kaplı vadide, Kapadokya’daki peri bacalarına benzeyen ilginç doğal oluşumları görebilirsiniz.

bölgesi. Antalya Müzesi çok geniş bir alanda 13 teşhir salonu ve bir açıkhava galerisinden oluşuyor. Çoeuklar için de, onların ilgisini çekeoek bir salon bulunan müzeyi tarih meraklıları mutlaka gezmeli. A sp en d o s

A majör port and oommerciai centre in antiquity. Aspendos today lies inland, 48 kilometer east of Antalya. İts magnifioent amphiteatre is the best preserved in the world and knovvn for its superb acoustics and is stili used for concerts. Antalya'nın 48 kilometre doğusunda, antikçağın önemli limanından kalma muhteşem bir amfiteatr. Olağanüstü akustiği ve iyi korunmuş olması nedeniyle bugün de konserler için kullanılıyor. D ü d en Falls / Düden Şelalesi A very beautiful vvaterfall (12 km north of the city centre). Kent merkezine kuzey yönünde 12 km uzaklıkta çok güzel bir şelale. Piknik için mükemmel bir tercih. H a d ria n 's G a te / Hadrian Kapısı The beautiful decorated, three-arched gate was built in honour of Hadrian when he

K arain C av e

Karain Mağarası The caves are 27 kilometer northwest of Antalya, İt is the largest cave in Turkey to have been inhabited. Finds from these remarkable caves go back to the paleolithic, some 30,000 years ago. Antalya'nın 27 kilometre kuzeybatısında yer alır. Türkiye'nin içinde insan yaşamış en büyük mağarasıdır. Yapılan arkeolojik kazılarda elde edilen buluntular, paleolitik çağlara, yaklaşık 30 bin yıl önceye tarihlenmektedir. M a n a v g a t W a te rfa ll

Manavgat Şelalesi A priority address for those who want to cool off on the hot, svveltering days of summer, and a natural vvonder created by the stream of the same name. With its thunderous cascade and icy vvaters, this vvaterfall, located in Antalya’s Manavgat tovvnship, is a haven of tranquility. Yazın sıcak ve bunaltıcı günlerinde serinlemek isteyenlerin bir numaralı adreslerinden biri; her mevsim bol suyu olan Manavgat Çayı’nın oluşturduğu bir doğa harikası: Manavgat Şelalesi. Antalya’nın Manavgat ilçesinde bulunan bu şelale, gümbür gümbür sesi, buz gibi suyuyla insana huzur veren bir cennet adeta.

P erg e

The origins of this ancient city 18 km north-east of Antalya go back to 1000 BC, but the surviving remains are Hellenic and Roman. An exceptional open-air museum. Antalya’nın 18 kilometre kuzeydoğusundaki bu antik kentin geçmişi MÖ 1000 yılına kadar uzanıyor. Ancak bugün gezilen kalıntılar Helen ve Roma dönemlerinden kalma bir açıkhava müzesi, P has e lis

Situated at the foot of Mt Tahtalı (Olympos), 15 km south of Kemer, the three harbors of Phaselis were the reason for its historical role as a commercial çenter. / Tahtalı Dağı’nın eteklerinde, Kemer'in 15 km güneyinde yer alan antik kent, üç limanı ile zamanının önemli bir ticaret merkeziydi. S id e

At this lively resort east of Antalya, the houses and ancient ruins are inextricably intervvined. There are two agoras, an amphiteatre and a museum in vvhich statues and other vvorks of art found here are exhibited. Antalya’nın doğusundaki bu turistik kıyı kasabası antik kalıntılarla içiçe. İki büyük agora, geniş bir amfiteatr ve burada gün ışığına çıkarılan heykel ve öteki eserlerin sergilendiği bir müze. O ld O u a rte r / Kaleiçi

The historic nucleus of Antalya. This district is now restored and has became an attractive touristic centre vvith its taverns, hotels, restaurants and entertainment facilities. İts narrovv streets lead dovvn to the old harbour (today an international yachting marina). Şehrin tarihi çekirdeği olan Kaleiçi; restore edilmiş hali, otel ve pansiyonları, restoranları ve eğlence olanaklarıyla turistik bir merkez. Dar sokaklardan inilen eski liman ise bugün uluslararası bir marina. T e rm e s s o s

Perched 1050 m above sealevel, this is an ancient city and a national park northvvest of Antalya. There is a natural history museum at the park entrance. Denizden 1050 m yükseklikte,

inanılmaz bir manzara, şaşırtıcı bir antik kent ve doğa müzesiyle bir ulusal park. T h e S u n a -ln a n K ıraç K aleiçi M u s e u m

Suna-lnan Kıraç Kaleiçi Müzesi Kaleiçi, Tel: 243 42 74 Museum consists of tvvo buildings, each one of which deserves designation as a cultural asset vvith protected status. Cross-sections of life in the castle in the first half of the 19th century are exhibited vvith special effects in the Museum's first section, located inside the defense vvalls. The second section, an ancient church, houses an exhibition of cultural artifacts and vvorks of art from the Suna and İnan Kıraç collection. Korunması gerekli kültür varlığı olarak tescilli iki binada yer alan Suna-lnan Kıraç Kaleiçi Müzesi’nin birinci bölümünde, 19. yüzyılın ikinci yarısına özgü Kaleiçi yaşamından kesitler özel efektlerle birlikte sunuluyor. Müzenin eski bir kilise binası olan ikinci bölümde ise, Sunalnan Kıraç koleksiyonuna ait kültür ve sanat eserleri sergileniyor. Undervvater Kaş

Sualtındaki Kaş The undervvater riches of Kaş, situated on one of the Mediterranean's majör millennia-old trade routes, are of course not limited to historic shipvvrecks. With its cold undervvater springs, crystal clear vvaters and first-rate undervvater visibility, Kaş is a number one address for diving buffs. Binlerce yıldır Akdeniz ticaretinin en önemli suyollarının üzerinde bulunan Kaş'ın sualtı zenginlikleri tabii ki tarihî batıklarla sınırlı değil. Sualtı kaynaklarının neden olduğu soğuk suyuyla dünyanın en berrak ve görüş mesafesi en uzun denizaltı coğrafyalarından birine sahip olan Kaş, dalış tutkunlarının birinci adresi. Y ivli M in a re (F lu te d M in are)

Yivli Minare is the symbol of Antalya and the city's oldest Seljuk monument, dates from the reign of Sultan Alaeddin Keykubad (1219-1238). Antalya'nın sembolü sayılan Yivli Minare, Sultan Alaeddin Keykubad (1219-1238) döneminden kalma, kentin en eski Selçuklu yapısıdır.

3 /2 0 0 6 SKYLIFE 159


K ı z ı lc a /

_

. . .

A la a t t in l

\

_

.Y agsıhüyuk

j>

Cumah

•Orhanlı Harmanlı •

. B™„ •Karabayır

Çam ," °

Y e d i B u ru n

Telmessos.

X a n th o s ı

Fethiye

$

» ■>.

'•

Antiphellos

Sütleğen

Meyisti

M eis Adası

Üzümlü

•Ç a v d ır

•P a la m u t

'Çamurköy.

K e m e ıy b a y ı r k ö y —° - I D e re k ö y

\ y

K ad y a nd a

^

Ören/

üzüm lü

jfe v

S öğ ü tlü de çe

» B a llık

ğr

/Bubon ?y

'1 ^

J

J**

Kekova Adası

'K a sa b a

• K e m e rk ö y

G öm be

o A k ça y

ıD ü d e nköyJı

(5

. «Yılmazlı Elmalı

0 rr

îfV ''J j

/K a y a b a ş

4

oeKçııer

/«»»<. İbecik/

In cirkö y

^

Sar 7 \ Ç ’ Vdlr

* Ç

V 'a ^ a n Z 5 Tefenni P 29 EfeyköyJ '

*»**

C ufn a ala m

*AİCI Kartfe *

G o lcu k •

A k ş a r . . Ketemi

• Ç ö ğ m e n fi O N ç (J K o A ^ •A rp a c ık

^

& Ö V

6 ^ vX

,*Derinkuyu « Ç " * * . •Kozlar Oedebağ.. O'* Günevköy-. Kuzören

j

5

'

41

F in ike K ö rfe zi

o G ölo va

a

Taşkesii

° ' basa

Kemer

Ka_ğ|ljr1^ /

Y

V 63X

B oğaziçi,

Akören^

Karakent D e re kö y

r ^ 8 - L „ - ^ O l Y p Q İIr» u a

H a yriye .

.B e y le rii •

İn ce le r

lYüreğil Yeşılyu

NoSerınhısar

w

I

A şa ğ ıka ra çâ y ^

Honaz

•Baharlar \\ Uçarı 63 / \ \\ ^ üuney / \ Horasanlı*' Büyükkonak O Acıpayam \ oc 53 »Dereköy 1 « Akalan* X * Yümru^ zırKaraman^

■S

f

73 43 22ÎJf[ar Çukurköy Kıalcabölük

• Ç a n a klı

ığlasurr^

^Y a rd ım c ı B u rn u

fekırova

'Ç a m y u v a

3Kemer

Kestel G ölü.

Büyükköy

İSPARTA

D ire k li ^ v * S a v k ö y

_ * B ağ sa ray Yazıpınar

Koyak Merkezi

Büğdüz~“ '

K ayaa ltıg

iURDUR

Askeriye

^^•Gökçebağy^

-

O ym a pına r

KOADS

Stabilize vol Stabilizeli ntud

Vsfalt yol -I s/titalı (hl\ <\i rt/nd

Çok şeritli yol M uin Unu- road

Dİ(iKR YOLLAR Other Roads

lylıig? riHidi

■ Asfalt yol Isplıeıtı p tu rd riHid Stabilize \o l ' Sntbiliz*tl road . K r» yolu

P r tn in c ia l Roads

İL Y O LLAR I

m m am m m

_________

D EVLET Y O LLAR I State Roads

YO LLAR

G ü n e ycik

128

" 34

k a n i]’ alanı Canıping

V lilli park \ 11tion1i l fhirk

Kayıık merkezi

Güm rük CltStlHttS

SenfHmi

TH Y Salı, O fiTıtrkhh Aidine* Saleı Offiı.-s

Toslak

26

A spendos

• D e re k ö y

O baköy

(0216)574 24 44

YAYINLARI

20 K M

ııerkı/

rUlageı.

Gürbüz

Kemer

o Side

o

D erek ö y

. .• G um uşka S apa

Dim çay Barajı

• M a h m u ts e y d i

K öpri

Sazipa

emir

1 75

•K a rgıca k

Mahmutl3V Vedra

□BUR DUR

Konaklı

P k u rc a la r .A v s a lla r

< ° ^ / ' # V * O rta k ö y U m u tlu

Gündoğmuş

Bozkır

Âkkise

Ortakaraö

îevrekli\ Keteni1

G üzelsu

o

Yarpuz

o C evizli

B ad e m li

LÎAlar,HanGÜZelbağ °

İbradı

Kuyucak

l^ a n a v g a t

GündoğduV Jl'caköy,’ŞelİİKİ A Çolaklı^^Â fSanlar

Taşağfl

0Ü züm lü

o D o ğ a n b ey

Beyşehir

Yenidoğan Sadıkhacı A

Seydişehir' Derebucak

Gencek0

Akçabelen

Kayabaşı

B a ş la ri

D ü za ğa ç Köprülü Karıyor

Mil! Pa*

Deniztepesi • SerikQ Beik.s

C)f

A Ç a l te p e

•Yeşilbağ

Kesme

Yeşıldağ*

^ , Üstünler

Beyşehir Gölii Yenişarbademli ^ O .Gölyaka O Kurucuova*

K as ım lar

Yakaavşar

Aspendûi

üıttA.

G ebiz

Karacuören Barajı

r

^ 1; Çobanisa ^Çandır

iîü tç ü le ro

Karadiken

Kovada G ö liiV

Ayvalıpınar

oAksu

'-G ö k ç e tıü y ü k


MIRACLE -------- Dc l.uxc kcsort-------

Lar a • Antal ya • Türki y

T + 9 0 2 4 2 3 5 2 21 21 • F + 9 0 2 4 2 3 5 2 21 11 in to @ m ir a c le o te l.c o m • v v v v v v .m ira c le o te l .c o m


MUĞLA

GUIDE

■ H otels / Oteller

CLUB HOTEL İSİS

BAIA BODRUM

(HV1)

KARIA PRINCESS HOTEL

r*~)

m Tel [252] 313 85 00

Tel [252] 317 21 40

Tel [252] 387 92 93

Tel [252] 316 89 71

Fax [252] 317 21 56

Fax [252] 387 76 25

Fax [252] 316 89 79

Fax [252] 313 45 30

Adres / Adresses Gümbet / Bodrum

Adres / Adresses Kızılburun Mevkii Gıındoğan/Bodrum

Adres / Adresses Canlıdere Sok.

Adres / Adresses Bitez Gündönümü

No. 15 48400 Bodrum-TÜRKİYE

baia@hotel-baia.com

kariaprincess@superoniine.com http://www.kariaprincess.com

Mevkii 48400 Gümbet Bodrum bodrum@dedeman.com .tr

reservation@isis.com.tr isis@isis.com.tr http://www.isis.com.tr

http://www.hotel-baia.com

http://w w w .dedemanhotels.com

--s

GRAND NEVVPORT

HILLSIDE

DIAMOND OF BODRUM

KEMPINSKI HOTEL

BEACH CLUB (HV1)

r~ *)

BARBAROS BAY (*'***)

HOTEL BODRUM (****)

Tel [252] 614 83 60

Tel [252] 316 02 02

Tel [252] 311 03 03

Tel [252] 317 23 78

Fax [252] 614 14 70

Fax [252] 316 11 20

Fax [252] 311 03 00

Fax [252]317 25 97

Adres / Adresses Kalemya Koyu P.K. 123 48300 Fethiye hbc@hillside.com.tr

Adres / Adresses Kumbahçe Mah.

Adres / Adresses Yalıçiftlik/Bodrum

Adres / Adresses Asarlık Mevkii Adnan

http://w ww.hillside.com .tr

Atatürk Cad. No: 116 Bodrum/Muğla diamond@diamondofbodrum.com .tr http ://w w w .diamondofbodrum.com .tr

reservations.barbaros@kempinski.com info.barbaros@kempinski.com http://www.kempinski-bodrum.com

Menderes Cad. No: 93 Gümbet info@grandnewporthotel .com http://www.grandnewporthotel.com

THE M ARM ARA BO DRUM

M O N T A N A P IN E R E S O R T

Tel [252] 616 71 08

LYKIA VVORLD

ELEGANCE HOTELS

(HV1/****)

INTERNATIONAL (*****)

Tel (252)617 02 00

Tel [252] 412 81 01

Tel [252] 313 81 30

Fax (252)617 03 50

Fax [252] 412 20 05

Fax [252] 313 81 31

Fax [252] 616 64 51

Adres / Adresses P.O.Box 102 48340

Adres / Adresses Uzunyalı Cad.

Adres / Adresses

Ölüdeniz/Fethiye lykia@lykiaworld .com http://www.lykiawor1d.com

No. 130 48700 Marmaris/Muğla info@elegancehotel.com http: //w w w .elegancehotel.com

Adres / Adresses Yokuşbaşı Mevkii Bodrum

AEGEAN DREAM RESORT HOTEL (*****)

HAPIMAG RESORT SEA GARDEN (*****)

CLUB FLIPPER

ROYAL MARIS HOTEL

r **)

(****)

Tel [252) 382 88 98

Tel [252] 368 90 10

Tel [252] 385 33 33

Tel [252] 412 83 83

Fax [252] 382 22 47

Fax [252] 368 90 56

Fax [252] 385 33 50

Fax [252] 412 41 12

Adres / Adresses Bahçelievler Mevkii

Adres / Adresses Yalıçiftlik Bodrum

Adres / Adresses Gökçebel Mevkii 48400 Yalıkavak/Bodrum hotel@clubflipper.com.tr http:// www.clubflipper.com.tr

Adres / Adresses Atatürk Cad. No:34

bodrum-info@themarmarahotels.com http://www.themarmarahotels.com

ölüdeniz - Fethiye info@montanapine.com http://www.m ontanapine.com

<S>

Telephone: International cod e for Turkey: 90. Muğla

area code: 252. For intercity calls vvithin Turkey first dial 0 ’, then the area code, and then the local number. For international calls first dial '00'.

162 SKYLIFE 3 /2 0 0 6

48400 Turgutreis/Bodrum info@aegeandream.com http ://www. aegeandream.com

sales.bodrum@hapimag.com http: //w w w .hapimag -seagarden.com

Marmaris / Muğla info@royalmarishotel .com http://www.royalmarishotel.com


■ E m e rg e n c y

CLUB ÇOBANTUR OTEL

GÖCEK LYKIA

(S)

RESORT OTEL (S)

Tel [252] 243 45 50

Tel (252)645 28 28

A m bulance Tel: 112 (Ali över Turkey) Poliçe Tel: 155 (Ali över Turkey) Fire Tel: 110 (Ali över Turkey) Tourism poliçe Tel: 527 45 03 Gendarme Tel: 156 (Ali över Turkey) C oast Guard Tel: 158 (Ali över Turkey)

Fax [252] 243 45 58

Fax (252) 645 28 27

Adres / Adresses Eski İskele Mevkii.

Adres / Adresses Cumhuriyet Mah.

Akyaka-Gökova/Muğla clubcobantur@cobantur.com

Göcek- Fethiye/TÜRKİYE

■ T o u rism In fo rm atio n

info@goceklykiaresort.com

Turizm Danışma

http://www.club.cobantur.com

http://www.goceklykiaresort.com

DALYAN RESORT

L'A M B IA N CE RESORT

(S)

OTEL (S)

Tel [252] 284 54 99

Tel [252] 313 83 30

Fax [252] 284 54 98

Fax [252] 313 82 00

Adres / Adresses Maraş Mah.

Adres / Adresses Myndos Kapısı

Kaunos Sk. No: 50 Dalyan Muğla info@dalyanresort.com http://www.dalyanresort.com

Gümbet Bodrum info@lambiance.com http://www.lambiance.com

Bodrum Barış Meydanı, Tel: 316 10 9 Dalaman Havalimanı, Tel: 792 52 20 Dalyan Ortaca, Tel: 284 42 35 Datça Hükümet Binası, İskele Mahalle, Tel: 712 31 63 Fethiye İskele Meydanı 1 Tel: 612 19 75 Köyceğiz Atatürk Kordonu Tel: 262 47 03 Marmaris İskele Meydanı 1 Tel: 412 10 35 Milas-Bodrum Milas-Bodrum Havalimanı, Tel: 523 00 66 M uğla Marmaris Bul., 24, Tel: 214 12 61

■ M u s e u m s / Müzeler The Bodrum Museum of Underwater Archeology Sualtı Arkeoloji Müzesi Tel: 316 2 5 1 6 09.00-12.00 / 02:00-07.00, closed Mondays / pazartesi kapalı ECESARAY MARINA &

THE INN AT SVVISSÖTEL GÖCEK

RESORT (S)

MARİNA & SPA RESORT (S)

Tel [252] 612 50 05

Tel [252] 645 27 60

Fax [252] 614 72 05

Fax [252] 645 27 67

Adres / Adresses

Adres / Adresses Göcek 48310 Fethiye emailus.gocek@swissotel.com

1. Karagözler 48300 Fethiye info@ecesaray.net http ://www.ecesaray.net

http://www.swissotel.com

Fethiye Museum / Fethiye Müzesi Kesikkapı Mah. Okul Sok. Fethiye, Tel: 614 11 50 Milas Museum Milas Müzesi Hayıtlı Mah. Köprüler Cad. No: 6 Milas, Tel: 512 39 70 Muğla Museum Muğla Müzesi This natural history museum exhibits fossils discovered near the village ot özlüce. Muğla merkez ilçeye bağlı Özlüce köyü yakınlarından çıkarılan fosillerin sergilendiği bir müze.

EL VINO BUTİK HOTEL (S)

EV (DESIGN HOTELS)

Tel [252] 313 87 70/71

Tel (252)377 60 70

Fax [252] 313 87 73

Fax (252) 377 55 66

Adres / Adresses Bodrum (12 ay açığız.) info@elvinobodrum.com

Adres / Adresses T ürkbükü/Bodrum

http://www.elvinobodrum.com

info@evturkbuku.com

http:// www.hgorganics.com

http://www.evturkbuku.com

■ S ig h tse ein g

Gezinti Bodrum Castle / Bodrum Kalesi This castle dedicated to St. Peter vvas built by the «nights of Rhodes in the 15th century, Located on the edge of the harbour, it covers an area of

approximately 30,000 square metres. 15. yüzyılda Rodos şövalyeleri tarafından St. Peter adına inşa edilen, yaklaşık 30 bin metrekarelik alana sahip kale limana hakim durumda. Dalyan This village southeast of Muğla is named after the river vvhich links Lake Köyceğiz to the Mediterranean. The channels of the river vvind through the reedbeds of the estuary amidst spectacular mountain scenery. Ortaca ilçesine bağlı küçük bir yerleşim yeri. Adını Köyceğiz Gölü’nü Akdeniz'e bağlayan beş mil uzunluğundaki kanaldan alıyor. Dalyan kanalı kıvrımlarıyla, sazlıklarıyla gezilecek bir doğa harikası. Datça Datça lies on the Reşadiye Peninsular, vvhich in geographical terms marks the confluence of the Aegean and Mediterranean. At the vvestern tip of the peninsular is the ancient city of Knidos, vvhere traces of almost ali the periods of vvestern Anatolian history are to be seen. From Datça on the coast there are also day trips by boat to the bays of Kargı, Kızılbük, Palamutbükü, Domuzbükü and Hayıtbükü. Datça ya da Reşadiye Yarımadası, Ege ile Akdeniz’in coğrafi olarak birbirinden ayrıldığı yer. Antik Knidos kenti de, Batı Anadolu tarihinin hemen hemen bütün izlerini barındıran bu yarımadanın tam ucunda. Datça ilçe merkezinden kalkan teknelerle Kargı Koyu, Kızılbük, Palamutbükü, Domuzbükü ve Hayıtbükü'ne günübirlik gezi yapmak mümkün. Marmaris Lying on a large bay encircled by pine covered hills, Marmaris enjoys one of the most beatiful settings of any Turkish resort. İt is close to such ancient ruins as Physkos, Saranda, Amos and loryma. İlçede gezilip görülmeye değer Physkos, Saranda, Amos, Loryma gibi antik kentler bulunuyor. Ölüdeniz Lagoon / Ölüdeniz With its clear turquoise waters this lagoon 15 km south of Fethiye is one of Turkey’s most renovvned natural sites. İt is surrounded by sand beaches and pine vvoods and is a conservation area. Fethiye'ye 15 kilometre uzaklıkta, Türkiye'nin bilinen en önemli koylarından biri. Bir benzerine az rastlanan Ölüdeniz, hareketsiz özelliği, deniz ürünleri ve kumsalıyla ilgi çekiyor. 3 /2 0 0 6 SKYLIFE 163


O

i

Asplıufl ı* ı\rtl nnul

\slall vol

Stabilizeti ntad

Other Roads

D İĞ E R Y O L L A R

l'illaf>•

Kov yolu

Sıahılucd nmd

________ Stahili/c vol

As/ıluıll ı>a\ftl mail

= = = = = /Vsfaliyol

P rovincial Roads

İ L Y O L IA R I

s

K ö rfe z i

'

«

i

M

r

Caınping

Kanıp alanı

Walerfall

Sclalc

Trekking

Gezi >t;ri

Liınan

Scaptırl

Jurkıüt Airlines Saks Office

THY Salı> Ofisi

i ! j \ R F r r ı . E R / S 7 r;v .v

Mesudiye •

i

S

£

o

*

Didyma

• İçmeler

*

T

30 KM

H isitm a ıl places

liırihi yer

K ov merkc/ı

ı \1

9

°

A

13

4

. lA A A

Gökova

Turunç

|/_,,nLn, KaStaboS

J

%

f

n â

653

,

M u r a tla r ^ /

/

Gökçeören.

-

j

1/

7

s k y

J_

^

•Elmalı

i

^__ J

/

/ A

J t

V.j^ılko/

1

Kınık1

Xanthosl

20

i| Kalkan

<3

158

ıs

Kasaba

“T

Kaş

1

\

•Kem erköy /

Artiphel

o

E lm a

V

oA kçay .Gömbe

^

.

S oğüT

(2

T *

N

Seki

— *— ir

Sütleğen <

*

V

.D en ıköy

' 29

^ Ç a v d ır Bayırköy /

Oınoanda

Kayacık

• Çavdır . . . ... «ı^^uıuıu *u.rumlu

.

iasanpa

Beykoy.

