__MAIN_TEXT__

Page 1

We provide the sum of the parts, so you can create the whole


“THE WHOLE IS GREATER THAN THE SUM OF ITS PARTS” ARISTOTLE

…that’s why we are dedicated to providing the widest, most flexible, industry leading range of quality kitchen and bedroom components, so that you can create exceptional finished results.


WELCOME TO THE 2020 DIRECTORY

1

DOORS & ACCESSORIES 1.01 - 1.31

2

WORKSURFACES 2.01 - 2.46

3

HANDLES 3.01 - 3.70

We bring together the most comprehensive, high quality stocked product portfolio, the most flexible services, and bespoke design options all supplied from under ONE roof.

4

KESSEBÖHMER STORAGE 4.01 - 4.62

Delivering excellent service and understanding our customers’ requirements is at the heart of everything we do, ensuring that it is always quick and easy to work with us, and that our proposition adds real value to your business.

5

BLUM COLLECTION 5.01 - 5.62

6

DRAWER ORGANISATION 6.01 - 6.20

PWS is the market leading distributor of kitchen and bedroom components proudly supplying the UK KBB industry for over 110 years. We’re committed to continuous innovation and a highly integrated, customer-centric approach.

Most importantly, you and your business are supported by ONE personal team dedicated to providing expert advice, and assisting a professional, streamlined journey from start to finish.

“We provide the sum of the parts, so that you can create the whole”

7 8 9 PWS BEDROOMS

WASTE MANAGEMENT & UTILITY ROOM 7.01 - 7.16

LIGHTING & ELECTRICAL ACCESSORIES 8.01 - 8.34

CABINET COMPONENTS & FINISHING TOUCHES 9.01 - 9.34

Please refer to our dedicated PWS Bedroom Directory to explore our comprehensive bedroom collection

@PWSDistributors TECHNICAL

For supporting technical information please refer to the pws website www.pws.co.uk

T: 01325 505599 (North) | 88 (South)

01


WHY CHOOSE PWS? THE MOST COMPREHENSIVE AND FLEXIBLE PRODUCT PORTFOLIO PWS offers one of the largest and most inclusive ranges of kitchen and bedroom products and componentry, with over 10,500 stocked items. An extensive choice of bespoke options are also available within our stocked door families and paint-to-order ranges, alongside a wide choice of entirely made-to-measure solutions.

STOCKED FINISHES

BESPOKE SIZES

MADE-TOMEASURE

THE MOST EXTENSIVE STOCKED DOOR FRONTAL OFFER IN THE INDUSTRY We now offer over 80 door families from stock for next day dispatch.

LEADING INNOVATION

We want to pioneer and define our sector. And as a long-established organisation, we have unrivalled access to consumer and industry intelligence across product and process trends, which enables us to innovate, differentiate and launch fast.

02

Order Online www.pws.co.uk

QUALITY ALWAYS

TRUE PARTNERSHIP

Quality begins and ends with the customer and we strive to always satisfy your needs. To this end, we have a global perspective in sourcing only the very best products and materials across our categories from around the world, underpinned by a policy of continued improvement in process and service.

We aim for much more than a mere transactional relationship with our customers. We want to understand your business and your goals and develop a partnership, via which we can tailor and provide specific product, service and commercial benefits.


EXCEPTIONAL SERVICES AND SUPPORT Dependability, knowledge, expertise, responsiveness and communication, are critical in a multi-faceted industry, and these values sit at the very core of PWS. Our customer-centric service culture is personal, efficient and reliable.

END-TO-END SUPPORT

MARKETING & RETAIL

PRODUCT & INSTALLATION

PWS

PTO

YOUR PERSONAL SUPPORT TEAM

TWO DESIGN CENTRES

PAINT-TO-ORDER SERVICE

See Pg. 18

See Pg. 10

See Pg. 06

CAD PLANNING & QUOTATION

SHOWROOM DESIGN SERVICE

See Pg. 19

See Pg. 12

EXTENSIVE MADE-TO-ORDER SERVICE See Pg. 1.08

EASY ORDERING PLATFORMS

MARKETING SUPPORT & TRAINING

See Pg. 20

See Pg. 14

FLEXIBLE DELIVERY OPTIONS

PARTNER PROGRAMMES & CONSUMER BRANDS

See inside back cover

See Pg. 17

DRILLING & JOINERY See Pg. 1.87

WORKSURFACE TEMPLATING & INSTALLATION See Pg. 09

INDUSTRY LEADING WARRANTY PACKAGES We now offer 6 year warranty on all door and door range accessories. This is just part of our outstanding overall warranty package, including a 10 year guarantee on all Kessebรถhmer products, a lifetime guarantee on Blum, 10 years on all Sensio LED lighting and 10 years on PWS Worksurfaces.

T: 01325 505599 (North) | 88 (South)

03


UNRIVALLED INFRASTRUCTURE, RESPONSE AND SCALABILITY Our in-house manufacturing infrastructure, gives us the flexibility to respond quickly to projects of any scale, and offer you the widest choice and ultimate flexibility. Based in our County Durham headquarters, we combine state-of-the-art technology with the highest quality materials and expert craftsmanship, to ensure a premium standard of finish every time.



Over 10,500 stocked components



Bespoke worksurface manufacturing



Fully automated paint factory



500,000 sq.ft site

04

Order Online www.pws.co.uk


A FIFTH GENERATION BUSINESS FOUNDED IN 1909 Our story began over 110 years ago, as a family run, independent business in County Durham. From day one, our approach was to create a kitchen collection that was innovative, flexible and good quality all at an affordable price; values that remain strong today. Still owned by the same family, we’ve now grown to become the market leading distributor of kitchen and bedroom components in the UK and our portfolio is as diverse as it is creative. We go to great lengths to ensure that the suppliers we work with are world class. Our longstanding supplier relationships are built on trust and dependability, driven by our desire to supply innovative, high quality products to our customers. We’re proud to have helped create thousands of homes, forging lasting partnerships with a growing family of valued customers nationwide. An established family business built for the future.

Darlington, High Row - circa 1909

T: 01325 505599 (North) | 88 (South)

05


PAINT-TO-ORDER SERVICE

NEW

Water-Based Paint Finish

At PWS, we’re committed to continually improving our service proposition to our customers. Our fully automated, paint-toorder (PTO) service offers an extensive colour palette and a superior quality and finish for all paint-to-order products across our comprehensive kitchen component portfolio. This year, we’re proud to announce that we are moving from polyurethane to water-based paint. This allows us to significantly reduce our VOC emissions, whilst also delivering a much higher standard of paint finishing.* Delivered out of our industry leading paint finishing facility at our County Durham headquarters, we employ the very latest technology innovations and manufacturing techniques, with a dedicated quality management team to ensure the highest levels of performance at all times.

LIGHTS/WHITES

CHALK

Order Online www.pws.co.uk

ALABASTER MODERN

MUSSEL

CASHMERE

DRY ROSE

STONE

BLUES

CHINA BLUE

PUTTY

SUEDE

TRUFFLE

LAVA

FLINT GREY

TRENCH COAT GREY

REGIMENT

GREENS

CHALK BLUE

CADET

CORNFLOWER

STORM BLUE

HARTFORTH BLUE

CHARCOAL

SAGE

GREYS

30 Matt and Gloss Colours DOVE GREY

06

PORCELAIN

WARM NEUTRALS

PARTRIDGE GREY

SILVER GREY

DUST GREY

SLATE

GRAPHITE

CARBON

COPSE GREEN


ROBOTIC ACCURACY

THE OPTIMUM ENVIRONMENT

Our high-performance robotic machinery incorporates the latest in 3D scanning, air filtration, temperature control and drying technology, for the utmost accuracy in application, and consistency of colour and finish every time. The only one of its kind in Europe.

Our super-scale dust extraction and filtration network cleans the air in the whole building every hour – to continuously ensure the purest environment and optimum paint finishing conditions.

IN-HOUSE QUALITY ASSURED Our high-quality, Fira Gold Certified paint is machine mixed in-house, and applied in the most highly controlled atmospheres to ensure quality control at all stages.

THE GREATEST CAPACITY AND THROUGHPUT Our highly automated technology allows us to handle volume with ease, offering the greatest capacity and quickest throughput in the industry. Our robotic paint line can run faster than five metres a minute. It both paints and dries, enabling product to be painted on both sides the same day.

IT’S ALL IN THE PREPARATION Specialist sanding and priming technology tailors the preparation of each door material type to optimise the paint adhesion - for a truly flawless finish that stands the test of time.

DRILLING SERVICE FOR PAINTED PRODUCTS Why not let us drill your products BEFORE they are painted. Our drilling service for painted products helps to significantly reduce potential damage – and makes things easier for you and your customers all round.

A BETTER, GREENER, WATER-BASED FINISH Following a year of rigorous testing, our new water-based paint not only helps us to provide a much greener service, but also delivers a higher quality finish with far greater scratch resistance. *Our new water-based finish will be implemented across all product ranges from mid-2020, with many of our door families already transitioned.

Please refer to Paint-to-Order door ranges and leadtimes on page 1.07

T: 01325 505599 (North) | 88 (South)

07


08

Order Online www.pws.co.uk


PWS WORKSURFACES Now in its twelfth year, PWS worksurfaces is one of the largest, most sophisticated, market leading fabricators of quality, bespoke worksurfaces in the UK. As an award winning facility, we offer the most comprehensive range of materials, including Quartz, Granite, Solid Surface, Ultra Compact and Timber, with a wide choice available from stock, and a full range of profiles and processes to suit your exact requirements. One of the highest value components of any kitchen is a quality worksurface. Therefore, it’s vital

that it’s delivered right first time. Our 98% right first time manufacturing record, including material, production and transit, gives you the reassurance you need. Our expertise is not limited to serving just one market. We consistently supply both the retail, contract and commercial sectors – and with our national network of templaters we can reach you, wherever the job is. We believe we are truly unique in the outstanding service we deliver.

T: 01325 505599 (North) | 88 (South)

09


INSPIRATIONAL DESIGN CENTRES Strategically located at PWS’ Southern and Northern business hubs, our design centres are the best platforms for inspiration, where you can browse our abundance of stunning kitchen and bedroom displays, and see our exceptional products and materials up close. Available for you to use as an extension of your own showroom, you are free to show your own customers around, explore hundreds of samples, and join our regular training events. Visits to our design centres are arranged on a pre-booked appointment basis. Please contact our customer service team who will be happy to schedule this for you.

Northern UK Team – Tel: 01325 505599 Email: north@pws.co.uk Aycliffe Business Park, Newton Aycliffe, Co.Durham DL5 6EQ

Southern UK Team – Tel: 01325 505588 Email: south@pws.co.uk 778 Buckingham Avenue, Slough, Berkshire SL1 4NL

10

Order Online www.pws.co.uk


T: 01325 505599 (North) | 88 (South)

11


SHOWROOM DESIGN SERVICE We’re proud to offer all showroom based customers access to our dedicated showroom design service for both kitchens and bedrooms. From advice on a single door swap to full showroom planning, our experienced designers can help to take the hassle out of planning and designing your displays. Working closely with you, they can create tailored designs which will fit beautifully, accurately, and commercially in your showroom – whilst being on hand to offer expert design advice on the latest products, materials, colours, finishes and details. We all know that consumers like to buy what they have seen. This is why many retailers ask our designers to help them replicate our imagery in their showroom. This can often help you to ensure a consistent consumer journey, with designs that may have already been seen in our brochures or online marketing platforms, and that your customers can trust and begin to imagine in their own home. Additionally, many of our retailers often plan their display updates in line with our product launches, which tend to generate the most demand from consumers looking to recreate these featured looks. Our designers can also assist with the wider elements of your showroom design. From work/meeting spaces, entrance ways, and sample/specification areas, to completely bespoke concepts, as well as providing advice on styling, materials and finishes, our showroom design service will help to create effortless flow and maximum engagement - and truly bring your space to life. To request a kitchen or bedroom showroom design contact showroomdesign@pws.co.uk

12

Order Online www.pws.co.uk
























,



.

-





 









 



#











$





& %





)





+

*



 





' (





0

/





1





Receive stunning 3D designs, overview plan with dimensions, full technical drawings, component and internal storage break downs, as well a quote for your display.















T: 01325 505599 (North) | 88 (South)

13


MARKETING SUPPORT CONSUMER LITERATURE Our high quality, inspirational consumer brochures feature a mix of room set, product and lifestyle photography to help your customers create their dream kitchen. •

The Kitchen Book

1909

The Worksurfaces Collection

Beautiful on the Inside Storage

TECHNICAL MANUALS Our supporting technical manuals and guides include comprehensive product information to make it easy for you to design, specify and install our products.

SAMPLE DOORS All of our ranges are available as samples in either 355x297mm or 570x397mm sizes to help you illustrate key features and benefits of each design to your customers.

DOOR STANDS Door stands are the perfect way to display our door ranges in your showroom. Ideal for smaller spaces where room is at a premium, these units allow you store frontal samples in a compact, tidy way. • Each stand holds 20 doors (570x397mm) • Manufactured from Egger U961 board and 3mm ABS edging with Kesseböhmer door display rails • Height - 2100mm | Width - 433mm | Depth - 600mm • Supplied - boxed, flat pack with cam & dowel fixings and with full assembly instructions

Order code

Description

DOORSTAND

Door display stand

14

Order Online www.pws.co.uk

1909 Manual

Handleless Rail Guide

Mock-In frame Guide

Clarendon Technical Manual

Beautiful on the Inside Storage Specification Guide


DOOR DISPLAY RAILS

DOOR BAG

Effectively display our doors, handleboards and worktop samples using our Chrome finished rails.

Our compact door bags allow you to easily transport and store up to ten samples doors.

• Left and right-hand versions available

• Each bag holds 10 doors (355x297mm)

• Supplied in packs of 10

• PWS branded

Order code

Description

Order code

Description

KDRLH

Left handed

PWSDOORBAG

10 door bag

KDRRH

Right handed

MADE-TO-MEASURE SWATCHES All of the available finishes in our UNITY, Alpina and Stanhope made-to-measure ranges are available in a swatch booklet.

Order code

Description

UNITY/SWATCH

UNITY sample swatch book

PAINT SWATCHES Paint swatches are the best way to show our full paint-toorder palette of thirty colours.

Order code

Description

CLASSICSWATCH

Paint-to-order colour sample swatch book

VENEER/SWATCH

Alpina sample swatch book STANHOPE/SWATCH Stanhope sample swatch book

HANDLEBOARDS Handleboards are the perfect way to display the wide range of handle options we have available. With the ability to hold up to twelve styles, simply choose the handles you want to display from the handle section in this directory.

Order code

Description

HANDLE/BOARD

Blank handleboard and clips to attached handles

STORAGE POINT OF SALE

HB/CLIPS

Additional clips

We’ve developed a storage point of sale kit to help you sell more internals. Featuring literature and several branded items to use in your showroom, this kit is designed to drive consumer interest in the benefit of smart storage.

Handleboard

Order code

Description

STORAGEPOS

Storage in-store point of sale kit

WORKSURFACE SUPPORT We have a suite of dedicated sales and marketing tools to support you including: •

Stone display stand and samples

Timber display stand and samples

Material sample books

Please see Worksurfaces section page 2.46 Worksurface sample books

Worksurface display stand

Please contact customer services for more information and to order any of the above items

T: 01325 505599 (North) | 88 (South)

15


IN THE PRESS PWS has strong and established relationships with the KBB press, and our experienced PR team is there to advise you on the best strategies to market your business to your local customer base. PWS has a range of consumer focused brands, including Second Nature and 1909. We’re very successful in securing regular press coverage and raising national awareness for these branded collections - all designed to drive unique consumer leads for our customers selling these ranges. We can also assist you in growing awareness for our branded collections in your local area, offering help and guidance on everything from magazine advertising, case studies, local and national press releases, to award entries, your own customer promotions and events, and even graphic design support.

REAL KITCHENS PROGRAMME All customers who are part of the Second Nature or 1909 partner programmes (see page 17) have exclusive access to our Real Kitchens Programme. Showcase your projects on your very own showroom page on our consumer websites, via our social channels, and in the national KBB press. The Real Kitchens Programme is proven to help drive up to 2 ½ times more consumer leads to your showroom.

EVENTS AND TRAINING PWS is dedicated to holding product training days and events for you to take free advantage of throughout the year. Gain an in-depth understanding of our new and existing product ranges, with advice on design and installation, and new techniques to maximise your sales. Contact your PWS account manager for our 2020 events schedule.

BEST IN CLASS IMAGERY All of our customers have direct access to an extensive suite of kitchen images. With instant online access, you have unlimited use of the very latest kitchen looks and design ideas for your own marketing activities.

Contact the PWS marketing team directly on +44 (0) 1325 621 373.

STAY SOCIAL For customers selling our branded collections (Second Nature and 1909), it’s really easy to engage with us via our consumer social media platforms. There’s always so much to get involved in to promote your business – from case studies, to special features on your showroom, or why not collaborate with us on a design or styling project, or even write a guest blog for us!

16

Order Online www.pws.co.uk

“There’s always so much to get involved in to promote your business – from case studies, to special features on your showroom”


PARTNER PROGRAMMES 2XU3:6SDUWQHUSURJUDPPHVDUHVSHFL´FDOO\GHVLJQHGWRVXSSRUWLQGHSHQGHQWUHWDLOHUV 5HLQIRUFHGE\GHGLFDWHG35DQGPDUNHWLQJFDPSDLJQVWKH\FUHDWHPRUHPDUNHWDZDUHQHVV DQGGULYHXQLTXHFRQVXPHUOHDGVGLUHFWO\WRRXUDFFUHGLWHGSDUWQHUV

Second Nature is our renowned and established consumer brand, exclusively sold through our accredited Second Nature partners across the UK.

LVDFROOHFWLRQRIFODVVLFSDLQWHGWLPEHUNLWFKHQV DGDSWHGDQGFRQVWUXFWHGWRPHHWWKHDHVWKHWLFDQG IXQFWLRQDOGHPDQGVRIDQ\VWFHQWXU\KRPH

As our largest kitchen portfolio, the Second Nature collection features an abundance of design possibilities to suit a wide range of styles, spaces and price points.

7KLVTXLQWHVVHQWLDO%ULWLVKUDQJHRIIHUVWKH FRQVXPHUWKHORRNDQGIHHORIDEHVSRNHNLWFKHQ EXWDWDFRPPHUFLDOO\DWWUDFWLYHSULFHIRUERWK UHWDLOHUVDQGFRQVXPHUV

Second Nature is underpinned by an industry leading partner programme and nationwide consumer marketing campaign. Designed to continually promote the brand, product collection, and all Second Nature showrooms - it drives unique consumer leads directly to all partners.

2XUSDUWQHUSURJUDPPHLVGHGLFDWHGWR SURPRWLQJDQGJURZLQJDZDUHQHVVIRUWKH EUDQGDQGSURGXFWFROOHFWLRQLQWKHPDUNHWSODFH ([FOXVLYHO\WDUJHWHGWRWKHGHPRJUDSKLF DQGSURPRWLQJDOOVKRZURRPVLWGULYHV XQLTXHFRQVXPHUOHDGVGLUHFWO\WRDOOSDUWQHUV

www.sncollection.co.uk

www.1909kitchens.co.uk

Accredited members of both the Second Nature * Ä ÄŠÄ€ÄŠ,.0*!.,.+#.))!/!*!Ăź0".+)Ä? •

'HGLFDWHGFRQVXPHUZHEVLWHV

•

:KHUHWREX\­ZHEVLWHOLVWLQJV

•

'LUHFWFRQVXPHUOHDGVIURP\RXUORFDODUHD

•

3ULRULW\EXVLQHVVDQGGLVSOD\VXSSRUW

•

1DWLRQDODQGORFDOYLVLELOLW\YLDRQJRLQJFRQVXPHU35DQGPDUNHWLQJ

•

([FOXVLYHFRPSOLPHQWDU\PDUNHWLQJPDWHULDOVDQGSRLQWRIVDOHPHUFKDQGLVH

•

([FOXVLYHWUDLQLQJHYHQWVDQGSHUVRQDOVKRZURRPGHVLJQVHUYLFH

•

([FOXVLYHXVHRIEHVWLQFODVVLPDJHU\

•

,QFOXVLRQLQWKH5HDO.LWFKHQVSURJUDPPH

•

6SHFLDOLVWSDUWQHUDFFUHGLWDWLRQDQGIDQWDVWLFLQFHQWLYHV

To join our family of successful brand partners across 0$! ÄŒ+.0+ %/1//0$!!*!Ăź0/* .!-1%.!)!*0/ÄŒ please contact your Area Sales Manager or member of your personal support team.

T: 01325 505599 (North) | 88 (South)

17


CUSTOMER-CENTRIC SUPPORT At PWS, delivering excellent customer service is at the heart of everything we do. With this in mind, we’ve recently introduced our new customer-centric support hub, designed to improve our business partnership with you, and make it much quicker and easier to work with us. Following significant restructuring, the new hub joins all PWS kitchen and bedroom sales and customer service teams together in one dedicated place, including experts in worksurfaces, storage and all accessory products – providing a seamless customer journey, and the most comprehensive range of products and services under one roof.

YOUR PERSONAL TEAM OF EXPERTS AND NEW ‘ONE CALL’ SERVICE

Our new support hub now also provides all customers with a dedicated team of experts working closely with you at all times - there to support all of your business needs via one quick and easy call. This includes:

LOCAL AREA SALES MANAGER (EXTERNAL)

Face-to-face business support in your local area

BUSINESS DEVELOPMENT

CUSTOMER SERVICES

(INTERNAL)

(INTERNAL)

An extension to your business providing valuable sales support and account management

End-to-end support for all projects: inc. dedicated worksurface advisor

CUSTOMER INDUCTION PROGRAMME All new PWS customers receive a personal induction programme, and continued day-to-day support going forward, covering:

TRADING ARRANGEMENTS • • • •

Order process Our enhanced remedial service Our returns procedure Logistics and delivery

EXPERT PRODUCT KNOWLEDGE • Our customer service advisors are fully trained in all aspects of our products and services. • As part of our customer induction programme we provide tailored training and trade material to support you in becoming a PWS product and brand champion in all areas. OPENING HOURS 8am – 7pm Monday – Thursday | 8am – 5pm Friday

18

Order Online www.pws.co.uk

PERSONAL CUSTOMER SERVICE ADVISOR • Every customer is assigned a personal customer services advisor as a point of contact and guide through every stage of your ordering process. • Direct dial for your personal support hub.

PROBLEM RESOLUTION • We have a robust remedial procedure in place as part of our problem resolution service. This will be managed through an enhanced lead time.

TRADE COUNTER OPEN 7am – 5pm Monday - Friday


CAD DESIGN & QUOTATION SERVICE As part of our customer-centric support programme, we offer a CAD design and quotation service to help our customers plan and create designs for their consumers – lightening the load, and providing tailored materials to support sales. Our team of expert CAD technicians will work closely with you to understand your requirements, whilst being on hand to make recommendations on our latest products. Working to your plans, our team will produce a tailored 3D CAD design using industry leading design software, along with a breakdown of the project cost. With the ability to visualise storage solutions, specific handle designs, lighting, worksurface detail, as well as representative interiors, we can help to bring your plans to life, and help your customer to visualise the design in their own home.

T: 01325 505599 (North) | 88 (South)

19


ORDERING MADE SIMPLE We want to make your service experience with us as simple and hassle free as possible which is why we are investing in our online services.

PWS WEBSITE

NEW PWS website coming early 2020

Our website is one of the simplest and easiest ways to deal with us. Real-time access provides a host of services and information close at hand around the clock. • Know our products? Quick Order lets you go straight to order đ*/1.!ĕ%* %*#,.+ 10/$/!!*) !!/%!.3%0$%),.+2! /!.$!/* ü(0!.%*# • Orders are allocated in real-time with live availability and pricing information • Build quotes and save template orders for future use đƫ$!',.+ 10%*"+.)0%+** /,!%ü0%+*/ • Feature-rich access to information on all the available products, services, events and latest news and information about PWS • Track orders and consignments or view your full order history • Manage your users and account online, check statements and manage payments

EQ FROM COMPUSOFT Many customers use EQ and we have worked with Compusoft to integrate our online services to make placing an order even simpler and real-time through this leading business management platform for the industry. ·

Using your PWS login details, place orders electronically through EQ with instant stock availability information and live stock allocation. ·

EQ Direct Pricing allows you to download your PWS product prices directly into EQ (PWS list and net prices) without the need to manage the discount lists in EQ. ·

As with the PWS website, ordering through EQ directly, rather than by email, allocates the stock immediately to your order. ·

You can track and progress your order immediately on the PWS Website.

WHAT DO I NEED? 1. EQ version 14.2.158 and above 2. PWS website login details ·

Set-up in the EQ supplier screen for account placing orders directly and EQ Direct Pricing integration.

CAD PACKAGES !+û!. ! %0! 0(+#1!/%*0$!)&+.ƫƵ/+"03.!,(0"+.)/č

20

Order Online www.pws.co.uk


NEW Clarendon shown in Hartforth Blue, please see page 19 for door range.


1 DOORS & ACCESSORIES INTRODUCTION Door selector

01

Paint-to-order summary

05

Made-to-order summary

06

DOORS Alpina

07

Belsay

11

Broadoak

15

Clarendon

19

Ellerton

27

Fitzroy

31

SERVICES Paint-to-Order – How to Order

85

Care & Maintenance Kits

86

Door Drilling

87

Co-ordinating MFC board options

89

DOOR MATRICES Lay-on

91

Hunton

95

Handleless Door Sizes Clarendon In-frame Sizes

99 103

37

1909 COLLECTION

%$ü!( 





ąă

Overview

107

%(+1.*!





ąĈ

Shaker & Ovolo

109

Mornington Beaded

51

Slab

115

Mornington Shaker

55

1909 Door Matrix

119

Mornington Bespoke

59

Bespoke Sizes

127

Porter

61

How-to-Order

129

Hunton

Handleless rails

67

Remo

69

Stanhope

75

UNITY

79

FEATURE DOORS Framed Glazed doors )+1.++./



83 

ĉą

T: 01325 505599 (North) | 88 (South)

1.02


DOOR SELECTOR PRODUCT AVAILABILITY Paint to-order

CLASSIC

Bespoke door sizes

Door drilling service

Handleless rail sizes

Paint to-order

MODERN

STOCKED DOORS

Bespoke door sizes

Handleless rail sizes

Door drilling service

STOCKED DOORS

BELSAY









LICHFIELD









BROADOAK









PORTER







NOT GLOSS

CLARENDON









REMO







NOT GLOSS

ELLERTON









FEATURE GLAZED









FITZROY









HUNTON









MILBOURNE









MADE - TO MEASURE

Paint to-order

Bespoke door sizes

Handleless rail sizes

Door drilling service

MORNINGTON SHAKER









NON STOCKED

MORNINGTON BEADED









ALPINA









1909 SLAB









STANHOPE









1909 SHAKER









UNITY









1909 OVOLO









PTO

PTO

CLASSIC DOOR FAMILIES BELSAY (PAGE 11) £

STOCKED COLOURS

PRE-FIX CODE

BROADOAK £

£

£

(PAGE 15)

£

STOCKED COLOURS

PRE-FIX CODE

PORCELAIN

BLN

NATURAL

BN

CASHMERE

BLH

ALABASTER

BA

BLD

STONE

BT

DOVE GREY

BLV

PARTRIDGE GREY

BPY

GRAPHITE

BLG

SANDED

BS

DUST GREY

SERVICE OPTIONS PAINT-TO-ORDER

CLARENDON (PAGE 19) £

£

£

£

£

STOCKED COLOURS

PRE-FIX CODE

PORCELAIN

YP

DUST GREY

YD

SANDED

YS

ELLERTON (PAGE 27) £

£

£

STOCKED COLOURS CHALK

FITZROY £

£

£

1.01

YX

BESPOKE DOOR SIZES

YQBESPOKE

(PAGES 1.31-1.36)

STOCKED COLOURS

PRE-FIX CODE

PORCELAIN

FZP

STONE

FZS

DOVE GREY

FZV

PARTRIDGE GREY

FZG

DUST GREY

FZU

GRAPHITE

FZR

HARTFORTH BLUE

FZB

Order Online www.pws.co.uk

PRE-FIX CODE ELC

SERVICE OPTIONS PAINT-TO-ORDER

SERVICE OPTIONS PAINT-TO-ORDER

BX

(Shown in paint-to-order)

SERVICE OPTIONS PAINT-TO-ORDER

FZX

BESPOKE DOOR SIZES

FZQBESPOKE

ELX


PRODUCT KEY: £ £ £ £ £ Painted Finish

HUNTON £

£

Real Timber Veneer

Woodgrain û!0

Handleless Rail Sizes

(PAGE 37)

Paint-to-Order Made-to-Measure Service Collection

Bespoke Door Sizes

Price Bands 1 - 5

PRE-FIX CODE

STOCKED COLOURS

£

Stocked Range

PORCELAIN

HUP

DUST GREY

HUV

HARTFORTH BLUE

HUB

SERVICE OPTIONS PAINT-TO-ORDER

HUX

BESPOKE DOOR SIZES

HUQBESPOKE

MILBOURNE (PAGE 47) £

£

PRE-FIX CODE

STOCKED COLOURS CHALK

RDL

PARTRIDGE GREY

RDP

PORCELAIN

RDN

DUST GREY

RDD

ALABASTER

RDA

HARTFORTH BLUE

RDB

SAGE

RDS

CHARCOAL

RDH

STONE

RDT

DOVE GREY

RDV

MORNINGTON SHAKER (PAGE 55) £

£

SERVICE OPTIONS

PRE-FIX CODE

STOCKED COLOURS

£

PAINT-TO-ORDER

RDX

MORNINGTON BEADED £

£

£

(PAGE 51)

PRE-FIX CODE

STOCKED COLOURS

PORCELAIN

MGP

PORCELAIN

MBP

STONE

MGT

STONE

MBT

DOVE GREY

MGV

DOVE GREY

MBV

PARTRIDGE GREY

MGY

PARTRIDGE GREY

MBY

DUST GREY

MGD

DUST GREY

MBD

HARTFORTH BLUE

MGB

HARTFORTH BLUE

MBB

GRAPHITE

MGR

GRAPHITE

MBR

SANDED

MGS

SANDED

MBS

SERVICE OPTIONS

1909

PRE-FIX CODE

STOCKED COLOURS

SERVICE OPTIONS

PAINT-TO-ORDER

MGX

PAINT-TO-ORDER

MBX

BESPOKE DOOR SIZES

MGQBESPOKE

BESPOKE DOOR SIZES

MBQBESPOKE

£ £ £ £ £

SLAB (PAGE 115)

SHAKER

OVOLO

Shaker and Ovolo are available with four beading options.

(PAGE 109)

(PAGE 109)

BEADING OPTIONS

Quarter Quarter Round Linear Round

Half Pencil Georgian & Scalloped

SERVICE OPTIONS PAINT-TO-ORDER BESPOKE DOOR SIZES SANDED - SL PAINT-TO-ORDER - L9

SANDED - SH PAINT-TO-ORDER - S9

SANDED - OV PAINT-TO-ORDER - O9

Because of the variables between the photographic and print process, colours shown in print may vary slightly from the actual product supplied.

T: 01325 505599 (North) | 88 (South)

1.02


KEY Price Bands 1 - 5

MODERN DOOR FAMILIES PORTER (PAGE 61) £

£

MATT STOCKED COLOURS

PRE-FIX CODE

£ £ £ £ £

WHITE

PMW

WHITE

PW

PORCELAIN

PMN

PORCELAIN

PN

CASHMERE

PMH

CASHMERE

PH

DOVE GREY

PMV

DOVE GREY

PV

SILVERY GREY PMS

£

£

PMU

DUST GREY

PU

GRAPHITE

PMG

GRAPHITE

PG

HARTFORTH BLUE

PMB

SERVICE OPTIONS

PAINT-TO-ORDER

PMX

PAINT-TO-ORDER

SX

BESPOKE DOOR SIZES

PQBESPOKE

BESPOKE DOOR SIZES

PQBESPOKE

MATT STOCKED COLOURS

£

SILVERY GREY PS

DUST GREY

SERVICE OPTIONS

REMO (PAGE 69)

PRE-FIX CODE

WHITE

RMW

WHITE

RW

PORCELAIN

RMN

PORCELAIN

RN

CASHMERE

RMH

CASHMERE

RH

DOVE GREY

RMV

DOVE GREY

RV

RMU

DUST GREY

RU

GRAPHITE

RMG

GRAPHITE

RG

HARTFORTH BLUE

RMB

SERVICE OPTIONS

PAINT-TO-ORDER

REM

PAINT-TO-ORDER

RX

BESPOKE DOOR SIZES

RQBESPOKE

BESPOKE DOOR SIZES

RQBESPOKE

FEATURE GLAZED (PAGE 83)

LICHFIELD (PAGE 43) £

£

SILVERY GREY RS

DUST GREY

SERVICE OPTIONS

£

PRE-FIX CODE

GLOSS STOCKED COLOURS

SILVERY GREY RMS

£

PRE-FIX CODE

GLOSS STOCKED COLOURS

STOCKED COLOURS

PRE-FIX

ESPRESSO

LFE

SANDED

LFS

£

£

£

£

£

PRE-FIX SHOWN IN BRACKETS BELOW

SERVICE OPTIONS PAINT-TO-ORDER

1.03

Order Online www.pws.co.uk

LFX

FLUTED GLAZED

BLACK GLAZED

BRONZE GLAZED

(FLG)

(BGL)

(BRGL)

Because of the variables between the photographic and print process, colours shown in print may vary slightly from the actual product supplied.


MADE-TO-MEASURE UNITY (PAGE 79) SUPERMATT (UXB) £ £

WOODGRAIN EFFECT (UXA) £

GLOSS (UXB) £ £

PURE WHITE

PURE WHITE

CASHMERE

CASHMERE

LIGHT GREY

LIGHT GREY

DUST GREY

DUST GREY

GRAPHITE

GRAPHITE

WHITE HALIFAX OAK

NATURAL DAVOS OAK

RECLAIMED OAK

PEBBLE GREY

FEATURE CONCRETE £

INDIGO

BRUNSWICK (UXC) HAYWARD (UXA)

GLOSS METALLIC (UXC) £ £ £

CHARACTER SEPIA BLACK ASH GRAPHITE GLADSTONE OAK

TRELLICK (UXA)

FJORD METALLIC GOLD METALLIC

ALPINA (PAGE 7) PRE-FIX SHOWN IN BRACKETS BELOW £

£

£

£

£

NATURAL OAK (LNO)

SMOKED LARCH (LSL)

STANHOPE CLASSSIC

MID OAK (LMO)

DEEP OAK (LDO)

BURNT ASH (LBA)

STANHOPE MODERN (PAGE 75)

(PAGE 75)

£

£

BOLAM

LANGLEY

MELDON

INGOE

WHITFIELD

HENSHAW

ACOMB*

One piece shaker

Shaker with Ovolo detail

Cathedral arch

Cathedral arch

Square slab

Sapponetta slab

Integrated handle

(STB)

(STB)

(STA)

(STA)

(STA)

(STA)

(STA)

APPLICABLE TO ALL BESIDES INGOE

MODERN ONLY

MATT

GLOSS

WOODGRAIN FINISH

CLASSIC INGOE ONLY NATURAL WOOD EFFECT

PORCELAIN

SUPER WHITE

WHITE

ALABASTER

CREAM

CREAM

MUSSEL

GREY

DOVE GREY

MUSSEL

CASHMERE

CASHMERE

SLALEY

HAZE

STONE

FALSTONE

ĵƵ+)*+02%((!%*#(+//ü*%/$!/

NATURAL WOODGRAIN

FEATURE

BLUE CANVAS CONCRETE GRAPHITE

T: 01325 505599 (North) | 88 (South)

āċĀą


PAINT-TO-ORDER SUMMARY Paint-to-Order Service

PAINT-TO-ORDER DOOR RANGES:

Clarendon Matt (YX)

Broadoak Matt (BX)

Ellerton Smooth Matt (ELX)

Mornington Shaker Matt (MGX)

Mornington Beaded Matt (MBX)

Fitzroy Smooth Matt (FZX)

Porter Matt / Gloss (PMX/SX)

Hunton Smooth Matt (HUX)

Remo Matt / Gloss (REM/RX)

Milbourne Matt (RDX)

%$ü!( Matt (LFX)

1909 SLAB Smooth Matt (L9)

1909 SHAKER Smooth Matt (S9)

1909 OVOLO Smooth Matt (O9)

PAINT-TO-ORDER COLOUR PALETTE: LIGHTS/WHITES

CHALK

PORCELAIN

WARM NEUTRALS

ALABASTER MODERN

MUSSEL

CASHMERE

DRY ROSE

STONE

BLUES

CHINA BLUE

PUTTY

SUEDE

TRUFFLE

LAVA

FLINT GREY

TRENCH COAT GREY

REGIMENT

GREENS

CHALK BLUE

CADET

CORNFLOWER

STORM BLUE

HARTFORTH BLUE

CHARCOAL

GREYS

SAGE

PAINT-TO-ORDER LEADTIMES DOORS

DOVE GREY

COPSE GREEN

PARTRIDGE GREY

SILVER GREY

DUST GREY

SLATE

GRAPHITE

Paint-to-Order lead-times: The stated lead-times for Paint-to-Order are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, in the form of  !(%2!.5 0!Č3%((!+*ü.)! 3%0$!$%* %2% 1(+. !.'*+3(! #!)!*0ċ

CARBON

Finish

Lead time

Remedial time

CLASSIC RANGES

Matt

15 working days

7 working days

1909

Matt

From 20 working days

11 working days

PORTER & REMO

Matt

15 working days

7 working days

PORTER & REMO

Gloss

*21 working days

14 working days

See page 85 on how to order PAINT-TO-ORDER RANGES *Lead-time based on orders placed before Wednesday 12 noon.

Because of the variables between the photographic and print process, colours shown in print may vary slightly from the actual product supplied.

NEW

Water-Based Paint Finish

1.05

Order Online www.pws.co.uk

30 Matt and Gloss Colours


MADE-TO-ORDER DOORS Made-to-Measure Collection

Bespoke Door Sizes

MORE CHOICE, GREATER FLEXIBILITY %/*+3$,,50++Ăť!.+1.) !ÄĄ0+ÄĄ+. !./!.2%!.+//Ä Äƒ ++.")%(%!/ÄŒ%*(1 %*#!/,+'! ++./%6!/%*/+)!+"+1.)+/0,+,1(./0+'!  .*#!/ÄŒ%*0ÄĄ0+ÄĄ. !.Ăź*%/$!/* ă ! %0! ) !ÄĄ0+ÄĄ)!/1.! ++.+((!0%+*/Ä‹(!/!/!!,#!.!"/!(+3"+."1.0$!. *"+.)0%+*5.*#!Ä‹ The easiest way to order bespoke sizes is at pws.co.uk

FITZROY (PAGE 36)

O O O

Any door size (Drawer/Door/Tall Door) Glazed / panel doors Available in 7 standard colours and our full Paint-to-Order palette

CLARENDON (PAGE 23)

O

O O

Bespoke door-set sizes – 19 drawer/door applications within set parameters Glazed / panel doors Available in sanded / 2 standard colours and our full Paint-to-Order palette

1909 SLAB (PAGE 127)

O O O

Bespoke door-set sizes – 20 drawer/door options Glazed / panel doors options Available in sanded and Paint-to-Order

HUNTON

O O O

O

O O

O O

Measure-to-Measure Slab collection 5 finish options covering Supermatt (7), Gloss (5), Gloss Metallic (2), Woodgrain Effect (6) and NEW feature concrete (3) Any size (Drawers/Doors/Panels) Angled doors

O O O

Any door size (Drawer/Door/Tall Door) Available in 15 standard matt/gloss colours and our full Paint-to-Order palette

1909 SHAKER (PAGE 127)

O O O

O O

Bespoke door sizes (Drawer/Door/Tall Door) Glazed / panel doors Available in sanded / 7 standard colours and our full Paint-to-Order palette

O O

Any door size (Drawer/Door/Tall Door) Feature ‘half-handle’ doors – horizontal and vertical set-size options Available in 15 standard matt/gloss stocked finishes and our full Paint-to-Order palette

1909 OVOLO (PAGE 127)

Bespoke door-set sizes – 22 drawer/door options Glazed / panel door designs Available in sanded and Paint-to-Order Additional joinery options – butt hinges and beading

ALPINA (PAGE 10)

O

(PAGE 59)

REMO (PAGE 73)

(PAGE 66)

O

O

UNITY (PAGE 80)

Bespoke door sizes (Drawer/Door/Tall Door) NEW Glazed door / panel doors Available in 3 standard colours and our full Paint-to-Order palette

PORTER

O

MORNINGTON

(PAGE 42)

O O O O

Bespoke door-set sizes – 22 drawer/door options Glazed / panel door designs Available in sanded and Paint-to-Order Additional joinery options – butt hinges and beading

STANHOPE (PAGE 76)

Measure-to-Measure Slab Veneer collection 5 highly distinctive, heavily textured finishes Any size (Drawers/Doors/Panels)

O O

O O

Measure-to-Measure Vinyl Door collection 7 door options available in 17 finishes covering Gloss, Concrete, Matt and Woodgrain effect Any size (Drawers/Doors/Panels) Bespoke accessory options

T: 01325 505599 (North) | 88 (South)

1.06


ALPINA

6Year GUARANTEE

TIMBER VENEERED SLAB

Made-to-Measure Real Timber Collection Veneer

PRODUCT SPECIFICATION

STOCKED FINISHES

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Burnt Ash

Textured Finish

DOOR THICKNESS 19mm

FINISH Heavily Textured Timber Veneer

Natural Oak

Deep Oak

(Horizontal grain) (Horizontal grain) (LNO)

(LDO)

Burnt Ash

Smoked Larch

EDGE DETAIL Matching ý0!*!!. (0.8mm edge)

REVERSE 0$%*#ý0 veneer

(Horizontal grain) (Horizontal grain)

PRODUCT OVERVIEW DOOR FAMILY STYLE

Slab - edged

DOOR THICKNESS

19mm

SUBSTRATE

Chipboard

FINISH

Real Timber Veneer (heavily embossed texture)

REVERSE

0$%*#!*!!.Ĩý0ü*%/$ĩ

PRICE BAND

£ £ £ £ £

(LBA)

(LSL)

MID OAK (Vertical grain) (LMO)

SERVICE OPTIONS

Bespoke Door Service (***BESPOKE) 26 working days 14 days remedial

KEY FEATURES  A collection of quality, real timber veneer slab doors  Highly distinctive, $!2%(50!401.! ü*%/$  5 striking door designs that work on their own or as an accent  Matching edge and .!2!./!Ĩý02!*!!.ĩ   !ġ0+ġ !/1.!+û!. - available in any door size to suit lay-on or true handleless kitchen designs

Alpina shown in Burnt Ash mixed with Porter Matt White

1.07

Order Online www.pws.co.uk


'QUICK ORDER' SIZES

Ƶ2%((!0++. !.5 ++.ü*%/$+ !

Alpina is a fully Made-to-Measure Collection available in any size. To facilitate ease of ordering, the following list of ŏ1%'(*!ŏ ++./%6!/.!2%((!0++. !.1* !./!0+ !/5 ++.ü*%/$Ĩ/!!,.!2%+1/,#!"+.,.!ġü4+ !/ĩċ See overleaf for Bespoke door size parameters

Drawer fronts

Handless Doors

Doors

***115X597

115x597mm

ĵĵĵĈāĆāąĈ

ĈāĆ4āąĈ))

ĵĵĵāćĀąĊĈ

āćĀ4ąĊĈ))

***139X297

139x297mm

***715X297

715x297mm

***160X597

160x597mm

***715X397

715x397mm

***160X797

160x797mm

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***160X897

160x897mm

ĵĵĵĈāĆąĊĈ

ĈāĆ4ąĊĈ))

***160X997

160x997mm

ĵĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ)) ĵĵĵăĂĆąĊĈ

ăĂĆ4ąĊĈ))

***715X597

715x597mm ***325X597

325x597mm

***895X297

895x297mm

***895X397

895x397mm

***325X797

325x797mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***325X897

325x897mm

***139X397 ĵĵĵāăĊąąĈ ĵĵĵāăĊąĊĈ ***139X597 ***139X797

139x397mm āăĊ4ąąĈ)) āăĊ4ąĊĈ)) 139x597mm 139x797mm

***139X897

139x897mm

***139X997

139x997mm

ĵĵĵāĈĆąĊĈ

āĈĆ4ąĊĈ))

ĵĵĵĉĊĆąĊĈ

ĉĊĆ4ąĊĈ))

***325X997

325x997mm

***175X597

175x597mm

***895X597

895x597mm

ĵĵĵćĉĆāąĈ

ćĉĆ4āąĈ))

ĵĵĵĂĉăąĊĈ

Ăĉă4ąĊĈ))

***980X597

980x597mm

***685X297

685x297mm

***283X597

283x597mm

***685X397

685x397mm

***283X797

283x797mm

ĵĵĵćĉĆąąĈ

ćĉĆ4ąąĈ))

ĵĵĵćĉĆąĊĈ

ćĉĆ4ąĊĈ))

***685X597

685x597mm

***283X897 ***283X997

283x897mm 283x997mm

Doors / drawer fronts ***355X397

355x397mm

ĵĵĵăĆĆąĊĈ

ăĆĆ4ąĊĈ))

***355X597

355x597mm

***355X797

355x797mm

***355X897

355x897mm

***355X997

355x997mm

ĵĵĵąĆĀĆĊĈ

ąĆĀ4ĆĊĈ))

ĵĵĵąĊĀĆĊĈ

ąĊĀ4ĆĊĈ))

***570X297

570x297mm

***570X397

570x397mm

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

ĵĵĵĆĈĀąĊĈ

ĆĈĀ4ąĊĈ))

***570X597

570x597mm

Larder doors ĵĵĵāĂąĆĂĊĈ

āĂąĆ4ĂĊĈ))

ĵĵĵāĂąĆăĊĈ

āĂąĆ4ăĊĈ))

ĵĵĵāùƹĊĈ

āĂąĆ4ąĊĈ))

ĵĵĵāĂąĆĆĊĈ

āĂąĆ4ĆĊĈ))

***1965X297

1965x297mm

ĵĵĵāĊćĆąĊĈ

āĊćĆ4ąĊĈ))

***1965X597

1965x597mm

T: 01325 505599 (North) | 88 (South)

1.08


ALPINA

PRE-FIX CODES: Natural Oak (LNO), Deep Oak (LDO), Burnt Ash (LBA), Smoked Larch (LSL), Mid Oak (LMO)

ACCESSORIES All accessories available to order in the codes !(+35 %*#0$!Ăź*%/$,.!ÄĄĂź4+ !Ä‹

Cornice ***C30

Modern cornice/light pelmet, 50x3050x18mm

***P30

Plinth, 150x3050x18mm

KEY FEATURES ĆŤ+ !//00! .!/1Ăž4+ !/Ä‹.!Ăź4+ !"+. ++..*#!ÄĽ+(+1. must be used when ordering.

Plinth

Feature Posts ***CP30

Base/wall corner post, 715x70x18mm - supplied in pairs

***TCP

Tall wall corner post, ĊĀĀ4ĈĀ4Ä Ä‰))ÄĄ3%0$/(,.+Ăź(!

***ECP685

External corner post, ćĉĆ4ąć4ąć))Č"+.$* (!(!//.%(/

***CP30B

Internal base corner post, 685x70x18mm, for handleless rails

ľľľĂąĀĀ

Appliance/larder feature end post, ĂąĀĀ4Ä Ä€Ä€4ĆĀ))

Feature island with Handleless 900x1200mm island (**BBEP1200) and pre-assembled external corner post (**ECP685)

End Panels ***BEP900/18

Base end panel, 900x650x18mm

***WEP780/18

Wall end panel, 780x370x18mm

***WEP960/18

Tall wall end panel with square edges 960x370x18mm

***EP25

* ,*!(3%0$/-1.!! #!/ÄŒ#(+//Ăź*%/$ +*"!+*(5ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

ľľľĂąĀĀļĊĀĀ

Breakfast bar end panel ĊĀĀ4ĂąĀĀ4Ä Ä‰))

***BBEP1200

Breakfast bar end panel, 685 x 1200 x 18mm, for handleless rails

Edging tape ***VE3

1.09

Ä™+Ăź((!.Äš,,(%*!*'3%0$!40.3% ! .3!.//$+3*Ćľ(,%*!!,' Veneer edging, 32x3000x0.8mm

Order Online www.pws.co.uk


ALPINA - BESPOKE DOOR PARAMETERS Alpina bespoke doors are available in the following drawer/door size parameters:

STANDARD BESPOKE DOOR SIZES

DRAWER

DOOR  CHOOSE HEIGHT

 CHOOSE HEIGHT

 CHOOSE WIDTH

 CHOOSE WIDTH

 CHOOSE WIDTH

MIN

MAX

Height

1OOmm

282mm

Width

100mm

1197mm

26 DAYS*

TALL DOOR

 CHOOSE HEIGHT

MIN

MAX

Height

283mm

895mm

Width

100mm

1197mm

MIN

MAX

Height

896mm

ĂĆąĀ))

Width

100mm

897mm

Made-to-Order lead-times

LEADTIME 14 DAYS REMEDIAL

The lead-times for Made-to-Order are for guidance purposes only and always subject to manufacturing ,%05ċƵ*1.0!(! ġ0%)!Č%*0$!"+.)+" !(%2!.5 0!Č3%((!+*ü.)! 3%0$!$%* %2% 1( order acknowledgement

*For orders received before 12pm mid-day, Wednesday.

How-to-order Alpina The easiest way to order is on www.pws.co.uk

To order bespoke sizes follow the following steps: āċ *,10!/,+'!,.!ü4+ !č

Code

Description

***BESPOKE

Bespoke size door

ĵĵĵ/$+1( !.!,(! 3%0$,.!ġü4+"$+/!* ++.ü*%/$Ģ please see each range page for more information

STEP 2. Choose door application (see door/drawer size parameters on each range page)

STEP 3. Choose height/width

T: 01325 505599 (North) | 88 (South)

1.10


BELSAY

6Year GUARANTEE

Stocked Ranges

FOIL SHAKER (WOODGRAIN EFFECT)

PRODUCT SPECIFICATION

STOCKED FINISHES

Woodgrain û!0

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Dust Grey

DOOR THICKNESS

5 piece door construction v-grooves and Inner angled frame detail

18mm

DOOR FRAME

CENTRE PANEL

95mm wide

NEW

Porcelain (BLN)

Cashmere (BLH)

Dust Grey (BLD)

Egger - W1200

Egger - U702

Egger - U732

6mm deep

Suggested board matches for Egger shown below each door. See page 89 for full list.

EDGE DETAIL 1mm edging with subtle chamfer ,.+ü(! Dove Grey (BLV)

Graphite (BLG)

Egger - U708

Egger - U961

PRODUCT OVERVIEW DOOR FAMILY STYLE

Shaker - 5 piece construction with inner angled frame

DOOR THICKNESS

18mm

SUBSTRATE

MDF

FINISH

003++ #.%*!û!0"+%(Ĩ1*,%*0! ĩ

REVERSE

Matching foil as per front face

CERTIFICATION

Fira Gold

PRICE BAND

SERVICE OPTIONS

Door Drilling Service 2 working days

£

KEY FEATURES  5 piece foil Shaker with highly authentic 3++ #.%*!û!0  Contemporary narrow frame design with angled centre panel  Modern colour palette available from stock in 5 colours Ƶ*û+. (!,.%! point  NEW trend Dust Grey colour introduced for 2020  NEW corner door solutions for greater ý!4%%(%05

Belsay shown in Dove Grey and Graphite

1.11

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Drawer fronts (Slab) ***116

115x597mm

ĵĵĵāąă

139x297mm

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

139x597mm

ĵĵĵāąĉ

FEATURE DOORS

Doors

Glazed door ĵĵĵĈāĆāąĈ

ĈāĆ4āąĈ))Ĩ/(ĩ ***715G

***WCDS

715x277x18mm, wall corner door solution, pair

***CDS

715x315x18mm, base corner door solution, pair

139x797mm

***713

715x297mm

ĵĵĵāąĊ

139x897mm

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

ĵĵĵāąĀ

139x997mm

ĵĵĵĈāą

715x397mm

***176

175x597mm

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***715

ĈāĆ4ąĊĈ))

ĵĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ))

Drawer fronts (Shaker) ***285

Ăĉă4ąĊĈ))

***716

715x597mm

***286

Ăĉă4ąĊĈ))

***893

895x297mm

***288

283x797mm

ĵĵĵĉĊą

895x397mm

***289

283x897mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***280

283x997mm

***895

ĉĊĆ4ąĊĈ))

***896

895x597mm

***986

980x597mm

Doors / drawer fronts ***355

ăĆĆ4ąĊĈ))

***356

355x597mm

***358

355x797mm

***359

355x897mm

***350

355x997mm

ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵĵąĊą

ąĊĀ4ăĊĈ)) (for belfast 800mm sink)

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***573

570x297mm

ĵĵĵĆĈą

570x397mm

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

ĈāĆ4ąĊĈ))Č clear glazed

Larder doors ***123

āĂąĆ4ĂĊĈ))

ĵĵĵāĂą

āĂąĆ4ăĊĈ))

***125

āĂąĆ4ąĊĈ))

***126

āĂąĆ4ĆĊĈ))

***193

1965x297mm, with cross rail UPDATED DESIGN

1965x597mm, with cross rail ***196

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

ĵĵĵćąć

ćąĆ4ĆĊĈ))

UPDATED DESIGN

T: 01325 505599 (North) | 88 (South)

1.12


BELSAY

PRE-FIX CODES: Porcelain (BLN), Cashmere (BLH), Dust Grey (BLD), Dove Grey (BLV), Graphite (BLG),

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice ***C30

Cornice, 102x3050x90mm

***L30

Modern cornice / light pelmet, 50x3050x28mm

***P30

Plinth 150x3050x16mm

Plinth xxxL30 Modern cornice/light pelmet, 3

Feature Posts ***CP30

Corner post, 715x70x18mm, (pair)

NEW

***CP30TW

ĵĵĵĂąĀĀ

Tall wall internal corner post, 895x70x70mm, (pair)

Tall feature end post ĂąĀĀ4ĈĆ4ĆĀ))

End Panels ***BEP900/18

Base end panel 900x650x18mm

ĵĵĵĈĈąĥāĉ

((!* ,*!(ĈĈą4ăĈĀ4āĉ))

ĵĵĵĊĆąĥāĉ

((!* ,*!(ĊĆą4ăĈĀ4āĉ))

***EP25

Tall tower end panel with square edges ĂąĀĀ4ćĆĀ4āĉ))

ĵĵĵĂąĀĀĥĊĀĀ

ǫ.!'"/0.!* ,*!(ĊĀĀ4ĂąĀĀ4āĉ))

ÇÇ INDICATES GRAIN DIRECTION

1.13

Order Online www.pws.co.uk


BELSAY- KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

(6!  ++.ĵĵĈāĆħ((!* ,*!(ČĵĵĈĈąĥāĉ

(("!01.!!* ,+/0ČĵĵĵĂąĀĀħǫ/!!* ,*!(ČĵĵǫĊĀĀĥāĉ

Kesseböhmer 300mm Base Pull-out, KBP300SILV

!01.!(. !.ĥ,,(%*!.1*ČāĂąĆ4ĆĊĈ))ĨĵĵāĂćĩ* ĈāĆ4ĆĊĈ))ĨĵĵĈāćĩ

T: 01325 505599 (North) | 88 (South)

āċāą


BROADOAK

6Year GUARANTEE

TIMBER SHAKER (V-GROOVES)

Stocked Ranges

PRODUCT SPECIFICATION

Painted Finish

Real Timber Veneer

STOCKED FINISHES

Paint-to-Order Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Natural Oak

DOOR THICKNESS

5 piece door construction (with V-grooves)

20mm DOOR FRAME 106mm

CENTRE PANEL

Alabaster Classic (BA)

Stone (BT)

Egger - U104

Egger - U201

5mm deep

EDGE DETAIL

Partridge Grey (BPY)

Suggested board matches for Egger shown below each door. See page 89 for full list.

Chamferred edge detail

Natural (BN)

PRODUCT OVERVIEW

Egger - H3368

DOOR FAMILY STYLE

Shaker (real timber painted) 5 piece construction with v-grooves

DOOR THICKNESS

20mm

SUBSTRATE

Solid Oak frame with Oak veneered MDF centre panel

FINISH

Matt painted (Natural Oak - clear (-1!.Č* ! ġ1*ü*%/$! ĩ

REVERSE

Painted as per front face (Natural Oak ġ(!.(-1!.Č* ! ġ1*ü*%/$! ĩ

CERTIFICATION

Fira Gold*

PRICE BAND

Sanded (BS)

*This does not apply to sanded doors

SERVICE OPTIONS

Paint-to-Order (BX)

Door Drilling Service

15 working days

2 working days

7 days remedial

£ £ £ £

KEY FEATURES  Hugely popular, solid oak Shaker door with traditional v-grooves  Natural Oak and painted ü*%/$!/2%((!  Large selection of feature door and accessories  Available in 5 stocked options and in our full paint-to-order palette

Broadoak shown in paint-to-order Putty and Regiment

1.15

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵ

Drawer fronts (Slab) **116

115x597mm

ĵĵāąă

139x297mm

ĵĵāąą

139x397mm

ĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵāąć

139x597mm

ĵĵāąĉ

139x797mm

ĵĵāąĊ

139x897mm

ĵĵāąĀ

139x997mm

**175 **176

Doors

FEATURE DOORS Curved door ĵĵĈāĆāąĈ

ĈāĆ4āąĈ))Ĩ/(ĩ **CD716

**715X257

715x257mm

**713

715x297mm

Glazed doors

**CDS

715x313x20mm corner door solution, pair

āĈĆ4ąĊĈ))

**715X325

715x325mm

175x597mm

ĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

ĵĵĈāą

715x397mm

ĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

Drawer fronts (Shaker) **285

Ăĉă4ąĊĈ))

**715

ĈāĆ4ąĊĈ))

**286

283x597mm

**716

715x597mm

**288

283x797mm

**893

895x297mm

**289

283x897mm

ĵĵĉĊą

895x397mm

**280

283x997mm

ĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

**895

ĉĊĆ4ąĊĈ))

**896

895x597mm

**986

980x597mm

Doors / drawer fronts **353

355x297mm

**355

ăĆĆ4ąĊĈ))

**356

355x597mm

**358

355x797mm

**359

355x897mm

**350

355x997mm

ĵĵąĆć

715x300mm, Small Curved Door

ĵĵĈāąƫ ĨĵĵĈāąĩ

715x397mm, clear glazed

**715CG (**715G)

ĈāĆ4ąĊĈ))Č clear glazed

**895CG (**895G)

ĉĊĆ4ąĊĈ))Č clear glazed

Please note: Codes for glazed doors in Broad Oak Sanded (BS) shown in brackets.

Larder doors **123

āĂąĆ4ĂĊĈ))

ĵĵāĂą

āĂąĆ4ăĊĈ))

ąĆĀ4ĆĊĈ))

**125

āĂąĆ4ąĊĈ))

ĵĵąĊą

ąĊĀ4ăĊĈ)) (for belfast sink)

**126

āĂąĆ4ĆĊĈ))

ĵĵąĊć

ąĊĀ4ĆĊĈ))

**573

570x297mm **193

ĵĵĆĈą

570x397mm

1965x297mm with cross rail

ĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

**575

ĆĈĀ4ąĊĈ))

**576

570x597mm

**196

1965X597mm with cross rail

ĵĵćąć

ćąĆ4ĆĊĈ))

T: 01325 505599 (North) | 88 (South)

1.16


BROADOAK

PRE-FIX CODES: Alabaster Classic (BA), Stone (BT), Partridge Grey (BPY), Natural (BN), Sanded (BS), Paint-to-order (BX)

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice

End Panels **C30

Classic Cornice, 36.5x3030x130xmm

**CBL

Cornice corner block, left hand, 135x37x180mm

**CBR

Cornice corner block, right hand, 135x37x180mm

**CCS300

**L30

**CLS300

Curved Cornice, 36.5x300x300mm

Light pelmet/Modern Cornice, 50x3030x28mm

Curved light pelmet, 50x300x300mm, unhanded

Plinth

**BEP900/18

Base end panel, 900x650x18mm

**EP25

* ,*!(ČĂąĀĀ4ćĆĀ4āĉ))

ĵĵĂąĀĀĂĉ

* ,*!(ČĂąĀĀ4ćĆĀ4Ăĉ))

ĵĵĈĈąĥāĉ

((!* ,*!(ČĈĈą4ăĈĀ4āĉ))

ĵĵĊĆąĥāĉ

((!* ,*!(ČĊĆą4ăĈĀ4āĉ))

**EP1200/900

Breakfast bar panel, 900x1200x18mm

ĵĵĂąĀĀĥĊĀĀ

ǫ.!'"/0.,*!(ČĊĀĀ4ĂąĀĀ4āĉ))

**BGP900/18

T&G panel, 900x650x18mm

ĵĵĂą

Ē!* ,*!(ČĂąĀĀ4ćĆĀ4āĉ))

ĵĵĈĈąĥāĉ

Ē3((!* ,*!(ČĈĈą4ăĈĀ4āĉ))

ĵĵĊĆąĥāĉ

Ē3((!* ,*!(ČĊĆą4ăĈĀ4āĉ))

ĵĵĂą

(5%*#/$!("ČĂĉ4ĂąĀĀ4ăĂĆ))

xxxP30 Plinth, 3030x150x16mm

ÇÇ INDICATES GRAIN DIRECTION

**P30

Plinth, 150x3030x16mm

**CPS560

Curved plinth 150x300x560mm, unhanded

Edging tape

!01.!.+ü(!/ **BCB

**BP2000

**FP1500

**VE3

Un-glued veneer edging, 32x3000x0.8mm, not available in Sanded (BS)

Timber Accessories Bullnose profile corner block, unhanded, Ăĉ4Ĉą4āĂą))

***BR12

Bottle rack 58x1200x20mm (Natural Oak finish)

***PR12

Plate rack 336x1200x20mm (Natural Oak finish)

ǫ1((*+/!,.+"%(!ČĂĉ4ĂąĀĀ4Ĉą))

Frame Profile, 1500x36x20mm

Corbel (available in Sanded or Paint-to-Order only) Feature Posts **BFEP890

**DFEP1210

**CORBEL

Corbel, 175x115x155mm

**CORBP

Corbel back panel, 700x300x20mm

Base radius feature end, 890x50x100mm

Dresser radius feature end, 1210x50x100mm

Mantel Kits Only available in PTO (BX) and Sanded (BS) **TFEP2120

Tall radius feature end, 2120x50x100mm

**FP890

Floor pilaster, 890x50x85mm

**CP30

Corner post, 715x70x20mm (pair)

***SM1500

Shelf mantle kit

***OM1500

Over mantle kit

***FM1500

Full mantle kit

Care and maintenance kit CKPWSBN

1.17

Order Online www.pws.co.uk

Care and maintenance kit for Broadoak Natural


BROADOAK - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Floor pilaster, **FP890

ƫ+.*%!ČĵĵƫăĀħƫ+.*%!+.*!.(+'Č.%#$0$* Č ĵĵƫǫħ((. %1/"!01.!!* ČĵĵĂāĂĀ

Glazed door, **715CG

ą ++.,*0.51/%*#āĂąĆ4ĂĊĈ)) ++./ĨĵĵāĂăĩ

Tall wall doors, 895x297mm (**893)

Small curved door, **CD716 Curved plinth section, **CPS560

T: 01325 505599 (North) | 88 (South)

1.18


CLARENDON

6Year GUARANTEE

TIMBER IN-FRAME SHAKER (OVOLO OUTER FRAME)

Stocked Ranges

PRODUCT SPECIFICATION

Real Timber Veneer

Painted Finish

Paint-to-Order Service

STOCKED FINISHES

Bespoke Door Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Dust Grey

DOOR THICKNESS

5 piece door +*/0.10%+*ĥą piece outer frame with Ovolo detail Ĩý1/$&+%*0/ĩ

20mm DOOR FRAME 68mm

CENTRE PANEL EDGE DETAIL

10mm deep

Porcelain (YP)

Dust Grey (YD)

Egger - W1200

Egger - U732

Sanded (YS)

Suggested board matches for Egger shown below each door. See page 89 for full list.

Chamferred detail

SERVICE OPTIONS OUTER FRAME 36mm wide

BOTTOM RAIL 68mm

PRODUCT OVERVIEW $'!. *ġ".)!ġĆ,%!! ++.Čą,%!! DOOR FAMILY STYLE 2+(+".)!3%0$ý1/$&+%*0/ DOOR THICKNESS

20mm

SUBSTRATE

Solid Ash frame with Ash veneered MDF centre panel

FINISH

00%*0! Ĩ#.%*! ü*%/$ĩ

REVERSE

Painted as per front face (Sanded is 1*ü*%/$! ĩ

CERTIFICATION

Fira Gold

PRICE BAND

Paint-to-Order (YX) 15 working days 7 days remedial

Bespoke Door Service (YQBESPOKE) Sanded -15 working days Painted -20 working days

£ £ £ £ £

KEY FEATURES  Real timber In-frame Shaker with Ovolo outer frame detail  Contemporary narrow Shaker door design  Available in 2 stocked colours and 'ready-topaint' sanded, as well as our paint-to-order palette  An extensive range of feature doors and accessories  Bespoke door service available for tailored designs

Clarendon shown in Dust Grey

1.19

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#ÄŒ,(!/!1/!,.!ÄĄĂź4+ !"+. !/%.! Ăź*%/$Ĩ/$+3*%*,.!2%+1/,#!ÄŠ%*,(!+"ľľ

Door & Double Door Sets

Drawerline sets

Appliance Door Sets

Door Set 770x260mm (for use with small curved door

**DLS770X300

770x300mm

**ADS315X600

315x600mm

ľľ ĈĈĀąĀĀ

ĈĈĀ4ąĀĀ))

ľľƾąĆĆćĀĀ

ąĆĆ4ćĀĀ))

**DS770X300

770x300mm

ľľ ĈĈĀąĆĀ

ĈĈĀ4ąĆĀ))

ľľƾąĊĆćĀĀ

ąĊĆ4ćĀĀ))

**DS770X350

770x350mm

**DLS770X500

770x500mm

**ADS630X600

630x600mm

ľľĈĈĀąĀĀ

ĈĈĀ4ąĀĀ))

**DLS770X600

770x600mm

**ADS650X600

650x600mm

ľľĈĈĀąĆĀ

ĈĈĀ4ąĆĀ))

**DDLS770X800

770x800mm

**ADS830X600

830x600mm

**DS770X500

770x500mm

**DDLS770X900

770x900mm

**ADS910X600

910x600mm

**DS770X550

770x550mm

**DDLS770X1000

770x1000mm

**DS770X600

770x600mm

**DDS770X800

Double door set, 770x800mm

**DDS770X900

Double door set, 770x900mm

**PDS770X500

770x500mm

**DDS770X1000

Double door set, 770x1000mm

**PDS770X600

770x600mm

**DS950X300

950x300mm

**PDS770X800

770x800mm

ľľĊĆĀąĀĀ

ĊĆĀ4ąĀĀ))

**PDS770X900

770x900mm

ľľĊĆĀąĆĀ

ĊĆĀ4ąĆĀ))

**PDS770X1000

770x1000mm

**DS950X500

950x500mm **SPDS770X600

770x600mm (slab design)

**DS770X260

COMBINATION DOORS - For Internal Pullout

Drawer Pack sets

ľľƍĈćĉÄ Ä…Äˆ

Ĉćĉ4Ä Ä…Äˆ))ÄŒ for 150mm internal pullout (standard plinth)

O ĆŤĈćĉÄ Ä…Äˆ

Ĉćĉ4Ä Ä…Äˆ))ÄŒ for 150mm internal pullout (moulded plinth)

**CD768X297

768x297mm (standard plinth)

O

**DS950X550

950x550mm

**DS950X600

950x600mm

**DS1250X300

1250x300mm

ľľÄ ĂĆĀąĀĀ

Ä Ä‚Ä†Ä€4ąĀĀ))

**PDL770X500

770x500mm

**DS1250X500

1250x500mm

**PDL770X600

770x600mm

**DS1250X600

1250x600mm

**PDL770X800

770x800mm

**SPDS770X800

770x800mm (slab design)

YXCD768X297M

Fixed bottom rail

**ĆŤĈćĉąąĈ

Ĉćĉ4ąąĈ))Č (standard plinth)

ľľƍĈćĉąąĈ

Ĉćĉ4ąąĈ))Č (moulded plinth)

ľľƍĈćĉąĊĈ

Ĉćĉ4ąĊĈ))Č (standard plinth)

O ĆŤĈćĉąĊĈ

ľľÄ ąăĀăĀĀ

Ä Ä…ÄƒÄ€4ăĀĀ))

**PDL770X900

770x900mm

ľľÄ ąăĀąĀĀ

Ä Ä…ÄƒÄ€4ąĀĀ))

**PDL770X1000

770x1000mm

ľľÄ ąăĀĆĀĀ

Ä Ä…ÄƒÄ€4ĆĀĀ))

**SPDL770X600

770x600mm (slab design)

ľľÄ ąăĀćĀĀ

Ä Ä…ÄƒÄ€4ćĀĀ))

**DDS335X920

American fridge/freezer double door set, 335x920mm (36mm bottom stile)

**SPDL770X800

770x800mm (slab design)

**DDS515X920

**DS507X600

ľľĆąĆćĀĀ

ľľĆąĆĉĀĀ

Tall American fridge/freezer double door set, 515x920mm (36mm bottom stile)

Farmhouse sink double door set, ĆąĆ4ĉĀĀ))

Ĉćĉ4ąĊĈ))Č (moulded plinth)

**CD768X597

768x597mm, (standard plinth)

**CD768X597M

768x597mm, (moulded plinth)

- For Appliance/larder door ľľƍĊąĉĆĊĈ

2!*0.%))!.ÄĽĂź((!.

O

**OT115X600

Drawer front/ oven trimmer 115x600mm (slab)

**OT167X600

Built under oven drawer front, 167x600mm (combination slab door)

ĆŤĊąĉĆĊĈ

Ċąĉ4ĆĊĈ4ĂĀ)) (standard plinth)

Ċąĉ4ĆĊĈ4ĂĀ)) (moulded plinth)

Fixed bottom rail

**CD1006X597

Belfast sink door set, 507x600mm

Farmhouse sink door set, ĆąĆ4ćĀĀ))

Separate bottom rail

768x297mm, (moulded plinth)

Separate bottom rail

O YXCD1006X597M

1006x597x20mm (standard plinth)

1006x597x20mm (moulded plinth)

OAvailable on a leadtime

T: 01325 505599 (North) | 88 (South)

1.20


CLARENDON PRE-FIX CODES: Porcelain (YP), Dust Grey (YD), Sanded (YS), Paint-to-order (YX)

DOOR RANGE CONTENT CONTINUED

$!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵ

COMBINATION DOORS

- For Larder Pullout with 2x mid rail

- For Appliance/larder door ĵĵƫāĂąĆĂĊĈ

O ƫāĂąĆĂĊĈ

āĂąĆ4ĂĊĈ4ĂĀ)) (standard plinth)

**CD2018X297

āĂąĆ4ĂĊĈ4ĂĀ)) (moulded plinth)

O YXCD2018X297M

Fixed bottom rail

ĵĵƫāùƹĊĈ

O ƫāùƹĊĈ

āĂąĆ4ąĊĈ4ĂĀ)) (standard plinth)

āĂąĆ4ąĊĈ4ĂĀ)) (moulded plinth)

**CD2018X397

Separate bottom rail

O YXCD2018X397M

2018x297, (standard plinth)

FEATURE DOOR SETS Curved Door Set **CDS770X300

2018x297, (moulded plinth)

2018x397, (standard plinth)

Glazed Door Set ĵĵĈĈĀąĀĀ

Glazed door set, ĈĈĀ4ąĀĀ))

**GDS770X500

Glazed door set, 770x500mm

**GDS950X500

Glazed door set, 950x500mm

2018x397, (moulded plinth)

Separate bottom rail

- For Fridge Freezer door

ĵĵƫĂĀāĉąĊĈ

O ĵĵƫāĂąĆĆĊĈ

āĂąĆ4ĆĊĈ4ĂĀ)) (Standard plinth)

Fixed bottom rail

Curved door set, 770x300mm (for 300x300mm cabinet)

ĂĀāĉ4ąĊĈ4ĂĀ)) (standard plinth)

ƫĂĀāĉąĊĈ

ĂĀāĉ4ąĊĈ4ĂĀ)) (moulded plinth)

**CD2018X597

2018x597x20mm (standard plinth) **GDS1220X500

Glazed dresser door set, 1220x500mm (36mm bottom rail)

O O ƫāĂąĆĆĊĈ

āĂąĆ4ĆĊĈ4ĂĀ)) (Moulded plinth)

YXCD2018X597M Fixed bottom rail

2018x597x20mm (moulded plinth)

Separate bottom rail

- For Larder Pullout with 1x mid rail

ĵĵƫāąĂĆĆĊĈ

Pantry Door Set

āąĂĆ4ĆĊĈČ (standard plinth)

**DSP1220X1000

Pantry 2 door set, 1220x1000mm

**BPS1220X1200

*0.5ą ++./!0Č 1220x1200mm

Fixed bottom rail

Corner Door Set

O ƫāąĂĆĆĊĈ

ĵĵǫƫĈĈĀăąĀ

Base corner door /!0ČĈĈĀ4ăąĀ)) (pair)

**WCU770X300

Wall corner door set, 770x300mm (pair)

**WCU950X300

Tall wall corner door set, 950x300mm (pair)

āąĂĆ4ĆĊĈČ (moulded plinth)

Separate bottom rail

OAvailable on a leadtime Please note, all Moulded plinth versions are available in sanded and paint to order.

1.21

Order Online www.pws.co.uk

ĵĵāąĀĀĆĀĀ

Glazed dresser door set, āąĀĀ4ĆĀĀ))


ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice

Feature Posts **C30S

Shaker cornice, 108x3030x70mm

**CBLS

Shaker cornice corner block, left hand, 133x108x72mm

**CBRS

Shaker cornice corner block, right hand, 133x108x72mm

**CCS300S

Shaker curved cornice, 36.5x300x300mm, unhanded (A)

**C30B

Beaded cornice, 108x3030x70mm

**CBLB

Beaded cornice corner block, left hand, 133x108x72mm

**CBRB

Beaded cornice corner block, right hand, 133x108x72mm

**CCS300B

Beaded curved cornice, 36.5x300x300mm, unhanded (A)

Plinth **P30

**CPS560

Plinth, 150x3030x16mm

**TWCP30

Tall corner post, 950x70x20mm, pair

ľľĂąĀĀ

((. %1/"!01.!!* ČĂąĀĀ4ĈĆ4ĆĀ))

ľľĂąĀĀ

((/-1.!"!01.!!* ČĂąĀĀ4ĈĆ4ĆĀ))

End Panels **BEP900/18

Base end panel, 900x650x18mm

ľľÄˆÄˆÄ…ÄĽÄ Ä‰

((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľÄŠÄ†Ä…ÄĽÄ Ä‰

((((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

**EP25

* ,*!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

**BGP900/18

T&G Base end panel, 900x650x18mm

ľľÄˆÄˆÄ…ÄĽÄ Ä‰

Ä’((* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľÄŠÄ†Ä…ÄĽÄ Ä‰

Ä’((((* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

ľľĂą

Ä’* *!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

ľľĂąĀĀļĊĀĀ

ÇŤ.!'"/0.,*!(ĊĀĀ4ĂąĀĀ4Ä Ä‰))

Curved plinth section, 150x560x300mm, unhanded

**MP30CL

Classic moulded plinth, 132x3050x22mm

ÇÇ INDICATES GRAIN DIRECTION

**CPS560CL

Curved classic moulded plinth, 150x560x560mm, unhanded

Timber Accessories **PR12

Plate rack, 336x1200x20mm, Ĩ01.('ß*%/$Ċ

**BR12

Bottle rack, 58x1200x20mm Ĩ01.('ß*%/$Ċ

!01.!.+Ăź(!/ **FP1500

.)!.+Ăź(!Ä Ä†Ä€Ä€4ăć4Ä‚Ä€))

Timber accessories only available in Natural Oak Finish. Note: Use a stock colour prefix when ordering to complete the code **FP1500/68

.)!.+Ăź(!Ä Ä†Ä€Ä€4ćĉ4Ä‚Ä€))

**DR600

Dishwasher split rail 31x600x20mm

Edging tape **ET3

Un-glued veneer edging, 22x3000x0.6mm

T: 01325 505599 (North) | 88 (South)

1.22


CLARENDON - BESPOKE !!!$,.+ 1005,!"+.2%(%(%055 ++./05(!ċǫ!/,+'! ++./*!+. !.! 1* !.0$!,.!ġü4+ !YQBESPOKE To order a bespoke size, state the type of set required followed by the dimensions eg: ā4++.!0ąĊĀ4ćĆĈ)) Fixed Dimensions

Pan Drawer Set Height Min - 260mm

Height 4ġąĊĀ))

Width Min - 260mm

Width Max - 1250mm

258

Extra Tall Door Set Height Min - 830

Height 4ġāąăĀ

Width Min - 300

Width Max - 650mm

Oven Trimmer / Filler Height Min - 25mm Width Min - 300mm

Height Max - 175mm

Butlers Pantry 2 Door Set

Width Max - 1200mm

Double American Fridge Freezer Door Set (36mm bottom frame) Height Min - 300mm

Height Max - 550mm

Width Min - 600mm

Width Max - 1200mm

Height Max - 770mm

Width Min - 600mm

Width Max - 1200mm

Height 4ġāąĀĀ))

Width Min - 800mm

Width Max - 1200mm

ǫ10(!./*0.5ą++.!0

Double Door Set Height Min - 260mm

Height Min - 1210mm

Height Min - 1210mm

Height 4ġāąĀĀ))

-

Width Max - 1200mm

Combination Larder Door

526

Height Min - 2018mm

Height Max - 2200mm

Width Min - 290mm

Width Max - 650mm

ORDERING SPECIAL SIZES Bespoke sizes are available at 2 times the price of the next largest sanded/painted size. Specials are available in both sanded and painted process options.

Notes: • Please note the size stated on the order must be the overall size, including the outer frame • Special size door sets are not available in corner door sets or curved door sets • We are unable to alter the standard specification of the range • The frames of special sized door sets are not pre-drilled • Specials are not available in accessories • We reserve the right to decline a request to make a door set size where it is decided the size makes the item impractical for production or susceptible to future service faults. i.e. bowing

Order code: YQBESPOKE

31 DAYS*

LEADTIME PAINTED

Door Set Height Min - 315mm Width Min - 300mm

Height 4ġāąĀĀ)) Width Max - 650mm

526

Width Min - 260mm

Width Max - 700mm

Combination Larder Door Separate Bottom rail

526

Drawer Line Double Door -

Height 770mm

Width Min - 700mm

Width Max - 1200mm

Height Min - 2018mm

Height Max - 2200mm

Width Min - 290mm

Width Max - 650mm

526

Extra Tall Combination Door 2 Drawer set (slab) -

Height 770mm

Width Min - 300mm

Width Max - 1200mm

258

Height Min - 1210mm

Height āąăĀ))

Width Min - 300mm

Width Max - 650mm

2 Drawer set (shaker) Combination Door -

Height 770mm

Width Min - 300mm

Width Max - 1200mm

3 Drawer set (slab) -

Height 770mm

Width Min - 300mm

Width Max - 1200mm

3 Drawer set (shaker)

1.23

-

Height 770mm

Width Min - 300mm

Width Max - 1200mm

Order Online www.pws.co.uk

LEADTIME SANDED

Drawer Line set Height 770mm

23 DAYS*

Height Min - 300mm

Height 1700mm

Width %*ġāąĆ))

Width Max - 700mm

Slab design up to 250mm wide Combination Door Separate Bottom Rail Height Min - 300mm

Height 1700mm

Width %*ġāąĆ))

Width Max - 700mm

Slab design up to 250mm wide

*For orders placed before 12 noon, ! *!/ 510ġ+ûċ


CLARENDON - FEATURE GLAZED DOORS Please note: Clarendon Glazed doors are supplied with glass

(6! ++.!0Č!+.#%*ą,*! !/%#*

Glazed Door Set, single pane ăćĀąĀĀƫ

ăćĀ4ąĀĀ))/%*#(!,*!Č(!.#(6!

ăćĀąĀĀ

ăćĀ4ąĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

ăćĀąĆĀƫ

ăćĀ4ąĆĀ))/%*#(!,*!Č(!.#(6!

ăćĀąĆĀ

ăćĀ4ąĆĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

YQ360X500CG

360x500mm single pane, clear glazed

YQ360X500GG

ăćĀ4ĆĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

YQ360X600CG

360x600mm single pane, clear glazed

YQ360X600GG

ăćĀ4ćĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

ĈĈĀąĆĀƫ

ĈĈĀ4ąĆĀ))/%*#(!,*!Č(!.#(6!

ĈĈĀąĀĀ

ĈĈĀ4ąĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

YQ770X600CG

770x600mm single pane, clear glazed

ĈĈĀąĆĀ

ĈĈĀ4ąĆĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

ĊĆĀąĀĀƫ

ĊĆĀ4ąĀĀ))/%*#(!,*!Č(!.#(6!

YQ770X500GG

ĈĈĀ4ĆĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

ĊĆĀąĆĀƫ

ĊĆĀ4ąĆĀ))/%*#(!,*!Č(!.#(6!

YQ770X600GG

ĈĈĀ4ćĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

YQ950X500CG

950x500mm single pane, clear glazed

ĊĆĀąĀĀ

ĊĆĀ4ąĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

YQ950X600CG

950x600mm single pane, clear glazed

ĊĆĀąĆĀ

ĊĆĀ4ąĆĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

YQ950X500GG

ĊĆĀ4ĆĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

YQ950X600GG

ĊĆĀ4ćĀĀ))Č#!+.#%*#(6! Ĩą,*!/ĩ

Glazed Dresser Door Set, single pane (36mm bottom rail to sit on worktop) āĂāĀąĆĀƫ

āĂāĀ4ąĆĀ))/%*#(!,*!Č(!.#(6!

YQ1210X500CG

1210x500mm single pane, clear glazed

YQ1210X600CG

1210x600mm single pane, clear glazed

āĂāĀąĆĀ

āĂāĀ4ąĆĀ))#!+.#%*#(6! ĨāĀ,*!/ĩ

āĂĂĀąĆĀƫ

āĂĂĀ4ąĆĀ))/%*#(!,*!Č(!.#(6!

YQ1210X500GG

1210x500mm georgian glazed (10 panes)

YQ1220X600CG

1220x600mm single pane, clear glazed

YQ1210X600GG

1210x600mm georgian glazed (10 panes)

āăĊĀąĆĀƫ

āăĊĀ4ąĆĀ))/%*#(!,*!Č(!.#(6!

āĂĂĀąĆĀ

āĂĂĀ4ąĆĀ))#!+.#%*#(6! ĨāĀ panes)

YQ1390X500CG

1390x500mmsingle pane, clear glazed

YQ1220X500GG

1220x500mm georgian glazed (10 panes)

YQ1390X600CG

1390x600mm single pane, clear glazed

YQ1220X600GG

1220x600mm georgian glazed (10 panes)

āąĀĀąĆĀƫ

āąĀĀ4ąĆĀ))/%*#(!,*!Č(!.#(6! āăĊĀąĆĀ

āąĀĀćĀĀƫ

āąĀĀ4ćĀĀ))/%*#(!,*!Č(!.#(6!

āăĊĀ4ąĆĀ))#!+.#%*#(6! ĨāĀ panes)

YQ1390X500GG

1390x500mm georgian glazed (10 panes)

YQ1390X600GG

1390x600mm georgian glazed (10 panes)

āąĀĀąĆĀ

āąĀĀ4ąĆĀ))#!+.#%*#(6! ĨāĀ panes)

āąĀĀĆĀĀ

āąĀĀ4ĆĀĀ))#!+.#%*#(6! ĨāĀ panes)

āąĀĀćĀĀ

āąĀĀ4ćĀĀ))#!+.#%*#(6! ĨāĀ panes)

Tall Glazed Door Set ĊĆĀąĀĀƫƫ

ĊĆĀ4ąĀĀ))ČĂ,*!3%0$.+//.%(Č clear glazed

ĊĆĀąĆĀƫƫ

ĊĆĀ4ąĆĀ))ČĂ,*!3%0$.+//.%(Č clear glazed

YQ950X600CC

9506500mm, 2 pane with cross rail, clear glazed

Glazed Dreezer Door Set, Georgian 10 Pane Design (36mm bottom rail to sit on worktop)

Tall 1/3 Glazed Door Set ĊĆĀąĀĀƫ

ĊĆĀąĀĀ))Čāĥă(!.#(6! ČĂĥă/+(%

ĊĆĀąĆĀƫ

ĊĆĀąĆĀ))Čāĥă(!.#(6! ČĂĥă/+(%

YQ950X500CT

950X500mm, 1/3 clear glazed, 2/3 solid

YQ950X600CT

950X600mm, 1/3 clear glazed, 2/3 solid

T: 01325 505599 (North) | 88 (South)

āċĂą


CLARENDON - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Tall wall door set, 950x500mm (**DS950X500)

Tall 3 panel combination door, 2018x597mm (**CD2018X597)

American Fridge Freezer door set, 335x920mm (**DDS335X920)

Pantry 2 door set, 1200x1000mm (**DSP1220X1000)

1.25

Order Online www.pws.co.uk

Small curved door set, 770x300mm (**CDS770X300)


CLARENDON - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

%.+32! ++./!0ČąĊĆ4ćĀĀ))ĨĵĵƵąĊĆćĀĀĩ

((+)%*0%+* ++.3%0$.+//.%(/ČāąĂĆ4ĆĊĈ)) ĨĵĵƫāąĂĆĆĊĈĩ

Slab drawer set, 770x600mm (**SPDS770x600)

Combination door, 768x297mm (**CD768X297)

((((++./ČĉĊĆ4ĊĊĈ))ĨĵĵĉĊĆĩČ3.,,! 3%0$!* ,*!(ČĂąĀĀ4ĊĀĀ4āĉ))ĨĵĵĂąĀĀĥĊĀĀĩ

T: 01325 505599 (North) | 88 (South)

1.26


ELLERTON

6Year GUARANTEE

SMOOTH PAINTED HANDLELESS SHAKER

PRODUCT SPECIFICATION

Stocked Ranges

Painted Finish

Paint-to-Order Service

STOCKED FINISHES

Handleless Rail Sizes

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Paint-to-Order Partridge Grey

1 piece door construction (routered shallow centre panel) with reverse 'scalloped' ,.+ü(!

DOOR THICKNESS 18mm DOOR FRAME

CENTRE PANEL

60mm

ą)) !!, EDGE DETAIL

Chalk (ELC) Egger - W980

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

 %1/,.+ü(!Č overpainted

PRODUCT OVERVIEW DOOR FAMILY STYLE

Handleless Shaker - 1 piece routered construction with reverse ŏ/((+,! $* (!ŏ,.+ü(!

DOOR THICKNESS

18mm

SUBSTRATE

HDF

FINISH

00,%*0! Ĩ/)++0$ü*%/$ĩ

Paint-to-Order (ELX)

Door Drilling Service

15 working days

2 working days

7 days remedial

Matching matt melamine reverse

REVERSE

(PtO - painted as per front face)

CERTIFICATION PRICE BAND

Fira Gold

£ £ £

KEY FEATURES  Handleless Shaker door with narrow frame and subtle centre panel  Reverse scalloped handle detail for use +*ý1/$.%(Ĩ+'+. ,%*0! ü*%/$ĩ  Quality, smooth-painted ü*%/$  Available from stock in Chalk and further paintto-order colours

Ellerton shown in Chalk with Rye rail trim

1.27

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

HORIZONTAL CHAMFER Drawer fronts (Slab)

Doors ***683

685x297mm

VERTICAL CHAMFER CONTINUED Doors

***116

115x597mm, filler (no chamfer)

ĵĵĵćĉą

685x397mm

***163

160x297mm

***685

ćĉĆ4ąĊĈ))

***713VH

715x297mm

ĵĵĵāćą

160x397mm

ĵĵĵćĉĆāąĈ

ćĉĆ4āąĈ))

ĵĵĵĈāąƬ

715x397mm

ĵĵĵāćĀąąĈ

āćĀ4ąąĈ))

ĵĵĵćĉĆăąĈ

ćĉĆ4ăąĈ))

***715VH

ĈāĆ4ąĊĈ))

***165

āćĀ4ąĊĈ))

ĵĵĵćĉĆąąĈ

ćĉĆ4ąąĈ))

***716VH

715x597mm

***166

160x597mm

***686

685x597mm

***893VH

895x297mm

***168

160x797mm

***CDS

***895VH

ĉĊĆ4ąĊĈ))

***169

160x897mm

685x315x18mm, corner door solution, pair

***896VH

895x597mm

***160

160x997mm

***WCDS

715x271x18mm, wall corner door solution, pair

***986VH

980x597mm

***713

715x297mm

ĵĵĵĈāą

715x397mm

Larder doors ***123VH

āĂąĆ4ĂĊĈ))

ĵĵĵāĂą

āĂąĆ4ăĊĈ))

***125VH

āĂąĆ4ąĊĈ))

***126VH

āĂąĆ4ĆĊĈ))

***193VHL

1965x297mm, left hand

***196VHL

1965x597mm, left hand

***193VHR

1965x297mm, right hand

***196VHR

1965x597mm, right hand

Drawer fronts (Shaker) ***325

ăĂĆ4ąĊĈ))Ƭ

***715

ĈāĆ4ąĊĈ))

***326

ăĂĆ4ĆĊĈ))Ƭ

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

***328

ăĂĆ4ĈĊĈ))Ƭ

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***329

ăĂĆ4ĉĊĈ))Ƭ

***716

715x597mm

***320

325x997mm

***893

895x297mm

ĵĵĵĉĊą

895x397mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***895

ĉĊĆ4ąĊĈ))

***896

895x597mm

Doors / drawers front ***353SAMPLE

355x297mm, sample

***355

ăĆĆ4ąĊĈ))Ƭ

***355NH

ăĆĆ4ąĊĈ)) (no chamfer for bi-fold door)

***356

ăĆĆ4ĆĊĈ))Ƭ

***356NH

355x597mm (no chamfer for bi-fold door)

***358

ăĆĆ4ĈĊĈ))Ƭ

***358NH

355x797mm (no chamfer for bi-fold door)

***359

ăĆĆ4ĉĊĈ))Ƭ

***359NH

355x897mm (no chamfer for bi-fold door)

***350

ăĆĆ4ĊĊĈ))Ƭ

***350NH

355x997mm (no chamfer for bi-fold door)

ĵĵĵąĊĀąąĈ

ąĊĀ4ąąĈ))Ƭ

ĵĵĵąĊă

ąĊĀ4ĂĊĈ))Ƭ

ĵĵĵąĊą

ąĊĀ4ăĊĈ))Ƭ

ĵĵĵąĊĆ

ąĊĀ4ąĊĈ))Ƭ

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

ĵĵĵĆĈą

570x397mm

VERTICAL CHAMFER Drawer fronts (Slab) ***176VH

175x597mm

Drawer fronts (Shaker) ***286VH

283x597mm

FEATURE DOORS Doors / drawer fronts ***356VH

355x597mm

ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***576VH

570x597mm

ĵĵĵćąć

ćąĆ4ĆĊĈ))

Glazed door (Horizontal chamfer) ĵĵĵĈāą

715x397mm, clear glazed

***715FG

ĈāĆ4ąĊĈ))Č clear glazed

***895FG

ĉĊĆ4ąĊĈ))Č clear glazed

Indicates reverse handle direction

T: 01325 505599 (North) | 88 (South)

1.28


ELLERTON PRE-FIX CODES: Chalk (ELC), Paint-to-order (ELX)

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice

End Panels ***C30

***MC30

***BEP900/18

Base end panel 900x650x18mm

ľľľÄˆÄˆÄ…ÄĽÄ Ä‰

((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľľÄŠÄ†Ä…ÄĽÄ Ä‰

((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

***EP25

* ,*!(ĂąĀĀ4ćĆĀ4Ä Ä‰))

***BBEP1200

Breakfast bar end panel, 685x1200x18mm

Cornice 3050x90x115mm

Modern cornice/light pelmet 3050x50x28mm

Plinth xxxP30 Plinth, 3030x150x16mm

***P30

Plinth 3050x150x16mm

Edging tape !01.!+/0/ļ.+ß(! ľľľĂąĀĀ

***ET3

Veneer edging tape, unglued, 22x3000x0.8mm

Tall square feature end ,+/0ĂąĀĀ4Ä Ä€Ä€4ĆĀ))

Timber Accessories ***CP30B

Internal base corner post, 685x70x18mm (Pre-assembled with chamfer)

***CP30W

Internal corner post 895x70x18mm, pre-assembled with chamfer profile (cut to size for 715 wall doors)

***BR12

Bottle rack 1200x58x20 (Natural oak finish)

***PR12

Plate rack 1200x336 (Natural oak finish)

Timber accessories only available in Natural Oak Finsh. Note: Use a stock colour prefix when ordering to complete the code

***ECP685

External base corner post, ćĉĆ4ąć4ąć))Ĩ3%0$$)"!.Ċ

Corbel (available in paint-to-order only) ***FP1500

ELXCTCORBEL

Frame profile 1500x36x18mm

Shelf corbel, contemporary style, Ä ÄŠÄ‚4Ä ÄˆÄ‚4ąĆ))ÄŒ,%*0!

KEY FEATURES ĆŤ+ !//00! .!/1Ăž4+ !/Ä‹.!Ăź4+ !"+. ++..*#!ÄĽ+(+1.)1/0!1/! 3$!*+. !.%*#Ä‹

Modern cornice/light pelmet 3050x50x28mm, (**MC30) Cornice 3050x90x115mm, (**C30)

1.29

!.0%(.%(,.+Ăź(! *0!.)! %0!Ä‹ ăĀĀĀ4ÄˆÄ 4Ä…Ä ))ÄŒĨľľÄ ăĀĀĀĊ

Order Online www.pws.co.uk

(0$+.%6+*0(.%(,.+Ăź(!"+. 3000x57x26.5mm, (**TP3000RYE)

Tall square feature end post ĂąĀĀ4Ä Ä€Ä€4ĆĀ))ÄŒĨľľĂąĀĀĊČ Cornice 3050x90x115mm, (**C30)


FLUSH HANDLELESS RAIL SYSTEM

RAIL FINISHES

Chalk (ELC)

.!ü4+ !/$+3*!(+30$!ü*%/$

Rye (RYE SUFFIX)

Paint-to-order (ELX)

MID PROFILE

TOP PROFILE

Flat Horizontal rail

Flat Horizontal rail

VERTICAL RAIL PROFILE

VERTICAL RAIL PROFILE

Intermediate

Used between cabinet and feature end post or panel.