Tefenni^

iB u y u k a ^ n

A

A ltm y a y la

- P ^ la n *

Arsa köy

.Palam ut

*

J 3 ö lh is a rv- > ^ _

^

. Çgltı

Orhanlı.

Salda Gölü - 63

H ayriye.

Beylerlı#

Gen

Yumrt z , r K a r a m a n , > i \.K u m a fş a rı

Ballık

Ibecik

Şöğutludere Ö ren.

;

YuSufça*

\

Kabaağaç / İYakaköy İÇamu.rkoy

Gölbent

A

iYeşilyuva

KibyrQ°

*

' m >

to r a ç u lh ^ W t. i ° F « h i» e W a e$ 0S.

■*-

. . .

« E ld ır e k K e m e y »Bayırköy

°

. Kaimkoz

Kara bayır

B o z k u rtD Çambaşı ^ Cu_ a||

Uçan ^ O A c ıp a y a m 53 .D ereköy A kalan* .Orenköy

Ç a m e lio

. A,

Radyonda

ı3

-

S e rın h ıs a r

Gölcük* Cumaalanı

^

-

.

Aşağıkaraçay

__ _________ A ia a »

35

_T ~

incırkoy. Üzümlü0

TPatlangıç l™ ^

Yedi Burun

Burnu

Kargı

122

T "° —

.

o * K i 2 ilyer n <z c ir Huoıid na Coossae, , İnceleş _ , ...

^

.Büyükkonak

*

“fi. O ° NN C C U KK Çöğmen

Jf

Karaçam 1

D a la m a n KaV .

\

A K D EN İZ

<

(ajrport)

•Baharlar Horasanlı •

n— ı,.* n ı,,^ Demirli '^ 7

u D rta c a ^ \ hH aA V vA a Ll iİM m AaM ni

3

p

. K a ra k ö y ^

o t m a n la r , ^

I Beyobası

Ö

Uo d aLla am m A a nn 7 > -

Knıınnc Kaunos

^

Okçular

Kurtoğlu Burnu

A

Gölü

Köyceğiz

KöyceğizO v c e a ız ° \

w.

Toparlar

13 J r I(A * Karaböğürtlen

3e

V" . Ebedk

..

DENİZLİ ÇARDAK \ HAVALİMANI 43 »Çukurkoy n M V M L iıv ı« n

1/Soff 7 J ^ \ (A,RPORT)

73

-

s'

}

,

'M

K ızılcabolul\^j-avas

Jc Jiı Avdan

f^ y r

G.ove<:llk \ D E N İZ L İ

. 3, Kayabaşı D ennkuyu.

100J

^

Turgut ıurguı\ • .P ortakallık *Kavakçalı

•Yara? 7

Yılancık

4

Kızılyaka

Karagol

" ^ > ——0 Göktepe

( 0 VJId M|a

L.

" ' ' J'

K n .u r

Aphrodisias

Yazır* K«^

B abadağ 0

K a ra c a s u ^ *. G e y re ^ tE a

t

B"r,"S

NeapOİİS

/m * .

o K a v a k lıd e re

lm 26 26 .\ , I o

%

-7

Çayboyu

X . .,

< Armutalanı 'içmeler

Beldibi

.Söğüt

^

Yerkesik.: TtJrKtsaiıV'J J»

M a rm a ris

K

Yeşilyurt

Karaca

'* AA no * nr KfifOmOS

75

Yat£P an

D)ağpınar a ğ p ın a r

B e n c il

36

Lagino

23

Gerg0 « ,« ,« • r

yf~

~^< g .

%

B o zd o ğ a n o

5

Alam ut

° ' İ > n i'>»“ '

Akçaova0 A kça o va 0 \yAA li aa oba V y ı ^r ^

Eskıçinel

D r Bozburun

Bucak merkezi

G ü rb ü z

15

o Marmaris

□ MUĞLA ,.-,,* o TTurgut

-

SETTLEM EN TS

^ K ıtfM' H»sarön“ Kot

Y E R L E Ş İM

p .

G ö k o v a K ö rfe z i

Mazıköy

Karaova

D a tça

İnce Burun

Kara Ada 4

B o d ru m Halikarnassos

0

A

i M ila s _ B O D R U j**/IİL A S

Guvercınlik^r^1^ ^

T . i .

Teıchıussa

?£ n [g p 8 * !^

Çok şeritli >ı>l

r

# ıu u ııu u

^

• -Ortaköy IŞ e lım ıy e

A

O

o , p uZİU zlu °KKa arpU

Ulukonak U lU K U lId K

^ T e k e le r ^ •

Ovakışlacık

Kazıklı

Çamiçî^

Herakleia

-c

.

,

^ •Ç a v d a r

^

Euromo * 0 ^

G ü llü k

Mulıi laııc nmd

_ _ _ _ _ _ _ Slabili/c %ol

., .

________

A

Yazıköy- -i- v a Knidos; 0

YOLLıVR / m m v

DEV L E T V O L L V R I .Si/a/e Roads

i

^- A n * .•St mr\

Akyarlar 4

0L

Turgutreis0

ın y ııu ıo

Myndos

Yalıkavak

D E N İ Z İ

E G E

(7

ıO Didyma0

A

li

J Y e n ık o y

M

\

K o ç a ° r l , D . I . ™ "O . =0 Bağarası Cincin Çakırbeyfrv

4 * * -

107 /Yeşilköy A

D id im

il*

Akköyö

Saiaf •

\'.7

Karine 0 • Atburga z J

Priene

Davutlar0


E info @ ric h m o n d n u a.co m i w w w .rich m o n d n u a .c o m

2006 THE BEST SPA H OTEL R I C H M O N D / N U A VVELLNESS- SPA W O N " T HE BEST SPA HOTEL 2 0 0 6 ' ' A W A R D İN T Ü R K İ Y E , AT THE “ SPA & L U X U R Y F A I R .

JUST

STOP

AND

BREATHE!

YOU W I L L S O O N R E A L I Z E . . .

nua WELLnes - Pa 5

5

S a h ilyo lu 5 4 6 0 0 Sapanca - Adapazarı - T u rke y T +90 2 6 4 582 21 0 0 F +90 2 6 4 582 21 01


NE NEREDE? PLAN OF THE INTERNATIONAL TERMİNAL AT THE ATATÜRK AİRPORT ATATÜRK HAVALİMANI DIŞ HATLAR TERMİNALİ’NDE

Information Desk

u

Elevator

* Toilets

m Customs Florist Pharmacy Baggage daim Hotel Info Bagagge Custody Smoking Area Domestic Transit

İN İSTANBUL

__

w

Meeting Point Underground Shuttle / Bus

A

Taxi

©

Parking Airlines Lost Baggage Claim & Found

E3

Post Office

*-

« $

Rent A Car

Ti

Tourist Information

Bank/Exchange Office

Duty Free Shop A 1 (Classics) Food & Beverage

Duty Free Shop A2 (Classics) Duty Free Shop A 3 (Vintage-Express Counter) Golden Touch

Ol o

166 SKYLIFE 3 /2 0 0 6

Preorder Pick-up Desk

□E

|

HH

Duty Free

Food & Beverage

Public Area

Non-Public Area

Passaport Control

Yellow Parking Area

Blue Parking Area

R ed Parking Area

Services

Gloria Jeans Botanik Cafe

Gourmet Comer

Po

Green Fields Bar

Legend

Coca-Cola Cafe

Lounge


Upstairs From Th« Food Court

GİDİŞ KATI / DEPARTURE

M ain D u ty F ree S hop

G olden Touch Shops

D

I P o st O ffice

Sushi Meze

I Tax F ree

Delights

Kids W onderw orld

Baggage Claim

La st M inute G ate Shop

Ticket S ales Bank/Exchange Office

Prim e C lass Lounge

La st M inute G ate Shop

Is b a n k M illennium Lounge

La st M inute G ate Shop

A d van ta ge C lub L ounge

Atasay

TH Y C İP Lounge

Mavi Jeans

Doluca Kiosks

E-Shopping

Teras Cate

C onference R oom s

I British A irw ays Terraces Lounge

3 /2 0 0 6 SKYLIFE 167


& RESERVATİON INFORMATION

& REZERVASYON DANIŞMA

■ Dış Bürolar International Offices ABU DABİ - ABU DHABI GSA: Salem Travel Agency Al Saman Tower, Hamdan Street, P.O. Box 346 Abu Dhabi UNITED ARAB EMIRATES Tel: (971-2) 6218000 / 6211116 travels@salemtravelagency. com

ADIS ABABA GSA: Ethiopian Airlines, Bole Airport P.O. Box 1755 ETHIOPIA Tel: (251-1) 182222

ALMATİ - ALMATY Furmanova Str. No: 100 480091 G. Almaty KAZAKHSTAN S/R Tel: (7-3272) 506773-506774506220-501067 sales@turkishairlines.kz

AMMAN Jabal Amman Third Circle A. Riyadh Centre 8th Floor P.O. Box 39177 Amman JORDAN S/R Tel: (962-6) 4659102-4659112 thy@go.com.jo

AMSTERDAM Terminal West, Room D716, Schipol Airport 1118AA Amsterdam NETHERLANDS S/R Tel: (31 -20) 405 96 36405 36 45 info@turkishairlines. n!

ASTANA JSC International Airport Astana New Passenger Terminal on the 2nd Floor No: 2043 Astana KAZAKHSTAN Tel: (7-3172) 777020-777021777881-777882

AŞKABAD - ASHGABAD Magtymguly Ave. No: 73 7444000 Ashgabad TÜRKMENİSTAN S/R Tel: (993-12) 392919-356612

BAKU Husi Hacıyev Cad. No: 11 Baku AZERBAIJAN Tel: (99-412) 977300-975438 thy.baku@azeurotel.com

ATİNA - ATHENS

BAHREYN - BAHRAIN Manama Travel Centre VV.L.L., The Diplomat Radisson Hotel (Lobby Area) Building 59, Road 1701 Manama 317 KINGDOM OF BAHRAIN Tel: (973) 17211896-1722264717222648 turkair@batelco.com.bh 168 SKYLIFE 3 /2 0 0 6

Baseler Str. 35-37 60329 Frankfurt-Main GERMANY R/Tel: (49-69) 65007411-17 tra@tkgermany.com

Av. Santa Fe 1114-1 Floor B Buenos Aires ARGENTINA Tel: (54-11)48162307 turkishbue@speedy.com.ar

HAMBURG

BANGKOK Gult Express Transport Agency Ltd. CP Tovver 3rd Floor, 313, Silom Road 10500 Bangkok THAILAND Tel: (66-2) 2310300-07 tksales@thy.co.th

BARSELONA - BARCELONA Aeropuerto de Barcelona, Terminal A Modulo 5, Planta 2° Numero: 24 08820 El Prat de Llobregat Barcelona SPAIN R/Tel: (34 93) 2984170-2984331 turkish@ctv.es

BASEL Flughoff Fiughaten Basel 4030 Basel SWIT7ERU\ND Tel: (061) 3254959

BERLİN - BERLİN Budapester Strasse 28-30 10787 Berlin GERMANY S/R Tel: (49-30) 2624033-35 ber@tkgermany.com Schoenefeld Airport Tel: (49-30) 60915500 Tegel Airport Tel: (49-30) 41013412/13

BETHLEHEM GSA: JOY International Tours and Travel, Nativity Str. P.O. Box 630 Bethlehem PALESTINE AUTHORITY Tel: (972-02) 2 7 7 0 1 3 0 -3 3

BEYRUT-BEIRUT Emir Bachir Str. Lazarists Bldg. A2-2 Block Mazzenine Floor Al Bashoura-Central District, Beirut LEBANON Tel: (961-1) 999849-999848999850 thybey@magnarama.com

BİŞKEK - BISHKEK Athens International Airport Building 17th, 5th km Spata-Loutsa Avenue 190 04 Spata GREECE Tel: (30-210) 3537280-81-82 thyotfice@athensalrport.gr

FRANKFURT

BUENOS AİRES GSA: Intercontinente S.A.

Sovyetskaya 136 Bishkek KYRGYZSTAN S/R Tel: (996-312) 660008/9660011-603561-603171 thytru@elcat.kg

BRÜKSEL - BRUSSELS

BÜKREŞ - BUCHAREST BD. N. Balcescu 35-A Bucharest ROMANIA S/Tel: (4021)3112410-3113210 thy@mb.roknet.ro

Hermannstr. 46, 20095 Hamburg GERMANY Tel: (49-40) 325805-0 S/R Tel: (49-40)32580511-13-14-15 ham@tkgermany.com

CENEVRE - GENEVA

HANNOVER

Geneva International Airport 1215, P.O. Box 825 Geneva 15 SWITZERUV\ID Tel: (41-22) 7316120(3 Lines) S/Tel: (41-22) 7312194 thyairport_gva@freesurf.ch

Fiughaten Hannover Terminal A 30662 Hannover GERMANY S/R Tel: (49-511) 3048210/4 Lines haj@tkgermany.com

HONG KONG Best Holidays Ltd., Room 1805 Jubilee Centre 18, Fenwick Str. VVanchai Hong Kong P.R. CHINA Tel: (852)31010592 thyhkg@netvigator.com

CEZAYİR - ALGIERS 30 Rue Hassene Benamene Les Verger, Bir Mourad Rais ALGERIA Tel: (213-21)541313-446866

ISLAMABAD GSA: Pakturk Enterprises

CİDDE - JEDDAH City Çenter Bldg. Annex 12/13 Medina Road. P.O. Box. 11563 21425 Jeddah SAUDI ARABIA S/R Tel: (966-2)6600127 thyinc@awalnet.net.sa

COLOMBO GSA: Pership Holidays Pvt. Ltd. Pership House Level 4, 35 Edvvard Lane Colombo 03 SRİ LANKA Tel: (94-11) 2559884-25536895360143

DAHRAN - DHAHRAN GSA: ABC Travel Agency

JAKARTA GSA: Pt Dharma Buana Experindo Mayapada Tovver 16th Floor Jl Jend Sudirman Kav 28 Süite 16-05 Jakarta 12920 INDONESIA Tel: (62 21) 5212029

KABİL - KABUL GSA: Arya Turizm Seyahat Kargo Tic. Ltd. Şti. Shar-e-naw, İnsaf Hotel 1st Floor, Ansari Waat Kabul AFGANİSTAN Tel: (93 70) 277361

KAHİRE - CAIRO

King Abdulaziz Str. 25th Cross P.O. Box: 739 Alkhobar 31952 Dhahran SAUDI ARABIA Tel: (966-3) 8670044-8676269

DOHA KATAR-DOHA OATAR GSA: Trans Orient Agency P.O. Box 363 Doha OATAR S/R Tel: (974) 4458458-4423496

DUBAİ Al Sholala Building, A Block No:608 P.O. Box 1200 Dubai UAE S/R Tel: (971-4) 2940099-2957467 sales@turkishairlines.ae customer@turklshairlines.ae

DUŞANBE - DUSHANBE GSA: K a y n a k Ltd. Ş ti, Rudaki

64/E Masco Plaza Jinnah Avenue Blue Area Islamabad PAKİSTAN S/R Tel: (92-51) 2277595-99

Cd.

51. Cantersteen,1000 Brussels BELGIUM S/R Tel: (32-2) 5001932-5117676 sales@turkishairlines.be

No: 18 Dushanbe

BUDAPEŞTE - BUDAPEST

DUSSELDORF

Apaczai Csere Janos U. 4 1052 Budapest HUNGARY Tel: (361) 2664269-2664291 turkishairlines@axelero.hu

Graf Adolf Str, No. 21 40212 Dusseldorf GERMANY S/R Tel: (49-211) 373062-3854260 thy-dus@t-online.de

TAJIKISTAN

Tel: (992) 372 21 41 99 thydushanbe@mkf.tj

Nile Hilton Commercial Çenter 2nd Floor, Suit No: 32-33 Tahrer Sq. Cairo EGYPT S/Tel: (202) 5749009 turkish@turkish-eg .com

KARACI ■ KARACHI Jinnah International Airport Level 5, Room No. 5039 Karachi PAKİSTAN S/Tel: (92-21) 4571629 R/Tel: (92-21) 5685922-5685487 thykhi@cyber, net.pk

KAZABLANKA-CASABLANCA Tour des Habbous, 7 eme Etage, Avenue des F.A.R. Casablanca 20.000 MOROCCO Tel: (0212)22 538 121 R/Tel: (0212) 22 464500 (3 hat/lines) casasales@turkishairlines.ma

KİEV 19 Pushkinskaya Str. Apt 1 P.O.Box 540 252001 Kiev UKRAİNE S/R Tel: (380-44) 49059332296461 -2352562 thykiev@ukrpack. net


v .•m

\

* w

'w % - » >

^

Uluslararası İstanbul Fuarları

/

International İstanbul Fairs

‘ ^

w w w . t u y a p . c o m . t r

ijM

ğ

ğ

ğ

23. Uluslararası Örgü, Nakış, Çorap Makineleri, Yan Sanayileri ve Kimyasalları Fuarı

fa

v % *

. •

,

'

*

vV

. 1 ^CAKtlIe Machinery and Accessoties “ s. ^ IndustripllSls Association ^

* ■%.

' %

v » *.

2tfd International Knitting, Embroidery, HosieryMachines, Side Industriesand ChemicalsFair &V- V S ' * ? . ■ ■ ,

Onaylı Fuarlar A p p ro v e d E v e n ts

l l «l >J Üye KuruluşJMember TÜRKİYE FUAR YAPIMCILARI DERNEĞİ TURKİSHFAİR ORGANIZERSASSOCIATION

Tel IP hone: (0-212) 886 6 886 (Pbx) Faks / Fax: (0-212) 886 66 98 - 886 6715

te rnet / Web:

Fuar Alanı / Fair Area: fairarea@tuyap.com.tr

IU

FUARLAR

W f5£

5174

E-posta / E-mail:

SAYILI

KANUN

Yurtiçi Satış / Domestlc Sales: yurtlcisalis@tuyap.com.tr Yurtdışı Satış / Overseas Sales sales@tuyap.com.tr Yurtdışı Fuarlar / Overseas Fairs tuyapoverseas@tuyap.com.tr Tanıtım, Halkla İlişkile r Promotlon and Public Relatlons: tanitim@tuyap.com.tr

GEREĞİNCE

F A İ R S A R E H E L D U P O N TH E A U T H O R IZ A T IO N O F

TÜRKİYE

ODALAR

E-posta

/ E-mail:

E-posta /E -m ail:

:

Tüyap Adana: tuyapadana@tuyap.com.tr

Tûyap İzmir tuyaplzmlr@tuyap.com.tr

Tüyap Ankara: tuyapankara@tuyap.com.tr

Tüyap Konya tuyapkonya@tuyap.com.tr

:

Tüyap Bursa tuyapbursa@tuyap.com.tr

VE

BORSALAR

\

J

TÜ YA P Y U R TD IŞI OFİSLER OVERSEAS OFFICES OF TÜ YA P

TÜ YA P Y U R T İÇ İ OFİSLER LOCAL OFFIC ES O F TVYAP

TÜ YA P FAİRS A N D E K H IB ITIO N S ORGA N İZA T IO N IN C . FAİR A R E A H E A D OFFIC E ıyap Fuar ve Kongre Merkezi tyap Fair, Convention and mgross Çenter ı Karayolu, Gürpınar Kavşağı lylikdüzü, Büyiikçekmece 1522 İstanbul Türkiye

_________ _ TS EN |S0 9001:2000

:

:

Tüyap Samsun tuyapsamsun@tuyap.com.tr

BİRLİĞİ

(TOBB)

:

:

Tüyap Moskova/MoscoH' Tüyap m\%ITblllsl tuyapmoscow@tuyap.com.tr tuyapgeorgia@tuyap.com.tr

Ü

S

: „ tuyapsotla@tuyap.com.tr

Tahran/reAran:

Tüyap tuyaptehran@tuyap.com.tr

:

Tüyap Halep/4/eppo luyapaleppo@tuyap.com.tr

İZNİ

İLE

DÜZENLENMEKTEDİR.

T H E U H IO H O F C H A M B E R S A M D C 0 M M 0 D I T Y E X C H A H G E S O F T U R K E Y , IH A C C O R D A H C E W IT H L A W H U M B E R 5 1 7 4 .

Beylikdüzü Tüyap Fuar ve Kongre Merkezi

Fair, Convention and Congress Çenter Beylikdüzii, Büyiikçekmece İstanbul


& RESERVATİON INFORMATION

& REZERVASYON DANIŞMA

KİŞİNEV - CHISINAU

LYON

NEW YORK

ROMA - ROME

Chisinau Bııld. Dada 80/3 Airport REPUBUC OF MOLDOVA S/Tel: (373-22) 525472-525095 kivoperation@thy. md

59 Boulevard Marius Vivier Merle 69429 Cedex 03 Lyon FRANCE R/Tel: (33-4) 37916670 thy.lyon@wanadoo.fr

John F. Kennedy International Airport Terminal One Jamaica 11430 New York USA S/Tel: (1-718) 7512601-7512618 Local S/R Tel: (516) 2475402 Toll free no: 1-800-8748875 passengerservices@tknyc.com info@tknyo.com

Piazza Della Republica 55 00185 Rome ITALY S/Tel: (39-06) 4873368 R/Tel: (39-06) 4828349 roma@turkishairlines.it

KOPENHAG - COPENHAGEN Kastrup Lufthavn Terminal 2, Departure Hail, Ground Floor 2700 Kastrup DENMARK S/RTel: (45-33) 144055 info@turkishairlines.dk

KÖLN - COLOGNE Flughafen Cologne Bonn Terminal 2, Ebene 7, Bauteil Ost, 51147 Cologne GERMANY S/Tel: (49-2203) 402694-96 R/Tel: (49-2203) 402676/77 thy-cgn@t-online.de

KUALA LUMPUR GSA: Abda Aviation Sdn. Bhd. 19.01, Tovver Block, Kompleks Antarabangsa, Jalan Sultan İsmail 50250 Kuala Lumpur MALAYSIA Tel: (60-3) 27136185 thykul@myjaring.net

KUVEYT - KUVVAIT Al Shuhada Str. Aliaa Çenter P.O. Box 23959 13100 Safat KUVVAIT Tel: (965) 2453820-21-2422889 thy_kwi@hotmail.com

LAHORE GSA: Pakturk Enterprises National Tovvers 28, Egerton Road Lahore PAKİSTAN S/R Tel: (92-42) 6309926/9

LEFKOŞA - LEFKOSA Mehmet Akif Cad. 52 Lefkosa TURKİSH REPUBUC OF NORTHEN CYPRUS S/R Tel: (392) 2271061-2271382 thykib@ebim.com.tr

LJUBLJANA Turkish Airlines Inc. Zgomji Bmik 130a SI-4210 Brinik-aerodom SLOVENIA Tel: (386 4) 2061673 S/Tel: (386 4) 2061680 ljutztk@siol.net

LİZBON - LISBON GSA: Anatolia Representacoes Turisticas S.A. Avenida Fontes Pereira de Melo, 35-4 H1050-118 Lisbon PORTUGAL Tel: (351) 210 078 800

LONDRA - LONDON 125 PalI Mail SW 1 Y5EA London UNITED KINGDOM S/R Tel: (44-20) 77669300 info@turkish-airlines.co.uk Heathrovv Airport Tel: (44-20) 88971731-3614 Stansted Airport S/Tel: (44) 1279 681822 Tel: (44) 1279 681450 170 SKYLIFE 3 /2 0 0 6

MADRİD Plaza de Espana, 18 Torre de Madrid, Planta 14 OFC 11 28008 Madrid SPAIN S/RTel: (34) 902111235915487230 turkish@idecnet,com

MALTA GSA: Arrigo Group Limited 248 Tower Road Sliema MALTA S/Tel: (356) 316645-316705

MANCHESTER Room 1012, Olimpic House Manchester Airport M90 1QX Manchester UNITED KINGDOM S/RTel: (44-161) 4895287-89-93 sales@thymanchester.co.uk

MASKAT - MUSCAT GSA: Sunrise Travel and Tourism LLC P.O. Box 884 VVadi-Kabir 117 Muscat SULTANATE OF OMAN S/R Tel: (968) 24564636-24564575

MEDİNE - MEDINA GSA: ABC Travel Agency, Sultanah Alnozel Str. Saad Çenter P.O. Box 3645 Medina SAUDI ARABIA Tel: (966-4) 8224106

MEKKE - MECCA GSA: ABC Travel Agency Al Mansur Str., Al Khazindar Bldg. P.O. Box 3844 Mecca SAUDI ARABIA Tel: (966-2) 5434887-5476052

MİLANO - MILAN Piazza Fontana 6. 20122 Milano ITALY S/R Tel: (39) 0272008078028056051 v.giudici@turkishairlines.it mxp@turkishairlines. it