(1/$$* (!(!//.%(,.+ü(!/ TOP profile ***TP3000

Flat horizontal rail for base units for use with chamfer door 3000x57x26.5mm TOP profile

***TP3000RYE

Flat horizontal rail for base units for use with chamfer door 3000x57x26.5mm, RYE OAK

***VPL3000

Vertical rail profile lateral ăĀĀĀ4Ćă4ąā))

***VPL3000RYE

Vertical rail profile lateral ăĀĀĀ4Ćă4ąā))ČRYE OAK

***VPI3000

Vertical rail profile Intermediate. ăĀĀĀ4Ĉā4ąā))

***VPI3000RYE

Vertical rail profile Intermediate. ăĀĀĀ4Ĉā4ąā))ČRYE OAK

MID profile ***MP3000

Flat horizontal rail for drawers for use with chamfer door 3000x72x26.5mm MID profile

***MP3000RYE

Flat horizontal rail for drawers for use with chamfer door 3000x72x26.5mm, RYE OAK

T: 01325 505599 (North) | 88 (South)

1.30


FITZROY

6Year GUARANTEE

SMOOTH PAINTED SHAKER

Stocked Ranges

PRODUCT SPECIFICATION

Painted Finish

Paint-to-Order Service

STOCKED FINISHES

Bespoke Door Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Hartforth Blue

DOOR THICKNESS

1 piece door construction (routered)

18mm

DOOR FRAME

CENTRE PANEL

110mm

Porcelain (FZP)

Stone (FZS)

Dove Grey (FZV)

Egger - W1200

Egger - U201

Egger - U708

Dust Grey (FZU)

Graphite (FZR)

Hartforth Blue (FZB)

Egger - U732

Egger - U961

Partridge grey (FZG)

8mm deep

EDGE DETAIL  %1/,.+ü(!Č overpainted

PRODUCT OVERVIEW DOOR FAMILY STYLE

Shaker - 1 piece routered construction

DOOR THICKNESS

18mm

SUBSTRATE

HDF

FINISH

00,%*0! Ĩ/)++0$ü*%/$ĩ Matching matt melamine reverse

REVERSE

(PtO - painted as per front face)

CERTIFICATION PRICE BAND

Fira Gold

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

Paint-to-Order (FZX)

Door Drilling Service

15 working days

2 working days

7 days remedial

Bespoke Door Service (FZQBESPOKE) 35 working days

£ £ £

KEY FEATURES  Single piece Shaker door in classic proportions  Quality, smooth matt ,%*0! ü*%/$  High density board (HDF) for extra rigidity  Available from stock in 7 colours and our full paint-to-order palette  Extremely versatile range content allowing a classic or modern look  NEW Bespoke Door Service for additional !/%#*ý!4%%(%05

Fitzroy shown in Hartforth Blue, Partridge Grey and Slate

1.31

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Drawer fronts (Slab) ***116

115x597mm

ĵĵĵāąă

139x297mm

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

139x597mm

ĵĵĵāąĉ

Doors

FEATURE DOORS Curved door ĵĵĵĈāĆāąĈ

ĈāĆ4āąĈ))Ĩ/(ĩ ***CD716

***WCDS

715x277x18mm Wall corner door, solution, pair

***CDS

715x315x18mm corner door solution pair

139x797mm

***715X257

715x257mm

ĵĵĵāąĊ

139x897mm

***713

715x297

ĵĵĵāąĀ

139x997mm

***715X325

715x325mm

ĵĵĵāĈą

175x397mm

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

***175

āĈĆ4ąĊĈ))

ĵĵĵĈāą

715x397mm

***176

175x597mm

Drawer fronts (Shaker)

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***715

ĈāĆ4ąĊĈ))

ĵĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ))

***285

Ăĉă4ąĊĈ))

***716

715x597mm

***286

283x597mm

***893

895x297mm

***288

283x797mm

ĵĵĵĉĊą

895x397mm

***289

283x897mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***280

283x997mm

***895

ĉĊĆ4ąĊĈ))

***896

895x597mm

***986

980x597mm

Doors / drawer fronts ***353

355x297mm

***355

ăĆĆ4ąĊĈ))

***356

355x597mm

***358

355x797mm

***359

355x897mm

***350

355x997mm

ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵĵąĊą

ąĊĀ4ăĊĈ))

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***573

570x297mm

ĵĵĵĆĈą

570x397mm

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

ĵĵĵćąć

ćąĆ4ĆĊĈ))

715x300mm small curved door

Glazed doors ĵĵĵăĂą

320x397mm, clear glazed

***325FG

ăĂĀ4ąĊĈ))Č(!. glazed

ĵĵĵĈāą

715x397mm, clear glazed

***715FG

ĈāĆ4ąĊĈ))Č(!. glazed

***895FG

ĉĊĆ4ąĊĈ))Č(!. glazed

Larder doors ***123

āĂąĆ4ĂĊĈ))

ĵĵĵāĂą

āĂąĆ4ăĊĈ))

***125

āĂąĆ4ąĊĈ))

***126

āĂąĆ4ĆĊĈ))

***193

1965x297mm (cross rail)

***196

1965x597mm (cross rail)

T: 01325 505599 (North) | 88 (South)

1.32


FITZROY

PRE-FIX CODES: Porcelain (FZP), Stone (FZS), Dove Grey (FZV), Partridge Grey (FZG), Dust Grey (FZU), Graphite (FZR), Hartforth Blue (FZB), Paint-to-order (FZX)

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice/Lighting Pelmet

Feature Posts

***MC30

Modern Cornice / Light Pelmet, 50x3050x28mm

***CP30

Corner post, 715x70x18mm (pair)

***MCC300

Curved Modern Cornice / Light Pelmet, 1*$* ! ČĂĉ4ăąĆ4ăąĆ))

ľľľĂąĀĀ

Tall radius feature end post, ĂąĀĀ4Ä Ä€Ä€4ĆĀ))

***L30

L-Shaped Modern Light Pelmet, 50x3050x60mm

ľľľĂąĀĀ

Tall square feature end post, ĂąĀĀ4Ä Ä€Ä€4ĆĀ))

***CLS300

Curved L-Shape Modern Light Pelmet, 1*$* ! ČĆĀ4ăąĆ4ăąĆ))

***C30

Classic Cornice 90x3050x115mm

***CCS300

Curved Classic Cornice, unhanded, ĊĀ4ăąĆ4ăąĆ))

***CBL

Cornice Corner Block, 93x119x169mm, left hand

***CBR

Cornice Corner Block, 93x119x169mm, right hand

***CCB

"Radius Cornice Corner Block, unhanded, 93x87x87mm (for use with framed panels)"

End Panels ***BEP900/18

Base end panel, 900x650x18mm

ľľľĈĈą4Ä Ä‰

((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľľĊĆą4Ä Ä‰

((3((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

***EP25

* ,*!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

ľľľĂąĀĀĂĉ

* ,*!(ČĂąĀĀ4ćĆĀ4Ăĉ))

***FEP895X605

Framed Base end panel, 895x605x18mm

ľľľĈĈĂăąĆ

.)! ((!* ,*!(ÄŒĈĈĂ4ăąĆ4Ä Ä‰))

ľľľĊĆĂăąĆ

Framed Tall wall end panel, ĊĆĂ4ăąĆ4Ä Ä‰))

ľľľÄ Ä‚Ä Ä€ăąĆ

Framed Dresser end panel, Ä Ä‚Ä Ä€4ăąĆ4Ä Ä‰))

ľľľÄ‚Ä Ä…Ä†ćĀĆ

Framed Appliance end panel, Ä‚Ä Ä…Ä†4ćĀĆ4Ä Ä‰))ÄŒ(!"0$*

ľľľÄ‚Ä Ä…Ä†ćĀĆ

Framed Appliance end panel, Ä‚Ä Ä…Ä†4ćĀĆ4Ä Ä‰))ÄŒ.%#$0$*

ľľľĂą

Ä’* ,*!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

ľľľĂąĀĀļĊĀĀ

Breakfast bar end panel, Ĩ,(%*ÄŒ+0$/% !/ÄŠĊĀĀ4ĂąĀĀ4Ä Ä‰))

ľľľĂąĀĀļĊĀĀ

T&G Breakfast bar end panel, ĊĀĀ4ĂąĀĀ4Ä Ä‰))

Plinth ***P30

***CPS560

Plinth, 150x3050x16mm

Curved plinth, 150x560x300mm

!01.!.+Ăź(!/ ***FP1500

.)!,.+Ăź(!Ä Ä†Ä€Ä€4ăć4Ä Ä‰))

***BP2000

ÇŤ1((*+/!,.+Ăź(!ÄŒĂĉ4ĂĀĀĀ4Ĉą4))ÄŒ unhanded

***BCB

ÇŤ1((*+/!,.+Ăź(!+.*!.(+'ÄŒ Ăĉ4Ĉą4Ä Ä‚Ä…))ÄŒ1*$* !

Timber Accessories ***BR12

Bottle rack, 58x1200x20mm, Ĩ01.('ß*%/$Ċ

***PR12

Plate rack, 336x1200x20mm, Ĩ01.('ß*%/$Ċ

Edging Tape ***VE3

1.33

Order Online www.pws.co.uk

Veneer edging tape, 32x3000x0.8mm, unglued


Corbels & Shelving

Mantel Kits

***CORBEL

Corbel 175x115x155mm

ľľľĂą

(5%*#/$!("ĂąĀĀ4ăĂĆ4Ăĉ))

***CORBP

**SM1500

Shelf mantel kit

**OM1500

Over mantel kit

Corbel back panel 700x300x18mm

Full mantel kit **FM1500

**MTP1500

Mantel top panel 1500x250x18mm

*Please refer to technical section of www.pws.co.uk for full breakdown of components included in each mantel kit.

Contemporary Shelf corbel, Ä ÄŠÄ‚4Ä ÄˆÄ‚4ąĆ))Ä? FZXCTCORBEL

Available only in Paint-to-order

ĆŤ(//%$!("+.!(ÄŒÄ ÄŠÄ‚4Ä ÄˆÄ‚4ąĆ))Ä? FZXCLCORBEL

Available only in Paint-to-order

***SS137

Shelf Bracket, 175x50x137mm, Ĩ01.('ß*%/$Ċ

Tall radius feature end ľľĂąĀĀČĆŤ+.*%!+.*!.(+'ÄŒ **CBR

Over mantel kit solution - Corbels, ***OM1500

Base framed end panel, **FEP895X605

ĆŤ(!.#(6!  ++.ÄŒÄľÄľÄƒÄ‚Ä…ħĆŤ+.*%!. %1//! +.*!.(+'ÄŒľľƍƍǍ

Small curved door, **CD716 Curved plinth, **CPS560, curved l-shape light pelmet, 50x3050x60mm

T: 01325 505599 (North) | 88 (South)

Ä Ä‹ÄƒÄ…


FITZROY - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

.3!.(%*!/!.1*3%0$/-1.!"!01.!!* ,+/0/ĨĵĵĂąĀĀĩ

Shelf Mantel Kit (**SM1500)

!01.!(!.#(6!  ++.ČĈāĆ4ąĊĈ))ĨĵĵĈāĆĩ

1.35

Order Online www.pws.co.uk

355x800mm bi-fold doors (**358) framed with square feature post ĨĵĵĂąĀĀĩ*  ġ/$,! )+ !.*(%#$0,!()!0Ĩĵĵ ăĀĩ


FITZROY - BESPOKE !3"+.ĂĀĂĀČ0$!%06.+5.*#!+Ăť!./ÇŤ!/,+'!!.2%!Ä‹$%/+),.!$!*/%2!+Ăť!.%*#+),.%/!/+"Ä‚)%*!/,+'! options. 1. Standard Fitzory Bespoke, available for Drawers, Doors and Larder Doors and 2. Feature Glazed Bespoke, available on a lead-time in a range of set sizes.

STANDARD BESPOKE DOOR SIZES

Fixed dimension 715mm

DRAWER/FILLER (SLAB)

DRAWER (SHAKER)

 CHOOSE HEIGHT  CHOOSE WIDTH MIN

MAX

Height

115mm

282mm

Width

Ä Ä…Äˆ))

1197mm

DOOR (SHAKER)

 CHOOSE HEIGHT  CHOOSE WIDTH

TALL DOOR (2 PANEL)

 CHOOSE HEIGHT  CHOOSE WIDTH

MIN

MAX

Height

283mm

ąĆĀ))

Width

257mm

1197mm

 CHOOSE HEIGHT  CHOOSE WIDTH

MIN

MAX

Height

Ä…Ä†Ä ))

1500mm

Width

257mm

ćąĈ))

ƾ ƾǍ ħ  Available on a lead-time

MIN

MAX

Height

1501mm

Ä‚Ä Ä…Ä†))

Width

297mm

ćąĈ))

Please note: Frame only (no glazing provided)

Fitzroy bespoke glazed doors come without glass. Please use the below guidelines to order glass separately.

CLEAR GLAZED

1/2 CLEAR GLAZED

1/2 SOLID

1/3 CLEAR GLAZED

1/3 SOLID

SET SIZES

SET SIZES

SET SIZES

SET SIZES

SET SIZES

HEIGHT

HEIGHT

HEIGHT

HEIGHT

HEIGHT

WIDTH

WIDTH

WIDTH

355

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ąąĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

895

ăĊĈČąąĈČĆĊĈ

1061

ăĊĈČąąĈČąĊĈČĆĊĈ

1071

ăĊĈČąąĈČąĊĈČĆĊĈ

1215

895

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

895

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

1/3 Clear Glazed - Glass size

ăĊĈČąąĈČąĊĈČĆĊĈ

Clear Glazed - Glass size Glass width = Door width -210mm

1/2 Clear Glazed - Glass size 715mm Height Doors. Glass width = Door width – 210mm

715mm Height Doors. Glass width = Door width – 210mm Glass height = Door height –692.5mm

Glass height = Door height – 512.5mm

895mm Height Doors Glass width = Door width – 210mm Glass height = Door height – 602.5mm

Glass height = Door height – 210mm

How-to-order Fitzroy Bespoke doors The easiest way to order is on www.pws.co.uk To order bespoke sizes follow the following steps: Made-to-Order lead-times

35 DAYS*

LEADTIME *For orders placed before 12 noon, ! *!/ 510ĥ+Ýċ

The lead-times for Made-toOrder are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, in the form of  !(%2!.5 0!ÄŒ3%((!+*Ăź.)!  with each individual order acknowledgement

Ä Ä‹ *,10!/,+'!,.!Ăź4+ !Ä?

Code FZQBESPOKE

Description Fitzroy Bespoke size door

STEP 2. Choose door height/width (see size parameters above) STEP 3. Choose further options (where relevant) Ģ!Ä‹#Ä‹Ăź*%/$+(+1.ÄŒ ++. .%((%*#!0

T: 01325 505599 (North) | 88 (South)

1.36


HUNTON

6Year GUARANTEE

SMOOTH PAINTED NARROW SHAKER

PRODUCT SPECIFICATION

Stocked Ranges

Handleless Rail Sizes

Painted Finish

Paint-to-Order Service

STOCKED FINISHES

Bespoke Door Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Dust Grey

DOOR THICKNESS

1 piece door construction (routered)

18mm

DOOR FRAME

CENTRE PANEL

75mm

5mm deep

Porcelain (HUP)

Dust Grey (HUU)

Egger - W1200

Egger - U732

Hartforth Blue (HUB)

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

EDGE DETAIL  %1/,.+ü(!Č overpainted

PRODUCT OVERVIEW DOOR FAMILY STYLE

Narrow framed Shaker - 1 piece routered construction

DOOR THICKNESS

18mm

SUBSTRATE

HDF

FINISH

00,%*0! Ĩ/)++0$ü*%/$ĩ

Paint-to-Order (HUX)

Door Drilling Service

15 working days

2 working days

7 days remedial

Bespoke Door Service (HUQBESPOKE) 35 working days

Matching matt melamine reverse

REVERSE

(PtO - painted as per front face)

CERTIFICATION

Fira Gold

PRICE BAND

£ £ £

KEY FEATURES  Single piece Shaker door with narrow frame for a contemporary look An extensive range of feature door designs and accessories to suit either a classic or modern kitchen designs Quality, smooth matt ,%*0! ü*%/$ Available in 3 stocked colours and our full paint-to-order palette Bespoke door service including NEW glazed door options

Hunton shown in Hartforth Blue and Porcelain

1.37

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Drawer fronts (Slab) ***116

115x597mm

ĵĵĵāąă

139x297mm

Doors

FEATURE DOORS ĵĵĵćąć

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

ćąĆ4ĆĊĈ))

ĵĵĵĈāĆāąĈ

ĈāĆ4āąĈ)) (slab)

139x597mm

***713

715x297mm

ĵĵĵāąĉ

139x797mm

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

ĵĵĵāąĊ

139x897mm

ĵĵĵĈāą

715x397mm

ĵĵĵāąĀ

139x997mm

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

ĵĵĵāĈą

175x397mm

***715

ĈāĆ4ąĊĈ))

***175

āĈĆ4ąĊĈ))

ĵĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ))

***176

175x597mm

***716

715x597mm

***826

825x597mm with cross rail

Drawer fronts (Shaker) ***285

Ăĉă4ąĊĈ))

***893

895x297mm with cross rail

***286

283x597mm

ĵĵĵĉĊą

895x397mm with cross rail

***288

283x797mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ)) with cross rail

***895

ĉĊĆ4ąĊĈ)) with cross rail

***289

283x897mm

***280

283x997mm

***896

895x597mm with cross rail

***326

325x597mm

***896NC

895x597mm, (no cross rail)

ĵĵĵăăĆąĆĉ

ăăĆąĆĉ))Č American fridge freezer door

***986

980x597mm

***123

āĂąĆ4ĂĊĈ))

Drawer fronts/doors ***353SAMPLE ***355

355x297mm (sample door)

āĂąĆ4ăĊĈ))

***125

āĂąĆ4ąĊĈ))

***126

āĂąĆ4ĆĊĈ))

ĵĵĵāąĂĆĂĊĈ

āąĂĆ4ĂĊĈ)) with cross rail

ĵĵĵāąĂĆĆĊĈ

āąĂĆ4ĆĊĈ)) with cross rail

ăĆĆ4ąĊĈ))

***356

355x597mm

***358

355x797mm

***359

355x897mm

***350

355x997mm

***355X1197

355x1197mm

ĵĵĵąĀć

ĵĵĵāĂą

ąĀĀ4ĆĊĈ))

Larder doors ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

Doors

***193 ĵĵĵąĊą

ąĊĀ4ăĊĈ))Č double farmhouse door

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))Č farmhouse door

***573

570x297mm

ĵĵĵĆĈą

570x397mm

ĵĵĵĆĈĀąąĈ

***196

1965x297mm, (3 panel design, with 2 cross rails)

1965x597mm, (3 panel design, with 2 cross rails)

Corner door solutions ***WCDS

715x277x18mm Wall corner door solution, pair

***CDS

715x315x18mm corner door solution, pair

Glazed doors ĵĵĵĈāąƫ

715x397mm, clear glazed

***715CG

ĈāĆ4ąĊĈ))Č clear glazed

ĵĵĵāĂāĆąĊĈƫ

āĂāĆ4ąĊĈ))Č clear glazed dresser

***895CG

ĉĊĆ4ąĊĈ))Č clear glazed with cross rail

NEW Handleless sizes ***165

āćĀ4ąĊĈ))(slab)

***166

160x597mm (slab)

***168

160x797mm (slab)

***169

160x897mm (slab)

***160

160x997mm (slab)

***160X1197

160x1197mm (slab)

***325

ăĂĆ4ąĊĈ))

***326

325x597mm

***328

325x797mm

***329

325x897mm

***320

325x997mm

***325X1197

325x1197mm

ĵĵĵćĉĆāąĈ

ćĉĆ4āąĈ)) (slab)

***683

685x297mm

ĵĵĵćĉĆăąĈ

ćĉĆ4ăąĈ))

ĵĵĵćĉą

685x397mm

ĵĵĵćĉĆąąĈ

ćĉĆ4ąąĈ))

***685

ćĉĆ4ąĊĈ))

ĵĵĵćĉĆĆąĈ

ćĉĆ4ĆąĈ))

***686

685x597mm

***CDS685

685x315x18mm, corner door solution, pair

Hunton handleless doors are designed for use with +(.%(,.+ü(!/ġ/!!,#!"+.(%/0%*#/ċ

ĆĈĀ4ąąĈ))

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

T: 01325 505599 (North) | 88 (South)

1.38


HUNTON PRE-FIX CODES: Porcelain (HUP), Dust Grey (HUU), Hartforth Blue (HUB), Paint-to-order (HUX)

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice

End Panels ***C30

***CBL

Cornice corner block 169x119x93mm, left hand, for use with feature post

***CBR

Cornice corner block 169x119x93mm, right hand, for use with feature post

***MC30

Modern cornice/ light pelmet, 50x3050x28mm

***L30

Light pelmet, 50x3050x60mm (for use as wide framing section)

Plinth ***P30

***MP30CL

***BEP900/18

Base end panel, 900x650x18mm

ľľľÄˆÄˆÄ…ÄĽÄ Ä‰

((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľľÄŠÄ†Ä…ÄĽÄ Ä‰

((((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

***EP25

* ,*!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

ľľľĂąĀĀĂĉ

* ,*!(ČĂąĀĀ4ćĆĀ4Ăĉ))

ľľľĂą

Ä’* ,*!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

ľľľĂąĀĀļĊĀĀ

Breakfast bar back panel, ĊĀĀ4ĂąĀĀ4Ä Ä‰))ÄŒĨ,(%*ÄĽ,(%*ÄŠ

ľľľĂąĀĀļĊĀĀ

T&G Breakfast bar back panel, ĊĀĀ4ĂąĀĀ4Ä Ä‰))

Classic Cornice, 90x3050x115mm

Plinth, 150x3050x16mm

+1( ! ,(%*0$ÄŒÄ ÄƒÄ‚4ăĀĆĀ4Ä‚Ä…))ÄŒ classic style

Corbels & Shelving !01.!.+Ăź(!/ ***BP2000

ÇŤ1((*+/!,.+Ăź(!ÄŒĂĉ4ĂĀĀĀ4Ĉą4))

***BCB

ÇŤ1((*+/!,.+Ăź(!+.*!.(+'ÄŒ Ăĉ4Ĉą4Ä Ä‚Ä…4))ÄŒ1*$* !

***FP1500

.)!,.+Ăź(!ÄŒÄ Ä†Ä€Ä€4ăć4Ä Ä‰))

***CORBEL

Corbel 175x115x155mm

***CORBP

Corbel back panel 700x300x18mm

***MTP1500

Mantel top panel, 1500x250x18mm

ľľľĂą

(5%*#/$!("ĂąĀĀ4ăĂĆ4Ăĉ))

***CLCORBEL

Shelf corbel, classic style, Ä Ä‰Ä‰4Ä Ä‡Ä‰4ąĆ))

***CTCORBEL

Shelf corbel, contemporary style, Ä ÄŠÄ‚4Ä ÄˆÄ‚4ąĆ))

***SS137

Feature shelf bracket 137x190x50mm Ĩ01.(+'ß*%/$Ċ

Feature Posts ***CP30

ľľľĂąĀĀ

ľľľĂąĀĀ

Corner post, 715x70x18mm, pairs

Tall radius feature post, ĂąĀĀ4Ä Ä€Ä€4ĆĀ))

Tall square feature post, ĂąĀĀ4Ä Ä€Ä€4ĆĀ))

Mantel Kits ***OM1500

Over mantel - kit 1

***FM1500

Full mantel - kit 2

***SM1500

Shelf mantel - kit 3

Timber Accessories ***BR12

***PR12

Bottle rack, 58x1200x20mm, Ĩ01.(+'ß*%/$Ċ

Plate rack, 336x1200x20mm, Ĩ01.(+'ß*%/$Ċ

Edging Tape ***VE3

1.39

Order Online www.pws.co.uk

Veneer edging tape, unglued, 32x3000x0.8mm


NEW HANDLELESS ACCESSORIES Feature Posts

L-Shape / C-Shape End Panels

***ECP685

40!.*(+.*!.,+/0ČćĉĆ4ąć4ąć))Č (pre-assembled)

***CP30B

Base corner post, 685x70x18mm, slab profile, (pair)

***CP30H

Half height internal corner post, 325x70x70mm, (pre-assembled)

***ECP325

Half height external corner post, ăĂĆ4ąć4ąć))ČĨ,.!ġ//!)(! ĩ

***CP30TW

Tall wall internal corner post, 895x70x70mm, (pre-assembled)

Feature End Panels ***BEP900/12

Base feature end panel, 900x650x12mm

***WEP960/12

Wall feature end panel, 960x370x12mm (cut to size)

***EP25/12

(("!01.!!* ,*!(ČĂąĀĀ4ćĆĀ4āĂ))

***LEP325X650

L-Shape Half height Base feature end panel, 325x650x18mm

***LEP685X650

L-Shape Base feature end panel, 685x650x18mm

***CEP325X960

C-Shape Half Height Island (Wall & Base) feature end panel, 325x960x18mm

***CEP685X960

C-Shape Island (Wall & Base) feature end panel, 685x960x18mm

***CEP325X1200

C-Shape Half Height Base (Double) feature end panel, 325x1200x18mm

***CEP685X1200

C-Shape Base (Double) feature end panel, 685x1200x18mm

For handleless rails see page xx

***BBEP1200

Breakfast bar end panel, 685x1200x18mm

HUNTON - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Extra wide drawer pack, 355x1197mm (***355X1197)

Tall appliance door with cross rail, āąĂĆ4ĆĊĈ))ĨĵĵāąĂĆĆĊĈĩ

1((ġ+10 ++.ČĈāĆ4āąĈ))ĨĵĵĈāĆāąĈĩ

((/-1.!"!01.!,+/0ČĂąĀĀ4āĀĀ4ĆĀ))Č1/! +* %/(* * /!.1*"+.".!!/0* %*#"1.*%01.!!û!0 ĨĵĵĵĂąĀĀĩ

T: 01325 505599 (North) | 88 (South)

āċąĀ


HUNTON - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

((3(( ++.3%0$.+//.%(ČĉĊĆ4ąĊĈ)) (**895)

Ƶ,,(%*! ++.ČąĀĀ4ĆĊĈ))ĨĵĵąĀćĩ

L-shaped light pelmet, 50x30250x60mm (**L30)

Tall 3 panel door, 1965x597mm (***196)

Over Mantel Kit (**OM1500)

āċąā

Order Online www.pws.co.uk

1((ġ+10 ++.ČĈāĆ4āąĈ))ĨĵĵĈāĆāąĈĩ

1((ġ+10 ++.ČĈāĆ4āąĈ))ĨĵĵĈāĆāąĈĩ


HUNTON - BESPOKE !3"+.ĂĀĂĀČ0$!1*0+*.*#!+Ăť!./ÇŤ!/,+'!!.2%!Ä‹$%/+),.!$!*/%2!+Ăť!.%*#+),.%/!/+"Ä‚)%*!/,+'! options. 1. Standard Hunton Bespoke, available for Drawers, Doors and Larder Doors and 2. Feature Glazed Bespoke, available on a lead-time in a range of set sizes. Fixed dimension 565mm

STANDARD BESPOKE DOOR SIZES Fixed dimension 300mm

Fixed dimension 565mm

DRAWER/FILLER (SLAB)

DRAWER (SHAKER)

DOOR

TALL DOOR (2 PANEL)

 CHOOSE HEIGHT  CHOOSE WIDTH

 CHOOSE HEIGHT  CHOOSE WIDTH

 CHOOSE HEIGHT  CHOOSE WIDTH

 CHOOSE HEIGHT  CHOOSE WIDTH

MIN

MAX

MIN

MAX

Height

115mm

282mm

Height

283mm ąĆĀ))

Width

Ä Ä…Äˆ))

1197mm

Width

257mm

1197mm

 CHOOSE HEIGHT  CHOOSE WIDTH

MIN

MAX

Height

Ä…Ä†Ä ))

1500mm

Height

825mm 1500mm

Height

1501mm Ä‚Ä Ä…Ä†))

Width

257mm

ćąĈ))

Width

257mm

Width

297mm ćąĈ))

ƾ ƾǍ ħ 

MIN

LARDER DOOR (3 PANEL)

MAX

ćąĈ))

MIN

MAX

Please note: Frame only (no glazing provided)

Available on a lead-time

Hunton bespoke glazed doors come without glass. Please use the below guidelines to order glass separately.

CLEAR GLAZED

1/2 CLEAR GLAZED

1/2 SOLID

1/3 CLEAR GLAZED

1/3 SOLID

SET SIZES

SET SIZES

SET SIZES

SET SIZES

SET SIZES

HEIGHT

HEIGHT

HEIGHT

HEIGHT

HEIGHT

WIDTH

WIDTH

WIDTH

355

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ąąĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

895

ăĊĈČąąĈČĆĊĈ

1061

ăĊĈČąąĈČąĊĈČĆĊĈ

1071

ăĊĈČąąĈČąĊĈČĆĊĈ

895

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

895

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

1/3 Clear Glazed - Glass size

1215

1/2 Clear Glazed - Glass size 715mm Height Doors. (//3% 0$Ĺ“++.3% 0$ĢÄ Ä…Ä€))

715mm Height Doors. (//3% 0$Ĺ“++.3% 0$ĢÄ Ä…Ä€)) Glass height = Door height – 585mm

(//$!%#$0Ĺ“++.$!%#$0Ģąćă))

ăĊĈČąąĈČąĊĈČĆĊĈ

Clear Glazed - Glass size (//3% 0$Ĺ“++.3% 0$ÄĄÄ Ä…Ä€))

895mm Height Doors (//3% 0$Ĺ“++.3% 0$ĢÄ Ä…Ä€)) Glass height = Door height – 550mm

How-to-order Hunton Bespoke doors The easiest way to order is on www.pws.co.uk

(//$!%#$0Ĺ“++.$!%#$0ĢÄ Ä…Ä€))

To order bespoke sizes follow the following steps: Made-to-Order lead-times

35 DAYS*

LEADTIME

PAINTED *For orders placed before 12 noon, ! *!/ 510ĥ+Ýċ

The lead-times for Made-toOrder are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, in the form of  !(%2!.5 0!ÄŒ3%((!+*Ăź.)!  with each individual order acknowledgement

Ä Ä‹ *,10!/,+'!,.!Ăź4+ !Ä?

Code HUQBESPOKE

Description Hunton Bespoke size door

STEP 2. Choose door height/width (see size parameters above)

STEP 3. Choose further options (where relevant) Ģ!Ä‹#Ä‹Ăź*%/$+(+1.ÄŒ ++. .%((%*#!0

T: 01325 505599 (North) | 88 (South)

Ä Ä‹Ä…Ä‚


LICHFIELD

6Year GUARANTEE

TIMBER SHAKER (J-PULL HANDLE)

PRODUCT SPECIFICATION

Stocked Ranges

Real Timber

STOCKED FINISHES

Painted Finish

Paint-to-Order Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Paint-to-order Partridge Grey

5 piece shaker door construction Ĩý1/$&+%*0/ĩ3%0$ and Jpull handle

DOOR THICKNESS 20mm

Espresso (LFE)

DOOR FRAME CENTRE PANEL

18mm

3mm depth

Sanded (LFS)

Egger - U732

Suggested board matches for Egger shown below each door. See page 89 for full list.

EDGE DETAIL

SERVICE OPTIONS

Chamferred detail

PRODUCT OVERVIEW DOOR FAMILY STYLE

'Narrow frame' Shaker with J-pull handle ġĆ,%!!+*/0.10%+*3%0$ý1/$&+%*0/

DOOR THICKNESS

20mm

SUBSTRATE

Solid Ash frame with Ash veneered MDF centre panel

FINISH

Sanded/Stained/ Matt Painted Ĩ#.%*! ü*%/$ĩ

Paint-to-Order (LFX)

Door Drilling Service

15 working days

2 working days

7 days remedial

Painted as per front face

REVERSE

Ĩ/,.!//+ġ/0%*! .!2!./!Č/* ! ġ1*ü*%/$! ĩ

CERTIFICATION

Fira Gold

PRICE BAND

£ £ £ £

KEY FEATURES  5 piece real timber Shaker  %$ü!( ŏ/ü*!".)! and J-Pull handle add a modern take on the classic Shaker door  Available from stock in Espresso and ready-topaint sanded, as well as our full paint-to-order palette  Perfect to use across the entire kitchen or mixed as a feature with other doors such as Remo

%$ü!( /$+3*%*/,.!//+

āċąă

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Larder doors

Drawer fronts ***116S

115x597mm (slab design)

***573

570x297mm

115x597mm (hidden handle profile)

ĵĵĵĆĈą

570x397mm

***116

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

ĵĵĵćąć

ćąĆ4ĆĊĈ))

ĵĵĵĈāĆāąĈ

ĈāĆ4āąĈ))

***WCDS

ĈāĆ4ĂĈą4ĂĀ)) wall corner door solution, pair (supplied with profiled internal corner section)

***CDS

715x313x20mm base corner door solution, pair (supplied with profiled internal corner section)

***WCDS900

ĉĊĆ4ĂĈą4ĂĀ))Č Tall wall corner door solution, pair (supplied with profiled internal corner section)

355x297mm

***713

715x297mm

***355

ăĆĆ4ąĊĈ))

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

***356

355x597mm

ĵĵĵĈāą

715x397mm

***358

355x797mm

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***359

355x897mm

***715

ĈāĆ4ąĊĈ))

***350

355x997mm

***716

715x597mm

ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***893

895x297mm

***356NH

355x597mm (no Jpull profile for bi-fold)

ĵĵĵĉĊą

895x397mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***358NH

355x797mm (no Jpull profile for bi-fold)

***895

ĉĊĆ4ąĊĈ))

355x897mm (no Jpull profile for bi-fold)

***896

895x597mm

***359NH

***986

980x597mm

***350NH

355x997mm (no Jpull profile for bi-fold)

ĵĵĵāąă

139x297mm

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

139x597mm

ĵĵĵāąĉ

139x797mm

ĵĵĵāąĊ

139x897mm

ĵĵĵāąĀ

139x997mm

***175

āĈĆ4ąĊĈ))

***176

175x597mm

***285

Ăĉă4ąĊĈ))

***286

283x597mm

***288

283x797mm

***289

283x897mm

***280

283x997mm

āĂąĆ4ĂĊĈ))Č3%0$ hidden profile

***125C

āĂąĆ4ąĊĈ))Č3%0$ hidden profile

***126C

āĂąĆ4ĆĊĈ))Č3%0$ hidden profile

Doors

Doors /drawer fronts ***353SAMPLE

***123C

T: 01325 505599 (North) | 88 (South)

āċąą


LICHFIELD PRE-FIX CODES: Espresso (LFE), Sanded (LFS), Paint-to-order (LFX)

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice/Light Pelmet ***C30

***L30

End Panels ***BEP900/18

Base end panel, 900x650x18mm

ĵĵĵĈĈąĥāĉ

((!* ,*!(ČĈĈą4ăĈĀ4āĉ))

ĵĵĵĊĆąĥāĉ

((!* ,*!(ČĊĆą4ăĈĀ4āĉ))

***EP25

* ,*!(ČĂąĀĀ4ćĆĀ4āĉ))

ĵĵĵĂąĀĀĥĊĀĀ

Breakfast bar Back panel, ĊĀĀ4ĂąĀĀ4āĉ))

!01.!ƫ+.*%!ČĆĀ4ăĀĆĀ4Ċą))

Modern cornice/light pelmet, 50x3050x28mm

Plinth ***P30

Plinth, 150x3030x16mm

***EP1200/900

Breakfast bar end panel, 900x1200x18mm Sanded/Paint-to-order only

ÇÇ INDICATES GRAIN DIRECTION

!01.!.+ü(!/ ***CP30

Internal Corner post, 715x70x20mm, slab profile, supplied in pairs

***BCP

Internal base corner post, 715x70x20mm, pre-assembled (J-profile)

***WCP

Internal wall Corner Post 715x26x26mm, pre-assembled (J-profile)

***BECP720

External base corner post, 720x75x75mm, pre-assembled (J-profile)

***ECP900

External wall corner post, 900x75x75mm, pre-assembled (J-profile)

Edging Tape ***ET3

Feature Posts ***FP3000

āċąĆ

Appliance/larder feature end post, 3000x100x50mm

Order Online www.pws.co.uk

Veneer edging tape, un-glued, 22x3000x0.8mm


LICHFIELD - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Pre-assembled base corner post, ĈāĆ4ĈĀ4ĂĀČ$* (!,.+ü(!Ĩĵĵǫƫĩ

āĂąĆ4ĂĊĈ))(. !. ++.Č3%0$$%

!*,.+ü(!ĨĵĵāĂăƫĩ

%$ü!( Ě/ ,1(($* (!,.+ü(!* 40!.*(+.*!.,+/0"+./!1*%0/ (**BECP720)

Feature cornice, **C30

%$ü!( Ě/%*0.%0!".)!* * (!(!// ġ,.+ü(!#%2!)+ !.*! #!0+0$! traditional Shaker

āĂąĆ(. !. ++./3%0$$% !*,.+ü(!Ģ/$+3*%*ĆĊĈ))3% !ĨĵĵāĂćƫĩ and 297mm wide (**123C)

T: 01325 505599 (North) | 88 (South)

āċąć


MILBOURNE

6Year GUARANTEE

PAINTED FOIL SHAKER (WOODGRAIN EFFECT)

PRODUCT SPECIFICATION

Stocked Ranges

Woodgrain û!0

STOCKED FINISHES

Painted Finish

Paint-to-Order Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Dust Grey

DOOR THICKNESS

5 piece door construction (with V-grooves)

22mm

DOOR FRAME

CENTRE PANEL

115mm

Chalk (RDC)

Porcelain (RDN)

Alabaster Classic (RDA)

Almond (RDL)

Egger - W980

Egger - W1200

Egger - U104

Egger - U100

Stone (RDT)

Dove Grey (RDV)

Partridge Grey (RDP)

Egger - U201

Egger - U708

Sage (RDS)

11mm deep EDGE DETAIL 2mm edging with chamferred detail

NEW

PRODUCT OVERVIEW DOOR FAMILY STYLE

Shaker - 5 piece construction with v-grooves

DOOR THICKNESS

22mm

SUBSTRATE

MDF

FINISH

Porcelain - matt foil only Stock/PtO - matt foil painted

CERTIFICATION

Fira Gold

PRICE BAND

£ £

Dust Grey (RDD)

Hartforth Blue (RDB)

Egger - U732

Egger - U599

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

Charcoal (RDH)

Paint-to-Order (RDX)

Door Drilling Service

15 working days

2 working days

7 days remedial

KEY FEATURES  5 piece Shaker door with feature v-grooves  Incredibly authentic 3++ #.%*!û!0"+%(  Milbourne's quality matt ,%*0! ü*%/$ /!2!* more value and helps this door stand out from the crowd  NEW trend Hartforth Blue now available from stock  An extensive collection of 11 stocked door ranges and paint-toorder colours.

Milbourne shown in Dust Grey

āċąĈ

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Drawer fronts (Slab) ***116

115x597mm

ĵĵĵāąă

139x297mm

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

139x597mm

ĵĵĵāąĉ

FEATURE DOORS

Doors

Curved door ĵĵĵĈāĆāąĈ

ĈāĆ4āąĈ))Ĩ/(ĩ ***CD716

***WCDS

715x271x22mm, pair, wall corner door solution

***CDS

715x311x22mm, pair, base corner door solution

139x797mm

***715X257

715x257mm

ĵĵĵāąĊ

139x897mm

***713

715x297mm

ĵĵĵāąĀ

139x997mm

***715X325

715x325mm

***175S

āĈĆ4ąĊĈ))

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

***176S

175x597mm

ĵĵĵĈāą

715x397mm

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***715

ĈāĆ4ąĊĈ))

Drawer fronts (Shaker) ***285

Ăĉă4ąĊĈ))

ĵĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ))

***286

283x597mm

***716

715x597mm

***288

283x797mm

***893

895x297mm

***289

283x897mm

ĵĵĵĉĊą

895x397mm

***280

283x997mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***895

ĉĊĆ4ąĊĈ))

***896

895x597mm

***986

980x597mm

Doors / drawer fronts ***353

355x297mm

***355

ăĆĆ4ąĊĈ))

***356

355x597mm

***358

355x797mm

***359

355x897mm

***350

355x997mm

ĵĵĵąĆć

Small curved door 715x300mm

Glazed doors ĵĵĵĈāąƫ ĨĵĵĵĈāąĩ

715x397mm, clear glazed

***715CG (***715G)

ĈāĆ4ąĊĈ))Č clear glazed

***895CG (***895G)

ĉĊĆ4ąĊĈ))Č clear glazed

Please note: Codes for Milbourne Paint-to-order (RDX) are shown in brackets.

Larder doors ***123

āĂąĆ4ĂĊĈ))

ĵĵĵāĂą

āĂąĆ4ăĊĈ))

ąĆĀ4ĆĊĈ))

***125

āĂąĆ4ąĊĈ))

ĵĵĵąĊą

ąĊĀ4ăĊĈ))

***126

āĂąĆ4ĆĊĈ))

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***573

570x297mm 570x397mm (sample door)

***193

ĵĵĵĆĈą

1965x297mm with cross rail

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

***196

1965x597mm with cross rail

ĵĵĵćąć

ćąĆ4ĆĊĈ))

T: 01325 505599 (North) | 88 (South)

āċąĉ


MILBOURNE ACCESSORIES

PRE-FIX CODES: Chalk (RDC), Porcelain (RDN), Alabaster Classic (RDA), Almond (RDL), Sage (RDS), Stone (RDT), Dove Grey (RDV), Partridge Grey (RDP), Dust Grey (RDD), Hartforth Blue (RDB), Charcoal (RDH), Paint-to-Order (RDX)

All accessory sizes shown in !%#$04% 0$4!,0$

Cornice / Light Pelmet ***L30

Modern cornice/light pelmet, 50x3050x28mm

***C30

Classic Cornice, 90x3050x102mm

***CCS300

Classic Curved cornice section, unhanded, 90x350x350mm

***CLS300

End Panels ***BEP900/18

ÇŤ/!!* ,*!(3%0$,.+Ăź(! ".+*0! #!ÄŒ 900x610x18mm

ľľľÄˆÄˆÄ…ÄĽÄ Ä‰

((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľľÄŠÄ†Ä…ÄĽÄ Ä‰

((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

***EP25

* ,*!(ÄŒ3%0$,.+Ăź(! ".+*0! #!ÄŒ ĂąĀĀ4Ä‡Ä Ä€4Ä Ä‰))

***EP25/650

End panel, square edged, ĂąĀĀ4ćĆĀ4Ä Ä‰))

ľľľĂą

Ä’!* ,*!(ÄŒ3%0$,.+Ăź(! ".+*0! #!ÄŒ ĂąĀĀ4Ä‡Ä Ä€4Ä Ä‰)) (Not available in Porcelain)

Curved modern light pelmet 50x350x350mm

NEW

ľľľĂąĀĀļĊĀĀ

Plinth

Breakfast bar back panel ĊĀĀ4ĂąĀĀ4Ä Ä‰))ÄŒĨ,(%*ÄŠ

0x16mm

ÇÇ INDICATES GRAIN DIRECTION

***P30

Plinth, 150x3000x16mm

Timber Accessories ***CPS560

Curved plinth, 150x350x350mm ***BR12

Bottle rack 58x1200x20mm Ĩ%*0! ß*%/$Ċ

***PR12

Plate rack 336x1200x20mm Ĩ%*0! ß*%/$Ċ

!01.!.+Ăź(!/ ***FP1500

,!*1*%0".)!,.+Ăź(!Ä Ä†Ä€Ä€4ăć4Ä‚Ä‚))

Feature Posts ***CP30

Corner post, 715x70x22mm (pair)

NEW

***CP30TW

ľľľĂąĀĀ

Ä Ä‹Ä…ÄŠ

Tall wall internal corner post, 895x70x70mm (pair)

Tall square feature end post, ĂąĀĀ4ĈĆ4ĆĀ))

Order Online www.pws.co.uk


MILBOURNE - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Classic Cornice, (**C30) with Modern Light Pelmet (**L30)

1965x597mm Tall larder door with cross rail (**196)

Small curved door (**CD716) with (("!01.!!* ,+/0ĨĵĵĂąĀĀĩ

Plate Rack (**PR12)

ĈāĆ4ĆĊĈ)),1((ġ+10ĨĵĵĈāĆ4āąĈĩ

!01.!(6!  ++./ČĈāĆ4ąĊĈ))ĨĵĵĈāĆĩ

āĂąĆ4ĆĊĈ))/01 %+(. !. ++.ĨĵĵāĂćĩ

T: 01325 505599 (North) | 88 (South)

1.50


MORNINGTON BEADED

6Year GUARANTEE

Stocked Ranges

Real Timber

Painted Finish

Paint-to-Order Service

Bespoke Door Service

6 Year Guarantee

TIMBER BEADED SHAKER STOCKED FINISHES

PRODUCT SPECIFICATION

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Dove Grey

DOOR THICKNESS

5 piece door construction Ĩý1/$&+%*0/ĩ

20mm

DOOR FRAME

CENTRE PANEL

88mm (incl. 15mm bead)

Porcelain (MBP)

Stone (MBT)

Dove Grey (MBV)

Egger - W1200

Egger - U201

Egger - U708

Dust Grey (MBD)

Hartforth Blue (MBB)

Graphite (MBR)

Egger - U732

Egger - U599

Egger - U961

Partridge grey (MBY)

10mm deep

EDGE DETAIL Chamferred detail

PRODUCT OVERVIEW DOOR FAMILY STYLE

Shaker with internal beading Ć,%!!+*/0.10%+*3%0$ý1/$&+%*0/

DOOR THICKNESS

20mm

SUBSTRATE

Solid Ash frame with Ash veneered MDF centre panel

FINISH

00%*0! Ĩ#.%*! ü*%/$ĩ

REVERSE

Painted as per front face

CERTIFICATION

Fira Gold

PRICE BAND

£ £ £

Sanded (MBS)

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

Paint-to-Order (MBX)

Door Drilling Service

15 working days

2 working days

7 days remedial

Bespoke Door Service (MBQBESPOKE) Sanded 15 working days Painted 20 working days

KEY FEATURES  5 piece real timber Shaker with narrow frame and classic bead detail  A distinctive ash grained texture with quality matt +2!.,%*0! ü*%/$  Available in a warm and neutral palette of 7 colours in addition to paint-to-order  Incredibly versatile door family with a choice of modern and traditional accessories  NEW bespoke door service for maximum ý!4%%(%05

Mornington Beaded shown in paint-to-order Cashmere

1.51

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Drawer fronts (Slab) ***116

115x597mm

ĵĵĵāąă

139x297mm

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

139x597mm

ĵĵĵāąĉ

139x797mm

ĵĵĵāąĊ

139x897mm

ĵĵĵāąĀ

139x997mm

***175

āĈĆ4ąĊĈ))

***176

175x597mm

Drawer fronts (Shaker) ***285

Ăĉă4ąĊĈ))

***286

283x597mm

***288

283x797mm

***289

283x897mm

***280

283x997mm

FEATURE DOORS

Doors

Curved door ĵĵĵĈāĆāąĈ

***CD716

***WCDS

715x277x20mm Wall corner door solution, pair

***CDS

715x313x20mm Base corner door solution, pair

***715X257

715x257mm

***713

715x297mm

***715X325

715x325mm

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

ĵĵĵĈāą

715x397mm

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***715

ĈāĆ4ąĊĈ))

ĵĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ))

***716

715x597mm

***893

895x297mm

ĵĵĵĉĊą

895x397mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***895

ĉĊĆ4ąĊĈ))

***896

895x597mm

***986

980x597mm

Doors ***353SAMPLE

ĈāĆ4āąĈ))Ĩ/(ĩ Small curved door, 715x300mm

Glazed doors ĵĵĵĈāąƫ

715x397mm, clear glazed

***715CG

ĈāĆ4ąĊĈ))Č clear glazed

***895CG

ĉĊĆ4ąĊĈ))Č clear glazed

355x297mm

***355

ăĆĆ4ąĊĈ))

***356

355x597mm

***358

355x797mm

***359

355x897mm

***350

355x997mm

ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵĵąĊą

ąĊĀ4ăĊĈ))

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***573

570x297mm

ĵĵĵĆĈą

570x397mm

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

ĵĵĵćąć

ćąĆ4ĆĊĈ))

Larder doors ***123

āĂąĆ4ĂĊĈ))

ĵĵĵāĂą

āĂąĆ4ăĊĈ))

***125

āĂąĆ4ąĊĈ))

***126

āĂąĆ4ĆĊĈ))

***193

1965x297mm cross rail

***196

1965x597mm cross rail

T: 01325 505599 (North) | 88 (South)

1.52


MORNINGTON

PRE-FIX CODES BEADED: Porcelain (MBP), Stone (MBT), Dove Grey (MBV), Partridge Grey (MBY), Dust Grey (MBD), Hartforth Blue (MBB), Graphite (MBR), Sanded (MBS)

ACCESSORIES FOR BEADED All accessory sizes shown in !%#$04% 0$4!,0$

Cornice / Light Pelmet

End Panels **BEP900/18

**L30

Modern Cornice / Light pelmet, 50x3030x28mm

**CLS300

Modern Curved light pelmet, 50x300x300mm

**C30

Classic Cornice, 108x3030x70mm

**CCS300

Classic Curved cornice, 36.5x300x300mm

**CBL

Cornice corner block, left hand, 108x72x133mm

**CBR

Cornice corner block, right hand, 72x108x133mm

ľľÄˆÄˆÄ…ÄĽÄ Ä‰

((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľÄŠÄ†Ä…ÄĽÄ Ä‰

((3((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

**EP25

* ,*!(ÄŒĂź*%/$! ĂąĀĀ4ćĆĀ4Ä Ä‰))

**BGP900/18

T&G End panel, 900x650x18mm

ľľÄˆÄˆÄ…ÄĽÄ Ä‰

Ä’((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľÄŠÄ†Ä…ÄĽÄ Ä‰

Ä’((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

ľľĂą

Ä’* ,*!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

**EP1200/900

ľľĂąĀĀļĊĀĀ

Plinth **P30

Plinth, 150x3030x16mm

Base end panel, 900x650x18mm

Breakfast bar end panel, 900x1200x18mm

Breakfast bar Back panel, ĊĀĀ4ĂąĀĀ4Ä Ä‰))

ÇÇ INDICATES GRAIN DIRECTION

Corbels & Shelving Only available in PTO (MBX/MGX) and Sanded (MBS/MGS) **CPS560

Curved plinth, 150x300x560mm

!01.!.+Ăź(!/ **FP1500

Mantel top panel 250X1500X20mm

***MSP1355

Mantel side panel 1355X300X20mm

***CORBEL

Corbel, 175X115X155mm

ľľľĂą

(5%*#/$!("ČĂĉ4ĂąĀĀ4ăĂĆ))

.)!.+Ăź(!Ä Ä†Ä€Ä€4ăć4Ä‚Ä€))

Feature Posts **CP30

***MTP1500

Corner post, 715x70x20mm (pair)

Mantel Kits Only available in PTO (MBX) and Sanded (MBS)

ľľĂąĀĀ

ľľĂąĀĀ

***SM1500

Shelf mantle kit

***OM1500

Over mantle kit

***CM1500

Cladding mantle kit

((/-1.!"!01.!!* ČĂąĀĀ4ĈĆ4ĆĀ))

((. %1/"!01.!!* ČĂąĀĀ4ĈĆ4ĆĀ))

Timber Accessories **BR12

Bottle rack, 1200x58x20mm, Ĩ01.('ß*%/$Ċ

**PR12

Plate rack, 1200x336mm, Ĩ01.('ß*%/$Ċ

Edging Tape **ET3

1.53

Order Online www.pws.co.uk

Veneer edging, un-glued, 22x3000x0.8mm


MORNINGTON BEADED - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Classic Cornice, 130x3030x36.5mm, (**C30)

Mornington Beaded door detail

Small Curved Door (**CD716)

½ Georgian Glazed door, 715x597mm, (**715X597GH), Bespoke Door Service

ĈāĆ4ąĊĈ))(6!  ++.ĨĵĵĈāĆƫĩ

((/-1.!"!01.!,+/0ČĂąĀĀ4ĈĆ4ĆĀ))ĨĵĵĂąĀĀĩ

((((++./ĉĊĆ4ăĊĈ))ĨĵĵĉĊąĩ

T: 01325 505599 (North) | 88 (South)

āċĆą


MORNINGTON SHAKER

6Year GUARANTEE

Stocked Ranges

Real Timber

Painted Finish

Paint-to-Order Service

Bespoke Door Service

6 Year Guarantee

TIMBER SHAKER PRODUCT SPECIFICATION

STOCKED FINISHES

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Partridge Grey

DOOR THICKNESS

5 piece door construction Ĩý1/$&+%*0/ĩ

20mm

DOOR FRAME

CENTRE PANEL

88mm

10mm deep

Porcelain (MGP)

Stone (MGT)

Dove Grey (MGV)

Egger - W1200

Egger - U201

Egger - U708

Dust Grey (MGD)

Hartforth Blue (MGB)

Graphite (MGR)

Egger - U732

Egger - U599

Egger - U961

Partridge grey (MGY)

EDGE DETAIL Chamferred detail

PRODUCT OVERVIEW DOOR FAMILY STYLE

Shaker - 5 piece construction 3%0$ý1/$&+%*0/

DOOR THICKNESS

20mm

SUBSTRATE

Solid Ash frame with Ash veneered MDF centre panel

FINISH

00%*0! Ĩ#.%*! ü*%/$ĩ

REVERSE

Painted as per front face

CERTIFICATION

Fira Gold

PRICE BAND

£ £ £

Sanded (MGS)

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

Paint-to-Order (MGX)

Door Drilling Service

15 working days

2 working days

7 days remedial

Bespoke Door Service (MGQBESPOKE) Sanded 15 working days Painted 20 working days

KEY FEATURES  5 piece real timber Shaker with narrow frame for a modern look  A distinctive ash grained texture with quality matt +2!.,%*0! ü*%/$  Available in a warm and neutral palette of 7 colours in addition to paint-to-order  Incredibly versatile door family with a choice of modern and traditional accessories  NEW bespoke door service for maximum ý!4%%(%05

Mornington Shaker shown in Hartforth Blue

1.55

Order Online www.pws.co.uk


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Drawer fronts (Slab) ***116

115x597mm

ĵĵĵāąă

139x297mm

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

139x597mm

ĵĵĵāąĉ

139x797mm

ĵĵĵāąĊ

139x897mm

ĵĵĵāąĀ

139x997mm

***175

āĈĆ4ąĊĈ))

***176

175x597mm

Drawer fronts (Shaker) ***285

Ăĉă4ąĊĈ))

***286

283x597mm

***288

283x797mm

***289

283x897mm

***280

283x997mm

Doors

FEATURE DOORS Curved door ĵĵĵĈāĆāąĈ

***CD716

***WCDS

715x277x20mm Wall corner door solution, pair

***CDS

715x313x20mm Base corner door solution, pair

***715X257

715x257mm

***713

715x297mm

***715X325

715x325mm

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

ĵĵĵĈāą

715x397mm

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***715

ĈāĆ4ąĊĈ))

ĵĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ))

***716

715x597mm

***893

895x297mm

ĵĵĵĉĊą

895x397mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***895

ĉĊĆ4ąĊĈ))

***896

895x597mm

***986

980x597mm

Drawer fronts/ Doors ***353SAMPLE

355x297mm

***355

ăĆĆ4ąĊĈ))

***356

355x597mm

***358

355x797mm

***359

355x897mm

***350

355x997mm

ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵĵąĊą

ąĊĀ4ăĊĈ))

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***573

570x297mm

ĵĵĵĆĈą

570x397mm

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

ĵĵĵćąć

ćąĆ4ĆĊĈ))

ĈāĆ4āąĈ))Ĩ/(ĩ Small curved door 715x300mm

Glazed doors ĵĵĵĈāąƫ

715x397mm, clear glazed

***715CG

ĈāĆ4ąĊĈ))Č clear glazed

***895CG

ĉĊĆ4ąĊĈ))Č clear glazed

Larder doors ***123

āĂąĆ4ĂĊĈ))

ĵĵĵāĂą

āĂąĆ4ăĊĈ))

***125

āĂąĆ4ąĊĈ))

***126

āĂąĆ4ĆĊĈ))

***193

1965x297mm cross rail

***196

1965x597mm cross rail

T: 01325 505599 (North) | 88 (South)

1.56


MORNINGTON

PRE-FIX CODES (SHAKER): Porcelain (MGP), Stone (MGT), Dove Grey (MGV), Partridge Grey (MGY), Dust Grey (MGD), Hartforth Blue (MGB), Graphite (MGR), Sanded (MGS)

ACCESSORIES FOR SHAKER All accessory sizes shown in !%#$04% 0$4!,0$

Cornice / Light Pelmet

End Panels **BEP900/18

**L30

Modern Cornice / Light pelmet, 50x3030x28mm

**CLS300

Modern Curved light pelmet, 50x300x300mm

**C30

Classic Cornice, 108x3030x70mm

**CCS300

Classic Curved cornice, 36.5x300x300mm

**CBL

Cornice corner block, left hand, 108x72x133mm

**CBR

Cornice corner block, right hand, 72x108x133mm

Base end panel, 900x650x18mm

ľľÄˆÄˆÄ…ÄĽÄ Ä‰

((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľÄŠÄ†Ä…ÄĽÄ Ä‰

((3((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

**EP25

* ,*!(ÄŒĂź*%/$! ĂąĀĀ4ćĆĀ4Ä Ä‰))

**BGP900/18

T&G End panel, 900x650x18mm

ľľÄˆÄˆÄ…ÄĽÄ Ä‰

Ä’((!* ,*!(ÄŒĈĈą4ăĈĀ4Ä Ä‰))

ľľÄŠÄ†Ä…ÄĽÄ Ä‰

Ä’((!* ,*!(ÄŒĊĆą4ăĈĀ4Ä Ä‰))

ľľĂą

Ä’* ,*!(ÄŒĂąĀĀ4ćĆĀ4Ä Ä‰))

**EP1200/900

ľľĂąĀĀļĊĀĀ

Plinth

Breakfast bar end panel, 900x1200x18mm

Breakfast bar Back panel, ĊĀĀ4ĂąĀĀ4Ä Ä‰))

ÇÇ INDICATES GRAIN DIRECTION

**P30

Plinth, 150x3030x16mm

Corbels & Shelving Only available in PTO (MBX/MGX) and Sanded (MBS/MGS) **CPS560

Curved plinth, 150x300x560mm

!01.!.+Ăź(!/ **FP1500

.)!.+Ăź(!Ä Ä†Ä€Ä€4ăć4Ä‚Ä€))

***MTP1500

Mantel top panel 250X1500X20mm

***MSP1355

Mantel side panel 1355X300X20mm

***CORBEL

Corbel, 175X115X155mm

ľľľĂą

(5%*#/$!("ČĂĉ4ĂąĀĀ4ăĂĆ))

Feature Posts Mantel Kits **CP30

ľľĂąĀĀ

ľľĂąĀĀ

Corner post, 715x70x20mm (pair)

Only available in PTO (MGX) and Sanded (MGS) ***SM1500

Shelf mantle kit

***OM1500

Over mantle kit

***CM1500

Cladding mantle kit

((/-1.!"!01.!!* ČĂąĀĀ4ĈĆ4ĆĀ))

((. %1/"!01.!!* ČĂąĀĀ4ĈĆ4ĆĀ))

Timber Accessories **BR12

Bottle rack, 1200x58x20mm, Ĩ01.('ß*%/$Ċ

Edging Tape **ET3

**PR12

1.57

Plate rack, 1200x336mm, Ĩ01.('ß*%/$Ċ

Order Online www.pws.co.uk

Veneer edging, un-glued, 22x3000x0.8mm


MORNINGTON SHAKER - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Classic Cornice, (**C30) with Modern Light Pelmet (**L30)

Mornington Shaker door detail, 10mm recessed centre panel

!+.#%*(6!  ++.ČĈāĆ4ąĊĈ))ĨĵĵĈāĆ4ąĊĈĩČǫ!/,+'!++.!.2%!

((/-1.!"!01.!,+/0/ČĂąĀĀ4ĈĆ4ĆĀ))3%0$/!!* ,*!(ĨĵĵǫĊĀĀĥāĉĩ

1((ġ+10 ++.ČĈāĆ4āąĈ))ĨĵĵĈāĆāąĈĩ

!01.!+,!*,*0.53%0$Ē,*!((%*#ĨĵĵĂąĩ

T: 01325 505599 (North) | 88 (South)

1.58


MORNINGTON - BESPOKE PARAMETERS !3"+.ฤ‚ฤ€ฤ‚ฤ€ฤŒ0$! +.*%*#0+*.*#!+รป!./วซ!/,+'!!.2%!ฤ‹$%/+),.!$!*/%2!+รป!.%*#+),.%/!/+"ฤ‚)%*!/,+'! options. 1. Standard Mornington Bespoke, available for Drawers, Doors and Larder Doors and 2. Feature Glazed Bespoke, available on a lead-time in a range of set sizes.

STANDARD BESPOKE DOOR SIZES

DRAWER/FILLER (SLAB)  CHOOSE HEIGHT  CHOOSE WIDTH MIN

MAX

Height

115mm

282mm

Width

257mm

1197mm

1.59

DRAWER (SHAKER)  CHOOSE HEIGHT  CHOOSE WIDTH MIN

MAX

Height

283mm

ฤ…ฤ†ฤ€))

Width

257mm

1197mm

Order Online www.pws.co.uk

DOOR

TALL DOOR (2 PANEL)

 CHOOSE HEIGHT  CHOOSE WIDTH MIN

MAX

Height

ฤ…ฤ†ฤ))

1500mm

Width

257mm

ฤ‡ฤ…ฤˆ))

 CHOOSE HEIGHT  CHOOSE WIDTH MIN

MAX

Height

1501mm

ฤ‚ฤฤ…ฤ†))

Width

257mm

ฤ‡ฤ…ฤˆ))


MORNINGTON - BESPOKE PARAMETERS Please note: Mornington Glazed doors are supplied with glass

ƾ ƾǍ ħ  AVAILABLE ON A LEAD-TIME

CLEAR GLAZED

1/2 CLEAR GLAZED

1/2 SOLID

1/3 CLEAR GLAZED

1/3 SOLID

SET SIZES

SET SIZES

SET SIZES

SET SIZES

SET SIZES

HEIGHT

HEIGHT

HEIGHT

HEIGHT

HEIGHT

WIDTH

WIDTH

WIDTH

355

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ąąĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

895

ăĊĈČąąĈČĆĊĈ

1061

ăĊĈČąąĈČąĊĈČĆĊĈ

1071

ăĊĈČąąĈČąĊĈČĆĊĈ

1215

ăĊĈČąąĈČąĊĈČĆĊĈ

GEORGIAN GLAZED 4 PANELS

1/2 GEORGIAN GLAZED SET SIZES

SET SIZES

HEIGHT

HEIGHT

HEIGHT

355

ăĊĈČąąĈČąĊĈČĆĊĈ

715

ąĊĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

715 895

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

895

ăĊĈČąąĈČąĊĈČĆĊĈ

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

ăĊĈČąąĈČąĊĈČĆĊĈ

895

GEORGIAN GLAZED 8 PANELS

1/3 GEORGIAN GLAZED

SET SIZES WIDTH

895

WIDTH

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

GEORGIAN GLAZED 10 PANELS

SET SIZES

SET SIZES

HEIGHT

HEIGHT

WIDTH

1061

ăĊĈČąąĈČąĊĈČĆĊĈ

1071

ăĊĈČąąĈČąĊĈČĆĊĈ

1215

WIDTH ăĊĈČąąĈČąĊĈČĆĊĈ

How-to-order Mornington Bespoke doors The easiest way to order is on www.pws.co.uk

31 DAYS*

LEADTIME

To order bespoke sizes follow the following steps: Ä Ä‹ *,10!/,+'!,.!Ăź4+ !Ä?

*For orders placed before 12 noon, ! *!/ 510ĥ+Ýċ

Code

Description

MBQBESPOKE

Mornington Beaded Bespoke size door

MGQBESPOKE

Mornington Shaker Bespoke size door

Made-to-Order lead-times The lead-times for Made-to-Order are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, %*0$!"+.)+" !(%2!.5 0!ÄŒ3%((!+*Ăź.)! 3%0$!$%* %2% 1( order acknowledgement

STEP 2. Choose door height/width (see size parameters above)

STEP 3. Choose further options (where relevant) Ģ!Ä‹#Ä‹Ăź*%/$+(+1.ÄŒ ++. .%((%*#!0

T: 01325 505599 (North) | 88 (South)

1.60


PORTER

6Year GUARANTEE

LACQUERED SLAB DOOR

Stocked Ranges

PRODUCT SPECIFICATION

Handleless Rail Sizes

Painted Finish

Paint-to-Order Service

STOCKED FINISHES

Bespoke Door Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Hartforth Blue

DOOR THICKNESS 18mm

FINISH

REVERSE

Laquered (Gloss or Matt)

Matching Matt melamine

White Matt (PMW) Gloss (PW)

Porcelain Matt (PMN) Gloss (PN)

Cashmere Matt (PMH) Gloss (PH)

Dove Grey Matt (PMV) Gloss (PV)

Egger - W1000

Egger - W1200

Egger - U702

Egger - U708

Silver Grey Matt (PMS) Gloss (PS)

Dust Grey Matt (PMU) Gloss (PU)

Graphite Matt (PMG) Gloss (PG)

Hartforth Blue Matt only (PMB)

Egger - U765

Egger - U732

Egger - U961

EDGE DETAIL Radius edge

PRODUCT OVERVIEW DOOR FAMILY STYLE

Slab (over-painted)

DOOR THICKNESS

18mm

SUBSTRATE

MDF

FINISH

%*0! Ĩ)00ĥ#(+//ü*%/$!/ĩ

REVERSE

Matching matt melamine reverse (PtO - matching matt painted reverse)

CERTIFICATION

Fira Gold

PRICE BAND

£ £

Egger - U599

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

Paint-to-Order Matt - PMX Gloss - SX

Ĩ4(ċ(+//ĩ

Bespoke Door Service (PQBESPOKE)

Matt - 15 working days

2 working days

35 working days

Door Drilling Service

Gloss - 21 working days

KEY FEATURES  Hugely popular and û+. (!(-1!.!  slab door Ƶ.+ /0+'! +û!.+" 15 matt & gloss colours and our paint-to-order palette  Extensive range content including comprehensive collection of handleless rail products  NEW bespoke door sizes for even further design ý!4%%(%05

Porter shown in Gloss White

1.61

Order Online www.pws.co.uk

Porter shown in Matt Hartforth Blue and Gloss Porcelain - with Copper rail


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Doors

Drawer front

FEATURE DOORS

***116

115x597mm

ĵĵĵāąă

139x297mm

ĵĵĵāąą

139x397mm

ĵĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵĵāąć

139x597mm

***713

715x297mm

ĵĵĵāąĉ

139x797mm

ĵĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

ĵĵĵāąĊ

139x897mm

ĵĵĵĈāą

715x397mm

ĵĵĵāąĀ

139x997mm

***175

āĈĆ4ąĊĈ))

***176

175x597mm

***285

Ăĉă4ąĊĈ))

***286

283x597mm

***288

283x797mm

***289

283x897mm

***280

283x997mm

ĈāĆ4āąĈ))

***715X257

715x257mm base filler door for small curve

***WCDS

715x277x18mm, wall corner door solution, pair

***CDS

715x315x18mm, corner door solution, pair

ĵĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

***715

ĈāĆ4ąĊĈ))

ĵĵĵĈāĆ4ĆąĈ

ĈāĆ4ĆąĈ))

***716

715x597mm

***893

895x297mm

ĵĵĵĉĊą

895x397mm

ĵĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

***895

ĉĊĆ4ąĊĈ))

***896

895x597mm

***986

980x597mm

Doors / drawer front ***353

355x297mm

***355

ăĆĆ4ąĊĈ))

***356

355x597mm

***358

355x797mm

***359

355x897mm

***350

355x997mm

ĵĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵĵąĊć

ąĊĀ4ĆĊĈ))

***573

570x297mm

ĵĵĵĆĈą

570x397mm

ĵĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

***575

ĆĈĀ4ąĊĈ))

***576

570x597mm

ĵĵĵćąć

ćąĆ4ĆĊĈ))Č"+. use with single ovens

Curved door

ĵĵĵĈāĆāąĈ

Larder doors ***123

āĂąĆ4ăĊĈ))

***125

āĂąĆ4ąĊĈ))

***126

āĂąĆ4ĆĊĈ))

***193

1965x297mm

***196

Small curved door, 715x300mm

***ICW600

Internal curved wall door for 720x600x 600mm cabinet

***ICB900

Internal curved base door for 720x900x 900mm cabinet

Glazed door ***715FS

Handleless rail sizes ***165

āćĀ4ąĊĈ))

***166

160x597mm

***168

160x797mm

***169

160x897mm

***160

160x997mm

***160X1197

160x1197mm }

***325

ăĂĆ4ąĊĈ))

***326

325x597mm

***328

325x797mm

***329

325x897mm

***320

325x997mm

***325X1197

325x1197mm }

āĊćĆ4ąĊĈ))

ĵĵĵćĉĆāąĈ

ćĉĆ4āąĈ))

***683

685x297mm

ĵĵĵćĉĆăąĈ

ćĉĆ4ăąĈ))

ĵĵĵćĉą

685x397mm

ĵĵĵćĉĆąąĈ

ćĉĆ4ąąĈ))

***685

ćĉĆ4ąĊĈ))

ĵĵĵćĉĆĆąĈ

ćĉĆ4ĆąĈ))}

***686

685x597mm

***CDS685

685x315x18mm, + 685x335x18mm, corner door solution, pair

1965x597mm

Please note:

}Indicates that this product is not2%((!".+)/0+'%*0$!"+((+3%*#ą.*#!/č Porcelain Gloss (PN), Graphite Gloss (PG), Silver Grey Matt (PMS), Silver Grey Gloss (PS). 

ĈāĆ4ąĊĈ))Č(!. glazed

āĂąĆ4ĂĊĈ))

ĵĵĵāĂą

***195

***CD716

$!/!,.+ 10/*!/0%((+. !.! %*0$!+2!+(+1./* ,%*0ġ0+ġ+. !.ü*%/$!/+* (! ġ0%)!1* !.,.!ġü4+ !SX

See page 68 for full list of compatible handlesless rail sizes

T: 01325 505599 (North) | 88 (South)

1.62


PORTER

PRE-FIX CODES (MATT/GLOSS): White (PMW/PW), Porcelain (PMN/PN), Cashmere (PMH/PH), Dove Grey (PMV/PV), Silver Grey (PMS/PS), Dust Grey (PMU/PU), Graphite (PMG/PG), Hartforth Blue (Matt only - PMB), Paint-to-order (PMX/PX)

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice

HANDLELESS RAIL ACCESSORIES ***C30

***CCS300SD

***ICCS600

Feature Posts

Modern cornice/light pelmet, 50x3050x28mm

***ECP685

External corner post, pre-assembled, ćĉĆ4ąć4ąć))

External curved cornice/light pelmet, 50x300x300mm

***CP30B

Base corner post, 685x70x18mm, (pair)

Internal curved cornice/light pelmet, 28x300x300mm

***CP30H

Half height internal corner post, 325x70x70mm, pre-assembled

***ECP325

Half height external corner post, ăĂĆ4ąć4ąć))Č,.!ġ//!)(! }

Plinth ***P30

***CPS560SD

***ICPS900

}

Feature End Panels

Plinth, 150x3050x16mm

Curved plinth section for the small curved door 150x530x300mm

Internal curved plinth, 150x900x900mm

Feature Posts ***CP30

Corner post, 715x70x18mm, (pairs)

***CP30TW

Tall wall internal corner post, 895x70x70mm, pre-assembled

***BEP900/12

Base feature end panel, 900x650x12mm

}

***WEP960/12

Wall feature end panel, 960x370x12mm (cut to size)

}

***EP25/12

* ,*!(ČĂąĀĀ4ćĆĀ4āĂ))}

***BBEP1200

Breakfast bar end panel, 685x1200x18mm

C-shape/L-shape End Panels

***FP3000

} ***LEP325X650

L-Shape Half height Base feature end panel, 325x650x18mm }

***LEP685X650

L-Shape Base feature end panel, 685x650x18mm

***CEP325X960

C-Shape Half Height Island (Wall & Base) feature end panel, 325x960x18mm }

***CEP685X960

C-Shape Island (Wall & Base) feature end panel, 685x960x18mm

}

C-Shape Half Height Base (Double) feature end panel, 325x1200x18mm

}

Tall feature square end post, 3000x100x50mm

End Panels ***BEP900/18

Base end panel, 900x650x18mm

***WEP780/18

Wall end panel, 780x370x18mm

***WEP960/18

Wall end panel, 960x370x18mm

***EP25

End panel with square edges, gloss finish +*"!+*(5ČĂąĀĀ4ćĆĀ4āĉ))

ĵĵĵĂąĀĀĥĊĀĀ

Breakfast bar end panel, ĊĀĀ4ĂąĀĀ4āĉ))

***CEP325X1200

***CEP685X1200

}

C-Shape Base (Double) feature end panel, 685x1200x18mm }

See page 68 for full list of compatible handlesless rail products

Please note:

}Indicates that this product is not2%((!".+)/0+'%*0$!"+((+3%*#ą.*#!/č Porcelain Gloss (PN), Graphite Gloss (PG), Silver Grey Matt (PMS), Silver Grey Gloss (PS). 

1.63

Order Online www.pws.co.uk

$!/!,.+ 10/*!/0%((+. !.! %*0$!+2!+(+1./* ,%*0ġ0+ġ+. !.ü*%/$!/+* (! ġ0%)!1* !.,.!ġü4+ !SX


PORTER LAY-ON - KEY FEATURES ĆŤ+ !//00! .!/1Ăž4+ !/Ä‹.!Ăź4+ !"+. ++..*#!ÄĽ+(+1.)1/0!1/! 3$!*+. !.%*#Ä‹

Internal curved base door (**ICW900), Small Curved Door (**CD716)

715x315mm base corner door solution (**CDS) 715x277mm wall corner door solution (**WCDS)

+Ăź((!.,,(%*! ++.ÄŒćąĆ4ĆĊĈ))ĨľľćąćĊ

Tall Wall Doors, 895x997mm (**895), wrapped with end panel, ĂąĀĀ4ĊĀĀ4Ä Ä‰))ĨľľĂąĀĀļĊĀĀĊ

Feature Post (**FP3000), Base End Panel (**BEP900/18mm)

T: 01325 505599 (North) | 88 (South)

Ä Ä‹Ä‡Ä…


PORTER HANDLELESS - KEY FEATURES

Porter shown on Brushed Copper Handleless Rails

40!.*(+.*!.,+/0ČćĉĆ4ąć4ąć))ĨĵĵƫćĉĆĩČǫ.!'"/0ǫ.* *!( 685x1200x18mm (**BBEP1200)

C-Shape Half Height Island panel, 325x960x18mm (**CEP325X960)

Dishwasher application in mid-rail design - Dishwasher Frame (**GPDDWF) with 2 x 325x597mm drawers (**326) ((((++./ĉĊĆ4ąĊĈ))ĨĵĵĉĊĆĩ3%0$ *0!.)! %0!ƫ+,,!.%( Cornice (**C30) with Tall wall end panel 960x370mm (**WEP960/18)

L-Shape half height panels, 325x650x18mm (**LEP325x650)

1.65

Order Online www.pws.co.uk

Extra wide pan drawer, 325x1997mm (**325x1197), Half height, internal corner post (**CP30H)


NEW PORTER - BESPOKE PARAMETERS

Bespoke Door Service

!3"+.ĂĀĂĀČ0$!+.0!..*#!+Ăť!./ÇŤ!/,+'!!.2%!ÄŒ2%((!"+..3!./ÄŒ++./*  . !.++./Ä‹

BESPOKE DOOR SIZES

DRAWER  CHOOSE HEIGHT  CHOOSE WIDTH

31 DAYS*

LEADTIME

MIN

MAX

Height

115mm

ąĆĀ))

Width

397mm

1197mm

DOOR  CHOOSE HEIGHT  CHOOSE WIDTH MIN

MAX

Height

Ä…Ä†Ä ))

Ä‚Ä Ä…Ä†))

Width

Ä Ä…Äˆ))

ćąĈ))

Made-to-Order lead-times The lead-times for Made-to-Order are for guidance purposes only and always subject to manufacturing capacity. An 1.0!(! ÄĄ0%)!ÄŒ%*0$!"+.)+" !(%2!.5 0!ÄŒ3%((!+*Ăź.)! 3%0$!$%* %2% 1(+. !.'*+3(! #!)!*0

*For orders placed before 12 noon, ! *!/ 510ĥ+Ýċ

How-to-order Porter Bespoke doors The easiest way to order is on www.pws.co.uk To order bespoke sizes follow the following steps: Ä Ä‹ *,10!/,+'!,.!Ăź4+ !Ä?

Code

Description

PQBESPOKE

PORTER Bespoke size door

STEP 2. Choose door height/width (see size parameters above)

STEP 3. Choose further options (where relevant) Ģ!Ä‹#Ä‹Ăź*%/$Ĩ)00+.#(+//ÄŠÄŒ+(+1.

T: 01325 505599 (North) | 88 (South)

1.66


HANDLELESS RAILS Handleless Rail Sizes

Aluminium Ĩ++ !/1Þ4Ċ

White (MW)

Graphite (MG)

Brushed Brass Brushed Copper (B) (C)

+Ăť!./+),.!$!*/%2!.1!* (!(!//%(+((!0%+*"+.1/!3%0$ 5 compatible door ranges. With over 30 products available in a choice of 5 trend colours, our Handleless Rail solutions help create a contemporary linear aesthetic to both modern and classic kitchen designs.

Compatible door ranges *+3+Ăť!./ ! %0! $* (!(!// rail door sizes and accessories in 2 stocked door families (18 ranges) as well as 3 made-to-measure door collections.

HUNTON

PORTER

ALPINA

STANHOPE

UNITY

KEY FEATURES  A collection of 30 products including accent plinth accessories  Available in 5 trend colours including Brushed Brass and Brushed Copper  UPDATED FOR 2020:  ƾ((.%(,.+ß(! !/%#*/ and sizes are now fully aligned across all  Ćß*%/$!/  Compatible with dedicated handleless door sizes and accessories in 2 stocked ranges and 3 made-tomeasure collections

1.67

Order Online www.pws.co.uk

Porter shown in Regiment & Dove Grey,

Alpina shown in Smoked Larch with porter Matt White,

featuring Brushed Brass Rails.

featuring Auminium rails.


K

J A B

L D E

C

F I

H

TOP PROFILES FOR BASE UNITS

A

+,.%(,.+ü(!"+./! ++./Č ąāĀĀ4ĆćċĆ4ĂĈċĂ))

GPT4100

Aluminium

GPT4100***

MW

MG

B

C

MID PROFILES FOR BASE UNITS

E

Aluminium

GPM4100***

MW

Top rail external corner joint, 90 degree, 56.5x27.5x27.5mm

MG

F

!.0%(,.+ü(!Ĩ *0!.)! %0!ĩ ąĂĀĀ4Ĉāċć4ąā))Č0.%)0+/%6!

J

B

C

NEW SIZE - 1200x73x26mm GPM1200

B

VERTICAL PROFILES FOR TALL UNITS

% ,.+ü(!"+. .3!./Č ąāĀĀ4Ĉă4Ăć))

GPM4100

GPV4200MID

Aluminium

GPV4200MID***

MW

GPMEX90

Aluminium

GPTEX90***

MW

MG

GPMEX90***

MW

MG

B

C

B

C

C

!.0%(,.+ü(!Ĩ(0!.(ĩ ąĂĀĀ4Ćăċă4ąā))Č0.%)0+/%6!

K

GPV4200END

Aluminium

GPV4200END***

MW

MG

B

C

NEW SIZEġāĊĈĀ4Ćăċă4ąā)) Aluminium only

GPV1970END

G

B

Aluminium only

GPV1970MID

Mid rail external, corner joint, 90 degree, 73x27.5x27.5mm

Aluminium

Top rail internal corner joint, 90 degree, 56.5x28.3x28.3mm

MG

NEW SIZEġāĊĈĀ4Ĉāċć4ąā))

Aluminium only

GPTEX90

C

G

Mid rail internal corner joint, 90 degree, 73x28.3x28.3mm

GPTIN90

Aluminium

GPMIN90

Aluminium

GPTIN90***

MW

MG

GPMIN90***

MW

MG

B

C

B

C

(1#ĥü((!."+.,,(%*!ü00%*#/Č ĆĉĀ4āć4ąĂ))

L

GPVAPPFILL

Aluminium

GPVAPPFILL***

MW

MG

B

C

STAINLESS STEEL PLINTHS

D

* ,/"+.0+,,.+ü(!/Č,%.Č 1 left & 1 right hand, 56.5x27.5mm

H

SSP30 - Plinth, 150x3000x12mm

* ,/"+. % ,.+ü(!/Č,%.Č 1 left & 1 right hand, 73x27.5mm

GPTEND

Aluminium

GPMEND

Aluminium

GPTEND***

MW

MG

GPMEND***

MW

MG

B

C

B

C

SSSJC - Straight plinth joint

% &+%*0/!0%+*"+.0+,,.+ü(!Č 56.5x8x28.5mm GPTJOINT

Aluminium

GPTJOINT***

MW B

I

SSJC90 - 90 degree corner SSMC - Multi-corner

Drawer line dishwasher frame, ĆĊĀ4ćąĆ))

GPDDWF

SSJC135 - 135 degree corner

Stainless steel substrate

Curved plinth section use with the small curved door, 530x150x12mm SSCPS560SDL - Left hand

MG C

PROFILES FOR WALL UNITS

SSCPS560SDL - Right hand

.+ü(!"+.3((%*!0/Č 3900x19.6x20mm

Securing brackets for top and mid rails, pack of 2, minimum orderr quantity of 25 GPFIXING

(/0%ü*%/$

Internal curved plinth to suit 600x600mm base unit

GPW3900

Aluminium

GPW3900***

MW

MG

((1.2! ,.+ü(!"+. 300x300mm small curved door GPCWS300SD

Aluminium

((1.2! ,.+ü(!"+.ćĀĀ4ćĀĀ)) internal curved wall unit GPCWSIC600

Aluminium

SSICCPS900 B

C

ACCENT PLINTHS Accent plinth, 150x3000x12mm ***P30

B

C

90 degree corner joint ***SJC

B

C

T: 01325 505599 (North) | 88 (South)

1.68


REMO

6Year GUARANTEE

LACQUERED J-PULL SLAB

Stocked Ranges

PRODUCT SPECIFICATION

Painted Finish

Paint-to-Order Service

STOCKED FINISHES

Bespoke Door Service

6 Year Guarantee

.!ġü4+. !.+ !/$+3*%*.'!0/

Shown in Dust Grey

DOOR THICKNESS

JPull handle ,.+ü(!

22mm

FINISH Laquered (Gloss or Matt)

REVERSE Matching Matt melamine

White Matt - RMW Gloss - RW

Porcelain Matt - RMN Gloss - RN

Cashmere Matt - RMH Gloss - RH

Dove Grey Matt - RMV Gloss - RV

Egger - W1000

Egger - W1200

Egger - U702

Egger - U708

Silver Grey Matt - RMS Gloss - RS

Dust Grey Matt - RMU Gloss - RU

Graphite Matt - RMG Gloss - RG

Hartforth Blue Matt only - RMB

Egger - U765

Egger - U732

Egger - U961

EDGE DETAIL Radius edge NEW

PRODUCT OVERVIEW DOOR FAMILY STYLE

J-Pull Slab (over-painted)

DOOR THICKNESS

22mm

SUBSTRATE

MDF

FINISH

%*0! Ĩ)00ĥ#(+//ü*%/$!/ĩ

REVERSE

Matching matt melamine reverse (PtO - matching matt painted reverse)

CERTIFICATION

Fira Gold

PRICE BAND

£ £ £

Egger - U599

Suggested board matches for Egger shown below each door. See page 89 for full list.

SERVICE OPTIONS

Paint-to-Order Matt - REM Gloss - RX

Ĩ4(ċ(+//ĩ

Bespoke Door Service (RQBESPOKE)

Matt-15 working days

2 working days

35 working days

Door Drilling Service

Gloss-21 working days

KEY FEATURES  Our best selling, contemporary J-Pull door collection  A quality 22mm overpainted door available in matt & gloss options  Available from stock in 15 colours and paint-toorder  NEW bespoke door sizes for even further !/%#*ý!4%%(%05

Remo shown in Matt Porcelain

1.69

Order Online www.pws.co.uk

Remo shown in Gloss Silver Grey


DOOR RANGE CONTENT $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵĵ

Drawer fronts

Doors

**116S

NEW 115x597mm, (slab, no handle)

ĵĵāąă

139x297mm

ĵĵāąą

139x397mm

ĵĵāăĊąąĈ

āăĊ4ąąĈ))

ĵĵāąĆ

āăĊ4ąĊĈ))

ĵĵāąć

139x597mm

ĵĵāąĉ

139x797mm

ĵĵāąĊ

139x897mm

ĵĵāąĀ

139x997mm

**175

āĈĆ4ąĊĈ))

**176

175x597mm

FEATURE DOORS Curved door

ĵĵĈāĆāąĈ

ĈāĆ4āąĈ))

**715X257

715x257mm, base ü((!."+./)(( curved door

**WCDS

715x271x22mm, wall corner door solution, pair

**WCDS900

895x271x22mm, wall corner door solution, pair

**CDS

715x311x22mm, base corner door solution, pair

**713

715x297mm

ĵĵĈāĆăąĈ

ĈāĆ4ăąĈ))

ĵĵĈāą

715x397mm

ĵĵĈāĆąąĈ

ĈāĆ4ąąĈ))

**715

ĈāĆ4ąĊĈ))

ĵĵĈāĆĆąĈ

ĈāĆ4ĆąĈ))

**285

Ăĉă4ąĊĈ))

**286

283x597mm

**288

283x797mm

**716

715x597mm

**289

283x897mm

**893

895x297mm

**280

283x997mm

ĵĵĉĊą

895x397mm

ĵĵĉĊĆąąĈ

ĉĊĆ4ąąĈ))

**895

ĉĊĆ4ąĊĈ))

**896

895x597mm

**986

980x597mm

Drawer fronts / doors **353

355x297mm

**355

ăĆĆ4ąĊĈ))

**356

355x597mm

**358

355x797mm

**359

355x897mm

**350

355x997mm

ĵĵąĆć

ąĆĀ4ĆĊĈ))

ĵĵąĊć

ąĊĀĆĊĈ))

**573

570x297mm

ĵĵĆĈą

570x397mm

ĵĵĆĈĀąąĈ

ĆĈĀ4ąąĈ))

**575

ĆĈĀ4ąĊĈ))

**576

570x597mm

ĵĵćąć

ćąĆ4ĆĊĈ))

**356NH

355x597mm (no handle)

**358NH

355x797mm (no handle)

**359NH

355x897mm (no handle)

**350NH

355x997mm (no handle)

**CD716

Small curved door 715x300mm

**ICW600L

Internal curved wall door for 720x600x600mm cabinet, left hand,

**ICW600R

Internal curved wall door for 720x600x600mm cabinet, right hand

**ICB900L

Internal curved base door for 720x900x900mm cabinet, left hand

**ICB900R

Internal curved base door for 720x900x900mm cabinet, right hand

Please note: Handing refers to hinged side as you face door in-situ

Glazed door **715FS

ĈāĆ4ąĊĈ))Č clear glazed

Larder doors **123

āĂąĆ4ĂĊĈ))

ĵĵāĂą

āĂąĆ4ăĊĈ))

**125

āĂąĆ4ąĊĈ))

**126

āĂąĆ4ĆĊĈ))

**123C

āĂąĆ4ĂĊĈ))Č hidden handle ,.+ü(!

ĵĵāĂąƫ

āĂąĆ4ăĊĈ)) hidden handle ,.+ü(!

**125C

āĂąĆ4ąĊĈ)) hidden handle ,.+ü(!

**126C

āĂąĆ4ĆĊĈ)) hidden handle ,.+ü(!

T: 01325 505599 (North) | 88 (South)

1.70


REMO

PRE-FIX CODES (MATT/GLOSS): White (RMW/RW), Porcelain (RMN/RN), Cashmere (RMH/RH), Dove Grey (RMV/RV), Silver Grey (RMS/RS), Dust Grey (RMU/RU), Graphite (RMG/RG), Hartforth Blue (Matt only - RMB), Paint-to-Order (REM/RX)

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

End Panels

Cornice **C30

Modern cornice/light pelmet, 50x3050x28mm

**CCS300SD

Curved modern cornice, 50x300x300mm, unhanded

**ICCS600

Internal curved cornice, 28x300x300mm, unhanded

Plinth **P30

Plinth, 150x3050x16mm

**CPS560SD

Curved plinth section use with the small curved door, 150x530x16mm

**ICPS900

Internal curved plinth, 150x900x900mm

Feature Posts

1.71

**CP30

Corner post, 715x70x22mm, (pair) (with handle profile)

**SCP30

Corner post, 715x70x22mm, (pair) (slab, no handle profile)

**WCP

Internal wall Corner Post, 715x26x26mm, pre-assembled, (with handle profile)

**BCP

Internal base Corner Post 715x70x70mm, pre-assembled, (with handle profile)

**ECP900

External corner post, 900x75x75mm, pre-assembled, (with handle profile)

**FP3000

Tall appliance/larder square feature end post, 3000x100x50mm

Order Online www.pws.co.uk

**BEP900/18

Base end panel, 900x650x18mm

**WEP780/18

Wall end panel, 780x370x18mm

**WEP960/18

Wall end panel, 960x370x18mm

**EP25

* ,*!(ČĂąĀĀ4ćĆĀ4āĉ))

ĵĵĂąĀĀĂĂ

* ,*!(ČĂąĀĀ4ćĆĀ4ĂĂ))

ĵĵĂąĀĀĥĊĀĀ

Breakfast bar end panel, ĊĀĀ4ĂąĀĀ4āĉ))


REMO - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

((3((+.*!. ++./+(10%+*Ĩ3%0$/0+,&ġ,1((,.+ü(!ĩČĵĵƫĊĀĀ

āĂąĆ4ĆĊĈ3%0$$)"!.! $* (!Č **126C

Appliance/larder feature end post, **FP3000

ćąĆ4ĆĊĈČ"+.1/!3%0$/%*#(!+2!*/Čĵĵćąć

Curved Base Door (**CD716)

Internal Curved Base Door (**ICB900L)

External Corner Post, 900x75x75mm (**ECP900) and internal corner post, 715x70x70 (**BCP)

T: 01325 505599 (North) | 88 (South)

1.72


REMO - BESPOKE PARAMETERS !3"+.ĂĀĂĀČ0$!!)+.*#!+Ăť!./ÇŤ!/,+'!!.2%!Ä‹$%/+),.!$!*/%2!+Ăť!.%*#+),.%/!/+"Ä‚)%*!/,+'!+,0%+*/Ä‹Ä Ä‹0* . !)+ ÇŤ!/,+'!3$%$+*/%/0/+" ÄĄ1((.1*ÄĄ+10* Ä‚Ä‹!01.!!)+ÇŤ!/,+'!3$%$"!01.!/+*0!),+..5/0+,,.+Ăź(! !/%#** %/2%((!+* a lead-time in a range of set sizes.

BESPOKE DOOR SIZES HORIZONTAL J-PULL PROFILE

VERTICAL J-PULL PROFILE

Left Hand shown

DRAWER

DOOR

 CHOOSE HEIGHT  CHOOSE WIDTH

SET SIZES (available on a leadtime)

 CHOOSE HEIGHT  CHOOSE WIDTH

HEIGHT

WIDTH

715 MIN

MAX

Height

115mm

ąĆĀ))

Width

Ä Ä…Äˆ))

1397mm

ĂĊĈČăĊĈČąĊĈČĆĊĈ

MIN

MAX

895

ĂĊĈČăĊĈČąĊĈČĆĊĈ

Height

Ä…Ä†Ä ))

Ä Ä…Ä‚Ä†))

980

597

Width

Ä Ä…Äˆ))

ćąĈ))

Ä Ä‚Ä…Ä†

ĂĊĈČăĊĈČąĊĈČĆĊĈ

Ä Ä…Ä‚Ä†

ĂĊĈČăĊĈąĊĈČĆĊĈ

FEATURE REMO BESPOKE STOP HANDLE DESIGN

Ä Ä‚Ä…Ä† (Door) Ä Ä‚Ä…Ä† (Door)

Left Hand shown

Left Hand shown

ĂĀĀĨß4! Ċ

Left Hand shown

ĊĂĀĨß4! Ċ

Left Hand shown

HORIZONTAL STOP PROFILE

VERTICAL STOP PROFILE

Ä Ä Ä€Ä€Ĩß4! ÄŠ

ĂĀĀĨß4! Ċ

715 (Door)

MEDIUM HEIGHT VERTICAL STOP PROFILE

895 (Door)

TALL HEIGHT VERTICAL STOP PROFILE

SET SIZES (available on a leadtime)

SET SIZES (available on a leadtime)

SET SIZES (available on a leadtime)

SET SIZES (available on a leadtime)

HEIGHT WIDTH

HEIGHT

HEIGHT

HEIGHT

WIDTH

139

ąĊĈČĆĊĈČĈĊĈČĉĊĈČĊĊĈČÄ Ä ÄŠÄˆ

Ä Ä‚Ä…Ä†

ĂĊĈČăĊĈČąĊĈČĆĊĈ

283

ąĊĈČĆĊĈČĈĊĈČĉĊĈČĊĊĈČÄ Ä ÄŠÄˆ

Ä Ä…Ä‚Ä†

ĂĊĈČăĊĈČąĊĈČĆĊĈ

355

ąĊĈČĆĊĈČĈĊĈČĉĊĈČĊĊĈČÄ Ä ÄŠÄˆ

715

ĂĊĈČăĊĈČąĊĈČĆĊĈ

895

ĂĊĈČăĊĈČąĊĈČĆĊĈ

980

597

Ä Ä‚Ä…Ä†

ĂĊĈČăĊĈČąĊĈČĆĊĈ

Ä Ä…Ä‚Ä†

ĂĊĈČăĊĈČąĊĈČĆĊĈ

31 DAYS*

LEADTIME

*For orders placed before 12 noon, ! *!/ 510ĥ+Ýċ

1.73

Order Online www.pws.co.uk

1965

WIDTH ĂĊĈČăĊĈČąĊĈČĆĊĈ

Ä‚Ä Ä…Ä†

WIDTH ĂĊĈČăĊĈČąĊĈČĆĊĈ

Made-to-Order lead-times The lead-times for Made-to-Order are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, %*0$!"+.)+" !(%2!.5 0!ÄŒ3%((!+*Ăź.)! 3%0$!$%* %2% 1( order acknowledgement


NEW REMO - BESPOKE PARAMETERS

Bespoke Door Service

MORE CHOICE, GREATER FLEXIBILITY %/*+3$,,50++Ăť!.+1.) !ÄĄ0+ÄĄ)!/1.!/!.2%!.+//Ä Äƒ ++.")%(%!/ÄŒ+2!.%*#/+)!+"+1.)+/0,+,1(./0+'! .*#!/ÄŒ %*0ÄĄ0+ÄĄ. !.Ăź*%/$!/* ă ! %0! ) !ÄĄ0+ÄĄ+. !. ++.+((!0%+*/Ä‹(!/!/!!,#!.!"/!(+3"+."1.0$!. *"+.)0%+*5.*#!Ä‹

BASE UNIT CONFIGURATIONS

APPLIANCE BANK CONFIGURATIONS

For Base Unit Runs and Island Units

Applicable to medium and tall height installations. Medium height installation shown below.