MOSKOVA - MOSCOVV B. Dimitrovka 7/5, Building 2, 2nd Floor Moscow RUSSİAN FEDERATİON Tel: (7-095) 980 5202 sales@turkishairlines.ru

MÜNİH - MUNICH Bahnhofsplatzl (Eingang Bayerstrasse) 80335 Munich GERMANY S/Tel: (49-089) 51410931-32 R/Tel: (49-089) 51410920-25 muc@tkgermany.com

NİCE Aeroport Nice, Cote D'Azur Terminal 1 06281 Nice Cedex 3 FRANCE S/Tel: (33-4) 93214479 (3 Unes) nice@turkishairlines.fr

NÜRNBERG - NUREMBERG Fluggast Terminal, Flughafen Strasse 100, 90411 Nuremberg GERMANY R/Tel: (49-911) 9297212-14/16 S/Tel: (49-911) 9372011/12 thynue@t-online.de

ODESSA Pushkinskaya 19/17 Odessa UKRAİNE Tel: (380-482) 347906-08 thy_odstztk@farlep.net

ROSTOV New Air Terminal Pr. Sholokhova 270/1 2nd Floor, Office No: 496 344066 Rostov-on-Don RUSSİAN FEDERATİON

SAN’A GSA: Universal Travel & Tourism P.O.Box: 18266, 60 Meters Road San'a YEMEN Tel: (967) 1 445970 (4 hat / lines)

SARAYBOSNA - SARAJEVO Ulica Kulovica Br. 5 Sarajevo BOSNIA & HERZEGOVINA S/R Tel: (387-33) 212 938666092-206241

SEUL - SEOUL OSAKA Ocat Bldg. 4F, 4-1 Minatomachi 1Chome Naniwa-Ku, 556-0017 Osaka JAPAN S/Tel: (81-6) 66441114 R/Tel: (81-6) 66441144

OSLO Gardermoen International Airport Departure Hail, 2061, Oslo NORVVAY S/Tel: (47) 648 20 530 (4 hat / lines) R/Tel: (47) 648 20 531

PARİS 58 Rue La Boetie 75008 Paris FRANCE Tel: (33-1) 56693350/57 paris@turkishairiines.fr

PEKİN - BEIJING W103, Kempinski Çenter 50 Liang Ma Qiao Road, 100016, Beijing P.R. CHINA Tel: (86-10) 64651867-70 bjsmanagment@turkishairtineschina.com bjsales@turkishairlineschina.com

PRAG - PRAGUE Vaclavske Namesti 19/3 Praha 1 Prague CZECH REBUBLIC Tel: (420) 234 708 708-715 info@turkishairlines.cz prg.sales@turkishairlines.cz

PRİŞTİNA - PRISTINA Lidhja E Pejes-Drini Ibardhe Str, No: 45 Pristina KOSOVA Tel: (381 -38) 502052-55 thytz@pm.ipko.net

RİYAD - RIYADH King Faisal Foundation P.O. Box 25194, 11466 Riyadh SAUDI ARABIA Tel: (966-1) 4631600-4632087 turkishairlines@sol.net.sa

E&M Air Service Co. Ltd. 904 Seoul Çenter Building, 5GA Sokong-Ro, Jung-Gu Seoul KOREA S/Tel: (822) 7570280 R/TEL: (822) 7777055 seltztkl ©komet.net

SİDNEY - SYDNEY 603/16 Barrack St. 2000 Sydney, NSW, AUSTRALIA Tel: (612) 92998400 (3 Unes) turkair@turkishairiines.com.au

SİMFEROPOL Simferopol Airport Crimea, 95491 Simferopol UKRAİNE S/R Tel: (380) 652248163 turkish@pop.cris.net

SİNGAPUR - SINGAPORE 150 Beach Road 15-04 Gateaway West 189720 SINGAPORE Tel: (65) 67324556-67324557 sales@thy.com.sg

SOFYA - SOFIA Saboma Str. No: 11 -A Sofia BULGARIA Tel: (359-2) 9883596-9874220 thy-sof-sat@medicom.bg

STOCKHOLM Tegner gatan 32 11359 Stockholm SVVEDEN Tel: (46-8) 218534/35 turkishairlines@swipnet.se turkishairlines@telia.com


TEB

teb.com.tr

444 0 666

B İR E Y S E L

TEB'DEN TE K H E S A P TA KOM PLE B AN KAC ILIK H İZM ETİ.

Açın, paranız fonda dursun, hesabınız kendi kendine çalışsın, gerektiğinde ödemelerinizi yapsın, yetmedi, kredi açsın, sonra yine fona dönsün!

8N P PARIBAS ORTAKLIĞI

TEB


& RESERVATİON

TİRAN - TİRANA

2 Allee De La Robertsau 67000 Strasbourg FRANCE R/Tel: (33-3) 88521413 thy.strasbourg@fr. oleane .com

Kam International S.H. P.K. Tirana International HotelBusiness Hail Skanderbeg Square Tirana ALBANIA Tel: (355-4) 234902-240964 thytia@icc-al.org

STUTTGART Lautenschlager Str. 20, 70173 Stuttgart GERMANY S/R Tel: (49-711) 2258222 / 7 lines thystr@t-online.de

ŞAM - DAMASCUS Abu Faddel Elmurady Str. 32 Damascus SYRIA S/Tel: (963-11) 2212263-2457277

TOKYO Toranomon Rapport, 4th Floor, 16-6 Toranomon 1-chom Minato-Ku 105-0001 Tokyo JAPAN R/Tel: (81-3)52511551 S/Tel: (81-3) 52511511 sales@turkishairlines.co.jp

ŞANGAY - SHANGHAI

INFORMATION

& REZERVASYON DANIŞMA

STRAZBURG - STRASBOURG

RM 342, Shanghai Centre, 1376 West Nanjing Road 200040 Shanghai, P.R. CHINA S/R Tel: (86-21) 3222002262798392 shasales@turkishairlineschina.com

GSA: Stellar Travel Inc. 100 University Ave. Süite 100 Toronto ON M5J 1 V6 CANADA Tel: (416) 596-6886 info@thycanada.com

ŞİKAGO - CHİCAGO 625 North Michigan Avenue, Süite 1400 Illinois 60611 Chicago USA Tel: (312) 9437858 (8 Lines) info@tkchi.com

TAHRAN - TEHRAN Ostad Motahari Avenue No: 239 Tehran İRAN S/RTel: (98-21) 87374648748450/51 -8737381/82/84 turkishair.thr@arayandeh.net

TAIPEI GSA: Golden Foundation Tours Corp. 8/F, 134 Chung Hsiao E. Road Sec. 4 Taipei TAIVVAN R.O.C. Tel: (886) 227733266 alan@gftours.com.tw

TRABLUS - TRİPOLİ GSPLAJ P.O. Box 4565 Elfateh Tovver 16th Floor Office Nr: 161 Tripoli UBYA S/RTel: (218-21) 3351352/53 thytip@yahoo.com

TAŞKENT - TASHKENT Navaiy Cad. No: 11/A Tashkent UZBEKISTAN Tel: (998-71) 1367989/90/92 thytasmng@sarkor. uz

TEBRİZ - TABRİZ Tabriz International Airport Turkish Airlines Tabriz IRAN Tel: (98-11) 2670151-4/6 tbkztk@thy.ir / tbzsales@thy.ir

TEL AVİV

172 SkY LİF E 3 /2 0 0 6

TORONTO

TUNUS - TUNIS Complexe Hotel El MechtelBloc Ctkd Blvd. Ouled Haffouz, 1 ler Etage 1005 El Omrane Tunis TUNISIA S/R Tel: (216-71) 787033-786473 turkish. air!ines@planet,tn

444 0 849

Uçuş Hattı Flight Line

■ İç Bürolar Domestic Offices ADANA Prof. Dr. Nusret Fişek Cad. No: 22 01120 Seyhan Tel: (322) 4570222 byilmazturk@thy.com

ADIYAMAN GSA: İnandı Turizm ve Seyahat Acentası, Atatürk Bulvan, No: 84 Tel: (416) 2161436/37/38/39 inanditurizm@mynet.com

AĞRI GSA: Ağn Mefser Turizm Vali Konağı Cad. No: 1 Tel: (472) 2159297-2151371

Acentası Lise Karşısı, Kütüphane Sok. D: 2 Tel: (382) 2132332-2127509

AMASYA GSA: Ayşafak Air Turizm Seyahat Acentası, Hacı llyas Mah. Yeniyol Cad. Saatçi Apt. No: 112/1 Tel: (358) 2122228 thyamasya@ttnet.net.tr

VARŞOVA - WARSAW Al Jerozolimskie 123 Millennium Plaza, IX Floor 02-017 Warsaw POLAND Tel: (4822) 5297700/01 director@turkish.pl

ANKARA

VİYANA - VIENNA

ANTAKYA GSA: Ant-Tur Antakya Turizm

Opemgasse 3 A -1010 VVİen AUSTRIA S/RTel: (43-1) 5862024 office@thy.at

Atatürk Bulvan No: 154 Kavaklıdere S/Tel: (312) 4280200 (5 Lines) R/Tel: 444 0 849 abayka@thy.com

ve Seyahat Acentası İnönü Cad. Rana Apt 15/D Tel: (326) 2149497-2160150

YENİ DELHİ - NEVV DELHİ

ANTALYA

Ambadeep Building 14 Kasturba Gandhi Marg. Connaught Place 110 00 Nevv Delhi INDIA S/Tel: (91-11) 41520795-97 R/Tel: (91-11) 41520790-94 management.deltk@interglobe.com

Konyaaltı Cad. Antmarin İş Merkezi No: 24 (Telsim yanı) S/Tel: (242) 2434380-2434383 pbx R/Tel: 444 0 849 mcavusoglu@thy.com

ZAGREB

Bat-Air Turizm ve Sey. Acentası Meydan Mah. Yeni Belediye Karşısı No: 22 S/R Tel: (488) 2139149-2139200

BİNGÖL GSA: Tütünen Turizm ve Sey, Acentası Yenişehir Mah. Genç Cad. Polat İş Hanı Kat: 4 No: 4 Tel: (426) 2135767

BİTLİS GSA: Öztaç Turizm Seyahat Acentası Nato Cad. Vakıflar Işhanı No: 1 Tel: (434) 2269898

BODRUM Kıbns Şehitleri Cad., Oasis Kültür ve Eğlence Merkezi, (Gümbet Kavşağı Karşısı) No: 8217/2 S/Tel: (252)3171203/04 R/Tel: 444 0 849 Bodrum Milas Havalimanı / Airport Tel: (252) 5230129-5230132 bodistmd@thy.com

BURSA AKSARAY GSA: Aksaray Turizm ve Seyahat

ÜSKÜP - SKOPJE Dame Gruev 3/2 Skopje MACEDONIA Tel: (389-2) 3117214-31161493148670 thyskp@yahoo.com

BATMAN GSA:

ARTVİN GSA: Turtıunt Turizm Seyahat Acentası, İnönü Cad. No: 16 Karahan Otel Girişi Tel: (466) 2121800

Haşim Işcan Cad. Tuğtaş İş Merkezi No: 12/E S/Tel: (224) 2211167-2212838 R/Tel: 444 0 849 bursasatis@thy.com.

ÇANAKKALE GSA: Sudalar Turizm ve Tic. A.Ş. Anafartalar Oteli İskele Meydanı Tel: (286) 2123366

ÇORLU GSA: Trakya Turizm ve Sey. Acentası, Çorlu Belediye Karşısı İş Merkezi No: 9 Tel: (282) 6530477/78

ÇORUM GSA: Çavuşoğlu Turizm ve Seyahat Acentası, Gazi Cad, Kesim Işhanı, No: 22 Kat: 3 Tel: (364) 2243928 cavusoğlutur@ttnet.net .tr

DALAMAN S/Tel: (252) 7925395 Fi/Tel: 444 0 849 aturut@thy.com

DENİZLİ İstiklal Cad. No: 27/B S/Tel: (258) 2648661-2648671 R/Tel: 444 0 849

DİYARBAKIR Sivil Havaalanı Terminal Binası Bağlar S/Tel: (412) 2355714 R/Tel: (412) 2368960-61

Hayarkon Str. No: 78 63432 Tel Aviv ISRAEL Tei: (972-3)5172333-35 sales@turkish.co.il

Jurisiceva 12, 10000 Zagreb CROATIA Tel: (385-1) 4921854/55 turkish-airlines@zg.htnet,hr

TİFLİS - TBILISI

ZÜRİH - ZÜRİCH

BALIKESİR GSA: Konak Arda Turizm Seyahat

EDREMİT

147, David Agmashenebeli Avenue Tbilisi GEORGIA S/R Tel: (99532) 959022-940703 thytbs@access.sanet.ge

Talstrasse 58-8001 Zürich SVVITZERLAND R/Tel (41-1) 2252323 zrhtk@bluewin.ch

Acentası, Eski Kuyumcular Mah. Çavuş Sok. İnal Apt. No: 15/1 Tel: (266) 2424462-2398575 konak.arda.tours@superonline.com

DHMİ Körfez Havaalanı, Edremit Tel: (266) 3761399 S/RTel: (224) 2211167 bursasatis@thy.com


Irak Hükümeti'nin Irak Dışında Ortaklaşa Gerçekleştirdiği ilk Fuar The First Fair That lraqi Governm ent Joinly Realizes Outside the Borders o f lraq

I

R

A

K

ULUSLARARASI

FUARI

expo gate way

IRAQ INTERNATIONAL FAİR

toIRAQ

7-11 / 06 / 2006 w

w

w

. ir a q in t e r n a t io n a lf a ir . c o

Gaziantep - Türkiye

w w w .ira k u lu s la ra ra s ifu a ri.c o m

DESTEKLEYENLER / SUPPORTERS

#TM

TO B »

T.C. BAŞBAK A N LIK DIŞ TİCARET M ÜSTEŞARLIĞI

TOBB

İ M REPUBUC OF TURKEY P M MINBTtY THE UNDERSECRETARIAT O f FOREIGN TRADE

The Union of Chombers OHMOcfi ıs o f Tim

G A Z İA N T E P SA N A Y İ ODASI

T İC A R E T O D A S I

C H A M B E R O F IN D U S T R Y

CHAM BER O F COM MERCE

G A Z İA N T E P

ORGANİZASYON / ORGANIZATION /A V em m 1nw~m 0 1. IRA K TİCARET B A KA N U Ö I

|S FORUM Fuarcılık ve Geliştirme A.Ş.

M IN IS T R Y O f T R A O t STA T! C O M P A N Y r o « IRACH « ir s

, . - _ „ _ 7J F< » « & Promotıons Co. Inc.

Forum Fairs & Promotions Co. Inc. Tel: + 9 0 (3 1 2 )4 1 9 19 32 (pbx) Fax: +90 (3 1 2 )4 19 19 37 www.forumfuar.com / www.forumfoir.com Gaziantep Chamber of Indushy Tel: +90 (342) 221 09 00 (pbx) Fax: +90 (342) 230 16 82


& RESERVATİON INFORMATION

& REZERVASYON DANIŞMA

EL A Z IĞ

Nailbey Mah. Vali Fahribey Cad. No: 39 S/Tel: (424) 2181576-2182300 R/Tel: 444 0 849 ezstk@ttnet.net.tr

ERZİNCAN GSA: Polat Turizm ve Sey. Acentası, Kızılay Mah. Süleyman Demirel İş Merkezi No: 4 Tel: (446) 2146784 THY Tel: (446) 2262114

ERZURUM Caferiye Mah. Cumhuriyet Cad. Eren İş Merkezi No: 88/3 Tel: (442)2136718-19 R/Tel: 444 0 849

İZM İR Cumhuriyet Bulvarı No: 99 Mahmut Rıza İş Merkezi Kat: 1 D: 2, Kat: 2 D: 4 Pasaport S/Tel: (232) 4841220 (5 Lines) R/Tel: 444 0 849 aavsar@thy.com

GAZİANTEP Atatürk Bulvarı No: 30/B S/Tel: (342) 2301563/64 R/Tel: 444 0 849 gztsatis@thy.com

GİRESUN G SA: Çotanak Turizm Sey. Acentası Atatürk Bulvarı No: 33/A Tel: (454) 2124880-2162890

HAKKARİ GSA: Oğuzkurt Turizm Sey. Acentası, Bulvar Cad. Oğuzkurt Apt. Kat: 1 Tel: (438) 2115257

İĞDIR G SA: Eger Turizm Sey. Acentası Belediye Parkı Karşısı No: 179 Tel: (476) 2279435/3231

İSPARTA GSA: Akita Turizm Seyahat Acentası İstiklal Mah. İstasyon Cad. Çağlar Apt. No: 23/1 Tel: (246) 2322592-2233590

İSKENDERUN G SA: Rende Tia Tour Sey. Acentası, Mareşal Fevzi Çakmak Cad. Kilise Dükkanları No: 21/B Tel: (326) 6138383-6134294 tiatur@superonline.com

İSTANBUL Pazarlama ve Satış Başkan Yardımcılığı (İç) Cumhuriyet Cad. No: 199-201 Kat: 3, Elmadağ, Harbiye S/Tel: (212) 2250556 R/Tel: 444 0 849 Satış Büroları - Sales Offices 1. K adıköy Satış M üdürlüğü Recep Peker Cad. No: 27 Kızıltoprak Tel: (216) 4184486 R/Tel: 444 0 849 2. Taksim Satış M üdürlüğü Cumhuriyet Cad., Gezi 174 SKYLIFE 3 /2 0 0 6

Dükkanları No: 7 Taksim Tel: (212) 2521106 (6 Lines) R/Tel: 444 0 849 3. H arbiye Satış M üdürlüğü Cumhuriyet Cad. No: 199-201 Kat: 3 Elmadağ Tel: (212) 2250556 (6 Lines) R/Tel: 444 0 849 harbiyesatis@thy.com 4. Genel Y önetim Satış Bürosu Yeşilköy S/Tel: (212) 4636363 Ext.3111 -3119 GSA: S abiha Gökçen Havalim anı Kurtköy S/Tel: 5855850/51,52,53

KAHRAM ANM ARAŞ G SA: Döngel Turizm Sey. Acenteliği, Trabzon Cad. No: 66/A Tel: (344) 2234181-2254037

KARAMAN G S A : Cicitur Seyahat Acentesi Haşan Ali Yücel Cad. Güzelzade Apt. No: 55 Tel: (338) 2120680-2142488

KARS G SA: Sınır Turizm ve Sey. Acentası, Atatürk Cad. No: 80 Tel: (474) 2123838/39/40

KAYSERİ Gevher Nesibe Mah. Tekin Sok. Hukuk Plaza Altı No: 6/C Kocasinan S/Tel: (352) 2223858 R/Tel: 444 0 849 kayserisatis@thy.com

KÜTAHYA

SİİRT

G S A : Serhat Turizm Seyahat Acentası Atatürk Bulvarı Arel Apt. No: 29/1 Tel: (274) 2123041

G SA: Bat-Air Turizm Sey. Acentası, Cumhuriyet Meydanı, Cumhuriyet Cad, Erdef Oteli Altı, No: 2 Tel: (484) 2237574 - 2237584

M ALATYA

SİVAS

Kanalboyu Cad. No: 10 Orduevi Karşısı S/Tel: (422) 3248001-3248008 R/Tel: 444 0 849 mlztztk@ttnet.net

G SA: Sivas Turizm Seyahat Acentası İstasyon Cad. 50. Yıl Sitesi No: 7-8 Tel: (346) 2211147-2244624 sivas@sivasturizm.com.tr

M ANİSA

ŞANLIURFA

G S A : Yoltur Seyahat Acentası Anafartalar Mah. Gaziosmanpaşa Cad. Merkez Işhanı No: 54/13 Tel: (236) 2346311 -2386649

G SA: Kaliru Turizm Seyahat Acentası, Sarayönü Cad. No: 74/A Köprübaşı Tel: (414) 2153344-2154548

ŞEREFLİKOÇHİSAR GSA: Bilen Turizm ve Seyahat Acentası Karayolları karşısı Yenişehir Tel: (482) 2133773-74

G SA: Çavuşoğlu Turizm Seyahat Acentası Ankara Cad. Çavuşoğlu Sok. No: 1/B Şereflikoçhisar Ankara Tel: (312) 6872383 unsalinaltekin@ttnet.net.tr

MARMARİS

TEKİRDAĞ

Atatürk Cad. No: 26/B Tel: (252) 4123751/52 R/Tel: 444 0 849 marmarissatis@thy.com

G S A : Trakya Turizm ve Seyahat Acentası Orta Cami Mah.Hükümet Cad. Belediye İş Merkezi K:1 D: 1 104 Tel: (282) 2618438

MARDİN

MUŞ G SA: Nurevsan Kamiloğlu Sitesi Atatürk Bulvarı İstasyon Cad. No: 127 S/Tel: (436) 2128682/83

NEVŞEHİR G SA: Argeus Turizm Seyahat Acentası, İstiklal Cad. No: 7 Ürgüp Tel: (384) 3414688-3415207

G S A : Ay Şafak Air Turizm Seyahat Acentası Gaziosmanpaşa Bulvarı Akyıldız Apt. No: 206/4 Tel: (356) 2147254 ay-safakair@ttnet.net.tr

TRABZON Trabzon Havalimanı Tel: (462) 3256738

UŞAK NİĞDE G SA: Sobek Turizm Sey. Acentası, İstasyon Cad. No: 67 Tel: (388) 2132117-2321507

KIRKLARELİ G SA: Korur Turizm ve Seyahat Acentası, Karakaş Mah. Karakaş Bey Sok. No: 14 Tel: (288) 2122066

TOKAT

G SA: Vatan Seyahat Acentası Durak Mah. Fatih Cad. No: 12/A Tel: (276) 2152033-2125129

VAN ORDU G S A : Çotanak Turizm Sey, Acentası, Şarkiye Mah. Belediye Sarayı Altı, No: 1/A Tel: (452) 2252054

Enver Perihanoğlu İş Merkezi Cumhuriyet Cad. No: 196 Tel: (432) 2155354/55 R/Tel: 444 0 849 vansatis@thy.com

OSMANİYE

YALOVA

G SA: Osair Turizm Seyahat Acentası, Alibeyli Mah. Orgeneral Cevdet Sunay Cad. Şehitlik Karşısı, Sarıkatipoğlu Pasajı, No: 2 Tel: (328) 8149229-8133404

G SA: Oba Turizm ve Seyahat Acentası Huzur Sok. Balkan Işhanı 19/B Tel: (226) 8141342

KIRŞEHİR G SA: Çavuşoğlu Turizm ve Sey. Acentesi, Atatürk Cad. Tüccarlar Işhanı No:7/2 Tel: (386) 2121172-2121718 m.inal@kaynet.net

KONYA Mevlana Cad. No: 9 Kat: 1/106 S/Tel: (332) 3512000-3512032 R/Tel: 444 0 849

SAKARYA G S A : Sakarya Turizm Uzunçarşı No: 1 Kat: 2, Adapazarı Tel: (264) 2749688

KUŞADASI G S A : Osman Turizm Seyahat Acentası Sağlık Cad. Akdaş Apt. No: 63 Tel: (256) 6144205-6149382

SAMSUN Kazımpaşa Cad. No: 18/A S/Tel: (362) 4352330 R/Tel: 444 0 849

YOZGAT G SA: Çavuşoğlu Turizm Sey. Acentası, Lise Cad. Vali Konağı Yanı, No: 49 Tel: (354) 2129193 (4 Lines) binaltekin@turk.net

R : Rezervasyon / Reservation S : Bilet Satış / Ticket Sales G SA : Genel Satış Acentası General Sales Agency


a n e w lo v e

is o n f 覺 r

M

in Mediterranean

hotels

DONNA

jC O M IN G SOON

S 襤 D E

MANAVGAT

A L A R A KAYI&im


BİLGİ INFO

c e p telefonlarının kapalı

Mobile phones interfere vvith the flight instruments and have a negative effect on flight safety. Therefore they must be switched off during the entire flight to provide personal and aircraft safety.

tutulm ası gerekm ektedir.

L a d ie s a n d G entlem en,

S a y ın Y o lc u la rım ız ,

The operation of the follovving items is forbidden during take off, landing and when the seat belt sign is on: Casette players, electronic games, portable computers, compact disc players, radio and TV receivers, portable video equipment, DVD, VCDor similar battery povvered electrical and electronic equipment. The operation of the follovving items is forbidden during the entire flight: Radio and TVtransmitter, portable phones, vvalky taikies, remote controlled toys, or any other electronic equipment transmitting eiectromagnetic vvaves.

aletlerini olum suz yön de e tkilem ekte ve uçuş em niyetini teh dit etm ektedir. Uçaklarım ızda uçuş em niyeti ve can güvenliği açısından

Do not!