715x597mm Horizontal Stop .+Ăź(! (LH)

715x597mm Horizontal 0+,.+Ăź(! (RH)

715x597mm Horizontal Stop .+Ăź(!(RH)

Ä Ä‚Ä…Ä†4ĆĊĈ)) Horizontal 0+,.+Ăź(! (RH)

Ä Ä‚Ä…Ä†4ĆĊĈ)) **126 600

715x597mm Horizontal Stop .+Ăź(!(LH)

715x597mm Horizontal Stop .+Ăź(!(RH)

715x597mm **716

355x597mm **356

355x597mm Horizontal Stop .+Ăź(! (RH)

355x597mm Horizontal Stop .+Ăź(!(LH)

355x597mm **356

355x597mm Horizontal Stop .+Ăź(!(RH)

355x597mm Horizontal Stop .+Ăź(!(RH)

355x597mm **356

355x597mm Horizontal Stop .+Ăź(!(LH)

355x597mm Horizontal Stop .+Ăź(!(LH)

355x597mm **356

355x597mm Horizontal Stop .+Ăź(!(RH)

Ä Ä‚Ä…Ä†4ĆĊĈ)) **126

Ä Ä‚Ä…Ä†4ĆĊĈ)) Horizontal 0+,.+Ăź(! (LH)

600

355x597mm Horizontal 0+,.+Ăź(! (LH)

355x597mm **356

355x1200mm Horizontal J-Pull .+Ăź(!

355x597mm **356

355x597mm Horizontal 0+,.+Ăź(! (RH)

355x597mm Horizontal 0+,.+Ăź(! (LH)

355x597mm **356

355x1200mm Horizontal J-Pull .+Ăź(!

355x597mm **356

355x597mm Horizontal 0+,.+Ăź(! (RH)

Ä Ä‚Ä…Ä†4ĆĊĈ)) Vertical Stop .+Ăź(!(LH)

Ä Ä‚Ä…Ä†4ĆĊĈ)) Vertical Stop .+Ăź(!(RH)

715x597mm Vertical

ÄĄ1((.+Ăź(! (LH)

715x597mm Vertical

ÄĄ1((.+Ăź(! (RH)

715x597mm Horizontal 0+,.+Ăź(! Design (RH)

355x597mm Horizontal Stop .+Ăź(! (LH)

715x597mm Horizontal 0+,.+Ăź(! (LH)

1965x597mm Vertical 0+,.+Ăź(! (Medium Height) (LH)

1965x597mm Vertical 0+,.+Ăź(! (Medium Height) (LH)

715x597mm Horizontal 0+,.+Ăź(! Design (LH)

600

600

355x597mm Horizontal 0+,.+Ăź(! (LH)

355x597mm Horizontal 0+,.+Ăź(! (RH)

355x597mm Horizontal 0+,.+Ăź(! (LH)

355x597mm Horizontal 0+,.+Ăź(! (RH)

715x597mm **716

715x597mm **716 Ä Ä‚Ä…Ä†4ĆĊĈ)) Horizontal 0+,.+Ăź(! (LH)

Ä Ä‚Ä…Ä†4ĆĊĈ)) Horizontal 0+,.+Ăź(! (RH) 1965x597mm Vertical 0+,.+Ăź(! (Medium Height) (LH)

715x597mm Horizontal 0+,.+Ăź(! (LH)

600

600

715x597mm **716

715x597mm **716

1965x597mm Vertical 0+,.+Ăź(! (Medium Height) (LH)

715x597mm Horizontal 0+,.+Ăź(! (RH)

WALL UNIT CONFIGURATIONS +.0.1(5!/,+'!!/0$!0%ÄŒ)%..+.((*%0+*Ăź#1.0%+*/ 3%0$ÇŤ/!*%0+*Ăź#1.0%+*/Ä‹

How-to-order Remo Bespoke doors The easiest way to order is on www.pws.co.uk

715x597mm

715x597mm

715x597mm

715x597mm

Horizontal 0+,.+Ăź(!

Horizontal 0+,.+Ăź(!

(RH)

(LH)

Vertical J-Pull .+Ăź(!

Vertical J-Pull .+Ăź(!

715x597mm

715x597mm

715x597mm

Horizontal 0+,.+Ăź(!

**716

Horizontal 0+,.+Ăź(!

(RH)

(LH)

To order bespoke sizes follow the following steps: Ä Ä‹ *,10!/,+'!,.!Ăź4+ !Ä?

Code

Description

RQBESPOKE

REMO Bespoke size door

STEP 2. Choose door height/width (see size parameters above)

STEP 3. Choose further options (where relevant) Ģ!Ä‹#Ä‹Ăź*%/$Ĩ)00+.#(+//ÄŠÄŒ+(+1.

T: 01325 505599 (North) | 88 (South)

Ä Ä‹ÄˆÄ…


STANHOPE

6Year

MADE-TO-MEASURE VINYL DOOR COLLECTION

Made-to-Measure Woodgrain Collection û!0

STANHOPE CLASSIC DOORS

UK MADE

GUARANTEE

Made in the UK

6 Year Guarantee

STANHOPE MODERN DOORS

Bolam

Langley

Meldon

Ingoe

One piece shaker

Shaker with Ovolo detail

Cathedral arch

PREFIX - STB

PREFIX - STB

PREFIX - STA

Cathedral arch !(3++ !û!0+*(5

Henshaw

Acomb

Square slab

Sapponetta slab

Integrated handle slab

PREFIX - STA

PREFIX - STA

PREFIX - STA

$%0ü!(

PREFIX - STA

Matt

++ #.%*!û!0

Porcelain

Stone

Alabaster

Blue Canvas

Mussel

Cashmere

Dove Grey

Graphite

Super White

Cream

Grey

Mussel

Cashmere

Egger W1100

Egger U727

Egger U104

Egger U540

Egger U100

Egger U702

Egger U708

Egger U961

Egger W980

Egger U104

Egger U708

Egger U100

Egger U702

CLASSIC INGOE ONLY

SERVICE OPTIONS

MODERN ONLY

Gloss*

ƫ(//%*01.(3++ !û!0

Door Drilling Service

Bespoke Door Service (***BESPOKE)

Slaley

Falstone

Ĩ4(ċ(+//ĩ

11 working days 7 days remedial

Egger H1796

Egger H1146

PRODUCT OVERVIEW DOOR FAMILY STYLE

Shaker/Slab range - 1 piece construction in various designs

DOOR THICKNESS

18mm

SUBSTRATE

MDF

FINISH

ƫ+%(Ĩ)00ĥ#(+//ĥ3++ #.%*!û!0ĩ

REVERSE

Matching matt melamine colour/foil

CERTIFICATION

Fira Gold

PRICE BAND

Natural Walnut Egger 3702

Feature

White

Cream

Haze

Egger W980

Egger U104

(White reverse)

Concrete (Light Grey reverse)

*Ƶ+)*+02%((!%*(+//ü*%/$!/

Suggested board matches for Egger shown below each door. See page 89 for full list.

Made-to-Order lead-times

11 DAYS*

LEADTIME

*For orders placed before 12 noon, ! *!/ 510ġ+ûċ

The lead-times for Made-to-Order are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, in the form of a delivery date, will !+*ü.)! 3%0$!$%* %2% 1( order acknowledgement

£

KEY FEATURES  Made-to-measure PVC door range  Versatile collection available in 7 door styles * )1(0%,(!ü*%/$!/%*(1 %*##(+//Č)00Č +*.!0!* 3++ #.%*!û!0  Angled door options and a huge array of accessorisation make Stanhope suitable for kitchens, bedrooms & bathrooms  Manufactured in the UK with Fira Gold and PEFC !.0%ü0%+*/

1.75

0*$+,!!*/$3/$+3*%*++ #.%*!û!0ƫ/$)!.!* (+//6!

Order Online www.pws.co.uk


DOOR SIZE GUIDE

The easiest way to order Stanhope is on www.pws.co.uk

The Stanhope Made-to-Measure Collection is available to order in bespoke sizes within set parameters (see below) or from a ‘Quick Order

%/0Ě+",.!ĥ !ß*! /%6!/* + !/Ĩ,(!/!/!!.%! %/0"+.ß((+. !.(%/0* ,.%%*#Ċċ

BESPOKE DRAWER/DOOR SIZE PARAMETERS

- .

!.! 1* !.0$!/1Þ4+ !ľľľǍ 

DRAWERS Height Min - 60mm

Height Max - 282mm

Width Min - 100mm

Width Max - 1200mm

GRAIN DIRECTION

SIZE PARAMETER EXCEPTIONS:

• Drawer fronts are supplied with horizontal grain as standard

BOLAM/INGOE/MELDON:

Height Min - 283mm

Height Max - 895mm

• Standard and Tall doors are supplied with 2!.0%(#.%*%*((ß*%/$!/!4!,0(+// Haze which is horizontal on all drawers/doors.

Width Min - 100mm

Width Max - 1200mm

DOORS FOR CORNER CABINETS

NOTES:

STANDARD DOORS

TALL DOORS

Height 4ĥĂĆąĀ))

ACOMB: %*%)1) .3!.ļ ++.3% 0$ĢĂąĀ))ċ *0!#.0! $* (!,.+ß(!+* .3!.".+*0/*  doors below 1699mm high have a 200mm long groove on the top. Doors above 1700mm high have a 900mm long groove on the left/right hand side.

Doors can be supplied with either left or right side edge square. Available up to Max. 1699mm high.

TALL DOORS Height Min - 896mm

Minimum door width with internal Shaker design – 275mm

Tall door designs with two panels will be supplied with the mid rail at 655mm from the bottom edge to the centre of the mid rail as /0* . 1*(!//+0$!.3%/!/,!%Ăź! Ä‹

LANGLEY: Min drawer height with internal Shaker design – 100mm Minimum drawer width with internal design – 100mm

Width Min - 100mm

ORDER STANHOPE AT PWS.CO.UK

Width Max - 896mm

ANGLED DOOR OPTIONS

- .

Minimum door width with internal design – ĂąĀ)) Doors between 100mm and 239mm width will have outer lines only and no centre panel

!.! 1* !.0$!/1Þ4+ !ľľľǍ 

ƾ*#(!  ++./.!2%((!3%0$%*0$!/)! ++./%6!,.)!0!./(%/0! +2!Ĩ1,0+ĂĆąĀ4ĉĊć))ĊĥNot available in Acomb, Ingoe and Meldon door styles

TW

TW

Angled doors are available in a wide variety of angles and shapes as shown in left illustration and the PWS angled door order form.

LH

A

RH LH

BW

B

RH

BW

OPEN FRAME DOORS

B

LH

RH

LH

BW

- .

A

BW

RH

• Angled doors are not available in gloss

• Additional 5 day lead time will apply to orders that include angled doors.

• When ordering, please specify the type of angled door (A or B) and dimensions for Left Hand Height (LH), Right Hand Height (RH), Bottom Width (BW) and for stepped angled doors specify Top width (TW).

• Door sizes above 1700mm high in Bolam, Langley, Meldon & Ingoe will be supplied with a mid-rail as standard. Mid-rail height is 6x5mm as /0* . 1*(!//+0$!.3%/!/,!%ß!  at order.

Angled doors can be ordered on www.pws.co.uk or by completing the PWS Stanhope angled door order form

!.! 1* !.0$!/1Þ4+ !ľľľǍ 

GLAZING OPTIONS

Open frame doors are available in all door styles in any size.

Available in open and georgian framed doors

OPEN DRAWER FRAME Height Min - 175mm

Framed doors can be supplied frame only or .!0! 3%0$Ĩ.5(%ÄŠ#(6%*#Ăź00! ÄŒ/!!#(6%*# options below. We can supply glazed frame doors in clear or frosted acrylic.

Height 4ÄĄăĆą)) NB: Drawer frame not available in Gloss colours.

Width Min - 296mm

Frame only (No glazing)

Width Max - 1200mm

Frosted

Clear

OPEN DOOR FRAME

Height Min - 283mm

Height Max - 1699mm

3 FRAME OPTIONS ARE AVAILABLE ON DOORS: %*$!%#$0Ä ÄˆÄ€Ä€))ÄĄ 4$!%#$0ĂĆąĀ))Ä‹

Width Min - 296mm

Width Max - 650mm

The top open and top & bottom open frames are available with any mid rail height (655mm supplied unless other requested).

Top Open Frame

Top & Bottom Open Frame

Full Open Frame

Min width 296mm - Max width 650mm.

T: 01325 505599 (North) | 88 (South)

1.76


STANHOPE ACCESSORIES

ORDER AT PWS.CO.UK

0*$+,!Ćľ!//+.%!/%*,.!ÄĄ !Ăź*! /%6!/*!+. !.! 1* !.0$! ! %0! /1Ăž4+ !//$+3*3%0$ľľľċ Ćľ!//+.%!/%*!/,+'!/%6!+,0%+*/Ĩ* *!(/ÄŒ *0!(/ÄŒ(%*0$/ÄŠ*!+. !.! 1* !./1Ăž4+ !ľľľƾƍƍǍ Ä‹ The easiest way to order is at www.pws.co.uk GLAZING OPTIONS For Georgian framed doors Framed doors can be supplied frame only +..!0! 3%0$Ĩ.5(%ÄŠ#(6%*#Ăź00! ÄŒ/!! glazing options below. We can supply glazed frame doors in clear or frosted acrylic.

Cornice and Light Pelmet

Radius rail options

Not available in Gloss Haze or Concrete.

Can be used for various applications including cornice, gable ends, pilasters etc.

Georgian Frame Doors

***L30

Tangent Light Pelmet. 57mm High 3$!*Ăź4! Ä‹ 3050mm length

Available in all door styles. Not available in Gloss Colours. ***715X396GG

ÄˆÄ Ä†4ąąć))

ÄľÄľÄľÄˆÄ Ä†ąĊć

ÄˆÄ Ä†4ąĊć))

***900X396GG

900x396mm

ľľľĊĀĀąąć

ĊĀĀ4ąąć))

ľľľĊĀĀąĊć

ĊĀĀ4ąĊć))

***1055X396GG

1055x396mm

ÄľÄľÄľÄ Ä€Ä†Ä†ąąć

Ä Ä€Ä†Ä†4ąąć))

ÄľÄľÄľÄ Ä€Ä†Ä†ąĊć

Ä Ä€Ä†Ä†4ąĊć))

80mm

R80

Plinth

Radius Rail ĉĀ))4ăą)) x 3050mm length

Note: Cross grain direction on Gloss Haze

(input height)

Can be supplied any height between 100mm and 200mm. ĨĂĆąĀ))(!*#0$ ĥß4! Ċ

Designed for use in various applications including cornice, pelmet, gable ends, pilasters and to box around a group of Cabinets. 37mm 36mm

Ä Ä…ÄŠÄ†4ăĊć))

***MR3O

55mm

Ä Ä…ÄŠÄ†4ąćć))

Ä Ä…ÄŠÄ†4ąĊć))

Square and T&G end panels All panels are available in 18mm and 25mm thick options. The Back Colour on 25mm is .!)Ä‹Ćľă))! #!,.+Ăź(!%//1,,(%! +* 25mm panels.

Multi-purpose rail

18mm

ÄľÄľÄľÄ Ä…ÄŠÄ†ąĊć

Multi-Purpose Rail 55x36x 3050mm length

18mm and 25mm panels are available in all colours except T&G panels which are not available in gloss colours. Min size 250mm hight by 250mm deep 4/%6!%/ĂĆąĀ))(+*#4ĉĊć)) !!,ċ Gloss Haze plain panels supplied with white back Concrete panels supplied with light grey back

Multi-purpose rail - MR30 ***ACCBESPOKE

Gun Barrel Pilasters

***BPI900

(input sizes) ĊĀĀ4Ċă4ąć)) (End block 160 wide) ***ACCBESPOKE

***2155X396GG

2155x396mm

(input sizes) ***BPI1250

ÄľÄľÄľÄ‚Ä Ä†Ä†ąąć

(Mid rail height 655mm only)

ÄľÄľÄľÄ‚Ä Ä†Ä†ąĊć

Ä‚Ä Ä†Ä†4ąąć))

Ä Ä‚Ä†Ä€4Ċă4ąć)) (End block 160 wide)

***CP70X30

720x30x30mm

ľľľƍĈĀÄ…Ä€

ĈĂĀ4ąĀ4ąĀ))

Ä‚Ä Ä†Ä†4ąĊć))

Clear

T&G end panel 18 or 25mm thick. Up to ĂĆąĀ4ĉĊć))

***SEP720_ _

Plain 1050mm High x 330mm Deep (720mm High Cabinet)

***SEP900 _ _

Plain1230mm High x 330mm Deep (900mm High Cabinet)

***SGP720_ _

T&G 1050mm High x 330mm Deep (720mm High Cabinet)

***SGP900_ _

T&G 1230mm High x 330mm Deep (900mm High Cabinet)

Fluted Pilasters

GLAZING OPTIONS (ACRYLIC)

Plain end panel 18 or 25mm thick. Up to ĂĆąĀ4ĉĊć))

Scroll end panel

Corner Post

***FPI900

Frame only (No glazing)

Radius Cornice Piece (Tangent) 120mm x 120mm

***RR30

***ACCBESPOKE

ÄľÄľÄľÄ Ä…ÄŠÄ†ąćć

***RCP120

715x396mm

ÄľÄľÄľÄˆÄ Ä†ąąć

ÄľÄľÄľÄ Ä…ÄŠÄ†ăĊć

Not available in Gloss Haze or Concrete.

80mm

***C30

Tangent Cornice. ąĆ))%#$ 3$!*ß4! ċ 3050mm length

900x100x18mm

***FPI1250

1250x100x18mm

ľľľ ĂĆąĀ

ĂĆąĀ4Ä Ä€Ä€4Ä Ä‰))

Modern Pilasters ***MPI900

900x100x18mm

***MPI1250

1250x100x18mm

ľľľ  ĂĆąĀ

ĂĆąĀ4Ä Ä€Ä€4Ä Ä‰))

Frosted

End code with LH (Left hand) or RH (right hand)

Please note: • Both Plain and T&G options are handed • Scroll panels not available in gloss colours

1.77

Order Online www.pws.co.uk


ACCESSORIES

The easiest way to order Stanhope is on www.pws.co.uk

General Accessories

Wrap around G-panel

(+//ƫ+(+1./$2!)00ü*%/$!4!,0 for Gloss White.

All panels are 18mm thick and when constructed all panels are edged.

Not available in Matt Blue Canvas ***ET1

Pre-glued Edging Tape 22mm X 50M

***HD600

!0!ý!0+./ 600mm length

***HD700

!0!ý!0+./ 700mm length

Mantle Options

Ƶ((,*!(//1,,(%! 3%0$ąĆ+&+%*0* * easy assembly system. All panels are vertical grain unless otherwise /,!%ü! WRAP AROUND PANEL SIZES CAN BE SPECIFIED AND ORDERED WITH STANHOPE ORDER FORM. PRICING AVAILABLE ON REQUEST.

***ACCBESPOKE

Broad Shelf for Non Standard Mantle (excludes corbels) Available from1000mm > ĂĆąĀ))(!*#0$ Not available in Gloss Haze or Concrete

Wrap around c-panel All panels are 18mm thick and when constructed all panels are edged. Ƶ((,*!(//1,,(%! 3%0$ąĆ+&+%*0* * easy assembly system.

Narrow Shelf for Non Standard Mantle (excludes corbels)

Handle-less Rail End Panels - use C-Panel 3%0$ !,0$+"ąĀ)) All panels are vertical grain unless otherwise /,!%ü! ċ WRAP AROUND PANEL SIZES CAN BE SPECIFIED AND ORDERED WITH STANHOPE ORDER FORM. PRICING AVAILABLE ON REQUEST.

***ACCBESPOKE RETURN ąĀġĂĀĀ))

DEPTH ąĀġāĂĀĀ))

Not available in Gloss Haze or Concrete

***ACCBESPOKE

HEIGHT !.0%(.%*ĆĀ))ġĂĆąĀ)) Horizontal Grain 50mm - 1200mm

ġąĀġāĂĀĀ))

Available from 1000mm > ĂĆąĀ))(!*#0$

Arched Facia for Non Standard Mantle. 360mm H. Specify required width.

Pair of Mantle Corbels 195mm(H) 115mm(W)

***MCORBEL

WIDTH Vertical Grain 50mm - 1200mm Horizontal Grain 50mm - 2530mm

Not available in Gloss Haze or Concrete

Mantle Options N

B

B

B

C

E

G F

H B

D 1435

WIDTH Vertical Grain 50mm - 1200mm Horizontal Grain 50mm - 2530mm

N

G F

E

I

B

D C

E

M

E

I

J

M

K

L

H

B

J 1435

HEIGHT !.0%(.%*ĆĀ))ġĂĆąĀ)) Horizontal Grain 50mm - 1200mm

K

470mm

470mm

L

***BSMK1000

Broad Shelf Mantle Kit 1000mm

***NSMK1000

Narrow Shelf Mantel Kit 1000mm

***BSMK1100

Broad Shelf Mantle Kit 1100mm

***NSMK1100

Narrow Shelf Mantel Kit 1100mm

***BSMK1200

Broad Shelf Mantle Kit 1200mm

***NSMK1200

Narrow Shelf Mantel Kit 1200mm

T: 01325 505599 (North) | 88 (South)

1.78


UNITY

5Year

MADE-TO-MEASURE EDGED SLAB COLLECTION

SERVICE OPTIONS

PRODUCT OVERVIEW DOOR FAMILY STYLE

Slab - edged

DOOR THICKNESS

18mm

ƍĨ++ #.%*Ý!0ļƍ+*.!0!Ċ

5 Year Guarantee

Two-Tone ă(//Ăť!0

NOTES: Ä‘3+ÄĄ0+*!ă#(//!Ăť!0! #%*#%/ 2%((!%*#(+//Ăź*%/$!/+*(5

Supermatt - Perfect Touch Matt PVC

FINISH

Made in the UK

Matching AirTech Edging

11 working days 7 days remedial

Gloss/Gloss Metallic - Acrylic

GUARANTEE

EDGE OPTIONS

Bespoke Service (***BESPOKE)

Door Drilling Service

MDF (Gloss/Metallic/Supermatt)

SUBSTRATE

Made-to-Measure Woodgrain Collection Ăť!0

UK MADE

++ #.%*Ý!0ļ!01.!ĥ !()%*!"+%(Ĩ0!401.! ß*%/$Ċ

Ä‘* ,*!(/.!! #! ((Ä…/% !// standard and are supplied in matching edge only

REVERSE

Matching matt melamine colour/foil

• Pelmet & plinth are edged on one long side only with a matching edge.

CERTIFICATION

Fira Gold

PRICE BAND

ÂŁ

GLOSS FINISHES -

.!Ăź4 UXB

Pure White

Cashmere

Light Grey

Dust Grey

Graphite

Egger - W1000

Egger - U702

Egger - U708

Egger - U732

Egger - U961

SUPERMATT FINISHES - Matching edge onlyċ.!ß4

UXB

NEW

NEW

Pure White

Cashmere

Pebble Grey

Light Grey

Dust Grey

Indigo Blue

Graphite

Egger - W1000

Egger - U702

Egger - U201

Egger - U708

Egger - U732

Egger - U599

Egger - U961

GLOSS METALLIC FINISHES -

.!Ăź4 UXC

NEW CONCRETE FINISHES

Notes: Metallic colours have a %.!0%+*(Ăź*%/$/%* %0!  by arrows on the protective Ăź()Ä‹Ćľ..+3//$+1( (("! in the same direction when Ăź00%*#Ä‹.%((%*#)1/0! /,!%Ăź! (!"0+..%#$0$*  with metallic doors.

Fjord Metallic

Gold Metallic

NEW

NEW

NEW

Brunswick Concrete (UXC)

Hayward Concrete (UXA)

Trellick Concrete (UXA)

WOODGRAIN EFFECT - Matching edge only. .!Ăź4Ćľ

Character Graphite

Reclaimed Oak

Egger - H3452

Egger - H1180

White Halifax Oak

Natural Davos Oak

Sepia Gladstone Oak

Black Ash

Egger - H3131

Egger - H3342

Egger - U999

+0!/Ä?Ćľ(()"3++ #.%*!Ăť!0Ăź*%/$!/+)!%*2!.0%(#.%* %.!0%+*//0* . * )0$%*#! #!+*(5Ä‹ Egger - H1176

1.79

Order Online www.pws.co.uk


UNITY - MADE-TO-MEASURE

The easiest way to order UNITY is on www.pws.co.uk

KEY FEATURES  Contemporary, madeto-measure slab door collection Ćľ2%((!%*ĂăĂź*%/$!/ including high gloss, supermatt, woodgrain !Ăť!0* "!01.! ĆŤ+*.!0!Ăź*%/$!/  2 edge options  Angled door options and a huge array of accessorisation make Stanhope suitable for kitchens, bedrooms & bathrooms  Drilling service  Manufactured in the UK with an 11 day lead-time

UNITY shown in Gloss metalic Fjord and Gloss Pure White

ORDERING BESPOKE DOOR SIZES IN UNITY UNITY Made-to-Measure Collection is available to order in bespoke sizes within set parameters (see below) or from a ‘Quick Order List’ of ,.!ÄĄ !Ăź*! /%6!/* + !/Ĩ,(!/!/!!.%! %/0"+.Ăź((+. !.(%/0* ,.%%*#ÄŠÄ‹$!!/%!/0350++. !. %/0 www.pws.co.uk

BESPOKE DRAWER/DOOR SIZE PARAMETERS

How-to-order UNITY

Ćľ(( ++.Ăź*%/$!/.!2%((!%*0$!"+((+3%*#/%6!/Ä?

The easiest way to order is on www.pws.co.uk

Ä‘ %*%)1)$!%#$0Ä Ä€Ä€))0+)4%)1)$!%#$0ĂĆąĀ)) • Minimum width 100mm to maximum width 897mm DRAWERS

To order bespoke sizes follow the following steps: Ä Ä‹ *,10!/,+'!,.!Ăź4+ !Ä?

Height Min - 100mm Width Min - 100mm

Height Max - 280mm Width Max - 1197mm

Code

Description

***BESPOKE

Bespoke size door

ľľľ/$+1( !.!,(! 3%0$,.!ĥß4+"$+/!* ++.ß*%/$Ģ please see each range page for more information

STANDARD DOORS Height Min - 281mm

Height Max - 895mm

Width Min - 100mm

Width Max - 1197mm

STEP 2. Choose door height/width (see door/drawer size parameters on each range page)

STEP 3. Choose further options (where relevant) – e.g. angled doors, door drilling etc. Please see each range page for relevant options

TALL DOORS Height Min - 896mm

Height 4ĥĂĆąĀ))

Made-to-Order lead-times

11 DAYS* Width Min - 100mm

LEADTIME

Width Max - 897mm *For orders placed before 12 noon, ! *!/ 510ĥ+Ýċ

The lead-times for Made-to-Order are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, in the form of a delivery date, will !+*Ăź.)! 3%0$!$%* %2% 1( order acknowledgement

T: 01325 505599 (North) | 88 (South)

1.80


UNITY - MADE-TO-MEASURE

ORDER AT PWS.CO.UK

ANGLED DOOR OPTIONS TW

TW

• Angled doors are available within the same door size parameters (%/0! +2!Ĩ1,0+ĂĆąĀ4ĉĊĈ))ĩ

A

LH

B

RH LH

RH

B

LH

RH

LH

A

• When ordering, please specify the type of angled door (A or B) and dimensions for Left Hand Height (LH), Right Hand Height (RH), Bottom Width (BW) and for stepped angled doors specify Top width (TW).

RH

đ Ƶ*#(!  ++./*!/,!%ü! +*. !6+*!+.5+),(!0%*# the PWS ‘ANGLED DOOR ORDER FORM’. • Additional 5 day lead time will apply to orders that include angled doors. BW

BW

BW

BW

DOOR DRILLING SERVICE Default hinge holdes by door size (based on standard PWS drilling pattern - see below) Please note: illustrations shown are left hand. 2001mm- 2400mm High

280mm - 720mm High 100mm

• A door drilling service for UNITY is available, charged at £1 a hole.

100mm

100mm

1501mm- 2000mm High

• Door drilling can be selected at the point of order on Tradezone or by completing the PWS ‘DOOR DRILLING ORDER FORM’.

100mm

901mm – 1500mm High

• PWS’s recommended standard drilling pattern is 100mm (+/- 1mm) from the ends with a 13.5mm deep hole (+/- 0.5mm), hole diameter of 35mm (+/- 0.2mm) and centre of hole 22.5 (+/- 0.5mm) from the side from side.

100mm

• Additional hinge holes will be drilled by default depending on door height as indicated in the above illustrations.

100MM - 900mm High

• Top Box drilling is available for door heights between 280-720mm $%#$Ĩ+,ǫ+4,,(%0%+*)1/0!/,!%ü! 00$!,+%*0+"+. !.ĩċ

100mm

đ 1!0+ %.!0%+*(ü*%/$Č .%((%*#+*)!0((% ++.//$+1( ! stipulated left or right hand (please note illustrations shown above are left handed). 100mm 22.5mm

100mm 22.5mm

3rd hole positioned centrally

100mm 22.5mm

3rd and 4th holes positioned equidistant between top/ bottom hole and centre line

100mm 22.5mm 3rd hole positioned centrally. 4th and 5th holes positioned equidistant from top/bottom hole and centre line

• Drilling is not available on angled doors or end panels. • Please allow 2 days’ additional lead-time to all orders that require drilling. • PWS are unable to accept any surplus doors to be returned once they have been drilled.

ACCESSORIES All accessory sizes shown in !%#$04% 0$4!,0$

Cornice

Feature Posts

***C30

Modern Cornice/Light Pelmet 70x3000x18mm, edged one long side only with a blank finish on the hidden face

***CP715

Corner post, 715x70x18mm - supplied in pairs

***CP685

Corner post, 685x70x18mm - supplied in pairs

Plinth GLOSS/MATT Plinth 150x3000x18mm, edged one long side only with a blank finish on the hidden face

End Panels ***BESPOKE (input height/width)

***P30 WOODGRAIN Plinth 150x2800x18mm, edged one long side only with a blank finish on the hidden face

End panels are available to order as a standalone product type in the same made-to-measure sizes as doors. End panels are supplied in a )0$%*#! #!+*(5* ! #! ((ą/% !///0* . ċ Pelmet and plinth are edged on one long side only with a matching edge.

1.81

Order Online www.pws.co.uk


UNITY - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

UNITY Supermatt Light Grey with angled doors, Supermatt Graphite with true handleless rail

ǫ!/,+'!)%.+32!ĥ+2!* ++./%6!/"+.ę*+ġü((!.Ě !/%#*

3+ġ0+*!ă#(//!û!0! #%*#

Extra wide 1200mm wide drawers

T: 01325 505599 (North) | 88 (South)

1.82


FRAMED GLAZED DOORS FEATURE MODERN GLAZED DOORS OVERVIEW Ƶ2%((!%*ăü*%/$!/Č0$!/!"!01.!#(6!  ++./ /+,$%/0%0! !*0 to contemporary kitchen designs and work well in a handleless context for a seamless, ultra-modern look.

FURTHER INFORMATION: 20mm door thickness, constructed aluminium frame with glazed front face. 1,,(%! 3%0$"1((ü00%*#'%0%*(1 %*#$%*#!Č+),0%(!)+1*0%*#',(0! and soft close adjustment.

PRODUCT OVERVIEW DOOR FAMILY STYLE

Glazed framed door

DOOR THICKNESS

20mm

SUBSTRATE

Aluminium frame with glazed panel Black Glazed Black frame with tinted glass

FINISH

PRICE BAND

BLACK GLAZED (BGL) (Supplied with hinge and handle)

BRONZE GLAZED (BRGL) (Supplied with hinge only - recommended for handleless look)

FLUTED GLAZED (FLG) (Supplied with hinge only - recommended for handleless look)

AVAILABLE SIZES: **715G

ĈāĆ4ąĊĈ))Č#(6!

**716G

715x597mm, glazed

Bronze Glazed Brown frame with smoked glass

**895G

ĉĊĆ4ąĊĈ))Č#(6!

Fluted Glazed ǫ('".)!3%0$ý10! (!.#(//

**896G

895x597mm, glazed

£ £ £ £ £

ALUMINIUM EFFECT GLAZED DOORS OVERVIEW Constructed from a mitred metallic foil wrapped MDF frame 15mm thick with ą))0$%'".+/0! 0+1#$!*! #(//* %*0!#.0! $* (!ċ

SIZE OPTIONS: Available in a number of key sizes including 3 handleless options which can be used for bi-fold door solutions.

1.83

Order Online www.pws.co.uk

AE356G

355x597mm, without handle

AE356HG

355x597mm, with integrated handle

AE358G

355x797mm, without handle

AE358HG

355x797mm, with integrated handle

AE350G

355x997mm, without handle

AE350HG

355x997mm, with integrated handle

ƵĈāą

715x397mm, with integrated handle

AE715HG

ĈāĆ4ąĊĈ))Č3%0$%*0!#.0! $* (!

AE895HG

ĉĊĆ4ąĊĈ))Č3%0$%*0!#.0! $* (!


TAMBOUR DOORS STANDARD TAMBOUR DOOR - STAINLESS STEEL EFFECT OVERVIEW 0%*(!///0!!(!û!0)+1. ++./1,,(%! 3%0$ü00%*#'%0%*(1 %*# roller and rolls, mounting bracket and track, screws and cover strips. Handle not included.

SIZE OPTIONS: Suitable for use with an 18mm carcase (265mm carcase depth required) Available to suit 500mm, 600mm, 800mm and 1000mm modular widths in 2 height options TDK1210X500

0* . 0)+1. ++.'%0ČāāĈą4ąćą))

TDK1210X600

0* . 0)+1. ++.'%0ČāāĈą4Ććą))

METALLIC TAMBOUR DOOR - STAINLESS STEEL EFFECT OVERVIEW !0((%ü*%/$)+1. ++.0$0"!01.!/ !+.0%2!"/%0.%)0$0+*!(/ 0$!! #!+"0$!./!ċ1,,(%! 3%0$ü00%*#'%0%*(1 %*#.+((!.* .+((!. mounting bracket, track, screws and cover strips.

SIZE OPTIONS: Suitable for use with an 18mm carcase (265mm carcase depth required) Available to suit 500mm and 600mm modular wide units MTDK1210X500

!0((%0)+1. ++.'%0ČāāĈą4ąćą))

MTDK1210X600

!0((%0)+1. ++.'%0ČāāĈą4Ććą))

Carcase depth required - 265mm 0%/!//!*0%(0$00$!.+((!.)!$*%/)%/ü00! 0+0$!1*%0!"+.!%0%/ü00!  in place and the carcase is lying horizontal. Please refer to the manufacturer’s instructions, supplied with the unit, prior to installation.

DELUXE TAMBOUR DOOR - STAINLESS STEEL EFFECT OVERVIEW Deluxe Tambour door that features a decorative fascia trim that conceals 0$!! #!+"0$!./!ċ1,,(%! 3%0$ü00%*#'%0%*(1 %*#.+((!.* .+((!. mounting bracket, track, screws and cover strips. Handle not included.

SIZE OPTIONS: Suitable -for use with an 18mm carcase (265mm carcase depth required) Available to suit 500mm, 600mm, 800mm and 1000mm modular widths in 2 height options DTDK1210X500

!(14!0)+1. ++.'%0ČāāĈą4ąćą))

DTDK1210X600

!(14!0)+1. ++.'%0ČāāĈą4Ććą))

T: 01325 505599 (North) | 88 (South)

āċĉą


PAINT-TO-ORDER ORDER FLOW CHART

Paint-to-Order Service

The easiest way to order is at www.pws.co.uk Select Door Style ǫ.+ +'Ĩǫ,.!ü4ĩ ƫ(.!* +*Ĩ,.!ü4ĩ

Order Complete

((!.0+*Ĩ ,.!ß4Ċ %06.+5Ĩ,.!ß4Ċ 1*0+*Ĩ,.!ß4Ċ

%$ß!( Ĩ ,.!ß4Ċ

Select Colour

Enter Quantity

30 options

Qty

 15 days leadtime* _

%(+1.*!Ĩ,.!ß4Ċ +.*%*#0+*Ǎ! ! Ĩ Ǎ,.!ß4Ċ

7 days remedial* *Subject to capacity

+.*%*#0+*$'!.Ĩ ,.!ß4Ċ +.0!. 00Ĩ ,.!ß4Ċ !)+ 00Ĩ ,.!ß4Ċ

Order Complete

 Select Door Style +.0!.(+//Ĩ,.!ß4Ċ !)+(+//Ĩ,.!ß4Ċ

Select Colour

Enter Quantity

30 options

Qty

21 days leadtime* _ Ä Ä… 5/.!)! %(Äľ For orders placed before 12 noon Wednesday 10+Ăť

When placing orders for paint-to-order doors please be aware of the following:

1.

Stated lead times for Paint-to-Order are designed as a guideline and always subject to manufacturing capacity. Ćľ*1.0!(! ÄĄ0%)!ÄŒ%*0$!"+.)+" !(%2!.5 0!ÄŒ3%((!+*Ăź.)! 3%0$!$ individual order acknowledgement.

2. 3.

Orders for paint-to-order door ranges can be placed by email or via the PWS website. Upon receipt of each order to PWS you will receive an itemised order acknowledgement.

Due to the bespoke nature of paint-to-order products, it is not possible to cancel or amend orders once placed. Additions to an order will be processed as a new order.

4.

Orders for painted product will be dispatched upon completion of the full order No part orders will be dispatched.

5.

PWS cannot accept the return of surplus paint-to-order product.

6.

Although we strive to maintain consistency, as a painted product there will be batch-to-batch variances. PWS cannot guarantee an exact colour match between orders. We do not recommend mixing doors ordered through paint-to-order with doors ordered from stock.

7.

The paint colours depicted in our marketing materials are indicative of the colours of the painted product. Paint colours do vary batch to batch and substrate to substrate.

8.

A selection of care and maintenance kits are available for paint-to-order colours.

1.85

Order Online www.pws.co.uk


CARE & MAINTENANCE KITS CARE & MAINTENANCE KIT 1%0(!"+..!,%.%*#)%*+./1û).'/ * /.0$!/ċ+."1(((%/0+"ü*%/$ options see the price list.

CODES FOR CARE & MAINTENANCE KITS MATT

GLOSS

Care & maintenance kit (matt) for selected stocked door ranges and paint to order colours

Care & Maintenance kit (gloss) paint-to-order colours

Care & Maintenance Kit contents: CKPWSBA

Classic Alabaster for Broadoak

CKG/ALABMOD

CKPWSBN

Broadoak Natural doors

CKG/CADET

Cadet

• 1x touch up pen

CKPWSRDA

Milbourne Alabaster doors

CKG/CASHMERE

Cashmere

• 1x softwax applicator

CKPWSRDC

Milbourne Chalk doors

CKG/CHALK

Chalk

CKPWSRDS

Milbourne Sage doors

CKG/CHALKBLUE

Chalk Blue

CKPWSALABMOD

Alabaster Modern

CKG/CHARCOAL

Charcoal

CKPWSCADET

Cadet

CKG/CHINABLUE

China Blue

CKPWSCASHMERE

Cashmere

CKG/COPSEGR

Copse Green

CKPWSCHALK

Chalk

CKG/CORNFLOWER

ƫ+.*ý+3!.

CKPWSCHALKBLUE

Chalk Blue

CKG/DOVEGREY

Dove Grey

CKPWSCHARCOAL

Charcoal

CKG/DRYROSE

Dry Rose

CKPWSCHINABLUE

China Blue

CKG/DUSTGREY

Dust Grey

CKPWSCOPSEGR

Copse Green

CKG/FLINTGREY

Flint Grey

CKPWSCORNFLOWER ƫ+.*ý+3!.

CKG/GRAPHITE

Graphite

CKPWSDOVEGREY

Dove Grey

CKG/HARTBLUE

Hartforth Blue

CKPWSDRYROSE

Dry Rose

CKG/LAVA

Lava

CKPWSDUSTGREY

Dust Grey

CKG/MUSSEL

Mussel

CKPWSFLINTGREY

Flint Grey

CKG/PGREY

Partridge Grey

CKPWSGRAPHITE

Graphite

CKG/PORCELAIN

Porcelain

CKPWSHARTBLUE

Hartforth Blue

CKG/PUTTY

Putty

CKPWSLAVA

Lava

CKG/SAGE

Sage

CKPWSMS

Sage

CKG/SILVERGREY

Silver Grey

CKPWSMUSSEL

Mussel

CKG/SLATE

Slate

CKPWSPGREY

Partridge Grey

CKG/STONE

Stone

CKPWSPORCELAIN

Porcelain

CKG/STORMBLUE

Storm Blue

CKPWSPUTTY

Putty

CKG/SUEDE

Suede

CKPWSSILVERGREY

Silver Grey

CKG/TRENCHCG

Trench Coat Grey

CKPWSSLATE

Slate

CKG/TRUFFLE

.1ÿ!

CKPWSSTONE

Stone

CKG/WHITE

White

CKPWSSTORMBLUE

Storm Blue

CKG/CARBON

Carbon

CKPWSSUEDE

Suede

CKG/REGIMENT

Regiment

CKPWSTRENCHCG

Trench Coat Grey

CKPWSTRUFFLE

.1ÿ!

CKPWSWHITE

White, Remo and Porter Matt White

CKPWSCARBON

Carbon

CKPWSREGIMENT

Regiment

• 1x softwax

• 1x scotchbrite pad

TOUCH UP LACQUER

TOUCH UP LACQUER, 150ML AEROSOL (MATT)

Suitable for repairing min+./1û).'/ * /.0$!/ċ+."1(((%/0+"ü*%/$ options see the price list

Touch up lacquer, 150ml aerosol (matt) for selected Milbourne door ranges and classic Paint-to-order colours

Alabaster Modern

MLPWSBA

Classic Alabaster for Broadoak

MLPWSRDA

Alabaster

MLPWSCADET

Cadet

MLPWSRDC

Chalk

MLPWSCASHMERE

Cashmere

MLPWSRDL

Almond

MLPWSCHALK

Chalk

MLPWSRDS

Sage

MLPWSCHALKBLUE

Chalk Blue

MLPWSSILVERGREY

Silver Grey

MLPWSCHARCOAL

Charcoal

MLPWSSLATE

Slate

MLPWSCHINABLUE

China Blue

MLPWSSTONE

Stone

MLPWSCOPSEGR

Copse Green

MLPWSSTORMBLUE

Storm Blue

MLPWSCORNFLOWER

ƫ+.*ý+3!.

MLPWSSUEDE

Suede

MLPWSDOVEGREY

Dove Grey

MLPWSTRENCHCG

Trench Coat Grey

MLPWSDRYROSE

Dry Rose

MLPWSTRUFFLE

.1ÿ!

MLPWSDUSTGREY

Dust Grey

MLPWSCARBON

Carbon

MLPWSFLINTGREY

Flint Grey

MLPWSREGIMENT

Regiment

MLPWSGRAPHITE

Graphite

MLPWSHARTBLUE

Hartforth Blue

MLPWSLAVA

Lava

MLPWSMS

Sage

MLPWSMUSSEL

Mussel

MLPWSPGREY

Partridge Grey

MLPWSPORCELAIN

Porcelain

MLPWSPUTTY

Putty

T: 01325 505599 (North) | 88 (South)

1.86


DOOR DRILLING SERVICE

+û!./ ++. .%((%*#/!.2%!0+$!(,)'!5+1. installation quicker, easier and more precise. This year, 3!Ě.!,(!/! 0+*+3+û!.0$%//!.2%!"+.((/0+'!  lay-on doors and paint-to-order products.

NOW AVAILABLE FOR

ALL STOCKED LAY-ON DOORS

It’s quick and easy to specify your requirements to us upon placing your order via the PWS website, www.pws.co.uk, with various options available to make the process as streamlined as possible.

including paint-to-order products

PRODUCT AVAILABILITY CLASSIC

MODERN

Door drilling service

STOCKED DOORS

Door drilling service

STOCKED DOORS

BELSAY



LICHFIELD

BROADOAK





PORTER

NOT GLOSS PTO

CLARENDON



REMO

NOT GLOSS PTO

ELLERTON



FEATURE GLAZED

FITZROY



HUNTON



MILBOURNE



MORNINGTON SHAKER



MORNINGTON BEADED



1909 SLAB



1909 SHAKER



1909 OVOLO



 Door drilling service

MADE - TO - MEASURE NONSTOCKED ALPINA



STANHOPE



UNITY



AS STANDARD • All hinge holes are based on a standard size - 35mm diameter (+/- 0.2mm) x 13.5mm depth (+/- 0.5mm) • Set positioning - centre point 22.5mm from side (+/- 0.5mm), 100mm (+/- 1mm) from top/bottom

2001mm- 2400mm High

280mm - 720mm High 100mm

100mm

100mm

1501mm- 2000mm High 100mm

901mm – 1500mm High 100mm 100MM - 900mm High 100mm

• Additional hinge holes will be drilled by default depending on door height as indicated on the illustrations opposite 100mm

• Upon ordering, please specify whether your door is to be drilled on the left or the right

1.87

Order Online www.pws.co.uk

22.5mm

100mm 22.5mm

3rd hole positioned centrally

100mm 22.5mm

3rd and 4th holes positioned equidistant between top/ bottom hole and centre line

100mm 22.5mm 3rd hole positioned centrally. 4th and 5th holes positioned equidistant from top/bottom hole and centre line


+3 WORKING DAYS

NEW DOOR DRILLING SERVICE FOR PAINTED PRODUCTS Choosing to have your doors drilled before they .!,%*0! $!(,/0+/%#*%ü*0(5.! 1! )#! – and makes things easier for you and your customers all round.

LEADTIME

LEAD TIME An additional 2 working days’ lead time applies to all orders that require drilling.

KEY DETAILS • Door drilling is charged at £1 a hole.

IT’S ALL MOVING ONLINE As part of our continuous improvement programme, we are launching a brand new website and ordering platform in early 2020, which will make drilling /,!%ü0%+*)1$-1%'!.* !/%!.ċ

• Top Box drilling is available for door heights between 280-720m • Drilling is not currently available on corner doors, curved doors, or end panels • Unfortunately surplus doors are unable to be returned once they have been drilled

Soon, we will be transitioning all drilling orders online (however we will still accept manual drilling order forms during the transitional period).

Please contact your customer services advisor for any help or advice on our door drilling service

1909 JOINERY SERVICE In addition to drilling for conventional hinges, 3!(/++û!.&+%*!.5/!.2%!"+.āĊĀĊ%*ġ".)! Shaker and Ovolo doors. This includes: • Notched frame and doors for butt hinges • An array of door beading options It’s quick and easy to specify your 1909 joinery requirements upon placing your order via the PWS website www. pws.co.uk – or alternatively speak to your customer services advisor for guidance. Ƶ((āĊĀĊü*%/$%*#0+1$!/.!)!0%1(+1/(5 hand crafted through expert PWS craftsman with the very best care and attention to detail. $!,(!/1.!+"ü*! !/%#*Č(%!/%*0$!ü*%/$ċ

See 1909 order process on page 1.131

T: 01325 505599 (North) | 88 (South)

1.88


CO-ORDINATING MFC BOARD OPTIONS $!!(+3 ƫ+. +,0%+*/.!+*(5/1##!/0! )0$!/0++1. ++.+(+1./*  +*+0*!!//.%(5+û!. %.!0)0$ċ!/0.+*#(5 .!+))!* 0$05+1+. !.+. /),(!/* +),.!#%*/00$! ++.!"+.!)'%*#5+1.ü*(%*!0ü*%/$/!(!0%+*ċ

STOCKED AND PAINT-TO-ORDER DOOR COLOURS COLOUR

STOCK DOOR AVAILABILITY

Alabaster

Broadoak, Milbourne

PAINT-TO-ORDER AVAILABILITY

Alabaster Modern

MFC BOARD OPTIONS

-

Kronospan - U7031



##!.ġāĀąČ .+*+/,*ġĈĀăā

Cadet

-



n/a

Carbon

-



Egger - U999, Kronospan - 0190

Cashmere

Belsay, Porter (matt/gloss), Remo (matt/gloss)



Egger - U702, Kronospan - 5981

Chalk

Ellerton, Milbourne



n/a

Chalk Blue

-



n/a

Charcoal

Milbourne



n/a

China Blue

-



n/a

Copse Green

-



n/a

ƫ+.*ý+3!.

-



n/a

Dove Grey

Belsay, Fitzroy, Milbourne, Mornington Shaker/Beaded, Porter (matt/gloss), Remo (matt/gloss)



Egger - U708, Kronospan - 0112

Dry Rose

-



n/a

Dust Grey

Clarendon, Fitzroy, Hunton, Milbourne, Mornington Shaker/Beaded, Porter (matt/gloss), Remo (matt/gloss)



Egger - U732, Kronospan - 0171

Flint Grey

-



n/a

Graphite

Belsay, Fitzroy, Milbourne, Mornington Shaker/Beaded, Porter (matt/ gloss), Remo (matt/gloss)



##!.ġĊćāČ .+*+/,*ġĀāćą

Hartforth Blue

Fitzroy, Hunton, Milbourne, Mornington Beaded/shaker, Porter (matt)



##!.ĆĊĊ .+*+/,*ġĉĊĉąǫ

Lava

-



##!.ġĈąāČ .+*+/,*ġĈāĉą

Mussel

-



Egger - U100, Kronospan - 5982

Partridge Grey

ǫ.+ +'Č%06.+5Č %$ü!( Č %(+1.*!Č +.*%*#0+*ǫ! ! ĥ$'!.



n/a

Porcelain

ǫ!(/5Čƫ(.!* +*Č%06.+5Č %$ü!( Č %(+1.*!Č +.*%*#0+*ǫ! ! ĥ Shaker, Porter (matt/gloss), Remo (matt/gloss)



Egger - W1200

Putty

-



n/a

Regiment

-



n/a

Sage

Milbourne



n/a

Silver Grey

Porter (matt/gloss), Remo stock (matt/gloss)



Egger - U765

Slate

-



n/a

Stone

Broadoak, Fitzroy, Milbourne, Mornington Beaded/Shaker



Egger U201

Storm Blue

-



n/a

Suede

-



n/a

Trench Coat Grey

-



n/a

.1ÿ!

-



##!.ġĈąĉ

White

Porter (matt/gloss), Remo (matt/gloss)

-

Egger - W1000, Kronospan - 0113

TIMBER DOOR RANGES COLOUR

STOCK DOORS

MFC BOARD OPTIONS

Espresso

%$ü!(

Egger - H3155, Kronospan - K016

Natural Oak

Broadoak

Egger - H3368, Kronospan - 8925

1.89

Order Online www.pws.co.uk


UNITY MADE-TO-MEASURE - COLOURS COLOUR

DOOR OPTIONS

MFC BOARD OPTIONS

Cashmere

Acrylic Gloss, Supermatt PVC

Egger - U702, Kronospan - 5981

Dust Grey

Acrylic Gloss, Supermatt PVC

Egger - U732, Kronospan - 0171

Fjord

Metallic Gloss

Egger - U636, Kronospan - K097

Gold

Metallic Gloss

n/a

Graphite

Acrylic Gloss, Supermatt PVC

##!.ġĊćāČ .+*+/,*ġĀāćą

Indigo

Supermatt PVC

Egger - U599

Light Grey

Acrylic Gloss, Supermatt PVC

Egger - U708, Kronospan - 0112

Pebble Grey

Supermatt PVC

Egger - U201

Pure White

Acrylic Gloss, Supermatt PVC

Egger - W1000, Kronospan - 0113

UNITY MADE-TO-MEASURE - WOODGRAINS COLOUR

MFC BOARD OPTIONS

Black Ash

Egger - U999, Kronospan - 0190

Character Graphite

##!.ġăąĆĂ

Natural Davos Oak

Egger - H3131, Kronospan - K006

Reclaimed Oak

Egger - H1180, Kronospan - K003

Sepia Gladstone Oak

##!.ġăăąĂ

Smoked Ash

Egger - H3766

White Halifax Oak

Egger - H1176, Kronospan - 5529

STANHOPE MADE-TO-MEASURE COLOUR

MFC BOARD OPTIONS

Gloss White

##!.ġĊĉĀČ .+*+/,*ġ āĀāČý!% !.!.ġăĀĀČ%*/ġĀĂĀ

Gloss Cream

##!.ġāĀąČ .+*+/,*ġĆāąĥĈĀăāČý!% !.!.ġāăĀćČ%*/ġćĆǫ

Gloss Haze

n/a

Concrete

n/a

Porcelain

Egger - W1100

Alabaster

##!.ġāĀąČ .+*+/,*ġĆāąČý!% !.!.ġāăĀăČ%*/ġćĆǫ

Mussel

##!.ġāĀĀČ .+*+/,*ġĆĊĉĂČý!% !.!.ġāăăāČ%*/ġāĊą

Cashmere

##!.ġĈĀĂČ .+*+/,*ġĆĊĉāČý!% !.!.ġāāćĉČ%*/ġāĆ

Dove Grey

##!.ġĈĀĉČ .+*+/,*ġĀāāĂČý!% !.!.ġāāĉĉČ%*/ġāĂ

Stone

##!.ġĈĂĈČ .+*+/,*ġ ĀĊćČý!% !.!.ġāāĉąČ%*/ġąĀ

Blue Canvas

##!.ġĆąĀČý!% !.!.ġāĉĀĀĂĨāĈāĈĩ

Graphite

Egger - U961

Super White Woodgrain

##!.ġĊĉĀČ .+*+/,*ġ āĀāČý!% !.!.ġăĀĀČ%*/ġĀĂĀ

Cream Woodgrain

##!.ġāĀąČ .+*+/,*ġĆāąČý!% !.!.ġāăĀăČ%*/ġćĆǫ

Grey Woodgrain

##!.ġĈĀĉČ .+*+/,*ġĀāāĂČý!% !.!.ġāāĉĉČ%*/ġāĂ

Mussel Woodgrain

##!.ġāĀĀČý!% !.!.ġāăăāČ%*/ġāĊą

Cashmere Woodgrain

##!.ġĈĀĂČ .+*+/,*ġĆĊĉāČý!% !.!.ġāāćĉČ%*/ġāĆ

Slaley

Egger - H1796, Finsa - 358

Falstone

##!.ġāāąćČ .+*+/,*ġĉāĊĈČý!% !.!.ġąĂĉĆČ%*/ġĀă

Natural Walnut

##!.ġăĈĀĂČ .+*+/,*ġćĂĂąČý!% !.!.ġăĀĀĀćČ%*/ġćĀ

Please Note: for any colour without a suggested board option we recommend considering a contrasting colour or woodgrain

T: 01325 505599 (North) | 88 (South)

1.90


KITCHEN FASCIA MATRIX FOR LAY-ON DOORS This matrix can be referred to when planning lay-on doors. Availability varies between ranges. Please see relevant door range pages earlier in The Directory for full range content.

1.91

Order Online www.pws.co.uk


T: 01325 505599 (North) | 88 (South)

1.92


APPLIANCE DOOR COMBINATIONS FOR LAY-ON DOORS To be used with appliances (600mm wide) in tower and studio units

Note: Appliance heights do vary, oven 0.%))!./ÄĽĂź((!./)5*!! 0+! increased or decreased in size. It is advisable to check door sizes available before ordering appliances. Not all doors are available in every range, please refer to price list.

1.93

Order Online www.pws.co.uk

645 645


645

645 4

645

645

T: 01325 505599 (North) | 88 (South)

āċĊą


KITCHEN FASCIA MATRIX FOR HUNTON $!!(+3+*ü#1.0%+*/.!/! +*/0+'! /%6!/+"1*0+*.*#!* ((/$+3*!(+32+% 0$!*!! "+.ü((!.,*!(/ċ(!/!*+0!0$! *!3/%6!/.!/$+3*%*ǫ %*(1 %*#ąĀĀ))ČĉĂĆ))* ćĉĆ)) !/%#*! "+.ü((!.".!!/+(10%+*/+*,+,1(.,,(%*!+*ü#1.0%+*/ċ

TALL HEIGHT INSTALLATION (2150mm Carcase)

2120

NEW

MEDIUM HEIGHT INSTALLATION (1970mm Carcase)

NEW

LOW HEIGHT INSTALLATION

NEW

1.95

Order Online www.pws.co.uk


NEW

NEW

NEW

NEW

T: 01325 505599 (North) | 88 (South)

1.96


APPLIANCE DOOR COMBINATIONS FOR HUNTON MEDIUM HEIGHT INSTALLATION (1970mm Carcase)

SINGLE OVEN CONFIGURATIONS

645

645

645

645

645

645

645

645

595

595

595

595

595

595

595

595

139

175 175 175 175

140

140

139 715

570

355 355

283 283

SINGLE OVEN AND COMPACT

SINGLE OVEN AND WARMING DRAWER CONFIGURATIONS

570

283 283

450

NEW NEW 400 400

NEW NEW 400 400

455

455

455

595

595

595

139

139 175 175

290 139

450

283

COMPACT APPLIANCE CONFIGURATIONS

COMPACT AND WARMING DRAWER CONFIGURATIONS

645

645

645

645

645

645

645

645

645

645

645

645

645

645

455

455

455

455

455

455

455

455

455

455

455

455

455

455

140

140 139

140

140 139

140 175 175 175

290

290

139

139 139

283

139

139 139

283

139 175

570

570

283

283

283

283

715

355

570 355

283 283

175

TALL HEIGHT INSTALLATION

NEW NEW 825 825

595

NEW NEW 825 825

595 139

715

570

283

NEW NEW 825 825

NEW NEW 825 825

595

595

595

355 355

355

283

825 825

NEW NEW

715

570

355

SINGLE OVEN CONFIGURATIONS

(2150mm Carcase)

139 283 283

175 175 175 175

825 825

NEW NEW 825 825

NEW NEW 825 825

595

595

595

175

140

140

570

645

645

645

645

595

595

595

595

595

175

175 139

175

175 139

175

715

570

283

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

455

455

455

455

455

455

140

140 139

140

140 139

290

290

715

570

140 175 175 175 175

NEW NEW

455

825 825

Order Online www.pws.co.uk

NEW NEW

355 355

283 283

570

175

NEW NEW

645

825 825

NEW NEW 825 825

175 175

SINGLE OVEN AND WARMING DRAWER CONFIGURATIONS

355 355

283

175 175 175

645

645

645

645

645

455

455

455

455

455

140 175

140 175 139

140 175

140 175 139

715

570

283

140 175 175 175

283 283

283

175 175

355 355

283 283

CONFIGURATIONS

1.97

355

290 139 283


SINGLE, COMPACT AND WARMING DRAWER

NEW NEW 400 400

455

DOUBLE OVEN CONFIGURATION

SINGLE OVEN AND 388 MICROWAVE CONFIGURATIONS

NEW NEW 400 400

NEW NEW 400 400

NEW NEW

455

388

388

400 400

570

645

2 X COMPACT APPLIANCES

570

715

645

715

388 595

595

140

140 175 175

355

595

645

455

455

140

570

400 400

645

595

595

355

355

355

NEW NEW 685 685

NEW NEW 400 400

NEW NEW

595

595

595

595

400 400

NEW NEW 400 400

NEW NEW 400 400

455

455

595

595

570

455

388

595

595

140

175 NEW NEW 400 400

450

140 355

SINGLE OVEN AND MICROWAVE

490

NEW 685 685

645

388

388

388

NEW NEW 825 825

595

595

595

139

139

139

283

325

355

139 283

COMPACT AND WARMING DRAWER CONFIGURATION

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

NEW NEW 825 825

455

455

455

455

455

455

455

455

455

139

139 139

283

139

139 139

283

140

140

570

570

283

283

283

283

139 175 175 175 175

355

715

715

890

890

139 175

175

355

355

175 175

NEW NEW 825 825

890

825 825

715

570

890

NEW NEW

355

2 X COMPACT APPLIANCES

DOUBLE OVEN

715

COMPACT APPLIANCE CONFIGURATIONS

NEW NEW 400 400

SINGLE, COMPACT AND WARMING DRAWER CONFIGURATION

140

595 139

NEW NEW 400 400

175 175

355

355

455 595

355

2 X SINGLE OVEN CONFIGURATION

140 355

139

283

SINGLE OVEN CONFIGURATION

645

890

139

NEW NEW

283

455

450

890

455

283

SINGLE OVEN COMPACT AND SINGLE OVEN AND WARMING DRAWER COMPACT

490

890

890 595

COMPACT AND WARMING DRAWER CONFIGURATION

645

455

595

455

455

SINGLE OVEN CONFIGURATION

NEW NEW 825 825

NEW NEW 825 825

595

595

NEW 355355

355355 NEW

NEW 355355

NEW 355355

NEW NEW 400 400

175

2 X SINGLE OVEN CONFIGURATION

570

570

595

595

595

595

SINGLE, COMPACT AND WARMING DRAWER CONFIGURATION

355355 NEW

T: 01325 505599 (North) | 88 (South)

570

570

455

455

595

595

140

140

355355 NEW

1.98


KITCHEN FASCIA MATRIX FOR HUNTON HANDLELESS RAIL SIZES This matrix can be referred to when planning Hunton handleless. Please see relevant door range pages earlier in The Directory for full range content.

TALL HEIGHT INSTALLATION

MEDIUM HEIGHT INSTALLATION

LOW HEIGHT INSTALLATION

APPLIANCE HOUSING DOORS - ELLERTON APPLIANCE HOUSING DOORS - ELLERTON ((!.0+* ! doors ++./3%0$2!.0%($* (!,.+ü(!/ profiles for use Ellerton++./%*(1 doors include with vertical handle for in use in appliance andlarder larderapplications. applications, appliance and and

1.99

Order Online www.pws.co.uk


KITCHEN FASCIA MATRIX FOR PORTER HANDLELESS RAIL SIZES This matrix can be referred to when planning Porter handleless. Please see relevant door range pages earlier in The Directory for full range content.

TALL HEIGHT INSTALLATION

MEDIUM HEIGHT INSTALLATION

LOW HEIGHT INSTALLATION

T: 01325 505599 (North) | 88 (South)

1.100


APPLIANCE DOOR COMBINATIONS FOR HANDLELESS PORTER AND HUNTON Please use this document as a one page guide to understand the product availability in the Porter and Hunton ranges, when planning built in appliance housings in handleless design. $!)&+.%05+"0$!/!+*ü#1.0%+*/!. %0!0$!*!! "+.ü((!./* .!/! +*0$!%* 1/0.5/0* . Ď(%#*%*#3%0$0$!)&+.%05+" ,,(%*!.* /ċ$!/%6!/%*0$!)0.%4!(+3.!%*(1/%2!+"/%6!/2%((!%*+.0!.* 1*0+*".+)0$!(5ġ+*.*#!/Č0++û!. wider breath of options. Aperture sizes are shown adjacent to the appliance type, with the actual appliance size shown beneath, in italics.

MEDIUM HEIGHT INSTALLATION

645

645

645

645

SINGLE OVEN AND COMPACT CONFIGURATIONS

SINGLE OVEN AND WARMING DRAWER CONFIGURATIONS

SINGLE OVEN CONFIGURATIONS

(1970mm Cabinet)

645

645

645

450

645

490

SIN AN

450

filler

460 (455)

1970mm Cabinet

600

600 (595)

(595)

139 715

355

283

175 175

283 570 283

645

645

645

645

645

645

645

460 (455)

139 715

355

570

355

355

645

645

645

139 283 283

175 175 175 175

290

139

139 139

283

283

(2150mm Cabinet)

570

570

715

570

283

645

645

645

139

139 139

283

283

283

283

283

355

715

895

685

685

139 175 175 175 175

SINGLE OVEN AND WARMING DRAWER CONFIGURATIONS

SINGLE OVEN CONFIGURATIONS

715

645

645 895

685

685

685

4 715 460 (455)

600 (595)

139

139

175

139

175

355 685

645

645

715

355

715

175

355

355

175 175 175

283

139 355

139

570

715

685

283

COMPACT AND WARMING DRAWER CONFIGURATION

645

715

715

139

175

895

685

685

645

645

139

139

175

175

460 (455) 140

460 (455)

175

600 (595)

139

140

355

460 (455)

139

Order Online www.pws.co.uk

715

715

900 (890)

600 (595)

2 X COMPACT CONFIGURATIONS

DOUBLE OVEN CONFIGURATIONS

570

175

715 355

1.101

160 355

645

355

283

TALL HEIGHT INSTALLATION

2150mm Cabinet

450

283

460 (455)

140

2150mm Cabinet

139

COMPACT APPLIANCE CONFIGURATIONS

460 (455)

460 (455)

600 (595)

140

COMPACT AND WARMING DRAWER CONFIGURATIONS

685

1970mm Cabinet

283

175 175

570 355

2 X COMPACT CONFIGURATION

139

filler

490

355

filler

570

685

645

645

355 715

715 355

355


SINGLE OVEN, COMPACT AND WARMING DRAWER CONFIGURATIONS

SINGLE OVEN AND MICROWAVE CONFIGURATIONS

450

450

490

filler

460 (455)

460 (455)

600 (595)

600 (595)

DOUBLE OVEN CONFIGURATIONS

450

645

645

715

900 (890) filler

filler

450

490

160

140 283

COMPACT AND WARMING DRAWER CONFIGURATION

645

570

715

139

139

355

325

175 175

355

355

283

SINGLE OVEN CONFIGURATION

645

645

460 (455)

645

600 (595)

140

490

355

355

355

355

SINGLE OVEN AND COMPACT CONFIGURATIONS

SINGLE OVEN, COMPACT AND WARMING DRAWER CONFIGURATIONS

715

645

filler

460 (455) 600 (595)

355

115

115

325

283

570

460 (455)

460 (455)

600 (595)

600 (595)

140

139 450

490

685

SINGLE OVEN AND MICROWAVE CONFIGURATIONS

715

685

645

139

139

139

283

325

355

175 450

400

COMPACT AND APPLIANCE CONFIGURATIONS

645

895

460 (455)

175

715

139

139 139

645

685

355 355

T: 01325 505599 (North) | 88 (South)

1.102


KITCHEN FASCIA MATRIX FOR CLARENDON Please use this document as a one page guide to understand the product availability in the Clarendon range. The sizes indicated above and beneath the door sets highlight the widths available and the sizes on the LHS indicate the heights.

MEDIUM HEIGHT INSTALLATION (1970mm Carcase) 260 300 350 400

450 500 550 600

800 900 1000

600

1000

400 500

1200

500

315 770

770

770 1220

68 frame profile

2020mm Frontal ( 1970mm Carcase)

1220

1220

2018

30mm worktop 770

770

770

100mm Plinth ( Including frame overhang)

260 300 350 400

450 500 550 600

770

300 500 400 600 450

800 900 1000

770

800 900 1000

770

500 900 600 1000 800

770

500 900 600 1000 800

600 800

600 800

TALL HEIGHT INSTALLATION Tall Height Installation (2150mm Carcase)

(2150mm Carcase) 300 500 400 550 450 600

Wall mounted microwave door set 600

500

500

495 950

950 1400

1

68 frame profile

2200mm Frontal ( 2150mm Carcase) 30mm worktop 770

770

100mm Plinth ( Including frame overhang)

260 300 350 400

770

450 500 550 600

800 900 1000

770

300 500 400 600 450

770

800 900 1000

770

500 900 600 1000 800

770

600 800

770

500 900 600 1000 800

600 800

Combination doors ( All combination doors available with and without a separate bottom rail for use with moulded plinth and dishwashers. Please refer to Price List for stock availability)

Built Builtunder underappliance appliance/ /sink sink applications applications

1006

948 545

68

768

545

507 315 167

600 B uilt under oven Appliance filler

1.103

600 B uilt under microwave

Order Online www.pws.co.uk

600 B elfas t s ink door set

600 Farmhous e s ink door set

800 Farmhous e s ink door set

147 497 297 597 447 Combination door

597 Combination door

Ĩ,!%(%/0,,(%*!.* //1$/ %!(!ÄŒ1!.+* +(" +,0 %Ăť!.!*0 /%6!)0.%4* +1.!/,+'!+Ăť!.*+))+ 0!/1$%*/0*!/Ä‹ÄŠ

597 Combination


Available in Madeto-Order sizes 315 - 1400

Each product type, ie drawer front, door set, tall door set etc. are available to order bespoke 3%0$%*/!0+"ü4!  parameters

Max. Height Min. Height

300 - 650

Min. Width

300 500 400 600

500

Max. Width

920 335

CURVED AND Tall Wall C urved CORNER DOORS Door S et

1250

1220

(All curved and corner door solutions are designed to work with the cabinet dimensions shown below) 950

2018

770

Tall Wall C orner Door Set

950

770

Wall C urved Door S et 300 500 400 600

600 800

260 300 350 400

450 500 550 600

Wall C orner Door Set

US Fridge Freezer

770

770

300

300 500 400 600

300 500 400 600

500

1430

B as e C orner Door S et

920

770

515

1400

300

B as e C urved Door S et

770

1250 260

300

340

C abinet s izes for curved and corner door sets 770

950

770

Tall Wall C orner Door S et 600 300

Tall Wall C urved Door S et 300 500 400 550 450 600

US Fridge Freezer

300

450 500 550 600

600

300 260 300 350 400

600 800

300 Wall C orner Door S et 600 300

Wall C urved Door S et 600

300 300

d without a d plinth and r stock

300 B as e C orner Door S et 900 2018

300

900

560

1006

560

B as e C urved Door S et

1425

1245

597

297 497 397 597

Combination door

Combination door

597 Combination door

297 497 397 597

560

Combination door

T: 01325 505599 (North) | 88 (South)

āċāĀą


APPLIANCE DOOR COMBINATIONS FOR CLARENDON Please use this document as a one page guide to understand the product availability in the Clarendon range, when planning built in appliance housings $!/!,,(%*!+*ü#1.0%+*/!. %0!0$!*!! "+.ü((!./* .!/! +*0$!%* 1/0.5/0* . * (%#*3%0$0$!)&+.%05+" appliance brands. Aperture sizes are shown adjacent to the appliance type, with the actual appliance size shown beneath, in italics. Ĩ,!%(%/0,,(%*!.* //1$/ %!(!Č1!.+* +(" +,0 %û!.!*0/%6!)0.%4* +1.!/,+'!+û!.*+))+ 0! such instances.)

MEDIUM HEIGHT INSTALLATION (1970mm Cabinet) 2020mm overall height including 50mm frame overhang  "   "

 "   "

  " "   "

   'O

 //2 +,.0-12

'O

'O

'O

'O

'O



'O

'O

'O

'O

'O

'O

,'O

!$,'O # ,'O $# ,'O #$,'O $#$,'O



 

,'O

 $,'O

# ,'O $#!,'O #$,'O $#$,'O

/835JO BIJ(>?(J8DBO TALL&>>O @@O HEIGHT INSTALLATION +(*7B/JO

(2150mm Cabinet) 2200mm overall height including 50mm frame overhang 

AAOFN0H)<;O60:46KO9C,<M.9C4O AAO2G)A0OEN0H6)C4O

 "   "

 "   "

  " "   "

 'O  'O  'O  'O

 'O  'O  'O  'O  'O  'O

 'O  'O

   //2 +,.0-12







 



     



,'O

1.105

 $,'O



  

# ,'O $# ,'O #$,'O $#$,'O

Order Online www.pws.co.uk

 



'O 7





 

 



 $,'O # 'O $#!,'O #$,'O $#$,'O 7


  " "   "

 "   "

    $'O



%2&2 % #2

!2&22 "2 % "!2

'O

$'O

  " "  "  "  "   "

 'O

'O



 "   "

$'O











 











 





 $ 'O

'O

!2&22 (2  '2 % #!2

$ 'O

'O



!2&22"2 % "!2

$'O









 

 



#=%O







$ 'O A$ 'O

$ 'O

$ 'O

$'O



 



" "   "   "



 



    $'O





!  "   "

$ 'O

$ 'O

%2&2 %2

!2&2  "2 ' 2 '2 % #2

'O

$ 'O

$ 'O

"2 %2

*"2 %2

$ 'O

$ 'O

 'O





 $ 'O

 

 



 



#=%O







 

(2%"2 )2 % $2





 













 

$ 'O

'O

$ 'O $ 'O

$ 'O



$ 'O

$ 'O

 $ 'O

T: 01325 505599 (North) | 88 (South)

1.106


Ä Ä&#x160;Ä&#x20AC;Ä&#x160;%/(//%%*ÄĄ".)!'%0$!*+((!0%+*3%0$/)++0$,%*0! Ăź*%/$Ä&#x2039;$! collection is presented around three core door styles â&#x20AC;&#x201C; a classic Shaker and 2+(+$'!.Ä&#x152;3$%$*+0$!1/0+)%/! 3%0$100$%*#!/* Ä&#x2026;!  options, and a Slab door style for a more contemporary look. Available in sanded format or painted in our palette of 30 carefully chosen +(+1./Ä&#x152;Ä Ä&#x160;Ä&#x20AC;Ä&#x160;(/++Ăť!./!/,+'!/%6!/3%0$+),.!$!*/%2!$+%!+" !0%(!  !//+.%/0%+*0+$!(,5+1.!0! %/0%*0(5 %Ăť!.!*0(++'Ä&#x2039; 1909 balances period features, delicate proportions and modern functionality. We have drawn from over 100 years of experienced craftsmanship to create a collection of beautiful kitchens. Photography shown in: Ovolo in Slate & Silver Grey

KEY FEATURES  Classic in-frame collection available in a choice +"Ä&#x192;/! ++./05(!/* Ä&#x2026;! +,0%+*/  Multiple product formats available - sanded or painted (all door styles), beading and/or notching for butt hinges (Shaker and Ovolo only)  Paint-to-order palette of 30 colours   !ÄĄ0+ÄĄ)!/1.!/%6!/2%((!"+."1.0$!.Ă˝!4%%(%05  Choice of Classic or Contemporary accessory styles ĆŤ+),.!$!*/%2!+((!0%+*+"$* (! !/%#*/* Ăź*%/$!/

1.107

Order Online www.pws.co.uk

NOW AVAILABLE IN

COMPLETE FORMAT for easier planning and installation See page X


THE CLASSIC IN-FRAME COLLECTION SMOOTH REAL TIMBER IN-FRAME COLLECTION

DOOR OPTIONS SHAKER

OVOLO

SLAB

Shaker and Ovolo are available notched for butt hinges, with a choice of four beading options.

BEADING OPTIONS

QUARTER ROUND LINEAR

QUARTER ROUND

HALF PENCIL & SCALLOPED

GEORGIAN

1909 shaker shown in Putty

T: 01325 505599 (North) | 88 (South)

1.108


6Year

SHAKER AND OVOLO

GUARANTEE

Stocked Ranges

Painted Finish

Real Timber

Paint-to-Order Service

6 Year Guarantee

Bespoke Service

TIMBER IN-FRAME SHAKER (SMOOTH FINISH, FLUSH JOINTS) FRAME DETAIL

PRODUCT SPECIFICATION

DOOR THICKNESS

.!ġü4+. !.+ !/$+3*%*.'!0/

SERVICE OPTIONS

5 piece door +*/0.10%+*Ä¥Ä&#x2026; piece outer frame Ĩý1/$&+%*0/Ä©

Ä&#x201A;Ä&#x2026;))

DOOR FRAME

CENTRE PANEL

78mm

Ovolo Sanded - OV Painted/joinery - O9

Shaker Sanded - SH Painted/joinery - S9

Paint-to-Order Shaker Ovolo 20 working days

12mm deep

Bespoke Service Shaker - S9BESPOKE Ovolo - O9BESPOKE Sanded - 23 days Joinery/PtO - 31 days

BEADING OPTIONS OUTER FRAME 36mm wide rail 68mm bottom rail Quarter Round Linear

PRODUCT OVERVIEW DOOR FAMILY STYLE

*Ä¡".)!$'!.Ä¡Ä&#x2020;,%!! ++.Ä&#x152;Ä&#x2026;,%!! ".)!3%0$ý1/$&+%*0/

DOOR THICKNESS

Ä&#x201A;Ä&#x2026;))

SUBSTRATE

Solid Alder wood frame with paper faced MDF centre panel

FINISH

* ! ġ1*ü*%/$! 0ġ 00,%*0! Ĩ/)++0$ü*%/$ĩ

REVERSE

Matt painted as per front face

CERTIFICATION

Fira Gold

PRICE BAND

Quarter Round

Half Pencil & Scalloped

Georgian

BUTT HINGE OPTIONS A choice of 2 butt hinge formats, Traditional butt hinges and False butt hinges (available for both door sets and combination doors).

Bright Chrome

Bright Nickel

Antique Bronze

Pewter

£ £ £ £ £

KEY FEATURES  A classic, smooth painted inframe Shaker collection  Solid timber (closed pore) frame and paper faced centre panel  2 door styles - plain Shaker and Ovolo frame design  Joinery service - with $+%!+"Ä&#x2026;! %*# options and notched for traditional butt hinges  Available in 'readyto-paint' sanded from stock or in our full paint-to-order palette of 30 colours

Shaker with Georgian Bead in Chalk

1.109

Order Online www.pws.co.uk

Ovolo shown in Dust Grey


DOOR RANGE CONTENT - SHAKER AND OVOLO $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵ

Door & Double Door Sets **DS770x260

Door Set 770x260mm (for use with small curved door, **CDS770x300)

Drawerline sets

Appliance Door Set

**DLS770X300

770x300mm

**ADS315X600

315x600mm

ĵĵ ĈĈĀąĀĀ

ĈĈĀ4ąĀĀ))

ĵĵƵąĆĆćĀĀ

ąĆĆ4ćĀĀ))

ĵĵ ĈĈĀąĆĀ

ĈĈĀ4ąĆĀ))

ĵĵƵąćĈćĀĀ

ąćĈ4ćĀĀ))

**DLS770X500

770x500mm

**ADS650X600

650x600mm

**DLS770X600

770x600mm

**ADS830X600

830x600mm

**DDLS770X800

770x800mm

**ADS910X600

910x600mm

**DDLS770X900

770x900mm

**DS770x300

770X300

**DS770x350

770X350

ĵĵĈĈĀąĀĀ

ĈĈĀąĀĀ

ĵĵĈĈĀąĆĀ

ĈĈĀąĆĀ

**DS770X500

770X500

**DS770X600

770X600

**DDS770X800

Double door set, 770x800mm

**DDS770X900

Double door set, 770x900mm

**PDS770X500

**DDS770X1000

Double door set, 770x1000mm

2 drawer set, 770x500mm

**PDS770X600

**DS950X300

Door set, 950x300mm

2 drawer set, 770x600mm

**PDS770X800

ĵĵĊĆĀąĀĀ

Door set, ĊĆĀ4ąĀĀ))

2 drawer set, 770x800mm

**PDS770X900

ĵĵĊĆĀąĆĀ

Door set, ĊĆĀ4ąĆĀ))

2 drawer set, 770x900mm

**DS950X500

Door set, 950x500mm

**PDS770X1000

**DS950X600

Door set, 950x600mm

**SPDS770X600

**DDLS770X1000 770x1000mm

For Internal Pullout ĨĂą))ĩ

Drawer Pack set

ĵĵƫĈćĉāąĆ

Ĉćĉ4āąĆ))Č (standard plinth)

ĵĵƫĈćĉāąĆ

Ĉćĉ4āąĆ))"+. (moulded plinth)

**CD768X295

768x295mm, (standard plinth)

2 drawer set, 770x1000mm

**CD768X295M

768x295mm, (moulded plinth)

2 drawer set, 770x600mm (slab design)

ĵĵƫĈćĉąąĆ

Ĉćĉ4ąąĆ))Č (standard plinth)

2 drawer set, 770x800mm (slab design)

ĵĵƫĈćĉąąĆ

Ĉćĉ4ąąĆ))Č"+. internals/ dishwasher (moulded plinth)

ĵĵƫĈćĉąĊĆ

NEWĈćĉ4ąĊĆČ (standard plinth)

ĵĵƫĈćĉąĊĆ

NEW Ĉćĉ4ąĊĆČ (moulded plinth)

**CD768X595

768x595mm, (standard plinth)

**CD768X595M

768x595mm, for internals/ dishwasher (moulded plinth)

**CD2018X295

2018x295, for larder pull-outs (standard plinth)

**CD2018X295M

2018x295, for larder pull-outs (moulded plinth)

**CD2018X395

2018x395, for larder pull-outs (standard plinth)

**CD2018X395M

2018x395, for larder pull-outs (moulded plinth)

**DS1250X300

Door set, 1250x300mm

ĵĵāĂĆĀąĀĀ

Door set, āĂĆĀ4ąĀĀ))

**DS1250X500

Door set, 1250x500mm

**PDL770X500

3 drawer set 770x500mm

**DS1250X600

Door set, 1250x600mm

**PDL770X600

3 drawer set 770x600mm

**DDS335X600

Top box double door set, 335x600mm (36mm bottom stile)

**PDL770X800

3 drawer set 770x800mm

**PDL770X900

3 drawer set 770x900mm

**PDL770X1000

3 drawer set, 770x1000mm

**DDS335X1000

American fridge/ freezer double door set, 335x1000mm (36mm bottom stile)

**DS507X600

Belfast sink door set, 507x600mm

ĵĵĆąĆćĀĀ

Farmhouse sink door set, ĆąĆ4ćĀĀ))

ĵĵĆąĆĉĀĀ

Farmhouse sink double door set, ĆąĆ4ĉĀĀ))

**TS770X150

Tray set frame, 770x150mm (for use with chopping board/ tray, IFTS150/W)

**SPDS770X800

**SPDL770X600

3 drawer set, 770x600mm (slab design)

**SPDL770X800

3 drawer set, 770x800mm (slab design)

Built Under Oven Frontal **OT115X600

**OT167X600

COMBINATION DOORS

Drawer front/oven trimmer 115x600mm (slab design)

Built under oven drawer front, 167x600mm (combination slab door)

T: 01325 505599 (North) | 88 (South)

1.110


DOOR RANGE CONTENT - SHAKER AND OVOLO $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵ

COMBINATION DOORS

FEATURE DOORS

For Appliance/larder door (22mm)

Curved door

Standard Plinth

Curved door set, 770x300mm (for 300x300mm cabinet)

**CAD768X595

768x595x22mm, (standard plinth)

**CAD768X595M

768x595x22mm (moulded plinth)

ĵĵƫƵĊąĉĆĊĆ

Ċąĉ4ĆĊĆ4ĂĂ)) (standard plinth)

ĵĵĈĈĀąĀĀ

Glazed door set, ĈĈĀ4ąĀĀ))

ĵĵƫƵĊąĉĆĊĆ

Ċąĉ4ĆĊĆ4ĂĂ)) (moulded plinth)

**GDS770X500

Glazed door set, 770x500mm

**CAD1006X595

1006x595x22mm (standard plinth)

**GDS950X500

Glazed door set, 950x500mm

**CAD1006X595M

1006x595x22mm (moulded plinth)

ĵĵƫƵāĂąĆĆĊĆ

āĂąĆ4ĆĊĆ4ĂĂ))

**GDS1220X500

ĵĵƫƵĂĀāĉąĊĆ

ĂĀāĉ4ąĊĆ4ĂĂ)) (standard)

Glazed dresser door set, 1220x500mm

ĵĵƫƵĂĀāĉąĊĆ

ĂĀāĉ4ąĊĆ4ĂĂ)) (moulded plinth)

ĵĵĊĆĀąĀĀ

1/3 glazed door /!0ČĊĆĀ4ąĀĀ))

**CAD2018X595

2018x595x22mm (standard plinth)

**FG950X500

1/3 glazed door set, 950x500mm

**CAD2018X595M

2018x595x22mm (moulded plinth)

Moulded Plinth

Pantry door sets **DSP1220X1000

Pantry 2 door set, 1220x1000mm

**BPS1220X1200

*0.5ą ++. set, 1220x1200mm

Corner door sets

1.111

**CDS770X300

ĵĵǫƫĈĈĀăąĀ

Base corner door /!0ČĈĈĀ4ăąĀ)) (pair)

**WCU770X300

Wall corner door set, 770x300mm (pair)

**WCU950X300

Tall wall corner door set, 950x300mm (pair)

Order Online www.pws.co.uk

Glazed door set


PRE-FIX CODES SHAKER Sanded (SH), Painted/Joinery (S9) PRE-FIX CODES OVOLO Sanded (OV), Painted/Joinery (09)

ACCESSORIES - SHAKER AND OVOLO All accessory sizes shown in !%#$04% 0$4!,0$

Cornice **C30

Cornice, 122x3050x90xmm

**PCB90CT

Corner block for contemporary moulded plinth, 135.5x56x56mm (for use with 18mm panel)

**CB30

Cornice build up, 90x3050x50mm

**PCPCL

Corner protection cover for classic moulded plinth, 135x23x23mm

**CCB

Cornice corner block, 92x88x88xmm

**PCPCT

Corner protection cover for contemporary moulded plinth, 135x23x23mm

**CCBB

Cornice build up corner block, 50x29x29xmm

**PSPPCL

Plinth block, 132x115x73mm, for breakfront pilaster, classic moulded plinth

**CCS300SD

Classic Curved cornice, 90x300x300mm

**PSPPCT

Plinth block, 132x115x73mm, for breakfront pilaster, contemporary moulded plinth

**CCSB300SD

Curved cornice build up, 50x300x300mm

Plinth **P30

**MP30CL

!01.!.+ü(!/ **BCC30

Ƶ &+%*%*#%*!0+2!.,.+ü(!Č 3050x28x8mm

**FP1500/36

.)!,.+ü(!ČāĆĀĀ4ăć4Ăą))Č top/side section

**FP1500/70

.)!,.+ü(!ČāĆĀĀ4ćĉ4Ăą))Č+00+) section

**MRF1500

 %1/! "!01.!!* ,.+ü(!Č āĆĀĀ4ĈĆ))4Ăą))

**DR600

NEW %/$3/$!./,(%0.%(Čăā4ćĀĀ4Ăą))

Plinth, 150x3050xx16mm

ƫ(//%)+1( ! ,(%*0$ČāăĂ4ăĀĆĀ4Ăą))

**MP30CT

Contemporary moulded plinth, āăĂ4ăĀĆĀ4Ăą))

**CPS560SD

Curved plinth, 150x560x300xmm

**CPS300MCLL

Curved classic moulded plinth 132x560x300mm, left hand

**CPS300MCLR

Curved classic moulded plinth 132x560x300mm, right hand

Feature Posts

**CPS300MCTL

**CPS300MCTR

**PCBCL

**PCBCT

**PCB90CL

**CP30

ƫ+.*!.,+/0ČĈĈĀ4ĈĀ4Ăą))Ĩ/( !/%#*Č pair)

**TWCP30

((3((+.*!.,+/0ČĊĆĀ4ĈĀ4Ăą)) (slab design, pair)

ĵĵĂąĀĀ

Tall square feature end post ĂąĀĀ4āĀĀ4ĆĀ))

ĵĵĂąĀĀ

(("!01.!!* ,+/0ČĂąĀĀ4ĈĆ4ĈĆ))

**ASKEW890

Askew leg, 890x75x75mm

Curved contemporary moulded plinth 132x560x300mm, left hand

Curved contemporary moulded plinth 132x560x300mm, right hand

Corner block for classic moulded plinth, āăą4ąĂ4ąĂ4))Ĩ"+. h+.!* ,*!(ĩ

Corner block for contemporary moulded ,(%*0$Čāăą4ąĂ4ąĂ4))Ĩ"+. h+.!*  panel)

Corner block for classic moulded plinth, 135.5x56x56mm, (for use with 18mm panel)

T: 01325 505599 (North) | 88 (South)

1.112


PRE-FIX CODES SHAKER Sanded (SH), Painted/Joinery (S9) PRE-FIX CODES OVOLO Sanded (OV), Painted/Joinery (09)

ACCESSORIES - SHAKER AND OVOLO All accessory sizes shown in !%#$04% 0$4!,0$

End Panels

Edging tape

**BEP900/18

Base end panel, 900x650x18mm

ĵĵĈĈąĥāĉ

((!* ,*!(ČĈĈą4ăĈĀ4āĉ))

ĵĵĊĆąĥāĉ

((3((!* ,*!(ČĊĆą4ăĈĀ4āĉ))

**EP1220/18

Dresser end panel, 1220x370x18mm

**EP25

((0+3!.!* ,*!(ČĂąĀĀ4ćĆĀ4āĉ))

ĵĵĂą

T&G tall tower end panel, ĂąĀĀ4ćĆĀ4āĉ))

**VE3

ĵĵĂąĀĀĥĊĀĀ

ĵĵĂąĀĀĥĊĀĀ

Corbel Shelf Support **CORBEL

Corbel, 175x115x155mm

**CORBP

Corbel back panel, ĈĀĀ4ăĀĀ4Ăą))

**CLCORBEL

Shelf Corbel, classic style, āĉĉ4āćĉ4ąĆ))

**CTCORBEL

Shelf Corbel, contemporary style, āĊĂ4āĈĂ4ąĆ))

Breakfast bar panel ĊĀĀ4ĂąĀĀ4āĉ))

T&G breakfast bar panel ĊĀĀ4ĂąĀĀ4āĉ))

Decor Framed Panels

Timber Accessories

**MTP1800

*0!(0+,,*!(ČĂĆĀ4āĉĀĀ4Ăą))

CI300/W

Cutlery insert, 300mm wide, washed oak

**FEP900X650L

ǫ/!".)!  h+.!* ,*!(Č ĊĀĀ4ćĆĀ4Ăą))Č(!"0$*

CI500/W

Cutlery insert, 500mm wide, washed oak

**FEP900X650R

ǫ/!".)!  h+.!* ,*!(Č ĊĀĀ4ćĆĀ4Ăą))Č.%#$0$*

IFTS150/W

Chopping board / Tray set for 150mm unit, washed oak for use with TS770X150

**FEP770X370L

((".)!  h+.!* ,*!(Č ĈĈĀ4ăĈĀ4Ăą))Č(!"0$*

PH800/W

Plate holder 800mm including base and 12 pins, washed oak

**FEP770X370R

((".)!  h+.!* ,*!(Č ĈĈĀ4ăĈĀ4Ăą))Č.%#$0$*

PH1000/W

Plate holder 1000mm including base and 12 pins, washed oak

**FEP950X370L

((3((".)!  h+.!* ,*!(Č ĊĆĀ4ăĈĀ4Ăą))Č(!"0$*

SHPR12

Plate rack, 1200x336x23mm, natural oak

SHBR12

ǫ+00(!.'ČāĂĀĀ4ąĆĀ4Ćć))Č natural oak

**FEP950X370R

((3((".)!  h+.!* ,*!(Č ĊĆĀ4ăĈĀ4Ăą))Č.%#$0$*

**FEP1220X370

.!//!.".)!  h+.!* ,*!(Č 1220x370mm, unhanded

ĵĵĂāąĀćĆĀ

Ƶ,,(%*!ĥ(. !.".)!  h+.!*  ,*!(ČĂāąĀ4ćĆĀ4Ăą))Č(!"0$*

DRBP

Door rack for butlers pantry, natural oak

ĵĵĂāąĀćĆĀ

Appliance/larder framed end panel, ĂāąĀ4ćĆĀ4Ăą))Č.%#$0$*

DRBP/W

Door rack for butlers pantry, washed oak

**FEP2320X650L

((,,(%*!ĥ(. !.".)!  h+.!*  ,*!(ČĂăĂĀ4ćĆĀ4Ăą))Č(!"0$*

SHSLT1000

Sliding larder rack for 1000mm cabinet, natural oak

**FEP2320X650R

1.113

Plain edging, un-glued, 3mx32mm

((,,(%*!ĥ(. !.".)!  h+.!*  ,*!(ČĂăĂĀ4ćĆĀ4Ăą))Č.%#$0$*

Order Online www.pws.co.uk


SHAKER AND OVOLO - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

Classic Cornice, (**C30) with Cornice Build Up(**CB30)

1909 Shaker door with pronounced bead and Antique Bronze butt hinge

Top box double door set (**DDS335X600)

Askew Leg (**ASKEW890)

Classic Moulded Plinth (**MP30CL)

Ĉćĉ4āąĆ))1((+10+)%*0%+* ++."+.)+1( ! ,(%*0$ĨĵĵƫĈćĉāąĆ ĩ

T: 01325 505599 (North) | 88 (South)

āċāāą


6Year

SLAB

GUARANTEE

Stocked Ranges

Real Timber

Painted Finish

Paint-to-Order Service

Bespoke Service

6 Year Guarantee

TIMBER IN-FRAME SHAKER (SMOOTH FINISH, FLUSH JOINTS) PRODUCT SPECIFICATION

FRAME DETAIL

DOOR THICKNESS

ą,%!!+10!. ".)!Ĩý1/$ joints)

22mm

DOOR FRAME

SERVICE OPTIONS

Slab Sanded - SL Painted/joinery - L9

78mm

OUTER FRAME 36mm wide rail

EDGE DETAIL Radius edge ,.+ü(!Č overpainted

68mm bottom rail

PRODUCT OVERVIEW DOOR FAMILY STYLE

*ġ".)!(ġą,%!!ý1/$".)!