Yapm ayın!

U çuş em niyeti için inişte, kalkışta ve kem er ikaz ışıkları yanarken; kaset çalar,

UÇAK İÇERİSİNDE, İNİŞTE,

elektronik oyunlar, taşınabilir

K ALK IŞ TA VE TÜM UÇUŞ

ve televizyon alıcıları,

B O Y U N C A K U LLA N ILM A S I,

taşınabilir video aletleri,

bilgisayar, d isk çalar, radyo

A YR IC A A Ç IK BIR A KILM A S I Y A S AK C İH AZLAR

DVD, VC D ve benzeri batarya ile çalışan elektronik ve elektrikli aletler kullanılamaz. U çak içinde tüm uçu ş boyunca; radyo ve

EO U IPM EN T VVHİCH İT IS

telsiz vericileri, taşınabilir

FO RBIDDEN TO USE OR

telefonlar, uzaktan kum andalı

TURN ON DURING TA K E -O FF

elektrom anyetik dalga yayan

OR LAN D IN G , AND

tüm aletlerin kullanılması

oyuncaklar ve

yasaktır.

T H R O U G H O U T THE FLİG HT

S a yın Y o lc u la rım ız , Tüm u çu ş boyunca, lütfen sigara, pipo , puro ve sigarillo içm eyiniz.

ÜZERİNİZDE VE EL BAGAJINIZDA TAŞIMAYINIZ! DO NOT CARRY ON YOUR PERSON AND İN YOUR CABIN BAGGAGE!

176 SKYLIFE 3 /2 0 0 6

Dear P assengers,

■ S ay ın Y o lc u la rım ız , C e p telefonları uçağın uçuş

BAVULUNUZDA VE EL BAGAJINIZDA RİSK TAŞIMAYIN! DO NOT CARRY RİSK İN YOUR CABIN AND CHECKED BAGGAGE!

La d ie s a n d G en tlem e n

Ptease refrain from smoking cigarettes, pipes and cigars during the flight.

A M E R İK A SEFER LER İN D E Ç A K M A K . KİBRİT VE BENZER İ T U TU ŞT U R U C U LA R I ÜZERİNİZDE, EL B A G A JIN IZ D A V E B A V U L U N U Z D A T AŞIM AN IZ K ES İN LİKLE YASAK TIR . FO R U.S. FLİGHTS. İT IS STRICTLY FO RBİDDEN TO C A R R Y LIGH TERS AND M A T C H ES ON YO UR PER SO N, İN YO UR CABIN AND CH ECK E D BAGGAGE.


Size dah a iyi hizm et ve re b ilm e m iz için lütfen arka sayfad aki form u do ldu rd uktan sonra dergid en ayırarak kabin e kib im ize iletiniz. Öneri ve görüşleriniz M üşteri İlişkileri M üdürlüğü tarafın d an ö zen le d e ğ e rlen d irile ce ktir. İn o rd e r th a t we can serve you b e tte r, please co m p le te the form on the b ack and hand it to one of the cabin crew . Y our vievvs and su g g e stio ns will be given careful co n sid e ra tio n by C u sto m e r R elations M anagem ent.

TURKİSH AIRLINES T Ü R K H A V A YOLLARI


Türk Hava Yolları’nı seçtiğiniz için teşekkür ederiz. Thank you for choosing Turkish Airlines. □

Uçuşla ilgili m em nuniyetim i paylaşm ak istiyorum. /

Ö neride bulunm ak istiyorum. /

I vvould like to make a suggestion.

Yolculuğum ile ilgili bir olayı aktarm ak istiyorum. gecikm e /

delay

iptal /

I vvould like to share my pleasure regarding the flight.

cancellation

/ With regard to my trip, I vvould like to inform you a situation concerning:

bagaj /

luggage ( diğer / other

Aşağıdaki bilgileri doldurduktan sonra dergiden ayırarak kabin ekibim ize teslim ederseniz çok m emnun olacağız. Bilgiler, Müşteri ilişkileri M üdürlüğü’ne iletilecektir.

We will be very pleased if, after completing the form, you vvould tear it out of the magazine and give it to one of our cabin crevv. The information vvill be passed on to our Customer Relations Management. O B a y /M r

E Bayan / Miss, Mrs

Uçuş numaranız / Your flight number

Soyadınız / Surname

Uçuş tarihiniz / Your departure date

ilk adınız / Your first name

Kalkış noktanız / Your departure city

Türk Hava Yolları Özel Yolcu Programı üyelik numaranız /

Varış noktanız / Your destination

Turkish Airlines Frequent Flyer Program membership number Seyahat sınıfınız / Your travel class

TK

Business Class Kart çeşidiniz / Your card type O Elite

Economy Class

(H Classic Yer numaranız / Your seat number

Adresiniz / Your address Uçak tipi / Your aircraft type

E-posta / e-mail_

T ü rk H a v a Yo lları h izm e tle rim iz ile ilgili öneri ve

Tel / Fax

ş ik a y e tle rin iz için / For your suggestions and complaints regarding Turkish Airlines services: E -p o s t a

T ü r k H a v a Y o lla rı A . 0 M ü ş te r i İliş k ile ri M ü d ü rlü ğ ü

Customer Relations Management

/ e-mail: c u s to m e r@ th y .c o m

T e l: + 9 0 2 1 2 4 6 5 2 2 6 9 Fax: + 9 0 2 1 2 4 6 5 22 63 w w w . t h y . c o m . t r ad res in d e ki ‘P A Y L A Ş A L IM ’ başlığı altın d a bulunan, T eşekkür,

G e n e l Y ö n e tim B in a s ı, Y e ş ilk ö y ,

Ö neri ve Ş ik a y e t’i sim geleyen ikonlardan birine tıklayarak d a iletebilirsiniz.

3 4 1 4 9 İs ta n b u l T ü rk iy e

Click on one of the icons for Thanks, Suggestions or Complaints under the ‘LETS SHARE’ menü on our vvebsite at WWW.thy.com.


Bilgi Turkish Airlines

Info

■ B e b e k le r iç in

Bebek maması, THY dış hat uçuşlarında "Özel Yemek Talepleri" kapsamındadır. Talep, rezervasyon sırasında ve tarifeli kalkış saatinden en az 24 saat önce yapılmalıdır. Cam kavanoz içinde yüklenen mamalar, sebzeli ve meyveli olmak üzere iki çeşittir. Kabin girişinde, sağ, sol veya orta sıra koltukların önünde sadece düz uçuş sırasında duvara monte edilebilen pusetleri kullanmak için, yer numaranızı alırken, bebeğinizin olduğunu ve önde oturmanız hususunu hatırlatmalısınız. Bebeğin altını değiştirmek için, kabindeki koltuklar yerine, bu işlemi kolaylaştıran özel modifikasyonlu tuvaletleri denemenizi tavsiye ediyoruz. ■ H a s ta v e h a m ile y o lc u la r iç in

Hasta yolcu için bilet alınırken ‘Hasta Yolcu Formu' düzenlenerek bilet kapağına mutlaka iliştirilmesi gerekir. Hasta yolcunun uçması için hastalık türünü belirten ve bu hastalığın uçak yolculuğuna engel teşkil etmeyeceğine dair bir doktor raporu gereklidir. Bu raporun tarihi 10 günden eski olamaz. Hasta yolcu, beraberinde doktor raporu getiremezse, DHMİ Genel Müdürlüğü İşletme Hekimliği Meydan Doktoru'ndan uçabileceğine dair onay alınır. Bakıma muhtaç hasta olan yolcu beraberinde

refakatçi getirmezse uçurulmaz. 7 ayını (28 hafta) bitirmiş hamile yolcunun kendi doktorundan veya DHMİ Genel Müdürlüğü İşletme Hekimliği Meydan Doktoru'ndan aldığı “uçakla seyahatinde sakınca yoktur" ibaresi bulunan raporu ile uçuşuna müsaade edilir. Bu raporun tarihi yedi günden eski olamaz. ■ E v c il h a y v a n la r için

Uçak kabininde evcil hayvan taşınması için rezervasyon yapılması gerekir. Evcil hayvan, yolcu tarafından getirilen uygun özel bir kafes, kutu ya da çanta içerisinde kabine alınır. Yolcu tarafından getirilen Ortaklık standartlarına uymayan muhafazalar kabul edilmez. Kabine alınacak evcil hayvanın geçerli bir sağlık belgesi, kimlik cüzdanı, aşı kağıdı yolcu beraberinde mevcut olmalıdır. Evcil hayvanlar kabinde oldukları süre içinde bulundukları muhafazalarından çıkartılamazlar ve muhafazalar sahiplerinin oturdukları koltukların önünde kabin içindeki gidiş ve gelişe engel olmayacak şekilde yerleştirilir. Yolcu kabininde taşınması mümkün olmayan ve yolcu beraberinde seyahat eden evcil hayvanlar ise, yolcu tarafından gerekli şartlara uygun muhafazaların içinde, kargo kompartmanında taşınır.

Infant Passengers

Baby food is available if requested in advance under THY’s Special Dietary Requests for 'International flights. The request must be submitted at the time of booking and at least 24 hours in advance of scheduled flight departure time. Baby foods are in glass jars and available in two varieties: vegetable and fruit. To use the cribs, which can be hung oniy while the aircraft is cruising on the walls at the entrance to the cabin in front of the

right, left and Central rows of seats, you must specify that you have an infant with you at check-in so that you can be placed in the front row of seats. To change your baby's nappy we suggest that you try using the specially modified lavatories vvhich facilitate this task, rather than the cabin seats.

m Sick Passengers and expectant mothers VVhen purchasing their ticket sick passengers should fiil in a Sick Passenger Form, vvhich must be attached to the cover of the ticket. A doctor's report specifying the nature of the illness from vvhich the passenger is suffering and declaring that there are no reasons why the person concerned should not fly is also required. This report must not be dated more than 10 days prior to the flight date. İf the sick passenger is unable to submit a medical report, then the State Airports Administration Medical Office vvill consult the passenger’s physician

for confirmation that the passenger is fit to fly. Passenger vvhose illness is severe enough to require care cannot fly unaccompanied.

Pregnant passengers in the 7th month (28th vveek) or more of pregnancy vvill only be permitted to fly vvith a statement from their own doctor or the State Airports Administration Medical Office declaring that air travel poses no risks for them. This report must be no more than seven days old on the day of the flight.

m Domestic pets Reservations are required for domestic pets, Passengers may carry domestic pets in the cabin only if they are in cages vvhich meet airline specifications. Domestic animals flying in the passenger cabin must possess a valid and up-todate record of health and vaccination. IA/hile on the aircraft domestic pets may not be allovved out of their carrying containers, vvhich must be placed in front of the ovvner’s sea t so as not to obstruct movement vvithin the cabin. Domestic pets accompanying passengers and vvhich cannot be carried in the cabin can be carried in the hoid in appropriate containers supplied by their ovvners. 3 /2 0 0 6 SKYLIFE 177


yararlanmak için lütfen ileriki satırlara bir göz atın.

Türk Hava Yollan vvebsitesi

satın almaya ya da

w w w .thy.com .tr

yapmaya ne dersiniz?

Biletinizi w eb sitemiz aracılığı ile rezervasyonunuzu w eb sitemizden Yapacağınız tek şey w w w.thy.com.tr adresine gitmek...

Turkish A irlines’ vvebsite

Yolculuğunuzla ilgili kısa detayları girdikten sonra seçtiğiniz özelliklere uygun uçuşlar

w ww.thy.com

ekranınıza getirilecek ve size uygun olan uçuşu seçmenizin ardından ücret detaylarını görüntüleyebileceksiniz.

TÜRK HAVA YOLLARI ®

Rezervasyonunuz için gerekli

E

yolcu bilgilerinin girilmesinin

Madrid ve Barcelona’da» « ve Lefko^rfyo

Mücrette»

onllnofailet

ardından bilet teslim seçeneğine

N' rr," n

göre ya rezervasyonunuzu yapabilecek ya da biletinizi satın

Oûrıuj t* Sn*

l> <Mıt ■donu; r T«v tön

- -th.-ö. m V

C

t>#nû> durailama noktalı

kodunuzu alıp verilen süre içinde sky

(»» f l ««0«0) .

*-

alabileceksiniz. Rezervasyon

|BmwıiKita) *J

FT3

biletinizi Türk Hava Yollarfnın satış ofislerinden biletletebilirsiniz, Biz

rttctsa. 0 sirsr

bu yönteme Ofiste Biletleme adını

TJfr'ya Ulafmak Ipn «

verdik. Eğer ödemeyi w eb sitemiz aracılığı ile yapmayı tercih

■ w w w .th y.co m .tr

süreye bağlı olarak Postayla Bilet

flight options w hich are

You may find ali Information

suitabie to your request wiil be displayed. By choosing

you need on this w ebsite... Turkish Airlines history, fleet information,

the flight, you m ay see the price details o f your trip. On

sales offices' contact

the next step you m ust enter

information, in-flight services,

passenger's details to create

frequent fiyer program information, faciiities offered to o u r passengers w ho need speciai care, prom otions and

you r reservation. A fter this step, you may choose ticket delivery option. İf you choose Ticket by Office option, you

ali other information you

need to go to the one o t our

need: w w w .thy.com

Sales Offices to com plete

Besides ali these information,

given time limit. İf you prefer

ticketing procedures in the you may enjoy ou r online

to make your paym ent online,

services such as online

depending the time rem ained

Schedule, online Ticket, and

to your flight, you m ay choose

Tarihçeden filo yapısına, Türk

ya da Havaalanında Biletleme

Hava Yollan satış ofislerinin iletişim

seçeneğini seçebileceksiniz.

online C heck-in in order to

Ticket b y Mail or Ticket on

bilgilerinden rezervasyona, uçak

Postayla Bilet’i tercih etmeniz

minimize the time you spend

Departure option. İn case that

içi hizmetlerimizden Özel Yolcu

halinde; biletiniz adresinize kurye

for you r travel transactions.

you choose the Ticket b y Mail

Programımıza, özel ilgi gereken

aracılığı ile gönderilecektir.

To enjoy o u r online services

option, we deliver your ticket

yolcularımıza sunduğumuz

(Postayla Bilet hizmeti Türkiye,

you do n o t have to be a

to your address b y courier.

kolaylıklardan promosyonlarımıza

ABD, Ingiltere'den başlayan

passenger. You may have an

(This service is only availabie

Türk Hava Yolları ile ilgili bilmek

yolculuklarda geçerlidir.)

important guest to m eet or

for the journeys starting from

istediğiniz herşey bu adreste:

Havaalanında Bilet seçeneğini

you simply to know whether

Turkey, USA an d UK) İf you

www.thy.com.tr

seçerseniz; biletinizi

your dearest arrived her/his

prefer Ticket on Departure, you may take you r ticket from

yolculuğunuzun başlayacağı

destination. Just reach our

Tüm bu bilgilerin yanı sıra Online

havalimanında bulunan Türk Hava

web site an d click the

Turkish Airlines' Sales Offices

Tarife, Online Bilet ve Online

Yolları satış ofislerinden teslim

Arrival-Departure link.

a t the airport where your journey begins. (We are

Check-in hizmetimizden

alabilirsiniz. (Havaalanında Bilet

We are doing ou r best in

yararlanabilir ve yolculuğunuzu

uygulamasının yaygınlaştırılması

order to d a im your baggage

continually looking to a d d

planlamak için harcadığınız süreyi

için çalışmalarımız devam etmekte

a t your destination point.

new routes to the eligible

azaltabilirsiniz.

ve her geçen gün listemiz

Sometimes, even we do not

Ticket on Departure

Online hizmetlerimizin

genişlemektedir. En güncel

want to make you live this

destinations. So, tor updated

avantajlarından faydalanmak için

bilgilere ulaşabilmek için lütfen w eb sitemizi ziyaret ediniz.)

bad experience, your baggage can not be

13 Haziran 2005 tarihinde başlayan hizmetimizle web

deiivered; you may check the status o f your baggage on

information, please visit our web site.) Beginning as o f June,

ou r w eb site.

Türk Hava Yolları seferlerinin

sitemizden satın alacağınız birçok iç hat uçuşları için artık e-bilet

Kalkış-Varış bilgilerine w eb sitemiz

satın alabilirsiniz. Böylece

To experience the faciiities

aracılığıyla ulaşabilirsiniz. Bagajınızın sizden farklı bir yere

websitemizden e-biletinizi satın

that ou r online services

to g o to the sales offices

aldığınızda satış ofisimize

provide on your next trip,

anymore, because your ticket

gitmesini engellemek için

gitmenize gerek kalmadan direkt uçuş günü check-in bankosuna

please take a glance to next pa ges. ..

will be issued electronically

elimizden gelenin en iyisini yapıyor, tüm önlemleri alıyoruz;

Do you wish lo bo ok and

ancak hiç istemediğimiz bu

giderek check-in yaptırabilirsiniz. Yakında diğer tüm iç hat

pay online your ticket

departure you will only need to go to the check-in counter.

durum ortaya çıkarsa, bagajınızın

uçuşlarınız ve dış hat uçuşlarınız

through our web site?

A t soon you will able to buy

takibini de w eb sitemiz aracılığı ile

için de w eb sitemiz aracılığı ile e-

The only thing you should do

e-ticket for your ali dom estic

yapabilirsiniz.

bilet satın alarak bilet satın alma

is to type on your browser's

and International tlights to

işleminizi daha kısa bir sürede ve zevkli bir şekilde

address ba r w w w .thy.com ,

make ensure you r ticket

Bir sonraki yolculuğunuzda online

A fter giving the information

buying process more

hizmetlerimizin avantajlarından

tamamlayabileceksiniz.

needed about you r trip, ali

enjoyable an d shorter.

mutlaka yolcu olmanız gerekmiyor. Beklediğiniz bir yakınınız ya da önemli bir konuğunuz mu var; tüm

178 SKYLIFE 3 /2 0 0 6

ederseniz, uçuşunuza kalan

■ w w w .th y .c o m

73 2 0 0 5 when you buy a dom estic (currently only for selected airports) ticket from ou r website, you will not have

(e-ticket) an d on the day o f


Online

w w w .thy.com .tr İnternetteki check-in bankonuz

Check-in

Self Check-in ■ O nline Check-in nedir? Yolcularımızın; www.thy.com.tr (türkçe) www.thy.com (ing)

adresimizden seyahat edecekleri uçuşlarına ulaşarak, kabin planında diledikleri koltukları seçebilme ve uçuşlarının son noktasına kadar check-in yapabilme olanağıdır.

w w w .thy.com Your online check-in desk ■ A bo u t Online C heck-

in

Accessing their flights from our vvebsites, www.thy.com.tr (Turkish) or www.thy.com (English), our passengers can choose the seat they want from the cabin plan and complete ali check-ın formalities up to their destination.

■ O nline C h eck-in yolcularım ıza neler kazandıracak?

m A dvantages o f Online C heck-in

Yolcularımız, seyahat edecekleri tüm rezervasyonlu uçuşlarına online ulaşarak, ev veya ofislerinin konforunda, seyahat edecekleri sınıfa ait koltuk planından dilediklerini seçerek check-in işlemlerini gerçekleştirebilecek ve birçok havalimanımızda kendilerine tahsis edilen özel kontuardan faydalanma imkânını elde edeceklerdir.

By accessing their previously reserved flights online, our passengers can choose whichever seat they want from the seating plan for the class in vvhich they are traveling from the comfort of their own home or office and complete checkin formalities, as well as taking advantage of the special check-in counters reserved for them at many of our airports.

■ O nline C h eck-in nasıl yapılacak?

■ H ow does Online

www.thy.com.tr (Türkçe) www.thy.com (İngilizce) adresimizde ONLINE HİZMETLER bölümünde yer alan ONLINE CHECK-İN sayfamızdan, bu hizmeti sunduğumuz havalimanı bilgilerine ve check-in işlemleri ile ilgili tüm detaylara ulaşabilirsiniz. Online Check-in yapabilmek için sadece isim/soyisim ve uçuş bilgileriniz yeterli olacaktır.

For full details regarding online check-in formalities and a list of airports offering this service, please visit the ONLINE CHECK-İNpage in the ONLINE SERVICES section of our website: www.thy.com.tr (Turkish) or www. thy.com (English). Your first and last name and your flight details are ali you need for Online Check-in.

■ Havaalanında yapılacak işlem ler

Yolcularmız, güvenlik prosedürlerinden geçtikten sonra, biniş kartlarının alınması ve bagajlarının teslim edilmesi işlemlerini, havaalanında kendilerine tahsis edilmiş olan check-in bankosunda tamamlayacaklardır.

C heck-in work

m P rocedure a t the airport A fter going through security procedures, our passengers will receive their boarding cards and com plete their baggage consigning at the check-in counter provided for them in the airport.

m S elf Check-in Türk Hava Yolları, Self Check-in cihazları ile havaalanındaki işlemlerinizi en hızlı biçimde gerçekleştirebileceğiniz bir hizmeti sunuyor. Bu uygulama sayesinde checkin işlemlerinizi kendiniz ve beraberinizdeki diğer yolcularımız için yapabilecek, istediğiniz koltuğu seçebilecek ve biniş kartınızı alarak doğrudan uçağa gidebileceksiniz. Bagajsız seyahatinizde, aynı gün içinde gittiğiniz yerden dönüş varsa dönüş uçuşunuz için de Retum Check-in işlemini gerçekleştirebileceksiniz. Bagajlı yada bagajsız, bağlantılı tüm yurtiçi seyahatlerinizde, siz ve beraberinizdekiler için, aynı rezervasyon kaydında olmak şartıyla, uçuşlarınızın son noktasına kadar Through Check-in yapabilecek ve tüm uçuşlarınıza ait koltuklarınızı seçerek, biniş kartlarınızı alabileceksiniz. Online Check-in yapmış olan yolcularımız, Self Check-in cihazlarından biniş kartlarını kendileri alarak doğrudan uçağa gitmenin yanı sıra, daha önce seçmiş oldukları koltukları değiştirme imkânına da sahip olabilecekler. Self Check-in hizmetimizden, geçerli elektronik bileti olan tüm yolcularımız yararlanabileceklerdir. Self Check-in hizmetimiz, İstanbul, Antalya, Dalaman, Bodrum ve İzmir havalimanlarından verilmektedir.

■ S e lf Check-in

Using Self Check-in equipment, Turkish Airlines offers a service which will make it possible for you to carry out your airport procedure in the speediest possible manner. Thanks to this service you will be able to effect check-in process foryourself and the passengers withyou, choose a seat to your liking, get your boarding pass and go straight to the plane. İfyou are travelling without baggage and there is a same-day return flight fromyour destination, you will also be able the carry out the Retum Check-in operation for the trip back. For ali domestic flights involving connections, with or without baggage, you and those travelling withyou will—provided you have made the same reservation—be able to effect a Through Check-in to your final destination, selecting seats and getting boarding passess for ali the flights. İn addition to get their boarding passes from the Self Check-in eçuipment, passengers who have performed Online Checkin will be able to change previously chosen seats. Passengers with valid electronic tickets can take advantage of our Self Check-in service. Self Check-in is available at İstanbul, Antalya, Dalaman, Bodrum and İzmirairports. 3 /2 0 0 6 SKYLIFE 179


Telefon ve faks hizmetleri Telephone and fax transm ission services

Geçerli Kredi Kartları

Credit Cards and Charges

American Express, Visa, Diners Club, JCB ve Mastercard/Eurocard. Telefon görüşmesinin dakikası 9,90 USD'dir.

American Express, Visa, Diners Club, JCB and Mastercard/Eurocard are accepted. The charge for a cali is USD 9.90 per minute or part thereof.

Yardım Müşteri Hizmetleri Telefonla görüşme konusunda herhangi bir sorunla karşılaşırsanız "I2+'İ tuşlayınız. Bu durumda AIRCOM Müşteri Hizmetleri Merkezi'ne bağlanmış olacaksınız. Bu arama için ücret ödemeyeceksiniz. Ayrıntılı bilgi için: e-mail: aircom@sita.aero Tel: + 1 514 3 247 266 (Bu numaraya yapılan aramalar ücretlidir.)