DOOR THICKNESS

22mm

SUBSTRATE

Solid Alder wood frame with paper faced MDF centre panel %*0ġ0+ġ+. !.ġ)00,%*0! Ĩ/)++0$ü*%/$ĩ

FINISH

* ! Ģ1*ü*%/$! Č.! 50+,%*0

REVERSE

Matt painted as per front face

CERTIFICATION

Fira Gold

PRICE BAND

£ £ £ £ £

KEY FEATURES  A premium, smooth painted inframe door in contemporary slab design  Solid timber (closed pore) frame and paper faced slab door  Available in 'readyto-paint' sanded from stock or in our full paint-to-order palette of 30 colours  Comprehensive stock based range content full bespoke door service available for further ý!4%%(%05

Slab shown in Dry Rose and Graphite

1.115

Order Online www.pws.co.uk

.!ġü4+. !.+ !/$+3*%*.'!0/

Paint-to-Order 20 working days

Bespoke Service Slab - L9BESPOKE Sanded - 23 days Joinery/PtO - 31 days


DOOR RANGE CONTENT - SLAB $!*+. !.%*#Č,(!/!1/!,.!ġü4+ !"+. !/%.! ü*%/$Ĩ/$+3*%*,.!2%+1/,#!ĩ%*,(!+"ĵĵ

Door & Double Door Sets Door Set 770x260mm (for use with small curved door)

**PDL770X500

3 drawer set 770x500mm

ĵĵƫĊąĉ4ĆĊĆ

Ċąĉ4ĆĊĆ))Č"+. larder pullouts

**PDL770X600

3 drawer set 770x600mm

**CD1006X595

1006x595mm, for larder pullouts

**DS770X300

770x300mm

**PDL770X800

3 drawer set 770x800mm

ĵĵƫāĂąĆĆĊĆ

**DS770X350

770x350mm

**PDL770X900

3 drawer set 770x900mm

āĂąĆ4ĆĊĆ))Č"+. larder pullouts

**CD2018X295

ĵĵĈĈĀąĀĀ

ĈĈĀ4ąĀĀ))

**PDL770X1000

3 drawer set, 770x1000mm

2018x295mm, for larder pullouts

**CD2018X395

ĵĵĈĈĀąĆĀ

ĈĈĀ4ąĆĀ))

2018x395mm, for larder pullouts

**DS770X500

770x500mm

ĵĵƫĂĀāĉąĊĆ

ĂĀāĉ4ąĊĆ))Č"+. larder pullouts

**DS770X600

770x600mm

**CD2018X595

2018x595mm, for larder pullouts

**DDS770X800

Double door set, 770x800mm

**DDS770X900

Double door set, 770x900mm

**DS770X260

**DDS770X1000

Double door set, 770x1000mm

**DS950X300

950x300mm

ĵĵĊĆĀąĀĀ

ĊĆĀ4ąĀĀ))

ĵĵĊĆĀąĆĀ

ĊĆĀ4ąĆĀ))

**DS950X500

950x500mm

**DS950X600

950x600mm

**DS1250X300

1250x300mm

ĵĵāĂĆĀąĀĀ

āĂĆĀ4ąĀĀ))

**DS1250X500

1250x500mm

**DS1250X600

1250x600mm

**DDS335X1000

American fridge/ freezer double door set, 335x1000mm (36mm bottom stile) Belfast sink door set, 507x600mm

**DS507X600

ĵĵĆąĆćĀĀ

ĵĵĆąĆĉĀĀ

Farmhouse sink door set, ĆąĆ4ćĀĀ))

Farmhouse sink double door set, ĆąĆ4ĉĀĀ))

Built Under Oven Frontal **OT115X600

Drawer front/ oven trimmer 115x600mm (slab, no frame)

**OT167X600

Built under oven drawer front, 167x600mm (combination door)

Pantry door sets

**ADS315X600

315x600mm

ĵĵƵąĆĆćĀĀ

ąĆĆ4ćĀĀ))

ĵĵƵąćĈćĀĀ

ąćĈ4ćĀĀ))

**ADS650X600

650x600mm

**ADS830X600

830x600mm

**ADS910X600

910x600mm

**PDS770X600

2 drawer set, 770x600mm

**PDS770X800

2 drawer set, 770x800mm

**PDS770X900

2 drawer set, 770x900mm

**PDS770X1000

2 drawer set, 770x1000mm

**BPS1220X1200

*0.5ą ++. set, 1220x1200mm

Corner Door Sets ĵĵǫƫĈĈĀăąĀ

Base corner door /!0ČĈĈĀ4ăąĀ)) (pair)

**WCU770X300

Wall corner door set, 770x300mm (pair)

**WCU950X300

Tall wall corner door set, 950x300mm (pair)

COMBINATION DOORS - For Internal Pullout

Curved Door Sets

ĵĵƫĈćĉāąĆ

Ĉćĉ4āąĆ))Č"+. 150mm internal pullout

**CD768x295

768x295mm, for internal pull outs

ĵĵƫĈćĉ4ąąĆ

Ĉćĉ4ąąĆ))Č"+. internal pull outs

ĵĵĵƫĈćĉ4ąĊĆ

NEW Ĉćĉ4ąĊĆ))Č"+. internal pull-outs

Drawer Pack sets 2 drawer set, 770x500mm

Pantry 2 door set, 1220x1000mm

Appliance Door Set

**CD768X595

**PDS770X500

**DSP1220X1000

ĵĵĵƫĈćĉ4ąąĆ

**DCD768X595

768X595mm, for fridge freezers and washing machines

NEW Ĉćĉ4ąąĆ))"+. internals/ dishwasher (separate bottom rail) 768x595mm, for internals/ dishwasher (separate bottom rail)

**CDS770X300

Curved door set, 770x300mm (for 300x300mm cabinet)

Glazed Door Sets ĵĵĈĈĀąĀĀ

Glazed door set, ĈĈĀ4ąĀĀ))

**GDS770X500

Glazed door set, 770x500mm

**GDS950X500

Glazed door set, 950x500mm

**GDS1220X500

Glazed dresser door set, 1220x500mm

ĵĵĊĆĀąĀĀ

1/3 glazed door /!0ČĊĆĀ4ąĀĀ))

**FG950X500

1/3 glazed door set, 950x500mm

T: 01325 505599 (North) | 88 (South)

1.116


PRE-FIX CODES SLAB Sanded (SL), Painted/Joinery (L9)

ACCESSORIES - SLAB All accessory sizes shown in !%#$04% 0$4!,0$

Cornice

End Panels **C30

**CCS300

**MC30

**MCC300

**BEP900/18

Base end panel, 900x650x18mm

ĵĵĈĈąĥāĉ

((!* ,*!(ČĈĈą4ăĈĀ4āĉ))

ĵĵĊĆąĥāĉ

((3((!* ,*!(ČĊĆą4ăĈĀ4āĉ))

**EP1220/18

Dresser end panel, 1220x370x18mm

**EP25

((0+3!.!* ,*!(ČĂąĀĀ4ćĆĀ4āĉ))

ĵĵĂą

T&G tall tower end panel, ĂąĀĀ4ćĆĀ4āĉ))

ĵĵĂąĀĀĥĊĀĀ

ǫ.!'"/0.,*!(ĊĀĀ4ĂąĀĀ4āĉ))

ĵĵĂąĀĀĥĊĀĀ

T&G breakfast bar panel ĊĀĀ4ĂąĀĀ4āĉ))

Classic cornice, 3050x50x97mm

Curved classic cornice (for 300x300mm wall unit)

Modern Cornice, 3050x50x28mm

Curved modern cornice/light pelmet for small curved door

Plinth **P30

Plinth, 3050x150x16mm

**CPS560SD

Curved plinth (for 300x560mm base unit)

Edging Tape

!01.!.+ü(!/

Plain edging, un-glued, 3mx32mm

**CTCORBEL

Shelf Corbel, contemporary style, āĊĂ4āĈĂ4ąĆ))

Corbel

**FP1500/68

.)!,.+ü(!ČāĆĀĀ4ćĉ4ĂĂ))Č bottom section

**FP1500/36

.)!,.+ü(!ČāĆĀĀ4ăć4ĂĂ))Č top/side section

**DR600

Dishwasher split rail, 31x600x22mm

Feature Posts

1.117

**VE3

**CP30

Corner post, 770x70x22mm

**TWCP30

((3((+.*!.,+/0ČĊĆĀ4ĈĀ4Ăą

ĵĵĂąĀĀ

Tall square feature end post ĂąĀĀ4āĀĀ4ĆĀ))

ĵĵĂąĀĀ

Tall feature end post, ĂąĀĀ4ĈĆ4ĈĆ))

**ASKEW890

Askew leg, 890x75x75mm

Order Online www.pws.co.uk


SLAB - KEY FEATURES ƫ+ !//00! .!/1þ4+ !/ċ.!ü4+ !"+. ++..*#!ĥ+(+1.)1/0!1/! 3$!*+. !.%*#ċ

((-1.!!01.!* +/0ĨĵĵĂąĀĀĩ

2 Drawer Set (**PDS770X900)

Dishwasher Combination Door (**DCD768X595)

*0.5ą++.!0ĨĵĵǫāĂĂĀāĂĀĀĩ

T: 01325 505599 (North) | 88 (South)

1.118


1909 FRONTAL MATRIX IN-FRAME SHAKER AND OVOLO 1##!/0! ".+*0(+*Ăź#1.0%+*/Ä&#x152;"+.1/!3$!*,(**%*#* /!00%*#+10Ä Ä&#x160;Ä&#x20AC;Ä&#x160;$'!.* 2+(+ %0$!*/ NOTE: This matrix has been designed to work with 30mm thick worktops

MEDIUM INSTALLATION HEIGHT

TS770X150

TALL INSTALLATION HEIGHT

768

445 595

CD768X595M CD768X445M

1.119

Order Online www.pws.co.uk

SPDL770X600


DDLS770X

CURVED AND CORNER DOORS

T: 01325 505599 (North) | 88 (South)

1.120


1909 APPLIANCE / LARDER MATRIX IN-FRAME SHAKER AND OVOLO Suggested combinations for use with appliances (600mm wide) in medium and tall height installations.

MEDIUM INSTALLATION HEIGHT

SPDL770x600

TALL INSTALLATION HEIGHT

1.121

Order Online www.pws.co.uk

SPDS770X600

PDS770X600


T: 01325 505599 (North) | 88 (South)

1.122


1909 FRONTAL MATRIX IN-FRAME SLAB 1##!/0! ".+*0(+*ü#1.0%+*/Č"+.1/!3$!*,(**%*#* /!00%*#+10āĊĀĊ %0$!*/ċ

MEDIUM INSTALLATION HEIGHT

260 300 350 400

450 500 600

base/wall double door set

TALL INSTALLATION HEIGHT

DCD768X595

1.123

Order Online www.pws.co.uk


CURVED AND CORNER DOORS

T: 01325 505599 (North) | 88 (South)

āċāĂą


1909 APPLIANCE / LARDER MATRIX IN-FRAME SLAB Suggested combinations for use with appliances (600mm wide) in medium and tall height installations.

MEDIUM INSTALLATION HEIGHT

TALL INSTALLATION HEIGHT

1.125

Order Online www.pws.co.uk


T: 01325 505599 (North) | 88 (South)

1.126


BESPOKE SIZES DOUBLE DOOR SETS

AVAILABLE MADE TO ORDER SIZES (See each product type for availability by door style)

300 - 650

SLAB

335 - 770

387 - 1390

SHAKER/OVOLO Max Height Min Height

Max Width 700 - 1000

Min Width

To order a special size state the type of set required followed by the dimensions: eg. ā4+1(! ++./!0ăĉĈ4ĉĀĀ))

OVEN TRIMMER & FILLER

2 AND 3 DRAWER SETS SHAKER SHAKER SHAKER/OVOLO /OVOLO /OVOLO

SLAB

24MM FRAME

24MM DRAWER

SHAKER SHAKER SHAKER/OVOLO (SLAB DESIGN) /OVOLO /OVOLO 24MM FRAME

24MM DRAWER

25 - 175

To order a special size state the type of set required followed by the dimensions: eg. ā4ă.3!./!0 ĈĈĀ4ąăĆ))

770

300 - 1200

To order a special size state the type of set required followed by the dimensions: eg. ā4.3!.".+*0+*(5Ĩ*++10!.".)!ĩāĈĆ))4ćĀĀ)) 300 - 1000

PAN DRAWER/DOOR SET/APPLIANCE DOOR SET

SLAB

SLAB

22MM FRAME

22MM DRAWER

SHAKER/OVOLO ĂĉĀġąăĀ

To order a special size state the type of set required followed by the dimensions: eg. ā4* .3!./!0ăĆĀ4ćĀĀ)) PLEASE NOTE: Drawer/Door sizes below 315mm in height will be specified in slab design and aren't available with beading.

300 - 1000

GLASS AND SOLID DOOR SET

DOUBLE DOOR / TOP BOX SETS (36mm bottom rail) SLAB

SLAB To order a special size state the type of set required followed by the dimensions: eg. ā4#(//Ē /+(%  ++./!0ĊĆĀ4ąăĆ))

950

ăĀĀġąĉĀ

SHAKER/OVOLO

(SUPPLIED UNGLAZED, INCLUDING BEADING) SHAKER/OVOLO

600-1000

To order a special size state the type of set required followed by the dimensions: eg. 1x Double door set 300 x 600mm

300 - 650

GLAZED DOORS (supplied un-glazed/including beading)

DOOR SET

SHAKER/OVOLO

SLAB

SLAB 387 - 1209

387 - 1390

To order a special size state the type of set required followed by the dimensions: eg. ā4++./!0ćĀĀ4ąăĆ))

387 - 1209

SHAKER/OVOLO

ąĀĀġćĀĀ

To order a special size state the type of set required followed by the dimensions: !#ċā4(6!  ++./!0ąĆĀ4āĂĀĊ))

ąĀĀġćĀĀ

300 - 650

DRESSER DOORS

DRAWER LINE SET

(supplied un-glazed/including beading. NOTE: 36mm bottom rail) SHAKER/OVOLO

SLAB

SHAKER/OVOLO

770

1210 - 1500

To order a special size state the type of set required followed by the dimensions: eg. ā4.3!.(%*!/!0ĈĈĀ4ąăĆ))

300 - 650

ąĀĀġćĀĀ

DOUBLE DOOR/DRAWER LINE SETS SHAKER/OVOLO

BUTLER’S PANTRY 2 DOOR SET SHAKER/OVOLO

770 700 - 1000

800 - 1000

Order Online www.pws.co.uk

SLAB

1210 - 1390

To order a special size state the type of set required followed by the dimensions: eg. ā4+1(! ++.ĥ .3!.(%*!/!0ĈĈĀ4ĉĀĀ))

1.127

To order a special size state the type of set required followed by the dimensions: !#ċā4.!//!. ++./!0ąĆĀ4āăĊĀ))

To order a special size state the type of set required followed by the dimensions: eg. ā4ǫ10(!.Ě/ ,*0.5 ++./!0ĉĆĀ4āăĊĀ))


BUTLERâ&#x20AC;&#x2122;S PANTRY 4 DOOR SET

COMBINATION DOORS 24MM (Pull open)

SLAB

SHAKER/OVOLO

1210 - 1390

315 - 1700

SHAKER/OVOLO

Ä Ä&#x2026;Ä&#x2020;ÄĄÄ&#x2021;Ä&#x2020;Ä&#x20AC; STANDARD PLINTH

MOULDED PLINTH

1200

To order a special size state the type of set required followed by the dimensions: eg. Ä 4ÇŤ10(!.Ä&#x161;/,*0.5 ++./!0Ä Ä&#x201A;Ä Ä&#x20AC;4Ä Ä&#x192;Ä&#x160;Ä&#x20AC;))

To order a special size state the type of set required followed by the dimensions: eg. Ä 4Ćľ,,(%*! ++.Ä&#x2C6;Ä&#x2C6;Ä&#x20AC;4Ä&#x2026;Ä&#x2026;Ä&#x20AC;))

BASE FRAMED END PANELS

COMBINATION LARDER DOORS 24MM (Pull open)

770 - 950

2018 - 2200

SHAKER/OVOLO

SHAKER

This panel has a radiussed front edge and is handed. Please specify handing on placement of order.

Ä&#x2020;Ä&#x2030;Ä&#x2026;ÄĄÄ&#x2021;Ä&#x2020;Ä&#x20AC;

290 - 395 STANDARD PLINTH

MOULDED PLINTH

To order a special size state the type of panel required followed by the dimensions: eg. Ä 4ÇŤ/!".)! !* ,*!(Ä&#x2C6;Ä&#x2030;Ä&#x20AC;4Ä&#x2021;Ä Ä&#x20AC;))

To order a special size state the type of set required followed by the dimensions: eg. Ä 4 . !. ++.Ä&#x201A;Ä&#x201A;Ä&#x20AC;Ä&#x20AC;4Ä&#x192;Ä&#x2020;Ä&#x20AC;))

WALL FRAMED END PANELS

COMBINATION DOORS 22MM (Swing open) SHAKER/OVOLO

This panel has a radiussed front edge and is handed. Please specify handing on placement of order.

SLAB

315 - 1700

770 - 1700

SHAKER

395 - 650

Ä&#x192;Ä&#x201A;Ä&#x2026;ÄĄÄ&#x2026;Ä&#x2020;Ä&#x20AC; STANDARD PLINTH

MOULDED PLINTH

STANDARD PLINTH

MOULDED PLINTH

To order a special size state the type of panel required followed by the dimensions: eg. Ä 4((".)! !* ,*!(Ä&#x160;Ä&#x20AC;Ä&#x20AC;))4Ä&#x2026;Ä&#x20AC;Ä&#x20AC;))

To order a special size state the type of set required followed by the dimensions: eg. Ä 4Ćľ,,(%*! ++.Ä&#x2C6;Ä&#x2C6;Ä&#x20AC;4Ä&#x2026;Ä&#x2026;Ä&#x20AC;))

APPLIANCE/LARDER FRAMED END PANELS

COMBINATION APPLIANCE LARDER DOORS 22MM

(supplied left and right hand)

(Swing open)

SHAKER

SLAB

2018 - 2200

Ä&#x201A;Ä Ä&#x2026;Ä&#x20AC;ÄĄÄ&#x201A;Ä&#x192;Ä&#x201A;Ä&#x20AC;

SHAKER/OVOLO

This panel has a radiussed front edge and is handed. Please specify handing on placement of order.

Ä&#x2020;Ä&#x2030;Ä&#x2026;ÄĄÄ&#x2021;Ä&#x2020;Ä&#x20AC;

395 - 650

To order a special size state the type of panel required followed by the dimensions: eg. Ä 4Ćľ,,(%*!ÄĽ(. !.".)! !* ,*!(Ä&#x201A;Ä Ä&#x2026;Ä&#x20AC;4Ä&#x2021;Ä Ä&#x20AC;))

To order a special size state the type of set required followed by the dimensions: eg. Ä 4 . !. ++.Ä&#x201A;Ä&#x201A;Ä&#x20AC;Ä&#x20AC;4Ä&#x192;Ä&#x2020;Ä&#x20AC;))

ORDERING SPECIAL SIZES Special size drawer front and door sets: Special sizes are available at 2 times the price of the next largest stocked size. Specials are available in both sanded and painted process options. Special size oven trimmer & filler: Special sized oven trimmers (no frame) are available at 2 times the price of the next largest stocked item. Specials are available in both sanded and painted process options.

Special size larders Special sized larders are available at 2 times the price of the nearest stocked item. Special size combination larder doors and combination larder doors with separate bottom rail are available at 3 times the price of the next largest stocked item. Specials are available in both sanded and painted process options. Special size decor end panels Special sized decor end panels are available at 2 times the price of the next largest stocked item. Specials are available in both sanded and painted process options.

Notes: â&#x20AC;˘ Please note the size stated on the order must be the overall size, including the outer frame â&#x20AC;˘ Where notched doors are required, please state handing â&#x20AC;˘ Special size door set are on a 23 working day lead time for sanded only, 31 working days on painted, notched and/ or beaded â&#x20AC;˘ Special size door sets are not available in corner door sets or curved door sets â&#x20AC;˘ Special size glass door sets are supplied unglazed, as door frame only â&#x20AC;˘ We are unable to alter the standard specification of the 1909 range

â&#x20AC;˘ The frames of special sized door sets are not pre-drilled â&#x20AC;˘ Specials are not available in accessories â&#x20AC;˘ We reserve the right to decline a request to make a door set size where it is decided the size makes the item impractical for production or susceptible to future service faults. i.e. bowing Calculation of Glass Size: (//% 0$Ĺ&#x201C; ÄĄÄ Ä&#x2026;Ä )) (//!%#$0Ĺ&#x201C; ÄĄÄ Ä&#x2026;Ä )) !Ä&#x2039;#Ä&#x2039;(//0+/1%0++.!0Ä&#x152;Ä&#x2C6;Ä&#x2C6;Ä&#x20AC;4Ä&#x2026;Ä&#x192;Ä&#x2026;)) ÄĄ++.%6!Ä&#x2021;Ä&#x2021;Ä 4Ä&#x192;Ä&#x2020;Ä&#x2021;))0$!.!"+.!(// /%6!Ĺ&#x201C;Ä&#x2020;Ä&#x201A;Ä&#x20AC;4Ä&#x201A;Ä Ä&#x2020;))

T: 01325 505599 (North) | 88 (South)

1.128


HOW TO ORDER

ORDERING 1909 can be ordered via TradeZone (www.pws.co.uk) or in writing via Customer Services.

ORDER LEADTIMES WORKING DAYS QUOTED Sanded (Shaker, Ovolo or Slab)

From stock

Painted only (Shaker, Ovolo or Slab)

20 days

Sanded, beaded and/or notched (Shaker or Ovolo door styles only)

20 days

Painted, beaded and/or notched

20 days

(Shaker or Ovolo door styles only)

MADE-TO-ORDER LEADTIMES WORKING DAYS QUOTED Bespoke Sanded (Shaker, Ovolo or Slab)

23 days

Bespoke Sanded, beaded and/or Notched (Shaker or Ovolo door styles only)

31 days

Bespoke painted, beaded and/or notched (Shaker or Ovolo door styles only)

31 days

Bespoke painted - no beading/no notching (Shaker, Ovolo or Slab)

31 days

PRICING 1909 kitchens are positioned at the upper end of the mid-market with a typical retail order value starting from £25,000. For full information on list pricing, please refer to the main PWS price list.

TO FIND OUT MORE Speak to your Area Sales Manager or contact Customer Services for a full technical guide.

Important Note:āĊĀĊ%/+*/0.10! ".+)/+(% ( !.".)!3%0$ý1/$&+%*0/ċ 1909 doors, in common with all other timber products, are subject to movement with changes in moisture levels in the environment. This movement may be expressed in the form of a hairline crack (also known as a ‘whisper line’) in the paint surface along the line of the joints. This is a natural characteristic of smooth painted timber furniture and does not represent a product fault. Whisper lines can be treated by over-painting.

Paint-to-Order lead-times: The stated lead-times for Paint-to-Order are for guidance purposes only and always subject to manufacturing capacity. An accurate lead-time, in 0$!"+.)+" !(%2!.5 0!Č3%((!+*ü.)! 3%0$!$%* %2% 1(+. !. acknowledgement.

1.129

Order Online www.pws.co.uk


1909 ORDER FLOW CHART STOCK SIZES SHAKER

OVOLO

SLAB

NA From Stock

Sanded

Sanded Beaded and Notched

SH

OV

SHAKER

OVOLO

S9

O9

SHAKER

OVOLO

SL

Select Beading

Select Notching

ą+,0%+*/

For butt hinges

Select Door Handing

Painted, Beaded Notched

Working days to process

30 options

SHAKER

OVOLO

S9

Completed Order

20

Select Colour

O9

20 Working days to process

SLAB

Painted Only S9

Completed Order

L9

Select Colour

Select Beading

Select Notching

30 options

ą+,0%+*/

For butt hinges

Select Door Handing

Completed Order

20 Working days to process

Completed Order

O9

BESPOKE SIZES SHAKER

OVOLO

SLAB

23 NA

Bespoke Sanded

Working days to process

S9BESPOKE O9BESPOKE L9BESPOKE

SHAKER

Bespoke, Sanded Beaded Notched

OVOLO Select Beading

Select Notching

ą+,0%+*/

For butt hinges

Select Door Handing

31 Working days to process

S9BESPOKE O9BESPOKE

SHAKER

Completed Order

OVOLO

Completed Order

SLAB

31

Select Colour

Working days to process

30 options

Bespoke Painted

Completed Order

S9BESPOKE O9BESPOKE S9BESPOKE

SHAKER

Bespoke, Painted, Beaded Notched

OVOLO Select Colour

Select Beading

Select Notching

30 options

ą+,0%+*/

For butt hinges

Select Door Handing

31 Working days to process

Completed Order

S9BESPOKE O9BESPOKE

* *Leadtime subject to manufacturing capacity

T: 01325 505599 (North) | 88 (South)

1.130


1909 NOW AVAILABLE IN

COMPLETE FORMAT FOR EASIER PLANNING AND INSTALLATION

We are pleased to announce that the 1909 collection is now available in a new complete format – sold through the Danesmoor Group, parent company of PWS Distributors. This move follows extensive development in response to customer feedback. As a typically more complex product range to plan and install, working closely with the Danesmoor Group, we have responded to this by +û!.%*#%0ę .!//! Ě* +*%*!0Č3%0$,.!ġ%*/0((! %*0!.*(/Č.! 5"+. installation. $%/$!(,/.!0%(!./0+)!!00$!!4,!00%+*/+"$%#$ġ!* .* 3%0$/%#*%ü*0(5 )+.!!/!* ý!4%%(%055č  removing the complexity in the planning, ordering and installation of 1909  helping you to save time  making the 1909 collection easier to sell Available to all PWS customers alongside our 1909 component collection, the *!3+û!.0.*/(0!/āĊĀĊĚ/1..!*0!40!*/%2!.*#!+"āĉČĀĀĀ+),+*!*0/%*0+ an easy-to-plan complete catalogue including:  three simple price bands  the most comprehensive yet straight forward sales and technical manual  an optional on-site delivery service  compatibility with all the major KBB design and quotation packages Many retailers have already embraced our 1909 complete initiative and our 1909 partner programme, designed to provide national and local marketing support and generate consumer sales leads for retailers. Discover more about the 1909 partner programme on page 17. +.*5*!3+.!4%/0%*#.!0%(!./%*0!.!/0! %*!+)%*#āĊĀĊ+),(!0!,.0*!.Č please contact Paul Dorrington 1909’s National Sales Manager directly at: paul.dorrington@1909kitchens.co.uk

1.131

Order Online www.pws.co.uk


T: 01325 505599 (North) | 88 (South)

1.132


2%*#.!ü*! +1..*#!%*ĂĀāĊ3!$2! 0$%/5!.(1*$! 03+*!31.06)0!.%( ")%(%!/Č %!0.ġ+((!0%+*+"/,% !.2!%*!  )0!.%(/3%0$+(+1.,(!00!0+ +),(%)!*0+1.!4%/0%*#.*#!ċ ƫ+*.!0!ġ*+*0.!* +((!0%+*+û!.%*#* (0!.*0%2!%*0!401.!*  %)!*/%+*ċ !$2!(/+(1*$! +1.ü./0!2!. +*/1)!..+$1.! ! %0! 0+ 3+.'/1."!/ċ!2!(+,! 0+!*(!0$! +*/1)!.0+)'!!/%!.* )+.!//1.!  $+%!/Č0$!+((!0%+*+*/%/0/+"ü2!!/0ġ /!((%*#Č(!.(5 !ü*! +(+1.+((!0%+*/Č ".+)3$%0!/0.02!%*/0+ ,,(! #.!5ċ $!+((!0%+*!*+),//!/0$!)+/0 .!(!2*0ü*%/$!/Č+(+1./* /05(!/Č.+// )1(0%,(!)0!.%(05,!/ċ


Ă WORKSURFACES

Ƶā CHOOSE YOUR MATERIAL Āă

Ƶă  Ƶ

Ƶ  Ƶ SERVICE

1.06)0!.%(+((!0%+*

ĀĆ

ƫ1/0+)!.%* 10%+*,.+#.))!

.*%0!)0!.%(+((!0%+*

ĀĊ

ƫ$++/!5+1.)0!.%(



ąā

+(% 1."!)0!.%(+((!0%+*

āă

*(%*!-1+00%+*/!.2%!*  !/%#* 0+-1+0!   ąĂ

(0.ƫ+),0)0!.%(+((!0%+*

āĆ

!),(0!* %*/0((,.+!//

ąă

%)!.)0!.%(+((!0%+*

āĊ

!),(0!* ,.!,.0%+*

ąą

*/0((0%+*!.2%!



ąĆ

.'!0%*#/1,,+.0 



ąć

ƵĂ  Ƶ ƫ  ƫƵ  $!ü*!. !0%(/





Ăă

01.($.0!.%/0%/



ĂĆ

0!.%(/%6%*#



Ăć

%'5+1.! #!/05(!



ĂĈ

ƫ10+10/





ĂĊ

.%*!.#.++2!/





ĂĊ

*0!#.0! /%*'/





ăā

ƫ!.)%/%*'/







ăă

!01.! +3*/0* /



ăą

ƫ(





ăĆ

,/0* /





ăć

,(/$'/





ăć



ăĈ

ƫ(

%*#/05(!/

%*# +3*/0* /

2!.$*#/





ăĉ

+%*0/





ăĊ

(**%*#/1,,+.0 +1)!*0/

10Year

ąĀ


 Ƶƫƫ

ƫ 

THE

WORKSURFACES ƫ

ƫ 

WHITE

WHITE

ƵǫƵƫƵĒ

Ƶ Ē ƫ 

Ƶ((+3%*#5+10+#+ +( !.+.'!!,0+ -1%!0!.Č()!.0$!)!/Č 0$%/!10%"1(+((!0%+* "!01.!/ %/0%*0%2! ).(!/05(!2!%*%*# ,00!.*/Č0$.+1#$ 0+++(Č*!10.(ý0 !/%#*/ċ

Ƶ2!./0%(!+((!0%+* 0$03+.'/3!((%*+0$ )+ !.*+.(//% /!00%*#ċ!01.%*# 2/02.%!05+" ,,(!  ,00!.*/%**..5+" /$ !/Ď".+)+ûġ3$%0! $1!/!*.%$! 3%0$ )%..+.! ,.0%(!/Č 0$.+1#$0+)10! 0+*!/ 3%0$/+"0!.#.%*/ċ

Ƶ 

GREY

ƫƵ

ČƵ Ē

Č ČƫƵ

ĒƵ 

!01.%*#*..5+" ,00!.*/".+)(%*!.0+ /,!'(! Č0$%/3.)Č )10! +((!0%+*Č+û!./ +0$0%)!(!// 0. %0%+*(!/0$!0%Č +.*,,!(%*# +*0!),+..5/05(!ċ

BLACK Ƶ Č Ƶǫ Č ƫ Ē */,%.! 50$!*01.( 3+.( Č0$%/,(!00! "!01.!/3.)*  %*2%0%*#!/0$!0%ċƵ +((!0%+*+".%$!.0$5 0+*!/Č"!01.%*#+(  /0+*!#.%*/Č0.*/(1!*0 .5/0((%/0%+**  .!ü*! 2!%*%*#ċ

ĂċĀā

!/0%)0!/Į,3/ċ+ċ1'

%0$2/0..5 +",00!.*/Č".+) /,!'(! !û!0 0$.+1#$0+!(+.0! .%,,(! ,00!.*/Č0$%/ %*0.%#1%*#(5/0.0 +((!0%+*Č)'!/0.1(5 /0.%'%*#/00!)!*0ċ


ƵƵ Ƶ Ƶ Ƶ  PIETRA ć*!3,+(%/$! )0!.%(/3%0$ !(%0!/,% !.2%!*%*#ċ$!/! %0%+*/+),(%)!*0!$+"+1.*!3+(+1. +((!0%+*/* (/+!*$*!+1.!2!.,+,1(."!01.!* /0.02!%*! )0!.%(/ċ

5$%0!

1,!

%(2!.

ƫ$.+(

ƫ.+*

Ƶ11.*

ƫƫ Ć*!3)0!.%(/ČĂ+"3$%$.!2%((!%*+1.*!3+*.!0!/1."!ü*%/$Č/+"0(5$+*! /1."!3$%$ +û!.//)++0$)00ü*%/$ċ$!/!*!3+(+1./* 0$!*!3/1."!ü*%/$.!2!.5+*0.!* * (/+ +),(%)!*0+1.*!3+*.!0!!û!0".+*0(/ċ

!)(!

52%((!

ǫ.%*

.%*%05

ǫ(".+*

%0$%*+1.0.0)0!.%(.*#!3!(/+$2!!4%/0%*#")%(%!/č •

(!#*0ġ !(%0!+. ,,(! +((!0%+*

0+.)ġ+( /0.0)%4+((!0%+*

!%*! ġ)%4+"!%0$!."!01.!+./0.0 PWS Worksurfaces: ĀāăĂĆĆĀĆĆĂĂ

ĂċĀĂ


Ƶ Ƶ   Ƶƫ

0.0.*%0!%(2!.2!/

ULTRA COMPACT

į01 %++ .%*%Ģ ġ ƵƫIJ

!'0+*ǫ!.#!*

TIMBER

Ƶā CHOOSE YOUR MATERIALS

0.0ƫ...%+%

0.0!..%*#+*!'


Ćľ Material Characteristics 1.!/,+'!-1.063+.'0+,/.!)*) ! ".+))%401.!+"+(+1.,%#)!*0/Ä&#x152;.!/%** ,1.! *01.(-1.06Ä&#x2039;$%/)0!.%($/!!*/,!%((5 !2!(+,! "+.'%0$!*,,(%0%+*Ä&#x2039;1.06%/ )+.!+*/%/0!*00$*#.*%0!Ä&#x152;* %/ 1.(!Ä&#x152;/0(! * .!/%/0*00+$!)%(/Ä&#x2039; 1.+((!0%+*+*/%/0/+")0!.%(/".+)+1. +3*0.0.* (+*#3%0$.*#!%(!/0+*! )0!.%(/".+)ĆŤ+/!*0%*+Ä&#x2039;

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

ĆŤ+*0!),+..5ĆŤ+(+1./ . 3!.%*# !/%/0*00+/0%*%*# ĆŤ+*/%/0!*0Ăź*%/$ *1"01.%*#2!./0%(%05 Ćľ Ä Ä&#x2030;Ä Ä&#x20AC;%*0!#.0! /%*'/2%((! ÇŤ++')0$! )0!.%(/2%((! ĆŤ+/!*0%*++( .%0+.

Ćľ  Material Characteristics +'Ä&#x152;10".+)%0Ä&#x161;/*01.(/00!Ä&#x152;.*%0!%/2!.5 /0.+*#)0!.%(3$%$%/*01.((5 1.(!Ä&#x2039;2!.5 /1."!,00!.*%/1*%-1!Ä&#x2039;

â&#x20AC;˘ 2!.5/1."!%/1*%-1! â&#x20AC;˘ . 3!.%*# â&#x20AC;˘ ĆŤ+/!*0%*++( .%0+.

1.+((!0%+*+*/%/0/+")0!.%(/".+)+1.+3* 0.0.* (+*#3%0$.*#!!*/)0!.%(/ ".+)ĆŤ+/!*0%*+Ä&#x2039;

 ƾƍ Material Characteristics !."!0"+.0$0+*0%*1+1/(++'Ä&#x152;Ă˝!4%(!!*+1#$ 0+.!0!+.#*%3+.'0+,/$,!/Ä&#x152;3%0$0+0((5 %*0!#.0! /%*'+,0%+*///!)(!//,.0+"5+1. 3+.'/1."!Ä&#x2039; Ćľ2%((!%*3% !/!(!0%+*+"+(+1.* ,00!.*Ä&#x2039; 1.+((!0%+*+*/%/0/+")0!.%(/".+)+0$ % /Ä&#x2019;ĆŤ+.%*Ä&#x2039;

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

ĆŤ+*0!),+..5,(!00! + !.*)00Ăź*%/$ %/1((5/!)(!//&+%*0/ *0!#.0! /%*'+,0%+*/ .#*%"+.)/*!.!0! ĆŤ*!.!,%.!

ULTRA COMPACT Material Characteristics Ćľ(!*/1."!0$0%/*%!0+0+1$* .!/%/0*0 0+((0$! %(5#.%* 0$00'!/,(!%*'%0$!*Ä&#x2039; 0%/*1(0.ÄĄ/+,$%/0%0! )0!.%("+.1/5 !2!.5 5(%"!Ä&#x2039;1.+((!0%+*+*/%/0/+"!'0+* )0!.%(/".+)ĆŤ+/!*0%*+Ä&#x2039;

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

*%-1!Ăź*%/$!/ !/%/0*00+$%#$0!),!.01.!/ 1(0%,(!,,(%0%+*/ ÇŤ++')0$! )0!.%(/2%((! Ćľ4%4Ä Ä&#x2030;Ä Ä&#x20AC;%*0!#.0! /%*'/2%((! 1%0(!"+.+10 ++.,,(%0%+*/ ĆŤ+/!*0%*++( .%0+.

TIMBER Material Characteristics 2!.50%)!./1."!%/1*%-1!3%0$)1(0%,(! ,+//%%(%0%!/"+. !/%#** +),+/%0%+*Ä&#x2039; 0%/ 00%(!Ä&#x152;* .%*#/*01.(!105* 3.)0$0+ *5'%0$!*Ä&#x2039;

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

01.(!105* 3.)0$ 2!.5/1."!%/1*%-1! %2!./!.*#! ĆŤ*!.!,%.! 01.(#!%*#

PWS Worksurfaces: Ä&#x20AC;Ä Ä&#x192;Ä&#x201A;Ä&#x2020;Ä&#x2020;Ä&#x20AC;Ä&#x2020;Ä&#x2020;Ä&#x201A;Ä&#x201A;

Ä&#x201A;Ä&#x2039;Ä&#x20AC;Ä&#x2026;


Ƶ 1.!/,+'!-1.063+.'0+,/.!)*) !".+))%401.!+"+(+1.,%#)!*0/Č.!/%**  ,1.!*01.(-1.06ċ$%/)0!.%($/!!*/,!%((5 !2!(+,! "+.'%0$!*,,(%0%+*ċ 1.06%/)+.!+*/%/0!*00$*#.*%0!Č* %/ 1.(!Č/0(!* .!/%/0*00+$!)%(/ċ 1.+((!0%+*+*/%/0/+")0!.%(/".+)+1.+3*0.0.* (+*# 3%0$.*#!+"%(!/0+*!)0!.%(/".+)ƫ+/!*0%*+ċ

#CSUKKC

0!.%(/$+3*č !)(!

SPECIAL ORDER MATERIAL

10Year

STOCKED MATERIAL

POLISHED FINISH

VOLCANO FINISH

SUEDE FINISH

JUMBO SLABS

N-BOOST TECHNOLOGY

CONCRETE EFFECT


#CSUKBW

#CSUKAI

Å&#x2020;Æ« 

Ç«Ä¡)0!.%(+*0%*//,.'(!!(!)!*0/ 0$0**+0!.!,(%0! %*,.%*0

Ç«

Ƶ 

Ƶ

 

Ƶĵ

#CSUKECR Å&#x2020;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Æ«

 Ƶ

 ĵ

 ƵƫƵ

Å&#x2020;Æ« 

ǫ Ƶƫĵ

(%)#!/2%((!

WHITE STORM*

ǫ Ƶƫ Ƶ ĵ

Ƶ 

(%)#!/2%((!

(%)#!/2%((!

(%)#!/2%((!

Ƶǫ  Ƶǫ  

CLASSIC CALACATTA

STRATA CALACATTA SILVER

Ƶ ƫƵ ƵƫƵƵ ĵ

(%)#!/2%((!

(%)#!/2%((!

(%)#!/2%((!

(%)#!/2%((!

STRATA STATUARIO

ƫƵ ƵƫƵƵ 

 Ƶ 

CARRARA GIOIA

!!,#!Ä&#x201A;Ä&#x2039;Ä&#x20AC;Ä&#x160;"+.)0!.%('!52%(%(%05

PIETRA ICY WHITE

ĵƫ+(+1.)0$/%*'/2%((!


(%)#!/2%((!

(%)#!/2%((!

CARRARA CLASSIC

Ƶǫ  

#CSUKAS Å&#x2020;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Ƶ

ARCTIC STORM

(%)#!/2%((!

#CSUKECL Å&#x2020;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Æ«

#CSUKHS Å&#x2020;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Ä&#x192;Ä&#x20AC;Ä&#x20AC;

#CSUKMC

#CSUKPS

 Ƶ

#CSUKTS Å&#x2020;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Ä&#x192;Ä&#x20AC;Ä&#x20AC;

TROPICAL STORM

HAIL STORM

 

PIETRA TAUPE

Ƶ

Æ«Æ«

Å&#x2020;Æ« 

Ƶ  Ƶ

(%)#!/2%((!

ǫ Ƶƫƫ 

ƵƵ

WARM CLAY

 Ƶƫ Ƶ

 Ƶ

#CSUKLP Å&#x2020;Ä&#x192;Ä&#x20AC;Ä&#x20AC;Ä&#x192;Ä&#x20AC;Ä&#x20AC; 

#CSUKWC

ROUGUI

LYRA*

#CSUKBARC

ǫƵǫ ƫƵƫƫ

Ƶ Ƶ

#CSUKTRC

  Æ«Æ«


(%)#!/2%((!

#CSUKGM

ĵ

GREY MIRROR

(%)#!/2%((!

Ƶ Ƶ

PIETRA SILVER

#CSUKBALC

ǫƵ ƫƫ

Ƶǫ 

#CSUKCG

 ĵ

#CSUKAGR

ASH GREY

Ƶĵ

#CSUKEB

Ç«

 ǫƵĵ

(%)#!/2%((!

(%)#!/2%((!

PIETRA CHARCOAL

 ƵƫƵǫ

ĵƫ+(+1.)0$/%*'/2%((!

CRYSTAL GREY

(%)#!/2%((!

ƫƵƫƵ Ƶĵ

Ƶ

(%)#!/2%((!

(%)#!/2%((!

 ƵƵǫ

Ƶǫ ǫ Ƶƫ

(%)#!/2%((!

Ƶ  

ƵƵ Ƶ Ƶ

Ä&#x201A;Ä&#x2039;Ä&#x20AC;Ä&#x2030;


Ƶ  +'Č10".+)%0Ě/*01.(/00!Č.*%0!%/2!.5/0.+*#)0!.%(3$%$%/*01.((5 1.(!ċ 2!.5/1."!,00!.*%/1*%-1!ċ 1.+((!0%+*+*/%/0/+")0!.%(/".+)+1.+3*0.0.* (+*# 3%0$.*#!+"!*/)0!.%(/".+)ƫ+/!*0%*+ċ

0!.%(/$+3*čǫ('ƫ+/)%+(%/$!

10Year

STOCKED MATERIAL

LEATHER FINISH

POLISHED FINISH

SUEDE FINISH

CARESS FINISH

TEXTURED FINISH

HEAT PROOF TO 300o

FOR USE OUTDOORS

YE AR

SPECIAL ORDER MATERIAL

WARRANTY


#GRUKIF ņăĀĀăĀĀ 

WHITE MACAUBAS

TAJ MAHAL

ƵƵ

#GRUKBS ņăĀĀăĀĀǫƵ

ICE BLUE

GLACIAL BLUE

#GRUKMP ņăĀĀăĀĀ 

Ƶ

#GRUKGS ņăĀĀăĀĀ

GRIS SYLVESTRE

#GRUKSI ņăĀĀăĀĀ

    

ņ Ƶ ņăĀĀăĀĀ Ƶ

Ƶ 

ņ ǫ ņăĀĀăĀĀǫ

BLACK BEAUTY

ƫ  Ƶ  

#GRUKSC ņăĀĀăĀĀƫ

   

#GRUKBIC ņăĀĀăĀĀǫ ƫ

ǫ Ƶƫƫ 

ǫ Ƶƫǫ

#GRUKAAP ņăĀĀăĀĀƵƵ

Ƶ ƵƵ 

#GRUKCBP ņăĀĀăĀĀƫǫ

#GRUKSWL ņăĀĀăĀĀ

SILVER WAVES LEATHER

ǫ ƵƫƵ

#GRUKCW ņăĀĀăĀĀƫ

ǫ Ƶƫ ƫ ƫ 

!!,#!ĂċĀĊ"+.)0!.%('!52%(%(%05

#GRUKSW ņăĀĀăĀĀ

 Ƶ 

#GRUKCBL ņăĀĀăĀĀƫǫ

BLACK COSMIC LEATHER


#GRUKSG ņăĀĀăĀĀ

 ƫ

STEEL GREY

#GRUKLBP ņăĀĀăĀĀ ǫ

ǫ 

#GRUKIBP ņăĀĀăĀĀ ǫ

 Ƶǫ Ƶƫ Ƶ

GRAPHITE PEARL

#GRUKSBG ņăĀĀăĀĀǫ

#GRUKLEP ņăĀĀăĀĀ 

 Ƶ 

#GRUKGPL ņăĀĀăĀĀ

ƵƵ Ƶ

#GRUKBLL ņăĀĀăĀĀǫ

ǫ Ƶƫ  

#GRUKPB ņăĀĀăĀĀǫ

 

PREMIUM BLACK

MOAK BLACK

ƫ  ƫƵ Ƶ ƫ 

++. !./),(!/+"0$!/!)0!.%(/+.+0$!. )0!.%(/*+0/$+3*,(!/!((+1./(!/Ē/!.2%! 0!)+*č

01325 505522 (!/!-1+0!0$!.!"!.!*!*1)!.%"/$+3*+. )0!.%(*)!* /1."!ü*%/$ċ


0!.%(/$+3*č!*/%(+


 Ƶƫ !."!0"+.0$0+*0%*1+1/(++'Čý!4%(!!*+1#$0+.!0!+.#*%3+.'0+, /$,!/Č3%0$0+0((5%*0!#.0! /%*'+,0%+*///!)(!//,.0+"5+1. 3+.'/1."!ċƵ2%((!%*3% !/!(!0%+*+"+(+1.* ,00!.*ċ1.+((!0%+* +*/%/0/+")0!.%(/".+)+0$% /Ēƫ+.%*ċ

0!.%(/$+3*čƵ1.+..!5

SPECIAL ORDER MATERIAL

10Year

SMOOTH/SILK FINISH


Ƶ   

  

ƵƵǫ Ƶƫ

Ƶ  

GLACIER WHITE

ƵƵƫ ƫƵ

ARROWROOT

ƵƵ 

ƫƫ

AURORA GREY

 Ƶ



ƫ ƫƫ

ƫ 



LAVA ROCK

++. !./),(!/+"0$!/!)0!.%(/+.+0$!. )0!.%(/*+0/$+3*,(!/!((+1./(!/Ē/!.2%! 0!)+*č

01325 505522  

  

(!/!-1+0!0$!)0!.%(*)!ċ

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

Ăċāą


ULTRA COMPACT Ƶ(!*/1."!0$0%/*%!0+0+1$* .!/%/0*00+((0$! %(5#.%* 0$0 0'!/,(!%*'%0$!*ċ 0%/*1(0.ġ/+,$%/0%0! )0!.%("+.1/5!2!.5 5 (%"!ċ1.+((!0%+*+*/%/0/+"!'0+*)0!.%(/".+)ƫ+/!*0%*+ċ Ƶ(()0!.%(//1%0(!"+.+10 ++.1/!ċ

0!.%(/$+3*č .!0

SPECIAL ORDER MATERIAL

POLISHED FINISH

10Year

SMOOTH/SILK FINISH

TEXTURED FINISH

SUEDE FINISH

HEAT PROOF TO 300o

30mm THICKNESS

FOR USE OUTDOORS

DEKTON GRIP


HALO

 

Ƶ Ƶ

 Ƶ

AERI

Ƶ

GLACIER

 

REM

SASEA

KAIROS

 

ǫ++' 0$Ƶ2%((!

Ƶ

ƵƵ

OPERA

AURA



Ç«

ǫ Ƶƫƫƫ

ƵƵ

!!,#!Ä&#x201A;Ä&#x2039;Ä&#x20AC;Ä&#x160;"+.)0!.%('!52%(%(%05


ARGA

TAGA

 



 Ƶ

SIROCCO

SOKE



KRETA

VERA

ǫ Ƶ

KORUS

GALEMA

VEGHA

KIRA

TRILIUM

Ƶ 

KORSO

Ƶ 

 


LAOS

FOSSIL

MILAR

ETER

KELYA

Ƶ

BALTIC

FEROE

BROMO

 

SIRIUS

SPECTRA

++. !./),(!/+"0$!/!)0!.%(/+.+0$!. )0!.%(/*+0/$+3*,(!/!((+1./(!/Ē/!.2%! 0!)+*č

01325 505522 (!/!-1+0!0$!)0!.%(*)!ċ

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

Ăċāĉ


 ǫƫ

ƫ  2!.50%)!./1."!%/1*%-1!3%0$)1(0%,(!,+//%%(%0%!/"+. !/%#**  +),+/%0%+*ċ 0%/00%(!Č* .%*#/*01.(!105* 3.)0$0+*5'%0$!*ċ

#IRHSAMPLE

0!.%(/$+3*č .+'+!..%*#+*!

STOCKED MATERIAL

END GRAIN CONSTRUCTION

10Year

BLANKS AVAILABLE

FULL STAVE CONSTRUCTION

FINGER STAVE CONSTRUCTION

BLOCK STAVE CONSTRUCTION


ƫƫ 

 ġƵ Ƶƫ

FULL-STAVE WORKSURFACE

Ƶü*#!.ġ/02!3+.'/1."!%/) !1,+" .!(0%2!(5/$+.0Č0$%*/02!/+"3++ ċ$!5.! +* ! 0+#!0$!.3%0$#(1!Č)'%*#0$!)/!1.!ċ

Ƶ"1((ġ/02!3+.'/1."!05,%((5"!01.!/(+'/ 3%0$)%*%)1)3% 0$+"ąĀġĆĀ))ċ$!/!.! +* ! 0+#!0$!.(+*#0$!%./% !/Č3%0$!$ /02!.1**%*#0$!"1(((!*#0$+"0$!3+.'/1."!Č .!/1(0%*#%**+(%*!.&+%*0/ċ

BLOCK STAVE

Ƶ 

Ƶü*#!.ġ/02!3+.'/1."!//!)(! %*0+$!2.+* 3%0$*+2!.(,,%*#/$,! +*/0.10%+*Č0$%* /02!/.!+* ! 0+#!0$!.* #(1! 0+)'!0$!) /!1.!ċƵ2%((!%*Ă)0!.%(/Č .+'+* 'ċ

ƫ$!-1!.+. +.+2!.(,,%*#(+'3+.'Č1/%*# !* #.%*)0!.%("+.!40./0.!*#0$ċ

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

ĂċĂĀ


 ǫƫ

ƫ  STAVES #WT/BBSAMPLE

ǫƵ ǫąĀ))

  ǫąĀ))

#WT/OASAMPLE

OAK ąĀ))

RUSTIC OAK ąĀ))

ņĥĂĈƵƵ  

OAK ĂĈ)) #WT/EGPOSAMPLE

(%)#!/2%((!

Ƶ  ǫąĀ)) #WT/SOSAMPLE

 ąĀ))

#WT/EGROSAMPLE #WT/ROSAMPLE

ņĥĂĈƵ  

RUSTIC OAK ĂĈ))

#WT/IRSAMPLE

(%)#!/2%((!

PRIME OAK ąĀ))

#WT/WASAMPLE

++. !./),(!/+"0$!/! )0!.%(/,(!/!((+1./(!/ Ē/!.2%!0!)+*č

01325 505522 STRATA OAK ąĀ))

ĂċĂā

!/0%)0!/Į,3/ċ+ċ1'

Ƶ ąĀ))


Ƶ  ņĥćĀĀƵ  

Ƶ Ƶ ćĀ))

ņĥĉĀƵ  

Ƶ Ƶ ĉĀ))

PWS Worksurfaces: ĀāăĂĆĆĀĆĆĂĂ

ĂċĂĂ


 Ƶ  Ƶ3+.'/1."!%*/0*0(5!+)!/0$!)+/01/!  !(!)!*0+"*5*!3'%0$!* !/%#*Ä&#x152;/+/!(!0%*# 0$!.%#$0ü*%/$* 0$%'*!//%/&1/0/%),+.0*0 /0$!)0!.%(Ä&#x2039;

ƵÄ&#x201A;  Ä&#x2019;Æ«  ƫƵ 

$!ü*!. !0%(/ ,!./+*(%05Ä&#x152;$.0!.*  *+û!.,.0%(/+(10%+*/0+0$!'%0$!*Ä&#x152;/+ 0%)!Ä&#x152;1* !./0* %*#* .!"1(+*/% !.0%+* )1/0!0'!*Ä&#x2039; !(!0%*#0$!ü*!. !0%(/3%(( !ü*!0$!/05(!+" '%0$!*Ä&#x152;3$!0$!.%0Ä&#x161;/*%*0!#.0! /%*'0+.!0! /!)(!//* +*0!),+..5(++'+.!10%"1((5 !0%(! ! #!/05(!0++),(!)!*00. %0%+*( .++)Ä&#x152;0$!,+//%%(%0%!/.!!* (!//Ä&#x2039;


ƫ  ƫƵ ƫƵ  $! !0%(5+1$++/!* %),00+5+1.$+/!*/1."!/ċǫ!(+3.!((0$!.!/5+1* ,!'0+5+1.3+.'/1."!.!0%(!.0+/!!((+"0$!+,0%+*/2%((!ċ

 !/%#** "1*0%+*ċ

MATERIAL CHARACTERISTICS

 ƫ  

*!5+1$2!$+/!*5+1.)0!.%(0$!*(++'05+1. 0$%'*!//+,0%+*/ċ

CUT OUT OVERVIEW

 

+ !.*ƫ+((!0%+*

ƫ(//%ƫ+((!0%+*

. %0%+*(ƫ+((!0%+*

Ƶ  

0* .

(.!

,!.

Wave

.'

!!//!

   

*0!#.0!

* !.)+1*0

ƫ!.)%

5ġ*

!01.!+3*/0* %*'

ƫ Ƶ  

,/0*

+ĥ*#!ǫ'/,(/$

1((ǫ'/,(/$

+3*/0* PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

ĂċĂą


ƵƵƵƵ ƫƵƵƫ  ƫ CHARACTERISTICS Natural Veining/Open Lines

Natural Undulating Surface +*!

%*%)(

Æ«+))+*

!.5 Æ«+))+*

+*!

%*%)(

Æ«+))+*

Natural Durability Properties

!.5 Æ«+))+*

+*!

%*%)(

Æ«+))+*

Ƶ  Ƶ61(Ƶ.*



Ç«%*+Æ«%#*+ Ç«%*+1! Ç«%*+. + Ç«('Æ«+/)% !0$!. Ç«(' %*!*!401.!

   



 



 

 

 

    

   























 

%(2!.2!/ !0$!. 



0.(45Ç«(' 

0!!(.!5

  

 

  

%*1+1/$%0!

 





++*!.( .!)%1)Ç«(' %,,(!  %*'

  





Æ«+(+*%($%0! .,$%0!!.( .%/5(2!/0.! * %*Ç«('!.( 2+.5*0/5

1* $/Ƶ*0%-1!

1* $/Ç«(1!!.(

1* $/)!.( !.(













Ƶ Ƶ.0%0+.) Ƶ/$.!5 ǫ.%*ƫ+*.!0! ǫ%*+$!(( ǫ.%((%*0$%0! ǫ.1*/3%'ƫ+*.!0! ƫ.5/0(.!5 +*5 (!#*0ƫ(5 (!#*0ƫ.!) (!#*0.!5 .!5 %..+. .!5!*0+ %(0+.) 53. ƫ+*.!0! !)(!ƫ+*.!0!

1*!.( .(! ǫ(' .(! .!5 .(! $%0! %#$00+.) $+!*%4* %!0.Ƶ11.* %!0.ƫ.+* %!0.ƫ$.+( %!0. 5$%0! %!0.%(2!. %!0.1,! 1.06 %..+. *+3"(( 0.0Ƶ/+(10! .(! $%0! 0.0ƫ(00+( 0.0ƫ(00%(2!. 0.0ƫ...ƫ(//% 0.0ƫ...%+% 0.0 .-1%* 0.0!.(0%*+ Ƶƫ 0.0001.%+ .!((%'ƫ+*.!0! .+,%(0+.) .)ƫ(5 $%0!!*0+

Ä&#x201A;Ä&#x2039;Ä&#x201A;Ä&#x2020;

  

  

   

    

    

   

 

   

 

  

 





   



 



  

          

 

       

!/0%)0!/Ä®,3/Ä&#x2039;+Ä&#x2039;1'

    

      



   

  



       

     

     

      

     



!.5 Æ«+))+*


 Ƶ Ƶ   

Maximum length with overmount cut out 30mm

Maximum length with undermount cut out 30mm

100mm max upstand length

Minimum rail thickness front

Minimum rail thickness rear

Maximum belfast rail thickness before requiring a rail - 30mm

Maximum Extended Overhang 20mm Material

Maximum Extended Overhang 30mm Material

Maximum Length with no cut outs

Ƶ  Ƶ61(Ƶ.* ǫ%*+ƫ%#*+ ǫ%*+1! ǫ%*+. + ǫ('ƫ+/)% ǫ(' %*!* ƫ+(+*%($%0! .,$%0!!.( .%/5(2!/0.! * %*ǫ('!.( 2+.5*0/5

ĂāĀĀ ĂăĀĀ ĂĀĀĀ ĂăĀĀ ĂĂĀĀ ĂąĀĀ ĂāĀĀ ĂăĀĀ ĂāĀĀ ĂăĀĀ ĂĀĀĀ

ĂąĀĀ ĂĆĀĀ ĂăĀĀ ĂĆĀĀ ĂĆĀĀ ĂĉĀĀ ĂąĀĀ ĂćĀĀ ĂąĀĀ ĂćĀĀ ĂăĀĀ

ĂāĀĀ ĂăĀĀ ĂĀĀĀ ĂăĀĀ ĂĂĀĀ ĂąĀĀ ĂāĀĀ ĂăĀĀ ĂāĀĀ ĂăĀĀ ĂĀĀĀ

ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ

ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ

āĈĆ ĂĀĀ ĂĀĀ ĂĀĀ ĂĀĀ āĆĀ āĈĆ ĂĀĀ āĈĆ āĈĆ ĂĀĀ

āĆĀ ĂĆĀ āĆĀ ĂĀ āĆĀ ăĀĀ ĂĆĀ ĂĆĀ ĂĆĀ ĂĆĀ āĆĀ

ĂĆĀ ĂĆĀ ĂĆĀ ĂĆĀ ĂĆĀ ăĀĀ ĂĆĀ ĂĆĀ ĂĆĀ ĂĆĀ ĂĆĀ

ĂĊĀĀ ĂĊĀĀ ĂĊĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ

1* $/Ƶ*0%-1!

1* $/ǫ(1!!.(

1* $/)!.( !.( ++*!.( .!)%1)ǫ(' %,,(!  %*' %(2!.2!/ %*1+1/$%0! 0.(45ǫ(' 0!!(.!5

ĂāĀĀ ĂăĀĀ ĂăĀĀ ĂāĀĀ ĂąĀĀ ĂāĀĀ ĂăĀĀ ĂāĀĀ ĂąĀĀ ĂăĀĀ

ĂăĀĀ ĂćĀĀ ĂćĀĀ ĂąĀĀ ĂĉĀĀ ĂąĀĀ ĂćĀĀ ĂąĀĀ ĂĉĀĀ ĂćĀĀ

ĂāĀĀ ĂăĀĀ ĂăĀĀ ĂāĀĀ ĂąĀĀ ĂāĀĀ ĂăĀĀ ĂāĀĀ ĂąĀĀ ĂăĀĀ

ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ

ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ ĆĆ

ĂĀĀ āĈĆ āĈĆ ĂĀĀ āĆĀ āĈĆ āĈĆ āĈĆ āĆĀ ĂĀĀ

āĆĀ ĂĆĀ ĂĆĀ ĂĆĀ ăĀĀ āĆĀ ĂĆĀ ĂĆĀ ăĀĀ ĂĆĀ

ĂĆĀ ăĀĀ ăĀĀ ĂĆĀ ăĀĀ ĂĆĀ ĂĆĀ ĂĆĀ ăĀĀ ĂĆĀ

ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ ĂĊĀĀ

ĂĈĀĀ

ĂĊĀĀ

ĂĈĀĀ

ĆĆ

ąĆ

āĆĀ

ĂĆĀ

ăĆĀ

ăĀĀĀ

Ƶ 0.0Č%(!/0+*!

Ƶ(( %)!*/%+*/.!%*))

0!.%(/$+3*č 1*!.( !0%(/$+3*čƫ1.2 #!.+ü(!

PWS Worksurfaces: ĀāăĂĆĆĀĆĆĂĂ

ĂċĂć


 ƫ   !$2! %2% ! +1.,.+ü(!+,0%+*/%*0+0$.!!0!#+.%!/Ď + !.*Čƫ(//%* . %0%+*(0+$!(,% !*0%"5 ,.+ü(!0$0)5ü0%*3%0$0$!,(**! 2%/%+*+"5+1.'%0$!*ċ +0((3+.'/1."!)0!.%(/.!/1%0(!"+.!$,.+ü(!+,0%+*ċ!!!(+3!$,.+ü(!"+.+),0%(!)0!.%(,,(%0%+*/ċ

ƫ Ƶ ƫ Ƶ 

 č$!*1/%*#*+*ġ/-1.!,.+ü(!Č)/+*Ě/)%0.!&+%*03+1( !/,!%ü! //0* . ċ ǫ  Ƶ č.+ü(! ! #!/*!1%(01,0+.!0!0$!%((1/%+*+"*!40.ġ !!, 3+.'/1."!ċ$!/!+,0%+*/*!1/! (+*#/% !*5 !/%#*,,(%0%+*/ċ ǫč3$!*,.+ü(%*#0%)!.3!

 .%,#.++2!//0* .



(0+(%/$ .*%0!Č1.06Č (0.ƫ+),0

(1/$Ĩ1%(

ġ1,ĩ

%0.!

Ĩ1%( ġ1,ĩ

$.'Ě/+/!+1*

$.'Ě/+/! ăć))+*(5

.*%0!Č1.06

.*%0!Č(0.ƫ+),0

.*%0!Č1.06

+(% 1."!

$.'Ě/+/!

Ƶ..+3

Ƶ..+3

ƫ+*+. !

.*%0!Č1.06Č(0.ƫ+),0Č +(% 1."!Č%)!.

.*%0!Č1.06Č (0.ƫ+),0Č+(% 1."!

%)!.

%)!.

.*%0!Č1.06Č (0.ƫ+),0

+((53++ ǫ!2!(

0!.0+,

.*%0!Č1.06

+(% 1."!

0!."(( #!ĵ

ƫ1.2ĵ

ǫ%. Ě/ǫ!'Ĩ1%(

ġ1,ĩ

CLASSIC

ƫ(//%Ĩ1%(

ƫ(//%Ĩ/!+,0%+*ĩ

ƫ(//%Ĩ0+,+,0%+*ĩ ąĀ))+*(5

ĉĀ))+*(5

%)!.

%)!.

%)!.

.*%0!Č1.06

.*%0!Č1.06

Ogee*

+0%ĵ

#!!Ē+0%

(! #!Ē+0%

(! #!ĵ

.*%0!Č1.06

Ĩ1%( ġ1,ĩ .*%0!Č1.06

Ĩ1%( ġ1,ĩ .*%0!Č1.06

.*%0!Č1.06

ąĀ))+*(5

.*%0!Č1.06

ĂċĂĈ

!/0%)0!/Į,3/ċ+ċ1'

ġ1,ĩ

ĵ%* %0!/,.+ü(!/.!*+0/1%0(!"+.ĂĀ)))0!.%(/


Ƶ  Ƶ

0* . -1.!  #!

0* . -1.! ƫ$)"!.

(+3ǫ!2!(

+(% 1."!Č%)!.

%*#(!ăČćČĉ))

+1(!ăČćČĉ))

Ĩ ((1/0.0%+*/$+3/ĉ))! #!,.+ü(!ĩ

Ĩ$+3/+1(!ĉ))! #!,.+ü(!ĩ

.*%0!Č1.06Č%)!.

.*%0!Č1.06Č (0.ƫ+),0Č+(% 1."!

.*%0!Č1.06Č (0.ƫ+),0

ĉ))3(Ě/ǫ!'

āĆ))3(Ě/ǫ!'ĵ

ƫ+'Ē1 .*0

āĆ))ǫ1((+/!ĵ

.*%0!Č1.06Č (0.ƫ+),0

.*%0!Č1.06Č (0.ƫ+),0

%)!.

.*%0!Č1.06 (0.ƫ+),0Č+(% 1."!

+30!./0+,+*+(% 1."!

.*%0!Č1.06Č (0.ƫ+),0Č+(% 1."!

1.0!.+1* %)!.

0.1' %1/ĵ +(% 1."!Č%)!.

0!."(( ąĀ))+*(5

%)!.

  Ƶ Ƶ ƫ Ƶ ǫ ƫ   !!//! .%*!.

!!//! +

ĂĀŐĂĀ

ăĀŐăĀ

#!!Ē+0%

+3*/0* 

(! #!Ē+0%

0!."((

ƫ1.2

Ƶ..+3

(! #!

$.'Ě/+/!

(+3ǫ!2!(

+0%

+((53++ ǫ!2!(

Ogee

ƫ+*+. !

Ƶ61(Ƶ.*

Y

Y

Y

Y

Y

Y

Y

Y

Y

Y





Y

Y

Y

Y



ǫ('ƫ+/)% !0$!.

Y

Y



















Y

Y

Y







ǫ('ƫ+/)%+(%/$!

Y

Y



















Y

Y

Y







ƫ+(+*%($%0!

Y

Y



Y

Y







Y

Y

Y

Y

Y

Y

Y

Y



%(2!.2!/ġ !0$!.

Y

Y



















Y

Y

Y

Y





%(2!.2!/ġ+(%/$!

Y

Y

















Y

Y

Y

Y





Y









Y

Y









Y

Y

Y

Y





Y

Ƶ 

ĵ * %0!/+(%/$! * %('

ULTRA COMPACT

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

ĂċĂĉ


CUT OUTS - OVERVIEW TAP HOLE

ƫƵ ƫ  

ăĆ)) %)!0!.0,$+(!/.!/,!%ü! //0* . Č 1*(!//+0$!.3%/!/00! ċ

(!/!!*/1.!Č,.%+.0+0!),(0%*#Č5+1.ǫ!("/0/%*'%/ ü00! %*%0/ü*(,+/%0%+*ċ1!0+0$!)!0$+ +"!.)% )*1"01.%*#Čǫ!("/0/%*'/2.5%*/%6!ċƵ/.!/1(00$! 3+.'/1."!+2!.$*#/.!-1%.! *2.5+*/% !.(5ċ " 0$!/%*'%/%*,(!3!*.!0!*1.0!+2!.$*# 0!),(0!* !*/1.!0$!+..!0,+/%0%+*%*#+" .%*!. #.++2!/ċ

HOBS (!/!/1,,(51/3%0$0$!)'!* )+ !(+"5+1.$+ * 3$!0$!.%0%/#/+.!(!0.%ċ!,!* !*0+*0$! )0!.%(/,!%ü! 3!)5 2%/!0$!1/!+".%(/ċ(!/! )'!(!.%"5+1.!-1%.!ý1/$+..!0! $+10+10ċ (!/! +1(!$!'5+1.$!0+10,10* .!-1%.! $+ /,%*#Ĩ0$%/2.%!/,,(%*!0+,,(%*!ĩċ

   (!/!/1,,(51/3%0$)'!Č)+ !(* ü00%*#05,!Ďý1/$ ĥ1* !.)+1*0ĥ%*/!0ċ(!/!!*/1.!5+1$2!0$!/%*' +*/%0!00%)!+"0!),(0!ċ!,!* !*0+*5+1.$+%!+" )0!.%(3!)5 2%/!1/%*#/1,,+.0.%(/ċ

   Ƶ Ƶ  R1 2

ƫ Ƶ ƫ (!/!(!01/'*+30$!*1)!.+",(1#/+'!0/* (%#$0 /3%0$!/5+1.!-1%.!10+10/"+.ċ(!/!!*/1.!*5,(1# /+'!0/+.(%#$0/3%0$!/.!%*ġ/%0100%)!+"0!),(0!ċ

Ƶ  1. .%*!.#.++2!///0* . .!/0.%#$0ąĆĀ)) ü*%/$! ċ.++2!/*!(+0! !%0$!./% !+"0$!/%*'Č ,(!/!(!01/'*+3ċ(!/!+*00+1.(!/Ē!.2%! 0!)%"5+1. !/%#*%*(1 !/*%*0!#.0! /%*'ċ

ġƵƫƵƫ ġ/$,!10+10/* *+0$!/3%((!1/! %*2.%!05 +"%.1)/0*!/ċ%ċ!ċ+2+% ,%,!/Č+./$,!.+1*  ,%((./ĥ*%/ċ

2 R1

$!/!3%((//0* . $2!ć)). %1/%*((+.*!./ċ )((!..+1#$ü*%/$10+10/*!.!-1!/0! "+.%0!)/ /1$/,+,ġ1,/+'!0/ċ

R1 0

0 R1

• •

%*%)1)āĂ)). %1/%*0!.*(+.*!./ %*%)1)āĀ)). %1/!40!.*(+.*!./

Ƶ  Ƶ//0* . ".%0!č •

Ć/0.%#$0 .%*!.#.++2!/ċ

.++2!/*!(+0!  !%0$!./% !+"0$!/%*'+3(ċ

ƵƵ

 Ƶ

TAPER

WAVE

TRACK

ƫ

2!.5!û+.0%/) !0+)%*%)%/!0$!+(+1.2.%0%+*!03!!*0$!.+10!.(%*!/* 0$!/1."!)0!.%(ċ !(/++û!."1((Č$("Č/(+,! * %*ü*%05 .%*!.#.++2!/ċ(!/!/'"+. !0%(/ċ

ĂċĂĊ

!/0%)0!/Į,3/ċ+ċ1'


   

0!.%(/$+3*č0.0ƫ...%+% %*'/$+3*čāĉāĀƵ4%4ĈĀĀ%*#+( .//

Ƶ ƫ.!0!+*0!),+..5/05(!3%0$/%*'0$0%*0!#.0!/3%0$%*0$!3+.'/1."!0+$%!2!/!)(!// (++'ċ$%/,+,1(.+,0%+*%/2%((!"+.+0$'%0$!*/* 0$.++)/ċ 0/-1%'* !/50+)%*0%* * 2%((!%**..5+")0!.%(+,0%+*/ċ !!,#!ĂċăāĒĂċăĂ"+.)+.! !0%(/

  Ƶ/!)(!// !/%#*((+3/"+.*1*%*0!..1,0! /1."!!03!!*0$!+1*0!.0+,* 0$!/%*'Č3$%(/0 (!./%(%+*!%/,(! .+1* 0$!.%)0+,.+2% !0%#$030!...%!.ċ %*0!**!%/!/5/0$!.! %/*+! #!3$!.!.1)/*  !.%/*#!01#$0ċ$!.!,+//%(!10+10/3%((!0'!*".+)0$! )*1"01.!./.!+))!* ! /,!%ü0%+*ċ* !.)+1*0/%*'/.!(( !/%#*! 3%0$$)"!.! ! #!ċ !!,#!ĂċăāĒĂċăĂ"+.)+.! !0%(/

CERAMIC Ƶ/%*'0+/1%0+0$+*0!),+..5* (//%'%0$!* !/%#*/ċƫ!.)%/%*'/.!%*.! %(5 1.(!Č3%0$ 0$!,%(%05+"3%0$/0* %*#2!.5$%#$0!),!.01.!/Č)!*%*#0$00$!5*!1/! 3%0$$+030!. 0,/ċƵ(0$+1#$!/50+(!*Č.!%/*!! ! 0+,.+0!00$!#(6! /1."!ċ1!0+0$!)*1"01.%*# ,.+!//Č!2!.5!.)%/%*'%/%* %2% 1(ċ !!,#!Ăċăă"+.)+.! !0%(/

Ƶ . %0%+*((5 !/%#*! %*/0%*(!///0!!(Č(5ġ+*/%*'/.!*+32%((!3%0$)1(0%,(! .%*!.+,0%+*/*  %*$+%!+")0!.%(/* ü*%/$!/0+$%!2! !/%.! /05(!ċ 5+*/%*'/.! !/%#*! 0+/%0+*0+, +"0$!3+.'0+,05,%((5Ć))+û0$!/1."!ċ +/0(5+*/%*'/.!/1,,(%! 3%0$0,$+(!ċ !!,#!Ăċăă"+.)+.! !0%(/

ƵƵ Ƶ)+ !.*2!./%+*+"!.)%/%*'ċƫ.!0!/00!)!*0%**5'%0$!*5%*/0((%*#"!01.! +3*/0* /%*'ċƵ"!01.! +3*/0* /%*'$/( ! ".+*03$%(/0(/+!*!ü00%*#".+)/0%*(!// /0!!(+3(0+!*/1.!!/5)%*0!**!* $5#!*%+* %0%+*/ċ !!,#!Ăċăą"+.)+.! !0%(/

PWS Worksurfaces: ĀāăĂĆĆĀĆĆĂĂ

ĂċăĀ


Ƶ   Integrated sinks by:

0!.%(/$+3*č0.0Ƶ/+(10! .(!$%0! %*'/$+3*čāĉāĀƵ4%4ĆĀĀ%*/0%*(!///0!!(

āĉāĀ+),*5*+3+û!.Ƶ4%4/%*'/%*ąü*%/$!/ !$2%((!%*0$!"1((/%6!.*#!ċ $!/!/%*'/,.+2% !30!.0%#$0/+(10%+*0$0 ((+3/0$!1/!+"$+0ĥ+%(%*#30!.0,/*  .!0!/*1,).'!0+*0!),+..5ü*%/$ċ • • •

āĂ)+*0$#1.*0!!+*/%*'&+%*0/ āĀ5!.#1.*0!!+*)0!.%( ĈĆ5!.#1.*0!!+*/%*'

1%0(!"+.)1(0%,(!)0!.%(,,(%0%+*/Č/,!' 0++1.(!/* !.2%!0!)"+.%*"+.)0%+*+* 2%(%(%05* (! 0%)!/ċ

+( ǫ.//

0%*(!//0!!(

ƫ+,,!.

1* !0(

Solid surface sinks by:

ƫ+.%*©+û!..*#!+"/%*'/0+/1%0*5 ,,(%0%+*%*(1 %*#0$!%.!4ġ/0+'.*#!+"/0 /%*'/Č2*%05/%*'/* 0$!%.,.'(%*#.*#!ċ *(52%((!0++. !.%*ƫ+.%*į'%0$!*+(+1./ 3$!*1/%*#+1."1((0!),(0!* %*/0((0%+* /!.2%!ċ ,!'0++1.(!/* !.2%!0!)"+. %*"+.)0%+*+*2%(%(%05* (! 0%)!/ċ */0*0+%(%*#30!.$+00,//$+1( *+0!1/! %* +*&1*0%+*3%0$/+(% /1."!/0/%*'/0+2+%  )#! .!/1(0%*#".+)0$!.)(/$+'ċ

0!.%(/$+3*č 2+',.'(%*# %*'/$+3*čĊĆĀĆ

Ăċăā

!/0%)0!/Į,3/ċ+ċ1'

ĊĆĀă

ĊĆĀą

ĊĆĀĆ

ăĂĀ4ąāą4āĊĈ))

ąāĆ4ąāĆ4āĊĈ))

ĆĀĊ4ąāĆ4āĊĈ))


Integrated quartz sinks by:

$%/)+/0%**+20%2!,.+ 10+/0/((0$! .!).'(!$.0!.%/0%/+"%(!/0+*!Č0$0)'! %00$!,.!)%!.,.+ 10+*0$!).'!0ċ$!/! "!01.!/%*(1 !č$%#$/.0$.!/%/0*!Č 1.%(%05 * +"+1./!Č0$!$%#$!/0,!."+.)*!%*0!.)/+" !/%#*ċ ,!'0++1.(!/* !.2%!0!)"+. %*"+.)0%+*+*2%(%(%05* (! 0%)!/ċ

0!.%(/$+3*č%(!/0+*!0!.*(ƫ(00+( %*'/$+3*č *0!#.%05

*0!#.%05*!

*0!#.%05)((

*0!#.%05 .#!

*0!#.%054 .#!

*0!#.%05+,

*0!#.%05

ąąĀ4ĆąĀ4āĈĆ))

ăĈĀ4ąĀĀ4āĈĆ))

ąĀĀ4ĆąĀ4āĈĆ))

ąćĆ4ĈĀĀ4ĂăĆ))

ąĀĀ4ĆąĀ4āĈĆ))

ąąĀ4ĆĆĀ4āĈĆ))

Solid surface sinks by:

%ġ /IJ+û!..*#!+"/%*'/0+/1%0*5 ,,(%0%+*%*(1 %*#0$!%.!4ġ/0+'.*#!+"/0 /%*'/Č%2.%/%*/*  %4.*#!ċ *(52%((!0++. !.3$!*1/%*#+1."1(( 0!),(0!* %*/0((0%+*/!.2%!ċ ,!'0++1.(!/* !.2%!0!)"+. %*"+.)0%+*+*2%(%(%05* (! 0%)!/ċ

*/0*0+%(%*#30!.$+00,//$+1( *+0!1/! %* +*&1*0%+*3%0$/+(% /1."!/0/%*'/0+2+%  )#! .!/1(0%*#".+)0$!.)(/$+'ċ

0!.%(/$+3*čƵ(,%*!$%0! %*'/$+3*čƫĆĀą į01 %++ .%*%%ġ /IJ

ƫăĂĆ ƫăĂĆ

ƫąĊĀ ƫąĊĀ

ƫąąĊ 

ăćĆ4ăćĆ4āĉą))

ąĂĀ4ĆĂĀ4āĊć))

ąāĆ4ąĉĊ4ąĂĀ))

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

ĂċăĂ


ƫƵ ƫ  

0!.%(/$+3*č%(!/0+*!0!.*(!.!*

%*#(!,%!!

,,(%*0$/-1.!

$!*$++/%*#!.)%/%*'0$!.!.!*1)!.+" ,(%*0$+,0%+*/ċ,,(%*0$/3%((!1/! %*0$!"+((+3%*# %.1)/0*!/č • • •

((0+3((,,(%0%+*/ċ $!*.1*%/+2!.0$!)4%)1))*1"01.%*# /,!%ü0%+*ċ !')0!.%(Č+.3$!.! !,0$+"0$!!("/0.%(%/ 0++/)((ċĵĵ

,,(%*0$. %1/

• • •

+,! #!,.+ü(! +*(5+*!("/010+10ċ ƫ$)"!.! 0+,! #!//0* . Ĩ+00+)! #!(!"0 /-1.!ĩċ !*%(ă))*!.!-1!/0! +*0$!0+,! #!ċ

ĵĵ+$!')%*%)1)!("/0.%(/!!)0!.%(/,!%ü0%+*0(!+*,#!ĂċĂć

CUT OUTS ǫƵ Ƶ   •

*.*%0!)0!.%(/0$!!*0.(,%!!+"0$!10+10 3%((!(!"0%*3%0$ĉ))(!"0%*0$!+00+)+"0$!10 +10Č0$%/%/"+. ! /0.!*#0$3$!*0.*/,+.0%*#*  ..5%*#0$!3+.',%!!ċ$%/3%((0$!*!.!)+2!  +*/%0!Ĩ/+)!3!'!.#.*%0!/)5$2!āĆ))(!"0%* 0$!+00+)+"0$!10+10/ĩċ

1.06)0!.%(3%(($2!0$!)% +),(!0!(5%*0$!"0+.5ċ

$!10+103%((.!)%*1*,+(%/$! Ĩ0$%/3%((! +2!.! 50$!%*/!0$++./%*'ĩċ

%*%)1).%(0$%'*!//".+*0* '%/ĆĆ))Ĩ0$! '%0$!*%*!0//$+1( !/!0".!*+1#$+û0$! 3((0+((+3"+.0$!/!)%*%)1).%(0$%'*!//50$! '%0$!*ü00!. 1.%*#0$!%.%*/0((0%+*ĩċ

Ăċăă

!/0%)0!/Į,3/ċ+ċ1'

(!.!)+2! 

$!$+* /%*'3%((! .50!/0! 00$!!* +"0$! %*/0((0%+*0+!*/1.!0$!10+10%/+..!0ċ


ƵƵ

0!.%(/$+3*č!'0+* %.

$!#.+3%*#,+,1(.%05+""!01.! +3*/0* /%*'.!0!/0$!(++'+"1%(01,!/,+'!/%*'ċ /%*#*1* !.)+1*0/%*',.+!//,*!(%/)*1"01.! 0+.!0!0$!1%(01,/05(!ċ

ǫ  

  

ǫ100&+%*0+2!* /$+3*+*,#!Ăċăă%//0* . ċ

%0.!&+%*02%((!+*!.0%*)0!.%(/ċ ,!'0+ƫ1/0+)!.!.2%!/"+."1.0$!.%*"+.)0%+*ċ

  ĒǫƵ  4,(+ ! 2%!3+".%(/

ĵĵĵ.,$%0+/$+3 $+.%(/ċĵĵĵ

%(/.!1/! 0+.! 1!0$!(!*#0$+".1*Č 3$!*0$!/%6!%/+2!./,!%ü0%+*Č/!!)0!.%( /,!%ü0%+*0(!+*,#!ĂċĂćċ

%(/*(/+!1/!  %*3((ġ0+ġ3((,,(%0%+*/ċ

%*%)1).%(0$%'*!//%/ĆĆ))ċ

%(/3%(($2!%/1%0#.++2!/%*+0$ 0$!.%(* %*0$! &+%*%*#,%!!/ċ $%/05,!+"&+%*0%/1/! 0+%*.!/! /0.!*#0$ċ

PWS Worksurfaces: ĀāăĂĆĆĀĆĆĂĂ

Ăċăą


ƫ Ƶ  "5+13*00+)'!/00!)!*0Č +3*/0* /* 3((( 0$!)0!.%(* ü*%/$!/* *+0$!. %)!*/%+*ċ

%*#.!0!0.1! !/%#*"!01.!ċƫ+*0./0%*#

ǫ.!'"/0./,.+2% !"1*0%+*(%05%*'%0$!*ċ$!.!.!)*535/0+%*(1 !0$!)Ďý+0%*#Č+*0./0%*# )0!.%(Č+.*!40!* !  +3*/0* ċ$!*,(**%*#.!'"/0.Č,(!/!+*/% !.0$!)4%)1) +2!.$*#* 1* !.,+(%/$%*#.!-1%.! Č/!!,#!Ăċăĉ+./,!'0++1./(!/Ē/!.2%!0!)"+.)+.! !0%(/ċ

B C A

D

0!.%(/$+3*č0.0001%.+

A

B

Ƶ

ǫĥƵǫƵƫ  Ƶ

ƫ.!0!1*%-1!"!01.!0+*53+.'/1."!* #.!0 (0!.*0%2!0+0%(%*#ċǫ!/,+'!+,0%+*/.!2%((!ċƵ/ /0* . +1.1,/0* /.!/1,,(%! %*ĂĀ)))0!.%(Č āĀĀ))$%#$3%0$Ă)).%/ċ!!)0!.%(/,!%ü0%+* #1% !Ĩ,#!ĂċĂćĩ"+.)4%)1)(!*#0$/ċ "1/%*#3%0$ #/,,(%*!,(!/!.!)!)!.0++*/% !.)%*%)1) %/0*!ċ

%*0%*(!*++'%*#.!* $%!2!/!)(!// '%0$!*(++'ċǫ'/,(/$!/.!,(! !$%* 0$! '%0$!*$+* ,01.!/,(00!./3$!*++'%*#ċ$!5 *(/+,.!2!*0 )#!0+5+1.3((,,!.+.,%*0 ".+)$!0* +* !*/0%+*ċƵ//0* . /,(/$'/ .!/1,,(%! %*ĂĀ)))0!.%(/ċ!!)0!.%( /,!%ü0%+*#1% !Ĩ,#!ĂċĂćĩ"+.)4%)1)(!*#0$/ċ " 1/%*#3%0$#/,,(%*!,(!/!.!)!)!.0++*/% !. )%*%)1) %/0*!ċ

C

D

FULL BACK SPLASH

Ƶ

$!,.%).5,1.,+/!+"'%0$!*'/,(/$%/0+,.+0!0 0$!3((".+)(%-1% /Č1/1((530!.ċǫ10%0*(/+)'! /00!)!*03%0$!%0$!.+*0./0%*#+.)0$%*#)0!.%(ċ Ƶ//0* . +1.'/,(/$!/.!/1,,(%! %*ĂĀ)) )0!.%(ċ!!)0!.%(/,!%ü0%+*#1% !Ĩ,#!ĂċĂćĩ"+. )4%)1)(!*#0$/ċ "1/%*#3%0$#/,,(%*!,(!/! .!)!)!.0++*/% !.)%*%)1) %/0*!* *510 +10/"+./+'!0/0$03+1( *!! 0+!%*(1 ! ċ

.+2% ! ! "1*0%+*(%05%**5'%0$!*5%*(1 %*# *!40!* !  +3*/0* ċ+0+*(5*%0!1/! / *!* ,*!(100$!5*+û!.!40./!0%*#ċ$!* ,(**%*#*!40!* !  +3*/0* ,(!/!+*/% !. )4%)1)+2!.$*#/* 3$!0$!.1* !.,+(%/$%*#%/ .!-1%.! ċ!!)0!.%(/,!%ü0%+*#1% !Ĩ,#!ĂċĂćĩ "+.)4%)1)(!*#0$/* +2!.$*#/

ĂċăĆ

!/0%)0!/Į,3/ċ+ċ1'


Ƶ ,/0* /*!1/! / !/%#*"!01.!Č10(/+,.+2% !,.0%(/+(10%+*"+.*5!*2%.+*)!*0.+1*  0$!$+1/!ċ 0!.%(/$+3*č!'0+*ǫ!.#!*

ǫ!/,+'!1,/0* /āĀĀ))/0* . ċ %)!.1,/0* /.!2%((!".+)/0+'

0* . "!01.!/"+.1,/0* /.!č

Ă))Ƶ..%/

ƫ$)"!.! 0+,! #!ċ

ĆĀġāĀĀ))$%#$ċ

!!)0!.%(/,!%ü0%+*#1% !Ĩ,#!ĂċĂćĩ"+. 4%)1)1,/0* (!*#0$ċ

ĆĀġ āĀĀ))

$!.!,+//%(!&+%*0/3%((!,(! !$%* 0,Č +.%*(%*!3%0$3+.'/1."!&+%*0ċ +.+(% 1."!)0!.%(/Č+2! 1,/0* /.! 2%((!1,+*.!-1!/0ċ

SPLASHBACKS 0* . "!01.!/"+./,(/$'/ .!č • • •

0!.%(/$+3*č0.0Ƶ/+(10!$%0!

ĂĀ)))0!.%(ċ 0* . /-1.!,+(%/$ċ -1.!+.*!./Ĩ(0$+1#$ /,(/$'/*!/$,! 0+ü0 0$!!40.0+.3$!.!.!-1%.! ĩċ +(%/$0+/0+,0$!%#$0+" 1,/0* /3$!.!1,/0* /.! .!-1%.! ċ Ƶ.%/!.*(/+! ! !$%*  /%*'0+/0+,30!./,(/$!/ċ

+(%/$0+/0+,0 $!%#$0+"1,/0*

+.+(% 1."!)0!.%(/Č+2!  1,/0* /ĥ/,(/$'/.!(/+ 2%((! !,!* %*#+*$+$+%!ċ PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

Ăċăć


FULL SPLASHBACK

0!.%(/$+3*č%*1+1/$%0!

'!*%),03%0$!%0$!.+*0./0%*#+.)0$%*#)0!.%(ċ • Ƶ//0* . +1./,(/$'/.!/1,,(%! %*ĂĀ)))0!.%( • (!/!+*/% !.*510+10/"+./+'!0/0$03+1( *!! 0+!%*(1 ! • !!)0!.%(/,!%ü0%+*#1% !Ĩ,#!ĂċĂćĩ"+.)4%)1)(!*#0$/ • ƫ+*/% !.)%*%)1) %/0*!%"1/%*#3%0$#/,,(%*! • (!/!!*/1.!((/+'!0/.!.!)+2! 00$!0%)!+"%*/0((

Ƶ +3*/0* /,.+2% !"1*0%+*(%05%**5'%0$!* 3%0$!%0$!.*!40!* !  +3*/0* 0++û!.!40. /!0%*#+./)0$%*#!* ,*!(ċ • $!*,(**%*#*!40!* !  +3*/0* ,(!/! +*/% !.)4%)1)+2!.$*#/* %"1* !. ,+(%/$%*#%/.!-1%.! • !!)0!.%(/,!%ü0%+*#1% !"+.)4%)1) (!*#0$/* +2!.$*#/

0!.%(/$+3*č%(!/0+*!ƫ$.+(+,/0+*!

ĂċăĈ

!/0%)0!/Į,3/ċ+ċ1'


Ƶ

0!.%(/$+3*č0.0ƫ...%+%

* (!(!// ++./

* (!  ++./ 35

40

* (!  ++.///0* . $2!ąĀ))+2!.$*# ".+)0$!.//ċƵ,,.+4%)0!(5ĂĀ))+2!.$*# ".+)0$!".+*0+"0$! ++.ċ * (!(!// ++.///0* . $2!ăĆ))+2!.$*# ".+)0$!.//ċƵ,,.+4%)0!(5āăġāĆ))+2!.$*# ".+)0$!".+*0+"0$! ++.ċ * (!(!// ++./)1/0!+*/%0!00%)!+"0!),(0! 0+!*/1.!0$!+..!0+2!.$*#%//!(!0! ċ N.B.ġ+*ġ/0* . ! #!,.+ü(!/)5.!-1%.! %û!.!*0+2!.$*#ċ

Ƶ *((+2!.$*#/Č)%*%)1)+"Ăĥă+"0$!3+.',%!!)1/0!/1,,+.0! ċ *N.B.ġ+)!#.*%0!/.!/1&!00+(.#!.+2!.$*#ġ/!!.*%0!/,!%ü0%+*#1% !Ĩ,#!ĂċĂćĩ"+. "1.0$!. !0%(/ċ Ƶ//0* . 0$!1* !./% !+"0$!/0+*!3%((!1*ü*%/$! ċƵćĀĀ.%0Ĩ$(",+(%/$ĩ+."1((,+(%/$*! .!-1!/0! 0* %0%+*($.#!ċ ƵćĀĀ.%0,+(%/$%/#!*!.((51/! +*0$!1* !./% !+"/!0%*#.!/0+0'!0$!.+1#$*!//+10+"0$! /1."!ċƵ"1((,+(%/$%/#!*!.((51/! %*.!/3$!.!0$!'/% !+"0$!/0+*!3%((!2%/%(!ċ Material

A - Max extended overhang

ăĀ)).*%0!ĵ ĂĀ)).*%0!ĵ ăĀ))1.06 ĂĀ))1.06 āĂ))(0.ƫ+),0 ĂĀ))(0.ƫ+),0 ăĉ))+(% 1."! ąĀ))%)!. ĂĈ))%)!.

ĂĆĀ)) āĆĀ)) ăĆĀ)) ĂĆĀ)) āĆĀ)) ăĀĀ)) ăĀĀ))+.(!*#0$/+2!.āćĀĀ)) ăĀĀ)) ĂĀĀ))

A

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

Ăċăĉ


 

0!.%(/$+3*čƵ/$.!5

  (!/!0'!0%)!0++*/% !.3$0&+%*05+1.!-1%.!/,.0+"5+1. !/%#*ċ ƫ+.*!.100&+%*0

0.%#$0&+%*0

%#+*(&+%*0

/+*Ě/)%0.! /!3$!*/!(!0%*# %1/.+ü(!

ƫ ƫƵ

+%*0/3%((!/1,,+.0! ".+*0* 'ċ$+1( 0$%/*+0!,+//%(!Č)/+*Ě/)%0.!*!1/! 0+ )+2!0$!&+%*0+2!./1,,+.0ċ

+%*0/*2.5%*0$%'*!//!/1,0+)4%)1)+"ă))ċ

Ƶ((.* ! )0!.%(/3%((1/!0$!/1,,(%!./.!+))!* ! .!/%*3$!.!,+//%(!ċ

/0* . &+%*0,.+! 1.!1/!/Ă,.0,+45.!/%*ċ%#)!*0%/

$!)4%)1)((+3(!(%,!03!!*03+&+%*0! ,%!!/ %/ŐĥġĀċĆ))ċ

+(% 1."!&+%*0/.!%*+*/,%1+1/3$!.!/+(% /1."!)0!.%(%/ %.!0%+*( %#+*(&+%*0%/1/! ċ

*(!///,!%ü! 0$!+.%!*00%+*+"#.%*/Č2!%*/*  %.!0%+*+"/02!/0&+%*0/**+0!#1.*0!! ċ

! 0+.!0!+(+1.)0$ċ

(!/!/,!'0++1.0!)"+.)+.! 2%!* %*"+.)0%+*

ĂċăĊ

!/0%)0!/Į,3/ċ+ċ1'


 Ćľ ĆŤ 

A

B

C

$!+2! +1)!*0/.!*+32%((!0+ +3*(+ "+.5+1.+*2!*%!*!0www.pws.co.uk

A

Your Check listĢ !0%(/((0$!%*"+.)0%+*3!.!-1%.!0+!*(!1/0+,.+2% !5+13%0$*1.0! -1+0!Ä&#x2039;

B

Planning ConsiderationsĢ+1.#1% !0+.!/3$!.! !/%#*$+%!/+.Ăź00%*#(%)%00%+*/*!! 0+! %/1//! !"+.!5+1.Ăź*(/,!%Ăź0%+*%/.!0! Ä&#x2039;

C

ĆŤ+))1*%0%*#5+1.,!%Ăź0%+*ÄĄ *+. !.3!*,.+2% !5+13%0$0$!)+/01.0!-1+00%+* 3!/'0$05+1,.+2% !(!.* +*%/!,(*3%0$(!. %)!*/%+*/Ä&#x152;)0!.%(*)!Ä&#x152;0$%'*!//Ä&#x152; ,.+Ăź(! !0%(* ((,,(%*!%*"+.)0%+*Ä&#x2039;

!3%(( %/1//((+"5+1. .3%*#/3%0$5+1+**%* %2% 1(/%/0+!*/1.!0$0!2!.5 !0%($/!!* +..!0(5,01.! Ä&#x2039;

ĆŤ+*00+1./(!/* /!.2%!0!)"+."1.0$!.%*"+.)0%+*+*Ä&#x20AC;Ä Ä&#x192;Ä&#x201A;Ä&#x2020;Ä&#x2020;Ä&#x20AC;Ä&#x2020;Ä&#x2020;Ä&#x201A;Ä&#x201A;

PWS Worksurfaces:Ä&#x20AC;Ä Ä&#x192;Ä&#x201A;Ä&#x2020;Ä&#x2020;Ä&#x20AC;Ä&#x2020;Ä&#x2020;Ä&#x201A;Ä&#x201A;

Ä&#x201A;Ä&#x2039;Ä&#x2026;Ä&#x20AC;


YOUR CUSTOMER ƫ  PROGRAMME

Ƶă  Ƶ

Ƶ  Ē ƫ

TRADING ARRANGEMENTS • . !.,.+!//!4,(%*! • +33! !(3%0$%//1!/ • 1..!01.*/,.+! 1.! • !(%2!.%*#,.+ 10/

CUSTOMER SERVICE • 2!.51/0+)!.%///%#*! ƫ1/0+)!.!.2%! Ƶ 2%/+.ċ$!53%((!5+1.,+%*0+"+*00* #1% ! 5+10$.+1#$0$!3+.'/1."!,.+!//ċ • 1.+*00!*0.!%/2%((!+*ĀāăĂĆĆĀĆĆĂĂċ •  +* 50+.% 5ĉċăĀ)0+Ć,)

PRODUCT KNOWLEDGE • 1.ƫ1/0+)!.!.2%!Ƶ 2%/+./.!"1((50.%*! %*(( +"+1.,.+ 10/* /!.2%!/ċ • Ƶ/,.0+"+1.ƫ1/0+)!. * 10%+*.+#.))!3! ,.+2% !0%(+.! 0.%*%*#* 0. !)0!.%(0+/1,,+.0 5+1%*!+)%*#3+.'/1."!%* 1/0.5!4,!.0/ċ

PROBLEM RESOLUTION • !$2!.+1/0.!)! %(/!.2%!%*,(!/,.0+" +1.,.+(!).!/+(10%+*/!.2%!ċ$%/3%((!)*#!  0$.+1#$*!*$*! (! 0%)!ċ

DISPATCH & INSTALL • 1.ą/0!,,.+#.))!%*+.,+.0!/Ď0!),(0%*#Č )*1"01.%*#Č !(%2!.5* %*/0((0%+*+"5+1. 3+.'/1."!ċ+./1,,(5+*(5,.+ 103!$2!2.%+1/ )!0$+ /+" %/,0$0+/1%05+1.*!! /ċ


 Ćľ  ĆŤ

SEE OUR FILM ON THE WEBSITE

Create an !/0%)0!%* )%*10!/+* +1.+*(%*! !/0%)0+.