■ T elefon Hizm etleri Filomuza yeni eklenen A-330 uçaklarımızın Economy ve Business Class koltuklarının hepsinde; tüm A-340 uçaklarımız ile A-310 GÖKSU uçağımızın Business Class koltuklarının her birinde telefon mevcuttur. Tüm yolcularımızın kullanımı için A-310 GÖKSU uçağımızın Economy Class kabininde 2 adet, A-340 uçaklarımızın Economy Class kabininde ise 4 adet telefon bulunmaktadır. İhtiyaç duymanız halinde size yardımcı olması için kabin memurunu çağırabilirsiniz. Nasıl kullanılır? a. Telefonu kaldırın. b. İngilizceyi seçmek için "1" tuşuna basınız. c. Türkçeyi seçmek için "2" tuşuna basınız. d. Ekran üstüne gelen menüden "1"i seçiniz. e. Kartınızı, manyetik kısmı telefonun sol tarafına bakacak şekilde yerleştiriniz ve size doğru kaydırınız. Ekranda "kart kabul edildi" yazısını göreceksiniz. Bu kartınızın kabul edildiği anlamına gelir. Telefon numarasını tuşlayınız. Sonra "+“ tuşuna basın, arama başlayacaktır. Ekranda "telefon bağlandı" yazısını gördüğünüz zaman telefonla görüşme yapabilirsiniz. Görüşmeniz bittikten sonra "End Cali" tuşuna basın. Başka bir numarayı daha aramak isterseniz kartınızı tekrar kullanmanıza gerek yoktur. "End Cali” tuşuna bastıktan sonra görüşme ücreti duracaktır. 180 SKYLİFE 3 /2 0 0 6

■ Telephone Services

Telephones are available at ali Economy and Business Class seats on the new A-330 aircraft that are being added to our fieet, and at each Business Class seat on our A-310 GÖKSU piane as weil as on ali ourA-340 planes. İn addition for other passengers there are two telephones in the Economy Class Cabin of the Göksu /4310, and four telephones in those of ourA-340 aircraft. You may cali the flight attendant to assist you if necessary. Irıstructiorıs a. Lift the handset b. To choose English press 1. c. To choose Turkish press 2. d. Seiect / from the menü on the screen. e. Piace your credit card vvith the magnetic strip facing ieft, and siide it tovvards you. When you see the message "Card accepted" on the screen, enter the numberyou wish to cali Then press the '+' key. When the message

“Cali connected" appears on the screen, you may have your cali. VZhen the cali is complete press the End Cali button. To place additional calls there is no need to reinsert your credit card. Merely enter the new number and press the '+' key again. Charging stops v/hen the handset is returned to the cradle.

Assistance Customer Services

İf you encounter any dıfficulties with your cali, please dial 12+. This will connect you to AIRCOM Service Support Services Centre. No charge will be made for this cali. For further information, please contact:

e-mail: aircom@sita.aero Tel: +1 514 3 247 266 (Please note that this number is not free of charge.)

■ Faks hizm etleri Başlamadan önce faks çekeceğiniz kağıt üzerindeki klipsleri, zımba tellerini ve diğer kağıt tutucularını çıkarın. Kağıdın kuru olduğuna ve üzerinde yiyecek, içecek veya yapışkan maddelerin olmadığına dikkat edin. Faks cihazınızın arkasındaki Power anahtarının "ON" konumunda olduğundan emin olun.

■ Fax transmission

First remove any elips, staples or other paper attachments fromthe sheets you wish to fax. Check that the paper is dry and elean. Make sure that the power svvitehat the back of the facsimile machine is in the ONposition.

1. Kağıdı ön yüzü yere bakacak şekilde, terminal onu tutup kavrayıncaya kadar kağıt kılavuzuna yerleştirin.

1. Hold the paper face downwards and place it in the paper guide. When correctlypositioned the terminal will grip it.

2. Kredi kartını manyetik kısmı sağ tarafa bakacak şekilde kredi kartı okuyucusuna yerleştirin ve aşağıya doğru kaydırın.

2. Place your credit card in the Slot with the magnetic strip facing to the right and siide downwards.

3. Kredi kartınız geçerli ve faks terminali tarafından kabul edildiyse "PLEASE WAIT" ışığı yanacaktır. Çevir sesi ile birlikte "ENTER NUMBER" ışığı yanıp sönmeye başlayınca, OO+ülke kodu+alan kodu+faks numarasını tuşlayın.

3. İf your credit card is valid and accepted the PLEASE WAİTlight will go on. When the dialling tone begins and the ENTERNUMBERlight starts flashing enter 00 + country code + area code +fax number.

Not a. Eğer kart geçersiz ise, kabul edilmemişse veya cihaz onu okuyamıyorsa "ERROR" ışığı yanacaktır. Bu durumda "STOP/C" tuşuna basarak yeniden deneyiniz. b. Meşgul sinyali duyuluyorsa "STOP/C" tuşuna basarak yeniden deneyiniz. 4. Bağlantı sağlanınca yeşil

"PLEASE WAIT" ışığı yanacak ve gönderme başlayacaktır. İhtiyaç duymanız halinde yardımcı olması için kabin memurunu çağırabilirsiniz.

Notes a. if your card is invalid, not

accepted or unreadable the ERROR light will come on. İn this case press the STOP/C button. b. if the number is engaged press STOP/C button and tryagain. 4. When the connection is made the PLEASE WAİTlight will come on and transmission begin. You may cali the flight attendant to assist you if necessary.


Siz ve bagajınız

You and your

İSİM / NAME ADRES / ADDRESS

t e l i tele p h o n e

fY u n r u o ^ s c te k rpg>_ H o ii-T s trm b u i 717

VP,

4 5 7?ı

CEP / MOBILE PHONE

baggage

E-MAIL

■ Seyahat etmek üzere seçtiğiniz

işlemlerini kendi adınıza yaptınnız

■ Please check destination to

havayoiu şirketinden bagajınızı

ve teslim ettiğiniz

vvhich your baggage should be

u Present your baggage in your

hangi noktaya kadar

bagaj/bagajlarınız için size

labelled and the vveight limit

own name, and check the

etiketleyeceğini ve kaç kiloya

verilen etiket kuponları üzerindeki

permitted by the airiine you are

information on the baggage

kadar taşıma hakkınız olduğunu

bilgileri kontrol ediniz. Bagajınızı

flying vvith. Also check the vveight

receipts given to you at

mutlaka öğreniniz ve biletinizden

bir başka yolcu adına

limit marked on your ticket.

check-in. Do not register your

kontrol ediniz.

kaydettirmeyiniz, aksi halde kayıp

m Check the size and vveight

baggage in the name o f another

to pay additional charges.

■ Kabin içine alabileceğiniz

veya hasar durumunda tarafınıza

limits for hand baggage allovved

passenger. Remember that in this

el bagajlarına ilişkin ebat ve kilo

tazminat ödenmesi mümkün

in the cabin for the airiine you are

event you vvill not be able to daim

sınırlamaları hakkında bilgi edininiz.

olmayacaktır.

flying vvith. Turkish Airlines allovvs

for lost or damaged baggage.

Türk Hava Yolları standart boyut

■ Uçağa binmeden önce bagaj

one piece o f cabin baggage

m You may be reçuired to identify

ve ağırlığı 20x40x60 cm ve 8

gösterme uygulaması var ise

measuring 20x40x60 cm and

your baggage before boarding

kg'dır.

bagaj/bagajlannızı görevlilere

vveighing a maximum o f 8 kg.

the aircraft. Please point out each

■ Bagajınızın üzerine ad/soyad,

gösteriniz.

m Every piece o f your

piece o f your baggage to the staff m em ber on duty.

telefon numarası ve adres gibi

■ Varışınızda; bagaj bandından

baggage should be labelled vvith

bilgileri içeren isim etiketini

size ait bagaj/bagajları alırken

your name, telephone number

■ On arrival, be careful not to

mutlaka takınız. Etiketler

yanlışlıkla benzer bagaj

collect baggage resembling your

bankolarımızdan temin edilebilir.

almamaya dikkat ediniz.

and destination adress. Tags are available from our check-in

■ Daha önceki seyahatlerinize ait

■ Varışınızda teslim alamadığınız

desks.

m Should you find that your

etiketlerinizi bagaj üzerinde

bagaj/bagajlarınız için Kayıp ve

m Remove any tags and labels

baggage has not arrived to your

bırakmayınız.

Bulunan Eşya ofisine yapacağınız

from previous joumeys.

destination, please inform the lost

■ Havayolumuz, bagajınızda

başvuruda seyahat biletiniz ve

u Our airiine is not responsible

and found Office show the staff

bulunan para, ziynet eşyası,

bagaj etiketinizi/etiketlerinizi ibraz

for cash, jevvellery, samples,

m em ber your ticket and baggage

numune, değerli evrak, elektronik

ediniz ve görevlilere bagajınızın

valuable documents, electronic

receipt/s, and give details o f the

own b y mistake.

eşya, bozulabilir/kırılabilir madde

rengi, tipi, markası ve içindekilerle

devices, perishalbe/fragile items,

colour, type, brand and contents.

ve diğer değerli eşyalardan hiçbir

ilgili bilgileri bildiriniz. Size verilen

o r other valuables in your

Please keep the passenger

şekilde sorumlu değildir.

bagaj aksaklık raporu, seyahat

baggage.

irregularity report, your ticket and

■ Çuval, naylon torba, teneke

bileti ve bagaj etiketinizi/

m Baggage packed in

ticket receipt/s, as these vvill be

kutu, bidon vs. bagaj niteliği

etiketlerinizi muhafaza ediniz.

sacks, plastic bags, plastic

needed to daim your baggage

taşımayan eşyalann uçağın bagaj

■ Bagajınız 5 cıün içinde

containers, tins and other

vvhen it arrives.

bölümüne ve kabin içine kabul

bulunamadıâı takdirde lütfen

unsuitable packaging vvill not be

edilmeyeceğini unutmayınız.

verilen bagaj talep formu, orijinal

allovved either as check-in or

m Should your baggage not be traced vvithın 5 davs. please

■ Çakı, bıçak, tırnak makası,

biletiniz, bagaj etiket(ler)iniz, -

cabin baggage.

apply to the nearest Turkish

çakmak vs. gibi kesici, delici ve

varsa- fazla bagaj biletiniz ve

m Knives, penknives, nail

Airlines Office or Baggage Tracing

patlayıcı eşyalann kabinde

hüviyetiniz ile birlikte en yakın

scissors, cigarette lighters and

Çenter vvith your Property

bulunması güvenlik açısından

THY ofisine veya Bagaj

other cutting, piercing and

İrregularity Report, original ticket,

sakıncalı olup, kabul edilmediğini unutmayınız ve yanınızda bulundurmayınız. ■ 32 kg'ı aşan bagajlar hiç bir

Aksaklıklan Takip Merkezi Müdürlüğü'ne müracaat ediniz. ■ Bagajınız, THY'nin bilgisi

explosive items are not allovved in the cabin for security reasons, so please check that you are not

original baggage receiptfs), excess baggage receipt (if any) and a valid Identification

dışında size ulaştı ise, lütfen

cartying any such items in your

document.

şekilde check-in işlemi esnasında kabul edilmemektedir.

+90 212 463 63 63 / 5577-82

hand luggage.

m İfa third party delivers your

■ Do not overfiit your suitcases

baggage, please inform us by

Bagaj/bagajlannızın taşıma

irtibat numaralanna haber veriniz ve/veya +90 212 465 23 87'ye

and bags beyond their vveight or

calling + 90 212 463 63 63 /

esnasında fazla doluluktan dolayı

faks çekiniz.

volüme capacify. This can lead

5577-82 and/or faxing

to the handle breaking an d other

+ 90 212 46 5 23 87

zarar görmemesi ve sapının kopmaması için genişlik sınırlarını

Unutmayınız ki, bagajınızı internet

damage to your baggage.

ve ağırlık taşıma kapasitesini

üzerinden takip etmeniz size zaman kazandıracaktır.

32 kg. vvill not be accepted in

zorlamayınız. Taşıma hakkınızı

Therefore, baggage exceeding

aştığınız takdirde fazla bagaj ücreti

W eb a d re s le rim iz:

THY flights. İf your baggage

ödemeniz gerektiğini unutmayınız.

www.thy.com .tr ve

exceeds the vveight allovvance,

■ Bagaj/bagajlannızın teslim

www.turkishairtines.com

remember that you vvill be liable

Please note that tracking your baggage via the Internet vvill save you valuable time.

Our web addresses are: vwwv. thy. com. tr and www. turkishairlines. com 3 /2 0 0 6 SKYLIFE 181


Türk Hava Yolları 4 Kargo

f\IR K \SH

CARGO

Turkish Airlines Cargo ■ T ü rk H a v a Y o lla rı K a rg o 'y ıı N e K a d a r

182 SKYLIFE 3 /2 0 0 6

How familiar are you with Turkish Airlines Cargo?

■ 24 s a a t/7 gün Internet üzerinden

T a n ıy o rs u n u z ?

(w w w .T K K a rg o .c o m ,

Değerli Yolcularımız, Rahat ve konforlu koltuklarınızda seyahat ederken, Uzakdoğu’dan Amerika'ya, Avrupa'dan Ortadoğu ve Afrika’ya aynı uçakta sizlerle birlikte kargo taşıdığımızı biliyor musunuz?

w w w .T H Y K a rgo .com veya w w w .T K C a rg o .co m ad reslerinden kargolarınızı sürekli ta kip edebilir, iç hat kargo üc re t ve tarife bilgilerim ize ulaşabilirsiniz. A yrıca A lo Kargo S ervisim iz vasıtasıyla 24 saat tele fonu nuzu n tuşlarını

■ Y olcu uçaklarının kargo

kullanarak, kon şim ento

kom partım anlarının yanı sıra

num aranız ile kargonuz

3 6 ton kapasiteli A 3 1 0 -3 0 4

hakkında her türlü bilgiyi

kargo uçağı ile de kargo

öğrenebilirsiniz.

hizm eti sunm aya başlayan

Alo Kargo erişim numaraları:

THY Kargo ile artık da ha fazla

(+90) 212 46 5 25 2 5 / 7 hat ve

noktaya, daha fazla kapasite

(+ 9 0 )2 1 2 46 5 22 22 / 3 hat

ile kargo gö n d e rm e k m üm kün.

■ Türkiye’den yurtdışına kargo

Frankfurt, M a astricht, Londra,

gö n d e rm e k isted iğ inizde, size

Tel Aviv, A lm ata ve Yeni Delhi

gü m rük işlem leri, kon şim ento

gibi noktalara tarifeli kargo

kesim i, ücretlendirm e,

uçağı seferi düzenleyen THY

pa ketlem e vs. konularında

Kargo, sizlerden gelen tale pler

yardım cı o laca k IATA

d o ğ ru ltu s u n d a bu noktaları

(Uluslararası Hava

daha da artıracaktır.

Taşımacıları Birliği) üyesi

■ Hava kargo taşım acılığında

kargo acentelerim ize

A vrupa'nın ö n d e gelen

başvurm alısınız. IATA üyesi

isim lerinden biri olan Türk

kargo acentelerim izin erişim

Hava Yolları Kargo, 2 0 0 0

bilgilerine,

yılında aldığı ISO 9 0 0 2 Kalite B e lg e s i’ni, 2 0 0 3 yılında ISO 9 0 0 1 :2 0 0 0 revizyonuna uygun

(+90) 2 1 2 4 6 3 6 3 63 / 5 3 1 4 -

yenileyerek; vizyonunu "U çuş

Türkiye'ye kargo gö n d e rm e k

5 8 0 8 no 'lu telefonlardan ulaşabilirsiniz. Yurtdışından

yapılan tüm noktalarda hava

isted iğ inizde ilgili ülkedeki

kargo taşım acılığı k o n usund a

satış ofisim izle bağlantı

ilk te rcih edilen kuruluş o lm a k ”

kurm anız ge rekece ktir.

şeklind e genişletti.

■ K argonuzu, tarifeli yo lcu ve

■ Tekstil ürünleri, ye d e k

kargo uça k seferlerim izin yanı

parça, m akine akşamı, h i-te c h

sıra, özel kira (charter)

ürünler, çiçek, canlı hayvan,

seferlerim iz ile istediğiniz gün

deri, yaş sebze, meyve,

ve saatte, istediğiniz yere

değerli eşyalarınız...

taşım am ız m üm kün. Özel kira

Kargonuzun cinsi ne olursa

taleplerinizi

olsun, nereye gö nderm ek

(+90) 2 1 2 4 6 5 24 67 ve 4 6 3

isterseniz isteyin, yapacağınız

6 3 6 3 / 5 8 0 7 no 'lu tele fonu

te k şey gönderinizi Türk Hava

arayarak ve/ve ya (+90) 212

Yolları K arg o'nun güvenilir

4 6 5 24 7 4 'e fax çe ke re k

ellerine teslim etm ek.

yapabilirsiniz.

Dear Passenger, Did you know that vvhıle you are traveling in your comfortable seat in the cabin we are transporting cargo from the Far East, the Middle East and Europe to America and Africa on the same ptane as you? m İn addition to the cargo hoids on passenger pianes, THY Cargo has begun offering a cargo service that makes use of 36-ton capacity A 310304 transports, so that it is now possible to send cargo shipments of greater capacity to more destinations. With scheduled cargo fiights to such points as Frankfurt, Maastricht, London and Tel Aviv, Almaty, New Delhi, THY Cargo will add new destinations based on input from you the customer. m One of Europe's leading names in air cargo transport, Turkish Airlines Cargo recently renewed its ISO 9002 Certificate of Ouality, received in 2000, in line with the ISO 9001:2000 revision made in 2003, thereby expanding its mission to that of ‘a toppreference company for air cargo transport to ali flight destinations'. m Textile products, automobile and machinery spare parts, hitech products, fresh fiovvers, live animals, leather, fresh fruits and vegetables, valuable goods—vvhatever your cargo and wherever you want to send it, ali you need do is turn it över to our reliable Turkish Airlines Cargo staff.

m/\s well as accessing our domestic cargo rates, scheduiess and other details, you may also track your cargo once you have sent it över the Internet any time 24/7 on our websites (www. TKKARGO.com, wwwTHYKARGO.com or ww w.TKCargo.com). You may also cali our Alo Kargo Servis 24 hours a day for information by punching in your bili of lading number on your touch-tone phone. Alo Kargo access numbers: (+90) 212 465 25 25 / 7 lines and (+90) 212 465 22 22 / 3 lines m İf you want to send cargo abroad from Turkey, you may consult our cargo agents. As members of IATA (International Air Transporters Association), they will assist you with customs formalities, biliş of lading, rates, packaging and other questions. You may reach our lATA-member cargo agents by telephone at (+90) 212 463 63 6 3 / 5314-5808. İf you want to send cargo to Turkey from abroad, you will need to contact our sales offices in the country from which you are sending. m İf you want to send your cargo not on one of our scheduled passenger or cargo fiights but on a special charter flight, we can transport it any day and any time to any place you wish. You may place your special charter requests by telephone (+90) 212 465 24 67, 463 63 63 / 5807 or fax (+90) 212 465 24 74.


W h eth er itâ&#x20AC;&#x2122;s light or h eavy, fragile or tough, liquid or solid... or ev en both! W h ate ver your cargo is, do n ot worry. It is safe vvith us, and it vvill get there on time.

TURKÄ°SH CARGO P h o n e : + 9 0 2 1 2 4 6 5 2 2 2 2 (P b x ) w w w .T K C a r g o .c o m


U.S. Dapartmont of Juatica

OMB tu. 1115-014*

W e lco m e to the U n ite d States 144W NomoMnijront Vîm W«lv«r Arrivat/ Doparturo Var.

Do any of t h . following apply to you? (A v m rY n trN u )

■nprovM* yM »ıth Um avraM İM «TtU«lbkcMiMnM Typoocprinllofibljrwlthp«nın AIİCAPTTALUSTOCKS IIMC ENGIJ8II T t k i n « l » m - r l > »>W. ( « 9 İM both Ih. ArrİT.1 fUcord. Ura. I tlmıgb 11«nd üıo DofiÂrturotUo«d. ıum« 14through 17. Th. ..von* «dr ol tb iiİH U mu* W »«n»! .» I doud ChıMr» under İh, ol feurtoon mu»

E3no C. IU»o you » w hoon « m » " » utaua*. or İn UrronM »ctıvıUeo, or -* ~ .»d 1445 « m »ou m»olv.d, m »o* M J, uı fW««ut»on. «oruud wtthNaxi Oormony or IU oOM.7 □ »««g) No

Göçmen

D

b 2 15 " l8 9 5 3 0 1

_L

yönetmeliği

A/o you Mokiog M **»rtı » th. Uâ, ar hove you rıer h n oKİuded .od doportod; oc booo pre>»u.ly romvod from Ih. Unıud Suuk or prorurod u •ııra.iod V> pmura ı> H * « «ıt^urtolhoUA byfroudormı»rcprM,nuıion? 0 * « 8 »».

E

llrro yy^ow dot^Q|^ ^ | ^ ^ r ^ lh^«t^ u»^yof» «WM

¥.

H m w n w r b. n <m ı* » U A w » «MUy famıh. U A » had »U& v * . rtnrotod? Ifyo., □ *oo»*»

Im m igration

regulations

A B D ’ye uçakla giden bütün

S tates, ple a se no te th a t ali

tem sile n yalnızca bir kişinin)

p a sse n g e rs (or one p a s s e n g e r p e r fam ily) m u st

G üm rük Deklare Formu doldurm ası ge rekm e ktedir. ABD vatandaşları, ikam et

c o m p le te a C usto m s D e claration Form. A p a rt from

kartı (yeşil kart) sahipleri,

U S citizens, g reen -ca rd

Kanada vatandaşları ya da

holders, C anadian citizens

yeni g ö çm enle rin dışında,

a n d n e w im m igrants,

ge çerli bir A BD vizesine

a li pa s s e n g e rs travelling to

sahip ve son varış noktası

the U n ite d States, vvhether

A BD ya d a A B D 'nin dışındaki

as th e ir final de stin a tio n o r in

bir ülkeye tra nsit olan yolcuların her biri tarafından

o b lig e d to fiil o u t the w hite I-

transit to a n o th e r country, are

beyaz renkli 1-94 form unun

94 form. The green

doldurulm ası zorunludur. A şağıda adı geçen ülkelerden birine ait bir

l-9 4 W form m u st be c o m p le te d if you h o ld a p a s s p o rt from one o f the

p a saport taşıyıp giriş

follovving co u n trie s: A ndorra,

yapıyorsanız ya da A BD vizesi

A ustralia, A ustria, Belgium ,

olm adan (vize m uafiyet

D enm ark, Finland, France,

program ı altında) tra nsit yo lcu

Germ any, G reat Britain,

gibi konaklıyorsanız yeşil renkli 1-94W form unun doldurulm ası ge rekm e ktedir. Ülkeler: A ndorra, A vustralya,

Iceland, Italy, Japan, L iech teste in , Luxem bourg, M o naco, N etherlands, Nevv Z e a la n d , Norvvay, San

A vusturya, B elçika,

M arino, S pain, Svveden o r

D anim arka, Finlandiya, Alm anya, B üyük Britanya,

S w itzerland, a n d are eith er en te rin g the U n ite d S tates

İzlanda, İtalya, Japonya, L iech tenstein, Lüksem burg,

s to p there as a transit

M onako, H ollanda, Yeni

p a s s e n g e r vvithout a U.S.

Zelanda, N orveç, San M arino,

visa u n d e r the visa w aiver program .

Ispanya, İsveç ve İsviçre. 184 SKYLIFE 3 /2 0 0 6

İf y o u are flying to the U nited

yolcuların (ya d a her aileyi

o r m aking an inte rm ed iate

^

ıl vitoc rthac of d «D foodt. taM tef coouMKfel 1* Kctidcv» tht tottl -mhMdnr IA»c l ım ‘ " * -----------' r umoom cfco. bw

« h u m ss s S s u

01B ranan m *c US. $ Joo-

Tü h mhiı iuo, tanmı. m ıhn « • £T..W .« »dom <Wk> mi S o S T S ^ o ij^ r r w » ' ** mtmauty li n IIIran. «J ımm im ta mİ pmdooı mpm ntaHMİ taaaruu WİX ON TIK (VTOOTt SİM Cif HIK HUM »Tim İW HAST MAO IIU IMMKIAVI IVHİBUAIİON UntT ANDMU» Am i ) M I MXJAkATKIN

r«*4%&


Özel Y o lc u Program ı F re q u e n t F ly e r P ro g ra m m e

TURKİSH AIRLINES TÜRK HAVA YOLLARI Türk Hava Yolları’nın Özel Yolcu Programı Şimdi Miles

Smiles..

Turkish A irline’s Fregucnl Flyer Programme is “ Miles

Sm iles” ,\ o w ..

Hizmetlerimizi farklılaştırdık ve zamanının çoğunu uçaklarımızda geçiren değerli üyelerimize yeni ayrıcalıklar kazandırdık.

InMiles&Smiles, weoffermanynewservicesandprivileges tailoredaccordingtoour members’ travel needswhospendmost of their timeonboard.

M iles&Sm iles’ın en büyük farkı, program başlangıcımızdan itibaren uygulamada olan “Classic” ve “Elite” kartlanmıza, 2 yeni kartımızın daha ilave edilmiş olmasıdır. Kartlarımız Classic, Classic Plus, Elite, Elite Plus olarak isimlendirilmiştir. Miles&Smiles üyelerimizin bugüne kadar kazanılmış hakları ise aynen devam etmektedir...