+((+30$!(%*'0 www.pwsworksurfaces.co.uk

+#%*1/%*#5+1.3!/%0!(+#%* !0%(/

  Ćľ  Ćľ   Ćľ  ĆŤ 

O 0!.%($+%! O!/%#* !0%(/ O%*%/$/,!%Ăź0%+*

 ĆŤ

+'*  )!* 0$! /,!%Ăź0%+*/

Ćľ

0.0(2#!%)!. PWS Worksurfaces:Ä&#x20AC;Ä Ä&#x192;Ä&#x201A;Ä&#x2020;Ä&#x2020;Ä&#x20AC;Ä&#x2020;Ä&#x2020;Ä&#x201A;Ä&#x201A;

Ä&#x201A;Ä&#x2039;Ä&#x2026;Ä&#x201A;


  ĆľÄ&#x2019; Ćľ

Ćľ  ĆŤ ĥƾƍƾ Ä Ä&#x2039;  Ćľ â&#x20AC;˘ . !.+*Ăź.)0%+*.!!%2! Ä&#x2039; 1.(!/Ä&#x2019;!.2%!0!)3%((((5+10++*Ăź.) 3!$2!5+1.Ăź*( .3%*#* 0$!$+/!* )0!.%(Ä&#x2039; â&#x20AC;˘ Non stock material requested. +1.$+/!*)0!.%(3%((!+. !.! *  (! 0%)!+*Ăź.)! Ä&#x2039;ĆŤ$.#!/3%((!,,(%!  00$%//0#!%"0$!)0!.%(%/$*#! +. *!((! Ä&#x2039; â&#x20AC;˘ A call from our customer services team to +*Ăź.)0$!0!),(0%*#,,+%*0)!*0* 5+1. readiness will be made one week and 48 hours prior.

Ä&#x201A;Ä&#x2039;  Ćľ â&#x20AC;˘ A CAD drawing will be sent for your approval. â&#x20AC;˘ Our Sales & Service team will call to discuss any variance to the pre template design. â&#x20AC;˘ If there are no changes or queries, your drawing will be passed straight to production. â&#x20AC;˘ If changes are necessary these will be actioned and a new CAD drawing sent for approval. ÇŤÄ&#x17D;,5)!*0%/.!-1%.! !"+.!!%*#,//! 0+ ,.+ 10%+*%"*+0.! %0+1*0Ä&#x2039;

â&#x20AC;˘ 24 hours prior to the template appointment, our templater will call to advise an expected 0%)!+"..%2(* 3%((+*Ăź.)+*0$! 5+" arrival.

Ä&#x2026;Ä&#x2039;Ćľ Ćľ

Ćľ 

Ä&#x192;Ä&#x2039;ĆŤ 

â&#x20AC;˘ Our installation team will call the customer to +*Ăź.)0%)!+"..%2(Ä&#x2039;

â&#x20AC;˘ Material will be delivered to the factory for production

â&#x20AC;˘ Once installed, our team will walk the customer through their new worksurface.

â&#x20AC;˘ The worksurface will be manufactured as per the approved drawing

â&#x20AC;˘ Discussion with customer will be made over warranty and aftercare instructions.

â&#x20AC;˘ 48 hours prior to installation our Sales & Service team will call the customer to +*Ăź.).! %*!//"+.0$!%*/0((0%+*Ä&#x2039;

â&#x20AC;˘ Time will be given to the customer to review the surface. â&#x20AC;˘ The installer will be available to answer any questions before asking the customer to sign +Ăť0$!%*/0((0%+*Ä&#x2039;

â&#x20AC;˘ 24 hours prior to installation our team will call the customer to advise an expected time of arrival.

â&#x20AC;˘ We will remove any worksurface related waste material

ĆŤ$!'+10+1.3!/%0!0+/!!+1..!ÄĄ0!),(0%*#,.!,2% !+ÄĄ3+.'/1."!/Ä&#x2039;,3/Ä&#x2039;+Ä&#x2039;1'ÄĽĆľ+10

(!/!!*/1.!5+1.1/0+)!.%/"1((5,.!,.! ,.%+.0+0$!0!),(0!/!.2%! * 0$00$!5.!+*/%0!00%)!+"0!),(0!0+*/3!.*5-1!/0%+*/

Ä&#x201A;Ä&#x2039;Ä&#x2026;Ä&#x192;

!/0%)0!/ÄŽ,3/Ä&#x2039;+Ä&#x2039;1'


TEMPLATE SERVICE   ƵƵƵ  $!.!,+//%(!Č3!,.+2% ! %#%0(0!),(0%*# /!.2%!/+0$03!*#%*1.0! )!/1.!)!*0/0+.!0!3+.'/1."!0$0ü0/ ,!."!0(53%0$%*5+1.1/0+)!.//,!ċ+1. 0!),(0!%*"+.)0%+*%/%*/0*0(5!)%(! 0++1. "0+.50+/1,,+.0+1. Ć0+Ĉ 5*0%+*3% !(! 0%)!".+)0!),(0!0+ %*/0((0%+*ċ 0%/%),+.0*00$0 !%/%+*)'!.%/+*/%0! 00$!0%)!+"0!),(0!ċ

Ƶ   Ƶ)!)!.+"+1.0!)3%((!%*0+1$

ąĉ$+1./ ,.%+.

Ăą$+1./ ,.%+.

ā$+1. ,.%+.

ƵƵ   Ƶ  ƫƫƵǫ 

ƫƵ ƫ  

Ƶ(('%0$!*1*%0/)1/0!/!1.!(5ü00! %*,(!/ %#%0(0!),(0%*#.!-1%.!/,$5/%((+0%+*,+%*0/ 0+)!/1.!".+)ċ

ǫ!("/0/%*'/*01.((52.5%*/%6!3$%$* 1/!+*/% !.(!3+.'/1."!+2!.$*#/ċ 0%/ %),+.0*00+!*/1.!0$00$!5.!ü00! %*0$!%. ü*(,+/%0%+*,.%+.0+0$!0!),(0%*#/!.2%!0'%*# ,(!/+0$0*1.0!+2!.$*#0!),(0!* !#%*! * 0$! .%*!.#.++2!/.!+..!0(5 ,+/%0%+*! ċ

TEMPORARY WORKSURFACES Ƶ((0!),+..53+.'0+,/)1/0!.!)+2! /+0$0 3!*.!+. 1.0!)!/1.!)!*0/ċ

Ƶ  ĨƵ  ĩ ++./)1/0!ü00! +*$* (!(!//.%(/5/0!)/ 0+!*/1.!3!1.0!(5)!/1.!0$!3+.'/1."! +2!.$*#ċ

Ƶ Ƶƫ Ƶ,,(%*!/)1/0!+*/%0!3%0$ !0%(/+"0$! )'!/* )+ !(/0$* ċƵ,,(%*!%*"+.)0%+* $!(,/1/0+(.%"510ġ+10/%6!/* ,+/%0%+*/ċƵ .!-1%.! Ć))#,!%0$!./% !+"*5".!!/0* %*# ,,(%*!Ĩ.*#!++'!./!0ĩ)1/0!) !0+ ((+3"+.ü00%*#* !4,*/%+*ċ

(!/!+0!čƫ$!')*1"01.!./#1% !(%*!/"+. )%*%)1) %/0*!/!"+. !/%#*%/+*ü.)!

 ġ Ƶġ  ĥǫ 0%/.%0%(0$0((+2!.)+1*0/%*'/.!+*/%0!0 0$!0%)!+"0$!0!),(0%*#/!.2%!0'%*#,(! /0$!%.+3(/ +*Ě0 %00!0$!(+0%+*+*0$! 3+.'/1."!ċ

CURVES ++./+*1.2! "!01.!/)1/0!ü00! /+0$! . %1/*!)!/1.! 1.0!(5ċ$!%*!0 (+*!%/*+0(35/*1.0!%* %0%+*+"0$! ü*(. %1/.!-1%.!)!*0ċ

DOWNLOAD CHECKLIST & PREP GUIDLINES

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

Ăċąą


Ƶ

Ƶ  ƫ Ƶ  Ƶ

Ƶ  Ƶ*50!),+..50+,/3%((*!! 0+!.!)+2! .! 5"+.0$!*!33+.'/1."!0+!%*/0((! ċ Ƶ((,,(%*!/)1/0!+*/%0!Č10Č*+0%*/0((! ċ (!/!!*/1.!0$!.!%/ !%/%+*)'!.+*/%0!00$!0%)!+"%*/0((0%+*ċ*!0$!%*/0((0%+*%/+),(!0! 3!3%(( 2%/!5+1+*0$!.!* )%*0!**!+"5+1.3+.'/1."!* (!2!#1.*0!!. 3%0$ 3!/%0!(%*'/"+."101.!)%*0!**!#1% *!ċ !3%(((/+.!)+2!*53+.'/1."!.!(0! 3/0!)0!.%(ċ

Ƶ   Ƶ)!)!.+"+1.0!)3%((!%*0+1$

ąĉ$+1./ ,.%+.

ĂċąĆ

Ăą$+1./ ,.%+.

!/0%)0!/Į,3/ċ+ċ1'

ā$+1. ,.%+.


Ƶ   !$2!/1%0!+" ! %0! ).'!0%*#0++(/0+/1,,+.05+1ċ ƫ ǫƫ

SAMPLE BOOKS

ĥǫƫāĊ ƫ+(+1.+((!0%+*.+$1.!ċ

ĥƫƫ ƫ+(+1.+((!0%+*,.!/!*00%+*/!* /),(!++'/ċ

  ƵƵ   ƵƵ

 ǫ   ƵƵ

Ƶǫ Ƶ    ƵƵ

  čāĊĆĀ4ĆĀĀ4ĆĀĀ)) ǫ čāĊĆĀ4ĈĆĀ4ćăĀ))

āĊĆĀ4ĈĆĀ4ĆĀĀ)

āĆĀ4ĈĆ))

ƫĥƵ  ĂĀĥĂĀ %4! /),(!/0* ČĂĀ-1.06/),(!/Č ĂĀ#.*%0!/),(!/

 Ƶ ĥƵ +.'/1."!//0* "+.0%)!. /),(!/

ƫĥāĆĀƵ  ăĀ ),(!/0* 3%0$1,0+ăĀ4āĆĀ4ĈĆ)) -1.06/),(!/

ƫĥƵ  ĂĀ ),(!/0* ČĂĀ-1.06/),(!/

WTSAMPLES %)!./),(!/"+./),(! %/,(5/0* 

ĥāĆĀƵ  ăĀ ),(!/0* 3%0$1,0+ăĀ4āĆĀ4ĈĆ)) #.*%0!/),(!/

ĥƵ  ĂĀ ),(!/0* ČĂĀ#.*%0!/),(!/ ƫĥƵ  āĀĥāĀ %4! /),(!/0* ČāĀ-1.06/),(!/Č āĀ#.*%0!/),(!/

ƫĥāĆĀƵ  ăĀ ),(!/0* 3%0$ăĀ4āĆĀ4ĈĆ)) )%4! /),(!/

++. !.)0!.%(/),(!/,(!/!(((!/* !.2%!+*ĀāăĂĆĆĀĆĆĂĂċ (!/!-1+0!0$!.!"!.!*!*1)!.//$+3*%*/!0%+*āċ)0!.%(/* 0$!ü*%/$5+1.!-1%.!ċ

PWS Worksurfaces:ĀāăĂĆĆĀĆĆĂĂ

Ăċąć


We continually expand our handle collection to capture new designs and finishes. We also work hard to ensure our products are easy to navigate, with clear imagery and information. We have continued to make improvements in both areas.

KEY FEATURES â&#x20AC;˘ 2!.Ä&#x2020;Ä&#x20AC;Ä&#x20AC;* (!/%*Ä&#x160;$* (!Ăź*%/$!/ ĆŤ+((!0%+*/+*/%/0%*#+"Ä&#x201A;Ä&#x2C6;Ăź*%/$! +,0%+*/Ä&#x2039; â&#x20AC;˘ 12 handle types, from classic D-Handles to new Loop Handles. â&#x20AC;˘ Detailed product information for every handle, including: family name, handle type, code, hole centres, handle length, other size options, price band, and all other available Ăź*%/$!/Ä&#x2039; â&#x20AC;˘ Ćľ((* (!/%*(1 !Ăź4%*#/.!3// standard.

WHATâ&#x20AC;&#x2122;S NEW â&#x20AC;˘ !3Ăź*%/$+((!0%+*0$0,01.!'!5 material styles. â&#x20AC;˘ Handle names to ensure they are easier to identify and order. â&#x20AC;˘ Recategorizing of our existing collection to ensure we have the correct handle types. â&#x20AC;˘ The introduction of new concrete and leather handles both additions to our Material Collection. â&#x20AC;˘ New handle application information, alerting 5+10+*+*ÄĄ/0* . Ăź00%*#.!-1%.!)!*0/ e.g. reverse mounted. â&#x20AC;˘ Handleless rail collection added to the collection.


3 HANDLES

Handle information

01

Handle types

02

WHITE COLLECTION

52

White Matt

STAINLESS STEEL COLLECTION

04

ANTIQUE COLLECTION

54

Ƶ*0%-1!ǫ.+*6!""!0

Ä&#x2020;Ä&#x2020;

CHROME COLLECTION

Ƶ*0%-1!%(2!.""!0

Ä&#x2020;Ä&#x2021;

16

Ƶ*0%-1!%'!(

Ä&#x2020;Ä&#x2021;

NICKEL COLLECTION

24

WARM METALLICS COLLECTION

Bright Nickel

25

Copper Bright

59

Satin Nickel & Nickel

27

Copper Aged

59

Copper Burnt

60

Brass Brushed

61

Brass Aged

61

PEWTER & CAST IRON COLLECTION

30

Pewter Effect

31

Pewter

35

Cast Iron

36

KNURLED COLLECTION

38

BLACK COLLECTION

44

Black Satin

45

Black Chrome & Nickel

47

Black Steel Matt

47

Black Matt

48

Black Industrial Matt

49



58

MATERIAL COLLECTION

64

Leather

65

Concrete

65

Ceramic

66

Timber

67

HANDLELESS RAIL COLLECTION

69


HANDLE INFORMATION +13%((ü*  !0%(! ,.+ 10%*"+.)0%+*"+.!2!.5$* (!Ä&#x2039;

1

)#!+"0$!$* (!* ü*%/$

2

Name and handle type

3

Table Includes: Other sizes available Codes HC - Handle Centres HL - Handle Length PB - Price Band

1

4

Technical drawing

5

0$!.ü*%/$!/2%((!

2 3

Guildford Pull Handle

Code H1027.32.SS H1028.64.SS H1029.128.SS

HC 32mm 64mm 128mm

HL 98mm 130mm 193mm

PB 1 2 2

4 32/64/128 98/130/193

For handle weights please visit www.pws.co.uk

5

28

Black Satin Effect p57

HANDLE APPLICATION !$2!% !*0%ü! $* (!/0$0/%0+10/% !+"0$!/0* . .+*0! +1*0! ,,(%0%+*Ä&#x2039; ++'+10"+. the Reverse Mounted and Multi Fixings symbol.

FRONT FACE MOUNTED Handle attached to the front of the door/drawer

3.01

Order Online www.pws.co.uk

RM

REVERSE MOUNTED

Handle attached to the back of the door/drawer

MF

MULTI FIXING

Two part handle with latch connection


HANDLE TYPES !$2!āĂ %û!.!*0$* (! types in our collection. The key !(+3(.%ü!/0$!$.0!.%/0% of each type. Many handle families contain multiple handle types, allowing you to use a combination throughout a design.

KNOB

CUP HANDLE

T-BAR HANDLE

%*#(!!*0.((5ü4! $* (!

Formed shaped handle to slot hand into

Small T shaped handle

LOOP HANDLE

LATCH HANDLE

DROP HANDLE

)(((++,0++,!*3%0$ü*#!./

Similar to a door lock with two parts and a catch

3+ü4! /+'!0/3%0$ vertically rotating central handle

BAR HANDLE

D-HANDLE

BOW HANDLE

Straight bar style handle with 03++.)+.!ü4%*#,+%*0/

D shaped handle with two or )+.!ü4%*#,+%*0/

Curved shaped handle 3%0$ý0!* /

TRIM HANDLE

BLOCK HANDLE

RAIL SYSTEM

A strip style handle, top/side mounted

Simple geometric style handle

A integrated rail for a true Handleless kitchen

T: 01325 505599 (North) | 88 (South)

3.02


STAINLESS STEEL COLLECTION

HANDLE FAMILIES Stainless steel handles provide a clean look that allows for ultimate versatility. The neutral +(+1.* ü*%/$%/,!."!0)0$"+.)+/0'%0$!*/ċ$!ü*%/$(/++),(!)!*0/ stainless steel with appliances and sinks.

Guildford

1.

2.

3.

Arlington

4.

5 5.

Clerkenwell

6.

7.

Portland

8.

9.

10.

Dartmouth

11.

12.

Holborn

13.

14.

HANDLE CODES 1. H1027.32.SS (p05) 2. H1028.64.SS (p05) 3. H1029.128.SS (p05) 4. H503.60.SS (p08) 5. H503.128.SS (p08) 6. H1124.96.SS (p06) 7. H1124.256.SS (p06) 8. TK2SS (p05) 9. 1003/79.SS (p05) 10. 1001/131.SS (p14) 11. H1123.60.SS (p08) 12. H1128.160.SS (p08) 13. K1108.32.SS (p06) 14. H1047.160.SS (p06)

2WKHU´QLVKHVDYDLODEOH

T: 01325 505599 (North) | 88 (South)

3.04


STAINLESS STEEL

Lythe Knob Code K1068.64.SS

HC Central

Portland Knob

HL 64mm

PB 2

Code TK2SS

HC Central

35

32

Didsbury Knob

HL 32mm

PB 1

Code K1120.33.SS

HC Central

HL 33mm

PB 1

19 33

20 64

35 30 25

Chrome p17, Bright Copper p59

Matt Black p48, Antique Bronze p55

Pelton Knob

Bay Knob Code K068.25.SS

HC Central

HL 25mm

PB 2

Code 6432SS

HC Central

25

Melton Knob

HL 30mm

PB 2

Code K530.35.SS

HC Central

26

25

HC Central 35

14 35

30

Dale Knob

Lea Knob

HL 35mm

PB 1

Code K353.36.SS

10

HC Central

Law Knob

HL 36mm

PB 1

Code K808.50.SS

30

HC 30mm

35

HC 64mm

Chrome p19

HL 118mm

Portland Cup Handle PB 2

Code 1003/79SS.SS

HC 64mm

HL 78mm

Guildford Cup Handle PB 1

Code H1027.32.SS H1028.64.SS H1029.128.SS

HC 32mm 64mm 128mm

HL 98mm 130mm 193mm

PB 1 2 2

28

53 64 118

3.05

PB 2

50

36

Hill Cup Handle Code H1070.64.SS

HL 50mm

32 20

Burbt Copper p60

PB 1

31 20

Code K557.35.SS

HL 35mm

32

Order Online www.pws.co.uk

64 78

Price Bands

32/64/128 98/130/193

23

11

Under £5

2

£5-£10

3

£10-£15

28

4

£15-£25

5

>£25


Hyde Trim Handle Code H423.32.BS

HC 32mm

Soho Trim Handle

Holborn Trim Handle

HL 50mm

PB 1

Code K1108.32.SS

HC 32mm

HL 56mm

PB 2

Code H1131.90.SS H1131.250.SS

HC 90mm 250mm

RM

HL 130mm 350mm

PB 1 2

18 50

36

50

10

130/350

56

Chrome p19

Matt Black p48, Matt White p52

Clerkenwell Trim Handle Code H1124.96.SS H1124.256.SS

HC 96mm 256mm

37

90/250

20

32

20

50

HL 198mm 360mm

Holborn Trim Handle

RM

PB 2 2

Code H1047.160.SS

HC 160mm

Marylebone Trim Handle

HL 200mm

PB 3

Code H1087.32.SS H1087.160.SS H1087.256.SS

HC 32mm 160mm 256mm

RM

HL 50mm 200mm 350mm

PB 1 1 2 40

1616 96/256

18

32

22 22

32/160/256

160 200

198/360

16.5 50/200/350

20

Chrome p19, Black Nickel p47

Fell Trim Handle Code H1088.32.SS H1088.160.SS H1088.256.SS

HC 32mm 160mm 256mm

Black Satin p46

Seattle Trim Handle

RM

HL 50mm 200mm 350mm

PB 1 1 2 40

16.5 32/160/256 50/200/350

Code H1089.145.SS H1089.295.SS H1089.395.SS H1089.445.SS H1089.495.SS H1089.595.SS H1089.795.SS H1089.895.SS H1089.995.SS

HC 62mm 192mm 286mm 335mm 382mm 481mm 668mm 766mm 866mm

HL 145mm 295mm 395mm 445mm 495mm 595mm 795mm 895mm 995mm

Clapham Trim Handle

RM

PB 2 2 2 2 2 2 3 3 3

Code H732.160.SS

HC 160mm

HL 176mm

PB 2

40

160 176

Black Satin p46 Available for all door widths 149-997mm 43 16.5 Various

149-997

Key: HC Hole Centre HL Handle Length PB Price Band RM Reverse Mounted

T: 01325 505599 (North) | 88 (South)

3.06


STAINLESS STEEL

Order code SS72.GP188 SS72.297/237 SS72.397/337 SS72.447/387 SS72.497/437 SS72.715/655 SS72.85/835

Leven Bar Handle

Leven Bar Handle

12mmØ diameter

16mmØ diameter

Hole centre (B) 128mm 177mm 277mm 327mm 377mm 595mm 775mm

Length (A) 188mm 237mm 337mm 387mm 437mm 655mm 835mm

PB 3 1 2 2 2 2 3

Order code H066.188.SS H059.237.SS H060.337.SS H061.387.SS

Hole centre (B) 128mm 177mm 277mm 327mm

Length (A) 188mm 237mm 337mm 387mm

PB 2 1 2 2

37

33

B B A

A

All screw fixings are 30mm in from the end

Code H697.128.SS H698.160.SS H699.224.SS

Middlenton Bar Handle

Middlenton Bar Handle

14mmØ diameter

18mmØ diameter

HC 128mm 160mm 224mm

HL 148mm 180mm 244mm

PB 1 1 2

Code H707.128.SS H708.160.SS H709.224.SS

35

HC 128mm 160mm 224mm

PB 2 2 2

40 128/160/224

128/160/224

148/180/244

148/180/244

Thorne Bar Handle

Thorpe Bar Handle

12mmØ diameter Order code H540.188.SS H541.237.SS H542.337.SS

HL 148mm 180mm 244mm

Hole centre (B) 168mm 217mm 317mm

22mmØ diameter Length (A) 188mm 237mm 337mm

PB 2 2 2

Order code

Hole centre (B)

H196.188.SS

159mm

Length (A) 188mm

PB 3

H197.237.SS

208mm

237mm

3

41 37 B B A

A

3.07

Order Online www.pws.co.uk

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Thorpe Bar Handle 14mmÃ&#x2DC; diameter Order code H117.510.SS H118.655.SS

Hole centre (B) 482mm 627mm 807mm 160mm 209mm 309mm 359mm 409mm 509mm 709mm

H119.835.SS H109.188.SS H110.237.SS H111.337.SS H112.387.SS H113.437.SS H114.537.SS H115.737.SS

Length (A) 510mm 655mm 835mm 188mm 237mm 337mm 387mm 437mm 537mm 737mm

PB 3 3 2 1 1 2 2 2 2 2

36

B A

Chrome p20, Black Satin p45

Arlington T-Bar Handle Code H503.60.SS

HC Central

HL 60mm

Leeming T-Bar Handle PB 1

Code H1003.62.SS

HC Central

Dartmouth T-Bar Handle

HL 62mm

PB 1

Code H1123.60.SS

HC Central

HL 60mm

PB 2

18 35

33 62 60

35.5 35.5

22

60 60

10

Bright Nickel p25, Black Satin Effect p45

Arlington Bar Handle Code H503.128.SS H504.192.SS H505.224.SS H506.384.SS

HC 128mm 192mm 224mm 384mm

HL 168mm 232mm 264mm 424mm

Leeming Bar Handle PB 1 1 1 1

Code H1002.160.SS

HC 160mm

38 38

Chrome p20, Aged Brass p61

Dartmouth Bar Handle

HL 222mm

PB 1

Code H1128.160.SS

HC 160mm

HL 195mm

PB 4

35 160 222

34 128/192/224/384 168/232/264/424

35.5 35.5

16 160 160

38 38

195 195

18

Bright Nickel p26, Black Satin Effect p45

Key: HC Hole Centre HL Handle Length PB Price Band

Bright Nickel p26, Black Satin Effect p45

Chrome p20, Aged Brass p62

T: 01325 505599 (North) | 88 (South)

3.08


STAINLESS STEEL

Strand T-Bar Handle

Strand Bar Handle

Hendon Bar Handle Stainless steel effect and chrome finish

Code H1143.60.SS

HC Central

HL 60mm

PB 1

Code H1144.242.SS

HC 192mm

HL 242mm

PB 2

33

33

60

192 242

20

Bright Nickel p25, Aged Brass p61

HC 224mm

HL 264mm

PB 2

HC 192mm 320mm 128mm 160mm

HL 204mm 332mm 140mm 172mm

38 128/160/192/320 140/172/204/332

Hammersmith Bar Handle

Smith Bar Handle

Stainless steel effect with brown leather effect feature

Black soft touch and stainless steel

Code H680.160.SSLE

HC 160mm

HL 184mm

PB 3

Code H952.128.SSBL

HC 160mm

HL 200mm

160 184

224 264

Clifton D-Handle Code H536.160.SS H539.352.SS

HC 160mm 320mm

PB 2 4

Code H1133.160.SS H1133.320.SS

HC 160mm 320mm

Carlton D-Handle

HL 180mm 340mm

PB 2 3

26

33 160/320 173/353

17

160/320

16

160 200

Hessay D-Handle

HL 173mm 353mm

PB 3

37

40

33

PB 2 2 2 2

20

Bright Nickel p26, Aged Brass p62

Kilby Bar Handle

Code H509.224.SS

Code H851.192.SSCH H852.320.SSCH H859.128.SSCH H850.160.SSCH

Code H918.160.SS

HC 160mm

HL 175mm

PB 2

40

15

180/340

15

160 175

Matt Black p48, Bright Copper p59, Brushed Brass p62

3.09

Order Online www.pws.co.uk

Price Under1 1£5 Under 2 £5-£10 1 Bands 2 £5£5-£10 3

£15-£25 £10-£15 3 £10-£15 4 4 £15-£25

5 5

>£25 >£25


Rainton D-Handle Code H1139.160.SS H1139.320.SS

HC 160mm 320mm

Sonning D-Handle

HL 196mm 356mm

PB 2 3

Code H745.128.SS H746.192.SS H747.224.SS H748.320.SS

HC 128mm 192mm 224mm 320mm

HL 136mm 200mm 232mm 330mm

Didsbury D-Handle PB 1 1 1 2

Code H1140.192.SS

HC 192mm

HL 206mm

PB 3

27 10

160/320

32 30

206

128/192/224/320 136/200/232/330

Matt Black p48, Matt White p52

Matt Black p48, Antique Bronze p55

Roger D-Handle Code 940/141SS

HC 128mm

HL 141mm

12

192

196/356

Alne D-Handle PB 1

Code H012.128.SS

HC 128mm

HL 148mm

Melton D-Handle PB 2

Code H837.192.SS

HC 192mm

HL 200mm

31.5

35

26 128 141

Key: HC Hole Centre HL Handle Length PB Price Band

PB 2

128 148

192 200

T: 01325 505599 (North) | 88 (South)

3.10


STAINLESS STEEL

Mickley D-Handle Code 11.2620.96.SS 11.2620.SS

HC 96mm 128mm

Danby D-Handle

HL 110mm 144mm

PB 2 2

Code H004.128.SF H005.160.SF

HC 128mm 160mm

Winton D-Handle

HL 136mm 168mm

PB 1 2

Code 8/963.A.SS

HC 160mm

HL 185mm

PB 1

22

30

28 96/128 110/144

160 185

128/160 136/168

14

Chrome p21

Potto D-Handle

Elwick D-Handle

Blythe D-Handle Bright steel effect

Code H415.160.BS H413.320.BS

HC 160mm 320mm

HL 170mm 332mm

PB 2 3

Code H733.160.SS

HC 160mm

HL 200mm

PB 2

Code H003.160.SF

HC 160mm

HL 182mm

PB 2

24 160 200

160/320 170/332

160 182

10

17

Chrome p21

Camden D-Handle Code H1132.160.SS

HC 160mm

Hove D-Handle

HL 180mm

PB 2

Code H1130.160.SS H1130.320.SS

HC 160mm 320mm

Hook D-Handle

HL 220mm 380mm

PB 2 3

30 160

HL 204mm

Keld D-Handle PB 2

Code H721.224.SS

HC 224mm

Moss D-Handle

HL 232mm

PB 2

Code H023.128.SS H022.192.SS

28/25

HC 128mm 192mm

HL 147mm 215mm

PB 4 3

35

38 160 204

PB 2

Matt Black p48, Matt White p52

Ryton D-Handle HC 160mm

HL 173mm

160 173

15

160/320 220/380

Chrome p21, Matt Black p48, Matt White p52

HC 160mm

33

23

29

180

Code H861.160.SS

Code H352.160.SS

128/192 147/215

224 232

Chrome p21, Black Satin p46, Black Chrome p47, Bright Copper p59

3.11

Order Online www.pws.co.uk

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Cray D-Handle Code H582.128.SS H596.160.SS

HC 128mm 160mm

Walton D-Handle

HL 143mm 175mm

PB 2 2

Code H295.128.SS H297.160.SS H299.224.SS

HC 128mm 160mm 224mm

Towton D-Handle

HL 137mm 168mm 232mm

PB 2 2 2

Code H581.128.SS H594.160.SS H595.224.SS

HC 128mm 160mm 224mm

HL 153mm 185mm 249mm 25

30

32

PB 2 2 3

128/160/224 137/168/232

128/160 143/175

24

128/160/224 153/185/249

Chrome p21

Hoxton D-Handle Code H1085.160.SS

HC 160mm

Askern D-Handle

HL 170mm

PB 2

Code H1113.160.SS H1113.320.SS

HC 160mm 320mm

HL 183mm 343mm

PB 2 3

12

15 33

26 160 170

24 160/320 9

183/343

Chrome p21, Industrial Matt Black p49, Aged Copper p59

Black Satin p46

Leven Bow Handle Code H251.160.SS

HC 160mm

Kirkby Bow Handle

HL 175mm

PB 1

Code H523.160.SS

HC 160mm

Ripon Bow Handle

HL 180mm

28

PB 1

160 180

22

24

Seaham Bow Handle HC 160mm 320mm

HL 172mm 330mm

28

Code 8/1026.B.SS 8/1026.A.SS

HC 160mm 320mm

24

25

Burton Bow Handle

HL 172mm 330mm

PB 2 2

28 160/320 172/330

PB 2

Silver Effect p56, Burnt Copper p60

Hurst Bow Handle PB 1 3

HL 191mm

160 191

Chrome p22

Code 8/1027.B.SS 8/1027.A.SS

HC 160mm

27

25 160 175

Code 8/1011.A.SS

Code H334.128.SS

HC 128mm

HL 149mm

PB 2

28 160/320 172/330

16

128 149

Burnt Copper p60

Key: HC Hole Centre HL Handle Length PB Price Band

T: 01325 505599 (North) | 88 (South)

3.12


STAINLESS STEEL

Melton Bow Handle Code H529.160.SS

HC 160mm

HL 203mm

Fordon Bow Handle PB 2

25 160 203

Code H775.160.SS

HC 160mm

Acklam Bow Handle

HL 235mm

PB 2

Code H867.128.SS H556.160.SS

25

HC 128mm 160mm

HL 165mm 238mm

PB 2 3

25

25

160 235

128/160 35

165/238

Chrome p22

Witton Bow Handle

Cassop Bow Handle

Catton Bow Handle

Brushed steel effect Code H417.160.BS

HC 160mm

HL 190mm

PB 2

Code H1071.128.SS

HC 128mm

HL 184mm

PB 1

Code H1065.160.SS H1065.320.SS

HC 160mm 320mm

HL 172mm 332mm

PB 2 3

24

30

128 160 190

31

22

184

160/320 172/332

Chrome p22

Chrome p22

Marrick Bow Handle Code H588.128.SS

HC 128mm

12

HL 162mm

Seamer Bow Handle

Shoreditch Bow Handle PB 2

Code H559.160.SS

HC 160mm

HL 193mm

PB 2

Code H1012.160.SS H1013.192.SS

HC 160mm 192mm

HL 178mm 210mm

PB 2 2

26 160

24 128 162

25

30 160/192 178/210

193

Burnt Copper p60

3.13

Order Online www.pws.co.uk

Price Bands

15

Chrome p22

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Healey Bow Handle Code 8/965.B.SS 8/965.A.SS

HC 128mm 160mm

HL 153mm 185mm

Portland Bow Handle PB 1 2

Code 1001/131SS

HC 96mm

HL 131mm

Robin Bow Handle PB 1

25

25

Code H841.160.SS

HL 234mm

PB 2

30 160 234

96 131

128/160 153/185

HC 160mm

Satin Nickel p27

Octon Bow Handle Code H567.160.SS

HC 160mm

HL 204mm

Cave Bow Handle PB 2

Code 1949SS 1950SS 1781SS 2285SS

HC 128mm 160mm 192mm 224mm

HL 154mm 190mm 226mm 267mm

Skelton Bow Handle PB 1 1 1 1

Code H585.128.SS

HC 128mm

HL 147mm

PB 1

25

25

32

Bowes Bow Handle Code H590.128.SS

HC 128mm

128 147

128/160/192/224 154/190/226/267

160 204

HL 160mm

Ç«+3!//-1.!Bow Handle

Bowes line Bow Handle PB 2

24

Code H600.128.SS

HC 128mm

Key: HC Hole Centre HL Handle Length PB Price Band

PB 2

Code H589.128.SS

HC 128mm

HL 160mm

PB 2

24

25 128 160

HL 160mm

128 160

128 160

T: 01325 505599 (North) | 88 (South)

3.14


3.05

Order Online www.pws.co.uk


CHROME COLLECTION

HANDLE FAMILIES Chrome handles are incredibly diverse and lend themselves to both contempary and traditional designs. The highly polished surface adds impact to furniture. Our collection balances modern and classic styles for all design appliances.

Kensington

1.

2.

3.

ǫ(++)ü!(

4.

5.

Hoxton Chrome

6.

7.

Wellington

8.

9.

10.

11.

Linton

12.

13.

14.

Barton

15.

16.

HANDLE CODES 1. H768.128.CH (p19) 2. K1043.32.CH (p19) 3. H1044.128.CH (p19) 4. H995.68.CH (p20) 5. H994.160.CH (p20) 6. H1108.96.CH (p18) 7. H1085.160.CH (p21) 8. K1075.32.CH (p17) 9. K879.34.CH (p17) 10. H1079.32.CH (p18) 11. H1117.50.CH (p18) 12. H1120.60.CH (p20) 13. H1120.160.CH (p20) 14. H1080.128.CH (p20) 15. K265.33.CH (p17) 16. H1092.64.CH (p18)

2WKHU´QLVKHVDYDLODEOH

T: 01325 505599 (North) | 88 (South)

3.16


CHROME

Shaw Knob Code 622/30C

HC Central

Wath Knob

HL 31mm

PB 2

Code CF6420

HC Central

25

Barton Knob

HL 32mm

PB 2

Code K265.33.CH

24

HC Central

32

17

20

31

32

HL 32mm

PB 1

24 28

Black Satin p45, Bright Copper p59

Scotton Knob Code K875.37.CH

HC Central

HL 39mm

Lythe Knob PB 3

39

Code K1068.64.CH

HL 64mm

20 64

35

Code K165.30.CH

HC Central

30

Yeadon Knob

HL 46mm

PB 2

Code K999.38.CH

HC 43mm

46

Yeadon Knob

HL 59mm

PB 2

Code K1000.35.CH

Chatsworth Knob HL 35mm

38 38

Code K1075.32.CH

HC Central

35

Bright Nickel p25, Pewter p31

3.17

Black Satin p45

HL 45mm

Order Online www.pws.co.uk

45

Wellington Knob PB 5

Code K879.34.CH

HC Central

32

45 48

PB 2

HL 94mm

Bright Nickel p25, Antique Bronze Effect p55

11

PB 5

44

40

94

43

Price Bands

38

59

Wellington Knob PB 4

HL 59mm

43

59 59

28

HC Central

HC 43mm

43

Black Satin p45

Code K877.35.CH

PB 1

45

Reeth Knob HC Central

HL 30mm

Stainless Steel p05, Bright Copper p59

Bright Nickel p25

46

PB 1

35 35

Code K1113.46.CH

Clove Knob

HC Central

Under £5

Bright Nickel p25

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Hood Cup Handle Code H1136.96.CH

HC 96mm

Barton Cup Handle

HL 129mm

PB 1

42

Code H1092.64.CH

HC 64mm

Collingwood Cup Handle

HL 104mm

PB 1

HL 108mm

76 76 108 108

23

Bright Copper p59, Black Satin p45

Wellington Cup Handle PB 5

Code H1116.96.CH

HC 96mm

HL 108mm

19 19

Antique Bronze Effect p55

Marton Cup Handle

HL 100mm

PB 5

4040 64 104

HC 32mm

HC 76mm

32

96 129

Code H1079.32.CH

Code H1127.76.CH

Hoxton Cup Handle PB 5

Code H1108.96.CH

HC 96mm

HL 120mm

PB 2

32 40 45 100

96 108

28

96 120

22

Industrial Matt Black p49, Antique Bronze p55, Aged Copper p59

Bright Nickel p25

York Cup Handle Code H1121.160.CH H1121.320.CH

HC 160mm 320mm

Filey Cup Handle

HL 198mm 358mm

PB 3 4

Code H714.32.CH H715.64.CH H716.128.CH H717.192.CH

HC 32mm 64mm 128mm 192mm

24 32/64/128/192 98/130/193/257

198/358

Code H1117.50.CH

HC Multiple

HL 57mm

PB 2 1 3 3

Code H1122.160.CH H1122.320.CH

HC 160mm 320mm

HL 198mm 358mm

PB 3 4

24 24

28

160/320 198/358

20

Bright Nickel p25

Bright Nickel p25

Wellington Latch Handle

Fenwick Cup Handle

HL 98mm 130mm 193mm 257mm 30

20

160/320

25

MF

PB 5

57 50

33

Antique Bronze Effect p55

Key: HC Hole Centre HL Handle Length PB Price Band MF Multi Fixing

T: 01325 505599 (North) | 88 (South)

3.18


CHROME

Hyde Trim Handle Code H424.32.CH

HC 32mm

50

HL 50mm

Lea Knob PB 1

Code K354.36.CH

HC Central

HL 36mm

PB 1

30

50

20 20

50

36

Stainless Steel p06

Stainless Steel p05

Escrick Trim Handle Code H1118.32.CH

HC 32mm

HL 50mm

Escrick Trim Handle PB 5

Code H1119.96.CH

HC 96mm

HL 110mm

Code H1124.96.CH H1124.256.CH

HC 160mm 256mm

HL 198mm 360mm

PB 2 2

40 40

40 40

32

Clerkenwell Trim Handle PB 5

16

198/360

110

110

50

22

160/256

20 20

96

96

20

Stainless Steel p06, Black Brushed Nickel p47

Kensington D-Handle Code H768.128.CH

HC 128mm

HL 186mm

Kensington D-Handle PB 2

25

HC 128mm

HL 170mm

Kensington Knob PB 5

Code K1043.32.CH

Order Online www.pws.co.uk

HC 32mm

HL 57mm

PB 4

25

25 128 186

3.19

Code H1044.128.CH

128 170

Price Bands

32

30

11

57

Under £5

2

£5-£10

3

£10-£15

57

4

£15-£25

5

>£25


Bloomfield T-Bar Handle HC Central

HL 68mm

Dartmouth T-Bar Handle PB 2

Code H1123.60.CH

HC Central

HL 60mm

22

68

60

Black Satin p45

HC 160mm

38

Stainless Steel p08, Aged Brass p61

Bloomfield Bar Handle Code H994.160.CH

PB 2

35.5 35.5

38

Code H995.68.CH

Dartmouth Bar Handle

HL 225mm

PB 3

Code H1128.160.CH

HC 160mm

HL 195mm

PB 3

38 160 225

35.5 35.5

22

38

160 160 195 195

Black Satin p45

Stainless Steel p08, Aged Brass p62

Weel T-Bar Handle

Bedford Bar Handle

Thorpe Bar Handle 14mmÃ&#x2DC; diameter

Code H1091.60.CH

HC Central

HL 60mm

PB 1

Code H883.160.CH

HC 160mm

HL 232mm

PB 5

Code H109.188.CH H110.237.CH

HC 160mm 209mm

HL 188mm 237mm

PB 2 2

45 36

38 60

22

160/209 188/237

20

160 232

Black Satin p45, Antique Bronze Effect p55

Bright Nickel p26

Stainless Steel p08, Black Satin p45

Linton T-Bar Handle

Linton Bar Handle

Linton D-Handle

Code H1120.60.CH

HC Central

HL 60mm

PB 2

Code H1120.160.CH H1120.256.CH

HC 160mm 256mm

HL 178mm 306mm

PB 3 3

160/256 20

Key: HC Hole Centre HL Handle Length PB Price Band

HC 128mm

HL 162mm

178/306

20 20

PB 5

37

33 33

33

60

Code H1080.128.CH

128 162

T: 01325 505599 (North) | 88 (South)

3.20


CHROME

Trent Bar Handle Code H758.192.CH

HC 192mm

Potto D-Handle

HL 204mm

PB 3

Code H416.160.CH H414.320.CH

HC 160mm 320mm

Camden D-Handle

HL 170mm 332mm

PB 2 3

Code H1132.160.CH

HC 160mm

HL 180mm

40

PB 2

30 26 192 204

160/320 170/332

Black Satin p46

HC 160mm

Stainless Steel p11, Black Matt p48, White Matt p52

Moss D-Handle

HL 170mm

PB 2

Code H673.192.CH

29

180

Stainless Steel p11

Hoxton D-Handle Code H1085.160.CH

160

18

HC 192mm

Mickley D-Handle

HL 212mm

PB 3

Code 11.2620.CH

HC 128mm

HL 144mm

PB 2

12 40

26 160 170

30 192 212

24

128 14

144

Stainless Steel p12, Industrial Matt Black p49, Aged Copper p59

Stainless Steel p11, Black Satin 46, Black Chrome 47, Bright Copper 59

Stainless Steel p11

Walton D-Handle Code H296.160.CH

HC 160mm

HL 169mm

PB 2

30 160 169

22

Stainless Steel p12

3.21

Order Online www.pws.co.uk

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Seamer Bow Handle Code H1012.160.CH H1013.192.CH

HC 160mm 192mm

Kendall Bow Handle

Haxby Bow Handle

HL 178mm 210mm

PB 2 2

Code H1114.160.CH

HC 160mm

HL 192mm

PB 2

Code H1141.160.CH H1141.288.CH H1141.448.CH

HC 160mm 288mm 488mm

HL 210mm 340mm 500mm

PB 2 3 4

33 33

30

160/192 178/210

160

30

12 12

192

15

160/288/448

Stainless Steel p13

Black Satin p46, Black Chrome p47

Acklam Bow Handle Code H556.160.CH

HC 160mm

210/340/500

Witton Bow Handle

HL 238mm

PB 2

Code H418.160.CH

HC 160mm

Cassop Bow Handle

HL 190mm

PB 2

30

35

Stainless Steel p13

Kirby Bow Handle

HL 130mm

PB 1

PB 1

Code H524.160.CH

HC 160mm

22

184

Stainless Steel p13

Mayfair Bow Handle HC 96mm

HL 184mm

128

160 190

Stainless Steel p13

Code H267.96.CH

HC 128mm

24

24

160 238

Code H1071.128.CH

Combs Bow Handle

HL 180mm

PB 2

Code H1106.250.CH

HC Various

HL 250mm

PB 2 21

25

27

160 180

96 130

24

26 128/160/192/224 250

Pewter Effect p36, Brushed Brass p62

Stainless Steel p12

Cave Bow Handle Code H1083.160.CH

HC 160mm

Abney Bow Handle

HL 183mm

PB 2

10

22 160

Code H1040.160.CH

HC 160mm

HL 200mm

PB 2

30 18

183

160 200

18

Black Chrome p47

Key: HC Hole Centre HL Handle Length PB Price Band

T: 01325 505599 (North) | 88 (South)

3.22


3.05

Order Online www.pws.co.uk


NICKEL COLLECTION

HANDLE FAMILIES Nickel’s distinctive warm hue sets it apart from other materials. Its warm tint gives it an elegant aesthetic that compliments a classic setting. Nickel’s sheen also embelishes the detail in many handle designs.

Bedford

1.

2.

Chelsea

3.

4.

Fenwick

5.

6.

Belgrave Nickel

7.

8.

9.

HANDLE CODES 1. H884.72.BN (p25) 2. H882.160.BN (p26) 3. H420.128.DN (p27) 4. K419.32.DN (p27) 5. H1122.160.BN (p25) 6. H1122.320.BN (p25) 7. K1107.35.SN (p27) 8. 8/952.B.SN (p27) 9. 8/951.B.SN (p27)

2WKHU´QLVKHVDYDLODEOH

T: 01325 505599 (North) | 88 (South)

3.24


BRIGHT NICKEL

Scotton Knob Code K874.37.BN

HC Central

Chatsworth Knob

HL 39mm

PB 5

39

Code K876.35.BN

HC Central

Code K1118.31.BN

PB 5

Code K878.34.BN

32

Harton Cup Handle

HL 94mm

PB 4

Code H1146.105.BN

HL 100mm

Chrome p17

Code H1121.160.BN H1121.320.BN

HC 160mm 320mm

PB 2

64 105

Aged Brass p62

York Cup Handle PB 4

HL 105mm

25

94

Wellington Cup Handle

HC 64mm

30

44

Chrome p17, Antique Bronze Effect p55

HC 32mm

HC Central

32

43

PB 2

Aged Brass p61

Wellington Knob

HL 45mm

45

45

HL 31mm

31

Chrome p17, Pewter p31

Wellington Knob HC Central

HC Central

48

Chrome p17

Code H1079.32.BN

PB 5

35 35

Code K1075.32.BN

Harton Knob

HL 35mm

Fenwick Cup Handle

HL 198mm 358mm

PB 3 4

Code H1122.160.BN H1122.320.BN

HC 160mm 320mm

HL 198mm 358mm

PB 3 4

32

100

160/320 198/358

28

Chrome p18

HC Central

160/320 198/358

20

Chrome p18

HL 60mm

PB 1

Code H1003.62.BN

HC Central

33

HL 62mm

Bedford T-Bar Handle PB 2

Code H884.72.BN

HC Central

HL 72mm

35

PB 5

38 72

62 60

20

20

Stainless Steel p09, Aged Brass p61

3.25

20 20

Chrome p18

Leeming T-Bar Handle

Strand T-Bar Handle Code H1143.60.BN

24

24

45

Order Online www.pws.co.uk

Stainless Steel p08, Black Satin p45

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Strand Bar Handle Code H1144.242.BN

HC 192mm

Leeming Bar Handle

HL 242mm

PB 3

Code H1002.160.BN

HC 160mm

Bedford Bar Handle

HL 222mm

33

PB 2

Code H882.160.BN

HC 160mm

HL 232mm

38

35 192 242

160 222

20

Stainless Steel p09, Aged Brass p62

HC 128mm 192mm

HL 168mm 232mm

Code H1147.205.BN

HC 160mm

HL 205mm

35

18

Heworth Knob PB 2

Code K1119.30.BN

HC Central

Key: HC Hole Centre HL Handle Length PB Price Band

HL 30mm

PB 2

50 160 205 33

Stainless Steel p08, Black Satin p45

20

Chrome p20

Harton Bow Handle PB 2 2

33 128/192 168/232

160 232

16

Stainless Steel p08, Black Satin p45

Arlington Bar Handle Code H503.128.BN H504.192.BN

PB 5

36

Aged Brass p62

T: 01325 505599 (North) | 88 (South)

3.26


SATIN NICKEL & NICKEL

Taxal Knob Code K686.32.SN

HC 32mm

Chelsea Knob

HL 57mm

PB 2

HC 32mm

Chelsea D-Handle

HL 50mm

PB 1

Code H420.128.DN

HC 128mm

HL 165mm

PB 2

25

56

25 32

32 57

HC Central

HL 35mm

165

Belgrave Cup Handle PB 1

Code 8/952.B.SN

HC 64mm

HL 94mm

Belgrave Bow Handle PB 1

Code 8/951.B.SN

HC 96mm

HL 128mm

PB 1

24

27

35 35

30

30

50

24

Belgrave Knob Code K1107.35.SN

Code K419.32.DN

64 94

90 20

128

20

25 25

Antique Nickel Effect p56

Antique Nickel Effect p56

Antique Nickel Effect p56

Healey Bow Handle Code 8/965.B.SN

HC 128mm

HL 152mm

PB 1

32 128 152

Stainless Steel p14

3.27

Order Online www.pws.co.uk

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Handles are Wellington Knob and a Wellington Cup - Bright Nickel (3.25)

Key: HC Hole Centre HL Handle Length PB Price Band


PEWTER COLLECTION

HANDLE FAMILIES $!*01.(,0%*+*,!30!.$* (!/!).!/0$!1*%-1!"!01.!/+"!$ handle design. These handle are full of character and sit perfectly in a traditional timber kitchen with a country feel, or with a more classic painted kitchen.

Hampshire

1.

2.

Berwick

3.

4.

Canterbury

5.

6.

Skelton

7.

8.

9.

HANDLE CODES 1. K886.30.PE (p32) 2. H887.128.PE (p34) 3. K1062.30.PE (p31) 4. H1063.96.PE (p33) 5*. H219.50.AP (p35) 6. H218.128.AP (p35) 7. K1114.20.PE (p31) 8. K1115.80.PE (p32) 9. H1142.128.PE (p33)

2WKHU´QLVKHVDYDLODEOH

T: 01325 505599 (North) | 88 (South)

3.30


PEWTER

Harbury Knob Code K480.25.PE

HC Central

HL 25mm

Avon Knob PB 2

Code K478.44.PE

HC Central

Milveston Knob

HL 44mm

Code K794.37.PE K795.40.PE

PB 2

HC Central Central

HL 37mm 40mm

PB 2 3

30 30 30 10 25

Cleeve Knob Code K791.37.PE

HC Central

10

10 44

HL 37mm

37/40

Loxley Knob PB 2

Code K485.40.PE

HC Central

Berwick Knob

HL 40mm

PB 2

Code K1062.30.PE

HC Central

HL 30mm

PB 3

37 26

14

13

37

40

Skelton Knob Code K1114.20.PE

HC Central

HL 20mm

30

Barford Knob

Consett Knob PB 3

Code K1116.75.PE

30

HC Central

28

HL 75mm

PB 4

Code K628.50.PE

HC Central

19

Chatsworth Knob HC Central

HL 35mm

10 45 50

33

Eydon Knob PB 3

Code K489.47.PE

HC Central

Avon Knob

HL 47mm

PB 3

Code K643.49.PE

48

HC Central

HL 49mm

PB 3

41

42

35

PB 3

25

75

37

Code K1109.35.PE

HL 50mm

14 49

15 47

Chrome p17, Bright Nickel p25

3.31

Order Online www.pws.co.uk

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Warwick Knob Code K627.45.PE

HC Central

Welton Knob

HL 45mm

PB 4

Code

HC Central

Heath Knob

HL 44mm

PB 3

K484.44.PE Backplate B487.40.PE | Price band 1

Code K630.46.PE

HC Central

HL 46mm

PB 4

22

HC Central

10 46

15 44

Copt Knob Code K481.40.PE

40

40

12 45 50

Hidcote Knob

HL 40mm

PB 3

Code K305.40.PE

HC Central

30

Hampshire Knob

HL 40mm

PB 2

Code

HC Central

K886.30.PE

HL 32mm

PB 3

44 30

30

12 40

12

Skelton T-Bar Handle

Coles T-Bar Handle Code H642.80.PE

HC Central

32

32

HL 80mm

PB 5

Code K1115.80.PE

HC Central

HL 80mm

PB 4

48

80

28

Milveston Cup Handle Code H457.64.PE

HC 64mm

HL 92mm

Wick Cup Handle PB 3

Code H987.64.PE

HC 64mm

Wixford Cup Handle

HL 90mm

42

Key: HC Hole Centre HL Handle Length PB Price Band

64 90

Code H803.96.PE

HC 96mm

HL 134mm

PB 5

30

15 32 22 92

PB 4

18

96 134

T: 01325 505599 (North) | 88 (South)

3.32


PEWTER

Barford Cup Handle Code H624.64.PE

HC 64mm

Warwick Cup Handle

HL 90mm

PB 4

Code H1055.96.PE

25

HC 96mm

HC 64mm

5

96 155

Cromwell Cup Handle

24

Cromwell Cup Handle

HL 87mm

PB 3

Code H1112.64.PE

HC 64mm

HL 100mm

44 44

64 64

27

100 100

87 87

Berwick Bar Handle

Skelton Bar Handle HC 128mm

HL 215mm

PB 5

38

Code H1063.96.PE

HC 96mm

Leigh Bar Handle

HL 160mm

PB 4

Code H1048.160.PE

38 15

Grove Bar Handle Code H552.128.PE

HC 128mm

HL 200mm

PB 4

160 12

200

19

Hanbury Bar Handle

HL 170mm

PB 4

28 128 170

HC 160mm

36 96 160

128 215

3.33

PB 4

46 46

27 27

64 64

Code H1142.128.PE

PB 4

46 64 90

Code H1111.64.PE

HL 155mm

Code H783.160.PE

HC 160mm

HL 198mm

PB 5

40 9

Order Online www.pws.co.uk

160 198

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Cleeve Bow Handle Code H792.128.PE

HC 128mm

Hidcote Bow Handle

HL 158mm

PB 4

26

Code H304.128.PE

HC 128mm

HL 184mm

Hurley Bow Handle PB 4

Code H159.128.PE H462.160.PE

HC 160mm

Devon Bow Handle

HL 216mm

PB 5

Code H465.160.PE

HC 160mm

HL 184mm

Flore Bow Handle PB 4

Hampshire Bow Handle HC 128mm

HL 182mm

Ensor Bow Handle PB 4

Code H307.128.PE

HC 128mm

HL 168mm

128 168

160 184

160 216

Code H887.128.PE

Code H1051.128.PE

PB 4

25

42

40

PB 4 4

128/160 186/222

128 184

Waverley Bow Handle

HL 186mm 222mm

28

32 128 158

Code H580.160.PE

HC 128mm 160mm

HC 128mm

HL 167mm

26

Manor Bow Handle PB 4

38

Code H546.96.PE

HC 96mm

HL 134mm

PB 4

35

28 128 182

128 167

24

Kilby Bow Handle Code H148.96.HPE H149.128.HPE

HC 96mm 128mm

HL 122mm 158mm

96 134

Huncote Bow Handle PB 3 4

Code H153.96.PE

HC 96mm

HL 154mm

Mathon Bow Handle PB 4

Code H151.96.PE

HC 96mm

HL 143mm

PB 4

30 26 28

31 96/128 122/158

Key: HC Hole Centre HL Handle Length PB Price Band

96 96 154

143

T: 01325 505599 (North) | 88 (South)

3.34


PEWTER

Stretton Bow Handle Code H1054.128.PE

HC 128mm

HL 150mm

Cryfield Bow Handle PB 4

Code H631.128.PE

HC 128mm

HL 176mm

PB 4

28

33

128 150

128 176

22

PEWTER EFFECT

Stivichall Knob Code K265.33.PE

HC Central

HL 33mm

Finham Knob PB 1

Code K719.46.PE

28

HC Central

Leasowes T-Bar Handle

HL 46mm

PB 2

Code 2432AP

HC Central

37 25 33

HL 70mm

PB 1

32 33 46

70

Aged Brass 61

Canterbury T-Bar Handle Code H219.50.AP

HC Central

HL 50mm

Canterbury D-Handle PB 2

Code H218.128.AP

HC 128mm

PB 2

Code H351.128.AP

HC 128mm

HL 144mm

PB 1

40

47

33 25 50

Aged Brass p61

3.35

Leasowes D-Handle

HL 147mm

Order Online www.pws.co.uk

19

128

128

147

144

Aged Brass p62

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Bishop D-Handle Code H845.128.PE H846.160.PE

HC 128mm 160mm

Escomb Bow Handle

HL 146mm 178mm

PB 2 2

Code H256.128.PE

HC 128mm

Hurworth Bow Handle PB 2

Code H853.96.PE

27

38

PB 1

PB 2

96 148

Syde Bow Handle

HL 130mm

HL 148mm

28

Mayfair Bar Handle HC 96mm

HC 96mm

128 188

128/160 146/178

Code H267.96.PE

HL 188mm

Code 9/1320.50

HC 96mm

HL 147mm

Upton Bow Handle PB 1

27

Code

HC 96mm

H255.96.PE

HL 143mm

PB 2

28

24 96 130

96 143

96 147

Chrome p22, Brushed Brass p62

CAST IRON

Bowburn Knob Code K375.35.CI

HC Central

Brandon Knob

HL 37mm

PB 1

Code IRC2866/38

HC Central

HL 29mm

Brandon Bow Handle PB 1

Code IRC3078

HC 96mm

HL 148mm

PB 2

20 38

35

Wolsingham Drop Handle HC 128mm

96 148

29

37

Code H091.128.CI

36

HL 148mm

Wolsingham Knob PB 2

Code K083.32.CI

HC Central

HL 32mm

Wolsingham T-Bar Handle PB 2

Code H080.74.CI

HC Central

HL 74mm

PB 2

25 52

40

128 148

Key: HC Hole Centre HL Handle Length PB Price Band

32

74

T: 01325 505599 (North) | 88 (South)

3.36


3.05

Order Online www.pws.co.uk


KNURLED COLLECTION %0$1*%-1!00%(! !/%#*Č0$! *1.(! ƫ+((!0%+*,.+ 1!/ %/0%*0%* 1/0.%( (++'0$0+),(!)!*0/)+ !.*/!00%*#ċ$%/.*#!%*0.+ 1!/1*%-1!!(!)!*0+" personalisation with our range of backplate options.

1

3

4

2

5

Handle positioning is key to completing any kitchen design – and it really can make or break a look. Our extensive knurled +((!0%+*+û!./)1(0%0,(!35/0+,+/%0%+*$* (!/+*0+2.%!05+"".+*0(05,!/ċ$!,$+0+/+2! $%#$(%#$00$! %2!./%05+"0$!.*#!* 0$! %û!.!*0/05(!/0$0*!.!0! ċ 1.Ă4 *++*+û/!0',(0!Ĩ āāāāċĂĀǫăĉą ǫĩ,+/%0%+*! $+.%6+*0((5+*/( +1(! ++./!0 2. 1 x Appliance pull (H1126.448.MB) on a tall slab combination door 3.Ă4 *++*+û/!0',(0!!2!*(5,+/%0%+*! +*.1*+"3% !/( .3!.,'/Ĩ āāāċĂĀǫăĉąǫĩ 4. Bar handle on rectangular backplate (H1126.257B386MB) positioned centrally towards the top edge of a 2 drawer pack 5.Ă4 *++*+û/!0',(0!Ĩ āāāāċĂĀǫăĉą ǫĩ,+/%0%+*! 2!.0%((5+*/( +1(! ++./!0

T: 01325 505599 (North) | 88 (South)

3.38


KNURLED COLLECTION NEW FINISH

Knurled Knob Code K1111.20.SS

HC Central

HL 20mm

Knurled Knob PB 1

Code K1111.20.AGB

HC Central

20

Knurled Knob

HL 20mm

PB 2

Code K1111.20.MB

HC Central

20

HL 20mm

PB 1

20

25

25

25

NEW FINISH

Knurled Knob

Knurled Knob

Knurled Knob

with circular backplate

with circular backplate

with circular backplate

Code K1111.20B383SS

HC Central

HL 40mm

Code K1111.20B383AGB

PB 2

HC Central

HL 40mm

PB 2

Code K1111.20B383MB

HC Central

HL 40mm

PB 2

40

40 40

40

40

28

40

28

28

NEW FINISH

Knurled Knob

Knurled Knob

Knurled Knob

with rectangular offset backplate

with rectangular offset backplate

with rectangular offset backplate

Code K1111.20B384SS

HC Central

HL 130mm

PB 2

Code K1111.20B384AGB

HC Central

HL 130mm

28

Code K1111.20B384MB

HC Central

HL 130mm

28

26

26

130

130

Knurled Knob

Knurled Knob

Knurled Knob

with fixed backplate

with fixed backplate

with fixed backplate

Code K1117.32.SS

HC Central

HL 32mm

PB 1

32

Code K1117.32.AGB

HC Central

HL 32mm

PB 2

Code K1117.32.MB

32

30

Order Online www.pws.co.uk

PB 2

28

26

130

3.39

PB 2

HC Central

HL 32mm

PB 1

32

30

Price Bands

30

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


NEW FINISH

Knurled T-Bar Handle Code H1125.35.SS

HC Central

Knurled T-Bar Handle

HL 60mm

PB 2

Code H1125.35.AGB

HC Central

35

60

Knurled T-Bar Handle

HL 60mm

PB 2

Code H1125.35.MB

HC Central

HL 60mm

35

16

60

PB 2

35

16

60

16

NEW FINISH

Knurled T-Bar Handle

Knurled T-Bar Handle

Knurled T-Bar Handle

with circular backplate

with circular backplate

with circular backplate

Code H1125.35B383SS

HC Central

HL 60mm

Code H1125.35B383AGB

PB 3

HC Central

HL 60mm

Code H1125.35B383MB

HC Central

HL 60mm

60

40

PB 3

38

38

38

60

PB 3

60

40

40

NEW FINISH

Knurled T-Bar Handles

Knurled T-Bar Handles

Knurled T-Bar Handles

with rectangular backplate

with rectangular backplate

with rectangular backplate

Code H1125.35B385SS

HC Central

HL 60mm

PB 3

Code H1125.35B385AGB

HC Central

HL 60mm

38

60

PB 3

26

HL 60mm

60

PB 3

38

60

26

26

Matt Black

Matt Black

Matt Black

Stainless Steel

Stainless Steel

Stainless Steel

Aged Brass

Aged Brass

Aged Brass

NEW FINISH

NEW FINISH

Knurled Rectangular Backplate not compatible with knob

HC N/A N/A N/A

HC Central

38

Knurled Circular Backplate Code B383.40.MB B383.40.SS B383.40.AGB

Code H1125.35B385MB

HL 40mm 40mm 40mm

PB 1 1 1

Code B385.40.MB B385.40.SS B385.40.AGB

HC N/A N/A N/A

HL 40mm 40mm 40mm

NEW FINISH

Knurled Offset Rectangular Backplate only compatible with knob

PB 1 1 1

Code B384.130.MB B384.130.SS B384.130.AGB

HC N/A N/A N/A

HL 130mm 130mm 130mm

26

PB 1 1 1

26 26

40 40 40

3

Key: HC Hole Centre HL Handle Length PB Price Band

130

3

3

T: 01325 505599 (North) | 88 (South)

3.40


KNURLED COLLECTION NEW FINISH

Knurled Bar Handle Code H1126.257.SS

HC 192mm

Knurled Bar Handle

HL 257mm

PB 3

Code H1126.257.AGB

HC 192mm

Knurled Bar Handle

HL 257mm

PB 4

HC 192mm

HL 257mm

PB 3

35

35

35

16

192 257

16

192 257

16

192 257

Code H1126.257.MB

NEW FINISH

Knurled Bar Handle

Knurled Bar Handle

Knurled Bar Handle

with circular backplate

with circular backplate

with circular backplate

Code H1126.257B383SS

HC 192mm

HL 257mm

PB 4

Code H1126257B383AGB

HC 192mm

HL 257mm

Code H1126.257B383MB

HC 192mm

HL 257mm

PB 4

38

38 192 257

PB 4

192 257

40

38 192 257

40

40

NEW FINISH

Knurled Bar Handle

Knurled Bar Handle

Knurled Bar Handle

with rectangular backplate

with rectangular backplate

with rectangular backplate

Code H1126.257B385SS

HC 192mm

HL 257mm

PB 4

Code H1126257B385AGB

HC 192mm

HL 257mm

Code H1126.257B385MB

HC 192mm

HL 257mm

PB 4

38

38 192 257

PB 4

192 257

26

38 192 257

26

26

NEW FINISH

Knurled Bar Handle

Knurled Bar Handle

Knurled Bar Handle

with bar handle backplate

with bar handle backplate

with bar handle backplate

Code H1126.257B386SS

HC 192mm

HL 257mm

PB 4

Code H1126257B386AGB

HC 192mm

HL 257mm

38 192 257

3.41

26

Order Online www.pws.co.uk

PB 4

Code H1126.257B386MB

HC 192mm

HL 257mm

PB 4

38 192 257

Price Bands

38 192 257

26

11

Under £5

2

£5-£10

3

£10-£15

26

4

£15-£25

5

>£25


NEW FINISH

Knurled Bar Handle Code H1126.448.SS

HC 448mm

HL 513mm

Knurled Bar Handle Code H1126.448.AGB

PB 4

HC 448mm

448 513

Knurled Bar Handle

HL 513mm

Code H1126.448.MB

PB 5

HC 448mm

448 513

HL 513mm

PB 4

448 513

NEW FINISH

Knurled Bar Handle

Knurled Bar Handle

Knurled Bar Handle

with circular backplate

with circular backplate

with circular backplate

Code H1126.448B383SS

HC 448mm

HL 513mm

PB 5

Code H1126448B383AGB

HC 448mm

HL 513mm

PB 5

HC 448mm

HL 513mm

PB 5

38

38

38 448 513

Code H1126.448B383MB

448 513

40

448 513

40

40

NEW FINISH

Knurled Bar Handle

Knurled Bar Handle

Knurled Bar Handle

with rectangular backplate

with rectangular backplate

with rectangular backplate

Code H1126.448B385SS

HC 448mm

HL 513mm

PB 5

Code H1126448B385AGB

HC 448mm

HL 513mm

PB 5

38 448 513

Code H1126.448B385MB

HC 448mm

HL 513mm

38 448 513

26

38 448 513

26

26

Matt Black

Matt Black

Stainless Steel

Stainless Steel

Aged Brass

Aged Brass

NEW FINISH

NEW FINISH

Knurled Bar Handle Backplate

Knurled Appliance Bar Handle Backplate

Only compatible with 192mm bar handle

Only compatible with 448mm bar handle

Code B386.267.MB B386.267.SS B386.267.AGB

HC 192mm 192mm 192mm

PB 5

HL 267mm 267mm 267mm

PB 2 2 2

HC 448mm 448mm 448mm

HL 513mm 513mm 513mm

PB 2 2 2

26

27 192 267

224 3

Key: HC Hole Centre HL Handle Length PB Price Band

Code B489.513.MB B489.513.SS B489.513.AGB

224 513

T: 01325 505599 (North) | 88 (South)

3.42


3.05

Order Online www.pws.co.uk


BLACK COLLECTION

HANDLE FAMILIES 00('%/0$!#.+3%*#ü*%/$+"0$!)+)!*0ċ 0+*0./0/,!."!0(53%0$,%*0! "1.*%01.!Č %*+0$)+ !.** (//%/!00%*#ċƫ.!0!+*0./0+.+(+1.)0$0+ .'ü*%/$!/ċ

Bromley

1.

2.

Hoxton Black

3.

4.

Claremont Black

5.

6.

7.

Clerkenwell Black

8.

9.

Barton Black

10.

11.

HANDLE CODES 1. K1112.35.MB (p49) 2. H1129.225.MB (p49) 3. H1104.96.MB (p49) 4. H1109.160.MB (p49) 5. K1106.30.MB (p49) 6. H1105.64.MB (p49) 7. H1103.160.MB (p49) 8. H1128.96.BBN (p47) 9. H1128.256.BBN (p47) 10. K1110.33.BS (p45) 11. H1092.64.BS (p45)

2WKHU´QLVKHVDYDLODEOH

T: 01325 505599 (North) | 88 (South)

3.44


BLACK SATIN

Barton Knob Code K1110.33.BS

HC Central

Yeadon Knob

HL 33mm

PB 1

Code K1000.35.BS

HC 43

33 33

PB 2

Code K999.38.BS

HC 43

43

Chrome p17, Bright Copper p59

HC Central

HL 60mm

59

38

Chrome p17

Weel T-Bar Handle Code H1091.60.BS

Code H1003.62.BS

HC Central

45

38

HL 62mm

Bloomfield T-Bar Handle PB 1

Code H995.68.BS

HC Central

HL 68mm

35

60

Barton Cup Handle HC 64mm

HL 104mm

68

Stainless Steel p08, Nickel p25

Chrome p20, Antique Bronze Effect p55

Code H1002.160.BS

HC 160mm

Bloomfield Bar Handle

HL 222mm

32

22

Chrome p20

Leeming Bar Handle PB 1

Code H994.160.BS

PB 2

HC 160mm

HL 225mm

35 64 104

160 222

23

PB 1

38 22

62

22

PB 2

Chrome p17

Leeming T-Bar Handle PB 1

HL 59mm

43

59

28 28

Code H1092.64.BS

Yeadon Knob

HL 59mm

PB 3

38 160 225

16

Chrome p18, Bright Copper p59

Stainless Steel p08, Nickel p26

Arlington Bar Handle

Thorpe Bar Handle

22

Chrome p20

14mmØ diameter Code H503.128.BS H504.192.BS

HC 128mm 192mm

HL 168mm 232mm

PB 2 2

Code H109.188.BS H110.237.BS

HC 160mm 209mm

HL 188mm 237mm

PB 2 2

36

33 128/192 168/232

160/209 18

Stainless Steel p08, Nickel p26

3.45

Order Online www.pws.co.uk

188/237

Stainless Steel p08, Chrome p20

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Marylebone Trim Handle Code H1087.32.BS H1087.160.BS H1087.256.BS

HC 32mm 160mm 256mm

Fell Trim Handle

RM

HL 50mm 200mm 350mm

PB 1 1 2

Code H1088.32.BS H1088.160.BS H1088.256.BS

HC 32mm 160mm 256mm

RM

HL 50mm 200mm 350mm

40

PB 1 1 2 40

16.5

16.5 32/160/256

32/160/256

50/200/350

50/200/350

Stainless Steel p06

Stainless Steel p06

Haxby Bow Handle Code H1114.160.BS

HC 160mm

Askern D-Handle

HL 192mm

PB 2

Code H1082.160.BS

HC 160mm

Hayes D-Handle

HL 183mm

PB 2

Code H1096.160.BS H1096.352.BS

HC 160mm 352mm

HL 224mm 420mm

PB 2 2

15 33 30

33 12

160 192

160 183

160/352 224/420

9

Chrome p22, Black Chrome p47

Stainless Steel p12

Moss D-Handle

Trent Bar Handle

9

Chrome and black Code H1016.128.BS H1017.192.BS

HC 128mm 192mm

HL 144mm 208mm

PB 2 2

30 128/192 144/208

Code H761.128.CHBR

HC 128mm

HL 140mm

PB 2

40 19

Stainless Steel p11, Chrome p21, Black Chrome p47, Bright Copper p59

128 140

Chrome p21

Key: HC Hole Centre HL Handle Length PB Price Band RM Reverse Mounted

T: 01325 505599 (North) | 88 (South)

3.46


BLACK CHROME & NICKEL

Cave Bow Handle Code H1083.160.BC

HC 160mm

Moss D-Handle

HL 183mm

PB 2

Code H1014.128.BC H1015.192.BC

HC 128mm 192mm

Fleet Bow Handle

HL 144mm 208mm

PB 2 2

Code H1066.160.BC

30

183 10

22 160

HL 200mm

PB 2

29 160

19

128/192 144/208

18

HC 160mm

200

Chrome p22

Stainless Steel p11, Chrome p21, Black Satin p46, Bright Copper p59

Haxby Bow Handle

Clerkenwell Trim Handle

17

Brushed Nickel Code H1114.160.BC

HC 160mm

HL 192mm

PB 2

Code H1128.96.BBN H1128.256.BBN

HC 160mm 256mm

HL 198mm 360mm

PB 2 3

33 33

16 12 12

160

22

160/256

192

198/360

Stainless Steel p06, Chrome p19

Chrome p22, Black Satin p46

BLACK STEEL MATT

Brafferton Knob Code K562.32.BMS

HC Central

HL 32mm

Brafferton D-Handle PB 1

Code H563.128.BMS

HC 128mm

HL 145mm

PB 2

25 34 12

32

3.47

Order Online www.pws.co.uk

128 145

Price Bands

16

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


BLACK MATT

Soho Trim Handle Code H1131.90.MB H1131.250.MB

HC 90mm 250mm

Highbury Cup Handle

RM

HL 130mm 350mm

PB 1 2

Code H1138.64.MB H1138.160.MB H1138.320.MB

HC 64mm 160mm 320mm

Whixley D-Handle

HL 94mm 190mm 350mm

PB 1 2 3

Code H1145.160.MB

HC 160mm

HL 170mm

PB 2

39

10 16 90/250

37

Aged Brass p62, Matt White p52

Hessay D-Handle HC 160mm 320mm

160 170

94/190/350

Stainless Steel p06, Matt White p52

Code H1133.160.MB H1133.320.MB

23

20

68/160/320

130/350

Matt White p52

Yard D-Handle

HL 180mm 340mm

PB 3 4

Code H1137.160.MB H1137.224.MB

HC 160mm 224mm

Rainton D-Handle

HL 168mm 264mm

PB 1 2

Code H1139.160.MB H1139.320.MB

HC 160mm 320mm

HL 196mm 356mm

PB 2 2

26 27

28 160/320

15 160/320

180/340

160/224

196/356

168/264

Stainless Steel p09, Bright Copper p59, Brushed Brass p62

Matt White p52, Bright Copper p59, Aged Brass p62

Hove D-Handle Code H1130.160.MB H1130.320.MB

HC 160mm 320mm

PB 2 2

Code H1132.160.MB

HC 160mm

HL 180mm

PB 2

30

23 15

160

220/380

29

180

Stainless Steel p11, Matt White p52

Stainless Steel p11, Chrome p21, Matt White p52

Didsbury D-Handle HC 192mm

Stainless Steel p10, Matt White p52

Camdem D-Handle

HL 220mm 380mm

160/320

Code H1140.192.MB

10

Didsbury Knob

HL 206mm

PB 2

Code K1120.33.MB

HC Central

HL 33mm

PB 1

32 33 192

12

206

Stainless Steel p10, Antique Bronze Effect p55

25

Stainless Steel p05, Antique Bronze p55

Key: HC Hole Centre HL Handle Length PB Price Band RM Reverse Mounted

T: 01325 505599 (North) | 88 (South)

3.48


BLACK INDUSTRIAL MATT

Claremont Knob Code K1106.30.MB

HC Central

Bromley Knob

HL 30mm

PB 1

Code K1112.35.MB

HC 16

HL 35mm

PB 1

35

30 26 35

24

Antique Bronze Effect p55

Claremont Cup Handle Code H1105.64.MB

HC 64mm

Vale Cup Handle

HL 95mm

PB 1

Code H1110.64.MB

HC 64mm

Hoxton Cup Handle

HL 95mm

PB 2

Code H1104.96.MB

HC 96mm

HL 120mm

PB 2

35 35

30 64 95

96 120

20 20

64 64

28

25

95

Chrome p18, Aged Copper p59, Antique Bronze p55

Antique Bronze Effect p55

Claremont D-Handle Code H1103.160.MB

HC 160mm

Hoxton D-Handle

HL 180mm

PB 2

Code H1109.160.MB

HC 160mm

Hatton Trim Handle

HL 170mm

PB 2

Code H1107.96.MB

HC 96mm

HL 140mm

PB 2 26 26

12

30

26 160

160 21

180

Aged Copper p59

Maygrove Bow Handle

HL 225mm

PB 2

Code H1135.160.MB

HC 160mm

HL 183mm

31

140

Stainless Steel p12, Chrome p21, Aged Copper p59

Bromley Bow Handle HC 160mm

24

170

Antique Bronze Effect p55

Code H1129.225.MB

96

Kilburn D-Handle PB 2

Code H1115.160.MB

HC 160mm

HL 170mm

PB 2

27 25 160

27 27

25

225

160

160 183

20 20

170

Antique Silver Effect p56

3.49

Order Online www.pws.co.uk

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Handle is Camdem D-Handle - Black Matt (3.48)

Key: HC Hole Centre HL Handle Length PB Price Band


1. 2.

3.

4.

6. 5.

7.

8.

9.

HANDLE CODES 1. H1138.160.MW 2. H1138.320.MW 3. H1138.64.MW 4. H1130.320.MW 5. H1130.160.MW 6. H1131.250.MW 7. H1131.90.MW 8. H1137.160.MW 9. H1132.160.MW


WHITE COLLECTION

HANDLE FAMILIES $%0!%/0$!,!."!0ü*%/$"+.(!*+*0!),+..5(++'ċ 0$%*#3$%0!$* (!/3%0$ white frontal adds minimalism and simplicity to your design. Adding white handles to a (''%0$!**.!0!.!ü*! )+*+$.+)!/!00%*#ċ

Highbury Cup Handle Code H1138.64.MW H1138.160.MW H1138.320.MW

HC 64mm 160mm 320mm

Hove D-Handle

HL 94mm 190mm 350mm

PB 1 2 3

Code H1130.160.MW H1130.320.MW

HC 160mm 320mm

Soho Trim Handle

HL 220mm 380mm

PB 2 2

Code H1131.90.MW H1131.250.MW

HC 90mm 250mm

RM

HL 130mm 350mm

PB 2 3

10 16 68/160/320

23 160/320

20

Matt Black p48, Aged Brass p62

HL 168mm 264mm

Stainless Steel p06, Matt Black p48

Camden D-Handle PB 1 2

Code H1132.160.MW

HC 160mm

37

130/350

Stainless Steel p11, Matt Black p48

Yard D-Handle HC 160mm 224mm

15

220/380

94/190/350

Code H1137.160.MW H1137.224.MW

90/250

HL 180mm

28

Rainton D-Handle PB 2

Code H1139.160.MW H1139.320.MW

HC 160mm 320mm

HL 196mm 356mm

PB 2 2

27

30 160

160/256

160/320

29

196/356

180

224/264

Matt Black p48, Bright Copper p59, Aged Brass p62

Stainless Steel p11, Chrome p21, Matt Black p48

10

Stainless Steel p10, Matt Black p48

Whixley D-Handle Code H1145.160.MW

HC 160mm

HL 170mm

PB 2

39

23

160 170

Matt Black p48

Key: HC Hole Centre HL Handle Length PB Price Band RM Reverse Mounted

T: 01325 505599 (North) | 88 (South)

3.52


3.05

Order Online www.pws.co.uk


ANTIQUE COLLECTION

HANDLE FAMILIES Ƶ*0%-1!$* (!/* .!(/!*/!+"$.0!.* %* %2% 1(%050+'%0$!*ċ%0$0$!%. naturally aged warmth they complement a traditional design and create a contrasting statement piece in a modern setting.

Claremont

1.

2.

3.

Belgrave

4.

5.

6.

Wellington

7.

8.

HANDLE CODES 1. K1106.30.BR (p55) 2. H1105.64.BR (p55) 3. H1103.160.BR (p55) 4. K1107.35.AN (p56) 5. 8/952.B.AN (p56) 6. 8/951.B.AN (p56) 7. K1075.32.BR (p55) 8. H1117.50.BR (p55)

2WKHU´QLVKHVDYDLODEOH

T: 01325 505599 (North) | 88 (South)

3.54


ANTIQUE BRONZE EFFECT

Claremont Knob Code K1106.30.BR

HC Central

Wellington Knob

HL 30mm

PB 1

Code K1075.32.BR

HC Central

Wellington Latch Handle

HL 45mm

PB 5

Code H1117.50.BR

HC Multiple

32

45

HL 50mm

MF

PB 5

57 57

30 45

26

Industrial Matt Black p49

HC 64mm

Chrome p18

Chrome p17, Bright Nickel p25

Claremont Cup Handle Code H1105.64.BR

HL 95mm

Collingwood Cup Handle PB 1

Code H1127.76.BR

HC 76mm

33

50

43

HL 108mm

Hoxton Cup Handle PB 5

Code H1104.96.BR

HC 96mm

HL 120mm

PB 1

40 40

30

76 76

64

25

28

Industrial Matt Black p49

HC 160mm

Chrome p18, ndustrial Matt Black p49, Aged Copper p59

Chrome p18

Claremont D-Handle Code H1103.160.BR

96 120

19 19

108

95

Didsbury D-Handle

HL 180mm

PB 2

Code H1140.192.BR

HC 192mm

HL 206mm

PB 3

32 30 206

21

Industrial Matt Black p49

Stainless Steel p10, Matt Black p48

Didsbury Knob

Weel T-Bar Handle Code H1091.60.BR

HC Central

HL 60mm

PB 1

45

Code K1120.33.BR

HC Central

HL 33mm

PB 1

33

60

22

Chrome p20, Black Satin p55

3.55

12

192

160 180

Order Online www.pws.co.uk

25

Stainless Steel p05, Matt Black p48

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


ANTIQUE SILVER EFFECT

Kilburn D-Handle Code H868.128.AS H869.160.AS

HC 128mm 160mm

HL 138mm 170mm

Ripon Bow Handle PB 2 2

24

Code H872.128.AS H873.160.AS

HC 128mm 160mm

HL 151mm 191mm

PB 2 2

27

128/160 138/170

128/160 151/191

Industrial Matt Black p49

25

Stainless Steel p12, Burnt Copper p60

ANTIQUE NICKEL EFFECT

Belgrave Knob Code K1107.35.AN

HC Central

HL 35mm

Belgrave Cup Handle PB 2

Code 8/952.B.AN

HC 64mm

HL 94mm

Belgrave Bow Handle PB 1

Code 8/951.B.AN

HC 96mm

HL 128mm

PB 1

35 35

27

25

64 94

25 25

Satin Nickel p27

Satin Nickel p27

Key: HC Hole Centre HL Handle Length PB Price Band MF Multi Fixing

20

96 128

Satin Nickel p27

T: 01325 505599 (North) | 88 (South)

3.56


3.05

Order Online www.pws.co.uk


WARM METALLICS COLLECTION

HANDLE FAMILIES Our metallics collection balances the muted warmth of brass with the bright resonance of copper. Warm metals can capture traditional period styling or bring drama to a modern setting.

Hoxton Copper

1.

2.

Eldon

3.

4.

5.

Barton Copper

6.

7.

Higbury

8.

9.

10.

Canterbury

11.

12.

HANDLE CODES 1. H1108.96.AC (p59) 2. H1085.160.AC (p59) 3. H1084.128.AC (p60) 4. H1084.160.AC (p60) 5. H1084.320.AC (p60) 6. K1110.33.CO (p59) 7. H1092.64.CO (p59) 8. H1138.64.AGB (p62) 9. H1138.160.AGB (p62) 10. H1138.320.AGB (p62) 11. H213.128.AB (p62) 12. H214.50.AB (p62)

2WKHU´QLVKHVDYDLODEOH

T: 01325 505599 (North) | 88 (South)

3.58


BRIGHT COPPER

Barton Knob Code K1110.33.CO

HC Central

Lythe Knob

HL 33mm

PB 1

Code K1068.64.CO

33 33

HC Central

Barton Cup Handle

HL 64mm

PB 1

Code H1092.64.CO

HC 64mm

HL 104mm

PB 1

32

35 20 64

64 104

35

23

28 28

Chrome p17, Black Satin p45

Stainless Steel p05, Chrome p17

Hessay D-Handle Code H1133.160.CO H1133.320.CO

HC 160mm 320mm

Yard D-Handle

HL 180mm 340mm

PB 2 3

Code H1137.160.CO H1137.224.CO

26 160/320

Chrome p18, Black Satin p45

HC 160mm 224mm

Moss D-Handle

HL 168mm 264mm

PB 1 2

Code H023.128.CO H022.192.CO

HC 128mm 192mm

HL 144mm 208mm

PB 2 3

30

28

15

160/224

180/340

19

128/192 144/208

168/264

Stainless Steel p11, Chrome p21, Black Satin p46, Black p47

Matt Black p48, Matt White p52, Aged Brass p62

Stainless Steel p09, Matt Black p48, Brushed Brass p61

AGED COPPER

Hoxton Cup Handle Code H1108.96.AC

HC 96mm

HL 120mm

Hatton Trim Handle PB 2

Code H1134.96.AC

HC 96mm

Hoxton D-Handle

HL 140mm

PB 2

Code H1085.160.AC

96 120

25

Chrome p18, Industrial Matt Black p49 Antique Bronze Effect p55

3.59

Order Online www.pws.co.uk

HL 170mm

PB 2

12

26 26

96

HC 160mm

26 160

31

24

170

140

Stainless Steel p12, Chrome p21, Industrial Matt Black p49

Industrial Matt Black p49

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Eldon Bar Handle Code H1084.128.AC H1084.160.AC H1084.320.AC

HC 128mm 160mm 320mm

HL 188mm 220mm 380mm

PB 2 2 2

32.5 128/160/320 188/220/380

BURNT COPPER

Dale Knob Code K557.35.BC

HC Central

HL 35mm

PB 1

10

35

35

Stainless Steel p05

Seaham D-Handle Code H1081.160.BC

HC 160mm

Ripon Bow Handle

HL 172mm

PB 2

Code H1086.160.BC

HC 160mm

Shoreditch Bow Handle

HL 191mm

PB 2

Code H559.160.BC

HC 160mm

HL 193mm

PB 2

26 25

160

27 160 172

Stainless Steel p12

25

160 24

191

25

Stainless Steel p12, Antique Silver Effect p56

Key: HC Hole Centre HL Handle Length PB Price Band RM Reverse Mounted

193

Stainless Steel p13

T: 01325 505599 (North) | 88 (South)

3.60


BRUSHED BRASS

Hessay D-Handle Code H1133.160.BHB H1133.320.BHB

HC 160mm 320mm

Marlow Trim Handle

HL 180mm 340mm

PB 2 3

26 160/320

15

Code H1148.204.BHB H1148.300.BHB

HC 160mm 256mm

RM

HL 204mm 300mm

PB 2 2

18 160/256 204/300

40

180/340

Stainless Steel p09, Matt Black p48, Bright Copper p59

AGED BRASS

Stivichall Knob Code K266.33.AB

HC Central

Harton Knob

HL 33mm

PB 1

Code K1118.31.AGB

HC Central

Canterbury T-Bar Handle

HL 31mm

PB 2

Code H214.50.AB

33

Bright Nickel p25

Strand T-Bar Handle Code H1143.60.AGB

HC Central

HL 60mm

Pewter Effect p35

Dartmouth T-Bar Handle PB 2

Code H1123.60.AGB

HC Central

HL 60mm

33

PB 2

35.5 35.5

60

20

Stainless Steel p09, Bright Nickel p25

3.61

PB 2

25 50

32

Pewter Effect p35

HL 50mm

47

31

28

HC Central

Order Online www.pws.co.uk

60 60

38 38

Stainless Steel p08, Chrome p20

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


HC 160mm

HL 195mm

PB 4

Code H1144.242.AGB

38

192 242

PB 3

PB 2

Code H1147.205.AGB

HC 160mm

HL 205mm

Mayfair Bow Handle PB 2

Code H268.96.AB

HC 96mm

HL 130mm

PB 1

96 130

Bright Nickel p26

Highbury Cup Handle

19

Pewter Effect p35

160 205

Bright Nickel p25

HC 64mm 160mm 320mm

PB 2

27

64 105

Code H1138.64.AGB H1138.160.AGB H1138.320.AGB

HL 147mm

147

35

30

25

HC 128mm

128

20

Harton Bow Handle

HL 105mm

Code H213.128.AB

Stainless Steel p09, Bright Nickel p26

Harton Cup Handle HC 64mm

HL 242mm

33

Stainless Steel p08, Chrome p20

Code H1146.105.AGB

HC 192mm

40

35.5 35.5

160 160 195

Canterbury D-Handle

Strand Bar Handle

Dartmouth Bar Handle Code H1128.160.AGB

Chrome p32, Pewter Effect p36

Yard D-Handle

HL 94mm 190mm 350mm

PB 1 2 3

Code H1137.160.AGB H1137.224.AGB

HC 160mm 224mm

HL 168mm 264mm

PB 1 2

28 16 64/160/320

20

160/224

94/190/350

Matt Black p48, Matt White p52

168/264

Matt Black p48, Matt White p52, Bright Copper p59

Key: HC Hole Centre HL Handle Length PB Price Band RM Reverse Mounted

T: 01325 505599 (North) | 88 (South)

3.62


Leather

Concrete

Timber

Ceramic


MATERIAL COLLECTION

HANDLE FAMILIES Our material collection incompasses old and new. We have embraced new trends with the introduction of our warm real leather collection and concrete range. Keeping with tradition, 0%)!.* !.)%+รป!./0%)!(!//,,!(ฤ‹

Jeaker

1.

2.

3.

4..

Justice

5.

6.

Holmes me

7.

8.

Gates

9.

10.

Milner

11.

12.

HANDLE CODES 1. H1149.80.BWNLE (p65) 2. H1150.160.BWNLE (p65) 3. H1149.80.BKLE (p65) 4. H1150.160.BKLE (p65) 5. K1121.32.CT (p65) 6. H1151.128.CT (p65) 7. K373.35.PEGC (p66) 8. H368.128.PEGC (p66) 9. SP7/39 (p66) 10. SP7/39CR (p66) 11. K371.35.ABB (p66) 12. H367.128.ABB (p66)

T: 01325 505599 (North) | 88 (South)

3.64


LEATHER

Jeaker Loop Handle

Jeaker Loop Handle

Brown leather

Black leather

Code H1149.80.BWNLE

HC Central

HL 80mm

PB 2

Code H1149.80.BKLE

80

HL 80mm

PB 2

80

25

23*

25

Black leather

Brown leather HC 160mm

HL 200mm

23*

Jeaker Bow Handle

Jeaker Bow Handle Code H1150.160.BWNLE

HC Central

PB 3

Code H1150.160.BKLE

HC 160mm

200

HL 200mm

PB 3

200

28

28

Recommended for non kitchen applications 160

* May differ as leather naturally ages

160

CONCRETE EFFECT

Justice Knob Code K1121.32.CT

HC Central

HL 32mm

Justice Block Handle PB 2

Code H1151.128.CT

HC 128mm

HL 128mm

PB 4

32 35

32

19 128 150

17

Alexandra T-Bar Handle Code H1152.16.CT

HC 16mm

HL 94mm

Alexandra T-Bar Handle PB 2

Code H1152.32.CT

94

3.65

20

22

22

Order Online www.pws.co.uk

HL 180mm

PB 3

180

20

16

HC 32mm

32

Price Bands

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


CERAMIC

Gates Knob Code SP7/39

HC Central

HL 39mm

Gates Knob PB 1

Code SP7/39CR

33

Holmes Knob

HL 39mm

PB 1

Code K373.35.PEGC

33

29 39

HC Central

HC Central

HL 32mm

Code H368.128.PEGC

PB 1

32

Holmes D-Handle PB 1

HL 32mm

35 29 39

Milner Knob Code K371.35.ABB

HC Central

HC 128mm

25

HL 153mm

Milner D-Handle PB 2

Code H367.128.ABB

HC 128mm

HL 153mm

PB 2

25

35

32

Key: HC Hole Centre HL Handle Length PB Price Band

128

128

153

153

T: 01325 505599 (North) | 88 (South)

3.66


TIMBER

Spencer Knob

Spencer Knob

Oak

Light Oak

Code S87/44BL S87/55BL

HC Central Central

31

HL 44mm 55mm

PB 1 1

Code S87/44X71

HC Central

Code S87/44X20

HC Central

HC Central Central

35 44

Oak PB 1 1

Code S87/44CR S87/55CR S87/70CR

29

HC Central Central Central

31

HL 44mm 55mm 70mm

35/45/61 44/55/70

Howlett Knob

Taylor Bow Handle

Walnut finish

Oak

HL 50mm

PB 2

Code H954.192.OA

HC 192mm

HL 265mm

23 50

PB 1 1 2

29

35/45 44/55

50

PB 3

23 192 265

26

20

Smith Bar Handle

Wilson D-Handle

Short D-Handle

Wenge finish and stainless steel

Oak and stainless steel

Brushed steel and oak

Code H953.160.SSWE

HC 160mm

PB 1

Archer Knob

HL 44mm 55mm

HC Central

HL 44mm

29

Sanded Oak

Code K967.50.WA

PB 1

35 44

Archer Knob

31

HL 44mm

29

29

35/37 44/55

Code S87/44X10 S87/55X10

Spencer Knob '/0%*! * (-1!.!