Wehave4 types ofcards in Miles&Smiles Programme: Classic, Classic Plus, Elite and ElitePlus. “Classic Plus” and“Elite Plus" areaddedtoour existing “Classic’’ and“Elite"cards andali ofour cards nowhaveextra benefits. Wehavealsokept thegained rights ofour Programme members.

Web sayfalarımızdan (www.thy.com.tr) yeni programımız hakkmdaki tüm detaylı bilgiye ulaşabilirsiniz.

Youcan havedetailedinformation regardingour newprogramme at www.thy.com

Mil Kazanımı:

Mileave Accrual:

M iles&Sm iles üyeleri, Türk Hava Yollan ve American Airlines ile gerçekleştirdikleri uçuşlardan, programımıza ortak olan otel ve araba kiralama şirketlerinden, Shop&Miles Kredi Kartı ile yapılan alışverişlerden ve anlaşmalı sağlık kuruluşundaki harcamalanndan mil kazanmaktadırlar.

Miles&Smiles members can eammilesfromour programmepartner hotels, car rental companies; healthserviceandShop&Miles Credit Card expenditures,fromTurkishAirlines' andAmericanAirlines’fiights.

Üyelerimiz, Türk Hava Yollan tarifeli uçuşlanndan Club Mil, program ortaklarıyla olan aktivitelerinden Bonus Mil kazanırlar. Miles&Smiles üyeleri harcarken de mil kazanmaya devam ederler. Türk Hava Yollan’nın Shop&Miles Kredi Kartı ile yapılan ödemeler, Miles&Smiles üyelerine Garanti Bankası tarafından Bonus Mil kazandınr.

Miles&Smiles memberseamClub MilesfromTurkishAirlinesfiights and Bonus Milesfrom Programmepartners. Miles&Smiles memberswill collect Bonus Miles whileshoppingwith the"Shop&Miles" co-brandedcredit card, developedin cooperationwith Garanti Bank.

Ödüller: Miles&Smiles üyeleri kazandıklan miller karşılığında, Türk Hava Yollan ile yapacaklan tarifeli uçuşlarda ücretsiz bilet, refakatçi bilet ve Business Class’a geçiş (upgrade) ödüllerinden kendileri ve diledikleri kişiler için yararlanabilirler. Üyelerimiz, American Airlines ile gerçekleştirecekleri tarifeli uçuşlarda da ücretsiz bilet kullanabilirler.

Onceenoughmiles arecollectedMiles&Smiles members canbenefitfromfree tickets, companionticketsor upgradesonali scheduledfiights of TurkishAirlines eitherfor themselves orfor belovedones. Our memberscanalsobenefitfromfree ticketsonAmericanAirlines fiights.

Miles&Smiles üyelerinin hesaplannda kayıtlı olan yemek tercihleri özel olarak uçaklara yüklenmektedir.

Special meal request ofMiles&Smiles members areservedonboardaccording totheir record in our system.

Üyeliğiniz Hemen Başlıyor

Miles

M iles&Sm iles Programı’na, www.thy.com.tr internet adresinden anında üye olarak, program avantajlanndan faydalanmaya başlayabilirsiniz. Türk Hava Yollan ile ilk uçuşunuzdan ya da program ortaklanyla gerçekleştirdiğiniz ilk aktivitenizden sonra kartınız adresinize gönderilecektir.

Youcan becomea Miles&Smiles member via www.thy.com andstart tobenefitfrom membershipadvantages. Your permanent membershipcardwül besent toyour address after yourfirstflight withTurkishAirlines oryourfirst activity withoneofour partner companies.

Türk Hava Yollan Satış Ofisleri, Garanti Bankası şubeleri ve uçuş esnasında kabin memurlan tarafından temin edilecek başvuru formlannı doldurarak da özel yolcu programımıza üye olabilirsiniz. Doldurulan formlar, THY İstasyon ve Satış Ofislerine veya uçak içinde uçuş ekibine teslim edilebilir. Miles

Smiles Üyelikleri

M iles&Sm iles Programı’nda üyelikler Classic Kart ile başlar. Türk Hava Yollan ile sık uçan üyelerimiz gerekli Club Mil kriterlerini sağladıktan takdirde üst üyelik seviyelerine yükselerek program avantajlanndan daha fazla faydalanırlar.

Smiles Memberships

Youcanalsobecomeamember of theprogrammebyfillingout theapplicationforms which are availableat TurkishAirlines salesoffices, Garanti Bank branches, check-in counters or onboard. Completedforms canbedeliveredtoTurkishAirlines sales offices, Garanti Bank branches or toour cabinstaffonboard. İnMiles&Smiles Programme, Classic Card is thebeginninglevel of membership. As our members reachtherequiredClubMiles, theyareupgradedtotier levelsofmembership whichallows themtobenefitfromspecial awards andmoreprivileges. Miles&Smiles memberscanstart toeammilesontheirfirstflight bypresentingtheir temporary cards toour staffwhichareattachedtotheenrollmentforms.

Nasıl Üye Olunur?

Üyelerimize, başvuru formunda bulunan geçici kart ile mil kazanma imkânı tanınmakta olup, üyelik ilk uçuşta Miles&Smiles Üyelik Kartı’nın check-in personelimize gösterilmesi ile başlar. Tüm Miles

Ali Miles Smiles Members can benefit from:

Smiles Üyeleri;

Self-service check-in, On-line check-in, Yedek rezervasyonlarında öncelik, Program ortağı araba kiralama şirketlerinden indirimli araba kiralama imkânı, Özel yemek tercihi imkânlarından yararlanabilirler, Classic Kart haricindeki tüm Miles&Smiles üyelikleri 2 yıl geçerlidir.

Self-Service kiosks, Online check-in, Priority on reservationwaitinglist, Discountedcar rentals at our partners, Special meal request, Ali membershipcards except Classic Card is validfor 2years.

Program Ortaklanmız/Prograımtıe Partners

aA

J J J J DECAR

DİVANTüZy.

Garanti

Ş h f*

P MEMORIAL

Raffles INTCUNATIOVAI

StX T

Sorularınız için/Foryour Questions: Çagn Merkezi Tel: 444 O 849 (Her gün 07:00-22:30) Faks: 0212 465 23 06 Cali Çenter Phone: 444 0 849 (Everyday 07:00-22:30) Fax: 0212 465 23 06

swissötel

JY V IJD U IC I


C lassic Kart

^

1

-------------------------------------------------------

Beginnercardofourprogramme. Classic Cardmemberscanbenefitfromtheadvantagesstated for ali Miles&Smiles members.

Programımızın başlangıç kartıdır. Classic Kart üyeleri, tüm Miles&Smiles üyeleri için belirtilen avantajlardan yararlanabilirler. C lassic Plus Kart Üyeliği ve Avantajları

r------------------ —----------- —------ — I Classic Card

1

1l Advantages of Classic Plus Card

Türk Hava Yollan uçuşlarından son 12 ay içerisinde 20.000 Club Mil kazanımı ile gerçekleşir. • İç hatlarda Business Class kontuarlanndan check-in, • Rezervasyon önceliği, • İç hatlarda özel salon (CİP) kullanımı, • Fazla bagaj hakkı (uçulan sınıfın bagaj hakkına ilave olarak 10 kg. ekstra bagaj).

Members needtocollcct 20.000ClubMiles inthelast 12months inorder toqualifyfor Classic PlusMembership. • Check-in at theBusiness Class counters onTurkishAirlines’ domestic flights, • Priority onthevvaiting üst över non-members and Classic Card holders, • Access totheCİP loungeson TurkishAirlines domesticJlights, • Additional baggageallowance: Extra baggageentitlement of 10kg.

F-lite Kart Üyeliği ve Ayrıcalıkları

Advantages of Elite Card

Türk Hava Yollan uçuşlarından son 12 ay içerisinde 40.000 Club Mil kazanımı Elite Kart sahibi olmanız için yeterli olacaktır. İç ve dış hat uçuşlarda rezervasyon önceliği, İç ve dış hatlarda özel salon (CİP) kullanımı, Türk Hava Yollan Business Class uçuşlanndan 2 kat mil kazanma, Elite Kart’ta kalış için maksimum 10.000 mile kadar Club Mil satın alma hakkı, İç ve dış hat Business Class kontuanndan check-in, Fazla bagaj hakkı (uçtuğunuz sınıfın bagaj hakkına ek olarak 15 kg. fazla bagaj veya transatlantik uçuşlarda ekstra 1 parça bagaj taşıma hakkı), Son dakika upgrade. Özel danışma ve rezervasyon hattı, Ücretli Business Class biletlerde 2. yolcuya (refakatçiye) % 50 indirim.

Members needtoreach40.000 Club Miles within thelast 12 months in order toqualifyfor EliteMembership. • Priority on reservationwaitingiist, • Check-in at Business Class counters, • Access toCİP lounges, • Additional baggageallowance (extrabaggage allovvance of 15kg över theregular baggageentitlement of theclassflown bothondomesticand intemationalflights. On our transatlanticflights this allowance equals tooneadditional itemofbaggage), • Dedicatedphone line, • Last Minute Upgrade, • Double miles on Turkish Airlines Business Class flights, • Elite Plus Card holders canpurchaseupto10.000ClubMiles in order tomaintain their membershipstatus, ' 50%discount onBusiness Class paidticketsfor thecompanion._________________

Elite Plus Kart Üyeliği ve Ayrıcalıkları

Privileges of Elite Plus Card

Türk Hava Yolları uçuşlarından son 12 ay içerisinde 80.000 Club Mil kazanmanız Elite Plus Kart’a geçiş için yeterli olacaktır. • Belirli uçuş sınıflannda rezervasyon garantisi verilmekte olup, yer garantisi için rezervasyonunuzun Economy Class’ta uçuştan en geç 72 saat, Business Class’ta en geç 48 saat öncesine kadar yapılması gerekmektedir, İç ve dış hatlarda özel salon (CİP) kullanımı, Türk Hava Yollan Business Class uçuşlanndan 2 kat mil kazanma, İç ve dış hatlarda Business Class kontuanndan check-in, Elite Plus Kart’ta kalış için maksimum 10.000 mile kadar Club Mil satın alma hakkı, Fazla bagaj hakkı (uçtuğunuz sınıfın bagaj taşıma hakkına ek olarak 20 kg. fazla bagaj, transatlantik uçuşlarda ise ekstra 1 parça fazla bagaj hakkı), Son dakika upgrade, Özel danışma ve rezervasyon hattı, Ücretli Business Class biletlerde 2. yolcuya (refakatçiye) % 50 indirim, Yılda 2 adet upgrade hediyesi, Hediye olarak Elite Kart verebilme, Aile bireylerinin tek hesapta mil kazanması ve harcaması.

Members needtocollect 80.000ClubMiles vvıthin thelast 12months in order toqualifyfor Elite Plus Membership. • ReservationAssurance: For our Elite Plus members, theseats arealways reservedon our aircrafts! Tobenefitfromreservation assurance that is offeredonly toour Elite Plus members oncertainflight classes, the reservation must becompletedat least 72 hours beforedeparturefor economy and48hours beforedeparturefor business dass Jlights, Access toCİP lounges bothondomesticand intemationaljlights, • Double miles on TurkishAirlines’ Business Classflights, • Check-in at Business Class counters, • ElitePlus Card holders can purchaseupto 10.000 Club Miles enabling themtomaintain their membershipstatus, • Additional baggageallowance (extrabaggageallowanceof 20 kgöver the regular baggageentitlement of theclassJlown bothondomesticandintemationalflights. On our transatlanticflights thisallowanceequals tooneadditional itemofbaggage), • Last Minute Upgrade, • Dedicatedphoneline, • 50%discount onBusiness Class paid tickets for thecompanion, Freeupgradesonany TurkishAirlinesJlight (2upgrades withineachElite Plus membershipyear), • Complimentary Elite Cardfor anypersonyou vvill choose, • Family Membership (family membershipvvill allow our members tocollect andspend miles to/fromonesingleaccount whichenables themtoachievemore programawards).

Miles

Smiles Üyelerine internetten Kolaylık

Yeni üye kaydı, Adres değişikliği, Uçuş bilgilerini inceleme, Miles&Smiles hesabındaki son mil durumu, Millerin geçerliliği hakkında bilgi, Bir üst kart seviyesine geçmek ya da kart seviyesini korumak için gereken Club Mil miktan, Pin kodu işlemleri, Eksik uçuş bilgileri ile ilgili işlemler. Programa ilişkin genel bilgi, Programdaki son dakika güncellemeleri, haberler ve dönemsel promosyonlar. Miles&Smiles üyeleri tüm bu işlemleri internet üzerinden rahatlıkla tamamlayabilirler. Miles

Smiles Elektronik Bilet!

İç ve dış hatlarda birçok noktamızda e-bilet düzenlenmeye başlanmıştır. Tüm işlemlerinizi www.thy.com.tr adresinden tamamlayarak ve elinizde biletiniz olmadan doğrudan check-in kontuarına müracaat ederek uçuşlannızı gerçekleştirebilirsiniz. Dilerseniz sadece rezervasyonunuzu internet üzerinden gerçekleştirerek biletinizi size en yakın satış ofisimizden temin edebilirsiniz. Önemli Notlar: Lütfen rezervasyonunuzu yaptırırken öncelikle TK ile başlayan Miles&Smiles üyelik numaranızı belirtiniz. Lütfen check-in işlemi esnasında Miles&Smiles Üyelik Kartı’nızı mutlaka gösteriniz, • Lütfen isim ve soyadınızın, biletiniz ve Miles&Smiles Üyelik Kartı’nız üzerinde birebir aynı şekilde yazılmış olmasına dikkat ediniz. Hesabınıza işlenmemiş uçuşlarınız için internet sitemizden işlem yapabilirsiniz.

Internet Services

Onlineenrollment, Ali Miles&Smiles transactions (pincodechange, retroclaiming, latest mileageamount, validity of miles, club miles required tobeupgraded totier level cards), Updatingaddressandpersonal information, Special promotionsfor Miles&Smiles members, Nemanddetailedinformation regardingMiles&Smiles, Miles

Smiles lılectronic Tickets Via Internet!

Electronic tickets canbeissuedon most ofour domesticand intemational lines. Youcan completeali ofyour transactions via Internet andwithout a ticketyou canproceeddirectly toour check-incounter. Ifyou wish, you canonly makeyour reservation via Internet andapply tooneofour sales officefor ticket issue. Pleasevisit our websitewww.thy.comfor detailedinformation regarding therelatedtransactions and theroutes electronic ticketscanbeapplied. Important Notes: • PleaseStateyour membershipnumber whichstarts with TK initial duringyour reservation. Pleasepresentyour membershipcardtoour check-instaffat check-in. • Pleasebesurethatyour name/sumameonyour ticket andonyour membership card areexactly thesameinorder toprevent retroclaimsforyourflights. Youcanalso registeryour missingflights via our websitewww.thy.com.


T H Y ’n in Ö zel Y o lc u P r o g r a m ı a rtık M ile s O u r F re q u e n t F ly e r P ro g ra m m e

is N o w

M i l e s

Sm iles S m ile s !

Yeni adım ız ve kartlarım ızla hizm etinizdeyiz. K azanılm ış haklarınızı saklı tutuyor, avantajlarınızı daha da artırıyoruz. We are at y o u r service w ith o u r brand new nam e and m em bership cards... W h ile keeping y o u r already gained en litlem en ts, we are increasing y o u r advantages m ore than ever.

M

ile

s

&

T U R K İS H A IR L IN E S TÜRK HAVA YOLLARI

S

\^y

m

ile

s

n Qyin

www.thy.com 444 O 849


-O. DEDEM AN (y

HOTELS & RESORTS

t

INTERNATIONAL

>(| „ TÜRK HAVA YOLLARI j

D ED E M A N

SPECİAL OFFER FOR

MİLES&SMİLES ÜYELERİNE

MİLES&SMİLES MEMBERS

YÖNELİK ÖZEL FIRSAT

FROM HOTEL DEDEMAN İSTANBUL

Hotel Dedeman İstanbul baharın yaklaştığı bu

İn these com ing spring days, H o te l D e d e m a n

gün lerde 1 M a rt - 1 M ayıs 2006 tarihleri

İstan b u l offers surprises a t D ine & D ance Bar,

arasında en az üç gece konaklam a yapan

a n d fre e entrance to Life Style H e a lth & Beauty

M iles& S m iles üyelerine Dine & Dance Bar’da

Ç enter f o r a li M iles&S m iles m em bers w ho stay

sürprizler ve Life Style Health & Beauty Center’a

m in im u m 3 nights between M arch İst a n d M a y

ücretsiz giriş hediye ediyor. Hotel Dedeman

İs t 2 00 6. This spring ıvill be m ore enjoyable fo r

İstanbul M iles&Sm iles üyeleri için düzenlediği

Miles&Sm iles members.

keyifli kılacak. Unutmayın, Dedeman Oteller zincirinin Türkiye,

D o n 'tfo rg e t th a t M iles& S m iles m em bers also

Kuzey Kıbrıs, M oldova ve Ö zb ekista n ’daki

eam 5 0 0 bonus miles f o r th e ir stay a t any o f 76

to p la m

16 o te lin d e g erçe kleş tireceğ in iz

konaklam alarda 500 bonus m il kazanmaya

D e d e m a n Hotels throug hout Turkey, N orth ern

| \

INCREDIBLE CH AN C E FROM

İN A N IL M A Z FIRSAT!

DECAR RENT A CAR!

01.03.2006 ile 30.04.2006 tarihleri arasında % 5 e k s tra in d ir im s iz le r i b e k liy o r.

Extra 5 % d is c o u n t is w a itin g fo r you b e tw e e n 0 3 .0 1 .2 0 0 6 and 0 4 .3 0 .2 0 0 6 .

Tü rkiye’nin g ü v enilir ve lider rent a car m a rk a s ı D E C A R , M ile s & S m ile s k a rt sahiplerinin M a rt ve N isan ayı o tom obil kiralam alarında, sahip oldukları in d irim ü z e rin d e n ekstra % 5 in d irim veriyor. Decar’a gelin, yoldan zam andan kazanın.

As the d ep endable and leader brand o f T u rk is h car re n ta l s e c to r D E C A R , is p r o m o t in g e x tra 5 % d is c o u n t fo r M ile s & S m ile s card holders fo r th e ir car rentals in March and April. Com e to Decar, save tim e save money.

İndirim O ranı

bu kampanya ile yaklaşan baharı çok daha

..

decar

DECAR RENT A C A R ’ DAN

HOTEL DEDEMAN İSTANBUL’DAN

V

0212

Discount Rate

Classic & Classic Plus

3 5% + 5%

Classic & Classic Plus

3 5 % + 5%

Elite & Elite Plus

4 0 % + 5%

Elite & Elite Plus

40% + 5%

S a h ip o ld u ğ u n u z k a rt t ü r ü n e g ö re indirim den yararlanm ak için, rezervasyon aşamasında lütfen kart türünüzü belirtiniz. M il kazanm ak için kiralam a başlangıcında k a rtın ib ra z e d ilm e s i g e re k m e k te d ir.

To benefit from the attractive advantages offered acc ording to your card, please d ec lare the type o f yo u r card d u rin g res e rv a tio n .T o co llect m iles you m ust present your card at the beginning o f the rental.

B ilgi ve rezervasyon için: W eb / w w w .de car.com

For in fo rm a tio n and reservation: W eb / w w w .de car.com

Tel.

0212 337 39 49

Tel: 0212 337 39 49

Faks: 0212 288 90 10

Fax: 0212 288 90 10

Cyprus, M oldova a n d Uzbekistan.

devam ediyorsunuz. ww w .dedem an .co m h otels@ dedem an.com Rezervasyon için 0212 274 88 OO’ı arayabilirsiniz.

Fo r reservations please c a li 0212 274 88 00.

T U R K İS H A IR L IN E S

MİL KAZANIM TABLOSU (G eliş ve G idişlerde) / MİLES EARNING TABLE (From or to city) TÜRK HAVA YOLLARI Kalkış İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL

Vanş ABU DHAB1 ADANA ALMATY AMMAN AMSTERDAM ANKARA ANTALYA ASTANA AŞKABAD/ASKHABAD ATlNA/ATHENS BAHREYN/BAH RAİN BAKU/BAKU BANGKOK BARSELONA/BARCELONA BASEL BEYRUT/BEIRUT BERLİN/BERLIN BİŞKEK/BİSHKEK BODRUM BRUKSEL/BRUSSELS BÜKREŞ/BUCHAREST BUDAPEŞTH/BUDAPEST CENEVRE/C.ENEVA CEZAYI R/ALG1ERS CİDDE/JEDDAH DALAMAN DENİZLİ DİYARBAKIR DONETSK DUBAİ DUŞANBE/DUSHANBE DUSSELDORF ERZURUM FRANKFURT GAZİANTEP HAMBURG HANNOVER HONG KONG İZMİR KAHIRE/CAIRO KARAÇl/KARACHl KARS KAYSERİ KAZABLANKA/CASABLANCA KAZAN KİEV

Mil 1867 443 2439 754 1373 227 301 2128 1582 345 1607 1108 4647 1387 1144 614 1076 2328 265 1347 283 652 1189 1405 1477 296 226 642 657 1868 2116 1267 653 1157 540 1236 1198 4977 196 764 2459 747 389 2057 1374 656

[Kalkış İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL

Varış KİŞ1NEV/CHISINAU KONYA KOPENHAG/COPENHAGEN KOLN/COLONGE KUVEYT/KUWAIT 1.EFKOSE/LEFKOSA LIZBON/LISBOA LJUBJANA LONDRA/LONDON LYON MADRİD/MADRİD MALATYA MANCHESTER MİLANO/MILAN MOSKOVA/MOSCOVV MUNIH/MUNICH NEW YORK NİCE n Urnberg / n u r e m b e r g ODESSA OSLO PARİS/PARIS PEKIN/BEIJING prag / prague PRIŞTİNE/PRISTINA RİYAD/RIYADH ROMA/ROME ROSTOV SAMSUN SAN’A SARAYBOSNA/SARAJ EVO SEUL ŞANGAY/SHANGAI S1MFEREPOL SİNGAPUR/SINGAPORE SİVAS SORA/SOF1A STOCKHOLM STRASBURG STUTTGART ŞAM/DAMASCUS ŞIKAGO/CHICAGO TAHRAN/TEHRAN TAŞKENT/TASİ İKENT TIFLIS/TBILISI TEL AVİV

Mil 412 288 1249 1240 1349 476 2003 804 1552 1233 1687 523 1674 1034 1091 978 5009 1117 1042 393 1522 1392 4398 943 412 1510 852 696 393 1992 569 5198 4999 382 5390 440 304 1364 1159 1095 672 5477 1270 2090 832 701

, [Kalkış İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL İSTANBUL ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ANKARA ADANA İZMİR İZMİR

Vanş

Mil ] [Kalkış

Varış

Mil

TEBRİZ/TEBRIZ TİRAN/TIRANA TOKYO TRABZON TRABLUS/TRIPOLI TUNUS/TUNIS ÛSKÜP/SKOPJE VAN VIYANA/V1ENNA VA R$0VA/VVARSAW YENİ DELHl/NEW DELHİ ZAGREB ZÜRIH/ZURICH ADANA ADIYAMAN AĞRI AMSTERDAM ANTALYA BATMAN BERLİN BRÜKSEL DİYARBAKIR DUSSELDORF ELAZIĞ ERZİNCAN ERZURUM FRANKFURT HAMBURG HANNOVER İZMİR KAHRAMANMARAŞ KARS KOLN/COLOGNE MALATYA MARDİN MÛNIH/MUNICH MUŞ SAMSUN STUTTGART ŞANLIURFA TRABZON VAN VIYANA/V1ENNA CIDDE/JEDDAH BERLIN/BERLIN KÛLN/COLOGNE

948 470 5755 572 1027 1038 387 789 779 858 2834 720 1096 250 338 533 1575 257 462 1259 1555 416 1471 353 347 434 1365 1421 1391 339 278 533 1445 297 459 1189 471 250 1308 380 362 564 982 1096 1165 1290

MUNİH/MUNİCH STUTTGART ATLANTA BALTİMORE BOSTON CLEVELAND DALLAS DENVER DETROİT HOUSTON LAS VEGAS LOS ANGELES MİAMI MINNEA POLİS ORLANDO PITTSBURGH RALEIGH DURHAM SAN DIEGO SAN FRANCİSCO SEATTLE ST. LOUIS VVASHINGTON ATLANTA BALTİMORE BOSTON CLEVELAND DALLAS DENVER DETROİT HOUSTON LAS VEGAS LOS ANGELES MIAMI MINNEAPOLIS ORLANDO PITTSBURGH RALEIGH DURHAM SAN DIEGO SAN FRANCİSCO SEATTLE ST. LOUIS VVASHINGTON SINGAPORE

1020 1131 599 611 858 307 801 907 237 935 1519 1746 1İ90 344 990 403 637 1727 1851 1726 257 590 756 179 191 416 1378 1626 491 1415 2235 2459 1092 1017 938 331 425 2432 2572 2406 882 215 897

İZMİR İZMİR CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO CHİCAGO NEW YORK NEW YORK NEW YORK NEW YORK NEVV YORK NEW YORK NEVV YORK NEVVYORK NEVVYORK NEW YORK NEVV YORK NEVV YORK NEVV YORK NEVV YORK NEVV YORK NEVV YORK NEVV YORK NEVV YORK NEVV YORK NEVV YORK BANGKOK

Amerikan Airlines tarifesinde New York ve Şikago bağlantılı uçuşlarda zaman zaman değişiklikler olabilmektedir. Güncel bilgi için satış ofislerimize danışabilirsiniz. Yukarıdaki mil değerleri Uluslararası Sivil Havacılık Teşkilatı'nın (IATA) belirlemiş olduğu mil değerleri olup, M iles&Sm iles Programı’nda bu mil değerleri kullanılmaktadır. Bu miller "uçuş bilgileri" sayfasında belirtilen mil değerlerinden farklıdır. American Airlines fiights vvhich have connections with New York and Chicago are subject to sehedule changes, please contact our sales offices fo r recent updates. The distance in miles specified are those laid down by the international A ir Transport Association (IATA), and usedfor M iles&Smiles Programme. These miles differ from those given on the flight information page.