HL 200mm

PB 3

Code H962.192.SSOA

HC 192mm

HL 210mm

PB 4

Code H438.160.BSO

HC 160mm

HL 170mm

PB 3

37 42

160 200

3.67

16

Order Online www.pws.co.uk

192 210

Price Bands

30 160 170

19

11

Under £5

2

£5-£10

3

£10-£15

4

£15-£25

5

>£25


Key: HC Hole Centre HL Handle Length PB Price Band


HANDLELESS RAILS COLLECTION

Aluminium (No code suffix)

White (MW)

Graphite (MG)

Brushed Brass Brushed Copper (B) (C)

+รป!./+),.!$!*/%2!.1!* (!(!//%(+((!0%+*"+.1/!3%0$ 5 compatible door ranges. With over 30 products available in a choice of 5 trend colours, our Handleless Rail solutions help create a contemporary linear aesthetic to both modern and classic kitchen designs.

3.69

Order Online www.pws.co.uk


K

J A B

L D E

C

F I

H

TOP PROFILES FOR BASE UNITS

A

Top rail profile for base doors, 4100x56.5x27.2mm

GPT4100

Aluminium

GPT4100***

MW

MG

B

C

MID PROFILES FOR BASE UNITS

E

Aluminium

GPM4100***

MW

Top rail external corner joint, 90 degree, 56.5x27.5x27.5mm

MG

F

Vertical profile (Intermediate) 4200x71.6x41mm, trim to size

J

B

C

NEW SIZE - 1200x73x26mm GPM1200

B

VERTICAL PROFILES FOR TALL UNITS

Mid profile for drawers, 4100x73x26mm

GPM4100

GPV4200MID

Aluminium

GPV4200MID***

MW

GPMEX90

Aluminium

GPTEX90***

MW

MG

GPMEX90***

MW

MG

B

C

B

C

GPV4200END

Aluminium

GPV4200END***

MW

MG

B

NEW SIZE - 1970x53.3x41mm

Mid rail internal corner joint, 90 degree, 73x28.3x28.3mm

GPTIN90

Aluminium

GPMIN90

Aluminium

GPTIN90***

MW

MG

GPMIN90***

MW

MG

B

C

B

C

Aluminium only

Plug/filler for appliance fittings, 580x16x42mm

L

GPVAPPFILL

Aluminium

GPVAPPFILL***

MW

MG

B

C

STAINLESS STEEL PLINTHS

D

End caps for top profiles, pair, 1 left & 1 right hand, 56.5x27.5mm

H

SSP30 - Plinth, 150x3000x12mm

End caps for Mid profiles, pair, 1 left & 1 right hand, 73x27.5mm

GPTEND

Aluminium

GPMEND

Aluminium

GPTEND***

MW

MG

GPMEND***

MW

MG

B

C

B

C

SSSJC - Straight plinth joint

Mid joint section for top profile, 56.5x8x28.5mm GPTJOINT

Aluminium

GPTJOINT***

MW B

I

SSJC90 - 90 degree corner SSMC - Multi-corner

Drawer line dishwasher frame, 590x645mm

GPDDWF

SSJC135 - 135 degree corner

Stainless steel substrate

Curved plinth section use with the small curved door, 530x150x12mm SSCPS560SDL - Left hand

MG C

PROFILES FOR WALL UNITS

SSCPS560SDL - Right hand

Profile for wall cabinets, 3900x19.6x20mm

Securing brackets forr to top op and a d mid rails, pack of 2, mi m minimum nimum m +. !.-1*0%05+"ĂĆ GPFIXING

Plastic finish

Internal curved plinth to suit 600x600mm base unit

GPW3900

Aluminium

GPW3900***

MW

MG

Wall curved profile for 300x300mm small curved door GPCWS300SD

Aluminium

Wall curved profile for 600 x 600mm internal curved wall unit GPCWSIC600

C

Vertical profile (lateral) 4200x53.3x41mm, trim to size

K

GPV1970END

G

B

Aluminium only

GPV1970MID

Mid rail external, corner joint, 90 degree, 73x27.5x27.5mm

Aluminium

Top rail internal corner joint, 90 degree, 56.5x28.3x28.3mm

MG

NEW SIZE - 1970x71.6x41mm

Aluminium only

GPTEX90

C

G

Aluminium

SSICCPS900 B

C

ACCENT PLINTHS Accent plinth, 150x3000x12mm ***P30

B

C

90 degree corner joint ***SJC

B

C

C


OUR PHILOSOPHY Kesseböhmer is the world’s leading premium storage brand, making kitchens beautiful on the inside since 1963. For generations, the name Kesseböhmer has stood for innovation and excellence in storage, backed by a strong heritage of design, functionality and quality. Expertly engineered, Kesseböhmer products not only help end-users maximise their space, they give them easy access to food and kitchen cookware. Kitchen manufacturers * ü00!./(/+!*!ü0".+),.+ 10/0$0.! 2!.5!/50+//!)(!Čü0*  &1/0ċ In keeping with our own values, kitchen storage should be reliable, practical and attractive. Or as we like to say, beautiful on the inside.


4 KESSEBÖHMER STORAGE

Product selection guide

01

WALL UNIT STORAGE

Pick your tray style

02

iMove

New for 2020

03

Wall unit storage

45

Wine rack

49

Lifting systems

52

LARDER STORAGE Larder pull-outs

05

Swing larders

09

43

MISCELLANEOUS

Tandem larders

13

+,ý,/05/Ē(%"0!./

ĆĈ

Convoy Centro

19

Worktop extenders

58

Convoy Premio

20

CORNER UNIT STORAGE LeMans II

23

Moveboard

26

Magic Corner

27

Carousels

29

Revo 90

31

BASE UNIT STORAGE 150mm pull-out

33

300/400mm Base unit pull-out

35

Base unit pull-out add-ons

38

Pull-out trays

41

10Year

Drawer organiser

59

Pantry accessories

60

Helping you sell more

61


PRODUCT SELECTION GUIDE

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Silver Arena

â&#x20AC;¢

Glass Sides

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Chrome Style

Anthracite Style

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Chrome Classic

Chrome Arena

Tray Style

Silver Classic

Unhanded

Handed

1200mm

1000mm

900mm

Handed

800mm

700mm

600mm

500mm

450mm

400mm

300mm

150mm

Cabinet Widths

LARDER In-Frame

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Studio Height Full Height Swing Larder

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

TANDEM Studio Height

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Full Height Tandem Solo Tandem Side Full Height Tandem Side Studio Height

â&#x20AC;¢

Tandem Side Base Height Convoy Premio Æ«+*2+5.!)%+Ä&#x2019; +*ü#1.! Convoy Centro

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

CORNER STORAGE LeMans

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

LeMans Studio Height Moveboard Magic Corner

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Revo 90 Half Carousel 3/4 Carousel

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

Full Carousel

â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

BASE UNIT PULL-OUT 150mm Classic

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

150mm Towel 150mm Tray Centre Mounted Base Pull-Out

â&#x20AC;¢ â&#x20AC;¢

YouBoXx

â&#x20AC;¢

â&#x20AC;¢

Base Tandem

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

Cleaning Agent

â&#x20AC;¢ â&#x20AC;¢

45 Degree

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Ƶ &1/0(!1((ġ100.5 Pull-Out chrome trays

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

WALL UNIT STORAGE 150mm Wall Pull-Out

â&#x20AC;¢

Wall Tandem Spice Rack Wine Rack

4.01

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Order online www.pws.co.uk

â&#x20AC;¢

Tray style only available in widths shown


PICK YOUR TRAY STYLE

SILVER CLASSIC

CHROME CLASSIC

Powder coated wire tray

Chrome plated wire tray

SILVER ARENA

CHROME ARENA

Powder coated rail No anti-slip surface

Chrome plated rail Anti-slip grey base

ANTHRACITE STYLE

CHROME STYLE

Powder coated anthracite band Anti-slip anthracite base

Chrome plated band Anti-slip grey base

Online support: support.kesseboehmer.world/en/

4.02


NEW FOR 2020

NEW

YouK The new YouK shelving system by Kesseböhmer leads the trend for industrial, open storage. Modular in design, it is easy to ü0* *!+*ü#1.! %*0+ a variety of shapes and uses around the entire house.

SEE PAGE 4.45

FREEspace

SEE PAGE 4.53

New from Kesseböhmer, the FreeSpace system lifts wall cupboard doors up and open 3%0$)1$)+.!!þ%!*5ċ Suited to the widest range of applications, its leaner design allows for a much greater use of internal space.

SpaceFlexx Combatting chaos in the tupperware drawer, the new Kesseböhmer SpaceFlexx employs high performance textile bands to nest any size and shape of storage container securely in place; in sight and easily accessible at all times.

SEE PAGE 4.59

4.03

Order online www.pws.co.uk


LARDER STORAGE Getting to the things at the back of your cupboards can be a real hassle, but larders provide easy access to all your items, meaning less food goes to waste, which will save you money.

EASY ASSEMBLY

MONEY SAVING

AMAZING OVERVIEW


LARDER PULL-OUTS FEATURES

Chrome Arena shown

Movement: Tested to 60,000 cycles, the entire contents come all the way out in a single movement Cabinet widths: 300mm, 400mm, 500mm Tray styles: Silver Classic, Chrome Classic, Chrome Arena, Anthracite Style, Chrome Style No. of trays: 5 (additional trays page 4.08) Load capacity: 100kg Height adjustable trays: Yes

ETOUCH

Soft-close: Top and bottom runner Soft-open: ƫ*!.!0.+ü00! ġ/!!!(+3

See page 4.09

MINIMUM INTERNAL CABINET DIMENSIONS Height 1800-2200mm | Depth 500mm | Width 262/362/462mm

FOR LARDER ADD-ONS SEE PAGE 4.07

SOFT-OPEN • • •

Easy opening ƫ*!.!0.+ü00! For use with Classic and Arena

A soft close is a given. So why not incorporate a soft-open too – taking your larder to the next level!

FOR ADDITIONAL

TRAYS SEE PAGE

4.10 Unhanded

4.05

Order online www.pws.co.uk

Order code

Description

KTLSOFTOPEN

Soft open adapter for larders


CHOOSE FROM 5 TRAY STYLES

SILVER CLASSIC Full height

Order code

Cab width

KLF300FESILV

300mm

4.08

• •

Powder coated wire tray Larder features soft-close on top runner only

Grey

CHROME CLASSIC

Order code

Cab width

In-frame full height

IFKLF300FESC

300mm

Studio height

KSLF300FESC*

300mm

Full height

KLF300FESC KLF400FESC KLF500FESC

300mm 400mm 500mm

Chrome wire trays

4.08

CHROME ARENA

• •

Order code

Cab width

In-frame full height

IFKALF300FESC

300mm

Studio height

KSALF300FESC*

300mm

Full height

KALF300SC KALF400FESC KALF500FESC

300mm 400mm 500mm

Chrome plated rail Anti-slip grey base

ANTHRACITE STYLE

CHROME STYLE

• • •

• • •

Powder coated band Anti-slip anthracite base Integrated soft-open

BEST SELLER

Chrome plated band Anti-slip grey base Integrated soft-open

Order code

Cab width

Order code

Cab width

Studio height

KSSALF300FEA*

300mm

Studio height

KSASLF300FESC *

300mm

Full height

KSALF300FEA

300mm

Full height

KASLF300FESC

300mm

KSALF400FEA

400mm

KASLF400FESC

400mm

KSALF500FEA

500mm

KASLF500FESC

500mm

ĵ01 %+$!%#$0(. !./.!/1,,(%! 3%0$ą0.5/* *!!//.5ü00%*#/* ü0*%*0!.*(%*!0$!%#$0+"āĂĀĀġāćĀĀ))ċ

Online support: support.kesseboehmer.world/en/

4.06


LARDER ADD-ONS ELECTRONIC OPENING

NEW

CAN BE RETROFITTED

PUSH TO OPEN Push to open, for complete handleless kitchen designs. Push to open can be used with a variety of Kesseböhmer products * *!.!0.+ü00! ċ%/0+*/*!1/! 5 screwing them into the side of the carcase or by using the housing clad on. Order code

Description

KPTOPA

Type A - 17-23N

KPTOPB

Type B - 23-34N

KPTOPC

Type C - 26-48N

KPTOPHSG

Housing clad on

Type

Strength

Recommended product

Type A

17-23N

150mm pull-out, Freelight, FreeMini, Tandem Solo, Tandem Side

Type B

23-34N

Microwave Lifter, Convoy Premio, ǫ/!,1((ġ+10/Č+,ý!4

Type C

26-48N

Base Pull-Out, Lifters, Tandem, Magic Corner, Larder

Housing clad on

JUST PUSH THE DOOR

FOR SMOOTH AUTOMATIC OPENING

Order code

Description

ETOUCH

Electronic touch opening

REVISED PRICE

LARDER CONNECTOR STRIP

Order code

EXTENSION CLIP +. &1/0(!(. !. frame to hook trays higher. Description

KLFPCGY (sold in singles)

Strip to connect 2 doors - grey

Order code

Description

KLFPCA (sold in singles)

Strip to connect 2 doors - anthracite

KBASFASC (sold in pairs)

Extension clip

4.07

Order online www.pws.co.uk


300mm LARDER ADD-ONS KONFIGURE BY KESSEBÃ&#x2013;HMER +*ü#1.!5 !//!®$)!.%//01**%*#Ä&#x152; contemporary, modular and customisable /0+.#!/5/0!)Ä&#x152;+û!.%*#+),(!0!2!./0%(%05 * ý!4%%(%05Ä&#x2039; *1"01.! %*+'Ä&#x152; +*ü#1.!*+0+*(5 works in drawers (see Section 6) but also in (. !./Ä&#x17D;+û!.%*#/0+.#!0$0%/+0$)+ 1(. and eye-catching. 1. +*ü#1.!%*/!.0/ 0$!ü*%/$%*#0+1$ to your Kesseböhmer storage solution.

Box 3

Box 4

Box 5

Oak

Order code

Box size

Multipurpose box 3

TIMB211X236OA

211x236x110mm

Multipurpose box 4

TIMBOX211OA

211x236x49mm

Multipurpose box 5

TIMB211X117OA

211X117.5x90mm

YOUBOXX Customise your Larder with the addition of a YouBoXx set. While large items, such as cereal boxes and bottles can be accommodated on 0.5/Ä&#x152;/)((!.%0!)/Ä&#x152;(%'!(++/!"++ /01û/*  kitchen utensils can be accommodated in a YouBoXx. Trays and YouBoXx sets are fully +),0%(!Ä&#x152;((+3%*#5+10+!û+.0(!//(5/3, them between your Larder and your Base Units.

Set 1

Order code

Description

KUBOXX1

2 rails, 2x 1L box, 2x 2L box + slotted knife block, 1x 2.1L box, 2 lids

PLASTIC INSERT FOR 300MM CLASSIC TRAYS

Grey Order code Plastic insert

KCTRAY300

Online support: support.kesseboehmer.world/en/

4.08


SWING LARDERS FEATURES

Chrome Arena shown

Movement: Can be turned left or right (90º) for easy access to either side Cabinet width: 300mm Tray styles: Chrome Arena, Chrome Style No. of trays: 5 (additional trays page 4.14) Load capacity: 70kg Height adjustable trays: Yes Soft-close: Top and bottom runner Soft-open: No

MINIMUM INTERNAL DIMENSIONS Height 1800-2200mm | Depth 500mm | Width 262mm

Unhanded

CHOOSE FROM 2 TRAY STYLES CHROME ARENA

CHROME STYLE

• •

• •

Chrome plated rail Anti-slip grey base

Chrome plated band Anti-slip grey base

Order code

Cab width

Order code

Cab width

KALFS300OESC

300mm

KASLFS300OESC

300mm

4.09

Order online www.pws.co.uk


ADDITIONAL 300MM TRAYS  Ƶ Ƶ ƵÄ&#x152;ǫƵ Ä&#x2019;Ç« SILVER CLASSIC Full height

Order code

Cab width

HxDxW

KCATL300SILV

300mm

110x467x250mm

4.08

â&#x20AC;¢

Powder coated wire trays

CHROME CLASSIC Order code

Cab width

HxDxW

In-frame

IFKCATL300C

300mm

110x467x200mm

Full extension

KCATL300C

300mm

110x467x250mm

4.08

â&#x20AC;¢

Chrome wire trays

CHROME ARENA

â&#x20AC;¢ â&#x20AC;¢

Order code

Cab width

HxDxW

In-frame

IFKBAS300CM

300mm

106x462x200mm

Full extension

KABAS300CM

300mm

106x462x250mm

BEST SELLER

Chrome plated rail Anti-slip grey base

ANTHRACITE STYLE

CHROME STYLE

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

Powder coated band Anti-slip anthracite base

Full extension

Order code

Cab width

HxDxW

KSATL300A

300mm

106x462x250mm

Chrome coated band Anti-slip grey base

Full extension

Order code

Cab width

HxDxW

KSATL300C

300mm

106x462x250mm

Extension clips available on page 4.07 Extension clips can slide on extended larder frames to hook onto additional baskets.

Online support: support.kesseboehmer.world/en/

4.10


TANDEM STORAGE Inspired by the design of ".% #!/Č+1.* !).*#!+û!./ immediate access to items. *(%'!/$!(2%*#Č%0+û!./+),(!0! transparency, even for wider cupboards.

EASY ACCESS

AMAZING OVERVIEW

CENTRAL FOOD STORAGE


TANDEM LARDERS Chrome Arena shown

FEATURES Movement: The rear trays are automatically drawn forward when the door is opened Cabinet widths: ĆĀĀ))ČćĀĀ))Ģ01 %+Ē1((!%#$0 Tray styles: Silver Classic, Chrome Classic, Chrome Arena, Anthracite Style, Chrome Style No. of trays: 6 door trays, 6 internal trays Load capacity: Door trays: 20kg, internal trays: 50kg Height adjustable trays: Yes (internal shelves only) Soft-close: Bottom runner Soft-open: No

STUDIO HEIGHT Chrome Arena shown

Unhanded

MINIMUM INTERNAL DIMENSIONS FULL: Height 1700mm | Depth 500mm | Width 462/562mm STUDIO: Height 1100mm | Depth 500mm | Width 462/562mm FURTHER INFORMATION Standard 110° hinge

Unhanded

4.13

Order online www.pws.co.uk


CHOOSE FROM 5 TRAY STYLES

SILVER CLASSIC Full height

Order code

Cab width

KTLF600SILV

600mm

Order code

Cab width

Powder coated wire trays

CHROME CLASSIC Studio height Full height

KSTLF500SC*

500mm

KSTLF600SC*

600mm

KTLF500SC

500mm

KTLF600SC

600mm

Order code

Cab width

Chrome wire trays

CHROME ARENA Studio height Full height

• •

KSTLFA500SC*

500mm

KSTLFA600SC*

600mm

KTLFA500SC

500mm

KTLFA600SC

600mm

BEST SELLER

Chrome plated rail Anti-slip grey base

ANTHRACITE STYLE

CHROME STYLE

• •

• •

Powder coated band Anti-slip anthracite base Order code

Cab width

Studio height

KSSATLF500A*

500mm

KSSATLF600A*

600mm

Full height

KSATLF500A

500mm

KSATLF600A

600mm

Chrome plated band Anti-slip grey base Order code

Cab width

Studio height

KASSTLF500SC*

500mm

KASSTLF600SC*

600mm

Full height

KASTLF500SC

500mm

KASTLF600SC

600mm

ĵ01 %+$!%#$00* !)/.!/1,,(%! 3%0$ą0.5/* *!!//.5ü00%*#/* ü0*%*0!.*(%*!0$!%#$0+"āĂĀĀġāćĀĀ))ċ

Online support: support.kesseboehmer.world/en/

4.14


TANDEM SIDE Anthracite style shown

FEATURES Cabinet widths: 500mm, 600mm Tray styles: Silver Arena (not anti-slip), Anthracite Style No. of trays: Base tandem = 3 trays Studio tandem = 4 trays Full height tandem = 6 trays Load capacity: 4kg per tray Height adjustable trays: Yes Shelf inserts to be shortened by: Internal cabinet depth minus 175 mm

Why not use our Tandem Side as a modern pantry? !%#$0 &1/0)!*0 Unhanded

FULL HEIGHT TANDEM SIDE COMES WITH 6 TRAYS Silver Arena shown

Colour Silver Arena

Anthracite Style

4.15

Order online www.pws.co.uk

Order code

Cabinet width

Height

KTDFH500SILV

500mm

1700mm

KTDFH600SILV

600mm

1700mm

KTDFH500A

500mm

1700mm

KTDFH600A

600mm

1700mm


STUDIO TANDEM SIDE COMES WITH 4 TRAYS Anthracite Style shown

Colour Silver Arena

Anthracite Style

Order code

Cabinet width

Height

KTDSH500SILV

500mm

1100mm

KTDSH600SILV

600mm

1100mm

KTDSH500A

500mm

1100mm

KTDSH600A

600mm

1100mm

Unhanded

BASE TANDEM SIDE COMES WITH 3 TRAYS Anthracite Style shown

Colour Silver Arena

Anthracite Style

Order code

Cabinet width

Height

KTDBH500SILV

500mm

600mm

KTDBH600SILV

600mm

600mm

KTDBH500A

500mm

600mm

KTDBH600A

600mm

600mm

Unhanded

Online support: support.kesseboehmer.world/en/

4.16


TANDEM SOLO FEATURES

Anthracite style shown

Movement: Open the door and the full contents will move towards you

GREAT ALTERNATIVE TO TANDEM

Cabinet widths: 500mm, 600mm Tray styles: Silver Arena, Chrome Arena, Anthracite Style No. of trays: 6 Load capacity: 80kg Height adjustable trays: Yes Soft-close: No Soft-open: Yes

MINIMUM INTERNAL DIMENSIONS Height 1800mm | Depth 495mm | Width 462/562mm

Unhanded

SILVER ARENA

FURTHER INFORMATION Standard 110° hinge

CHROME ARENA • Powder coated rail • No anti-slip tray

• Chrome coated rail • Anti-slip tray

Order code

Cab width

Order code

Cab width

KTS500SILV

500mm

KATS500SC

500mm

KTS600SILV

600mm

KATS600SC

600mm

ANTHRACITE STYLE • Powder coated band • Anti-slip tray

Order code

Cab width

KTSFH500A

500mm

KTSFH600A

600mm

4.17

Order online www.pws.co.uk


CONVOY FAMILY Convoy represents the very best of Kessebรถhmer in one fantastic package.

CONVENIENCE

UNMATCHED VISIBILITY

STANDOUT PERFORMANCE


CONVOY CENTRO FEATURES Movement: Open the door and the entire contents come all the way out in a single movement Cabinet width: 300mm Tray styles: Grey (non-shatter) glass-sided anti-slip trays No. of trays: 5 Load capacity: 130kg Height adjustable trays: !/Ģý+0%*#$!%#$0 &1/0)!*0 Soft-close: Yes (bottom and top runner) Soft-open: Yes (bottom runner)

MINIMUM INTERNAL DIMENSIONS Height 1900-1999mm | Depth 500mm | Width 268mm FURTHER INFORMATION Supporting shelf required

Full extension

Unhanded

4.19

Order online www.pws.co.uk

Order code

Cab width

KCONVOY300

300mm


CONVOY PREMIO FEATURES Movement: Open the door and the full content moves towards you Cabinet width: 600mm Tray styles: Grey (non-shatter) glass-sided anti-slip trays No. of trays: 5 Load capacity: 130kg Height adjustable trays: !/Ģý+0%*#$!%#$0 &1/0)!*0 Soft-close: Yes (bottom and top runner) Soft-open: Yes (bottom runner)

MINIMUM INTERNAL DIMENSIONS Height 1900-1999mm | Depth 500mm | Width 568mm FURTHER INFORMATION %*%)1)āĆĀǜ$%*#!.!-1%.!

Full extension

Order code

Cab width

KCONPREM600*

600mm

* PLEASE NOTE - UNITS ARE HANDED Please insert order code with a L for left hand or R for right hand, replacing the asterix e.g. left hand 600mm wide unit KCONPREM600L Product shown with white base trays but supplied with grey base trays.

For Shaker door installation please contact customer /!.2%!/0+.!!%2! %û!.!*0 front bracket

CONVOY PREMIO ELECTRONIC TOUCH OPENING

Unhanded Left hand shown

ALSO AVAILABLE WITH LUXURY ANTHRACITE TRAYS SEE PAGE 4.21

Order code

Description

ETOUCH

Electronic touch opening

Online support: support.kesseboehmer.world/en/

4.20


CONVOY PREMIO

SAME TECHNICAL SPEC AS PAGE 4.20

KONFIGURE FOR PREMIO

Our luxury anthracite Convoy Premio comes with 5 trays. The top tray is a multipurpose detachable tray, while the 4 other trays come with an anthracite anti-slip base, drawer liner and oak frame. Anti-slip drawer liner included. Pre-cut to size.

Powder coated anthracite trays

For Shaker door installation please contact customer /!.2%!/0+.!!%2! %û!.!*0 front bracket

Order code

Cab width

KCONPREMA600*

600mm

* PLEASE NOTE - UNITS ARE HANDED Please insert order code with a L for left hand or R for right hand, replacing the asterix e.g. left hand unit - KCONPREMA600L

Right hand shown

TRAY INSERTS TRANSFORM YOUR PREMIOċƫ1/0+)%/!5+1.*0$.%0!+'ƫ+*2+5.!)%+3%0$+1.0.5%*/!.0/Č+û!.%*# a number of options for storage and organisation.

SET 1 - BOTTLE HOLDER

SET 3 - GLASS HOLDER

Order code

Order code

KCONTRAYSET1

KCONTRAYSET3

SET 2 - INGREDIENTS HOLDER

SET 4 - PLATE HOLDER

Order code

Order code

KCONTRAYSET2

KCONTRAYSET4

PLEASE NOTE: Add on sets only include inner inserts, not the tray or wooden frame.

4.21

Order online www.pws.co.uk


CORNER STORAGE Transform the dead spaces in your kitchen. These best sellers transform dark corners into useable storage. Once hard-to-reach items .!*+3.+1#$00+5+1.ü*#!.0%,/ċ

EASY ACCESS

MAKE USE OF DEAD SPACE

TRANSFORM CORNERS


LEMANS II FEATURES

Chrome Arena shown

Movement: Each tray swings out of the cabinet completely and independently Door widths: 400mm, 450mm, 500mm, 600mm Tray styles: Silver Arena, Chrome Arena, Anthracite Style, Chrome Style No. of trays: 2 Load capacity: 25kg per tray Height adjustable trays: Yes Soft-close: ƫ*!.!0.+ġü00! 

MINIMUM INTERNAL DIMENSIONS DOOR WIDTH: 400mm 450mm 500mm 600mm CAB WIDTH: >764mm >800mm >910mm >960mm CAB DEPTH: >495mm CAB HEIGHT: >650mm - 800mm FURTHER INFORMATION Can be used below a drawer !%#$0 &1/0(!4(!čćĆĀġĉĀĀ))

Right hand shown

Studio Height LeMans See page 4.25 Anthracite style shown

Right hand shown

4.23

Order online www.pws.co.uk


CHOOSE FROM 4 TRAY STYLES

SILVER ARENA • • •

Power coated rail No anti-slip surface Fixed axle at 520mm

Order code

Door width

KLM450SILV*

450mm

KLM500SILV*

500mm

KLM600SILV*

600mm

Order code

Door width

K2LM400SC*

400mm

CHROME ARENA • •

Chrome plated rail Anti-slip grey base

BEST SELLER

K2LM450SC*

450mm

K2LM500SC*

500mm

K2LM600SC*

600mm

ANTHRACITE STYLE • •

Powder coated anthracite band Anti-slip anthracite base

Order code

Door width

KSA2LM400A*

400mm

KSA2LM450A*

450mm

KSA2LM500A*

500mm

KSA2LM600A*

600mm

CHROME STYLE • •

Chrome plated band Anti-slip grey base

SOFT CLOSE

Order code

Door width

KAS2LM450SC*

450mm

KAS2LM500SC*

500mm

KAS2LM600SC*

600mm

TRAVEL CLIP Transport your pre-installed LeMans without the risk of damage

Grey

• •

ƫ*!.!0.+ü00! Sold in singles

Order code

Description

KLMSCML

Self-closing mechanism, left hand - grey

• Clip connects the tray to the arms of the LeMans so it doesn’t move during transportation • Sold in singles

KLMSCMR

Self-closing mechanism, right hand - grey

KLMASCML

Self-closing mechanism, left hand - anthracite

Order code

Description

KLMASCMR

Self-closing mechanism, right hand - anthracite

KLMTC

Travel clip

FURTHER INFORMATION A 500mm wide LeMans can be used with a 600mm wide in-frame door. See the inframe application guide * PLEASE NOTE - Units are handed - Please insert order code with a L for left hand or a R for right hand, replacing the asterix e.g. left hand 450mm wide unit - KAS2LM450SCL.

Online support: support.kesseboehmer.world/en/

4.24


STUDIO HEIGHT LEMANS TO MAKE A STUDIO HEIGHT LEMANS

Anthracite style shown

• • •

Right hand shown

Anthracite style shown

Right hand shown

4.25

Order online www.pws.co.uk

Order 2 base unit LeMans II Order separate studio height axle Minimum internal height of 1050mm is required

Order code

Description

KLMSTUDIO

Axle for studio height, 1050mm, not extendable

KLMHASTUDIO

Extendable axle, 1330-1575mm


MOVEBOARD FEATURES Movement: Each tray swings out independently Door widths: 400mm, 500mm Tray styles: Silver No. of trays: 2 Load capacity: 20kg per tray Height adjustable trays: No Soft-close: No

Right hand shown

MINIMUM INTERNAL DIMENSIONS DOOR WIDTH: 400mm 450mm CAB WIDTH: >764mm >910mm CAB DEPTH: >500mm CAB HEIGHT: >535mm FURTHER INFORMATION Can be used below a drawer

TRAY STYLE

NEW REVISED PRICE

SILVER • •

Powder coated trays No anti-slip trays

Order code

Door width

KMB400SILV*

400mm

KMB500SILV*

500mm

* PLEASE NOTE - Units are handed - Please insert order code with a L for left hand or a R for right hand, replacing the asterix e.g. left hand 400mm wide unit - KMB400SILVL

Online support: support.kesseboehmer.world/en/

4.26


MAGIC CORNER Chrome Arena shown

FEATURES Movement: Attached to the back of the door, both trays slide simultaneously for full corner access Cabinet widths: 900mm â&#x20AC;&#x201C; 1000mm Tray styles: Silver Classic, Chrome Classic, Chrome Arena, Chrome Style No. of trays: 2 door trays and 2 internal trays Load capacity: 14 kg door trays, 18kg internal trays Height adjustable trays: Yes Soft-close: Yes

min. 485

MINIMUM INTERNAL DIMENSIONS

min. 450 860-970

Right hand shown

4.27

Order online www.pws.co.uk

FURTHER INFORMATION Can be used below a drawer (product height 525mm)


CHOOSE FROM 4 TRAY STYLES

SILVER CLASSIC •

Powder coated wire trays

Order code

Description

KMCUSILV*

Swings left/right

CHROME CLASSIC •

Chrome wire trays

Order code

Description

KMCUSC*

Swings left/right

CHROME ARENA • •

Chrome plated rail Anti-slip

Order code

Description

KAMCUSC*

Swings left/right

BEST SELLER

CHROME STYLE • •

Chrome plated bands Anti-slip

Order code

Description

KASMCUSC*

Swings left/right

FURTHER INFORMATION * PLEASE NOTE - Units are handed - Please insert order code with a L for left hand or a R for right hand, replacing the asterix e.g. left hand - KMCUSCL.

Online support: support.kesseboehmer.world/en/

4.28


CORNER CAROUSELS 1/2 CAROUSEL Chrome Arena shown

• • •

15kg load capacity Classic and Arena Axle height: 525mm

460mm

* Needs a 497mm door

3/4 CAROUSEL Chrome Arena shown

• • •

20kg load capacity Classic, Arena and Style Axle height: 640mm

• • •

25kg load capacity Arena and Style Axle height: 685-735mm

FULL CAROUSEL Chrome Arena shown

1200x1200 shown

4.29

Order online www.pws.co.uk


CHOOSE FROM 4 TRAY STYLES

SILVER CLASSIC • Powder coated wire trays

3/4 carousel

Order code

Description

KWC270SILV

tray set 700mmØ

CHROME CLASSIC • Chrome wire trays

Order code

Description

1/2 carousel

KWC180C

tray set 750mmØ

3/4 carousel

KWC270C

tray set 700mmØ

CHROME ARENA • Chrome plated rail • Anti-slip Order code

Description

1/2 carousel

KSH180GC*

tray set 750mmØ

3/4 carousel

KSH270GC

tray set 700mmØ

Full carousel

KSH360GC

tray set 700mmØ

FURTHER INFORMATION *The KSH180GC is supplied with a distance bracket providing 5mm packing between the corner post and axle.

CHROME STYLE • Chrome plated bands • Anti-slip

3/4 carousel Full carousel

Order code

Description

KASSH270GC KASSH360GC

tray set 700mmØ tray set 700mmØ

PLEASE NOTE ƵĂĈĀƫ*!ü00! 0+*%*0!.*(1.2!,,(%0%+*

Online support: support.kesseboehmer.world/en/

4.30


REVO 90 CORNER CAROUSEL FOR FOLDING DOORS

Chrome Arena shown

FEATURES Movement: Centre mounted, revolving folding doors Cabinet widths: 900mm x 900mm Tray styles: Chrome Arena, Chrome Style No. of trays: 2 Load capacity: 25kg per tray Height adjustable trays: Yes Soft-close: Yes

MINIMUM INTERNAL DIMENSIONS Ø810

412.5 1

19

56 16/ 0 90

0

0

56

0

90

FURTHER INFORMATION Plinth or carcass need to be lowered by 20mm (shown in image)

Unhanded

CHOOSE FROM 2 TRAY STYLES CHROME ARENA

CHROME STYLE

• •

• •

Chrome plated rail Anti-slip grey base

Chrome plated band Anti-slip grey base

Order code

Cab width

Order code

Cab width

KAREVO90SC

900mm

KASREVO90SC

900mm

4.31

660-860

3

900 412.5

560

84

Order online www.pws.co.uk


BASE UNIT PULL-OUTS If you have no idea whatâ&#x20AC;&#x2122;s lurking at the back of your narrow base units, then this is the product for you. Base unit pull-outs transform narrow and awkward cupboards into dynamic and functional storage spaces, bringing every inch of space into play.

AMAZING OVERVIEW

TRANSFORM NARROW SPACES

EVERYTHING COMES OUT TO YOU


150mm BASE UNIT PULL-OUTS How to maintain our chrome products: • Never leave cleaning products to work for longer than necessary. • /!/+"0(+0$0+3%,!+û .+,/+"30!."0!.!$1/!ċ • Remove any remnants of cleaning products quickly to avoid any damage.

BASE

TRAY

Chrome Classic shown

TOWEL

Chrome Classic shown

FEATURES Use: Transforms narrow spaces, great for use on either side of your sink or oven

Load capacity: Base 12kg per tray Tray 6kg per tray Towel 10kg per tray

Cabinet widths: 150mm

Height adjustable trays: No

Tray styles: Silver Classic, Chrome Classic, Anthracite Style, Chrome Style

Soft-close: Yes

No. of trays: 3 versions – 2 trays/baking tray/towel holder and tray

FURTHER INFORMATION %#$0ġ$* ü4%*#ċ++(ġ(!// &1/0)!*0 of height, width and door angle located under the bottom tray

FRONT PANEL ADJUSTMENT Ƶ &1/00$! ++.%*!2!.5 %.!0%+*0+$%!2!,!."!0ü0ċ This can be done without using a screwdriver.

% ! &1/0)!*0 %(0 &1/0)!*0

FURTHER INFORMATION ++((!//ă &1/0)!*0+"$!%#$0Č3% 0$*  ++.*#(!

4.33

Order online www.pws.co.uk

Chrome Classic shown

!%#$0 &1/0)!*0

A DESIGNER’S

FRIEND

FITTING VIDEO SCAN HERE


CHOOSE FROM 4 TRAY STYLES

SILVER CLASSIC â&#x20AC;¢ â&#x20AC;¢

Powder coated rail +Ä&#x192; &1/0)!*0

Order code

Description

KTBP150SILV

Base pull-out

KTRBP150SILV

Towel pull-out

MINIMUM INTERNAL DIMENSIONS Height 540mm | Depth 481mm | Width 112mm

CHROME CLASSIC â&#x20AC;¢

Chrome plated rail

Order code

Description

KBP150CH

Base unit pull-out

KTBP150C

Tray pull-out

KTRBP150C

Towel pull-out

BEST SELLER

MINIMUM INTERNAL DIMENSIONS Height 540mm | Depth 481mm | Width 112mm

ANTHRACITE STYLE â&#x20AC;¢ â&#x20AC;¢

Powder coated band Anti-slip anthracite base

Order code

Description

KSABP150A

Base unit pull-out

KSATBP150A

Tray pull-out

KSATRBP150A

Towel pull-out

MINIMUM INTERNAL DIMENSIONS Height 540mm | Depth 481mm | Width 112mm

CHROME STYLE â&#x20AC;¢

Chrome plated band

Order code

Description

KASBP150CH

Base unit pull-out

KASTBP150C

Tray pull-out

KASTRBP150C

Towel pull-out

MINIMUM INTERNAL DIMENSIONS Height 540mm | Depth 481mm | Width 112mm

Online support: support.kesseboehmer.world/en/

4.34


300mm/400mm BASE UNIT PULL-OUTS Anthracite Style shown

FEATURES Use: Optimal access to narrow base units with this centre mounted pull-out Cabinet widths: 300mm, 400mm Tray styles: Silver Classic, Chrome Classic, Chrome Arena, Anthracite Style, Chrome Style No. of trays: 2 Load capacity: 24kg Height adjustable trays: Yes Soft-close: Yes Soft-open: No

FOR BASE UNIT PULL-OUT ADD-ONS SEE PAGE 4.38

MINIMUM INTERNAL DIMENSIONS 300mm - Height 631mm | Depth 480mm | Width 260mm 400mm - Height 631mm | Depth 480mm | Width 360mm FURTHER INFORMATION Additional trays available see page 4.10 Base Unit Pull-out and Larder trays are now compatible See page 4.10 for tray dimensions

Unhanded

Why not add YouBoxx to your Base Unit Pull-out? See page 4.39

4.35

Order online www.pws.co.uk

FOR 500/600MM BASE UNIT PULL-OUTS SEE PAGE 4.37


CHOOSE FROM 5 TRAY STYLES

SILVER CLASSIC •

Powder coated rail 4.38

Order code KBP300SILV

Cab width 300mm

CHROME CLASSIC •

Chrome wire rail 4.38

Order code

Cab width

KBP300SC

300mm

KBP400SC

400mm

CHROME ARENA • •

Chrome plated rail Anti-slip grey base

Order code

Cab width

KABP300SC

300mm

KABP400SC

400mm

ANTHRACITE STYLE

CHROME STYLE

• •

• •

Powder coated band Anti-slip anthracite base

Chrome plated band Anti-slip grey base

Order code

Cab width

Order code

Cab width

KSABP300A

300mm

KASBP300SC

300mm

KSABP400A

400mm

KASBP400SC

400mm

Online support: support.kesseboehmer.world/en/

4.36


500mm/600mm BASE UNIT PULL-OUT Chrome Arena shown

FEATURES Use: Optimal access to wider base units Cabinet widths: 500mm, 600mm Tray styles: Chrome Arena, Anthracite Style No. of trays: 1x big tray, 2x small trays, 1/2 YouBoXx Set 1 Load capacity: 24KG Height adjustable trays: Yes FOR 300/400MM UNITS SEE PAGE 4.36

Soft-close: Yes Soft-open: No

MINIMUM INTERNAL DIMENSIONS Height 631mm | Depth 480mm | Width 460/560mm FURTHER INFORMATION No additional trays available

Unhanded

CHOOSE FROM 2 TRAY STYLES CHROME ARENA

ANTHRACITE STYLE

• • •

• • •

Chrome plated rail Anti-slip grey base White YouBoXx Set 1

Powder coated band Anti-slip anthracite base Anthracite YouBoXx Set 1

Order code

Cab width

Order code

Cab width

KABP500SC

500mm

KSABP500A

500mm

KABP600SC

600mm

KSABP600A

600mm

4.37

Order online www.pws.co.uk


BASE UNIT PULL-OUT ADD-ONS KONFIGURE FOR 300MM +*ü#1.!5 !//!®$)!.%//01**%*# contemporary and customisable storage system, +û!.%*#+),(!0!2!./0%(%05* ý!4%%(%05Ä&#x2039; *1"01.! %*+'Ä&#x152; +*ü#1.!*+0+*(53+.'/%* drawers (see section 6) but also in Base Unit Pull10/Ä&#x17D;+û!.%*#+0$,.0%(* 00.0%2!/0+.#!Ä&#x2039; 1. +*ü#1.!+'%*/!.0/Ä&#x152; 0$!ü*%/$%*#0+1$ 0+5+1. !//!®$)!./0+.#!/+(10%+*Ä&#x2039;$!5+û!. the perfect place to store those items used on a %(5/%//1$//1#.Ä&#x152;%/1%0/Ä&#x152;0!* +û!!Ä&#x152; or your loose bits and bobs.

MULTIPURPOSE BOX 3

MULTIPURPOSE BOX 4

MULTIPURPOSE BOX 5

Order code

Order code

Order code

TIMB211X236OA

211x236x110mm

TIMBOX211OA

211x236x49mm

TIMB211X117OA

PLASTIC TRAY INSERT

PUSH TO OPEN

â&#x20AC;¢

â&#x20AC;¢

For 300mm Classic trays, grey

211x117.5x90mm

For more information see page 4.07

Order code

Cab width

Order code

KCTRAY300

300mm

KPTOBA / KPTOBB / KPTOBC

Online support: support.kesseboehmer.world/en/

4.38


BASE UNIT PULL-OUT YOUBOXX FOR 300mm Personalise your 300mm base unit pull-out with our YouBoXx sets. Simply order a 300mm frame and choose Set 1 or Set 2. Each YouBoXx set comes with a traverse rail that can simply be hooked on a 300mm base pull-out. YouBoXx sets and trays are fully compatible, ((+3%*#5+10+!รป+.0(!//(5/3,0$!)!03!!* your larder and your base units.

Available in Anthracite

Unhanded

4.39

Order online www.pws.co.uk


YOUR ORDERING OPTIONS

OPTION 1: SET 1 + TRAY •

Perfect for your breakfast items such as cereal, oils and spices

Order code

Description

Set 1 Boxes

KUBOXX1

2 rails, 2x 1L box, 2x 2L box + slotted knife block, 1x 2.1L box, 2 lids

300mm frame

KBP300FO

For base unit pull-out (grey)

Additional tray

See page 4.10

Choice of 5 styles

OPTION 2: SET 2 + TRAY •

Perfect for storing your bottles and tins for cooking and baking

Order code

Description

Set 2 Bottle holder

KUBOXX2

2x 3.2L, 1 dish with bottle railing, 6 dividers, 2 holders

300mm frame

KBP300FO

For base unit pull-out (grey)

Additional tray

See page 4.10

Choice of 5 styles

OPTION 3: SET 1 + 2 •

Perfect for storing your bottles, oils and spices for easy access next to your hob

Order code

Description

Set 1 Boxes

KUBOXX1

2 rails, 2x 1L box, 2x 2L box + slotted knife block, 1x 2.1L box, 2 lids

Set 2 Bottle holder

KUBOXX2

2x 3.2L, 1 dish with bottle railing, 6 dividers, 2 holders

300mm frame

KBP300FO

For base unit pull-out (grey)

Online support: support.kesseboehmer.world/en/

4.40


BASE UNIT PULL-OUT CLEANING UTENSIL BASKET FEATURES Use: The perfect solution for keeping cleaning accessories in one place Cabinet widths: 300mm + width of hinges

MINIMUM INTERNAL DIMENSIONS Height 510mm | Depth 468mm Width 285mm FURTHER INFORMATION Supplied with - 1x system base, 1x portable basket with handle, 1x portable basket without handle, 1x swivel basket, 8x dividers

Tray styles: White plastic with chrome railing Load capacity: 24KG Height adjustable trays: No Soft-close: Yes

Order code

Description

KCUP274C

285mm wide + width of hinges

Ä&#x2026;Ä&#x2020;Ç&#x153;Ƶ 

Ä¡ FEATURES Door widths: 400mm Tray style: Classic No. of trays: 2 Load capacity: 24KG Height adjustable trays: Yes

MINIMUM INTERNAL DIMENSIONS Height 663mm | Depth 515mm Width 107mm FURTHER INFORMATION Shelf dimensions: Height 74mm Depth 467mm Left Width 228mm

hand

Right hand

Soft-close: Yes Left hand shown

Order code

Cab width

KPA300SCL/R

300mm

ADJUSTABLE PULL-OUT TRAYS FEATURES Cabinet widths: 500mm, 600mm

MINIMUM INTERNAL DIMENSIONS Height 80mm | Depth 493mm Width 428mm/530mm

Tray style: Classic No. of trays: Sold in singles Load capacity: 15kg per tray Soft-close: No

Order code

FURTHER INFORMATION Suitable for 15mm and 18mm carcase materials. Each tray is supplied with runners, 2x distance angle brackets and door protection clips in metallic grey

Cab width

KAPB500CH

500mm

KAPB600CH

600mm

PULL-OUT CHROME TRAYS FEATURES Cabinet widths: 500mm, 600mm

MINIMUM INTERNAL DIMENSIONS Height 127mm | Depth 500mm Width 420mm/520mm

Tray style: Classic No. of trays: Sold in singles Load capacity: 30kg per tray Soft-close: Yes Soft-open: No

4.41

Order online www.pws.co.uk

Order code

Cab width

Tray, runner KPD500BFEC Ä&#x2019;.'!0 KPD600BFEC

500mm

Tray with runner

KPD500FEC

500mm

KPD600FEC

600mm

600mm


WALL STORAGE If you’re struggling to reach the highest parts of your wall cabinets, then Kesseböhmer has a number of solutions. Cleverly designed wall storage brings your cupboard contents within easy reach, to make life that little bit easier.

AMAZING OVERVIEW

TRANSFORM NARROW SPACES

EVERYTHING COMES OUT TO YOU

EASY ACCESS

IMPROVED ERGONOMICS


iMOVE PULL DOWN SYSTEM FOR WALL UNITS 600mm anthracite oak double shelf shown

FEATURES Use: Improves the ergonomics of a wall unit by bringing the top shelf into easy reach

No. of trays: 1 shelf (single) or 2 shelves (double) Load capacity: 8kg

Cabinet widths: 500mm, 600mm, 900mm

Soft-close: Yes

Tray styles: Grey or Anthracite

Soft-open: No â&#x20AC;&#x201C; but locks in stop position

POSSIBLE INSTALLATION DIMENSIONS (MM) The iMove can be used with a hinged door or lifter. Please see table below for possible installation measurements if your hinge protrusion is under/over 25mm.

Dimensions (mm)

Hinged door

Hinged door

Hinge protrusion

< 25

> 25

Installation height, hinge

65

65

Installation depth, iMove

57

57

82

Installation height, iMove

25

80

25

Clear inside depth, carcase

270

270

295

Single Tray*

Min cab height

470

580

650

Double Tray*

Min cab height

710

770

710

Dimensions for single and double tray iMove

*Heights vary with the individual installation measurements

4.43

Order online www.pws.co.uk

Lifters


SINGLE SHELF iMOVE

DOUBLE SHELF iMOVE

Order code

Cab width

Colour

Order code

Cab width

Colour

KIMOVE500SA

500mm

anthracite

KIMOVE500DA

500mm

anthracite

KIMOVE600SA

600mm

anthracite

KIMOVE600DA

600mm

anthracite

KIMOVE900SA

900mm

anthracite

KIMOVE500DG

500mm

grey

KIMOVE500SG

500mm

grey

KIMOVE600DG

600mm

grey

KIMOVE600SG

600mm

grey

KIMOVE500DOA

ĆĀĀ))

*0$.%0!Č+'/!Ē'

KIMOVE900SG

900mm

grey

KIMOVE600DOA

ćĀĀ))

*0$.%0!Č+'/!Ē'

PRODUCT DIMENSIONS 500mm: Height 380mm | Depth 267mm | Width 465mm 600mm: Height 380mm | Depth 267mm | Width 565mm 900mm: Height 380mm | Depth 267mm | Width 865mm

PRODUCT DIMENSIONS 500mm: Height 565mm | Depth 267mm | Width 465mm 600mm: Height 565mm | Depth 267mm | Width 565mm

CABINET DIMENSIONS

CABINET DIMENSIONS

FURTHER INFORMATION For perfect movement the product should be propped (4kg)

PLEASE NOTE 270mm internal depth required

Online support: support.kesseboehmer.world/en/

4.44


WALL UNIT STORAGE

NEW

YouK

Our latest wall storage solution YouK, can be used throughout the house. It’s linear appearance provides a contemporary feel to any room. Bespoke solutions can be achieved through YouK’s wide range of sized shelves and thicknesses • •

Available free standing or wall hanging +3 !.+0! ('ü*%/$

STANDARD TECHNICAL REQUIREMENTS

15k

g

Shelf depth 15k

g

15k

g

169 (2 89 )

15k

g

30

Floor installation 1 foot per frame to work around skirting board

4.45

Order online www.pws.co.uk


NEW Each bracket can hold 15kg (shelf included)

15kg

32

0

15kg

32

0

15kg

32

20

0

0

2210

15kg 15kg

20

0 32

0

15kg

1500

15kg

905

905

668 550

30

YouK1

30

YouK2

30

30

YouK3

YouK4

30

YouK5

Order code

Description

YOUK1

YouK shelving midway unit (height 668 - depth 200 mm), 1 piece, single packaging

YOUK2

YouK shelving midway unit (height 905 - depth 200 mm, 1 piece, single packaging

YOUK3

YouK shelving unit (height 550 - depth 320 mm), 1 piece, single packaging

YOUK4

YouK shelving unit (height 905 - depth 320 mm), 1 piece, single packaging

YOUK5

YouK shelving larder unit (height 1500 - depth 320 mm), 1 piece, single packaging

YOUK6

YouK shelving larder unit (height 2210 - depth 320 mm), 1 piece, single packaging

YOUKFOOT

YouK foot 20x20x150mm, deep black

30

YouK6

MODULAR OPEN UNIT Open framed modular units, for use on walls, base or midway systems and suitable to personalise with an 18mm board on the shelves and back panel. (Board not supplied, 558/758 x 278 x 18mm). Supplied in kit format with full installation guidance enclosed with the product. +3 !.+0! ('ü*%/$ċ 4%)1)!%#$0ƫ,%05+"ĆĀ'#ċ

Order code

Description

MSU600MB*

Modular open unit 360mm (H), 600mm (W), 320mm (D)

MSU800MB*

Modular open unit 360mm (H), 800mm (W), 320mm (D)

*discount from Section 1 applies

Online support: support.kesseboehmer.world/en/

4.46


WALL UNIT STORAGE THE CLIMBER

PRODUCT FEATURES • • • • •

Product guarantee: 2 years Cabinet supplied (glass shelves included) Cabinet is 373mm deep Electronic opening Lead time: 6 weeks

PLEASE NOTE Additional lead-time will apply to these items, please enquire at time of ordering.

Climbers are non stock products. For price enquiries and order codes please contact Customer Services North: 01325 505599 South:01325 505588

WALL MOUNTED CLIMBER Available cabinet heights 650mm, 720mm, 780mm, 910mm Available cabinet widths 600mm, 800mm, 900mm, 1000mm Available glass colours Translucent, black, white, translucent black Available cabinet colours $%0!Č/0%*(!///0!!(ü*%/$Č('

TOP MOUNTED CLIMBER Available cabinet heights 1130mm, 1260mm, 1390mm Available cabinet widths 600mm, 800mm, 900mm, 1000mm Available glass colours Translucent, black, white, translucent black Available cabinet colours $%0!Č/0%*(!///0!!(ü*%/$Č('

4.47

Order online www.pws.co.uk

Climbers are equipped with European plugs/ sockets (UK plug/ socket is not supplied)


SPICE RACK FEATURES 4 tier storage in heavy gauge chrome

Order code

Cab width

KSR30C

300mm

KSR50C

500mm

FURTHER INFORMATION Height 425mm | Depth 66mm | Width 202mm .!3ü4!/0+0$!'+"0$! ++.0āĊā))!*0.!/ Height 395mm | Depth 66mm | Width 436mm .!3ü4!/0+0$!'+"0$! ++.0ąĂć))!*0.!/

LINERO TOWEL RAIL FEATURES 1,,(%! 3%0$*!!//.5ü4%*#.'!0/* !*  caps Order code

Description

KLTRSS

Linero towel rail, stainless steel

DIMENSIONS 450mm x 16mmØ %(,.+&!0%+*ĆĀ))

WALL TANDEM FEATURES Movement: When the door is opened, the rear shelves are brought forward via the clip-on follower mechanism Cabinet width: 300mm Tray styles: Classic No. of trays: 3 internal trays, 3 door trays Soft-close: Yes Soft-open: No

Order code

Description

KTPW300C

Wall pull-out 300mm

MINIMUM INTERNAL DIMENSIONS Height 684mm | Depth 280mm | Width 262mm FURTHER INFORMATION $!+00+)$%*#!)1/0!ü00! āĆĀ))".+)0$!/!+"0$! ý++.ċǫ'+. %/*+0/1,,(%!

Online support: support.kesseboehmer.world/en/

4.48


WALL UNIT STORAGE 150MM WALL PULL-OUT FEATURES Use: Can also be used in a kitchen island Cabinet width: 150mm Tray styles: Classic No. of trays: 2 Load capacity: 6kg per tray Soft-close: Yes Soft-open: No

Order code

Description

KWP150C

Wall pull-out, 150mm

MINIMUM INTERNAL DIMENSIONS Height 470mm | Depth 270mm | Width 112mm

VERTICAL WINE RACK • • •

Heavy guage chrome wire For base or wall units Holds 5 or 15 standard bottles

Order code

Cab dimension

KWR150C

5 tier wine rack, 150mm wide

KWR5TC

5 tier wine rack, 296mm wide

MINIMUM INTERNAL DIMENSIONS Height 616mm | Depth 195mm | Width 110mm Height 624mm | Depth 184mm | Width 260mm

4.49

Order online www.pws.co.uk


LIFTING SYSTEMS The FREE lift family delivers silky smooth opening and closing action for 3((1*%0/3%0$3% !.*#!+"ý,/%6!/ and weights. The easy and harmonious movements are noiseless and !û+.0(!//ġ3$%$ /1,0+ /0.%'%*#1/!.!*!ü0/ċ


LIFTING SYSTEMS Stanhope

Stanhope

Broadoak

Ellerton

Fitzroy

Mornington

Porter

Remo

Unity

Ingoe/Meldon/ Langley/Bolam

Acomb/Henshaw/ $%0ü!(

Front height

Code

Dimensions

283

285

283x497mm

1.8

1.7

-

1.8

2.1

1.9

2.5

1.9

2.0

2.5

2.0

2.0

1.8

283

286

283x597mm

2.1

2.2

-

2.1

2.5

2.3

3.0

2.2

2.4

3.0

2.4

2.4

2.1

283

288

283x797mm

2.7

2.7

-

2.8

3.3

3.0

3.9

2.9

3.3

4.0

3.3

3.3

2.8

283

289

283x897mm

3.0

3.2

-

3.2

3.7

3.4

4.4

3.0

3.7

4.4

3.7

3.7

3.2

283

280

283x997mm

3.3

3.6

-

3.5

4.1

3.8

4.9

3.4

4.1

4.9

4.1

4.1

3.5

355

355

355x497mm

2.4

2.1

2.5

2.2

2.5

2.3

3.1

2.2

2.5

3.1

2.5

2.5

2.2

355

356

355x597mm

2.8

2.7

3.1

2.7

3.0

2.8

3.7

2.6

3.1

3.8

3.1

3.1

2.7

355

358

355x797mm

3.5

3.4

4.1

3.5

4.0

3.7

5.0

3.3

4.1

5.1

4.1

4.1

3.5

355

359

355x897mm

3.9

3.9

4.6

4.0

4.5

4.1

5.6

3.8

4.6

5.6

4.6

4.6

4.0

355

350

355x997mm

4.3

4.2

5.1

4.4

5.0

4.6

6.2

3.9

5.1

6.3

5.1

5.1

4.4

355

350FD

355x597mm

-

-

N/A

N/A

7.2

N/A

DOOR WEIGHTS IN KILOGRAMS

PLEASE NOTE

Milbourne

%$ü!(

Hunton

Belsay

You will need to add 2x the weight of the handle used to that of your door See Tradezone for handle weights

-

450

456

450x597mm

3.2

3.0

-

3.4

3.8

3.4

4.0

2.8

3.9

4.8

3.9

3.9

490

496

490x597mm

3.3

3.4

4.2

3.7

4.1

3.7

4.4

3.0

4.2

5.2

4.2

4.2

3.7

570

575

570x497mm

3.4

3.2

-

3.5

4.0

3.6

4.2

2.9

4.1

5.1

4.1

4.1

3.5

570

576

570x597mm

3.9

4.0

-

4.3

4.7

4.3

5.1

3.4

4.9

6.1

4.9

4.9

4.3

715

716

715x597mm

4.9

4.9

6.2

5.3

5.8

5.3

6.4

4.0

6.4

7.9

6.4

6.4

5.3

IN-FRAME INSTRUCTIONS

3.4

18mm

18mm filler panel

36mm

FURTHER INFORMATION FREEMINI, FREESWING AND FREESLIDE CAN ALSO BE USED WITH IN-FRAME DOORS. PLEASE NOTE: you will need to know the height and weight of the door and add the weight of the handle used. You will also need to use a packer to build up to the frame of the door.

4.51

Order online www.pws.co.uk


FREEmini

IDEAL FOR KITCHENS, BATHROOMS AND LIVING AREAS

• • •

Small door compact lifter Multi-position stop Soft close

Order code

Description

FREE/MINI/A

Lifting mechanism

FREE/MINI/B

Lifting mechanism

FREE/MINI/C

Lifting mechanism

* Refer to table below for A, B and C weights FURTHER INFORMATION Height 167mm | Depth 107mm | Width 34mm Cabinet Height 200 to 450mm Cabinet Width up to 1200mm PLEASE NOTE YOU WILL NEED TO ADD 2X THE WEIGHT OF THE HANDLE USED TO THE WEIGHT OF YOUR DOOR. See the handle section for handle weights

Weights (Kg) Free Mini - A

Free Mini - B

Free Mini - C

Min

Max

Min

Max

Min

Max

200

1.7

4.6

3.7

7.9

6.8

14.7

225

1.5

4.1

3.1

7.1

6

13.1

250

1.3

3.8

2.9

6.4

5.4

11.8

275

1.2

3.3

2.5

5.7

4.8

10.6

300

1.1

3.1

2.4

5.1

4.4

9.6

325

1

2.8

2.1

4.6

4

8.8

350

0.9

2.6

2

4.2

3.7

8.1

375

0.9

2.3

1.9

3.8

3.5

7.5

400

0.8

2.1

1.7

3.6

3.2

7

425

0.7

1.9

1.5

3.4

2.9

6.5

450

0.6

1.7

1.4

3.2

2.7

6.1

Front height (mm)

FOR PWS DOOR WEIGHTS SEE PAGE

4.51 LIFT DOORS FROM 0.7 TO 14.7KG

Online support: support.kesseboehmer.world/en/

4.52


LIFTING SYSTEMS

NEW

FREEspace IDEAL FOR KITCHENS, BATHROOMS AND LIVING AREAS

FOR PWS DOOR WEIGHTS

ORDERING GUIDE Step 1 – Select your lifter type according to your door height and weight Step 2 – Decide whether you would like a handle door or push to open mechanism Step 3 – Select order code depending on lifter type you require

• • • • • •

FREEspace can lift all of our door weights Radically reduced product space Smallest mounting depth Only 3 screws for easy and quick installation Integrated opening angle limiter Over time FREEspace will replace FREEmini Type B (pageType 4.52) C Type D Type E Type F

SEE PAGE

4.51

APPLICATION WITH HANDLE • • • •

ā4ü00%*#(!"0 ā4ü00%*#.%#$0 with Kesseböhmer branding 4 x front screw with clip

Type

Colour

Order code

B

Grey/nickel

SPACE1

C

Grey/nickel

SPACE2

Door Height mm

Type B

Type C

Type D

Type E

Type F

D

Grey/nickel

SPACE3

225

2.3 - 4.3

3.8 - 7.1

6.4 - 9.3

9.2 - 13.4

13.4 - 19.1

E

Grey/nickel

SPACE4

250

1.9 - 3.9

3.4 - 6.4

5.8 - 9.1

8.3 - 12.6

12.1 - 17.2

F

Grey/nickel

SPACE5

275

1.9 - 3.5

3.1 - 5.8

5.3 - 8.2

7.5 - 12

11.0 - 15.6

300

1.7 - 3.2

2.8 - 5.3

4.8 - 7.5

6.9 - 11

10.1 - 14.3

325

1.6 - 3.0

2.6 - 4.9

4.4 - 7.0

6.4 - 10.2

9.3 - 13.2

350

1.5 - 2.8

2.4 - 4.6

4.1 - 6.5

5.9 - 9.5

8.6 - 12.3

375

1.3 - 2.6

2.2 - 4.3

3.8 - 6.0

5.5 - 8.8

8.1 - 11.4

400

1.2 - 2.4

2.1 - 4.0

3.6 - 5.6

5.2 - 8.3

7.6 - 10.7

425

1.1 - 2.3

2.0 - 3.8

3.4 - 5.3

4.9 - 7.8

7.1 - 10.1

450

1.1 - 2.0

1.9 - 3.5

3.2 - 5.0

4.6 - 7.3

6.7 - 9.5

475

1.0 - 2.0

1.8 - 3.4

3.0 - 4.7

4.3 - 7.0

6.4 - 9.0

500

0.9 - 1.9

1.7 - 3.2

2.9 - 4.5

4.1 - 6.6

6.0 - 8.6

525

0.9 - 1.8

1.6 - 3.0

2.7 - 4.3

3.9 - 6.3

5.7 - 8.2

550

0.8 - 1.7

1.5 - 2.9

2.6 - 4.1

3.7 - 6.0

5.5 - 7.8

Type

Colour

Order code

575

0.8 - 1.7

1.4 - 2.8

2.5 - 3.9

3.6 - 5.7

5.2 - 7.4

B

Grey/nickel

SPACEPTO1

600

0.8 - 1.6

1.4 - 2.7

2.4 - 3.7

3.4 - 5.5

5.0 - 7.1

C

Grey/nickel

SPACEPTO2

625

0.7 - 1.5

1.3 - 2.5

2.3 - 3.6

3.3 - 5.3

4.8 - 6.8

D

Grey/nickel

SPACEPTO3

650

0.7 - 1.5

1.3 - 2.4

2.2 - 3.5

3.2 - 5.1

4.6 - 6.6

E

Grey/nickel

SPACEPTO4

4.53

Weights (Kg)

Order online www.pws.co.uk

APPLICATION WITH PUSH TO OPEN • • • • •

ā4ü00%*#(!"0 ā4ü00%*#.%#$0 with Kesseböhmer branding 1 x Push to open 4 x front screw with clip


A STABILISATION BAR IS REQUIRED FOR EACH MECHANISM ORDER SEPARATELY BELOW

FREEswing

• • • • •

Up and over lifter Medium to large doors ++(ġ(!// &1/0)!*0 Easy installation Integrated damping system PWS Doors

Door Heights

Weights

PWS Order Codes

Acomb, Belsay, Bolam, Broadoak, Hunton, Fitzroy, Henshaw, *#+!Č *#(!5Č %$ü!( Č !( +*Č %(+1.*!Č +.*%*#0+*Č+.0!.Č !)+Č*%05Č$%0ü!(

450mm high 450x597mm

3.2 - 6.1 kg

SWING3

Acomb, Belsay, Bolam, Broadoak, Ellerton, Fitzroy, Henshaw, *#+!Č *#(!5Č %$ü!( Č !( +*Č %(+1.*!Č +.*%*#0+*Č+.0!.Č !)+Č*%05Č$%0ü!(

500mm high 490x597mm

3.2 - 6.1 kg

SWING3

Acomb, Belsay, Bolam, Broadoak, Hunton, Fitzroy, Henshaw, *#+!Č *#(!5Č %$ü!( Č !( +*Č %(+1.*!Č +.*%*#0+*Č+.0!.Č !)+Č*%05Č$%0ü!(

570mm high 570x497mm

2.5 - 5 kg

SWING1

Ƶ+)Čǫ!(/5Čǫ.+ +'Č1*0+*Č%06.+5Č!*/$3Č %$ü!( Č +.*%*#0+*Č+.0!.Č$%0ü!(

570mm high 570x597mm

2.5 - 5 kg

SWING1

Bolam, Ingoe, Langley, Meldon, Milbourne, Remo, Unity

570mm high 570x597mm

5 - 10 kg

SWING4

Acomb, Belsay, Broadoak, Hunton, Ellerton, Fitzroy, Henshaw,

%$ü!( Č +.*%*#0+*Č+.0!.Č*%05Č$%0ü!(

715mm high 715x597mm

3.2 - 6.5 kg

SWING2

Bolam, Ingoe, Langley, Meldon, Milbourne, Remo, Tomba

715mm high 715x597mm

6.5 - 11.30 kg

SWING5

STABILISATION BAR FOR FREEswing AND FREEslide Order code

Description

FREEBAR600

For 600mm unit

FREEBAR800

For 800mm unit

FREEBAR900

For 900mm unit

FREEBAR1000

For 1000mm unit

Online support: support.kesseboehmer.world/en/

4.54


LIFTING SYSTEMS FREEfold

• • • • •

Bi-fold lifter Ideal for tall units Integrated damping system Easy installation Door connecting hinges are supplied PWS doors

Door heights 2x355mm

Weights

PWS order codes

Ƶ+)Čǫ.+ +'Č%06.+5Č!*/$3Č %$ü!( Č +.*%*#0+*Č$%0ü!( 

2x355x497mm

3.6 - 6.1 kg

FOLD1

Belsay, Bolam, Ellerton, Hunton, Ingoe, Langley, Meldon, Milbourne, Porter, Remo, Unity

2x355x497mm

5.2 - 9.9 kg

FOLD2

2x355x597mm

3.6 - 6.1 kg

FOLD1

Acomb, Belsay, Bolam, Broadoak, Ellerton, Fitzroy, Henshaw, Ingoe,

*#(!5Č %$ü!( Č !( +*Č %(+1.*!Č +.*%*#0+*Č+.0!.Č!)+Č *%05Č$%0ü!(

2x355x597mm

5.2 - 9.9 kg

FOLD2

Ƶ+)Čǫ!(/5Čǫ.+ +'Č%06.+5Č!*/$3Č %$ü!( Č +.*%*#0+*Č $%0ü!(

2x355x797mm

5.2 - 9.9 kg

FOLD2

Bolam, Ellerton, Hunton, Ingoe, Langley, Meldon, Milbourne, Porter, Remo, Unity

2x355x797mm

7.6 - 14.5 kg

FOLD3

Belsay, Broadoak, Mornington

2x355x897mm

5.2 - 9.9 kg

FOLD2

Ƶ+)Čǫ+()Č((!.0+*Č%06.+5Č!*/$3Č *#+!Č *#(!5Č %$ü!( Č !( +*Č %(+1.*!Č+.0!.Č!)+Č*%05Č$%0ü!(

2x355x897mm

7.6 - 14.5kg

FOLD3

Broadoak, Mornington

2x355x997mm

5.2 - 9.9 kg

FOLD2

Acomb, Bolam, Belsay, Ellerton, Fitzroy, Henshaw, Ingoe, Langley,

%$ü!( Č !( +*Č %(+1.*!Č+.0!.Č!)+Č*%05Č$%0ü!(

2x355x997mm

7.6 - 14.5 kg

FOLD3

FREEfold ELECTRONIC TOUCH OPENING

JUST PUSH THE DOOR

FOR SMOOTH AUTOMATIC OPENING

Order code

Description

EFOLD

Electronic touch opening

4.55

Order online www.pws.co.uk

• • •

ƫ*!.!0.+ġü00! Safety stop Operating voltage 24V


FREEslide

DUO

FOR PWS DOOR WEIGHTS SEE PAGE

4.51

• • • • •

Can be used as a Microwave lifter Door will stop securely in any position Can lift doors 2.60 - 5.50 kg Useable cabinet heights: 430 - 600mm Lifts the door 470mm

• • • •

Flap stay Slide down gently /5(%,ġ+*ü00%*# Non-handed

Order code

Description

Order code

Description

SLIDE

Out and up lifter

FSU

*%2!./(ý,/05

FURTHER INFORMATION Freeslide requires a stabilisation bar for each mechanism Order separately FROM PAGE 4.54

FREElight • • • •

Left or right side Easy installation One lifter required Kitchens, bathrooms and living areas

Order code

Description

FREELIGHT

Freelight B

GREAT VALUE AT AN ATTRACTIVE PRICE 90° Opening Angle

110° Opening Angle

Weights (kg)

Weights (kg)

Front Height (mm)

Min

Max

Min

Max

275

3,5

6,0

2,6

4,3

300

3,5

6,0

2,6

4,3

350

3,5

6,0

2,6

4,3

400

3,5

6,0

2,6

4,3

450

3,5

6,0

2,6

4,3

500

3,5

6,0

2,6

4,3

550

3,5

6,0

2,6

4,3

600

3,5

6,0

2,6

4,3

PLEASE NOTE: you can use 2 mechanisms to double the weight capacity

Online support: support.kesseboehmer.world/en/

4.56


TOP FLAP STAYS AND LIFTERS TOP FLAP HINGE

• • •

Steel nickel plated ,.%*#/$2! &1/0(!0!*/%+* Supplied in pairs

Order code

Spring mechanism

KFH4NP

3+ &1/0(!/,.%*#/

MICROWAVE DOOR HINGE KIT • • •

Opens upwards 2 gas operated springs Max door weight 4kg

FURTHER INFORMATION Useable cabinet width œ *0!.*(3% 0$ĢĂ4ü00%*#3% 0$Ĩǫĩ Useable cabinet height œ *0!.*($!%#$0Ģü00%*#$!%#$0Ĩǫĩ PLEASE NOTE When applying the hinge to a wall cabinet, note that the internal depth required is 220mm minimum. Standard cabinet hanging brackets may be 1*/1%0(!ċ$!*0$! ++.%/+,!*! 0$!ü*%/$%*#$!%#$0 is 370mm above its original position.

Order code

Spring mechanism

KMHS

Microwave door hinge, 2 gas springs 450-600mm units

KMHPISTON

Microwave Hinge - Piston

Dimensions for installation, inside the cabinet KMHS

4.57

,!.!-1%.!)!*0"+.ü00%*#

Width

Min depth

Min height

Width (BW)

Height (BH)

411-570mm

220mm

320mm

35mm

40mm

Order online www.pws.co.uk


WORKTOP EXTENDERS MIXER LIFT (WORKTOP EXTENDER)

A

FEATURES

max. 505

Use: A versatile system to support appliances on a horizontal surface Internal carcase width: 410-570mm Load capacity: 12kg 465mm

FURTHER INFORMATION Useable height 290mm Order code

Description

KMLW

Mixer lift

PLEASE NOTE Timber top not supplied

PULL-OUT TABLE • Extra working space • 40!* /0+ĉāĀ))ý1/$ • Minimum cab depth 500mm FEATURES Movement: Table extends to 810mm and the /!0%+*//%0ý1/$ Load capacity: 30kg Minimum cabinet depth: 500mm Cabinet width: 600mm when ordering TTFTM Possible cabinet widths: 450-900mm (KTFTM) Table top TTFTM Dimensions: 545mm wide | 844mm long

FURTHER INFORMATION • Grey surface with PVC edges • Other materials and various widths can be used for the table top • Surface thickness 15-19mm

Order code

Description

KTFTM TTFTM

Mechanism for pull-out table Table top, 600mm unit, grey

Online support: support.kesseboehmer.world/en/

4.58


DRAWER ORGANISER

NEW

SpaceFlexx For those who are forever losing their tupperware lids. .#*%/!01,,!.3.!3%0$+1.(0!/0ý!4%(!/0+.#!/+(10%+*Ä¡,!(!44Ä&#x2039;

Available to use in any drawer from 600mm width

A drawer without the use of SpaceFlexx

Order code

Description

SPACEFLEXX

SpaceFlexx, kitchen utensil organiser (drawer width from 600mm)

4.59

Order online www.pws.co.uk

A drawer with the use of SpaceFlexx

MINIMUM INTERNAL DIMENSIONS Height 130mm | Depth 422 | Width 472/520mm


PANTRY ACCESSORIES BUTLER’S PANTRY DOOR RACK Door rack available in natural or washed oak ü*%/$ċThe rack has 5 shelves each with a wooden rail to prevent items falling from the shelf when the pantry door is opened. 353mm

DIMENSIONS We recommend using 4 hinges per door. Sold singularly.

1050mm

106mm

Order code

Description

DRBP

Butler’s pantry rack, natural oak, 1050mm (H) x 353mm (W) x 106mm (D)

DRBP/W

Butler’s pantry rack, washed oak, 1050mm (H) x 353mm (W) x 106mm (D)

PANTRY TRAIN Pantry train designed for use inside a 1000mm pantry and when moved across the cabinet it allows easy access to the rear of the pantry.

430mm

1166mm

138mm

Order code

Description

SHSLT1000

In-frame Shaker sliding train for 1000mm cabinet, oak

*discount from Section 1 applies

Online support: support.kesseboehmer.world/en/

4.60


HELPING YOU SELL MORE END CONSUMER STORAGE MAGAZINE Our new Beautiful On The Inside consumer magazine showcases the very best internal solutions to your customers. Full of handy hints and tips, this easy to read magazine shows +*/1)!./0$!.!(!*!ü0/+"%*2!/0%*#%*/0+.#! solutions when designing their kitchen.

Order code STORAGEBRO20

KONFIGURE BY KESSEBÖHMER POINT OF SALE These printed drawer inserts allow consumers to 2%/1(%/!$+3 +*ü#1.!3+1( (++'* 3+.'%* 0$!%.'%0$!*ċ ((1/0.0%*#ćĀĀČĉĀĀČĊĀĀĒāĀĀĀ)) /$((+3 .3!./!0/Č0$!5ü0ąĆĀ)) !!,ǫ(1) Legrabox and Tandembox drawers. Order code

Description

INSERTDS600

600mm wide drawer

INSERTDS800

800mm wide drawer

INSERTDS900

900mm wide drawer

INSERTDS1000

1000mm wide drawer

“OPEN ME” BEAUTIFUL ON THE INSIDE SHOWROOM STICKERS Available in black and white designs to complement your displays, these stickers are a /10(!10!û!0%2!35+"$%#$(%#$0%*#3$!.! internals are situated in your showroom. 6 x white and 6 x black stickers with 1 x USB pen Order code KESSESTICKERS

PROMOTIONAL PACK Want to order them all? Order our complete Kesseböhmer storage promotional pack that includes the following: 20 x Beautiful On The Inside end consumer storage magazines Ć4 !//!®$)!./,!%ü0%+** ,.%!#1% !/ Ć4 +*ü#1.!,.%*0! /$((+3 .3!.%*/!.0/ ġćĀĀČĉĀĀČĊĀĀĒāĀĀĀ))3% ! 1 x pack of showroom stickers 1 x Kesseböhmer USB stick featuring consumer storage videos for your showroom Order code STORAGEPOS

4.61

Order online www.pws.co.uk


PROMOTIONAL DISPLAY RAILS • • • •

û!0%2! %/,(5+" ++./),(!/ ƫ$.+)!ü*%/$! .%(/ Packs of 10 Left and right hand versions

Order code

Description

KDRLH

Left hand, pack of 10

KDRRH

Right hand, pack of 10

KESSEBÖHMER STORAGE TINS

PROP

SET 1

YOUR DISPLAYS

Order code

Description

KMTIN/24

A box contains 24 tins in two designs

SET 2

Order code

Description

KMTIN/12

A box contains 12 tins in two designs

Kesseböhmer Support Homepage • Fitting videos/instructions • Technical data sheets • Technical drawings

https://support.kesseboehmer.world/en/

How to maintain our chrome products: • Never leave cleaning products to work for

longer than necessary. • /!/+"0(+0$0+3%,!+û .+,/+"30!.

after each use. • Remove any remnants of cleaning

products quickly to avoid any damage.

Online support: support.kesseboehmer.world/en/

4.62


5.2

Order Online www.pws.co.uk


5 BLUM

LEGRABOX DRAWERS

SPACETOWER

Component Drawer Kits

03

Backs and Bases

04

Component LEGRABOX SPACETOWER

27

Pre-assembled LEGRABOX SPACETOWER

28

Component TANDEMBOX SPACETOWER

29

Pre-assembled TANDEMBOX SPACETOWER

30

SERVO-DRIVE FLEX

31

RUNNERS FOR DOVETAIL

32

LEGRABOX ACCESSORIES

Movento

33

Ambia Line

15

Tandem

34

Gollinucci Drawer Inserts

16

Drawer Liners

16

HINGES

35

LIFT SYSTEM

54

JIGS AND TEMPLATES

55

EASY ASSEMBLY APP

61

Component TIP-ON BLUMOTION

05

Component Internal Front

06

Component Drawer Packs

07

Pre-assembled Drawer Packs

09

Pre-assembled Drawers

11

Pre-assembled Internal Drawers

12

Pre-assembled TIP-ON BLUMOTION

13

LEGRABOX IN-FRAME Backs and Bases

14

Pre-assembled Drawers

14

TANDEMBOX DRAWERS Components Drawer Kits

17

Backs and Bases

18

Component TIP-ON BLUMOTION

19

Component Internal Front

20

Component Drawer Packs

21

Pre-assembled Drawer Packs

23

Pre-assembled Drawers

25

Pre-assembled Internal Drawers

26

For Technical support please call the Blum Technical Support Hotline on 0800 230 0898

Technical Support Hotline: 0800 230 0898

5.3


5.01

Order Online www.pws.co.uk


DRAWER BOXES YOUR CHOICE OF DRAWER BOXES: LEGRABOX High load bearing capacity

Ƶǫ%/ !ü*! 5/0.%#$0(%*!/0$0 .!0!*!(!#*0(++'Ä&#x2039; 0(/+!*!ü0/from a high load capacity of 40kg or 70kg.

TANDEMBOX ANTARO Clear, rectangular design TANDEMBOX antaro is characterised by its clear design and rectangular gallery. Load bearing capacity of 30kg, 50kg or 65kg.

MOTION TECHNOLOGY

Legrabox and Tandembox can be combined with: Ç«(1)Ä&#x161;/+4/5/0!)/+û!.3% !.*#!+" ,+//%%(%0%!/* )!!0 %û!.!*0 !/%#* !)* / placed on furniture. They boast a feather-light glide, enhanced ease of use, top quality and beautiful design. â&#x20AC;¢

BLUMOTION (SOFT CLOSE) %(!*0* !û+.0(!//(+/%*#0%+*

â&#x20AC;¢

TIP-ON BLUMOTION (PUSH TO OPEN) Mechanical opening support, combined with BLUMOTION

â&#x20AC;¢

SERVO-DRIVE Electronic opening system

LEGRABOX | MOVENTO BLUMOTION S Most Legrabox and Movento runners have now been replaced by the new BLUMOTION S runner which can be used for standard BLUMOTION drawers and TIP-ON BLUMOTION.

Technical Support Hotline: 0800 230 0898

5.02


COMPONENT DRAWER KITS LEGRABOX

N HEIGHT 66.5mm

M HEIGHT 90.5mm

C HEIGHT 177mm

F HEIGHT 241mm

66.5mm

90.5mm

177mm

241mm

N

M C F

SIDE STABILISATION • Additional stabilisation for extra wide high fronted pull-outs • Recommended cabinet width: 900-1400mm

Order code

Depth

ZS7M650LU

450-650mm

SINK DRAWER C Height • BLUMOTION • Orion grey Order code

Drawer

Depth

Weight

LBC/450/40OGSK

Sink

450mm

40kg

All kits comprise of a pair of runners, a pair of sides, back and front brackets. Bases and backs not included.

5.03

Order Online www.pws.co.uk


PREASSEMBLED DRAWERS & PACKS PAGE 5.09

DRAWER KITS LEGRABOX LAY ON (ORION GREY)

Guideline weight capacity of runner system 40kg - up to 600mm width 70kg - up to 1400mm width

COMPONENTS

SINGLE BOX

40kg and 70kg kits comprise of a pair of BLUMOTION runners, a pair of ORION GREY sides, front and back brackets

1 component kit packed in 1 box (comprised of a pair of BLUMOTION runners, a pair of runners, a pair of ORION GREY sides, front and back brackets).

N Height

M Height

C Height

F Height

Order Code

Order Code

Order Code

Order Code

LBC/450/40OG

LBF/450/40OG

Depth

Carrying Capacity

Components/ Single Box

270

40kg

Components

LBM/270/40OG

400

40kg

Components

LBM/400/40OG

Components

NEW

LBN/450/40OG

LBM/450/40OG

40kg Single Box

NEW SLBM/450/40OG

NEW SLBC/450/40OG

450 Components

NEW LBM/450/70OG

NEW LBC/450/70OG

Single Box

NEW SLBM/450/70OG

NEW SLBC/450/70OG

40kg

Components

LBM/500/40OG

LBC/500/40OG

70kg

Components

NEW LBM/500/70OG

NEW LBC/500/70OG

70kg

500 LBF/500/70OG

Available in multiples of 12 only.

BACKS AND BASES FOR 450MM DEPTH STEEL BACKS

MFC BASES For use with steel back

M Height

C Height

Cabinet width

Order code

Order code

300mm

ZB7M232S.6

ZB7C232S.6

400mm

ZB7M332S.6

ZB7C332S.6

450mm

ZB7M382S.6

ZB7C382S.6

500mm

ZB7M432S.6

ZB7C432S.6

600mm

ZB7M532S.6

ZB7C532S.6

800mm

ZB7M732S.6

ZB7C732S.6

900mm

ZB7M832S.6

ZB7C832S.6

1000mm

ZB7M932S.6

ZB7C932S.6

1200mm

ZB7M1132.6

ZB7C1132.6

MFC BACKS AND BASES

Cabinet width

Order code

300mm

LBS450/300SG

400mm

LBS450/400SG

450mm

LBS450/450SG

500mm

LBS450/500SG

600mm

LBS450/600SG

800mm

LBS450/800SG

900mm

LBS450/900SG

1000mm

LBS450/1000SG

NEW 1200mm

LBS450/1200SG

Back & Base dimensions consider 18mm End Panels on Cabinets

M Height

C Height

Cabinet width

Order code

Order code

300mm

LBBBM450/300OG

LBBBC450/300OG

400mm

LBBBM450/400OG

LBBBC450/400OG

450mm

LBBBM450/450OG

LBBBC450/450OG

500mm

LBBBM450/500OG

LBBBC450/500OG

600mm

LBBBM450/600OG

LBBBC450/600OG

800mm

LBBBM450/800OG

LBBBC450/800OG

900mm

LBBBM450/900OG

LBBBC450/900OG

1000mm

LBBBM450/1000OG

LBBBC450/1000OG

NEW 1200mm

LBBBM450/1200OG

LBBBC450/1200OG

Technical Support Hotline: 0800 230 0898

5.04


COMPONENT TIP-ON BLUMOTION LEGRABOX

LAY ON DRAWER (ORION GREY) Tip-On BLUMOTION combines the advantages of the Tip-On mechanical opening support system with the .!(%(!Ç«    ),!*%*#Ä&#x152;"+./%(!*0* !û+.0(!//(+/%*#Ä&#x2039;

All kits comprise of a pair of BLUMOTION runners, a pair of ORION GREY sides, back and front brackets and Tip-On mechanism. Bases and backs not included.

N Height

Guideline maximum weight capacity of runner system 40kg - up to 600mm width 70kg - up to 1400mm width

M Height

Order code

Drawer

Depth

Weight

Order code

Drawer

Depth

Weight

LBTN/450/40OG

Lay on

450mm

40kg

LBTM/270/40OG

Lay on

270mm

40kg

LBTM/400/40OG

Lay on

400mm

40kg

LBTM/450/40OG

Lay on

450mm

40kg

LBTM/500/40OG

Lay on

500mm

40kg

NEW LBTM/450/70OG

Lay on

450mm

70kg

NEW LBTM/500/70OG

Lay on

500mm

70kg

C Height

F Height

Order code

Drawer

Depth

Weight

Order code

Drawer

Depth

Weight

LBTC/450/40OG

Lay on

450mm

40kg

LBTF/450/40OG

Lay on

450mm

40kg

LBTC/500/40OG

Lay on

500mm

40kg

LBTF/500/70OG

Lay on

500mm

70kg

NEW LBTC/450/70OG

Lay on

450mm

70kg

NEW LBTC/500/70OG

Lay on

500mm

70kg

ACCESSORIES Order code Description

5.05

Order Online www.pws.co.uk

T60.1125W

TIP-ON BLUMOTION synchronisation linkage for cutting to size

T60.000D

TIP-ON BLUMOTION synchronisation adapter for linkage (2 per kit)

65.5631

Front gap template for dr3!.,.+ü(!/

T60.300D

TIP-ON BLUMOTION synchronisation linkage 300mm wide units


COMPONENT INTERNAL FRONT LEGRABOX

BACKS & BASES PAGE 5.04

LEGRABOX LATCH For Internal Drawers

INTERNAL DRAWER FRONT M Height

• Orion grey • Fascia only Order code

Drawer

Cabinet width

Order code

Description

ZW7.250M

Inner drawer front

300mm

ZI7.0M07MI/MG

LEGRABOX latch for inner drawers

ZW7.350M

Inner drawer front

400mm

ZW7.400M

Inner drawer front

450mm

ZW7.450M

Inner drawer front

500mm

ZW7.550M

Inner drawer front

600mm

ZW7.750M

Inner drawer front

800mm

ZW7.850M

Inner drawer front

900mm

ZW7.950M

Inner drawer front

1000mm

ZW7.1150M

Inner drawer front

1200mm

INTERNAL DRAWER FRONT WITH GALLERY C Height

INTERNAL DRAWER FRONT WITH GLASS FRONTS C Height

• Orion grey

• Orion grey

• Fascia only

• Fascia only

Order code

Drawer

Cabinet width

Order code

Drawer

Cabinet width

ZW7.250CR

Inner pull out front, with gallery

300mm

LBC/IDG600

Inner drawer front

600mm

ZW7.350CR

Inner pull out front, with gallery

400mm

LBC/IDG800

Inner drawer front

800mm

ZW7.400CR

Inner pull out front, with gallery

450mm

LBC/IDG900

Inner drawer front

900mm

ZW7.450CR

Inner pull out front, with gallery

500mm

ZW7.550CR

Inner pull out front, with gallery

600mm

ZW7.750CR

Inner pull out front, with gallery

800mm

ZW7.850CR

Inner pull out front, with gallery

900mm

ZW7.950CR

Inner pull out front, with gallery

1000mm

ZW7.1150CR

Inner pull out front, with gallery

1200mm

Technical Support Hotline: 0800 230 0898

5.06


CABINETS & DRAWER FRONTS NOT INCLUDED

COMPONENT DRAWER PACKS LEGRABOX WITH BACKS AND BASES - 450MM DEEP DRAWERS

Includes single box kits, not single components. If single components are required remove the “S” e.g. LBM/450/ 40OG instead of SLBM/450/40OG

+$!(,5+1/,!%"5ǫ(1))+.!!þ%!*0(5,(!/!/!!!(+3(%/0+",.+ 10 codes that make up drawer packs in component form (MFC Back and Base). 2 X M HEIGHT AND 1 X C HEIGHT

1 X M HEIGHT AND 2 X C HEIGHT

2 X C HEIGHT

139

175

355 175

283

355

• 2x cutlery (M Height) drawer • 1x pan (C Height) drawer • Includes soft-close BLUMOTION runners, ".+*0ü4%*#.'!0/Č/.!3/"+..1**!./ and drawer fronts • Includes backs and bases • Suggested drawer front heights: 2x 175mm & 1x 355mm Width

355

283

• 1x cutlery (M Height) drawer • 2x pan (C Height) drawer • Includes soft-close BLUMOTION runners, ".+*0ü4%*#.'!0/Č/.!3/"+..1**!./ and drawer fronts • Includes backs and bases • Suggested drawer front heights: 1x 139mm & 2x 283mm

Order Code

• 2x pan (C Height) drawer • Includes soft-close BLUMOTION runners, ".+*0ü4%*#.'!0/Č/.!3/"+..1**!./ and door fronts • Includes backs and bases • Suggested drawer front heights: 2x 355mm

Order Code

Order Code

300mm 2X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/300OG LBBBC450/300OG

1X 2X 1X 2X

SLBM/450/40OG SLBC/450/40OG LBBBM450/300OG LBBBC450/300OG

2X 2X

SLBC/450/40OG LBBBC450/300OG

2X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/400OG LBBBC450/400OG

1X 2X 1X 2X

SLBM/450/40OG SLBC/450/40OG LBBBM450/400OG LBBBC450/400OG

2X 2X

SLBC/450/40OG LBBBC450/400OG

2X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/450OG LBBBC450/450OG

1X 2X 1X 2X

SLBM/450/40OG SLBC/450/40OG LBBBM450/450OG LBBBC450/450OG

2X 2X

SLBC/450/40OG LBBBC450/450OG

2X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/500OG LBBBC450/500OG

1X 2X 1X 2X

SLBM/450/40OG SLBC/450/40OG LBBBM450/500OG LBBBC450/500OG

2X 2X

SLBC/450/40OG LBBBC450/500OG

2X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/600OG LBBBC450/600OG

1X 2X 1X 2X

SLBM/450/40OG SLBC/450/40OG LBBBM450/600OG LBBBC450/600OG

2X 2X

SLBC/450/40OG LBBBC450/600OG

2X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/800OG LBBBC450/800OG

1X 2X 1X 2X

SLBM/450/70OG SLBC/450/70OG LBBBM450/800OG LBBBC450/800OG

2X 2X

SLBC/450/70OG LBBBC450/800OG

2X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/900OG LBBBC450/900OG

1X 2X 1X 2X

SLBM/450/70OG SLBC/450/70OG LBBBM450/900OG LBBBC450/900OG

2X 2X

SLBC/450/70OG LBBBC450/900OG

2X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/1000OG LBBBC450/1000OG

1X 2X 1X 2X

SLBM/450/70OG SLBC/450/70OG LBBBM450/1000OG LBBBC450/1000OG

2X 2X

SLBC/450/70OG LBBBC450/1000OG

1X 2X 1X 2X

SLBM/450/70OG SLBC/450/70OG LBBBM450/1200OG LBBBC450/1200OG

2X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/1200OG LBBBC450/1200OG

2X 2X

SLBC/450/70OG LBBBC450/1200OG

400mm

450mm

500mm

600mm

800mm

900mm

1000mm

1200mm

5.07

Order Online www.pws.co.uk


COMPONENT DRAWER PACKS -LEGRABOX

For frontal sizes please refer to the PWS lay-on Matrix. Pre-assembled drawers are also compatible with In-frame and Handleless Matrices. See pws.co.uk for frontal sizes.

1 X C HEIGHT AND 1 X M HEIGHT + INTERNAL DRAWER

3 X M HEIGHT AND 1 X C HEIGHT

4 X M HEIGHT

139 355

175

139

175

139 175 355

• • • •

1x pan (C Height) drawer 1x (M Height) drawer 1x (M Height) internal drawer Includes soft-close BLUMOTION runners, ".+*0ü4%*#.'!0/Č/.!3/"+..1**!./ and drawer fronts • Includes backs and bases • Suggested drawer front heights: 2x 355mm Width

283

• 3x cutlery (M Height) drawer • 1x pan (C Height) drawer • Includes soft-close BLUMOTION runners, ".+*0ü4%*#.'!0/Č/.!3/"+..1**!./ and drawer fronts • Includes backs and bases • Suggested drawer front heights: 3x 139mm & 1x 283mm

Order Code

175

• 4x cutlery (M Height) drawer • Includes soft-close BLUMOTION runners, ".+*0ü4%*#.'!0/Č/.!3/"+..1**!./ and drawer fronts • Includes backs and bases • Suggested drawer front heights: 4x 175mm

Order Code

Order Code

300mm 2X 1X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG ZW7.250M LBBBM450/300OG LBBBC450/300OG

3X 1X 3X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/300OG LBBBC450/300OG

4X 4X

SLBM/450/40OG LBBBM450/300OG

2X 1X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG ZW7.350M LBBBM450/400OG LBBBC450/400OG

3X 1X 3X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/400OG LBBBC450/400OG

4X 4X

SLBM/450/40OG LBBBM450/400OG

2X 1X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG ZW7.400M LBBBM450/450OG LBBBC450/450OG

3X 1X 3X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/450OG LBBBC450/450OG

4X 4X

SLBM/450/40OG LBBBM450/450OG

2X 1X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG ZW7.450M LBBBM450/500OG LBBBC450/500OG

3X 1X 3X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/500OG LBBBC450/500OG

4X 4X

SLBM/450/40OG LBBBM450/500OG

2X 1X 1X 2X 1X

SLBM/450/40OG SLBC/450/40OG ZW7.550M LBBBM450/600OG LBBBC450/600OG

3X 1X 3X 1X

SLBM/450/40OG SLBC/450/40OG LBBBM450/600OG LBBBC450/600OG

4X 4X

SLBM/450/40OG LBBBM450/600OG

2X 1X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG ZW7.750M LBBBM450/800OG LBBBC450/800OG

3X 1X 3X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/800OG LBBBC450/800OG

4X 4X

SLBM/450/70OG LBBBM450/800OG

2X 1X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG ZW7.850M LBBBM450/900OG LBBBC450/900OG

3X 1X 3X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/900OG LBBBC450/900OG

4X 4X

SLBM/450/70OG LBBBM450/900OG

2X 1X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG ZW7.950M LBBBM450/1000OG LBBBC450/1000OG

3X 1X 3X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/1000OG LBBBC450/1000OG

4X 4X

SLBM/450/70OG LBBBM450/1000OG

2X 1X 1X 2X 1X

SLBM/450/70OG SLBC/450/70OG ZN7.1150M LBBBM450/1200OG LBBBC450/1200OG

3X 1X 3X 1X

SLBM/450/70OG SLBC/450/70OG LBBBM450/1200OG LBBBC450/1200OG

4X 4X

SLBM/450/70OG LBBBM450/1200OG

400mm

450mm

500mm

600mm

800mm

900mm

1000mm

1200mm

Technical Support Hotline: 0800 230 0898

5.08


PRE-ASSEMBLED DRAWER PACKS

CABINETS NOT INCLUDED

LEGRABOX

Choice of Steel or MFC back

â&#x20AC;¢

,0%+*/"+.((/0* . %*!03% 0$/*  .3!.+*ü#1.0%+*/

â&#x20AC;¢

Drawers come pre-assembled for quick and easy installation

â&#x20AC;¢

Cabinets are not included and must be purchased separately

wer line r dra

â&#x20AC;¢

ut anti e-c -s li pr

p

+$!(,5+13+.')+.!!þ%!*0(53!*+3+û!.,.!ġ//!)(!  .3!. packs. All the components required for the drawer packs can be ordered using one product code.

pplied wi th Su

FOR 450MM DEEP DRAWERS

EACH DRAWER COMES WITH: ƫ/!3%0$!%0$!. ƫ+.0!!('ü4! 0+#!0$!.3%0$'.'!0/* ü00! 3%0$ .3!./% !/



A pair of Legrabox Blumotion runners - 40kg



Ä&#x201A;4.3!.".+*0ü4%*#.'!0/



4x Drawer cover caps



8x Euroscrews and 8x Woodscrews to attach runner to cabinet



Orion grey pre-cut drawer liner



2 x M height and 1 x C height 175 175

355

â&#x20AC;¢ 2x pre-assembled cutlery (M Height) drawer â&#x20AC;¢ 1x pre-assembled pan (C Height) drawer â&#x20AC;¢ Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Ä&#x152;/.!3/"+..1**!./*  drawer fronts â&#x20AC;¢ Suggested drawer front heights: 2x 175mm & 1x 355mm

STEEL BACK Order code

Order code

300mm

L3DH450/300STL

L3DH450/300MFC

400mm

L3DH450/400STL

L3DH450/400MFC

450mm

L3DH450/450STL

L3DH450/450MFC

500mm

L3DH450/500STL

L3DH450/500MFC

600mm

L3DH450/600STL

L3DH450/600MFC

800mm

L3DH450/800STL

L3DH450/800MFC

900mm

L3DH450/900STL

L3DH450/900MFC

1000mm

L3DH450/1000STL

L3DH450/1000MFC

NEW 1200mm

L3DH450/1200STL

L3DH450/1200MFC

STEEL BACK

MFC BACK

1 x M height and 2 x C height 139 283

283

â&#x20AC;¢ 1x pre-assembled cutlery (M Height) drawer â&#x20AC;¢ 2x pre-assembled pan (C Height) drawer â&#x20AC;¢ Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Ä&#x152;/.!3/"+..1**!./*  drawer fronts â&#x20AC;¢ Suggested drawer front heights: 1x 139mm & 2x 283mm

For frontal sizes please refer to the PWS lay-on Matrix. Pre-assembled drawers are also compatible with In-frame and Handleless Matrices. See pws.co.uk for frontal sizes.

5.09

Order Online www.pws.co.uk

MFC BACK

Cabinet width

Cabinet width

Order code

Order code

300mm

L3DD450/300STL

L3DD450/300MFC

400mm

L3DD450/400STL

L3DD450/400MFC

450mm

L3DD450/450STL

L3DD450/450MFC

500mm

L3DD450/500STL

L3DD450/500MFC

600mm

L3DD450/600STL

L3DD450/600MFC

800mm

L3DD450/800STL

L3DD450/800MFC

900mm

L3DD450/900STL

L3DD450/900MFC

1000mm

L3DD450/1000STL

L3DD450/1000MFC

NEW 1200mm

L3DD450/1200STL

L3DD450/1200MFC


PRE-ASSEMBLED DRAWER PACKS - LEGRABOX

2 x C height

STEEL BACK

355

• 2x pre-assembled pan (C Height) drawer • Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  door fronts • Suggested drawer front height: 2x 355mm

355

Order code

Order code

300mm

L2D450/300STL

L2D450/300MFC

400mm

L2D450/400STL

L2D450/400MFC

450mm

L2D450/450STL

L2D450/450MFC

500mm

L2D450/500STL

L2D450/500MFC

600mm

L2D450/600STL

L2D450/600MFC

800mm

L2D450/800STL

L2D450/800MFC

900mm

L2D450/900STL

L2D450/900MFC

1000mm

L2D450/1000STL

L2D450/1000MFC

NEW 1200mm

L2D450/1200STL

L2D450/1200MFC

STEEL BACK

MFC BACK

1 x C height and 1 x M height + internal drawer

355

355

• • • •

1x pre-assembled pan (C Height) drawer 1x pre-assembled (M Height) drawer 1x pre-assembled (M Height) internal drawer Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  .3!. fronts • Suggested drawer front height: 2x 355mm

Cabinet width

Order code

Order code

300mm

L2DI450/300STL

L2DI450/300MFC

400mm

L2DI450/400STL

L2DI450/400MFC

450mm

L2DI450/450STL

L2DI450/450MFC

500mm

L2DI450/500STL

L2DI450/500MFC

600mm

L2DI450/600STL

L2DI450/600MFC

800mm

L2DI450/800STL

L2DI450/800MFC

900mm

L2DI450/900STL

L2DI450/900MFC

1000mm

L2DI450/1000STL

L2DI450/1000MFC

NEW 1200mm

L2DI450/1200STL

L2DI450/1200MFC

STEEL BACK

MFC BACK

3 x M height and 1 x C height

139 139 139

• 3x pre-assembled cutlery (M Height) drawer • 1x pre-assembled pan (C Height) drawer • Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  .3!. fronts • Suggested drawer front height: 3x 139mm & 1x 283mm

283

Cabinet width

Order code

Order code

300mm

L4DD450/300STL

L4DD450/300MFC

400mm

L4DD450/400STL

L4DD450/400MFC

450mm

L4DD450/450STL

L4DD450/450MFC

500mm

L4DD450/500STL

L4DD450/500MFC

600mm

L4DD450/600STL

L4DD450/600MFC

800mm

L4DD450/800STL

L4DD450/800MFC

900mm

L4DD450/900STL

L4DD450/900MFC

1000mm

L4DD450/1000STL

L4DD450/1000MFC

NEW 1200mm

L4DD450/1200STL

L4DD450/1200MFC

STEEL BACK

MFC BACK

4 x M height 175 175 175

• 4x pre-assembled cutlery (M Height) drawer • Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  .3!. fronts • Suggested drawer front height: 4x 175mm

175

MFC BACK

Cabinet width

Cabinet width

Order code

Order code

300mm

L4DH450/300STL

L4DH450/300MFC

400mm

L4DH450/400STL

L4DH450/400MFC

450mm

L4DH450/450STL

L4DH450/450MFC

500mm

L4DH450/500STL

L4DH450/500MFC

600mm

L4DH450/600STL

L4DH450/600MFC

800mm

L4DH450/800STL

L4DH450/800MFC

900mm

L4DH450/900STL

L4DH450/900MFC

1000mm

L4DH450/1000STL

L4DH450/1000MFC

NEW 1200mm

L4DH450/1200STL

L4DH450/1200MFC

• Additional 3-day lead time applies to whole order unless placed separately • Orders cannot be cancelled once placed • Goods can not be returned if ordered incorrectly or if surplus stock is ordered

Technical Support Hotline: 0800 230 0898

5.10


PRE-ASSEMBLED DRAWERS LEGRABOX

Additional 3-day lead time applies to whole order unless placed separately

Orders cannot be cancelled once placed

Goods can not be returned if ordered incorrectly or if surplus stock is ordered

STEEL BACKS

Su p p lie d

lip drawe i-s r

nt

+$!(,5+13+.')+.!!þ%!*0(53!+û!.,.!ġ//!)(!  .3!./ with a choice of Steel or MFC back to our Blum collection. Available in M and C heights and 300-1200mm widths, we assemble drawers to +. !./+0$!5.! !(%2!.! .! 50+ü0ċ

th pre-cut wi a

er lin

ORION GREY - 450MM DEEP DRAWERS

MFC BACKS

M Height

C Height

Cabinet width

Order code

Order code

Cabinet width

Order code

Order code

300mm

PL450/300MSTL

PL450/300CSTL

300mm

PL450/300MMFC

PL450/300CMFC

M Height

C Height

400mm

PL450/400MSTL

PL450/400CSTL

400mm

PL450/400MMFC

PL450/400CMFC

450mm

PL450/450MSTL

PL450/450CSTL

450mm

PL450/450MMFC

PL450/450CMFC

500mm

PL450/500MSTL

PL450/500CSTL

500mm

PL450/500MMFC

PL450/500CMFC

600mm

PL450/600MSTL

PL450/600CSTL

600mm

PL450/600MMFC

PL450/600CMFC

800mm

PL450/800MSTL

PL450/800CSTL

800mm

PL450/800MMFC

PL450/800CMFC

900mm

PL450/900MSTL

PL450/900CSTL

900mm

PL450/900MMFC

PL450/900CMFC

1000mm

PL450/1000MSTL

PL450/1000CSTL

1000mm

PL450/1000MMFC

PL450/1000CMFC

NEW 1200mm

PL450/1200MSTL

PL450/1200CSTL

NEW 1200mm

PL450/1200MMFC

PL450/1200CMFC

EACH DRAWER COMES WITH: ƫ/!3%0$!%0$!. ƫ+.0!!('ü4! 0+#!0$!.3%0$' .'!0/* ü00! 3%0$ .3!./% !/



A pair of LEGRABOX BLUMOTION runners - 40kg



Ă4.3!.".+*0ü4%*#.'!0/



4x Drawer cover caps



8x Euroscrews and 8x Woodscrews to attach runner to cabinet



Orion grey pre-cut drawer liner



5.11

Order Online www.pws.co.uk


PRE-ASSEMBLED INTERNAL DRAWERS LEGRABOX th pre-cut wi a nt

lip drawe i-s r

Su p p lie d

ORION GREY - 450MM DEEP DRAWERS

• Additional 3-day lead time applies to whole order unless placed separately • Orders cannot be cancelled once placed er lin

• Goods can not be returned if ordered incorrectly or if surplus stock is ordered

STEEL BACKS

MFC BACKS

Cabinet width

M HEIGHT Order code

C HEIGHT Order code

300mm

IPL450/300MSTL

IPL450/300CSTL

300mm

IPL450/300MMFC

IPL450/300CMFC

400mm

IPL450/400MSTL

IPL450/400CSTL

400mm

IPL450/400MMFC

IPL450/400CMFC

450mm

IPL450/450MSTL

IPL450/450CSTL

450mm

IPL450/450MMFC

IPL450/450CMFC

500mm

IPL450/500MSTL

IPL450/500CSTL

500mm

IPL450/500MMFC

IPL450/500CMFC

600mm

IPL450/600MSTL

IPL450/600CSTL

600mm

IPL450/600MMFC

IPL450/600CMFC

800mm

IPL450/800MSTL

IPL450/800CSTL

800mm

IPL450/800MMFC

IPL450/800CMFC

900mm

IPL450/900MSTL

IPL450/900CSTL

900mm

IPL450/900MMFC

IPL450/900CMFC

1000mm

IPL450/1000MSTL

IPL450/1000CSTL

1000mm

IPL450/1000MMFC

IPL450/1000CMFC

NEW 1200mm

IPL450/1200MSTL

IPL450/1200CSTL

NEW 1200mm

IPL450/1200MMFC

IPL450/1200CMFC

Cabinet width

M HEIGHT Order code

C HEIGHT Order code

EACH INTERNAL DRAWER COMES WITH: 1x Pre-assembled drawer - contents (see page 5.11)



1x Drawer front (assembled to the drawer)



Latch not included (see page 5.06)



Technical Support Hotline: 0800 230 0898

5.12


PRE-ASSEMBLED TIP-ON BLUMOTION LEGRABOX th pre-cut wi a nt

lip drawe i-s r

TIP-ON BLUMOTION combines the advantages of the TIP-ON mechanical opening support system with the reliable BLUMOTION dampening, for silent * !û+.0(!//(+/%*#ċ

Su p p lie d

ORION GREY - 450MM DEEP DRAWERS

er lin

STEEL BACKS

MFC BACKS

M Height

C Height

Cabinet width

Order code

Order code

Cabinet width

M Height Order code

C Height Order code

300mm

TPL450/300MSTL

TPL450/300CSTL

300mm

TPL450/300MMFC

TPL450/300CMFC

400mm

TPL450/400MSTL

TPL450/400CSTL

400mm

TPL450/400MMFC

TPL450/400CMFC

450mm

TPL450/450MSTL

TPL450/450CSTL

450mm

TPL450/450MMFC

TPL450/450CMFC

500mm

TPL450/500MSTL

TPL450/500CSTL

500mm

TPL450/500MMFC

TPL450/500CMFC

600mm

TPL450/600MSTL

TPL450/600CSTL

600mm

TPL450/600MMFC

TPL450/600CMFC

800mm

TPL450/800MSTL

TPL450/800CSTL

800mm

TPL450/800MMFC

TPL450/800CMFC

900mm

TPL450/900MSTL

TPL450/900CSTL

900mm

TPL450/900MMFC

TPL450/900CMFC

1000mm

TPL450/1000MSTL

TPL450/1000CSTL

1000mm

TPL450/1000MMFC

TPL450/1000CMFC

NEW 1200mm

TPL450/1200MSTL

TPL450/1200CSTL

NEW 1200mm

TPL450/1200MMFC

TPL450/1200CMFC

EACH INTERNAL DRAWER COMES WITH: 1x Pre-assembled drawer - contents (see page 5.11)



1x Tip-On BLUMOTION Kit (Tip-On BLUMOTION, Tip-On BLUMOTION Adapter, Tip-On BLUMOTION Linkage) assembled with the drawer



5.13

Order Online www.pws.co.uk

• Additional 3-day lead time applies to whole order unless placed separately • Orders cannot be cancelled once placed • Goods can not be returned if ordered incorrectly or if surplus stock is ordered


LEGRABOX IN-FRAME

Include single box kits not single components. If single components are required remove the “S” e.g. LBM/450/ 40OG instead of SLBM/450/40OG

COMPONENT KIT & BACKS AND BASES Kits compromise of a pair of BLUMOTION runners, a pair of ORION GREY sides and back and front brackets. Backs and bases must be ordered seperately. 25mm packer for in-frame page 5.51

COMPONENT KIT

BACKS AND BASES MFC

M Height (runners)

C Height (runners)

M Height

C Height

Cabinet width

Depth

Order code

Order code

Order code

Order code

500mm

270mm

LBM/270/40OG

IFLBM270/500OG

600mm

270mm

LBM/270/40OG

IFLBM270/600OG

300mm

450mm

SLBM/450/40OG

IFLBM450/300OG

400mm

450mm

SLBM/450/40OG

IFLBM450/400OG

450mm

450mm

SLBM/450/40OG

500mm

450mm

SLBM/450/40OG

SLBC/450/40OG

IFLBM450/500OG

IFLBC450/500OG

600mm

450mm

SLBM/450/40OG

SLBC/450/40OG

IFLBM450/600OG

IFLBC450/600OG

800mm

450mm

SLBM/450/70OG

SLBC/450/70OG

IFLBM450/800OG

IFLBC450/800OG

900mm

450mm

SLBM/450/70OG

SLBC/450/70OG

IFLBM450/900OG

IFLBC450/900OG

1000mm

450mm

SLBM/450/70OG

SLBC/450/70OG

IFLBM450/1000OG

IFLBC450/1000OG

NEW 1200mm

450mm

SLBM/450/70OG

SLBC/450/70OG

IFLBM450/1200OG

IFLBC450/1200OG

IFLBM450/450OG

In-frame Spacer: IFSLEGRABOX Please refer to page 5.51 for in-frame accessories

slip drawer

Su p p lie d

th pre-cut wi a

int

PRE-ASSEMBLED IN-FRAME DRAWERS MFC BACK AND BASE EACH DRAWER COMES WITH:

NEW

er in

l

1x Pre-assembled drawer with in-frame backs and bases (see page 5.11) 4x LegraBox In-frame Spacer

Cabinet Width

Depth

M Height

C Height

Order Code

Order Code

300

PIFLM450/300OG

400

PIFLM450/400OG

450

PIFLM450/450OG

500

PIFLM450/500OG

PIFLC450/500OG

PIFLM450/600OG

PIFLC450/600OG

600

450

800

PIFLM450/800OG

PIFLC450/800OG

900

PIFLM450/900OG

PIFLC450/900OG

1000

PIFLM450/1000OG

PIFLC450/1000OG

1200

PIFLM450/1200OG

PIFLC450/1200OG

Technical Support Hotline: 0800 230 0898

5.14


AMBIA-LINE LEGRABOX ACCESSORIES

Cutlery Divider

Knife Block

â&#x20AC;˘ Orion grey

â&#x20AC;˘ Orion grey

Order code

Description

Order code

Description

ZC7S450BS3

3 Tier cutlery divider, 300mm wide for NL450 LEGRABOX drawer

ZC7M0200

Knife block for 9 knives

ZC7S500BS3

3 Tier cutlery divider, 300mm wide for NL500 LEGRABOX drawer

Foil & Film Holder

Spice Holder

â&#x20AC;˘ Orion grey â&#x20AC;˘ Can be used with: ZC7S450RS2 | ZC7S500RS2

â&#x20AC;˘ Orion grey â&#x20AC;˘ Must be used with: ZC7F400RSP

Order code

Description

Order code

Description

ZC7C0000

+%(Ä&#x2019;Ăź()holder

ZC7G0P0I

Spice holder for C&F height pull-outs

Plate Holder â&#x20AC;˘ Orion grey

Order code

Description

ZC7T0350

Plate holder for up to 12 plates, 188mm - 322mm plate diameter

STEEL FRAMES â&#x20AC;˘ Orion grey

M HEIGHT | Shallow drawers Order code

Description

ZC7S300RSU

Steel frame, 50mm high, 242mm wide for NL270 & above

ZC7S450RS1

Steel frame, 50mm high, 100mm wide for NL450

ZC7S500RS1

Steel frame, 50mm high, 100mm wide for NL500

ZC7S450RS2

Steel frame, 50mm high, 200mm wide for NL450

ZC7S500RS2

Steel frame, 50mm high, 200mm wide for NL500

ZC7S450RSA

0!!(Ăź((!.".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä Ä Ä&#x2030;))3% !"+. Ä&#x2026;Ä&#x2020;Ä&#x20AC;Ä&#x2039; ĨÄ&#x2039;Ä&#x2039;1/! 0++),(!0!(5Ăź((Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))3% ! .3!.1*%03%0$ 18mm & 19mm end panels in conjunction with 1 x 300mm cutlery tray & 1 x 100mm frame).

ZC7S500RSA

0!!(Ăź((!.".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä Ä Ä&#x2030;))3% !"+. Ä&#x2020;Ä&#x20AC;Ä&#x20AC;Ä&#x2039; ĨÄ&#x2039;Ä&#x2039;1/! 0++),(!0!(5Ăź((Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))3% ! .3!.1*%03%0$ 18mm & 19mm end panels in conjunction with 1 x 300mm cutlery tray & 1 x 100mm frame).

C HEIGHT | Deep drawers Order code

Description

ZC7F300RSU

Steel frame, 110mm high, 242mm wide for NL270 & above

ZC7F400RSP

Steel frame, 110mm high, 218mm wide for NL400 & above

5.15

Order Online www.pws.co.uk


GOLLINUCCI DRAWER INSERTS

DISCOUNT FROM SECTION 6 APPLIES

LEGRABOX ACCESSORIES

Gollinucci creates items that make everyday life simpler. Available in a popular matt orion grey Ăź*%/$Ä&#x152;%0/.*#!+"10(!.5%*/!.0/+)!3%0$ modular accessories for personalised functionality. â&#x20AC;˘ Orion grey â&#x20AC;˘ Scratch resistant ĆŤ100+Ăź0Ä&#x2026;Ä&#x2020;Ä&#x20AC; !!, .3!./Ä? Order code

Drawer size

OGCT400/450

400mm

Dimensions 320x422mm

OGCT500/450

500mm

420x422mm

OGCT600/450

600mm

520x422mm

OGCT800/450

800mm

720x422mm

OGCT900/450

900mm

820x422mm

OGCT1000/450

1000mm

920x422mm

For our full range of drawer accessories please see Section 6 - Drawer Organisation

Personalise your storage with additional complementary accessories.

Please note that all three accessories 3%((+*(5Ăź0%*Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))3% 0$ .3!./

Order code

Order code

Order code

OGCHOPB

OGKNIFEB

OGFOILDISP

â&#x20AC;˘ Wooden chopping board â&#x20AC;˘ For use with 800, 900, 1000 wide drawers

â&#x20AC;˘ Knife block â&#x20AC;˘ For use with 500, 600, 800, 900 and 1000 wide drawers

â&#x20AC;˘ +%(ÄĽĂź() %/,!*/!. â&#x20AC;˘ For use with 500, 600, 800, 900 and 1000 wide drawers

DRAWER LINERS LEGRABOX ACCESSORIES .%+*.!5Ä&#x152;*0%ÄĄ/(%, .3!.(%*!./,.+2% !/01**%*#* +/0!Ăť!0%2! %0%+*(!//+.50+/0* .  .3!./!/Ä&#x2039;Ăť!.%*##.!0/+(10%+*0+,.!2!*0)+2!)!*0+"'%0$!*!//+.%!/3%0$%* .3!./Ä&#x2039; They can also be used as shelf liners to protect glassware and china.

Order code

Order code

DM1500X500AHT

DM1500X500ALT

â&#x20AC;˘ 1500x500mm

â&#x20AC;˘ 1500x500mm

â&#x20AC;˘ anthracite heavy texture

â&#x20AC;˘ anthracite light texture

â&#x20AC;˘ non slip mat

â&#x20AC;˘ non slip mat

â&#x20AC;˘ cut to size

â&#x20AC;˘ cut to size

Technical Support Hotline: 0800 230 0898

5.16


COMPONENT DRAWER KITS TANDEMBOX N HEIGHT 68.5mm

SPACE REQUIREMENT

M HEIGHT 83.6mm

SPACE REQUIREMENT

B HEIGHT 135mm

SPACE REQUIREMENT

D HEIGHT 200mm

D HEIGHT 200mm

SPACE REQUIREMENT

SPACE REQUIREMENT

SIDE STABILISATION FOR WIDER DRAWERS Top Mounted • Additional stabilisation for extra wide high fronted pull-outs • Recommended cabinet width: 900-1200mm • Aluminium rod needs to be cut to size

Order code

Depth

ZST.450BA

450mm-600mm

Flexible design elementsġǫ(1) !/%#*!(!)!*0/) !+"#(//+.)!0(+û!.  %0%+*(ý!4%%(%05 1.%*#0$! !/%#*,.+!//ċ

5.17

Order Online www.pws.co.uk


Guideline weight capacity of runner system

PREASSEMBLED DRAWERS & PACKS PAGE 5.23

DRAWER KITS TANDEMBOX LAY ON (GREY)

30kg - up to 600mm width 50kg - up to 900mm width 65kg - up to 1200mm width

COMPONENTS

SINGLE BOX

30kg, 50kg and 65kg kits comprise of a pair of BLUMOTION runners, a pair of GREY sides, front and back brackets

1 component kit packed in 1 box (comprise of a pair of BLUMOTION runners, a pair of runners, a pair of GREY sides, front and back brackets).

NEW

N Height

M Height

B Height

D Height

Order Code

Order Code

Order Code

Order Code

Depth (mm)

Carrying Capacity

Components/ Single Box

270

30kg

Components

TBM/270/30

400

30kg

Components

TBM/400/30 TBD/450/30

Components

TBN/450/30

TBM/450/30

TBB/450/30

30kg

TBD/450/30GLASS Single Box

NEW STBM/450/30

NEW STBD/450/30 TBD/450/50

Components

NEW TBM/450/50

50kg

450

TBD/450/50GLASS Single Box

NEW STBM/450/50

NEW STBD/450/50 TBD/450/65

Components

NEW TBM/450/65

65kg

TBD/450/65GLASS Single Box

NEW STBM/450/65

Components

TBM/500/30

NEW STBD/450/65 TBD/500/30

30kg

TBD/500/30GLASS TBD/500/50 50kg

500

Components

NEW TBM/500/50 TBD/500/50GLASS

65kg

TBD/500/65

NEW TBM/500/65

Components

TBD/500/65GLASS

Available in multiples of 20 only.

BACKS AND BASES STEEL BACKS - GREY

MFC BASES For use with steel back

M Height

D Height

Cabinet width

Order code

Order code

300mm

Z30M235S.6

Z30D235S.6

400mm

Z30M335S.6

Z30D335S.6

Cabinet width

Order code

450mm

Z30M385S.6

Z30D385S.6

300mm

TBS450/300SG

500mm

Z30M435S.6

Z30D435S.6

400mm

TBS450/400SG

600mm

Z30M535S.6

Z30D535S.6

450mm

TBS450/450SG TBS450/500SG

450mm depth

800mm

Z30M735S.6

Z30D735S.6

500mm

900mm

Z30M835S.6

Z30D835S.6

600mm

TBS450/600SG

1000mm

Z30M935S.6

Z30D935S.6

800mm

TBS450/800SG

Z30D1135.6

900mm

TBS450/900SG

1000mm

TBS450/1000SG

NEW 1200mm

TBS450/1200SG

NEW 1200mm

Z30M1135.6

MFC BACKS AND BASES - 450mm depth Cabinet width

M Height

D Height

Order code

Order code

300mm

TBBBM450/300G

TBBBD450/300G

400mm

TBBBM450/400G

TBBBD450/400G

450mm

TBBBM450/450G

TBBBD450/450G

500mm

TBBBM450/500G

TBBBD450/500G

600mm

TBBBM450/600G

TBBBD450/600G

800mm

TBBBM450/800G

TBBBD450/800G

900mm

TBBBM450/900G

TBBBD450/900G

1000mm

TBBBM450/1000G

TBBBD450/1000G

NEW 1200mm

TBBBM450/1200G

TBBBD450/1200G

Back & Base dimensions are based upon 18mm End Panels on Cabinets

Technical Support Hotline: 0800 230 0898

5.18


COMPONENT TIP-ON BLUMOTION TANDEMBOX

All kits comprise of a pair of BLUMOTION runners, a pair of GREY sides, back and front brackets and TIP-ON mechanism. Bases and backs not included.

LAY ON DRAWER - GREY

Guideline weight capacity capacity of runner system 30kg - up to 600mm width 65kg - up to 1200mm width

N Height

B Height

Order code

Drawer

Depth

Weight

Order code

Drawer

Depth

Weight

TBTN/450/30

Lay on

450mm

30kg

TBTB/450/30

Lay on

450mm

30kg

M Height

D Height

Order code

Drawer

Depth

Weight

Order code

Drawer

Depth

Weight

TBTM/450/30

Lay on

450mm

30kg

TBTD/450/30

Lay on

450mm

30kg

NEW TBTM/450/65

Lay on

450mm

65kg

TBTD/450/30GLAS

Lay on

450mm

30kg

TBTD/450/65

Lay on

450mm

65kg

ACCESSORIES Order code Description T60.B00H

Tandembox TIP-ON BLUMOTION synchro shaft holder & base support bracket for units over 750mm wide

65.5627

Setup template for Tandembox TIP-ON BLUMOTION

T60.B3530

Tandembox TIP-ON BLUMOTION unit & latch for 350-600mm, 30kg

T60.B3560

Tandembox TIP-ON BLUMOTION unit & latch for 350-600mm, 65kg

T60.1125W

Tandembox TIP-ON BLUMOTION synchronisation linkage for cutting to size

5.19

Order Online www.pws.co.uk


COMPONENT INTERNAL DRAWER FRONT TANDEMBOX GREY - FASCIA ONLY BACKS & BASES

FRONT PIECE FOR INTERNAL DRAWER M Height

FRONT PIECE FOR INTERNAL DRAWER D Height

PAGE 5.18

Order code

Drawer

Cabinet width

Order code

Drawer

Cabinet width

ZIA.130M0.1

Front piece for inner drawer

300mm

ZIA.130D2.A

Front piece for inner pull-out

300mm

ZIA.230M0.1

Front piece for inner drawer

400mm

ZIA.230D2.A

Front piece for inner pull-out

400mm

ZIA.280M0.1

Front piece for inner drawer

450mm

ZIA.280D2.A

Front piece for inner pull-out

450mm

ZIA.330M0.1

Front piece for inner drawer

500mm

ZIA.330D2.A

Front piece for inner pull-out

500mm

ZIA.430M0.1

Front piece for inner drawer

600mm

ZIA.430D2.A

Front piece for inner pull-out

600mm

ZIA.630M0.1

Front piece for inner drawer

800mm

ZIA.630D2.A

Front piece for inner pull-out

800mm

ZIA.730M0.1

Front piece for inner drawer

900mm

ZIA.730D2.A

Front piece for inner pull-out

900mm

ZIA.830M0.1

Front piece for inner drawer

1000mm

ZIA.830D2.A

Front piece for inner pull-out

1000mm

Front piece for inner drawer

1200mm

NEW ZIA.1030D2.1

Front piece for inner pull-out

1200mm

Order code

Product

Material

ZIF.80M5GRIF

Handle

Nylon

NEW ZIA.1030M0.1

Handle • Grey

Handle And Latch • Grey

Order code

Product

Material

ZIF.80M7GRI/MIT

Handle and latch

Nylon

Technical Support Hotline: 0800 230 0898

5.20


CABINETS & DRAWER FRONTS NOT INCLUDED

COMPONENT DRAWER PACKS TANDEMBOX WITH BACKS AND BASES - 450MM DEEP DRAWERS

Include single box kits not single components. If single components are required remove the “S” e.g. TBM/450/ 40OG instead of STBM/450/40OG

+$!(,5+1/,!%"5ǫ(1))+.!!þ%!*0(5,(!/!.!"!.0+0$!+),+*!*0 product codes below that make up drawer packs (MFC Back and Base). 2 X M HEIGHT AND 1 X D HEIGHT

1 X M HEIGHT AND 2 X D HEIGHT

2 X D HEIGHT

139

175

355 175

283

355

• 2x pre-assembled cutlery (M Height) drawer • 1x pre-assembled gallery rail pan (D Height) drawer • Includes soft-close Blumotion runners, front ü4%*#.'!0/* /.!3/"+..1**!./*  drawer fronts • Includes backs and bases

Width

355

283

• 1x pre-assembled cutlery (M Height) drawer • 2x pre-assembled gallery rail pan (D Height) drawer • Includes soft-close Blumotion runners, front ü4%*#.'!0/* /.!3/"+..1**!./*  drawer fronts • Includes backs and bases

Order Code

• 2x pre-assembled gallery rail pan (D Height) drawer • Includes soft-close Blumotion runners, front ü4%*#.'!0/* /.!3/"+..1**!./*  drawer fronts • Includes backs and bases

Order Code

Order Code

300mm 2X 1X 2X 1X

STBM/450/30 STBD/450/30 TBBBM450/300G TBBBD450/300G

1X 2X 1X 2X

STBM/450/30 STBD/450/30 TBBBM450/300G TBBBD450/300G

2X 2X

STBD/450/30 TBBBD450/300G

2X 1X 2X 1X

STBM/450/30 STBD/450/30 TBBBM450/400G TBBBD450/400G

1X 2X 1X 2X

STBM/450/30 STBD/450/30 TBBBM450/400G TBBBD450/400G

2X 2X

STBD/450/30 LBBBC450/400G

2X 1X 2X 1X

STBM/450/30 STBD/450/30 TBBBM450/450G TBBBD450/450G

1X 2X 1X 2X

STBM/45030 STBD/450/30 TBBBM450/450G TBBBD450/450G

2X 2X

STBD/450/30 LBBBC450/450G

2X 1X 2X 1X

STBM/450/30 STBD/450/30 TBBBM450/500G TBBBD450/500G

1X 2X 1X 2X

STBM/450/30 STBD/450/30 TBBBM450/500G TBBBD450/500G

2X 2X

STBD/450/30 TBBBD450/500G

2X 1X 2X 1X

STBM/450/30 STBD/450/30 TBBBM450/600G TBBBD450/600G

1X 2X 1X 2X

STBM/450/30 STBD/450/30 TBBBM450/600G TBBBD450/600G

2X 2X

STBD/450/30 TBBBD450/600G

2X 1X 2X 1X

STBM/450/50 STBD/450/50 TBBBM450/800G TBBBD450/800G

1X 2X 1X 2X

STBM/450/50 STBD/450/50 TBBBM450/800G TBBBD450/800G

2X 2X

STBD/450/50 TBBBD450/800G

2X 1X 2X 1X

STBM/450/50 STBD/450/50 TBBBM450/900G TBBBD450/900G

1X 2X 1X 2X

STBM/450/50 STBD/450/50 TBBBM450/900G TBBBD450/900G

2X 2X

STBD/450/50 TBBBD450/900G

2X 1X 2X 1X

STBM/450/65 STBD/450/65 TBBBM450/1000G TBBBD450/1000G

1X 2X 1X 2X

STBM/450/65 STBD/450/65 TBBBM450/1000G TBBBD450/1000G

2X 2X

STBD/450/65 TBBBD450/1000G

2X 1X 2X 1X

STBM/450/65 STBD/450/65 TBBBM450/1200G TBBBD450/1200G

1X 2X 1X 2X

STBM/450/65 STBD/450/65 TBBBM450/1200G TBBBD450/1200G

2X 2X

STBD/450/65 TBBBD450/1200G

400mm

450mm

500mm

600mm

800mm

900mm

1000mm

1200mm

5.21

Order Online www.pws.co.uk


COMPONENT DRAWER PACKS - TANDEMBOX

For frontal sizes please refer to the PWS lay-on Matrix. Pre-assembled drawers are also compatible with In-frame and Handleless Matrices. See pws.co.uk for frontal sizes.

1 X D HEIGHT AND 1 X M HEIGHT + INTERNAL DRAWER

3 X M HEIGHT AND 1 X D HEIGHT

4 X M HEIGHT

139 355

175

139

175

139 175 355

• 1x pre-assembled gallery rail pan (D Height) drawer • 1x pre-assembled (M height) drawer • 1x pre-assembled (M height) internal drawer • Includes soft-close Blumotion runners, front ü4%*#.'!0/* /.!3/"+..1**!./*  drawer fronts • Includes backs and bases Width

283

• 3x pre-assembled cutlery (M Height) drawer • 1x pre-assembled gallery rail pan (D Height) drawer • Includes soft-close Blumotion runners, front ü4%*#.'!0/* /.!3/"+..1**!./*  drawer fronts • Includes backs and bases

Order Code

175

• 4x pre-assembled cutlery (M Height) drawer • Includes soft-close Blumotion runners, front ü4%*#.'!0/* /.!3/"+..1**!./*  drawer fronts • Includes backs and bases

Order Code

Order Code

300mm 2X 1X 1X 2X 1X

STBM/450/30 STBD/450/30 ZIA.130MO.1 TBBBM450/300G TBBBD450/300G

3X 1X 3X 1X

STBM/450/30 STBD/450/30 TBBBM450/300G TBBBD450/300G

4X 4X

STBM/450/30 TBBBM450/300G

2X 1X 1X 2X 1X

STBM/450/30 STBD/450/30

3X 1X 3X 1X

STBM/450/30 STBD/450/30 TBBBM450/400G TBBBD450/400G

4X 4X

STBM/450/30 TBBBM450/400G

3X 1X 3X 1X

STBM/450/30 STBD/450/30 TBBBM450/450G TBBBD450/450G

4X 4X

STBM/450/30 TBBBM450/450G

400mm

ZIA.230MO.1

TBBBM450/400G TBBBD450/400G

450mm 2X 1X 1X 2X 1X

STBM/450/40OG STBD/450/40OG ZIA.280MO.1

2X 1X 1X 2X 1X

STBM/450/30 STBD/450/30 ZIA.330MO.1 TBBBM450/500G TBBBD450/500G

3X 1X 3X 1X

STBM/450/30 STBD/450/30 TBBBM450/500G TBBBD450/500G

4X 4X

STBM/450/30 TBBBM450/500G

2X 1X 1X 2X 1X

STBM/450/30 STBD/450/30 ZIA.430MO.1 TBBBM450/600G TBBBD450/600G

3X 1X 3X 1X

STBM/450/30 STBD/450/30 TBBBM450/600G TBBBD450/600G

4X 4X

STBM/450/30 TBBBM450/600G

2X 1X 1X 2X 1X

STBM/450/50 STBD/450/50 ZIA.630MO.1 TBBBM450/800G TBBBD450/800G

3X 1X 3X 1X

STBM/450/50 STBD/450/50 TBBBM450/800G TBBBD450/800G

4X 4X

STBM/450/50 TBBBM450/800G

2X 1X 1X 2X 1X

STBM/450/50 STBD/450/50 ZIA.730MO.1 TBBBM450/900G TBBBD450/900G

3X 1X 3X 1X

STBM/450/50 STBD/450/50 TBBBM450/900G TBBBD450/900G

4X 4X

STBM/450/50 TBBBM450/900G

2X 1X 1X 2X 1X

STBM/450/65 STBD/450/65 ZIA.830MO.1 TBBBM450/1000G TBBBD450/1000G

3X 1X 3X 1X

STBM/450/65 STBD/450/65 TBBBM450/1000G TBBBD450/1000G

4X 4X

STBM/450/65 TBBBM450/1000G

2X 1X 1X 2X 1X

STBM/450/65 STBD/450/65 ZIA.1030MO.1 TBBBM450/1200G TBBBD450/1200G

3X 1X 3X 1X

STBM/450/65 STBD/450/65 TBBBM450/1200G TBBBD450/1200G

4X 4X

STBM/450/65 TBBBM450/1200G

TBBBM450/450G TBBBD450/450G

500mm

600mm

800mm

900mm

1000mm

1200mm

Technical Support Hotline: 0800 230 0898

5.22


PRE-ASSEMBLED DRAWER PACKS

CABINETS NOT INCLUDED

TANDEMBOX e-c pr

wer line r dra

â&#x20AC;¢ Choice of Steel or MFC back

ut antisli

p

+$!(,5+13+.')+.!!þ%!*0(53!*+3+û!.,.!ġ//!)(!  .3!. packs. All components required for drawer packs can be ordered by using one product code.

pplied wit Su h

FOR 450MM DEEP DRAWERS

â&#x20AC;¢ ,0%+*/"+.((/0* . %*!03% 0$/*  .3!.+*ü#1.0%+*/ â&#x20AC;¢ Drawers come pre-assembled for quick and easy installation â&#x20AC;¢ D Height drawers come with gallery rails â&#x20AC;¢ Cabinets are not included and must be purchased separately

EACH M HEIGHT DRAWER COMES WITH:

EACH D HEIGHT DRAWER COMES WITH:

ƫ/!3%0$!%0$!. ƫ+.0!!('ü4! 0+#!0$!.3%0$' .'!0/* ü00! 3%0$ .3!./% !/



ƫ/!3%0$!%0$!. ƫ+.0!!('ü4! 0+#!0$!.3%0$' .'!0/* ü00! 3%0$ .3!./% !/



A pair of Tandembox Blumotion runners - 30kg



A pair of Tandembox Blumotion runners - 30kg



Ä&#x201A;4.3!.".+*0ü4%*#.'!0/



A pair of long side gallery rails



2x Drawer cover caps



Ä&#x201A;4.3!.".+*0ü4%*#.'!0/



8x Euroscrews and 8x Woodscrews to attach runner to cabinet



2x Drawer cover caps



Grey pre-cut drawer liner



8x Euroscrews and 8x Woodscrews to attach runner to cabinet



Grey pre-cut drawer liner



2 x M height and 1 x D height 175 175

355

â&#x20AC;¢ 2x pre-assembled cutlery (M Height) drawer â&#x20AC;¢ 1x pre-assembled gallery rail pan (D Height) drawer â&#x20AC;¢ Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Ä&#x152;/.!3/"+..1**!./*  .3!. fronts â&#x20AC;¢ Suggested drawer front heights: 2x 175mm & 1x 355mm

STEEL BACK Order code

Order code

300mm

T3DH450/300STL

T3DH450/300MFC

400mm

T3DH450/400STL

T3DH450/400MFC

450mm

T3DH450/450STL

T3DH450/450MFC

500mm

T3DH450/500STL

T3DH450/500MFC

600mm

T3DH450/600STL

T3DH450/600MFC

800mm

T3DH450/800STL

T3DH450/800MFC

900mm

T3DH450/900STL

T3DH450/900MFC

1000mm

T3DH450/1000STL

T3DH450/1000MFC

NEW 1200mm

T3DH450/1200STL

T3DH450/1200MFC

STEEL BACK

MFC BACK

1 x M height and 2 x C height 139 283

283

â&#x20AC;¢ 1x pre-assembled cutlery (M Height) drawer â&#x20AC;¢ 2x pre-assembled gallery rail pan (D Height) drawer â&#x20AC;¢ Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Ä&#x152;/.!3/"+..1**!./*  .3!. fronts â&#x20AC;¢ Suggested drawer front heights: 1x 139mm & 2x 283mm

For frontal sizes please refer to the PWS lay-on Matrix. Pre-assembled drawers are also compatible with In-frame and Handleless Matrices. See pws.co.uk for frontal sizes.

5.23

Order Online www.pws.co.uk

MFC BACK

Cabinet width

Cabinet width

Order code

Order code

300mm

T3DD450/300STL

T3DD450/300MFC

400mm

T3DD450/400STL

T3DD450/400MFC

450mm

T3DD450/450STL

T3DD450/450MFC

500mm

T3DD450/500STL

T3DD450/500MFC

600mm

T3DD450/600STL

T3DD450/600MFC

800mm

T3DD450/800STL

T3DD450/800MFC

900mm

T3DD450/900STL

T3DD450/900MFC

1000mm

T3DD450/1000STL

T3DD450/1000MFC

NEW 1200mm

T3DD450/1200STL

T3DD450/1200MFC


PRE-ASSEMBLED DRAWER PACKS - TANDEMBOX

2 x D height

STEEL BACK

355

• 2x pre-assembled gallery rail pan (D Height) drawer • Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  .3!. fronts • Suggested drawer front height: 2x 355mm

355

Order code

Order code

300mm

T2D450/300STL

T2D450/300MFC

400mm

T2D450/400STL

T2D450/400MFC

450mm

T2D450/450STL

T2D450/450MFC

500mm

T2D450/500STL

T2D450/500MFC

600mm

T2D450/600STL

T2D450/600MFC

800mm

T2D450/800STL

T2D450/800MFC

900mm

T2D450/900STL

T2D450/900MFC

1000mm

T2D450/1000STL

T2D450/1000MFC

NEW 1200mm

T2D450/1200STL

T2D450/1200MFC

STEEL BACK

MFC BACK

1 x D height and 1 x M height + internal drawer

355

355

• 1x pre-assembled gallery rail pan (D Height) drawer • 1x pre-assembled (M height) drawer • 1x pre-assembled (M height) internal drawer • Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  .3!. fronts • Suggested drawer front height: 2x 355mm

Cabinet width

Order code

Order code

300mm

T2DI450/300STL

T2DI450/300MFC

400mm

T2DI450/400STL

T2DI450/400MFC

450mm

T2DI450/450STL

T2DI450/450MFC

500mm

T2DI450/500STL

T2DI450/500MFC

600mm

T2DI450/600STL

T2DI450/600MFC

800mm

T2DI450/800STL

T2DI450/800MFC

900mm

T2DI450/900STL

T2DI450/900MFC

1000mm

T2DI450/1000STL

T2DI450/1000MFC

NEW 1200mm

T2DI450/1200STL

T2DI450/1200MFC

STEEL BACK

MFC BACK

3 x M height and 1 x D height

139 139 139 283

• 3x pre-assembled cutlery (M Height) drawer • 1x pre-assembled gallery rail pan (D Height) drawer • Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  .3!. fronts • Suggested drawer front height: 3x 139mm & 1x 283mm

Cabinet width

Order code

Order code

300mm

T4DD450/300STL

T4DD450/300MFC

400mm

T4DD450/400STL

T4DD450/400MFC

450mm

T4DD450/450STL

T4DD450/450MFC

500mm

T4DD450/500STL

T4DD450/500MFC

600mm

T4DD450/600STL

T4DD450/600MFC

800mm

T4DD450/800STL

T4DD450/800MFC

900mm

T4DD450/900STL

T4DD450/900MFC

1000mm

T4DD450/1000STL

T4DD450/1000MFC

NEW 1200mm

T4DD450/1200STL

T4DD450/1200MFC

STEEL BACK

MFC BACK

4 x M height 175 175

• 4x pre-assembled cutlery (M Height) drawer • Includes soft-close BLUMOTION runners, front ü4%*#.'!0/Č/.!3/"+..1**!./*  .3!. fronts • Suggested drawer front height: 4x 175mm

175 175

MFC BACK

Cabinet width

Cabinet width

Order code

Order code

300mm

T4DH450/300STL

T4DH450/300MFC

400mm

T4DH450/400STL

T4DH450/400MFC

450mm

T4DH450/450STL

T4DH450/450MFC

500mm

T4DH450/500STL

T4DH450/500MFC

600mm

T4DH450/600STL

T4DH450/600MFC

800mm

T4DH450/800STL

T4DH450/800MFC

900mm

T4DH450/900STL

T4DH450/900MFC

1000mm

T4DH450/1000STL

T4DH450/1000MFC

NEW 1200mm

T4DH450/1200STL

T4DH450/1200MFC

• Additional 3-day lead time applies to whole order unless placed separately • Orders cannot be cancelled once placed • Goods can not be returned if ordered incorrectly or if surplus stock is ordered

Technical Support Hotline: 0800 230 0898

5.24


PRE-ASSEMBLED DRAWERS h pre-cu wit t p draw i-sli er er lin

+$!(,5+13+.')+.!!þ%!*0(53!+û!.,.!ġ//!)(!  .3!./ with a choice of Steel or MFC back to our Blum collection. Available in M and D heights and 300-1200mm widths. We assemble drawers 0++. !./+0$!5.! !(%2!.! .! 50+ü0ċ

d

t an

GREY - 450MM DEEP DRAWERS

Su p p lie

TANDEMBOX

• Additional 3-day lead time applies to whole order unless placed separately • Orders cannot be cancelled once placed • Goods can not be returned if ordered incorrectly or if surplus stock is ordered

STEEL BACKS

MFC BACKS M Height

D Height

Order code

Order code

M Height

D Height

Cabinet width

Order code

Order code

300mm

PT450/300MSTL

PT450/300DSTL

300mm

PT450/300MMFC

PT450/300DMFC

400mm

PT450/400MSTL

PT450/400DSTL

400mm

PT450/400MMFC

PT450/400DMFC

450mm

PT450/450MSTL

PT450/450DSTL

450mm

PT450/450MMFC

PT450/450DMFC

500mm

PT450/500MSTL

PT450/500DSTL

500mm

PT450/500MMFC

PT450/500DMFC

600mm

PT450/600MSTL

PT450/600DSTL

600mm

PT450/600MMFC

PT450/600DMFC

800mm

PT450/800MSTL

PT450/800DSTL

800mm

PT450/800MMFC

PT450/800DMFC

900mm

PT450/900MSTL

PT450/900DSTL

900mm

PT450/900MMFC

PT450/900DMFC

1000mm

PT450/1000MSTL

PT450/1000DSTL

1000mm

PT450/1000MMFC

PT450/1000DMFC

NEW 1200mm

PT450/1200MSTL

PT450/1200DSTL

NEW 1200mm

PT450/1200MMFC

PT450/1200DMFC

Cabinet width

EACH M HEIGHT DRAWER COMES WITH:

EACH D HEIGHT DRAWER COMES WITH:

ƫ/!3%0$!%0$!. ƫ+.0!!('ü4! 0+#!0$!.3%0$' .'!0/* ü00! 3%0$ .3!./% !/



ƫ/!3%0$!%0$!. ƫ+.0!!('ü4! 0+#!0$!.3%0$' .'!0/* ü00! 3%0$ .3!./% !/



A pair of Tandembox Blumotion runners - 30kg



A pair of Tandembox Blumotion runners - 30kg



Ă4.3!.".+*0ü4%*#.'!0/



A pair of long side gallery rails



2x Drawer cover caps



Ă4.3!.".+*0ü4%*#.'!0/



8x Euroscrews and 8x Woodscrews to attach runner to cabinet



2x Drawer cover caps



Grey pre-cut drawer liner



8x Euroscrews and 8x Woodscrews to attach runner to cabinet



Grey pre-cut drawer liner



5.25

Order Online www.pws.co.uk


PRE-ASSEMBLED INTERNAL DRAWERS TANDEMBOX h pre-cu wit t p draw i-sli er

Su p p lie

d

t an

GREY - 450MM DEEP DRAWERS

• Additional 3-day lead time applies to whole order unless placed separately • Orders cannot be cancelled once placed

er lin

• Goods can not be returned if ordered incorrectly or if surplus stock is ordered

For Drawer Accessories please go to Section 6

STEEL BACKS

MFC BACKS

Cabinet width

M HEIGHT Order code

D HEIGHT Order code

Cabinet width

M HEIGHT Order code

D HEIGHT Order code

300mm

IPT450/300MSTL

IPT450/300DSTL

300mm

IPT450/300MMFC

IPT450/300DMFC

400mm

IPT450/400MSTL

IPT450/400DSTL

400mm

IPT450/400MMFC

IPT450/400DMFC

450mm

IPT450/450MSTL

IPT450/450DSTL

450mm

IPT450/450MMFC

IPT450/450DMFC

500mm

IPT450/500MSTL

IPT450/500DSTL

500mm

IPT450/500MMFC

IPT450/500DMFC

600mm

IPT450/600MSTL

IPT450/600DSTL

600mm

IPT450/600MMFC

IPT450/600DMFC

800mm

IPT450/800MSTL

IPT450/800DSTL

800mm

IPT450/800MMFC

IPT450/800DMFC

900mm

IPT450/900MSTL

IPT450/900DSTL

900mm

IPT450/900MMFC

IPT450/900DMFC

1000mm

IPT450/1000MSTL

IPT450/1000DSTL

1000mm

IPT450/1000MMFC

IPT450/1000DMFC

NEW 1200mm

IPT450/1200MSTL

IPT450/1200DSTL

NEW 1200mm

IPT450/1200MMFC

IPT450/1200DMFC

EACH INTERNAL DRAWER COMES WITH: 1x Pre-assembled drawer - contents (see page 5.25)



1x Drawer front (assembled to the drawer)



Latch not included (see page 5.20)



Technical Support Hotline: 0800 230 0898

5.26


LEGRABOX SPACE TOWER COMPONENTS

SPACE TOWER | LEGRABOX Without BACKS & BASES • BLUMOTION • Orion grey • 5 x hinges and mounting plates for door • 4 x deep drawers (C Height) + front • 1 x shallow drawer (M Height) + front

SPACE TOWER | LEGRABOX TIP-ON BLUMOTION Without BACKS & BASES • TIP-ON BLUMOTION • Orion grey • 5 x hinges and mounting plates for door • 4 x deep drawers (C Height) + front • 1 x shallow drawer (M Height) + front

Cabinet width

Depth

Order code

Cabinet width

Depth

Order code

300mm

450mm

STLB450/300

300mm

450mm

STLBT450/300

400mm

450mm

STLB450/400

400mm

450mm

STLBT450/400

450mm

450mm

STLB450/450

450mm

450mm

STLBT450/450

500mm

450mm

STLB450/500

500mm

450mm

STLBT450/500

600mm

450mm

STLB450/600

600mm

450mm

STLBT450/600

300mm

500mm

STLB500/300

300mm

500mm

STLBT500/300

400mm

500mm

STLB500/400

400mm

500mm

STLBT500/400

450mm

500mm

STLB500/450

450mm

500mm

STLBT500/450

500mm

500mm

STLB500/500

500mm

500mm

STLBT500/500

600mm

500mm

STLB500/600

600mm

500mm

STLBT500/600

SPACE TOWER | LEGRABOX With BACKS & BASES (MFC only) • BLUMOTION • Orion grey • 5 x Hinges and mounting plates for door • 4 x Deep drawers (C Height) + front • 1 x Shallow drawer (M Height) + front

SPACE TOWER | LEGRABOX TIP-ON BLUMOTION With BACKS & BASES (MFC only) • TIP-ON BLUMOTION • Orion grey • 5 x Hinges and mounting plates for door • 4 x Deep drawers (C Height) + front • 1 x Shallow drawer (M Height) + front

Cabinet width

Depth

Order code

Cabinet width

Depth

Order code

300mm

450mm

STLB450/300KMFC

300mm

450mm

STLBT450/300KMFC

400mm

450mm

STLB450/400KMFC

400mm

450mm

STLBT450/400KMFC

450mm

450mm

STLB450/450KMFC

450mm

450mm

STLBT450/450KMFC

500mm

450mm

STLB450/500KMFC

500mm

450mm

STLBT450/500KMFC

600mm

450mm

STLB450/600KMFC

600mm

450mm

STLBT450/600KMFC

5.27

Order Online www.pws.co.uk


LEGRABOX SPACE TOWER PRE-ASSEMBLED PLANNING (components and pre-assembled)

80

1.Ƶƫ'%0/%*(1 !ü2!$%*#!/Ä&#x2039;$!,(**%*# %((1/0.0%+*!(+3+*(5/$+3/"+1.$%*#!/Ä&#x2039;$%/%//1þ%!*0 for most applications as it allows for a maximum door weight of 16kg. Five hinges allow a door weight of up to 22kg.

+$!(,5+13+.')+.!!þ%!*0(53!*+3+û!. pre-assembled SPACE TOWER. All components required for the SPACE TOWER can be ordered by using one product code.

â&#x20AC;¢ Drawers come pre-assembled for quick and easy installation â&#x20AC;¢ Available for the following cabinet widths: 300/400/450/500/600mm â&#x20AC;¢ Available in a choice of Steel or MFC back â&#x20AC;¢ Cabinets are not included and must be purchased separately

256

L

LEGRABOX 4 x C height, 1 x M height

1684

Supplied with pre-cut anti-slip drawer liner

EG

RABOX

â&#x20AC;¢ Orion grey â&#x20AC;¢ 450mm depth

1428

â&#x20AC;¢ Available with Steel or MFC back EACH D HEIGHT DRAWER COMES WITH:

352

1340

1108

4x C Height pre-assembled drawers + front



1x M Height pre-assembled drawer + front



.+*0ü4%*#.'!0/



Screws for runners and door fronts



5x Pairs of Legrabox Blumotion runners - 40kg



5x 155o nil protrusion hinges + mounting plates



Orion grey pre-cut drawer liner



STEEL BACK Order code

Order code

300mm

PSTL450/300STL

PSTL450/300MFC

400mm

PSTL450/400STL

PSTL450/400MFC

450mm

PSTL450/450STL

PSTL450/450MFC

500mm

PSTL450/500STL

PSTL450/500MFC

600mm

PSTL450/600STL

PSTL450/600MFC

670

320

756

MFC BACK

Cabinet width

38*

19

280

379

436

57*

â&#x20AC;¢ Additional 3-day lead time applies to whole order unless placed separately â&#x20AC;¢ Orders cannot be cancelled once placed â&#x20AC;¢ Goods can not be returned if ordered incorrectly or if surplus stock is ordered

Technical Support Hotline: 0800 230 0898

5.28


TANDEMBOX SPACE TOWER COMPONENTS

SPACE TOWER | TANDEMBOX ANTARO Without BACKS & BASES

SPACE TOWER | TANDEMBOX ANTARO including glass sides Without BACKS & BASES

• BLUMOTION • Grey • 5 x Hinges and mounting plates for door • 4 x Deep drawers (D Height) + front • Gallery rails where applicable • 1 x Shallow drawer (M Height) + front

• BLUMOTION • Grey • 5 x Hinges and mounting plates for door • 4 x Deep drawers (D Height) + front • Gallery rails and glass where applicable • 1 x Shallow drawer (M Height) + front

Cabinet width

Depth

Order code

Cabinet width

Depth

Order code

300mm

450mm

STTB450/300

300mm

450mm

STTB450/300GL

400mm

450mm

STTB450/400

400mm

450mm

STTB450/400GL

450mm

450mm

STTB450/450

450mm

450mm

STTB450/450GL

500mm

450mm

STTB450/500

500mm

450mm

STTB450/500GL

600mm

450mm

STTB450/600

600mm

450mm

STTB450/600GL

300mm

500mm

STTB500/300

300mm

500mm

STTB500/300GL

400mm

500mm

STTB500/400

400mm

500mm

STTB500/400GL

450mm

500mm

STTB500/450

450mm

500mm

STTB500/450GL

500mm

500mm

STTB500/500

500mm

500mm

STTB500/500GL

600mm

500mm

STTB500/600

600mm

500mm

STTB500/600GL

SPACE TOWER | TANDEMBOX ANTARO With BACKS & BASES (MFC only)

SPACE TOWER | TANDEMBOX ANTARO including glass sides With BACKS & BASES (MFC only)

• BLUMOTION • Grey • 5 x Hinges and mounting plates for door • 4 x Deep drawers (D Height) + front • Gallery rails where applicable • 1 x Shallow drawer (M Height) + front

• BLUMOTION • Grey • 5 x Hinges and mounting plates for door • 4 x Deep drawers (D Height) + front • Gallery rails and glass where applicable • 1 x Shallow drawer (M Height) + front

Cabinet width

Depth

Order code

Cabinet width

Depth

Order code

300mm

450mm

STTB450/300KMFC

300mm

450mm

STTB450/300GLK

400mm

450mm

STTB450/400KMFC

400mm

450mm

STTB450/400GLK

450mm

450mm

STTB450/450KMFC

450mm

450mm

STTB450/450GLK

500mm

450mm

STTB450/500KMFC

500mm

450mm

STTB450/500GLK

600mm

450mm

STTB450/600KMFC

600mm

450mm

STTB450/600GLK

5.29

Order Online www.pws.co.uk


TANDEMBOX SPACE TOWER PRE-ASSEMBLED Supplied with pre-cut anti-slip drawer liner

â&#x20AC;¢ Grey

A

ND

EMB

O X

1.Ƶƫ'%0/%*(1 !ü2!$%*#!/Ä&#x2039;$!,(**%*# %((1/0.0%+*!(+3+*(5/$+3/"+1.$%*#!/Ä&#x2039;$%/%//1þ%!*0 for most applications as it allows for a maximum door weight of 16kg. Five hinges allow a door weight of up to 22kg.

TANDEMBOX ANTARO 4 x D height, 1 x M height

T

PLANNING (components and pre-assembled)

â&#x20AC;¢ 450mm depth

80

â&#x20AC;¢ Available with Steel or MFC back TANDEMBOX SPACE TOWER KIT COMES WITH:





4x D Height pre-assembled drawers



1x M Height pre-assembled drawer



.+*0ü4%*#.'!0/



Screws for runners and door fronts



5x Pairs of Tandembox Blumotion runners - 30kg



5x 155o nil protrusion hinges



Grey pre-cut drawer liner





STEEL BACK



1340



MFC BACK

Cabinet width

Order code

Order code

300mm

PSTT450/300STL

PSTT450/300MFC

400mm

PSTT450/400STL

PSTT450/400MFC

450mm

PSTT450/450STL

PSTT450/450MFC

500mm

PSTT450/500STL

PSTT450/500MFC

600mm

PSTT450/600STL

PSTT450/600MFC

SPACE TOWER | TANDEMBOX ANTARO including glass sides MFC BACK PSTTG450/300MFC

400mm

PSTTG450/400MFC

450mm

PSTTG450/450MFC

500mm

PSTTG450/500MFC

600mm

PSTTG450/600MFC



280



Order code

300mm

670





Cabinet width



â&#x20AC;¢ Additional 3-day lead time applies to whole order unless placed separately â&#x20AC;¢ Orders cannot be cancelled once placed â&#x20AC;¢ Goods can not be returned if ordered incorrectly or if surplus stock is ordered

Technical Support Hotline: 0800 230 0898

5.30


SERVO-DRIVE Ă˝!4 For electrical opening of handleless, built-in refrigerators. ÄĄ Ă˝!4*!1/! 3%0$*5/0* .  built-in refrigerators, combination fridge/freezers and freezers.

SERVO-DRIVE FLEX DRIVE UNIT

Order code

SERVO-DRIVE Ă˝!4

SDRIVE/FLEX

Drive unit for refrigerators, freezers and dishwashers, comes complete with combined plug/transformer, cabinet switch and wireless receiver

5.31

Order Online www.pws.co.uk

SERVO-DRIVEĂ˝!4%/ /5/0!)3$%$%//,!%Ăź((5 designed to suit the demands of everyday kitchen use.


RUNNERS FOR DOVETAIL MOVENTO+û!.//5*$.+*%/! Č"!0$!.ġ(%#$0 glide, 4-dimensional front adjustment, dynamic carrying capacities of 40 and 60kg, high stability and great rigidity. TANDEM full extensions provide full access to interiors. They open completely so you can get to the very back of drawers.

BLUMOTION By Blum

MOVENTO

TANDEM

Load-bearing classes. 40kg and 60kg carrying capacity, excellent sag values and high stability.

Gap design. New 4-dimensional easy-setting option for a precise gap design.

Gliding storage wonders. TANDEM gives you extra-wide, high and deep pull-outs, providing extra storage space. Technical Support Hotline: 0800 230 0898

5.32


MOVENTO FOR DOVETAIL The evolution of motion

MOTION

MOVENTO+û!.//5*$.+*%/! Č"!0$!.ġ(%#$0 glide, 4-dimensional front adjustment, dynamic carrying capacities of 40kg and 60kg, high stability and great rigidity.

New quality of motion – from opening to closing.

MOVENTO FULL EXTENSION DRAWER RUNNER Concealed 40kg OR 60kg

DRAWER RUNNERS (Pairs)

• BLUMOTION • Locking device included

• Concealed MOVENTO full extension runners with 40kg or 60kg

Order code MOVENTO

Length

Weight

MOV270/40

Concealed runners for wooden drawers

270mm

40kg

MOV450/40

Concealed runners for wooden drawers

450mm

40kg

MOV450/60

Concealed runners for wooden drawers

450mm

60kg

MOV500/40

Concealed runners for wooden drawers

500mm

40kg

MOV500/60

Concealed runners for wooden drawers

500mm

60kg

MOV550/60

Concealed runners for wooden drawers

550mm

60kg

MOV650/60

Concealed runners for wooden drawers

650mm

60kg

MOV750/60

Concealed runners for wooden drawers

750mm

60kg

dynamic load bearing

• Synchronised, feather-light glide • Tool-free side, height and tilt adjustment in locking device • Blumatic self-closing feature • Optional tool-free depth adjustment

SIDE STABILISATION SET FOR WIDER DRAWERS 800/900/1000/1200

• Built-in width and depth tolerance compensation

Order code

MOVENTO side stabilisation Length Cabinet width

ZS7M750MU

Full extension, for cutting to size

750mm

1400mm

DEPTH ADJUSTER* * The depth adjustment for MOVENTO can be implemented as an option for inset application setting range +/- 2mm

SPACE REQUIREMENT

Order code

MOVENTO depth adjuster

298.7601TV-KL Left hand, only recommended for inset/in-frame applications 298.7601TV-KR Right hand, only recommended for inset/in-frame applications

5.33

Order Online www.pws.co.uk


TANDEM FOR DOVETAIL The Blum runner system has been designed to meet all the requirements of everyday use.

TANDEM makes you feel good A feather-light glide, soft-close BLUMOTION – that’s what TANDEM’s all about. It’s the ease of use and quality of motion that inspire.

TANDEM FULL EXTENSION DRAWER RUNNER Concealed 30KG

DRAWER RUNNERS (Pairs)

• BLUMOTION • Locking device included Order code TANDEM

Length

Weight

TR270/30

Full-extension runners

270mm

30kg

TR450/30

Full-extension runners

450mm

30kg

• Concealed TANDEM full-extension runners, with either 30kg or 50kg dynamic load bearing

• TANDEM inside for unparalleled running action for the lifetime of the furniture

• Tool-free height adjustment in locking device • Built-in width and depth tolerance compensation • Built-in BLUMOTION"+./%(!*0*

!û+.0(!//Č/+"0(+/%*#0%+*

SPACE REQUIREMENT

Technical Support Hotline: 0800 230 0898

5.34


HINGES CHOOSING THE RIGHT HINGE There are many reasons to choose hinges from Blum: high quality, durability, easy assembly, +),.!$!*/%2!,.+ 10+û!.Č2.%!05+"/,!%( solutions and an attractive design. ǫ(1)Ě/!û+.0/.!+*!*0.0! +*,!."!0)+0%+* and are constantly searching for new ways to improve products and services. Discover these !*!ü0/"+.5+1./!("ċ

3 QUESTIONS YOU NEED TO ASK YOURSELF BEFORE YOU CHOOSE A HINGE: āċ

+3 +5+13*00+ü4%0ĕ

Ăċ

+3". +5+13*0%00++,!*ĕ

ăċ

+5+13*0%00+!/+"0ġ(+/!ĕ

NUMBER OF HINGES Door height (mm)

• The number of hinges depends on the door weight and front height • To achieve good stability, distances between hinges should be as large as possible • Information on weight and height apply to a standard door width of 600mm.

*kg

4 DIFFERENT HINGE TYPES MODUL 95o

• Long established Blum hinge • For Appliances – 95 Degree • Smaller than standard hinge • Good choice for applications where you will not be removing the doors, or want to prevent doors from being removed without tools

CLIP TOP

CLIP

• First generation of clip hinge • It allows doors to be removed without tools, and without loss of adjusted positions

• It has been replaced by the clip-top hinge in all but a few specialty applications

• Mounting plate and hinge held together by clip

CLIP TOP BLUMOTION

• Second generation of clip hinge • It allows doors to be removed without tools, and

• Third generation of clip hinges with integrated

without loss of adjusted positions • Fully adjustable and easily removable hinges • Can be adjusted in all 3 positions (horizontal, vertical and depth) after installation

• A switch on the hinge cup turns the soft-close

5.35

Order Online www.pws.co.uk

soft-close (BLUMOTION) ),%*#"!01.!+*+.+û

• Same features as CLIP TOP hinge


HINGE COMPONENTS 3 DIFFERENT HINGE COMPONENTS HINGE BOSS MOUNTING PLATE

HINGE ARM

THE BOSS - 4 %û!.!*0ü4%*#+,0%+*/

KNOCK-IN

EXPANDO

INSERTA

• Designed for quick installation with

• %*#!%/ü4! 0+0$! ++.3%0$

MINIPRESS machine • .!//ġ%*ü4%*# • Special press-in tool required • Ribbed dowels are pre-attached to the hinge

dowels that expand into place with screws • Works like a wall plug • Expanding dowels are pre-attached to the hinge and screwed in manually

• Premium hinge • ++(".!!ü4%*# • Install without screws • Cover of the hinge arm acts as lever, expanding the hinge dowels into predrilled recesses

SCREW-ON • Manual install

Technical Support Hotline: 0800 230 0898

5.36


THE ARM 3 DIFFERENT INSTALLATION SCENARIOS, 3 DIFFERENT HINGE TYPES

STRAIGHT

HALF CRANKED

FULLY CRANKED

OVERLAY HINGE

HALF OVERLAY (DUAL) HINGE

INSET HINGE

MOUNTING PLATES - ă %û!.!*005,!/0+$++/!".+)

CRUCIFORM

HORIZONTAL

2 PART PRESSED CRUCIFORM

• Pressed steel cruciform mounting

• Horizontal hinge mounting plates are

• Pressed steel cruciform mounting

plates are compatible with all Blum clip-top hinges. • Blum clip-top hinges simply clip to mounting plates; no tools required allowing speedy assembly. • W%0$0$!+,0%+*0+1/!0$%. ü4%*# point for wide angled hinges or heavy doors. • Single hand adjustment not possible

the latest innovation from Blum. • This plate gives a sleeker look than traditional mounting plates. • Built in clip top technology for easy attachment of cabinet doors. • Door height can be precisely adjusted within the built in cam screw. So no need to hold the door while adjusting. • ƫ*Ě0!1/! 3%0$+(.%(,.+ü(!ċ

plates are compatible with all Blum clip-top hinges. • Blum clip-top hinges simply clip to mounting plates; no tools required allowing speedy assembly. • Single hand adjustment. So no need to hold the door while adjusting

PERSONALISED COVER CAP • Printed with your logo for use with BLUM Clip, Clip-Top and Clip-Top BLUMOTION hinges

• Available in Nickel with standard printing colour black • Contact your Area Sales Manager or Customer Service Representative today to order your unique cover cap

• MOQ 1000 • 12-15 weeks lead time

5.37

Order Online www.pws.co.uk


MODUL

Suggested Mounting Plates for Hinges on this page For our full range of mounting plates & box quantity please go to page 5.49

175H3100

Horizontal Cam Screw On

173L8100

Pressed Cruciform

173H7100

2 part pressed Cruciform

SPECIAL APPLICATION HINGE SYSTEM BLUM MODUL 95° REFRIGERATOR/APPLIANCE HINGE • MODUL with spring closing mechanism • For refrigerator facade doors • Shallow hinge arm height • Slide-on hinge arm • All-metal hinge, nickel plated • 95° opening angle • Three-dimensional front adjustment with mounting plate (to be ordered separately)

PRODUCT KEY Screw-on boss

2

Boss cover cap

3

Order code

Overlay

91K9550 NEW 91K9550/250

Mounting plate

65

1

Product 1

Screw-on boss - sprung

1

Screw-on boss - sprung - BOX QUANTITY 250

70T3504

2

Boss cover cap

194K6100E

3

Mounting plate

CLIP HINGES BLUM CLIP 100° HINGE • All-metal hinge, nickel plated • 100° opening angle • Three-dimensional adjustment with relevant mounting plate (ordered separately)

• Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Overlay

Screw-on boss

2

Arm cover cap

3 BLUMOTION

Order code 71M2550 NEW 71M2550/250

Product 1

Screw-on boss - sprung

1

Screw-on boss - sprung - MOQ 250

90M2503

2

Arm cover cap

973A0500.01

3

BLUMOTION

Technical Support Hotline: 0800 230 0898

5.38


CLIP-TOP BLUM CLIP-TOP 110° HINGE • All-metal hinge, nickel plated • 110° opening angle • Convenient spiral-tech depth adjustment • Spring closing mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

3

Boss cover cap

5 BLUMOTION

4 Restrictor 86°

Order code

Overlay

71T3550

Product 1

Screw-on boss - sprung

1

Screw-on boss - sprung - BOX QUANTITY 250

70T3550.TL

1

Screw-on boss - unsprung

70.1503

2

Arm cover cap

70T3504

3

Boss cover cap

70T3553

4

Restrictor 86°

973A0500.01

5

BLUMOTION

NEW 71T3550/250

1.5MM HINGE BOSS SPACER Order code 70T3507.21

• Suitable for 71B3550/71T3550 with screw-on boss

• 1.5mm thick spacer • Finish: nylon, natural

5.39

Order Online www.pws.co.uk


CLIP-TOP

Suggested Mounting Plates for Hinges on this page For our full range of mounting plates & box quantity please go to page 5.49

175H3100

Horizontal Cam Screw On

173L8100

Pressed Cruciform

173H7100

2 part pressed Cruciform

BLUM CLIP-TOP 107° HINGE • All-metal hinge, nickel plated • 107° opening angle • Three-dimensional adjustment with relevant mounting plate (ordered separately)

• Convenient spiral-tech depth adjustment • With or without spring closing mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

3

Boss cover cap

4 BLUMOTION

Order code

Overlay

Product

75T1550

1

Screw-on boss - sprung

70.1503

2

Arm cover cap

70T1504

3

Boss cover cap

973A0500.01

4

BLUMOTION

BLUM CLIP-TOP 170° HINGE • All-metal hinge, nickel plated • 170° opening angle • Convenient spiral-tech depth adjustment • With or without spring closing mechanism • Tool-free door to cabinet assembly and removal. Safety information If young children have access to furniture, with wide angle hinges, then the 155° opening 0-protrusion hinges should be used.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

Overlay

3

BLUMOTION

Dual

Order code

B CLIP-TOP BLUMOTION T CLIP-TOP

Product

Order code

1

Screw-on boss - sprung

71T6650

1

NEW 71T6550/125

1

Screw-on boss - sprung - BOX QUANTITY 125

Screw-on boss - sprung

70T6550.TL

1

Screw-on boss - unsprung

973A6000

3

BLUMOTION

80.6507

2

Arm cover cap

973A6000

3

BLUMOTION

71T6550

Product

Technical Support Hotline: 0800 230 0898

5.40


CLIP-TOP

Suggested Mounting Plates for Hinges on this page For our full range of mounting plates & box quantity please go to page 5.49

175H3100

Horizontal Cam Screw On

173L8100

Pressed Cruciform

173H7100

2 part pressed Cruciform

BLUM CLIP-TOP 60° CORNER CABINET BI-FOLD HINGE • All-metal hinge, nickel plated • 60° opening angle • Special hinge for corner cabinets with bi-fold doors

• For door thickness 15mm to 23mm • Convenient spiral-tech depth adjustment • With spring closing mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

Basic Application

2

Arm cover cap

Order code 79T8500 NEW 79T8500/25 70.1503

5.41

Order Online www.pws.co.uk

Product 1

Screw-on boss - sprung

1

Screw-on boss - sprung - MOQ 25

2

Arm cover cap


CLIP TOP 110° HINGE Regardless of whether it’s wood, wide or narrow alu frames - the CLIP top 110° hinge +û!./3% !.*#!+",,(%0%+*/ċ

Technical Support Hotline: 0800 230 0898

5.42


CLIP-TOP BLUMOTION ONYX BLACK

CLIP-TOP BLUMOTION: Everything inside Slamming doors are a thing of the past. With CLIP-TOP BLUMOTION hinges, doors close silently because the BLUMOTION soft-close feature is built into the hinge cup. These hinges are also equipped with a deactivation switch, so even small and light3!%#$0 ++./(+/!!û+.0(!//(5!2!.50%)!ċ

NUMBER OF HINGES Door height (mm)

• The number of hinges required depends on the door weight and front height • To achieve good stability, distances between hinges should be as large as possible • Information on weight and height apply to a standard door width of 600mm.

*kg

BLUM CLIP-TOP 110° INTEGRATED BLUMOTION HINGE • With integrated BLUMOTION - deactivation option • All-metal hinge • 110° opening angle • Convenient spiral-tech depth adjustment • With spring closing mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Boss cover cap

3

4 Arm cover cap

Overlay

5.43

Order code

Product

71B3550.ONS

1

Screw-on boss

70T3504.ONS

2

Boss cover cap

70T3553

3

Restrictor 86°

70.1503.ONS

4

Arm cover cap

Order Online www.pws.co.uk

Restrictor 86°


CLIP-TOP BLUMOTION

BLUM CLIP-TOP BLUMOTION 95° PROFILE/THICK DOOR HINGE • %*#!"+.0$%' ++./*  ++./3%0$,.+ü(! • All-metal hinge • 95° opening angle and integrated BLUMOTION - deactivation option

• Convenient spiral-tech depth adjustment • With spring closing mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Overlay Order code

3 Arm cover cap

Boss cover cap

Dual

Product

Order code

71B9550.ONS

1

Screw-on boss - sprung

71B9650.ONS

1

Screw-on boss

70T3504.ONS

2

Boss cover cap

70T3504.ONS

2

Boss cover cap

70.1553.ONS

3

Arm cover cap

70.1663.ONS

3

Arm cover cap

Product

18.7

BLUM CLIP-TOP MOUNTING PLATE - HORIZONTAL CAM

58 .3

32

• 2mm height adjustment • Install with chipboard screws 3.5mm • Drilling template available Order code

Spacing

Finish

Height

175H3100.ONS

0mm

Onyx black

8.5mm

20

Technical Support Hotline: 0800 230 0898

5.44


CLIP-TOP BLUMOTION Nickel plated

BLUM CLIP-TOP 110° INTEGRATED BLUMOTION HINGE • With integrated Blumotion - deactivation option • All-metal hinge, nickel plated • 110° opening angle • Convenient spiral-tech depth adjustment • Closing spring mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on Screw-on boss

2 INSERTA boss/ EXPANDO

3

4 Boss cover cap

5 Restrictor 86°

6 Arm cover cap

1

Overlay

Arm cover cap

Dual

Order code

Inset

Product

Order code

1

Screw-on boss

71B3650

1

1

Screw-on boss - BOX QUANTITY 250

70T3504

4

Boss cover cap

70T3553

5

Restrictor 86°

2

INSERTA boss

70.1663

6

Arm cover cap

2

INSERTA boss - BOX QUANTITY 250

2

EXPANDO

70.1503

3

Arm cover cap

70T3504

4

Boss cover cap

70T3553

5

Restrictor 86°

71B3550 NEW 71B3550/250 71B3590 NEW 71B3590/250 71B358E

5.45

Order Online www.pws.co.uk

INSERTA/knock-in

Product

Order code

Screw-on boss

71B3750 NEW 71B3750/250

Product 1

Screw-on boss

1

Screw-on boss - BOX QUANTITY 250

70T3504

4

Boss cover cap

70T3553

5

Restrictor 86°

70.1663

6

Arm cover cap


CLIP-TOP BLUMOTION

Suggested Mounting Plates for Hinges on this page For our full range of mounting plates & box quantity please go to page 5.49

175H3100

Horizontal Cam Screw On

173L8100

Pressed Cruciform

173H7100

2 part pressed Cruciform

BLUM CLIP-TOP BLUMOTION 95° PROFILE/THICK DOOR HINGE • %*#!"+.0$%' ++./*  ++./3%0$,.+ü(! • All-metal hinge, nickel plated • 95° opening angle and integrated Blumotion deactivation option

• Convenient spiral-tech depth adjustment • Closing spring mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

3

Boss cover cap

4 Arm cover cap

Overlay

Inset Product

Order code

1

Screw-on boss - sprung

71B9750

70.1503

2

Arm cover cap

70T3504

3

Boss cover cap

Order code 71B9550

NEW 71B9750/50

Product 1

Screw-on boss - sprung

1

Screw-on boss - sprung - BOX QUANTITY 50

70T3504

3

Boss cover cap

70.1663

4

Arm cover cap

BLUM CLIP-TOP BLUMOTION 107° HINGE FOR THIN DOORS • All-metal hinge, nickel plated, with integrated Blumotion

• For door thicknesses starting from 15mm • 107° opening angle • Three-dimensional adjustment with relevant mounting plate (ordered separately)

• Convenient spiral-tech depth adjustment • Closing spring mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

3

Boss cover cap

Overlay Order code 75B1550

Product 1

Screw-on boss

70.1503

2

Arm cover cap

70T3504

3

Boss cover cap

Technical Support Hotline: 0800 230 0898

5.46


CLIP-TOP BLUMOTION

BLUM CLIP-TOP BLUMOTION +45° II ANGLED HINGES 110° • With integrated Blumotion • All-metal hinge, nickel plated • +45° angled hinge • 110° opening angle • Three-dimensional front adjustment • Convenient spiral-tech depth adjustment • Tool-free door to cabinet assembly and removal • Mounting plates to be ordered separately. 14

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

3

Boss cover cap

Overlay +45° Order code

Product

79B3558

1

Screw-on boss - sprung

70.1503

2

Arm cover cap

70T3504

3

Boss cover cap

BLUM CLIP-TOP BLUMOTION BLIND CORNER HINGE, INSET APPLICATION • With integrated Blumotion - deactivation option • All-metal hinge, nickel plated • 95° opening angle • Three-dimensional front adjustment • Convenient spiral-tech depth adjustment • Tool-free door to cabinet assembly and removal • Requires 3mm spaced mounting plate, to be ordered separately.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

Inset with BLUMOTION

Order code

Product

79B9550

1

Screw-on boss

70.1503

2

Arm cover cap

70T3504

3

Boss cover cap

5.47

Order Online www.pws.co.uk

3

Boss cover cap


CLIP-TOP BLUMOTION

Suggested Mounting Plates for Hinges on this page For our full range of mounting plates & box quantity please go to page 5.49

175H3100

Horizontal Cam Screw On

173L8100

Pressed Cruciform

173H7100

2 part pressed Cruciform

BLUM CLIP-TOP BLUMOTION ZERO PROTRUSION HINGES - 125° OR 155° • All-metal hinge, nickel plated • 155° for doors up to 24mm. 125° for doors up to 35mm

• For cabinets with inner drawers or pull-outs • Convenient spiral-tech depth adjustment • With or without closing spring mechanism • Tool-free door to cabinet assembly and removal.

PRODUCT KEY Screw-on 1

Screw-on boss

2

Arm cover cap

3

Restrictor

Overlay 125° Order code

Product

71B7550D

1

Sprung hinge with BLUMOTION

70T7553

3

Restrictor 92°

Overlay 155° Order code

Product

71T7550*

1

Sprung hinge with CLIP TOP

71B7550*

1

Sprung hinge with BLUMOTION

1

Sprung hinge with BLUMOTION - BOX QUANTITY 125

70.4503

2

Arm cover cap

70T7553.09

3

Restrictor 92°

70T7553

3

Restrictor 110°

70T7500NTL

1

Screw-on boss - unsprung

70T7503N09

3

Restrictor 92°

NEW 71B7550/125*

*Both hinges can be used in combination with each other. Example: Units requiring 5 hinges; 3 could be 71B7550 & 2 could be 71T7550

Technical Support Hotline: 0800 230 0898

5.48


CLIP MOUNTING PLATES BLUM CLIP MOUNTING PLATE - HORIZONTAL CAM EXPANDO â&#x20AC;¢ +/- 2mm height adjustment â&#x20AC;¢ Ƶü4%*#Ĩ,.!Ä¡)+1*0!  screws with split dowels)

â&#x20AC;¢ Drilling template available â&#x20AC;¢ Install with additional screw if used with wide angle hinges. Order code Spacing Finish

Height

177H3100E

8.5mm

0mm

Nickel plated

18.7

BLUM CLIP MOUNTING PLATE - HORIZONTAL CAM SCREW-ON â&#x20AC;¢ +/- 2mm height adjustment â&#x20AC;¢ Fix with chipboard screws 3.5mm â&#x20AC;¢ Drilling template available â&#x20AC;¢ Install with additional screw if used with wide angle hinges

58

.3

32

20

Order code Spacing Finish

Height

175H3100

0mm

Nickel plated

8.5mm

NEW BOX QUANTITY 500 175H3100/500 0mm

Nickel plated

8.5mm

BLUM CLIP MOUNTING PLATE - PRESSED CRUCIFORM â&#x20AC;¢ +/- 3mm height adjustment â&#x20AC;¢ Fix with chipboard screws Ã&#x2DC;3.5 or 4mm

53

(recommended screw length 15mm)

â&#x20AC;¢ Drilling template available â&#x20AC;¢ Install with additional screw if used with wide angle hinges

57

Order code Spacing Finish

Height

173L6100

8.5mm

0mm

Zinc plated

NEW BOX QUANTITY 500 173L8100/500 0mm

Zinc plated

8.5mm

Zinc plated

11.5mm

173L6130

3mm

BLUM CLIP MOUNTING PLATE - PRESSED CRUCIFORM â&#x20AC;¢ +/- 3mm height adjustment â&#x20AC;¢ Pre-mounted system screws included min 11.5

53

Ã&#x2DC;6mm

â&#x20AC;¢ Drilling template available â&#x20AC;¢ Install with additional screw if used with wide angle hinges

57

Order code Spacing Finish

Height

173L8100

0mm

Nickel plated

8.5mm

173L8130

3mm

Nickel plated

11.5mm

BLUM CLIP MOUNTING PLATE - PRESSED CRUCIFORM â&#x20AC;¢ +/- 2mm height adjustment â&#x20AC;¢ Pre-mounted screws with split dowels included 53

min 11.5

57

5.49

Order Online www.pws.co.uk

â&#x20AC;¢ Drilling template available â&#x20AC;¢ Install with additional screw if used with wide angle hinges Order code Spacing Finish

Height

174E6100.01

8.5mm

0mm

Nickel plated


CLIP MOUNTING PLATES

BLUM CLIP MOUNTING PLATE - 2 PART PRESSED CRUCIFORM • +/- 2mm height adjustment • Install with chipboard screws Ø3.5 or 4mm 56

(recommended screw length 15mm)

57

• Drilling template available • Install with additional screw if used with wide angle hinges Order code Spacing Finish

Height

173H7100

0mm

Nickel plated

8.5mm

NEW BOX QUANTITY 500 173H1700/500 0mm

Nickel plated

8.5mm

BLUM CLIP MOUNTING PLATE - 2 PART PRESSED CRUCIFORM • +/- 2mm height adjustment • Pre-mounted screws with split min 11.5

56

dowels included

57

• Drilling template available • Install with additional screw if used with wide angle hinges Order code Spacing Finish

Height

174H7100E

8.5mm

0mm

Nickel plated

BLUM CLIP MOUNTING PLATE - 2 PART CAST CRUCIFORM

min 11.5

44

• +/- 2mm height adjustment • Install with Euro or system screws • Drilling template available • Install with additional screw if used 68

with wide angle hinges Order code Spacing Finish

Height

175H9100

8.5mm

0mm

Nickel plated

BLUM CLIP MOUNTING PLATE - 2 PART CAST CRUCIFORM • +/- 2mm height adjustment • Install with chipboard screws Ø3.5 or 4mm 44

(recommended screw length 16mm)

68

• Drilling template available • Install with additional screw if used with wide angle hinges Order code Spacing Finish

Height

175H7100

0mm

Nickel plated

8.5mm

175H7190

9mm

Nickel plated

17.5mm

Technical Support Hotline: 0800 230 0898

5.50


IN-FRAME IN-FRAME AND 1909 IN-FRAME HINGES • With integrated BLUMOTION • Tool-free assembly and removal • With closing spring mechanism Order code

IN-FRAME - UP TO 21MM THICK FRONTALS

71B3750

CLIP-TOP BLUMOTION inset standard hinge 110° - screw-on.

71T6650

CLIP-TOP half overlay wide angle hinge 170° - screw-on. 973A6000 BLUMOTION softclose mechanism for attachment to 170° can be used.

Order code

1909 IN-FRAME

71B9750

CLIP-TOP BLUMOTION inset ,.+ü(! ++.$%*ge 95° - screw-on.

CLIP MOUNTING PLATE • 18mm • Nickel plated • Zinc material Order code Product 175H9190.22

CLIP mounting plate

IN-FRAME DOOR INSTALLATION 18

39

Recommended distance

175H9190.22 extra-deep mounting plate 71B3750 110° CLIP-TOP

• Horizontal section through face of cabinet IFDS1 door 1û!..'!0

ăĂĀă1û!.

5 Recommended distance

Door

Frame

GREY NYLON 9MM CONNECTOR • Nylon connector used in conjunction with the 175H9190.22 CLIP mounting plate when using the 71T6650 170° CLIP-TOP hinge/or 71B7650 155° CLIP-TOP hinge. Order code Product DB181.619

Grey nylon 9mm connector

IN-FRAME SPACER, FOR USE WITH LEGRABOX • Nylon, injection moulded spacer for use with In-Frame kitchens.

• Colour matched to Blum Legrabox. • 4 required per drawer box, packed quantities of 4.

5.51

Order Online www.pws.co.uk

Order code

Product

IFSLEGRABOX

IN-FRAME Spacer, for use with Legrabox.


IN-FRAME

IN-FRAME AND 1909 IN-FRAME HINGES OVERVIEW Pre-bagged packs containing the common +),+*!*0/.!-1%.! "+.ü00%*#%*ġ".)! ++./ċ FITTING PACK 1

ORDER CODE INFP1

Suitable for IN-FRAME doors up to a height of 900mm Includes: x5 euroscrews, x10 roundhead screws, 4Ć".)!.'!0/Č4Ă ++./0+,/Č4Ă ++.1û!./Č x2 110° hinges, x2 base plates.

FITTING PACK 2

ORDER CODE INFP2

Suitable for in-frame doors between 900mm and 1600mm Includes: x5 euroscrews, x10 roundhead screws, 4Ć".)!.'!0/Č4Ă ++./0+,/Č4Ă ++.1û!./Č x3 110° hinges, x3 base plates

FITTING PACK 3

ORDER CODE INFP3

Suitable for in-frame-only options Includes: x5 euroscrews, x10 roundhead screws, 4Ć".)!.'!0/Č4Ă ++./0+,/Č4Ă ++.1û!./

FITTING PACK 4

ORDER CODE INFP4

Suitable for corner solutions Includes: x5 euroscrews, x10 roundhead screws, 4Ć".)!.'!0/Č4Ă ++./0+,/Č4Ă ++.1û!./Č x2 110° hinges, x2 corner unit hinges, x4 base plates

1909 ġ *ġ".)!ü00%*#/,'Č/!!/!0%+*Ċċ

Fitting Pack 1 shown

TIP-ON ACCESSORIES ADJUSTABLE TIP-ON SHORT PUSH LATCH • Handleless fronts open with a single

mi

touch, using the TIP-ON mechanical opening system by Blum. • To close, simply press shut. TIP-ON is combined with the unsprung CLIP-TOP hinge to deliver optimum door motion. • 4mm Gap adjustment

n5

0 1/2

1/2

0.6 Order code

Product

Finish

956.1004

Piston and catch plates

Grey

ADAPTER PLATE Order code

Product

956.1201

Inline adapter plate – short version

ADJUSTABLE TIP-ON EXTENDED PUSH LATCH FOR SPRUNG HINGES 76

mi

n

• Fixing method: drilling, handle side • Non-magnetic

Ø 10

0.6

Order code

Finish

956A1006

Grey

38

ADAPTER PLATE Order code

Product

956A1201

Inline adapter plate – long version

Technical Support Hotline: 0800 230 0898

5.52


5.53

Order Online www.pws.co.uk


AVENTOS HK-XS

FOR HANDLE WEIGHTS VISIT PWS.CO.UK

AVENTOS HK-XS is a compact lifter for wall cabinets. The AVENTOS HK-XS +û!./$%#$(!2!(+" !/%#*".!! +)Ä&#x152; 1!0+%0/*..+3/05(!Ä&#x2039;

BLUMOTION By Blum

AVENTOS HK-XS proves itself with the familiar AVENTOS quality of motion. Stay lifts open and close with seemingly weightless movement. They close /%(!*0(5* !û+.0(!//(5%*+)%*0%+*3%0$CLIP-TOP BLUMOTION hinges.

AVENTOS HK-XS â&#x20AC;¢ ,!%ü((5"+./)((0+,3((%*!0/+.0$+/!3%0$(+3%*0!.*( !,0$/ â&#x20AC;¢ Symmetrical lift mechanism, can be used on one or both sides for heavier frontals. â&#x20AC;¢ %(!*0* !û+.0(!//(+/%*#Ä&#x152;0$*'/0+Ç«    â&#x20AC;¢ Stops at any opening position â&#x20AC;¢ Easy assembly and adjustment

Order code Power factor AVHKXS1000 200 - 1000 AVHKXS1800 800 - 1800

Power factor LF = cabinet height KH (mm) x door weight incl. double handle weight (kg)

Note: The power factor is doubled when used on two sides

Technical Support Hotline: 0800 230 0898

5.54


JIGS AND TEMPLATES Tried and tested in everyday applications, Blum template and assembly devices ensure that //!)(5%//%),(!Č!þ%!*0* /0.%#$0"+.3. ċ They are a perfect combination of high precision and practical value, which is greatly appreciated both in workshops and directly on site. Ease of use and durability make them essential tools and guarantee top-quality assembly that inspires professionals. Drilling and insertion machines Blum’s drilling and insertion machines are designed for the assembly of Blum products. They !*(!,.!%/%+* .%((%*#* %*/!.0%+*+"ü00%*#/ċ

MINIPRESS M Drilling and insertion machines Precision drilling and component insertion.

LEGRABOX ASSEMBLY DEVICE FOR DRAWERS Assembly devices and machines Fast and easy ways to assemble drawers and pull-outs.

5.55

Order Online www.pws.co.uk


JIGS AND TEMPLATES

FRONT GAP TEMPLATE Assembly templates Measurements are transferred precisely and with ease.

Assembly templates Blum templates make it easy to transfer exact measurements to cabinets or frontals. They are easy to use and ensure precise assembly.

Assembly devices and machines Blum assembly devices and machines help you assemble drawers and pull-outs. They ensure ease of use with quick set-up times. Available on a 5 day leadtime.

MINIPRESS P The specialist tool Order code M53.1050.01MP

DRILL BITS

PAGE 5.60

Description Single phase 240V Blum MINIPRESS P machine c/w hold down clamps, laser centre marking, calibrated table, 2 rules & drill bits 35mm & 8mm dia. Requires compressed air supply.

MINIPRESS M The mobile tool Order code M52.1050M

DRILL BITS

PAGE 5.60

Description Single phase 240V Blum MINIPRESS M machine. NOTE bench is not supplied with this machine.

Technical Support Hotline: 0800 230 0898

5.56


JIGS AND TEMPLATES

BASE ROUTER For LEGRABOX Order code M35.7300 Description Base router for LEGRABOX.

ECODRILL Door Hinge Drilling Order code M31.1000 Description Blum ECODRILL for on-site door drilling for hinges.

DRILLING TEMPLATES FOR BLUMOTION/TIP-ON Order code 65.5010 Description Drilling template for BLUMOTION/TIP-ON

FOR LEGRABOX BASE/BACK Order code ZML.7000 Description Drilling template for LEGRABOX base/back.

5.57

Order Online www.pws.co.uk


JIGS AND TEMPLATES

DRILLING TEMPLATES FOR MOVENTO/TANDEM Order code T65.1000.02 Description Drilling template for MOVENTO/TANDEM

FOR HINGES & MOUNTING PLATES Order code 65.7500.03 Description Drilling template for hinges & mounting plates on 1000mm rail

FOR HINGES & MOUNTING PLATES Order code 65.059A Description Drilling template for hinges & mounting plates

UNIVERSAL BRACKET TEMPLATE Order code ZML.0040.01 Description *%2!./( .%((%*#0!),(0!"+.".+*0ġü4%*#.'!0/!0

Technical Support Hotline: 0800 230 0898

5.58


JIGS AND TEMPLATES

DRILLING TEMPLATES UNIVERSAL ROD TEMPLATE Order code 65.1000.01 Description Universal rod template for runners.

UNIVERSAL INDIVIDUAL TEMPLATE Order code 65.1051.02 Description Template for mounting plates, runners and AVENTOS.

FRONT GAP TEMPLATE Order code 65.5631 Description Front gap template for LEGRABOX/MOVENTO for use with TIP-ON BLUMOTION

5.59

Order Online www.pws.co.uk


JIGS AND TEMPLATES

ASSEMBLY DEVICES FOR DRAWERS LEGRABOX Order code ZMM.0700L Description Assembly device for LEGRABOX drawers.