H ilto n

Gökyüzünde Türk Hava Yollan, karada Avis ile

TU R K İS H A IR LIN ES TÜRK HAVA YOLLARI

hızla ve güvenle sevdiklerinize ulaşırsınız. İn the sky vvith Turkish Airtines and on the road vvith Avis. you can reach your loved ones quickly and securely

Hilton VVeekends + 2 x Miles

AV/S

0

We tryharder.

T U RK İSH AIRLINES TUR K HAVA YOLLARI

31 Mayıs 2006'ya kadar Avrupa, Afrika ve B.A.E’nde 100'den fazla Hilton'da unutulmaz bir hafta sonu tatili Miles&Smiles üyelerine 2 kat Bonus Mil kazandırıyor. Size paketlerden birini seçmek kalıyor. 'Şık' Paket: Rez. Kodu Adana. i z ^ r . A n t e r a A M a ^

P77TIS, 'Romantik' Paket: Rez. Kodu P77TBR, 'Buluşalım' Paketi: Rez. Kodu

İstanbul. Dalaman &Trabzo

P77TGT, 'Uzun Hafta Sonu' Paketi: Rez. Kodu: P77TLW.

havalimanlarında...

Until 31 May 2006 enjoy a Hilton Weekend at more than 100 hotels in Europe, Africa and U.A.E. and double your Bonus Miles ifyou are a Miles&Smiles

Size özel günlük araç kiralama fiyatlarımız: O ur S p e c ia l D aily Rates:

member. Now, ali you have to do is choose one of our great packages.

FIAT ALBEA I FORD FOCUS

İn Style': Res. Code P77TIS, Be Romantic': Res. Code P77TBR, ’Get Together': Res. Code P77TGT, 'Longer VVeekends': Res. Code: P77TLW.

L T30¥*L

Kampanya koşulları

&

79

Detaylı bilgi için

www.avis.com.tr

72

YTL YTL

89 82

YTL YTL

Sabiha Gökçen'de (Sabiha Gökçen Rates)

Reservation: +90 212 3 6 8 68 00 Kampanya 31 Mart 2006 tanhine kadar Avis genel kiralama koşullan dahilinde geçerlidir. Kampanya Miles&Smiles üyelerine mil kazandırmaktadır. Üye bu kampanyadan faydalanmak için Miles&Smiles üyelik kartını, kampanya tarihleri arasında THY ile uçtuğunu gösteren biletini ve biniş kartını beyan etmelidir. This offer is valid until March 3İst 2006. Avis general rental terms and conditions are applicable. Mileage eamıng ıs possible for Miles&Smiles members with these fares. This offer is valid only for Miles&Smiles members who present a THY flıght ticket and a boardıng card ıssued vvıthın the valıdity perıod of the offer.

B ilgi için / F o r i n f o r m a t i o n

h ilto n c o m / w e ek e n d s T A K E M E T O T H E H İLTO N

Çırağan Palace Kem pinski’den özel fırsat! Çırağan Palace Kempinski İstanbul, Nisan 2006 sonuna kadar, Miles&Smiles üyelerine; Deluxe, Grand Deluxe ve otel süitleri rezervasyonlarında kahvaltıyı dahil ediyor.

Special offer from the Çırağan Palace Kempinski İstanbul! Until the end of April 2006, the Çırağan Palace Kempinski İstanbul is offering Miles&Smiles members a complimentary breakfast buffet vvith any Deluxe, Grand Deluxe or hotel süite reservations.

Divan, geçmişten günümüze, yaşamayı bilmenin ve seçkin tercihlerin simgesi oldu. Keyif ve lezzeti, ‘hayat boyu Divan keyfi’ felsefesiyle benzersiz bir şekilde sundu. Ayrıcalıklı hizmet anlayışıyia sektörün öncü kuruluşu olmaya devam eden Divan, 2006’da 50. yaşını kutluyor. Divan Otelleri'nden Miles&Smiles üyelerine ilan edilmiş fiyat üzerinden 31 Mayıs 2006'ya kadar %10 indirim uygulanacaktır.

Pioneer of the Turkish hospitality sector and a symbol of distinction and exclusMty, Divan celebrates its 50th anniversary in 2006 vvith pride and joy. Çırağan Caddesi No 32 Beşiktaş 3 4 34 9 İstanbul Türkiye Ç ıra ğ a n P ala c e K e m p in sk i ISTAN BU!. 'Thffa*UnfHotrbotü*WvU-

© gloM not« o»anc*

Tel + 90 2 12 326 46 46 Faks + 90 212 259 6 6 87 reservations.ciraganpalace@kempinski.com ww w.ciragan-palace.com

10% sale vvill appty from rack rate to ali Miles&Smiles members until May 31, 2006.

www.divan.com.tr

Rezervasyonlar d oluluk oranına bağlıdır.

Reservations are subject to availability.

ÜRK HAVA YOLLARI

®

T U R K İSH A IR LIN ES TÜ RK HAVA YOLLARI


■ Türk Hava Yolları Uçuşları ve Mesafeler - Turkish Airlines Flights and D istances (Dış Hatlar-lntemational Flights)

Uçuş bilgileri

M İLANO / M ILAN M X P (M İL)

173 5

93 7

ALM ATY ALA

4145

2238

MOSKOVA / MOSCOVV SVO (M O W ) 193 2

104 3

AM M A N A M M

152 8

825

MÜN İH / M UN IC H M U C

1637

884

AM STERD AM A M S

2356

1272

NEVV YO RK J F K (N Y C )

8575

4630

ASTAN A TS E

3902

21 0 7

NİCE NC E

1983

1071

AŞ KAB AD / AS H G A B A D A S B

2636

1423

NÜRN BER G / NUREM BERG N U E

173 3

936

580

313

358

BAHRAIN BAH

27 8 7

663

150 5

BAKÜ / BAKU G Y D (BAK)

1845

996

B A N G K O K BK K

78 0 3

4213

B A R C ELO N A BC N

2 2 /8

123 0

BASEL BSL BERLİN S X F - T X L

196 3

1060

185 8

100 3

PRİŞTİNA / PRISTINA PR N

565

BİŞKEK / BISHKEK FR U

104 6 4047

B R ÜK SEL / BR US SELS B R U

2228

BUDAPEŞTE / BUDAPEST B U D

1 189

BEYRUT / BEIRÜT BE Y

CENEVRE / GENEVA G VA

1952

O D ES SA O D S O S LO O S L

2734

147 6

PARİS (ORLY) O R Y (PAR)

2358

127 3

PEKİN / BEIJING BJS

76 9 0

4152

PRAG / PRAGUE PR G

1613

871

860

464

RIYAD / RIYADH R U H

2602

1405

2185

R O M A / ROM E (FIUMICINO) FC O

148 9

804

120 3

RO STO V RO V

137 9

745

642

S A N 'A SAH

3550

1917

311

S A R A YBO SN A / SARAJEVO SJJ

1461

789

SEUL / SE O U L IC N (SEL)

8708

4702

1054

CEZAYİR / ALGIERS ALG

2471

1334

CİDDE / JED DA H JE D

2584

1395

D O NETSK D O K

1150 _ 3274

DU ŞA N BE / DU SH AN B E DY U D Ü SS ELD O R F D U S

621

3587

176 8 1937

2182

117 8

FRANKFURT FRA

190 9

1031

HA M B UR G H A M

2130

117 1

HANNOVER HAJ

2061

H O N G KO NG HK G

9708

1 5242

113

SİM FER O PO L S IP SİNG APUR / SING APORE S IN

659

356

9538

5150

574

310

ST O C K H O LM A R N (STO )

2408

13 0 0

STRAS BO UR G SX B

1952

1054

STUTTGART S T R

183 0

988

ŞA M / D A M A S C U S D A M

119 3

644

ŞA N G AY / SH AN G H Aİ PVG

8975

4846

ŞİKA G O / C H İC A G O O R D (C H I)

9204

4970

SO FYA / SO FIA S O F

KAHİRE / C A IR O CAI

129 3

69 8

TAHRAN / TEHRAN T H R

2165

116 9

KARACI / KARACHI KH I

4210

2273

TAŞKENT / TASHKEN T TA S

3517

189 9

KAZABLANKA/CASABLANCA CMN (CAS) 3 4 6 9

1873

TEBRİZ / TABRİZ T B Z

155 2

838

KAZAN KZN

2252

121 6

TEL AVİV TLV

1261

681

KOPENHAG / COPENHAGEN C P H

2109 724

113 9

TİFLİS / TBILIS T B S

143 9

777

391

TİRAN / TİRANA T IA

87 2

471

KIŞİNEV / CHISIN AU KIV KİEV K B P (IEV)

11 0 9

599

KÖ LN / C O LO G N E C G N

2146

115 9

KUVEYT K W I

2632

1421

837

452

3484

1881

LONDRA / LONDON LON (LHR, STN) 2 5 8 0

1393

LEFKO ŞA EC N LİZBO N / LISBO N LIS

değerleri, uçağın uçtuğu irtifada

N.. Miles

1753

DUBAİ DXB

yayımlanan km ve mil (deniz mili)

Km

3246

BÜKREŞ / BU CH AREST O T P (BUH]I 5 7 6

■ Dergimizin bu sayfasında

İstanbul’dan / From İstanbul

Km

ATİNA / ATHEN S ATH

Flight information

N.. Miles

İstanbul’dan / From İstanbul AB U DABİ / AB U DHABI A U H

LJU B LJA N A LJU

1337

722

10 1 4 9

5480

TR ABLU S / TRİPOLİ T IP

TO KYO N R T (TYO )

1941

104 8

TU N U S / TUNIS T U N

179 6

970

704

380

ÜSKÜ P / SKO PJE S K P VARŞO VA / VVARSAVV W A W

144 6

781

VİYANA / VIENNA VİE

135 6

732 2614

LYON LY S

2174

1174

YENİ DELHİ / NEVV DELHİ D E L

4841

M ADRİD M A D

2821

1523

ZAG R EB ZA G

119 8

64 7

M ANC HESTER M A N

2785

1504

ZÜRİH / ZÜ RİCH Z R H

183 0

988

takip ettiği rotanın yer üzerindeki iz düşümünün ölçülen mesafesidir. The distance in kilometres and nautical miles in the table on this page is the projected distance on the ground for the route flown b y the aircraft. ■ Uçaklarımızın içindeki monitörlerde görülen rakam ise, uçağın havada katettiği mesafedir. The figüre shown on the cabin m onitors give the actual distance flovvn b y the aircraft through the air, including adjustments o f direction to com pensate for wind, a nd other weather conditions. ■ Türk Hava Yolları Özel Yolcu Programı'nda uygulanan mil değerleri ise, Uluslararası Sivil Havacılık Teşkilatı'nın (IATA) yayımlamış olduğu rakamlar olup yukarıda yazılan mil değerlerinden farklıdır. The miles used by Turkish Airiine's Frequent Flyer Programme are those published by the International A ir Transport Association (IATA) and therefore they are different from the distances in miles noted above.

190 SKYLIFE 3 /2 0 0 6

■ Türk Hava Yolları Uçuşları ve Mesafeler - Turkish Airlines Flights and Distances (İç Hatlar-Domestic Flights) İstanbul’dan / From İstanbul (Atatürk Airport) AD AN A A D A AN KA R A ESB AN TALYA A Y T BO D R U M / M İLAS BJV DALAM AN D L M DENİZLİ D N Z DİYARBAKIR D IY ERZURUM E R Z G AZİANTEP G Z T İZMİR AD B KARS KYS KAYSERİ A S R KO N Y A KYA MALATYA M L X SA M S U N S Z F SİVAS VA S TR ABZON T Z X VAN VA N

Km 824 419 535 526 648 461 1087 1091 983 41 9 125 8 69 6 53 0 861 69 8 707 974 1304

İstanbul’dan / From İstanbul (Sabiha Gökçen Airport) Km AD AN A A D A AN KA R A ESB AN TALYA A Y T DİYARBAKIR DIY ERZURUM E R Z İZMİR A D B KARS KY S TR ABZO N T Z X VAN VAN

776 393 489 1011 1068 431 121 6 928 128 7

Ankara’dan / From Ankara (Esenboğa Airport) A D AN A A D A ADIYAM AN A D F AĞRI A J I ANTALYA A Y T

Km 439 600 870 454

BATM AN BA L

772

BO D R U M / M İLAS B JV * DİYARBAKIR D IY ELAZIĞ EZ S ERZİNCAN E R C ERZURUM E R Z

657 696 596 591 717

İSTANBUL İS T İZMİR A D B KA H R AM AN M AR AŞ K C M KARS K S Y M ALATYA M L X MARDİN M Q M MUŞ M SR SA M S U N S Z F ŞANLIURFA S F Q TR ABZON T Z X VAN VA N

420 643 522 933 50 2 772 80 2 378 757 604 943

* Sadece Türk Hava Yolları’nın yaz tarifesinde uygulanmaktadır. * Only during the summer season.


Kale Champion Kilit

T u t t u

m

u

b 覺 r a k m

a z !

w w w .k a le k ilit.c o m .tr

Tel: 0 2 1 2 5 5 7 3 4 0 0


S n ıılrup /*

Victoria h.

Prinee / C harles /.yİ

Soınhampum Is.

I

H u c Im iii

Bay

McMurray

Edmonton

Rouyn

NEW YO RK B a ltim o re

ishington DC

S a n F r a n c is c o 1

L o s A n g e le s a S a n P ie g c

»uston

Ic o Monterrey

C iıllf o f Mc' mco

Havana

NICARAGUA COSTARİCA S .n J o M

Panam a C ity

PANAMA Bucî

Guayaguiiı

TURKİSH AIRLINES T Ü R K H A V A YOLLARI Code share flights by American Airlines

VENEZUEIA


Kau<tt“l


Svalburd

Islanıl.s (Nor.)

(DENMARK)

IC E L A N t) R eykjavik

FINLAND

„ ' S to c k h o lm

UNITED KINGDOM

T a llin n ESTONIA

DENMARK

Copenhagen

••

tlTVAM A

A Dublin

BELARLIS

Bart:n! pgland

IR E LA N D

•S t.P r tm b u r ç

R ig a LATVİA

^ a sM A fo rf/^ b tR M A N v

M° “ °

M"insk

W ro c law W a r s a w

hm ıu llaıu l (

K ıe v

U

Kharkov,

K R A

I

M O LD O V *

C h isin a u î M A N IA 1 ■ a te ,

St.Johrfs

V

,

I İ U

N E Donetsk

____ r - ' - t e

PO RT U G A L

TURKMENfST.

SHGH/

L is b o n A lg i e r s

MOROl

A le x a n d ri

SAXDIaim^ W V

\ b a h r a i Kt 1 QAIAR 1 ) D U B A İ1 u A â b tf A B U DHAB

Tamantasset

M A U R I T A N I A N o u a k c h o tt CAPE VERDl

.Dtk»r şfNtGAi

A d is A b a b a E T H

I O P 1A

ia rib o Cayon ne ’:NCH

UGANDA

lANA

K a m p a la

K E N Y A

^ .T M o n a 1

M o g a d ish u

N a ir o b i

B u ju m b u r a

Dodom a

SEYCH fctLES

RANZANIA •Recife

L ilo n g w e

ff&hüTy

Brasilia

LusW

T

Livingstoo* H a ra ra

G oian ia

^ZIMBABİWE

B e lo Horİzonte

P o rt L o u is M A U jR IT T R E U N IO N

BOTSWANA Rio de Janeiro Sao Paulo

G ab o ro n e Pretorıa Johanrtosburg*

’ Curitiba

REPUBLICOF M asoru

- ^ S O U T H A l RİCA

Cape Town'

j

M ap u tO M Babane

SW AZUAND

’Poft Eli

lo n te v id e o

Tnstan Ju Cıuılıa h

'i kl

Priııa■F.d\mnl İsi. (SAJ


Tomsk Karisk

Novosibirsk Barnaul Ulan-Ude

Silkinilin Is.

U la n B a to r 'Harbin o Vladiv

erkand

TASHKENT

,B A D

* * ' d u S H Â N B Ç .',

^^TA|IKISTAN

,XmM

B E IJIN G Taiyuan

SEOUL

Jiriân

Lanihou*

* SOUTH KOREA .Busaıı

>

Naç Kyotl

TOKYO

Kita-Kyushu, Kobe* fukuoka SHANGHAI

Chengdı^

bası China

_____

Chengdu. Jaipur.

KARACHI

«Agra Kanpu?

K ath ı

Fuzhou.

Ahm adabad

Nanning |Kaohsiııng M YANM AR

HON G KONG

LAOS

I NDI A

V ie n tia n e

H yderab ad

I İdimin Is.

T H A IL A ! B a n g a lo r e

M a dras

BANGKOK

MALDİVES Ho Chi Minh City SRİ LAN KA

C o lo m b o

FEDERATION STATES OF MICRONESIA

“D avao M

A

L

A

Y

BRU N EI S I A

uala L u m p u r > S IN G A P O R E

_ S lfjlG A P O RE

J f l

Jtabıu ilu ra Is.

Üoriieo Balikpapan

Irclum i İsi. Palernbaria ;1 $ Java Sca O ■ J a k a r ta ^ B a nd un g JtlVtt Is, .Surabaya

PAPUA

f

N E W G U IN E A

Vı ■ lir im in h i

Arufura S c i

H o n ia r a

Tovvnsvflle

Noumea

'Sydney ‘Adelaide

C a n b e rr a

Amstenlunı İsi Melbourne

VVellingt

Tasmama Is. •

Hob8Tt

^Christchurch

Gürbüz

YAYINLARI

(0216) 574 24 44


BALIKEJnR'

m e d i t e r r a n e a n

s e a

AniuhüBu\

'ANTALYA

«İSPARTA

AFYON

KyTAHYA

BURDUR!

DENİZLİ

İSTANBUL

İ-J DALAM AN

MUĞI

IODRUM

İZMİR

ÇANAKKALE

SLA Ol MARMARA

TEKİRDAĞ

K IR K L A R E L İ

« Z V

l!m w 'sf GREEK CYPRIOI ADMINISFRAIION O l SOI THIRN CYPRI.S

A D A N Â cSs ^

•YOZGAT

AM ASYA

LEBANO

Mersin ft/ı

MERSİN

>

KASTAMONU

bk a ra m a n

KONYA

B A R T IN

1I RKI5 H REPLB1IC O l NORTHERN CYPRUS

ZONGULDAK

a n Iye

TOKAT

İAZİ ANTEP

SİVAS

ORDU

jANLI URFA

\tatürk l\ ı m

Kebanfkn

DİYARBAKIR

TUNCELİ

x p Û M tr*!A N f

v vV>

Ş etiF

İR ZU R U M

-

..v '

■— i

(0216)574 24 44

200 kr

V 4*

Gürbüz YAYINLARI

)'

/ .ARMENI


TÜRK HAVA YOLLARI

Yeni Airbus A

3 3 0

geldi.

Türk Hava Yolları, dünyada sayılı havayolu şirketinin gerçekleştirebileceği dev atılımla, gökyüzünde görkem li bir hareket başlatıyor. Pilosuna eklenen yeni Airbus A330'ıı Türkiye'ye hediye ediyor. Yeni nesil Airbus A320'ler, Boeing 737-800'ler ve geniş gövdeli Airbus A330'lardan oluşan toplanı 59 adetlik yeni uçak siparişinin ilk teslimi olan bu uçaklar, emniyet ve konfor konusunda, dünya havayolu taşım acılığının ulaştığı son noktanın temsilcileri. Bu dev yatırımla Türk Hava Yolları, gökyüzünde yepyeni bir dönem i müjdeliyor. Avrupa'nın en hızlı büyüyen havayolu şirketi ve Türkiye'nin dünyadaki en büyük m arkası olmanın gururunu yaşıyor.

w w w .thy.com

444

O 849


A 330-203

A 340-311/313

A 321-111/231/211 — A 320-214/232

'

Number o f aircraft

Number of aircraft

Number o f aircraft

Number of aircraft

Uçak adedi: 2

Uçak adedi: 7

Uçak adedi: 7

Uçak adedi: 14

Commercial names

Commercial names

Ticari adları: Gaziantep/Konya

Ticari adları: İstanbul/Isparta/Ankara Izmir/Adana/Hakkari/Aydın

Commercial names Ticari adları: Yozgat/Osmaniye/Kırıkkale/Aksaray /Çankırı/Burdur/Bingöl

Commercial names Ticari adları: Şanlıurfa/Balıkesir/Kahramanmaraş/Mersinz Erzurum/Sakarya/Adıyaman/Çorum/Batmaı Şırnak/Kırklareli/Düzce/Muş/Rize

Maximum take o ff vveight

Azami kalkış ağırlığı: Maximum take off vveight 233.000 kg Azami kalkış ağırlığı Wing span Kanat açıklığı: 60.30 m 257.000 kg (A 340-311) Length 262.000 kg (A340-313) Gövde uzunluğu: 58.80 m Wing span Kanat açıklığı: 60.30 m Height Yerden yüksekliği: 17.40 m Length Cruise speed Gövde uzunluğu: 63.69 m Yatay uçuş sürati: Height Yerden yüksekliği: 16.85 m 890 km/h Cruise speed Passenger capacity Yatay uçuş sürati: 890 km/h Yolcu kapasitesi: 250 Passenger capacity Seat pitch (inch) Yolcu kapasitesi: 271 Koltuk aralığı: Seat pitch (inch) Koltuk aralığı: 33, 34 (EC): 54 (BC) 33 (EC); 61 (BC)

Maximum take off vveight

Azami kalkış ağırlığı: 83.000/89.000 kg Wing span Kanat açıklığı: 34.09 m Length Gövde uzunluğu: 44.51 m Height Yerden yüksekliği: 11.76 m

Maximum take off vveight

Azami kalkış ağırlığı: 73.500/75.500/77.000 kg Wing span

Kanat açıklığı: 33.91 m/34.09 m

Cruise speed

Length

Yatay uçuş sürati: 835/844 km/h

Gövde uzunluğu: 37.57 m

Passenger capacity

Height

Yolcu kapasitesi: 155/181/186/195/202 Seat pitch (inch) Koltuk aralığı: 30, 31, 32, 33 (EC); 33, 34, 36 (BC)

Yerden yüksekliği: 11.91 m/11.76 m Cruise speed

Yatay uçuş sürati: 858 km/h Passenger capacity

Yolcu kapasitesi: 150/156/159/167/168

Maximum cruising altitude

Maximum cruising altitude

Maximum cruising altitude

Seat pitch (inch)

Azami yatay uçuş yüksekliği: 41.100 ft

Azami yatay uçuş yüksekliği: 41.100 ft

Azami yatay uçuş yüksekliği: 39.000/39.800 ft (TC-JMG)

Koltuk aralığı: 30, 31 (EC); 32, 33 (BC)

Maximum passenger range

Maximum passenger range

Maximum passenger range

Azami yatay uçuş yüksekliği: 39.000 ft

Azami menzil: 10.371 km

Azami menzil: 11.952 km

Azami menzil: 2.250/3.200 km

Maximum passenger range

Maximum cargo capacity

Maximum cargo capacity

Maximum cargo capacity

Azami menzil: 3.350 km

Azami kargo kapasitesi: 37.528 kg/105.95 m3

Azami kargo kapasitesi: 44.836 kg/152.80 m3

Azami kargo kapasitesi: 12.837-11.548 kg/58-46.49 m3

Azami kargo kapasitesi: 9.435 kg/37.06 nT

194 SKYLIFE 3 /2 0 0 6

Maximum cruising altitude

Maximum cargo capacity


A 310-304/203 Number o f aircraft

Uçak adedi: 6 Commercial names

Ticari adları: Aras/Çoruh/Ergene/ Aksu/Göksu/Lefkoşa Maximum take off vveight

Azami kalkış ağırlığı: 153.000/157.000 kg (TC-JDB) VVing span Kanat açıklığı: 43.90 m Length Gövde uzunluğu: 46.66 m Height

,B 737-800

B 737-400

RJ 100

Number o f aircraft

Number o f aircraft

Number of aircraft

Uçak adedi: 30

Uçak adedi: 17

Uçak adedi: 1

Commercial names Ticari adları:

Commercial names Ticari adları:

Commercial names

Diyarbakır/Hatay/Afyonkarahisar/ Sivas/Iğdır/Mardin/Ağrı/ Zonguldak/Ordu/Niğde/Bitlis/Edirne/ Amasya/Giresun/Ardahan/Tekirdağ/ Kastamonu/Elazığ/Manisa/Tunceli/ Malatya/Eskişehir/Bolu/Kocaeli/ Nevşehir/Erzincan/Artvin/Tokat

Kars/Ayvalık/Marmaris/Amasra/ Alanya/Antalya/Muğla/Çanakkale/ Efes/Side/Bergama/Gelibolu/ Anadolu/Bursa/Trabzon/Bayburt/Uşak

Ticari adları: Denizli

Maximum take off vveight

Maximum take off vveight

Azami kalkış ağırlığı: 46.039 kg

Maximum take off vveight

VVing span

Azami kalkış ağırlığı: 68.038/65.090/64.637 kg VVing span Kanat açıklığı: 28.90 m

Kanat açıklığı: 26.34 m Length

Gövde uzunluğu: 31.0 m

Azami kalkış ağırlığı: 79.015 kg

Length

Height

VVing span Kanat açıklığı:34.31m/35.78m Length Gövde uzunluğu: 39.47 m Height Yerden yüksekliği: 12.55 m

Gövde uzunluğu: 36.40 m Height Yerden yüksekliği: 11.125 m

Yerden yüksekliği: 8.585 m

Cruise speed

Yatay uçuş sürati: 720 km/h

P a s s e n g e r c a p a c ity

C ru is e s p e e d

Yatay uçuş sürati: 797 km/h

Passenger capacity

Yolcu kapasitesi: 210/208 (TC-JDB) Seat pitch (inch) Koltuk aralığı: 31, 32 (EC); 38 (BC)

Yatay uçuş sürati: 858 km/h

Passenger capacity

Yolcu kapasitesi: 99

Passenger capacity

Yolcu kapasitesi: 148/150/152 Seat pitch (inch) Koltuk aralığı: 29, 30, 31, 32 (EC); 34, 38 (BC)

Koltuk aralığı: 30 (EC); 31 (BC)

Yerden yüksekliği: 15.80 m Cruise speed

Yatay uçuş sürati: 860 km/h

Maximum cruising altitude

Azami yatay uçuş yüksekliği: 41.000 ft

Yolcu kapasitesi: 165 Seat pitch (inch) Koltuk aralığı: 30 (EC); 31 (EC); 35 (BC) Maximum cruising altitude

Cruise speed

Seat pitch (inch)

Maximum cruising altitude

Maximum cruising altitude

Azami yatay uçuş yüksekliği: 37.000 ft

Azami yatay uçuş yüksekliği: 31.000 ft

Maximum passenger range

Azami yatay uçuş yüksekliği: 41.000 ft

Azami menzil: 8.100/8.980 km (TC-JDB)

Maximum passenger range

Maximum passenger range

Maximum passenger range

Azami menzil: 4.755 km

Azami menzil: 3.350 km

Azami menzil: 2.259 km

Maximum cargo capacity

Maximum cargo capacity

Maximum cargo capacity

Maximum cargo capacity

Azami kargo kapasitesi: 24.995-21.820 kg/68.20-54.16 m3

Azami kargo kapasitesi: 8.408 kg/45.05 m3

Azami kargo kapasitesi: 7.491 kg/39.22 m3

Azami kargo kapasitesi: 3.800 kg/22.99 m3 3 /2 0 0 6 SKYLIFE 195


AEROBİK AEROBICS

CMİrobic/ UÇUŞ - EGZERSİZ PROGRAMI / INFLIGHT EXERCISE PROGRAM

A şağıda g ö re c e ğ in iz u ç u ş -e g z e rs iz p ro g ra m ı A iro b ic s , Türk Hava Yolları ve Hillside City Club işbirliği ile hazırlanmıştır. Airobics'e ayıracağınız birkaç dakika ile uzun süren yolculuğunuza hareket katacak ve kendinizi çok daha zinde hissedeceksiniz. A iro b ics, the inflight e x e rcise pro gra m below has been developed by Turkish Airlines and Hillside City Club of İstanbul. By committing just a few minutes for Airobics, you can turn your long journey into a much more energetic and refreshing one. Now please fold up your table, bring your seat to the upright position and relax your body.

KAN DO LAŞIM INI DÜZENLEYİCİ AYAK ve BACAK EGZERSİZLERİ LEG & FOOT EXERCISES TO REGULATE BLOOD CIRCULATION 1. K oltuğunuzda dik o tu ru r pozisyonda, a ya kla rın ız yerdeyken parmaklarınıza basarak topuklarınızı yukarı kaldırın, tekrar yere basın, topuklarınıza basarak ayaklarınızın ön kısmını yukarı doğru kaldırın ve geri indirin. Bu hareketleri arka arkaya 3 kez tekrarlayın. (Uzmanlar, uçuş esnasında bu egzersizi sık sık uygulamanızı önerm ektedirler.) 1. Sit straight in your seat, with your feet flat on the floor. First lift your heels keeping your toes on the floor, then lovver your heels till your feet are flat on the floor. Lift your toes keeping your heels on the floor and then lovver your toes till your feet are flat on the floor again. Repeat 3 times. (Doctors recommend that you repeat this exercise as often as possible during your flight.)

2. Önce sağ ayağınızı hafifçe kaldırarak öne doğru uzatın. Ayak bileğiniz ile önce içten dışa doğru, sonra dıştan içe doğru daireler çizin [3'er kez). Aynı h a re k e ti s o l aya ğınızla da uyg ulayın (3 'e r kez). 2. First stretch out your right leg and raise your foot just a little. Rotate your ankle clockvvise (3 times) and then counter clockvvise (3 times). Repeat the same vvith your left ankle (3 times for each direction). 3. Sağ dizinizi karnınıza doğru çekin ve indirin (3 kez). Aynı hareketi sol dizinizle de uygulayın (3 kez). 3. Pull your right knee tovvards your chest and move it down again (3 tim e s ). Do the sam e vvith your le ft knee (3 tim e s ).

GERME VE GEVŞETME EGZERSİZLERİ // STRETCHING AND RELAXATION EXERCISES

A.

Omuzlarınızı yukarı doğru kaldırın ve in dirin (3 kez].

4. Raise your shoulders and lower them. Repeat 3 times.

5. O m u z la rın ız la önden a rka ya d o ğ ru 3 kez ve a rk a d a n doğru 3 kez olmak üzere daireler çizin.

öne

5. Roll your shoulders backvvards (3 times) and then forvvards 13 times).

6. Başınızı, göğsünüze doğru yavaşça indirin. 3'e kadar sayın ve tekrar yavaşça kaldırın. Başınızı kaldırırken arkaya atmamaya dikkat edin (3 kez). 6. Keep sitting up straight. Slovvly lovver your head tovvards your chest. Count to 3 and raise your head gently. As you raise your head, be carefu l not to je rk backvvards. Repeat 3 tim es.


7. Karşıya bakar pozisyondayken, başınızı hafifçe öne eğerek sağ omzunuza doğru çevirin, gözleriniz omuz başınıza baksın ve yavaşça başlangıç pozisyonuna dönün (3 kez). Aynı hareketi sol omzunuza doğru tekrarlayın 13 kez). 7. Look ahead. Slightly lovver your head and gently turn your head towards your right shoulder. You should be tooking at the end of your shoulder. Then return to the starting position with the same movement 13 times). Repeat the same exercise tovvards your left shoulder and return slowly to the original position 13 times).

8. Ellerinizi avuç içleri yukarı bakacak şekilde bacaklarınızın üzerine koyun ve ken dinizi rah at bırakın. D irs e k le rin iz i, parmaklarınız omuzlarınıza değecek şekilde kıvırın ve açın [3 kez). 8. Rest your hands on your thighs vvith your palms facing up and relax. Touch your shoulders vvith your fingers and return your hands to the o rig in al position. Repeat 3 tim es.

9. Ellerinizi avuç içleri yukarı bakacak şekilde bacaklarınızın üzerine koyun ve yum ruk şeklinde iyice sıkarak kapatıp, açın 13 kez). 9. Rest your hands on your thighs, palms up. Close your hands tightly into a fist and open. Repeat 3 times.

SOLUNUM EGZERSİZLERİ // BREATHING EXERCISES 10. Bir elinizi göğsünüzün, diğer elinizi midenizin üzerine yerleştirin. Burnunuzdan derin nefes alın. Göğüs kafesinizin iyice şiştiğini hissedin. Nefesinizi ağzınızdan yavaşça dışarı verin. Aynı şekilde bir kez daha burnunuzdan derin nefes alın, ancak bu kez karın boşluğunuzun şiştiğini hissedin. Nefesinizi ağzınızdan yavaşça dışarı verin. 10. Put one hand on your chest, the other on your abdomen. Take a deep breath through your nose. Feel your chest expand. Slovvly exhale through your mouth. Inhale deeply again through your nose, but this time feel your diaphragm fiil vvith air. Exhale again slovvly through your mouth.

GEVŞEME EGZERSİZİ // RELAXATION EXERCISE 11. Ellerinizi avuç içleri yukarı bakacak şekilde bacaklarınızın üzerine koyun. Bu egzersize önce e lle rin izi yum ruk şeklinde sıkarak başlamalısınız. Sonra sırasıyla kollarınızı ve üst gövdenizi sıkın. Sıkma işlemine kalçanızla, sonra bacaklarınız ve ayaklarınızla devam edin. Ve şimdi aynı sırayla yavaş yavaş tüm vücudunuzu gevşetin. Önce eller, sonra kollar, üst gövdeniz, kalçanız, bacaklarınız ve ayaklarınız. Her birini gevşetirken kanınızın gevşettiğiniz bölgeye dolduğunu hissedeceksiniz. 11. Put your hands on your lap, palms up. Start this exercise by clenching your fists, then tense your arms. Slowly continue to tighten your entire upper-body, follovved by your hips, right dovvn to your legs and feet. Now in the same order, slovvly relax your body starting vvith your hands, then arms, upper-body, hips and finally your legs and feet. As you relax, you vvill feel the blood flovv through every part of your body.

^

Uzun yolculuklarda sağlığınız için hatırlanması g ere ke n ler:

Healthy tips for long-haul flights

1. Bol bol su için. 2. A lkollü içeceklerden uzak durun. 3. Mümkün olduğunca az tuz tüketin.

1. Drink plenty of vvater. 2. Avoid alcoholic beverages. 3. Keep salt consumption to a minimum. 4. Repeat Airobics exercises as frequently as possible (particularly exercises 1 and 2). 5. During the flight, take frequent short walks. 6. Wear comfortable shoes. 7. Avoid tight clothing.

U. Airobics egzersizlerini mümkün olduğunca sık aralıklarla tekrarlayın (özellikle 1 ve 2 nolu egzersizler). 5. Uçuş esnasında sık sık kısa yürüyüşlere çıkın. 6. Rahat ayakkabılar giyin. 7. H areketlerinizi kısıtlayan dar giysilerden kaçının.


1. Alexandre Dumas'nın ünlü romanı 'Üç Silahşorlar’,

1. Alexandre Dumas's famous novel, 'The Three Musketeers',

d'Artagnan ve üç arkadaşının maceralarını konu alıyordu.

relates the adventures o f d ’Artagnan and his three friends. Tvvo of

Genç silahşorun iki arkadaşının ismi Athos ve Porthos’du.

these young musketeers were named Athos and Porthos. Can

Üçüncüsünü hatırlayabilecek misiniz?

you remember the name o f the third one?

a. Aramis b. Keops

a. Aramis b. Cheops

c. Philip

c. Philip

d. Edmond

d. Edmond

2. 1965'te yönetmeni Robert VVise'a ‘En iyi Film Oskarı'nı

2. Who composed the music for the popular Broadway musical,

kazandıran, ünlü Broadvvay müzikali ‘Neşeli Günler’in

‘Sound o f Music', which earned director Robert Wise the Oscar for ‘Best Film'in 7965?

bestecisi kimdi? b. Richard Rodgers

a. Andrevv Lloyd VVebber b. Richard Rodgers

c. Arthur Freed

c. Arthur Freed

d. Alan Menken

d. Alan Menken

a. Andrew Lloyd VVebber

3. Afrika kıtasının yüzölçümü olarak en büyük ülkesi

3. VVhich is the largest country in A f rica by surface

aşağıdakilerden hangisidir?

area?

a. Sudan b. Cezayir

a. Sudan b. Algeria

c. Libya

c. Libya

d. Etiyopya

d.

Ethiopia

4. 'Yaşlılık bilimi’nin tıptaki adını biliyor musunuz?

4. What is the ‘s cience o f ageing' called in medicine?

a. Histoloji

a. Histology b. Immunology

b. İmmünoloji c. Gerontoloji

c. Gerontology

d.

d. Deontoloji

Deontology

5. Rocky III filminin Grammy ödülü kazanan ve Oskar'a

5. VVhich rock group made the Oscar nominee and

aday olan hit şarkısı 'Eye of the Tiger’ hangi rock grubuna

Grammy-winning hit song, Eye o f the Tiger', from the film

aittir?

Rocky III?

a.

Scorpions

b. Heart

a.

c.

Foreigner

d. Survivor

c.

6.

Antikçağda küçük banyo, dinlenme, giyinme odaları

bulunan ve beden eğitim verilen 'spor salonlarfna ne ad verilirdi?

The Scorpions Foreigner

b. d.

Heart Survivor

6. What was the name given to the 'gyms' o f Antiquity with small rooms for bathing, relaxing and dressing and vvhere physical education was also given?

a.

Agora

b.Akropolis

a. Agora

c.

Palaestra

d. Temenos

c. Palaestra

b. Acropolis d. Temenos o 9 'p -g ‘o -p 'e •£ 'q 'Z ' V' l :suo|in|os / J3|iunzoö


i

M

1

MUCİZE

THE M

MIRACLE NUT

HAZELNUT

KURUYEMİŞ

ö FINDIK

i

&

COM E S

FROM

DİYARI

TURKEY

TÜRKİYE

Good for blood pressure.

Tansiyona iyi geliyor.

Kemikleri güçlendiriyor.

Enhancesthe bones.

Kolesterole iyi geliyor.

Good for cholesterol.

Kansızlığa iyi geliyor.

Good for anemia.

Enerji veriyor.

Builds up energy.

Good for insomnia.

Uykusuzluğa iyi geliyor

Rejuvenates the skin.

Cildi gençleştiriyor.

Sinir bozukluğuna iyi geliyor.

Good for strained nerves.

Dişleri kuvvetlendiriyor.

Makes the teeth stronger.

And also...

Ayrıyyetten...

aganigi-naganigi nooooky-nooooky her gün bir avuç fındık

FTG

IC9I MUCİZE KURUYEMİŞ

FINDIK

İY İ G E L İR

TAN ITIM GRUBU

TURKİSH AIRLINES TÜRK HAVA YOLLARI


BULMACA

Özümleme, benzeşme

Atomlarla ilgili olan

Kıta

Avrupa Birliği (kısaltma)

İstanbul'un eski bir adı

Bağıntıcılık

Kırmızı

On çalışma

Bolluk, verim Bir savaş silahı

Katışıksız, saf Ağlayan, inleyen

Bulaşma, geçme Bir mastar eki

İktisat Çit, perde Yalıtkan madde

Ay

Namaz kıldıran kimse

Şeytana tapma Küre ile ilgili, kürevi

Kiloamper (kısaltma) Taşıt dizisi Sıvacı aleti

Hastalıktan kurtulma Hastalıklı, — ..ık.ıt

Koşum ve eyertakımlan yapan kimse

Bataklık gazı Bir bağlaç

Kalça sinirlerinde oluşan ağrılı hastalık

Tavlada bir sayı Damara takl­ an ince boru

Yenebilir hayvan iç organlar

Bir zaman birimi

Hristiyan

Elbisede takım

Vekillik

Şok etkisi yaratma

Vilayet

Çaresiz

Parola

Fas'ın plaka işareti

Bazı yörelerde ‘iyi'ninbir

Buyuran

İnanmış, aklı vatmış

Gümüş balığı

Övgü, övme

Şafak vakti Bir tahıl ölçeği Yetmez miktarda

Seçme işi

Valide

luna'nın kolu alan bir ırmak

Kullanım süresi

Uzaklık anlatır

Beyaz

Çivit mavisi

Bir iç organımız

Labada Bir

Tam olarak, adamakıllı

tembih sözü

Acil

Yük asansörü

Rütbesiz asker

Antımevi

Asya'da bir ırmak

Parlak bir kumaş türü Olgunlaş­ mamış kavun

Biricik

Silisyumun simqesi Saç teli

Gemi odası

Bir nota

Bir tür peynir

Hane, konut

Küçük su kanalı Alarm düdüğü

İma Saçı olmayan Baryumun simqesi

Araç

Edebiyatla ilgili, yazınsal

Gebe

Akarsu yatağı

Üzüntü, keder

Akıllıca Tanrıtanı­ maz

Ilır peygamber

Azeri sazı Merasim

15. harfin okunuşu

iyi. hoş

Karışık renkli Duman kiri

Su

İçtenlik

Bir Akira Kurosawa filmi

Karadeniz’e özgü küçük tekne

Mantık

Çözümü sağda 200 SKYLIFE 3 /2 0 0 6

O


to

E a m m

I

t

E a

E a

o co

o o

t

co

£

ıo

to

ca

o co

E

I I cö

£ (D ■O ? Q) E

£ Q> -Q IQ) E

LO

N.

Q> ~Q

İn Turkey as in the rest o f the world, A dult Education Centers and the large variety o f evening courses they offer are a great boon fo r vvorking people. İn ou r puzzle we ask you to figüre o u t which courses are on offer a t one o f these A dult Education Centers, on which days and at which time they are given, and how many people are signed up fo r each one.

£?

Q)

I E 0 ^ 0 ) C \j

CNİ

c \|

co" {/> ü> oy

i

Q_

Bilgisayar / Computer İngilizce / Englısh

Ul

Muhasebe / Accourıtıng

S 8 o

OYUN

tÇ/3 E a

KATILIMCI SAYISI NUMBER OF MEMBERS

GUNU DAY

KURS SAATİ COURSE TIME

Halk Eğitim Merkezleri, tüm dünyada olduğu gibi Türkiye'de de düzenledikleri çeşitli kurslarla, gündüz çalışan insanların en büyük yardımcısı... Bulmacamızda bir Halk Eğitim M erkezi’nin düzenlediği kursları, bunların hangi gün, hangi saatte yapıldığını ve katılımcı sayısını soruyoruz sizlere...

PUZZLE

e-m ail: medyapuzzle@ yahoo.com

Konservecilik / Cannıng İP U Ç L A R I

Arıcılık / Bee-keepıng

N O T : Gün sıralaması pazartesiden

başlayıp pazar günü sona erer. 1. İngilizce kursuna 17 kişi katılmaktadır. 2. 20 kişinin katıldığı kurs pazar günüdür. 3. Arıcılık kursu, muhasebe kursundan daha önceki bir günde yapılmaktadır. 4. Pazartesi günkü kursun başlama saati 17:30’dur. 5. Saat 17:00'de başlayan kursun (ki bu bilgisayar kursu değildir) günü, arıcılık kursunun olduğu cumartesi gününden daha öncedir. 6. En çok katılımın olduğu kursun başlama saati 17:45'tir. Çarşamba günleri verilen bilgisayar kursunun başlama saati ise bu kursun başlama saatinden daha öncedir. 7. 24 kişilik kurs, konservecilik kursunun yapıldığı günden daha sonraki bir gündedir.

15 kişi I 15 members 17 kişi / 17 members 20 kişi / 20 members 24 kişi / 24 members 29 kişi / 29 members Pazartesi / Morıday Çarşamba / Wednesday Cuma / Frıday Cumartesi / Saturday Pazar / Sunday SAATİ COURSE TIME

KURS COURSE

GÜNÜ DAY

3 w 3 S Lm 3 A v' 1 v] ■ N V ■ a ■

SOLUTIONS ÇÖZÜMLER Aepjnıes

■uj-d gp:g

!$!>t 6 2

IS 8JJB L U nQ

9 t ’ -L V

>JI|I0IJV

SJdqUI3LU QL

Aepuoyy

'tu 'd 0£:Ç

öuıuueo

( s e jje z e d

Aepuns

-lu'd 00-9

!$!>l 02

JB Z B d

00=81

sj&qLueuj 11

A e puj

sja quje uj pz !§!>!

VZ

U39IABW JO U39WnN is ia v s

lo ^ n ı ı v *

eıııno Aüpseupd/A eqıue§jeö

lu

d OO'S

00:Z t lu

1 3

>|!I!O 0AJ8SUO>1

o

!$l> l S I S J d q u J 9 L ll O Z

il

3 m

6uıda9>ı-9ag

s jd ç u je u j 6Z

!$!>!

KATILIMCI SAYISI NUMBER OF MEMBERS

d s ı:ç

Gl-ll

6ui}unooov 9q0segn^| ysı/Buz

1 vl>jjv

0 D Z !|j6 ü |

jd in d ıu o o

rx | | i

AVQ

3WI± 3SHDOO

3SUDOO

0NQO

|1 W S

sa n *

v XV

n

jB A e s !6 |ig

v w .

|y o i v ı o ' z ' ı ( t | İ d ’n v'j V s v la

v

| v

| v

| v

|

CLUES The week starts on Monday and ends on Sunday. 1. The Englısh course has 17 members. 2 . The course vvith 20 members is given on Sundays. 3 . The bee-keeping course is given eariier in the week than the accounting course. 4 . The course given on Mondays starts at 5:30 p.m. 5 . The course that starts at 5 p.m. (and it's not the Computer course) is given eariier in the week than the bee-keeping course, which is on Saturdays. 6. The course vvith the most members starts at 5:45 p.m. The Computer course, vvhich is given on VVednesdays, starts eariier than this course. 7. The course vvith 24 members is given on a later day of the vveek than the course on canning fruits and vegetabies. 3 /2 0 0 6 SKYLIFE 201


cc

FILMS ON FLIGHTS THY VİDEO

Û . YOURS, M İNE AND OURS

THE RINGER

Oyuncular / Cast: Dennis Quaid, Rene Russo, Sean Faris, Katija Pevec, Yönetmen / Director: Raja Gosnell

Başrollerinde Lucille BalI ve Henry Fonda'nın oynadığı 1968 tarihli filmin yeniden çevrimi olan Yours, Mine And Ours, iki büyük ailenin bir araya gelip büyük karmaşa yarattıkları bir aile komedisi. Sekiz çocuklu, dul sahil güvenlik amirali ve on çocuklu, dul çanta tasarımcısı birbirlerine aşık olur ve evlenirler.

Based on a filmfrom 1968 (that starred Lucille BalI and Henry Fonda), this is a genially spraw!ing family comedy about two huge families that come together to create total chaos. A widowed Coast Guard Admiral and a widow handbag designer fail in love and marry, much to the dismay of her ten and his eight children.

O yuncular / Cast:

Mohammed Ahmed, Geoffrey Arend, Luis Avalos, Edvvard Barbanell Y ö n etm en / D irecto r:

Barry W. Blaustein

JUST FRIENDS Oyuncular / Cast: Ryan Reynolds, Amy Smart, Anna Faris, Chris Klein Yönetmen / Director: Roger Kumble

Lise yıllarında en yakın arkadaşına aşkını itiraf eden Chris'in kalbi kırılmıştır. Yıllar sonra Chris, Hollyvvood’da ünlü bir albüm yapımcısı olmuş ve lisedeki görüntüsü tamamen değişmiştir. Kendisinden psikopatlık derecesinde hoşlanan sanatçı Samantha James