TANDEMBOX Order code ZMM.0350T Description Assembly device for TANDEMBOX drawers.

DRILL BITS 2.5mm

8mm

35mm

Order code

Description

Order code

Description

Order code

Description

M01.ZB35.02

RH Rotation on 10mm dia shank 3%0$ý0ČĆĈmm OAL

M01.ZB08.03

LH Rotation on 10mm dia shank 3%0$ý0ČĆĈmm OAL

M01.ZB02.D3

LH Rotation on 10mm dia shank 3%0$ý0ČĆĈmm OAL

NARROW SWIVEL STOPS Left hand

Right hand

Order code

Description

Order code

Description

MZS.2000LI

Narrow swivel stop LH to suit Blum MINIPRESS

MZS.2000RE

Narrow swivel stop RH to suit Blum MINIPRESS

Technical Support Hotline: 0800 230 0898

5.60


EASY ASSEMBLY APP YOUR DIGITAL ASSEMBLY TOOL Youâ&#x20AC;&#x2122;d like to assemble and adjust Blum hinges, lift systems, pull-outs and other ü00%*#//5/0!)/-1%'(5* !þ%!*0(5Ä&#x2022; The EASY ASSEMBLY app for smartphones and tablets answers any questions you may have about the assembly and adjustment +"Ç«(1)ü00%*#/Ä&#x2039;$!,,%*(1 !///!)(5 instructions and assembly videos for all Blum products.

DOWNLOAD

INTUITIVE APP

Download the EASY ASSEMBLY app now free of charge from the Apple App Store (for iOS) or Google Playstore (for Android) onto your smartphone or tablet!

EASY ASSEMBLY includes an overview of all assembly and installation instructions, arranged by product group. The assembly app has been designed to be intuitive, making it easy to use.

ASSEMBLY INSTRUCTIONS

INTERACTIVE APPLICATIONS

Up-to-date assembly and installation instructions at your ü*#!.0%,/Ä&#x2039;$%//2!/ time and ensures that furniture is assembled to the highest standard.

Interactive applications clearly indicate the right drilling positions and show you how to adjust Ç«(1)ü00%*#/Ä&#x2039;

ASSEMBLY VIDEOS

LIVE SUPPORT

Assembly videos demonstrate each individual work step and show adjustment options in detail.

5.61

Order Online www.pws.co.uk

More questions about the assembly or adjustment of Blum ü00%*#/Ä&#x2022;!Ä&#x161; !#(  to provide personal assistance. Our LIVE /!.2%!+û!./ a chat or video call feature.


Technical Support Hotline: 0800 230 0898

5.62


6 DRAWER ORGANISATION

KONFIGURE BY KESSEBÃ&#x2013;HMER

01

Shallow internal drawer sets

03

Deep internal drawer sets

07

Individual products

09

Drawer liners

10

DRAWER ACCESSORIES

11

Cutlery inserts

11

Plate holders

13

Timber drawer accessories

13

Oak drawer accessories

14

LEGRABOX accessories

15

In-frame dovetail drawer accessories 16 Spice drawers

PULL-OUT BASKETS

19

20

NOTE None of the props shown in this section are included For drawer systems please see section 5 - Blum Collection


6.02

Order Online www.pws.co.uk


KONFIGURE BY KESSEBÖHMER +*ü#1.!5 !//!®$)!.%//01**%*#+*0!),+..5Č)+ 1(.* 1/0+)%/(!/0+.#!/5/0!)Č+û!.%*# +),(!0!2!./0%(%05* ý!4%%(%05ċ Based around 17 modular productsČ2%((!/individual components or as ready-made setsČ +*ü#1.! ,.+2% !/0%(+.) !/+(10%+*/"+.((1/!/".+)10(!.50+"++ /0+.#!ċ *1"01.! %*+'Č%0%/ !/%#*!  "+.1/!%* .3!./Č/!,1((ġ+10/* ,1((ġ+10(. !./Ď+û!.%*#+0$,.0%(* 00.0%2!/0+.#!ċ

HOW IT WORKS

$!)+ 1(.* ý!4%(!*01.!+"0$!.*#!)!*/0$00$%/,.+ 10 +!/*+0*!! 0+ü0ý1/$0+0$!/% !/ as any voids can be utilised as functional compartments.

DRAWER COMPATIBILITY +*ü#1.!%/+),0%(!3%0$((+))+* .3!. /5/0!)/Č%*(1 %*#ǫ(1)Č!00%$* .//ċ +*ü#1.! can be accommodated in 450mm and 500mm deep drawers up to a width of 1000mm. 500mm

450mm

T: 01325 505599 (North) | 88 (South)

6.02


SHALLOW INTERNAL DRAWER SETS 1..*#!+" 24 ready-made shallow drawer sets+Ăť!.0$!% !(/0+.#!* +.#*%/0%+*/+(10%+*/"+."++  ,.!,.0%+*%0!)/Ä&#x152;10(!.5Ä&#x152;10!*/%(/* )+.!Ä&#x2039;!/%#*! 0+Ăź0 .3!./".+)300-1000mm wide and with a depth of 450mmÄ&#x152;0$!5*!!40!* ! 0+Ăź0500mm .3!./3$!*1/%*#!,0$40!*/%+*Ä&#x2039;

Drawer width 300mm

400mm

SET 1

*

â&#x20AC;˘ Multipurpose insert

Order code

Order code

DS300/SET1

DS400/SET1

â&#x20AC;˘ Cross divider

â&#x20AC;˘ Cutlery insert * This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))

SET 2

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))

â&#x20AC;˘ Multipurpose insert

Order code

Order code

DS300/SET2

DS400/SET2

â&#x20AC;˘ Knife block

â&#x20AC;˘ Ä&#x201A;4)1(0%,1.,+/!%*/!.0 â&#x20AC;˘ Spice holder

â&#x20AC;˘ Cross divider

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))

SET 3

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))

â&#x20AC;˘ Multipurpose insert

Order code

Order code

DS300/SET3

DS400/SET3

â&#x20AC;˘ Spice holder

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))

6.03

Order Online www.pws.co.uk

â&#x20AC;˘ Ä&#x2026;4Box 1

â&#x20AC;˘ Ä&#x201A;4)!0( %2% !.Box 1

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))


ĵ!/%#*+"10(!.5%*/!.0/)52.5".+)0$+/!/$+3*Č,(!/!.!"!.0+,#!ćċĀĊ"+.%* %2% 1( !/%#*/ Accessories not included

Drawer width 450mm

500mm *

*

Order code

Order code

DS450/SET1

DS500/SET1

• Cutlery insert

• Cutlery insert

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*č40!.*(3% 0$)%*1/ĉĀ))

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*č40!.*(3% 0$)%*1/ĉĀ))

Order code

Order code

DS450/SET2

DS500/SET2

• Ă4)1(0%,1.,+/!%*/!.0• Knife block • Cross divider

• Ă4)1(0%,1.,+/!%*/!.0 • Foil/Film dispenser

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*č40!.*(3% 0$)%*1/ĉĀ))

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*č40!.*(3% 0$)%*1/ĉĀ))

• ą4Box 1

• Cross divider

Order code

Order code

DS450/SET3

DS500/SET3

•Ă4)!0( %2% !.Box 1

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*č40!.*(3% 0$)%*1/ĉĀ))

• ą4Box 1

•Ă4)!0( %2% !.Box 1

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*č40!.*(3% 0$)%*1/ĉĀ))

T: 01325 505599 (North) | 88 (South)

6.04


SHALLOW INTERNAL DRAWER SETS 1..*#!+" 24 ready-made shallow drawer sets+Ăť!.0$!% !(/0+.#!* +.#*%/0%+*/+(10%+*/"+."++  ,.!,.0%+*%0!)/Ä&#x152;10(!.5Ä&#x152;10!*/%(/* )+.!Ä&#x2039;!/%#*! 0+Ăź0 .3!./".+)300-1000mm wide and with a depth of 450mmÄ&#x152;0$!5*!!40!* ! 0+Ăź0500mm .3!./3$!*1/%*#!,0$40!*/%+*Ä&#x2039;

Drawer width 600mm

800mm *

SET 1

*

Order code

Order code

DS600/SET1

DS800/SET1

â&#x20AC;˘ Cutlery insert * This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))

â&#x20AC;˘ Cutlery insert â&#x20AC;˘ Ä&#x2026;4Box 1 â&#x20AC;˘ Ä&#x201A;4)!0( %2% !.Box 1

â&#x20AC;˘Ä&#x201A;4+**!0%+*(%,

*

SET 2

*

â&#x20AC;˘ Cutlery insert â&#x20AC;˘ Knife block

Order code

Order code

DS600/SET2

DS800/SET2

â&#x20AC;˘ Multipurpose insert

* This set is recommended for use with drawers with an internal  3% 0$0$0%/%##!.0$*Ä?40!.*(3% 0$)%*1/Ä&#x2030;Ä&#x20AC;))

SET 3

* This set is recommended for use with drawers with an internal width that is %##!.0$*Ä? 40!.*(3% 0$ minus 80mm

â&#x20AC;˘ Ä&#x2026;4Box 1 â&#x20AC;˘ Multipurpose insert â&#x20AC;˘ Ä&#x201A;4+**!0%+*(%,

6.05

â&#x20AC;˘ Cutlery insert â&#x20AC;˘ Multipurpose insert â&#x20AC;˘ Knife block

Order code

Order code

DS600/SET3

DS800/SET3

â&#x20AC;˘ Foil/Film dispenser â&#x20AC;˘Ä&#x201A;4)!0( %2% !.Box 1

Order Online www.pws.co.uk

â&#x20AC;˘ Ä&#x2026;4Box 1 â&#x20AC;˘ Multipurpose insert â&#x20AC;˘ Ä&#x201A;4+**!0%+*(%,

â&#x20AC;˘ Spice holder â&#x20AC;˘Ä&#x201A;4)!0( %2% !.Box 1


ĵ!/%#*+"10(!.5%*/!.0/)52.5".+)0$+/!/$+3*Č,(!/!.!"!.0+,#!ćċĀĊ"+.%* %2% 1( !/%#*/ Accessories not included

Drawer width 900mm

1000mm *

*

Order code

Order code

DS900/SET1

DS1000/SET1

• Cutlery insert • ą4Box 1 • Ă4)!0( %2% !.Box 1

•Ă4+**!0%+*(%,

• ą4Box 1 • Ă4)!0( %2% !.Box 1 • Cutlery insert

• Multipurpose insert • Foil/Film dispenser •Ă4+**!0%+*(%,

*

*

Order code

Order code

DS900/SET2

DS1000/SET2

• Cutlery insert • Ă4)1(0%,1.,+/!%*/!.0 • Knife block

• Foil/Film dispenser

• Cutlery insert • Ă4)1(0%,1.,+/!%*/!.0 • Knife block

• Spice holder

*

• ą4Box 1 • Multipurpose insert

Order code

Order code

DS900/SET3

DS1000/SET3

• Spice holder •Ă4)!0( %2% !.Box 1

• Cutlery insert • Multipurpose insert • Knife block

•Ă4Box 4 • Metal divider Box 4

T: 01325 505599 (North) | 88 (South)

6.06


DEEP INTERNAL DRAWER SETS Our selection of 15 deep drawer sets+û!.*+ûġ0$!ġ/$!("/+(10%+*"+./0+.%*#+*/1)(!/Č++'3.!Č,+0/*  ,*/ċ!/%#*! 0+ü0 .3!./3%0$depth of 450mm, they are available in 500-1000mm wide sets.

Drawer width 600mm

800mm

SET 1

500mm

Order code

Order code

Order code

DD500/SET1

DD600/SET1

DD800/SET1

• Ă4Box 5 • Box 3 • Metal divider Box 2 and 3

• ą4Box 3 • Ă4)!0( %2% !.Box 2 and 3

SET 2

• Ă4Box 5 • Box 3 • Metal divider Box 2 and 3

Order code

Order code

Order code

DD500/SET2

DD600/SET2

DD800/SET2

• Ă4Box 3 • Metal divider Box 2 and 3

• • • •

Box 3 Ă4Box 5 Metal divider Box 2 and 3 Plate rack

SET 3

• Ă4Box 3 • Metal divider Box 2 and 3

Order code

Order code

Order code

DD500/SET3

DD600/SET3

DD800/SET3

• Box 2 • Metal divider Box 2 and 3

6.07

Order Online www.pws.co.uk

• Box 2 • Metal divider Box 2 and 3

• Box 2 • Metal divider Box 2 and 3


Accessories not included

Drawer width 900mm

Order code

Order code

DD900/SET1

DD1000/SET1

• ą4Box 3 • Ă4)!0( %2% !.Box 2 and 3

• • • •

1000mm

• ą4Box 3 • Metal divider Box 2 and 3

Order code

Order code

DD900/SET2

DD1000/SET2

Box 3 Ă4Box 5 Metal divider Box 2 and 3 Plate rack

• • • •

Box 3 Ă4Box 5 Metal divider Box 2 and 3 Ă4,(0!.'

Order code

Order code

DD900/SET3

DD1000/SET3

• Ă4Box 3 • Metal divider Box 2 and 3 • Plate rack

• Ă4Box 3 • Metal divider Box 2 and 3 • Plate rack

T: 01325 505599 (North) | 88 (South)

6.08


KONFIGURE BY KESSEBÖHMER INDIVIDUAL PRODUCTS 1%0(!"+.č

+.+),(!0!,!./+*(%/0%+*5+1*+. !. +*ü#1.!,.+ 10/%* %2% 1((5ċ .+))1(0%,1.,+/!+4!/0+10(!.5%*/!.0/* /,%!$+( !./Č%0Ě/(($!.!ċ If you prefer a ready-made solution see our Shallow Drawer Sets+*,#! 6.05 and our Deep Drawer Sets+*,#!ćċĀĈċ

6.09

Shallow Drawer Deep Drawer Pull Out Base Unit/Larder

BOX 1

BOX 2

Order code

Order code

TIB300OA

TIMB211X422OA

• 1(0%,1.,+/!ǫ+4ā"+.  shallow drawer • ăĀĀ4āĀĆ4ąĊ)) • Oak

• 1(0%,1.,+/!ǫ+4Ă"+.  deep drawer • Ăāā4ąĂĂ4āāĀ)) • Oak

BOX 3

BOX 4

Order code

Order code

TIMB211X236OA

TIMBOX211OA

• 1(0%,1.,+/!ǫ+4ă"+.  deep drawer and larder • Ăāā4Ăăć4āāĀ)) • Oak

• 1(0%,1.,+/!ǫ+4ą"+. shallow drawer and larder • Ăāā4Ăăć4ąĊ)) • Oak

BOX 5

CUTLERY INSERT

Order code

Order code

TIMB211X117OA

TICI300OA

đ 1(0%,1.,+/!ǫ+4Ć"+.  deep drawer and larder đ Ăāā4āāĈċĆ4ĊĀ)) • Oak

• ăĀĀ4ąĂĂ4ąĊ)) • Oak

MULTIPURPOSE INSERT

CROSS DIVIDER*

Order code

Order code

TIMI152OA

TICD137OA

• āĆĂ4ąĂĂ4ăĊ)) • Oak • For use with*

• āăĈ4ąĂĂ4ăĈċĆ)) • Oak

FOIL/FILM DISPENSER*

SPICE HOLDER*

Order code

Order code

TIFD137OA

TISSH137OA

đ āăĈ4ąĂĂ4ąĆ)) • Oak/aluminium

• Stepped spice holder • āăĈ4ąĂĂ4Ăć)) • Oak

KNIFE BLOCK*

PLATE RACK

Order code

Order code

TIKB137OA

TIPR340OA

đ āăĈ4ąĂĂ4ąĆ)) • Oak

• • • •

Order Online www.pws.co.uk

Plate rack for deep drawer ăąĀ4āĉĀ4āĊā)) Oak Adjustable

* for use with multipurpose insert


METAL DIVIDER BOX 1

METAL DIVIDER BOX 2 & 3

Order code

Order code

MDIVBOX1

MDIVBOX2/3

â&#x20AC;˘ Metal divider for  )1(0%,1.,+/!ÇŤ+4Ä â&#x20AC;˘ Ä&#x160;Ä&#x2020;4Ä Ä Ä 4Ä&#x2026;Ä&#x192;))

â&#x20AC;˘ Metal divider for  )1(0%,1.,+/!ÇŤ+4Ä&#x201A;* Ä&#x192; â&#x20AC;˘ Ä&#x201A;Ä&#x20AC;Ä&#x20AC;4Ä&#x160;Ä&#x160;4Ä Ä&#x20AC;Ä&#x201A;))

METAL DIVIDER BOX 4

CONNECTION CLIP

Order code

Order code

MDIVBOX4

DRAWERCLIP

â&#x20AC;˘ Metal divider for  )1(0%,1.,+/!ÇŤ+4Ä&#x2026; â&#x20AC;˘ Ä Ä&#x160;Ä&#x2021;4Ä&#x201A;Ä Ä&#x192;4Ä&#x2021;))

â&#x20AC;˘ Branded connection clips for drawer inserts â&#x20AC;˘ Ä&#x2026;Ä&#x20AC;4Ä Ä&#x192;4Ä Ä&#x201A;)) â&#x20AC;˘ ĆŤ+**!0* Ăź4%*,(! your individual drawer  %*/!.0/0+.!0!*5 !/%#*

DRAWER DEPTH EXTENSION Extra deep drawers? 1. !,0$!40!*/%+*%*/!.0((+3/5+10+1/! +*Ăź#1.!%* .3!./0$0.!Ä&#x2020;Ä&#x20AC;Ä&#x20AC;)) !!,Ä&#x2039; â&#x20AC;˘ ĆŤ100+Ăź0Ä&#x152;((+3%*#1/!.+//(( .3!. widths.

Order code

Description

Sizes

 Ä&#x2020;Ä&#x20AC;Ä&#x20AC;Ćľ

!,0$!40!*/%+*"+.Ä&#x2020;Ä&#x20AC;Ä&#x20AC;)) !,0$ .3!./

Ä Ä&#x201A;Ä&#x20AC;Ä&#x20AC;4Ä Ä&#x2020;Ä&#x20AC;4Ä&#x2026;Ä&#x160;))

DRAWER LINERS .%+*.!5Ä&#x152;*0%ÄĄ/(%, .3!.(%*!./,.+2% !/01**%*#* +/0!Ăť!0%2! %0%+*(!//+.50+/0* .  .3!./!/* +),(!)!*00$!)+ 1(.*01.!+" +*Ăź#1.!Ä&#x2039;Ăť!.%*##.!0/+(10%+*0+,.!2!*0 0$!1*3*0! /(% %*#+"'%0$!*!//+.%!/%* .3!./Ä&#x152;0$!5*(/+!1/! //$!("(%*!./0+,.+0!0 #(//3.!* $%*Ä&#x2039;

Order code

Order code

DM1500X500AHT

DM1500X500ALT

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Ä Ä&#x2020;Ä&#x20AC;Ä&#x20AC;4Ä&#x2020;Ä&#x20AC;Ä&#x20AC;)) Ćľ*0$.%0!$!250!401.! Non-slip mat Cut to size

Ä Ä&#x2020;Ä&#x20AC;Ä&#x20AC;4Ä&#x2020;Ä&#x20AC;Ä&#x20AC;)) Ćľ*0$.%0!(%#$00!401.! Non-slip mat Cut to size

T: 01325 505599 (North) | 88 (South)

6.10


DRAWER ACCESSORIES CUTLERY INSERTS Compatible with

1.*!3+((!0%+*+"+.%+*#.!5)+ 1(.10(!.5 0.5/.! !/%#*! "+.0$!+,0%)%/0%+**  personalisation of drawers. â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

â&#x20AC;˘ ĆŤ10(!.50.5 !/%#*! 0+! ,+/%0%+*! Ă˝1/$#%*/00$! .3!./% ! â&#x20AC;˘ For min. 400mm drawer

6.11

278 278

â&#x20AC;˘ ĆŤ10(!.50.5 !/%#*! 0+! ,+/%0%+*! %*0$!)% (!+" 0$! .3!. â&#x20AC;˘ For min. 600mm drawer

H45 H45 minmin420 max 420 //max 490490

minmin420 max 420 / / max 490490

420 //max 490490 minmin420 max 266 266

CUTLERY INSERT 600

H45 H45

CUTLERY INSERT 600

H45 H45

CUTLERY INSERT 400

.%+*#.!5 %*%)1) .3!. !,0$Ä?Ä&#x2026;Ä&#x201A;Ä&#x20AC;)) 4%)1) .3!. !,0$Ä?Ä&#x2026;Ä&#x160;Ä&#x20AC;)) Ćľ01(10(!.5%*/!.0%/Ä&#x2026;Ä&#x2C6;Ä&#x20AC;))(+*# 0*!100+Ăź0

376 376

â&#x20AC;˘ ĆŤ10(!.50.5 !/%#*! 0+! ,+/%0%+*! Ă˝1/$#%*/00$! .3!./% ! â&#x20AC;˘ For min. 600mm drawer

Order code

Order code

Order code

MODCT/400SSWOG

MODCT/600SDWOG

MODCT/600SSWOG

Order Online www.pws.co.uk


DRAWER INSERTS Compatible with

Gollinucci creates items that make everyday life /%),(!.Ä&#x2039;Ćľ2%((!%*,+,1(.)00+.%+*#.!5 Ăź*%/$Ä&#x152;%0/.*#!+"10(!.5%*/!.0/+)!3%0$ modular accessories for personalised functionality. Cut to size:

â&#x20AC;˘ .%+*#.!5 â&#x20AC;˘ Scratch resistant

ĆŤ100+Ăź0Ä&#x2026;Ä&#x2020;Ä&#x20AC; !!, .3!./Ĩ !#.+4+*(5ÄŠÄ?

Order code

Drawer size

Dimensions

Order code

Drawer size

Dimensions

ĆŤÄ&#x2026;Ä&#x20AC;Ä&#x20AC;

Ä&#x2026;Ä&#x20AC;Ä&#x20AC;))

Ä&#x192;Ä&#x2020;Ä 4Ä&#x2026;Ä&#x160;Ä&#x20AC;))

ĆŤÄ&#x2026;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x2026;Ä&#x2020;Ä&#x20AC;

Ä&#x2026;Ä&#x20AC;Ä&#x20AC;))

Ä&#x192;Ä&#x201A;Ä&#x20AC;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ĆŤÄ&#x2020;Ä&#x20AC;Ä&#x20AC;

Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2026;Ä&#x2020;Ä 4Ä&#x2026;Ä&#x160;Ä&#x20AC;))

ĆŤÄ&#x2020;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x2026;Ä&#x2020;Ä&#x20AC;

Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2026;Ä&#x201A;Ä&#x20AC;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ĆŤÄ&#x2021;Ä&#x20AC;Ä&#x20AC;

Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2020;Ä&#x2020;Ä 4Ä&#x2026;Ä&#x160;Ä&#x20AC;))

ĆŤÄ&#x2021;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x2026;Ä&#x2020;Ä&#x20AC;

Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2020;Ä&#x201A;Ä&#x20AC;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ĆŤÄ&#x2030;Ä&#x20AC;Ä&#x20AC;

Ä&#x2030;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2C6;Ä&#x2026;Ä&#x20AC;4Ä&#x2026;Ä&#x160;Ä&#x20AC;))

ĆŤÄ&#x2030;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x2026;Ä&#x2020;Ä&#x20AC;

Ä&#x2030;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2C6;Ä&#x201A;Ä&#x20AC;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ĆŤÄ&#x160;Ä&#x20AC;Ä&#x20AC;

Ä&#x160;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2030;Ä&#x2026;Ä&#x20AC;4Ä&#x2026;Ä&#x160;Ä&#x20AC;))

ĆŤÄ&#x160;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x2026;Ä&#x2020;Ä&#x20AC;

Ä&#x160;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2030;Ä&#x201A;Ä&#x20AC;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ĆŤÄ Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;

Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))

Ä&#x160;Ä&#x2026;Ä&#x20AC;4Ä&#x2026;Ä&#x160;Ä&#x20AC;))

ĆŤÄ Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x2026;Ä&#x2020;Ä&#x20AC;

Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))

Ä&#x160;Ä&#x201A;Ä&#x20AC;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

!./+*(%/!5+1./0+.#!3%0$

%0%+*(+),(!)!*0.5!//+.%!/Ä&#x2039;

Please note that all three !//+.%!/3%((+*(5Ăź0%* 1000mm wide drawers

Order code

Order code

Order code

OGCHOPB

OGKNIFEB

OGFOILDISP

â&#x20AC;˘ ++ !*$+,,%*#+. â&#x20AC;˘ For use with 800Ä&#x152;900Ä&#x152; 1000mm wide drawers

â&#x20AC;˘ Knife block â&#x20AC;˘ For use with 500Ä&#x152;600Ä&#x152;800Ä&#x152; 900Ä&#x152;1000mm wide drawers

â&#x20AC;˘ +%(ÄĽĂź() %/,!*/!. â&#x20AC;˘ For use with 500Ä&#x152;600Ä&#x152;800Ä&#x152; 900Ä&#x152;1000mm wide drawers

T: 01325 505599 (North) | 88 (South)

6.12


DRAWER ACCESSORIES PLASTIC CUTLERY INSERTS â&#x20AC;˘ Grey â&#x20AC;˘ 450mm deep drawer

Utensils not included

Order code

Drawer size

Dimensions

ÇŤĆŤ Ä&#x2026;Ä&#x20AC;Ä&#x20AC;

Ä&#x2026;Ä&#x20AC;Ä&#x20AC;))

Ä&#x192;Ä Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ÇŤĆŤ Ä&#x2020;Ä&#x20AC;Ä&#x20AC;

Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2026;Ä Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ÇŤĆŤ Ä&#x2021;Ä&#x20AC;Ä&#x20AC;

Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2020;Ä Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ÇŤĆŤ Ä&#x2030;Ä&#x20AC;Ä&#x20AC;

Ä&#x2030;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2C6;Ä Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ÇŤĆŤ Ä&#x160;Ä&#x20AC;Ä&#x20AC;

Ä&#x160;Ä&#x20AC;Ä&#x20AC;))

Ä&#x2030;Ä Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

ÇŤĆŤ Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;

Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))

Ä&#x160;Ä Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;))

PLATE HOLDERS

â&#x20AC;˘ 'Ăź*%/$ â&#x20AC;˘ ĆŤ*!100+Ăź0 Äľ%*(1 !/Ä&#x2030;0%)!.,%*/* Ä&#x201A;Ä&#x2020;*0%ÄĄ/(%,1Ăť!./

Order code

Description

Ä&#x2030;Ä&#x20AC;Ä&#x20AC;ÇŤ

+.1/!3%0$Ä&#x2030;Ä&#x20AC;Ä&#x20AC;))ÇŤ(1)Ćľ ÇŤÄľ

Sizes Ä&#x2C6;Ä&#x20AC;Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x160;))

Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;ÇŤ

+.1/!3%0$Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))ÇŤ(1)Ćľ ÇŤÄľ

Ä&#x160;Ä&#x20AC;Ä&#x2026;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x160;))

Ä&#x2030;Ä&#x20AC;Ä&#x20AC; ÇŤ

+.1/!3%0$Ä&#x2030;Ä&#x20AC;Ä&#x20AC;))ÇŤ(1) ƾǍÄľ

Ä&#x2C6;Ä Ä&#x160;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x160;))

Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC; ÇŤ

+.1/!3%0$Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))ÇŤ(1) ƾǍÄľ

Ä&#x160;Ä Ä&#x160;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x160;))

TPIN4

Set of 4 round timber pins for plate holders

TIMBER DRAWER ACCESSORIES â&#x20AC;˘ 44mm thick solid beech . !.+ !

ĆŤ%*!0/%6!

% 0$

!,0$

BTSCI5

500mm

411mm

422mm

BTSCI6

600mm

511mm

422mm

BTSCI8

800mm

711mm

422mm

BTSCI9

900mm

811mm

422mm

BTCI10

1000mm

911mm

422mm

â&#x20AC;˘ Beech veneer

6.13

Order Online www.pws.co.uk

. !.+ !

ĆŤ%*!0/%6!

% 0$

!,0$

BTCI500

500mm

416mm

422mm

BTCI600

600mm

516mm

422mm

BTCI800

800mm

716mm

422mm

BTCI900

900mm

816mm

422mm

BTCI1000

1000mm

916mm

422mm


OAK DRAWER INSERTS  !".+)3/$! +'Ä&#x152;+'!*$1/!*10(!.5 %*/!.0/.!0$!,!."!0350++.#*%/!5+1. .3!./+ that it is always neat and tidy. .3!.%*/!.0/.!/1,,(%! /+*!,%!!0+Ăź0 a chosen drawer width. Additional accessories available (see below for options).

LEGRABOX . !.+ !

% 0$

!,0$

!%#$0

OCILB400

319mm

422mm

41.6mm

OCILB500

419mm

422mm

41.6mm

OCILB600

519mm

422mm

41.6mm

OCILB800

719mm

422mm

41.6mm

OCILB900

819mm

422mm

41.6mm

OCILB1000

919mm

422mm

41.6mm

!%#$0

TANDEMBOX . !.+ !

% 0$

!,0$

OCITB400

301.5mm

422mm

41.6mm

OCITB500

401.5mm

422mm

41.6mm

OCITB600

501.5mm

422mm

41.6mm

OCITB800

701.5mm

422mm

41.6mm

OCITB900

801.5mm

422mm

41.6mm

OCITB1000

901.5mm

422mm

41.6mm

COMPATIBLE INSERT ACCESSORIES !+Ăť!."+1.!//+.%!/0$0*! ! %*0+0$! .3!.%*/!.0/Ä?"+%( %/,!*/!.Ä&#x152;'*%"!(+'Ä&#x152;/,%!$+( !. and cross divider. !! .3!.+*Ăź#1.0%+*/"+.2%((!+,0%+*/Ä&#x2039;

FOIL DISPENSER

compartment suitable for Insert Accessory

KNIFE BLOCK

Order code

Order code

OACIFD

OACIKB

â&#x20AC;˘ Ä Ä&#x192;Ä&#x2C6;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x192;Ä&#x2030;)) â&#x20AC;˘ Washed oak/aluminium

â&#x20AC;˘ Ä Ä&#x192;Ä&#x2C6;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x201A;Ä&#x2021;)) â&#x20AC;˘ Washed oak

SPICE HOLDER

CROSS DIVIDER

Order code

Order code O

OACISH

OACICD O

â&#x20AC;˘ Ä Ä&#x192;Ä&#x2C6;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x201A;Ä&#x2021;)) â&#x20AC;˘ Stepped spice holder â&#x20AC;˘ Washed oak

â&#x20AC;˘ Ä Ä&#x192;Ä&#x2C6;4Ä&#x2026;Ä&#x201A;Ä&#x201A;4Ä&#x192;Ä&#x2C6;Ä&#x2039;Ä )) â&#x20AC;˘ Washed oak

T: 01325 505599 (North) | 88 (South)

6.14


DRAWER ACCESSORIES AMBIA-LINE LEGRABOX ACCESSORIES*

CUTLERY DIVIDER

KNIFE BLOCK

Ä&#x2018;.%+*#.!5

Ä&#x2018;.%+*#.!5

Order code

Description

Order code

Description

ZC7S450BS3

Ä&#x192;%!.10(!.5 %2% !.Ä&#x152;Ä&#x192;Ä&#x20AC;Ä&#x20AC;))3% !"+. NL450 LEGRABOX drawer

ZC7M0200

Knife block for 9 knives

ZC7S500BS3

Ä&#x192;%!.10(!.5 %2% !.Ä&#x152;Ä&#x192;Ä&#x20AC;Ä&#x20AC;))3% !"+. NL500 LEGRABOX drawer

FOIL & FILM HOLDER

SPICE HOLDER

Ä&#x2018;.%+*#.!5 Ä&#x2018;ĆŤ*!1/! 3%0$Ä? ZC7S450RS2 | ZC7S500RS2

Ä&#x2018;.%+*#.!5 Ä&#x2018; 1/0!1/! 3%0$Ä? ZC7F400RSP

Order code

Description

Order code

Description

ZC7C0000

+%(Ä&#x2019;Ăź()holder

ZC7G0P0I

,%!$+( !."+.ĆŤÄ&#x2019;$!%#$0,1(l-outs

PLATE HOLDER Ä&#x2018;.%+*#.!5

Order code

Description

ZC7T0350

(0!$+( !."+.1,0+Ä Ä&#x201A;,(0!/Ä&#x152; 188 - 322mm plate diameter

STEEL FRAMES Ä&#x2018;.%+*#.!5

M HEIGHT | Shallow drawers Order code

Description

ZC7S300RSU

0!!(".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä&#x201A;Ä&#x2026;Ä&#x201A;))3% !"+.L270 & above

ZC7S450RS1

0!!(".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä Ä&#x20AC;Ä&#x20AC;))wide for NL450

ZC7S500RS1

0!!(".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä Ä&#x20AC;Ä&#x20AC;)) wide for NL500

ZC7S450RS2

0!!(".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä&#x201A;Ä&#x20AC;Ä&#x20AC;mm wide for NL450

ZC7S500RS2

0!!(".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä&#x201A;00mm wide for NL500

ZC7S450RSA

0!!(Ăź((!.".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä Ä Ä&#x2030;))3% !"+. Ä&#x2026;Ä&#x2020;Ä&#x20AC;Ä&#x2039; 1/! 0++),(!0!(5Ăź((Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))3% ! .3!.1*%03%0$ Ä Ä&#x2030;ÄĽÄ Ä&#x160;))!* ,*!(/%*+*&1*0%+*3%0$Ä 4Ä&#x192;Ä&#x20AC;Ä&#x20AC;))10(!.5 t.5Ä&#x2019;Ä 4Ä Ä&#x20AC;Ä&#x20AC;))".)!Ä&#x2039;

ZC7S500RSA

0!!(Ăź((!.".)!Ä&#x152;Ä&#x2020;Ä&#x20AC;))$%#$Ä&#x152;Ä Ä Ä&#x2030;))3% !"+. Ä&#x2020;Ä&#x20AC;Ä&#x20AC;Ä&#x2039; 1/! 0++),(!0!(5Ăź((Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))3% ! .3!.1*%03%0$ Ä Ä&#x2030;ÄĽÄ Ä&#x160;))!* ,*!(/%*+*&1*0%+*3%0$Ä 4Ä&#x192;Ä&#x20AC;Ä&#x20AC;))10(!.5 0.5Ä&#x2019;Ä 4Ä Ä&#x20AC;Ä&#x20AC;))".)!Ä&#x2039;

C HEIGHT | Deep drawers Order code

Description

ZC7F300RSU

0!!(".)!Ä&#x152;Ä Ä Ä&#x20AC;))$%#$Ä&#x152;Ä&#x201A;Ä&#x2026;Ä&#x201A;))3% !"+. Ä&#x201A;Ä&#x2C6;Ä&#x20AC;& above

ZC7F400RSP

0!!(".)!Ä&#x152;Ä Ä Ä&#x20AC;))$%#$Ä&#x152;Ä&#x201A;Ä Ä&#x2030;))3% !"+. Ä&#x2026;Ä&#x20AC;0 & above

* Discount from Section 5 applies

6.15

Order Online www.pws.co.uk


IN-FRAME DOVETAIL DRAWER ACCESSORIES TIMBER PLATE HOLDER

NATURAL OAK

WASHED OAK !/%#*! 0+".!!(5 .+,%*0+ .3!./* ((+3 !/5.!)+2("+.(!*%*#Ä&#x2039; Ƶ  Ƶ   Ƶ  Supplied with pre-drilled base panel with 12 pins to be positioned as required

'ü*%/$/$+3*

. !.+ ! %*%/$

Æ«%*!0/%6! % 0$

PH800OA

Natural

800mm

669mm

!,0$ 405mm

PH800/W

Washed

800mm

669mm

405mm

PH1000OA

Natural

1000mm

869mm

405mm

PH1000/W

Washed

1000mm

869mm

405mm

TIMBER CUTLERY INSERT !/%#*! 0+".!!(5 .+,%*0+ .3!./* )4%)%/!0$!/,!1/!  3$%(/0.!)%*%*#ý!4%(!Ä&#x2039; Ƶ  Ƶ   Ƶ  The inserts do not have a base which allows you to add felt drawer liners (order separately IFFDL1000CH)

NATURAL OAK

WASHED OAK

. !.+ !

%*%/$

Æ«%*!0/%6!

% 0$

!,0$

CI300OA

Natural

300mm

170mm

406mm

!%#$0 52mm

CI300/W

Washed

300mm

170mm

406mm

52mm

CI500OA

Natural

500mm

370mm

406mm

52mm

CI500/W

Washed

500mm

370mm

406mm

52mm

FELT DRAWER LINER

â&#x20AC;¢ Cut to size â&#x20AC;¢ Æ«$.+(ü*%/$ . !.+ !

% 0$

!,0$

IFFDL1000CH

1000mm

398mm

Utensils not included

T: 01325 505599 (North) | 88 (South)

6.16


DRAWER ACCESSORIES DOVETAIL DRAWER BOXES Compatible with Ƶ2%((!ü*%/$!/č

NATURAL OAK

WASHED OAK

• The perfect complement to a traditional or painted kitchen • Genuine handcrafted appearance • Drawers are supplied assembled • 16mm solid timber sides • 6mm plywood base

Natural oak shown

. !.+ !

!,0$

!%#$0

Ƶ2%((!3% 0$/



ĂĈĀĥĵǫ

ĂĈĀ))

ĊĀ))

ąĀĀČĆĀĀ))



ąĆĀĥĵǫ

ąĆĀ))

ĊĀ))

ăĀĀČąĀĀČąĆĀČĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))



ąĆĀĥĵǫĥ

ąĆĀ))

āĉą))

ĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))



ĂĈĀĥĵǫ

ĂĈĀ))

ĊĀ))

ĆĀĀČćĀĀ))



ąĆĀĥĵǫ

ąĆĀ))

ĊĀ))

ăĀĀČąĀĀČąĆĀČĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))



ąĆĀĥĵǫĥ

ąĆĀ))

āĉą))

ĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))

ġƵ 



Ƶ

NATURAL OAK 

WASHED OAK . !.+ !

!,0$

!%#$0

Ƶ2%((!3% 0$/



ĂĈĀĥĵǫĥ

ĂĈĀ))

ĊĀ))

ĆĀĀČćĀĀ))



ąĆĀĥĵǫĥ

ąĆĀ))

ĊĀ))

ăĀĀČąĀĀČąĆĀČĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))



ąĆĀĥĵǫĥ

ąĆĀ))

āĉą))

ĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))



ĂĈĀĥĵǫĥ

ĂĈĀ))

ĊĀ))

ĆĀĀČćĀĀ))



ąĆĀĥĵǫĥ

ąĆĀ))

ĊĀ))

ăĀĀČąĀĀČąĆĀČĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))



ąĆĀĥĵǫĥ

ąĆĀ))

āĉą))

ĆĀĀČćĀĀČĉĀĀČĊĀĀČāĀĀĀ))

ġƵ 

Ƶ



6.17

Order Online www.pws.co.uk




INTERNAL DOVETAIL DRAWERS



. !.+ !

Ćľ

DI270/*SB/W

270mm

90mm

500mm



 Ä&#x2026;Ä&#x2020;Ä&#x20AC;ļľǍļ

Ä&#x2026;Ä&#x2020;Ä&#x20AC;))

Ä&#x160;Ä&#x20AC;))

Ä&#x2026;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2020;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2021;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2030;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x160;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))



 Ä&#x2026;Ä&#x2020;Ä&#x20AC;ļľǍļ

Ä&#x2026;Ä&#x2020;Ä&#x20AC;))

Ä Ä&#x2030;Ä&#x2026;))

Ä&#x2026;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2020;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))

ÄĄĆľ 

â&#x20AC;˘ Ä Ä&#x2021;))/+(% +'%*0!.*( +2!0%( .3!./Ä&#x152;3%0$%*0!.#.0!  scalloped handle â&#x20AC;˘ 4(1/%2!(52%((!%*3/$! +'Ăź*%/$ â&#x20AC;˘ Ćľ2%((!%*Ä&#x201A;$!%#$0/ÄĄÄ&#x160;Ä&#x20AC;))* Ä Ä&#x2030;Ä&#x2026;)) â&#x20AC;˘ Runners not included â&#x20AC;˘ Movento or Tandem runners can be used (see section 5) !,0$

!%#$0

Ćľ2%((!3% 0$/



IDI270/*SB/W

270mm

90mm

500mm



 Ä&#x2026;Ä&#x2020;Ä&#x20AC;ļľǍļ

Ä&#x2026;Ä&#x2020;Ä&#x20AC;))

Ä&#x160;Ä&#x20AC;))

Ä&#x2026;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2020;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2021;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2030;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x160;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä Ä&#x20AC;Ä&#x20AC;Ä&#x20AC;))



 Ä&#x2026;Ä&#x2020;Ä&#x20AC;ļľǍļ

Ä&#x2026;Ä&#x2020;Ä&#x20AC;))

Ä Ä&#x2030;Ä&#x2026;))

Ä&#x2026;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2020;Ä&#x20AC;Ä&#x20AC;Ä&#x152;Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))

DOVETAIL DRAWER WITH INTEGRATED CUTLERY TRAY Compatible with 

. !.+ !

% 0$

!,0$

!%#$0

ĆŤ+),.0)!*0/

â&#x20AC;˘ 16mm solid oak sides â&#x20AC;˘ *0!#.0! 10(!.5+),.0)!*0/ ADDITIONAL OPTIONS â&#x20AC;˘ In-frame version available â&#x20AC;˘ Various size options

  2020

ÄĄĆľ 

Ćľ

Vertical (+*#

short

+.%6+*0(

DC500

454mm

440mm

90mm

1

3

1

DC600

554mm

440mm

90mm

1

4

1

DC800

754mm

440mm

90mm

4

2

2

DC900

854mm

440mm

90mm

3

4

2

DC1000

954mm

440mm

90mm

4

4

2

IFDC500

404mm

440mm

90mm

1

3

1

IFDC600

504mm

440mm

90mm

1

4

1

IFDC800

704mm

440mm

90mm

4

2

2

IFDC900

804mm

440mm

90mm

4

3

2

IFDC1000

904mm

440mm

90mm

4

4

2

SEE PAGE 4.59

,!(!44 ĆŤ+)00%*#$+/%*0$! 01,,!.3.! .3!.Ä&#x152;0$!*!3 !//!ÂŽ$)!.,!(!44 !),(+5/$%#$,!."+.)*! 0!40%(!* /0+*!/0*5/%6! * /$,!+"/0+.#!+*0%*!. /!1.!(5%*,(!Ä&#x17D;%*/%#$0*  easily accessible at all times. T: 01325 505599 (North) | 88 (South)

6.18


DRAWER ACCESSORIES CHOPPING BOARD / SERVING TRAYS

â&#x20AC;˘ +(% +'$+,,%*# board and tray set (compatible with 1909 frame set Ä&#x2C6;Ä&#x2C6;Ä&#x20AC;4Ä Ä&#x2020;Ä&#x20AC;ÄŠ/1,,(%!  3%0$/,%*#'%0/Ä&#x152; care advice and metal threaded inserts for handle attachment

â&#x20AC;˘ !0+"Ä&#x201A;/!.2%*#0.5/ and 1 spice drawer Ĩ%*(1 %*#/,!./ÄŠ for use with in-frame tray set

Order code

Description

Order code

Description

Ä Ä&#x2020;Ä&#x20AC;ÄĽ  

*ÄĄ".)!/!.2%*#0.5ÄĽ$+,,%*#+. /!0"+. Ä Ä&#x2020;Ä&#x20AC;))1*%0Ä&#x152;3/$! +'

Ä&#x201A;Ä&#x20AC;Ä&#x20AC;  

*ÄĄ".)!/!.2%*#0.5Ä&#x152;/,%! .3!.*   /,!./Ä&#x152;+'Ä&#x152;"+.1/!3%0$0.5/!0

SPICE DRAWERS

Compatible with

â&#x20AC;˘ 16mm solid oak â&#x20AC;˘ 6mm plywood base â&#x20AC;˘ !/%#*! "+.1/!%* 500mm module â&#x20AC;˘ Pack consists of Ä&#x192;4 .3!.+4!/* Ä&#x201A;4 .3!.#1% !/ NOTE Not suitable for vertical application

Order code

Description



. !.+ !

% 0$

!,0$

!%#$0

Ä&#x201A;Ä&#x20AC;Ä&#x20AC; 

*ÄĄ".)!/!0+"Ä&#x2026; +2!0%(/,%! .3!./Ä&#x152; ÄĽ3#1% !/Ä&#x152;"+.1/!3%0$$!.ÄĽ/,%! .3!./!0

lay on

DSDS5

141mm

250mm

105mm

6.19

Order Online www.pws.co.uk


PULL-OUT BASKETS LINDO MODERN BASKETS â&#x20AC;˘ Suitable for in-frame cabinets â&#x20AC;˘ '* 3(*10Ăź*%/$ â&#x20AC;˘ $/'!0%*(1 !/Ä&#x201A;4.1**!./ Walnut

   â&#x20AC;˘ !/%#*! "+.1/!%*Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))* Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))3% !1*%0/ â&#x20AC;˘ !,0$Ä&#x2026;Ä&#x2021;Ä&#x20AC;))ħ!%#$0Ĩ".+*0ÄŠÄ Ä&#x192;Ä&#x2021;Ä&#x2039;Ä&#x2020;))Ĩ/% !/ÄŠÄ&#x201A;Ä Ä&#x20AC;)) â&#x20AC;˘ 40!.*(3% 0$Ä?Ä&#x2026;Ä&#x201A;Ä&#x20AC;))"+.Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))ħÄ&#x2020;Ä&#x201A;Ä&#x20AC;))"+.Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))

Oak

Order code

Description

 ÇŤÄ&#x2020;Ä&#x20AC;Ä&#x20AC;Äľ

%* +)+ !.*/'!0Ä&#x152;Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))Ä&#x152;*01.(+'* )!0(Ä&#x152;,%.

 ÇŤÄ&#x2021;Ä&#x20AC;Ä&#x20AC;Äľ

%* +)+ !.*/'!0Ä&#x152;Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))Ä&#x152;*01.(+'* )!0(Ä&#x152;,%.

*Customer discount from section 1 applies

WICKER BASKET !("+./0+.%*#2!#!0(!/* ".!/$"++ /01ĂťÄ&#x2039; .)!%*(1 !/.+10! $* (!Ä&#x152;((%*0$!+*! assembly.    â&#x20AC;˘ !/%#*! "+.1/!%*Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))* Ä&#x2021;Ä&#x20AC;Ä&#x20AC;))3% !1*%0/ â&#x20AC;˘ !,0$Ä?Ä&#x2026;Ä&#x2020;Ä&#x20AC;))!%#$0Ĩ%*".)!ÄŠÄ?Ä&#x201A;Ä Ä&#x20AC;)) â&#x20AC;˘ 40!.*(3% 0$Ä?Ä&#x2026;Ä Ä&#x20AC;))"+.Ä&#x2020;Ä&#x20AC;Ä&#x20AC;))Ä&#x152;Ä&#x2020;Ä Ä&#x20AC;))"+.Ä&#x2021;Ä&#x20AC;Ä&#x20AC;)) â&#x20AC;˘ $/'!0%*(1 !/Ä&#x201A;4.1**!./ ĨÄ&#x192;Ä&#x2026;))4Ä&#x192;Ä&#x2C6;))4Ä&#x2026;Ä Ä&#x20AC;))4Ä&#x2030;))ÄŠ

Order code

Description

 Ä&#x2020;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x201A;Äľ

%'!./'!03%0$.1**!./Ä&#x152;,%.

 Ä&#x2021;Ä&#x20AC;Ä&#x20AC;ÄĽÄ&#x201A;Äľ

%'!./'!03%0$.1**!./Ä&#x152;,%.

*Customer discount from section 1 applies

T: 01325 505599 (North) | 88 (South)

6.20


7 WASTE MANAGEMENT

Product selection guide

01

300mm cabinets

03

400mm cabinets

05

450mm cabinets

07

500mm cabinets

09

600mm cabinets

11

800mm cabinets

13

900 & 1000mm cabinets

14

UTILITY ROOM Laundry baskets

15

Ironing board

15

Towel rails

16

2Year


PRODUCT SELECTION GUIDE Gollinucci are a global leader in the design and manufacture of waste management systems for kitchens. Ƶ2%((!%*2.%!05+"+(+1./Č3% 0$/* ü00%*#+,0%+*/Č0$!%.%0!)/.!,!."!0350+'!!,5+1.*!3 kitchen clean and tidy by keeping waste and recycling behind doors rather than on display. With a market (! %*#$+%!+",%05* +),.0)!*0+)%*0%+*/5+1Ě((!(!0+ü* ,.+ 103$%$,!."!0(5 suits any kitchen design.

To help you specify and order the correct bin to meet end consumers needs we have introduced an easy 0+1* !./0* 0!$*%(.!"!.!*!#1% !0+%((1/0.0!ü00%*#0%)!Č%*!0*  ++.)+1*0%*#/3!((/*5 additional features.

KEY TO ICONS USED GENERAL

CABINET MOUNTING

DOOR MOUNTING

Fitting time

Bottom mounted

Attached to door front

Soft close

Door mounted

Fits in drawer

Side mounted

Pull-out (hinged door)

Swing (hinged door)

7.01

Order Online www.pws.co.uk


Page

Drawer mounting

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

Side mounting

Base mounting

Mounting

++.ü4%*#

Linen Grey

Black

White

Stainless Steel

Grey

Orion Grey

Total capacity

Hinged door

Door Fixing

Colour

No of bins

Soft close

1000mm

Features

900mm

800mm

600mm

500mm

450mm

400mm

300mm

Cabinet Width



Ä¡Ç« Ä&#x152; Ä&#x152;Ç«  ƵƵƫ 280GY 286SS 222-GY 223-GY 224-GY 294-GY

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

292-GY

â&#x20AC;¢ â&#x20AC;¢

296-GY 551GY

â&#x20AC;¢ â&#x20AC;¢

550GY

1

16

1

20

2

28

3

30

1

30

1

40

3

31

2

42

2

60

2

70

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

7.03 7.03 7.03 7.03 7.04 7.04 7.06 7.06 7.08 7.08

 Ä¡Ç« Ä&#x152; Ä&#x152;Ç«  ƵƵƫ H406AL

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

272SS 272BK 240GY 250SSGY 538-GR

â&#x20AC;¢

201WH

â&#x20AC;¢

1

12

1

13

1

13

2

28

2

28

2

42

1

16

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

7.05 7.05 7.05

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

7.05 7.06 7.07

â&#x20AC;¢

7.09

DRAWER BIN 9XL/600-GY

â&#x20AC;¢

9XL/800-GY

â&#x20AC;¢

9XL/900-GY

â&#x20AC;¢

9XL/1000-GY

â&#x20AC;¢

2

29

3

38

3

49

4

58

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

7.11 7.13 7.14 7.14



Ä¡Ç« Ä&#x152;ƵƵƫ 580PL/30-GY 580PL/40-GY EVO580/45-GY 580PL/45-GY 560/4550-GY 588-GY 551GY 550GY 560/5050-GY 585-GY 584-GY 580PL/50-GY EVO580/50-GY EVO580/60-GY 581-GY 571/6050-GY 560/6050-GY 580PL/60-GY 580-GY

â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

1

40

2

58

2

58

2

58

2

58

2

70

2

60

2

70

2

58

2

60

2

70

2

80

2

80

4

74

4

75

2

80

2

84

2

80

4

85

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

7.04 7.06 7.07 7.07 7.07 7.08 7.08 7.08

â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

T: 01325 505599 (North) | 88 (South)

7.09 7.09 7.09 7.10 7.10 7.11 7.11 7.11 7.12 7.12 7.12

7.02


300mm CABINET WIDTH PULL-OUT WASTE BIN 16 LITRES Linen Grey

PULL-OUT WASTE BIN 20 LITRES Grey/Stainless Steel

• Suitable for use under a sink

16L

360

423

20L 380

300

230

380

300

230

Order code

Order code

280GY

286SS

PULL-OUT WASTE BIN 28 LITRES Grey

PULL-OUT WASTE BIN 30 LITRES Grey

• 1((!40!*/%+* • Lid can be used as a shelf

• 1((!40!*/%+* • Lid can be used as a shelf

14L

10L 400

10L

14L 450

7.03

430

255

10L

400

450

Order code

Order code

222-GY

223-GY

Order Online www.pws.co.uk

430

255


PULL-OUT WASTE BIN 30 LITRES Grey

PULL-OUT WASTE BIN 40 LITRES Grey

• 1((!40!*/%+* • Lid can be used as a shelf

• 1((!40!*/%+* • Lid can be used as a shelf

30L

400

40L 450

430

255

537

450

Order code

Order code

224-GY

294-GY

440

225

PULL-OUT WASTE BIN 40 LITRES Orion Grey

NEW

• Runners and plastic lid included • Optional shelf pull-out available (see page 7.14)

40L

506

502

min 260/max 268

Order code 580PL/30-GY LID580PL/30-GY - Optional plastic shelf (Orion Grey)

T: 01325 505599 (North) | 88 (South)

7.04


400mm CABINET WIDTH DOOR MOUNTED BIN 12 LITRES Finish - plastic Ral 9001

AUTOMATIC BIN 13 LITRES White/Stainless Steel

• Suitable for use under a sink 315

12L

280

315

13L

355

277

238

358

Order code

Order code

H406AL

272SS

AUTOMATIC BIN 13 LITRES Black/Stainless Steel

AUTOMATIC DOUBLE BIN 28 LITRES Linen Grey

• Suitable for use under a sink 14L 13L

355

277

420

14L 358

7.05

420

Order code

Order code

272BK

240GY

Order Online www.pws.co.uk

420

267


AUTOMATIC DOUBLE BIN 28 LITRES Stainless Steel and Linen Grey

PULL-OUT WASTE BIN 31 LITRES Grey

• 1((!40!*/%+* • Lid can be used as a shelf 14L

7.5L 7.5L

420

339

14L

16L 440

330

473

267

460

343

Order code

Order code

250SSGY

292-GY

PULL-OUT WASTE BIN 42 LITRES Grey

PULL-OUT WASTE BIN 58 LITRES Orion Grey

• 1((!40!*/%+* • Lid can be used as a shelf

• Runners and plastic lid included • Optional shelf pull-out available (see page 7.14)

21L

29L

400

21L

463

29L 473

460

343

min 360/max 368

Order code

Order code

296-GY

580PL/40-GY

458

LID580PL/40-GY - Optional plastic shelf (Orion Grey)

T: 01325 505599 (North) | 88 (South)

7.06


450mm CABINET WIDTH AUTOMATIC BIN WITH DIVIDER 42 LITRES Grey

PULL-OUT WASTE BIN 58 LITRES Orion Grey

NEW

• Suitable for use under a sink

• !0(/$!("(% +2!.Ĩü4! ĩ • 1((!40!*/%+*"+./0+.#!

21L

29L 427

484

433

29L

21L 343

475

360

500

min 412/max 418

Order code

Order code

538-GR

EVO580/45-GY

PULL-OUT WASTE BIN 58 LITRES Orion Grey

PULL-OUT WASTE BIN 58 LITRES Grey

• Runners and plastic lid included • Optional shelf pull-out available (see page 7.14) 29L

463

• Blum TANDEMBOX runners and plastic lid included 29L 463

463

29L

29L min 410/max 418

458

Order code

Order code

580PL/45-GY

560/4550-GY

LID580PL/45-GY - Optional plastic shelf (Orion Grey)

7.07

Order Online www.pws.co.uk


PULL-OUT WASTE BIN 60 LITRES Grey

PULL-OUT WASTE BIN 70 LITRES Grey

384

384

30L

35L 593

511

30L

35L 493

500

Order code

493

500

Order code

551GY

550GY

Ä&#x2020;Ä&#x2020;Ä&#x2020;Ç«Æ« Ä¡,0%+*(".+*0"%4%*#.'!0

Ä&#x2020;Ä&#x2020;Ä&#x2020;Ç«Æ« Ä¡,0%+*(".+*0"%4%*#.'!0

PULL-OUT WASTE BINS 70 LITRES Grey

â&#x20AC;¢ !0(/$!("(% +2!.Ĩü4! Ä© â&#x20AC;¢ 1((!40!*/%+*"+./0+.#! 35L 480 560

35L 400

500

480

Order code 588-GY

T: 01325 505599 (North) | 88 (South)

7.08


500mm CABINET WIDTH UNDER-SINK BIN 16 LITRES White

PULL-OUT WASTE BIN 58 LITRES Grey

• Blum TANDEMBOX runners and plastic lid included

16L

384

423

230

29L 463

463

29L 353

Order code

Order code

201WH

560/5050-GY

PULL-OUT WASTE BINS 60 LITRES Grey

PULL-OUT WASTE BINS 70 LITRES Grey

• !0(/$!("(% +2!.Ĩü4! ĩ • 1((!40!*/%+*"+./0+.#!

• !0(/$!("(% +2!.Ĩü4! ĩ • 1((!40!*/%+*"+./0+.#! 35L

30L

560

480

35L

30L 450

7.09

500

480

450

Order code

Order code

585-GY

584-GY

Order Online www.pws.co.uk

500

480


PULL-OUT WASTE BINS 80 LITRES Orion Grey

PULL-OUT WASTE BINS 80 LITRES Orion Grey

NEW

• Runners and plastic lid included • Optional shelf pull-out available (see page 7.14) 40L

506

40L

• !0(/$!("(% +2!.Ĩü4! ĩ • 1((!40!*/%+*"+./0+.#! 40L

504

40L min 460/max 468

458

min 462/max 468

Order code

Order code

580PL/50-GY LID580PL/50-GY - Optional plastic shelf (Orion Grey)

EVO580/50-GY

500

T: 01325 505599 (North) | 88 (South)

7.10


600mm CABINET WIDTH PULL-OUT WASTE BIN 74 LITRES Orion Grey

DRAWER BIN 29 LITRES Orion Grey

STAY FRESH SEE PAGE 7.13

NEW

20L

min 399/max 490

â&#x20AC;¢ Width and depth can be cut down between the sizes indicated â&#x20AC;¢ Compatible with all common drawer systems

9L

â&#x20AC;¢ !0(/$!("(% +2!.Ĩü4! Ä© â&#x20AC;¢ 1((!40!*/%+*"+./0+.#! 8L

209

8L 480

29L 29L

min 429/max 540

min 562/max 568

500

Order code

Order code

9XL/600-GY

EVO580/60-GY

PULL-OUT WASTE BIN 75 LITRES Grey

PULL-OUT WASTE BIN 80 LITRES Orion Grey

INCLUDES LEGRABOX DRAWER SIDES

â&#x20AC;¢ !0(/$!("(% +2!.Ĩü4! Ä© â&#x20AC;¢ 1((!40!*/%+*"+./0+.#! 7.5L 7.5L

30L 30L

7.11

â&#x20AC;¢ *(1 !/Ç«(1) Ƶǫ.1**!./Ä&#x152; .3!./% !/Ä&#x152;/0!!('* )!0((% 40L

480

505 529

40L 550

500

480

472

Order code

Order code

581-GY

571/6050-GY

Order Online www.pws.co.uk


PULL-OUT WASTE BIN 80 LITRES Orion Grey

PULL-OUT WASTE BIN 84 LITRES Grey

• Runners and plastic lid included • Optional shelf pull-out available (see page 7.14)

• Blum TANDEMBOX runners and plastic lid included

40L

506

42L 495

463

40L

42L min 560/max 568

458

Order code

Order code

580PL/60-GY LID580PL/60-GY - Optional plastic shelf (Orion Grey)

560/6050-GY

PULL-OUT WASTE BIN 85 LITRES Grey

• !0(/$!("(% +2!.Ĩü4! ĩ • 1((!40!*/%+*"+./0+.#! 7.5L 7.5L

35L 35L

560

550

500

480

Order code 580-GY

T: 01325 505599 (North) | 88 (South)

7.12


800mm CABINET WIDTH DRAWER BIN 38 LITRES Orion Grey

20L

9L

min 399/max 490

• Width and depth can be cut down between the sizes indicated • Compatible with all common drawer systems

9L

209

min 580/max 740

Order code 9XL/800-GY

STAY FRESH TECHNOLOGY STAY FRESH LID for use with 9XL bins

MYZYME

• Patented lid with incorporated misting system for enzymatic liquid MYZYME*

The enzyme liquid is odourless and totally natural - 1 litre

Order code

Order code

9XL/ATOMLID

9XL/ATOMBLT

* Daily use of the stay fresh lid permanently eliminates unpleasant odours caused by separate waste collection. The system will also work with diluted lemon juice.

7.13

Order Online www.pws.co.uk


900mm & 1000mm CABINET WIDTH DRAWER BIN 58 LITRES

• Width and depth can be cut down between the sizes indicated • Compatible with all common drawer systems

• Width and depth can be cut down between the sizes indicated • Compatible with all common drawer systems

9L

20L

Orion Grey

209

min 399/max 490

20L

min 399/max 490

DRAWER BIN 49 LITRES Orion Grey

9L 20L 20L 9L

min 730/max 840

209

min 880/max 940

Order code

Order code

9XL/900-GY

9XL/1000-GY

PLASTIC SHELF FOR 580PL/_ _ - GY • Shelf can be pulled out • Product available in the following cabinet widths: ăĀĀČąĀĀČąĆĀČĆĀĀ* ćĀĀ)) Order code

Cabinet width

LID580PL/30-GY

300mm

LID580PL/40-GY

400mm

LID580PL/45-GY

450mm

LID580PL/50-GY

500mm

LID580PL/60-GY

600mm

T: 01325 505599 (North) | 88 (South)

NEW

7.14


UTILITY ROOM LAUNDRY BASKETS 500MM LAUNDRY BASKET White

600MM LAUNDRY BASKET White

• Blum TANDEMBOX runners and white steel backs included

• Blum TANDEMBOX runners and white steel backs included

473

473

40L

50L

506

506

40L

Order code

Order code

560B/500WH

560B/600WH

AUTOMATIC POP-UP IRONING BOARD* • Rises automatically when pulled out from behind a 140mm high drawer front. Fold the 0+,ý0* 0$!+. %/.! 50+1/! đ *1"01.! ".+)!,+45+0! /0!!( đ $!*%*1/!0$!3+.'/1."!%/!4!,0%+*((5/0(! đ $!/1."!$/.!,(!(!$!0.!ý!0%2!+2!. đ Ƶ,,.+4%)0!3+.'%*#.!+"ĊąĀ4ăĂĀ)) %0/%*0+ąĀĀČąĆĀ+.ĆĀĀ))%*!0ċ Requires a minimum 100mm high cabinet and 505mm deep aperture. Worktop overhang must be: 25-40mm.

7.15

Order Online www.pws.co.uk

Order code

Description

Finish

PI6OAL

Ironing Board

Almond (Ral9001)

PIC

Spare Cover

Silver


TOWEL RAIL* • A high quality two arm aluminium towel rail with roller glide action đ (!4%(! !/%#*0+!*(!2!.0%(+.$+.%6+*0()+1*0%*#

*Customer discount from section 9 applies

Order code

Description

Finish

Width

Height

Depth

RTR2SI

Two arm

Silver

94mm

27mm

439mm

T: 01325 505599 (North) | 88 (South)

7.16


8.2

Order Online www.pws.co.uk


8 LIGHTING & ELECTRICAL ACCESSORIES The importance of lighting

01

Smart Drivers - Alexa

03

Drivers and accessories

04

Series 1

05

Cabinet lighting

09

Under cabinet strip lighting

15

Flexible strip lighting

16

Ƶ(1)%*%1),.+ü(! 



Ăā

Plinth lighting

23

Drawer & shelf lighting

25

Pendant lighting

28

Remotes, sensors & dimmers

29

ELECTRICAL ACCESSORIES SensioPods

31

Evoline socket ports 2+(%*!'ý%,

32





ăă

KEY TO ICONS USED

Cool/ Natural/ Warm

LED Colour

Dimmer

The colour temperature of the LED lighting product.

This product can be dimmed.

110º

The beam angle of the product.

1.5 metres

2 per m

The cable length of LED lights per metre

Quantity of LED lights per metre

CCTT – A seamless cycle through the full spectrum of temperatures from cool to natural white, then from natural to warm white. Mimic outside lighting +* %0%+*/ġ/%!*0%ü((5,.+2!*0+$2!,+/%0%2!%),0+*+1.$!(0$ċ

Bedroom light can be ü00! "0!. installation.

Prismatic LED technologyTM

Built-in IR sensor switch

3-in-1 colour TrioToneTM light

For more information on all Sensio products visit: www.sensio.co.uk

CCT

ON ALL SENSIO LED LIGHTING

T: 01325 505599 (North) | 88 (South)

8.3


SENSIO PRODUCTS FOR EVERY AREA OF YOUR KITCHEN...

A G H

E

A B C D E

Under cabinet spot lighting Under cabinet strip lighting Interior cabinet lighting Flexible strip lighting Plinth lighting

8.01

Order Online www.pws.co.uk

F G H I

Drawer/shelf lighting SensioPods Sensors and controllers Smart home

I


C

B

F

D

THE IMPORTANCE OF KITCHEN LIGHTING Lighting is no longer just a kitchen accessory, itâ&#x20AC;&#x2122;s a necessity. Transform your kitchen designs by incorporating a lighting scheme in the initial design stages.

T: 01325 505599 (North) | 88 (South)

8.02


SMART DRIVERS - ALEXA

NEW

Compatible with Alexa smart technology software

Key Features • Enables voice-controlled lighting with the Sensio smart mobile app • Inconspicuous, slimline design - 16mm depth • )((!*+1#$0+ü0%*0$!2+% !$%*  kitchen wall cabinets • Integrated JB4 ports • Protection from short circuiting, overloading and electrical surge • Available in both 15W and 30W kits • Mains voltage - 198-264V • 2m mains lead cable • CCT Adapter included in Duo Colour Kits to enable colour changeable lighting

Code

Description

SE4090990

āĆ3).03%ü .%2!.'%0/%*#(!+(+1.

SE4091990

āĆ3).03%ü .%2!.'%0 1++(+1.+(+1.

SE4092990

ăĀ3).03%ü .%2!.'%0/%*#(!+(+1.

SE4093990

ăĀ3).03%ü .%2!.'%0 1++(+1.

8.03

Order Online www.pws.co.uk

.


DRIVERS AND ACCESSORIES *+. !.0+,+3!.!*/%+(%#$0端00%*#/0$!following drivers are required. Each driver's main cable length is 1.5m. It is important to note that our drivers have a limited number of ports to connect your lights to. For example a driver with 6 ports is limited to a maximum of 6 lights. Each driver can run a number of lights. Simply divide the wattage of the driver by the wattage of a single light and this will tell you exactly how many lights can be run by the driver. Example: 15W driver with 3W lights, 15 / 3 = 5 lights

HD LED LINK Cable, 2.5m

TITAN 6W/24V L+3.+端(! Driver

Code

Description

Code

Power

Description

SE9009

HD LED Link Cable

SE490950

6W

Driver with 6 ports

TITAN 15W/24V

+3.+端(! Driver

TITAN 30W/24V L+3.+端(! Driver

Code

Power

Description

Code

Power

Description

SE491950

15W

Driver with 6 ports

SE492950

30W

Driver with 6 ports

24V/60W LED Driver

DIMMABLE 24V/ 30W Driver

with 12 port LED Block

Compatible with Leading/Trailing Edge Dimmers

Code

Description

Code

Description

SE40557.1

60W Driver with 12 port JB4 distributor

SE40599

Dimmable 24V/30W Driver

T: 01325 505599 (North) | 88 (South)

8.04


SERIES 1

NEW

SENSIO SERIES 1 is simplicity without the compromise. â&#x20AC;¢ Itâ&#x20AC;&#x2122;s a range of simple, high quality lights. â&#x20AC;¢ One LED colour available - Natural White.

1

Ä&#x2018; *!ü*%/$2%((! for each light. â&#x20AC;¢ One pack size. 3

2

4

6

5

7

1 Velos

2 Treos

3 Plaza

4 Axis

5 Dart

6 Iris

7 Zeta

SERIES 1 COLLECTION INCLUDES...

VELOS Under Cabinet LED Spot Light Dimmer

120o 1.5 metres

â&#x20AC;¢ LED technology for long service life 190.00

â&#x20AC;¢ Energy saving (good lumens per watt ratio) â&#x20AC;¢ Ideal for under cabinet lighting â&#x20AC;¢ Can be used with a range of Sensio switches and dimmers 4.00

â&#x20AC;¢ High light output

70.00

â&#x20AC;¢ Elongated design allows for vast spread of light across worktop â&#x20AC;¢ Magnetic mounting plate, no visible screws â&#x20AC;¢ Ç«.1/$! Ƶ(1)%*%1)ü*%/$ â&#x20AC;¢ Plug and driver included in packs only

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE11092N0

5W

24V

1

ORequired

Natural White

PACK

SE11092N3

5W

24V

3

15W included

Natural White

ACCESSORIES Code

Description

SE9009

  %*'Æ«(!Ä¡Ä&#x201A;Ä&#x2039;Ä&#x2020;)Ä¡40!* /0$!(!+*ü00%*#Ä&#x2039;$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

8.05

Order Online www.pws.co.uk

LED Colour


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

AXIS 240V Under Cabinet LED Strip Light Dimmer

120o 1.5 metres

2 per m

â&#x20AC;¢ LED technology for long life â&#x20AC;¢ Energy saving (good lumens per watt ratio) â&#x20AC;¢ Ideal for under cabinet lighting â&#x20AC;¢ *Ä¥+û/3%0$ â&#x20AC;¢ Ƶ(0!.*0%2!0+Ä&#x2020;Ĩý1+.!/!*0Ä©3%0$*+ visible LEDâ&#x20AC;&#x2122;s

30.00

222.00 / 343.00 / 524.00 / 904.00

â&#x20AC;¢ No driver required

22.00

Code

Description

Wattage

Voltage

Qty

LED Colour

SINGLE

SE10099N0

904mm Axis

16W

240V

1

Natural White

SINGLE

SE10079N0

524mm Axis

8W

240V

1

Natural White

SINGLE

SE10029N0

343mm Axis

5W

240V

1

Natural White

SINGLE

SE10019NO

222mm Axis

3W

240V

1

Natural White

ACCESSORIES Code

Description

SE9009

  %*'Æ«(!Ä¡Ä&#x201A;Ä&#x2039;Ä&#x2020;)Ä¡40!* /0$!(!+*ü00%*#Ä&#x2039;$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

SE101290

Axis connecting cable 500mm

SE101190

Axis connecting cable 250mm

PLAZA Square Prismaticâ&#x201E;¢ LED light Dimmer

1.5 metres

LED Colour

â&#x20AC;¢ Easy to use and install 98.80

â&#x20AC;¢ Ideal for under cabinet lighting

98.80

â&#x20AC;¢ LED technology for long life â&#x20AC;¢ Energy saving (good lumens per watt ratio) â&#x20AC;¢ %û1/! (%#$0Ĩ*+2%/%(! +0/Ä© â&#x20AC;¢ Bright output â&#x20AC;¢ Ƶ(1)%*1)ü*%/$ â&#x20AC;¢ Dimmable â&#x20AC;¢ #*!0%!6!($% !/ü4%*#/

6.70

â&#x20AC;¢ Plug and driver included in packs only

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE11090N0

3.6W

24V

1

ORequired

Natural White

PACK

SE11090N3

3.6W

24V

3

15W included

Natural White

ACCESSORIES Code

Description

SE9009

  %*'Æ«(!Ä¡Ä&#x201A;Ä&#x2039;Ä&#x2020;)Ä¡40!* /0$!(!+*ü00%*#Ä&#x2039;$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

T: 01325 505599 (North) | 88 (South)

8.06


SERIES 1

IRIS LED Plinth Light 750mm

LED Colour

• Easy to use and install • Ideal for use on kitchen plinth or bathroom (zone2) • LED technology for long life • Energy Saving (good lumens per watt ratio) • Fittings can be daisy chained for simple installation

Ƿ15.00

Ƿ10.00

37.00

• Available individually or as a pack of 4 %*(1 %*#!*/%+Ě/%0*(+3,.+ü(! .%2!. and 3pin plug • ƫ$.+)!ü*%/$ • Plug and driver included in packs only

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE15990N0

0.32W

24V

1

ORequired

Natural White

PACK

SE15990N4

0.32W

24V

4

6W included

Natural White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

DART 5m LED Flexible Strip 120o 60 per m

• LED Technology for long life • Energy Saving (good lumens per watt ratio) • Easy to install • Ideal for any Kitchen Design • Dimmable • Self Adhesive

5000.00 0.80

1.80

• High Lumens per watts 8.00

• Cuttable at every 100mm & reusable • 5m length • Sensio Plug and Play system eliminates the possibility of wrongly connecting the strip. • Plug and driver included in packs only

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE10355N0

3.6W per meter

24V

1

ORequired

Natural White

PACK

SE10355N1

3.6W per meter

24V

1

30W included

Natural White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

SE101080*

Driver Connection Cable - 2.5M. *Required to run the Dart LED Flexible Strip

8.07

Order Online www.pws.co.uk

LED Colour


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

TREOS Triangle LED Under Cabinet Light Dimmer

2.5 metres

LED Colour

140.00

• Easy to use and install • LED technology for long life • Energy saving (good lumens per watt ratio) • %û1/! (%#$0Ĩ*+2%/%(! +0/ĩ 147.00

8.80

20.75

• Plug and Play (Quick release connector) • 0%*(!///0!!(ü*%/$

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE11290N0

2W

24V

1

ORequired

Natural White

PACK

SE11290N3

6W

24V

3

6W included

Natural White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

ZETA LED Surfaced/Recessed Under Cabinet Light Dimmer

Ƿ68.00

13.00

2.5 metres

LED Colour

• Easy to use and install • LED Technology for long life • Energy saving (superb lumens per watt ratio) • %û1/! (%#$0Ĩ*+2%/%(! +0/ĩ

Ƿ45.80

• Fitting supplied with collar for surface mounting • Plug and Play (Quick release connector) • 0%*(!///0!!(ü*%/$ • Plug and driver included in packs only

Recessed shown

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE11190N0

2W

24V

1

ORequired

Natural White

PACK

SE11190N3

6W

24V

3

6W included

Natural White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

T: 01325 505599 (North) | 88 (South)

8.08


CABINET LIGHTING BERMUDA TRIOTONE LED Triangle Light

Cool/ Natural/ Warm LED Colour

Dimmer

110º

2.5 metres

2 per m

• 1 light - 3 colour temperatures with easy access switch • Cable can be unplugged from the back of 0$!ü00%*#2%-1%'ġ.!(!/!+**!0+. • %û1/!  %#$0

142

• 1)%*+1/!þ5+"ĈĊġĊā )ĥ 156

15cm

Stainless Steel Finish

2.5m

1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE21000

2W

24V

1

ORequired

Cool/Natural/Warm

PACK

SE21000K3.1

6W

24V

3

6W included

Cool/Natural/Warm

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2%driver

BERMUDA LED Triangle Light Cool/ Warm LED Colour

Dimmer

110º

2.5 metres

• Traditional look, modern solution • 0%*(!///0!!(ü00%*##.!0"+.+0$ contemporary and traditional kitchens • 1)%*+1/!þ5+"ĉĀ )ĥ 142

• Can be used with a range of Sensio switches and dimmers

156

15cm 2.5m

1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE90010C0

2W

24V

1

ORequired

Cool White

SINGLE

SE90010W0

2W

24V

1

ORequired

Warm White

PACK

SE90010C3.1

6W

24V

3

6W included

Cool White

PACK

SE90010W3.1

6W

24V

3

6W included

Warm White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2%driver

8.09

Order Online www.pws.co.uk

2 per m


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

HYPE TRIOTONE - LED Surface/Recessed Light Cool/ Natural/ Warm LED Colour

13.5

Dimmer

110º

2.5 metres

2 per m

• 1 light - 3 colour temperatures • Cable can be unplugged from the back of 0$!ü00%*#2%-1%'ġ.!(!/!+**!0+. • Easy to use, simply move the switch on the '+"0$!ü00%*#0+ !/%.! 0!),!.01.! • %û1/! (%#$0

68

2.5m 1.5m

15cm

• 1)%*+1/!þ5+"ĈĊġĊā )ĥ

1.5m

Image shows how this product is wired to a driver

SINGLE

Code SE21100

Wattage 2W

Voltage 24V

Qty 1

Driver ORequired

Led Colour Cool/Natural/Warm

PACK

SE21100K3.1

6W

24V

3

6W included

Cool/Natural/Warm

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2%driver

HYPE - LED Surface/Recessed Light Cool/ Warm LED Colour

13.5

Dimmer

110º

2.5 metres

2 per m

• 0%*(!///0!!(ü00%*##.!0"+.+0$ contemporary and traditional kitchens • 1)%*+1/!þ5+"ĉĀ )ĥ • Using as task lighting or illuminate cabinet interiors with glass fronted wall units • Can be used with a range of Sensio switches and dimmers

68

2.5m 15cm 1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE90050C0

2W

24V

1

ORequired

Cool White

SINGLE

SE90050W0

2W

24V

1

ORequired

Warm White

PACK

SE90050C3.1

6W

24V

3

6W included

Cool White

PACK

SE90050W3.1

6W

24V

3

6W included

Warm White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2%driver

T: 01325 505599 (North) | 88 (South)

8.10


CABINET LIGHTING NOVUS HD LED Triangle Light Cool/ Warm LED Colour

Dimmer

50o

2.5 metres

• Slim exterior, high brightness • Perfect for kitchens without a pelmet

139

• 1)%*+1/!þ5+"ĉĀ )ĥ • Ăą4$%#$ !ü*%0%+* ŏ/,!.(%#$0 148

• Lens over each diode to intensify light output

20.6

• Long lamp life - lasts up to 47,500 hours more than halogen • Can be used with a range of Sensio switches and dimmers

15cm

• Supplied with detachable cable 75mm ".+)0$!/!+"0$!ü00%*#

2.5m

1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED colour

PACK

SE9001HDCWK3.1

6W

24V

3

6W included

Cool white

PACK

SE9001HDWWK3.1

6W

24V

3

6W included

Warm white

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2%driver

MAGNUM - Rechargeable Battery Light Cool LED Colour

25

210mm

• Quick and simple to install. No wiring required • Magnet mounted with a mini USB port to make charging as simple as possible đ %û1/!.+*!(/((2%/%(! ,+%*0/

70

Stainless Steel

• Very versatile light suitable for installation in a variety of locations • PIR motion sensor switch to control light • Stainless Steel

NEW

• Comes with USB charging lead

Chrome

NEW

Finish

Code

Wattage

Voltage

Qty

SINGLE

Chrome

SE3301N0

0.4W

5V

1

Cool White

SINGLE

Stainless Steel

SE3300N0

0.4W

5V

1

Cool White

8.11

Order Online www.pws.co.uk

LED Colour

2 per m


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

PINTO - LED Flat Disc Light Warm LED Colour

Dimmer

120o 1.5 metres

2 per m

đ %/.!!0ü00%*#Č+*(5ć)) !!,

8.7

• Can be used under kitchen cabinets as a task light or inside glass fronted wall units as mood lighting • 16 integrated LEDs đ $ü00%*#.1*/0+*(5āċĆ/+ąü00%*#/ can be run from a single 6W driver 57

1.5m

15cm

• Simple to install, surface mount using 2 screws

1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE10138WW.24

1.5W

24V

1

ORequired

Warm White

PACK

S10138WWK3.24.1

4.5W

24V

3

6W included

Warm White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2%driver

SLS QUADRA MODERN - LED Under/Over Cabinet Light Cool/ Warm LED Colour

Dimmer

120o

2.5 metres

2 per m

đ ,!%(%/! (!*/ %û1/!/ /0+.!0! the appearance of invisible diodes

40 180

• Easy installation using daisy chaining 0+ü0)1(0%,(!(%#$0/%*0++*!.!

10

• Specially designed mounting brackets allow for simple installation • No in-built sensor • Can also be installed over cabinet using mounting bracket sold separately

2.5m

15cm 1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE21092C0

2.5W

24V

1

ORequired

Cool White

SINGLE

SE21092W0

2.5W

24V

1

ORequired

Warm White

ACCESSORIES Code

Description

SE240920 Over cabinet mounting bracket for Quadra SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

T: 01325 505599 (North) | 88 (South)

8.12


CABINET LIGHTING ALTI - Square Prismatic LED Light Cool/ Warm LED Colour

Dimmer

100o

2.5 metres

2 per m

• Featuring Prismatic LED technology • Super thin depth of 7mm 110

• Great for kitchens without a pelmet • Superbly bright output đ 4%)1)(1)%*+1/!þ5+"Ċā )ĥ

110

• Switch/dim using Sensio sensors and controllers

7

2.5m

15cm 1.5m

Image shows how this product is wired to a driver

SINGLE

Code

Wattage

Voltage

Qty

Driver

LED Colour

SE21006C0

3.5W

24V

1

ORequired

Cool White

SINGLE

SE21006W0

3.5W

24V

1

ORequired

Warm White

PACK

SE21006C3.1

10.5W

24V

3

15W included

Cool White

PACK

SE21006W3.1

10.5W

24V

3

15W included

Warm White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

PAD2 - Prismatic LED Light Cool/ Warm LED Colour

75 180 7

Dimmer

110o

2.5 metres

• Featuring Prismatic LED technology đ ƫ+*0%*/*%**+20%2! %û1/!.3%0$* !0$!  !/%#*0++),(!0!(5 %û1/!(%#$0 • Discreet 7mm depth • Elongated light panel to allow for an increased spread of light across the worktop • Superbly bright output đ 4%)1)(1)%*+1/!þ5+"ĉĉ )ĥ

1.5m

15cm 1.5m

• Switch/dim using Sensio sensors and controllers

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

SINGLE

SE22006C0

3.5W

24V

1

ORequired

Cool White

SINGLE

SE22006W0

3.5W

24V

1

ORequired

Warm White

PACK

SE22006C3.1

10.5W

24V

3

15W included

Cool White

PACK

SE22006W3.1

10.5W

24V

3

15W included

Warm White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2%driver

8.13

Order Online www.pws.co.uk

2 per m


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports

QUADRA PRO - Colour Temperature Changeable Under/Over Cabinet Light 40

CCT

15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

Cool/ Natural/ Warm LED Colour

Dimmer

120o

2.5 metres

• Multi-Functional, reduces multiple SKU’s • High light output

180 10

• Optional in built IR for detection as well as colour changing function • Dimmable with Sensio 24V dimmers

1

• 3++*0.+(+*ü#1.0%+*/č

Image shown with sensor

ƫ+*ü#1.0%+*āč A run of Quadra Pro lights are installed with Quadro Pro IR as the parent light. The user then controls the parent light with hand commands (switch) ƫ+*ü#1.0%+*Ă: A run of Quadro Pro child lights connect directly to a DuoFlex Receiver and are then controlled with the 3-IN-1 Remote Control.

2 Image shown without sensor

2.5m

15cm 1.5m

Image shows how this product is wired to a driver

1

Quadra Pro IR Colour Temperature Changeable Under Cabinet Light (WITH SENSOR) - (2900K-6000K)

Code

Wattage

Voltage

Qty

Driver

SINGLE

SE21092P0

2.5W

24V

1

ORequired

PACK

SE21292P3.1

7.5W

24V

3

15W included

Pack includes 1 x Quadra Pro IR, 2 x Quadra Pro, 1 x 15W Driver

2

Quadra Pro Colour Temperature Changeable Under Cabinet Light (WITHOUT SENSOR) - (2900K-6000K)

Code

Wattage

Voltage

Qty

Driver

SINGLE

SE21192P0

2.5W

24V

1

ORequired

PACK

SE21392P3

7.5W

24V

3

15W included

Pack includes 3 x Quadra Pro, 1 x 15W Driver, 1 x DuoFlex Receiver, 1 x 3-In-1 Remote Control ACCESSORIES Code

Description

SE240920 Over cabinet mounting bracket for Quadra SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

SE1004100 DuoFlex Reciever

Over cabinet mounting bracket Over cabinet mounting (each bracket to be bought separately)

• Inset shows SE240920 Mounting Bracket (required to transform the Quadra into an over cabinet light) 40mm 10mm

Code

Description

180mm

Under cabinet mounting (bracket provided with each fitting)

SE240920 Over cabinet mounting bracket

T: 01325 505599 (North) | 88 (South)

8.14


DRIVERS REQUIRED More information Page 8.04

CABINET LIGHTING

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

ALPHA - Under Cabinet Spot Light Cool/ Warm LED Colour

Dimmer

70o

2.5 metres

2 per m

• LED Technology • Super slim 3mm thick stylish under cabinet light • Available in a square (S) or rectangular (R) shape đ 0%*(!///0!!(ü*%/$

2.5m

15cm 1.5m

Image shows how this product is wired to a driver

SINGLE (S)

Code

Wattage

Voltage

Qty

Driver

LED Colour

SE11490W0

3W

24V

1

ORequired

Warm White

SINGLE (S)

SE11490C0

3W

24V

1

ORequired

Cool White

SINGLE (R)

SE11390W0

3W

24V

1

ORequired

Warm White

SINGLE (R)

SE11390C0

3W

24V

1

ORequired

Cool White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

UNDER CABINET STRIP LIGHTING CONNEX TRIOTONE - Colour Changeable LED Strip Light Cool/ Natural/ Warm LED Colour

120º

IMPROVED SPEC

• The colour changeable alternative to the LED with no visible diodes • Easily interchangeable between warm, natural and cool white đ 40.!)!(5$%#$(%#$0+10,10"+.!û!0%2! task lighting đ %*/ü00%*#"+./%),(!%*/0((0%+*

28

270 / 396 / 524 / 623

21

Code

Wattage

Voltage

Qty

Length

SINGLE

SE100390

3W

240V

1

222mm

Cool/Natural/Warm White

SINGLE

SE100490

5W

240V

1

343mm

Cool/Natural/Warm White

SINGLE

SE100590

9W

240V

1

524mm

Cool/Natural/Warm White

SINGLE

SE100690

12W

240V

1

623mm

Cool/Natural/Warm White

ACCESSORIES Code

Description

SE101290

Connex connecting cable 500mm

SE101190

Connex connecting cable 250mm

8.15

Order Online www.pws.co.uk

LED Colour


FLEXIBLE STRIP LIGHTING DUOFLEX - Flexible Strip Light Cool/ Natural/ Warm LED Colour

$!*15%*#0$!1+(!4ý!4%(!/0.%, lighting you require a driver connection lead and controller for each run of strips. These are purchased separately (unless buying in a pack).

120o

Dimmer

Warm White

Natural White

2.5 metres

Cool White

• Can be easily alternated between cool white, natural white and warm white and anything in between • Self- adhesive 3M tape on back for installation • Male and female ends allow you to create required length

10

1000 / 2000

• Can be cut to length (every 100mm)

2.5

• Cut the strip ONCE and that will create the end of the run. The cut piece with the female end cannot be reused • Operate using a DuoFlex compatible remote control or Sensio Multi-Light App • One remote will control all receivers with a 15M radius • Maximum length of 6M can be run from each receiver • Ten brightness levels

Code SINGLE

Replaces

SE10445D0

SINGLE

SE10425D0

PACK

SE104125D1.2

SE10425D1

Wattage

Voltage

Qty

Length

Driver

LED Colour

2.5W

24V

1

0.5m

ORequired

Warm/Natural/Cool

10W

24V

1

2m

ORequired

Warm/Natural/Cool

10W

24V

1

2m

15W included

Warm/Natural/Cool

Includes the driver, driver lead, receiver and 3-IN-1 remote control ACCESSORIES Code

Description

SE10325*

Driver Connection Lead - 2.5m. *One Driver Lead is required for each run of the DuoFlex

SE10328

DuoFlex Inter-Connecting Lead - 500mm

SE10327

DuoFlex Corner Connection Lead - 50mm

T: 01325 505599 (North) | 88 (South)

8.16


FLEXIBLE STRIP LIGHTING VIVA - LED Flexible Strip Light Cool/ Warm LED Colour

Dimmer

120o

2.5 metres

â&#x20AC;¢ Extremely low energy consumption, only 5W per 2M â&#x20AC;¢ Self-adhesive 3M tape on back for installation â&#x20AC;¢ Male and female ends allow you to create required length â&#x20AC;¢ Can be cut to length (every 50mm) Ä&#x2018; Æ«100$!/0.%,Æ«* .!Ä¡1/!0$!10+û section using cut joining connector â&#x20AC;¢ Suitable for use in multiple areas including plinth, over/under cabinet

8 1000 / 2000

2.5

15cm 2.5m

1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Length

Driver

LED Colour

SINGLE

SE10615C0

2.5W

24V

1

1m

ORequired

Cool White

SINGLE

SE10615W0

2.5W

24V

1

1m

ORequired

Warm White

SINGLE

SE10625C0

5W

24V

1

2m

ORequired

Cool White

SINGLE

SE10625W0

5W

24V

1

2m

ORequired

Warm White

PACK

SE10615C1.1

2.5W

24V

1

1m

15W included

Cool White

PACK

SE10615W1.1

2.5W

24V

1

1m

15W included

Warm White

PACK

SE10625C1.1

5W

24V

1

2m

15W included

Cool White

PACK

SE10625W1.1

5W

24V

1

2m

15W included

Warm White

ACCESSORIES Code

Description

SE9009

  %*'Æ«(!Ä¡Ä&#x201A;Ä&#x2039;Ä&#x2020;)Ä¡40!* /0$!(!+*ü00%*#Ä&#x2039;$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

SE10314*

LED Flexible strip driver. Connection lead - 2500mm. *Required to run the Viva LED Flexible Strip

SE10316

LED Flexible strip corner Connection lead - 50mm

SE10317

LED Flexible strip inter-Connecting lead - 1500mm

SE10318MCC LED Flexible strip cut. Jointing connector

8.17

Order Online www.pws.co.uk


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

PRIMO - 5M Clip LED Flexible Strip Cool/ Warm LED Colour

Dimmer

120o

2.5 metres

• Can be cut and re-used up to 50 times • Illuminate several areas of a room with one strip • Self-adhesive 3M tape on the back of the ü00%*#"+.%*/0((0%+* • Supplied as a 5M reel • Can be cut to length (every 100mm) • Suitable for multiple areas-including plinth, over/under cabinet 10

5000

3

15cm 2.5m

1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Length

Driver

SINGLE

SE10755C0

18W

24V

1

5m

ORequired

LED Colour Cool White

SINGLE

SE10755W0

18W

24V

1

5m

ORequired

Warm White

PACK

SE10755C1

18W

24V

1

5m

30W included

Cool White

PACK

SE10755W1

18W

24V

1

5m

30W included

Warm White

ACCESSORIES Code

Description

SE101080*

Driver Connection Cable - 2.5M. *Required to run the Primo LED Flexible Strip

SE100050

End cap/Interconnecting clip

SE101050

Corner Connector

SE9009

  %*'ƫ(!ġĂċĆ ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

T: 01325 505599 (North) | 88 (South)

8.18


FLEXIBLE STRIP LIGHTING SIGMA - Bendable Flexible Strip Cool/ Warm LED Colour

Dimmer

120o

2.5 metres

• Strip can be bent around 90 degree corners without the need for corner cables or starting a new run of strip • Available in a 5M reel • Self-adhesive 3M tape on back for installation • The product can be cut to length with cut points every 100mm • Can be cut and reused up to 50 times • Uses the same connectors as the Primo range

1.5mm

8mm

15cm 2.5m

1.5m

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Length

Driver

SINGLE

SE10255C0

18W

24V

1

5m

ORequired

LED Colour Cool White

SINGLE

SE10255W0

18W

24V

1

5m

ORequired

Warm White

PACK

SE10255C1.1

18W

24V

1

5m

30W included

Cool White

PACK

SE10255W1.1

18W

24V

1

5m

30W included

Warm White

ACCESSORIES Code

Description

SE101080*

Driver connection cable - 2.5M. *Required to run the Sigma LED Flexible Strip

SE100050

End cap/interconnecting clip

SE101050

Corner Connector

SE9009

  %*'ƫ(!ġĂċĆ ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

8.19

Order Online www.pws.co.uk


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

RGB - Colour Changing Flexible Strip RGB

Dimmer

120o

2.5 metres

• 7 preset colours available: • Blue, cyan, green, yellow, red, violet and cool white • Great for mood lighting • Function available to cycle through colours • Self- adhesive 3M tape on back for installation • Male and female ends allow you to create required length 10 2.5 1000 / 2000

• Can be cut to length (every 100mm) • Operate using the RGB Remote Control or Sensio Multi-Light App • 3-in-1 remote will control all receivers within 15M radius • Multiple receivers can be controlled by one remote • Maximum length of 12M from a 60W Driver

MULTIPLE RECEIVERS CAN NOW BE CONTROLLED FROM ONE RGB REMOTE CONTROL There is no limit on the number of receivers per remote, the only stipulation is that they are all within a 15m radius of the controller at one time. For further information on the rgb remote control see page 8.29

Code SINGLE

SE10225R0

PACK

SE10225R1.2

Replaces SE10225R1

Wattage

Voltage

Qty

Length

Driver

LED Colour

10W

24V

1

2m

ORequired

RGB Colour

10W

24V

1

2m

30W included

RGB Colour

Includes the driver, driver lead, receiver and 3-IN-1 remote control ACCESSORIES Code

Description

SE10325*

Driver connection lead - 2.5m. *Required to run the RGB LED Flexible Strip

SE10327

LED RGB Flexible Strip Corner. Connection Lead - 50mm

SE791050 RGB receiver is required per run of RGB strips (1 receiver to each driver used) SE791990 3-IN-1 Remote Control - for more information see page 8.29

T: 01325 505599 (North) | 88 (South)

8.20


ALUMINIUM PROFILE FINO - 1."! +1*0! Ƶ(1)%*%1).+ü(! đ +1/!/((!*/%+ý!4%(!/0.%,/

1

• End caps and mounting brackets supplied 3%0$!$,.+ü(!ĨĂ3%0$0$!ā Čą3%0$ the 2M) • Can be cut to length • Perfect for use inside cabinets, larders or wardrobes

2

Code

Qty

Length

SINGLE

SE981120

1

1m

SINGLE

SE981220

1

2m

ACCESSORIES Code

Description

SE982050 Ă* ƫ,/+.1."! +1*0! .+ü(! SE981050 Ă +1*0%*#ǫ.'!0/+.1."!ċ +1*0! ĥ!!//! .+ü(!

CONTOUR - * !.+.'0+,.+ü(!"+.* (!(!// %0$!*/ đ $!,.+ü(!$/!!* !/%#*! /,!%ü((5 to accommodate our full range of ý!4%(!/0.%,/ đ (% !/1* !..%(Čü4!/0+3+.'0+,

End-Cap

1

đ $! !/%#*+"0$!,.+ü(!"1((5 %û1/!/ 0$!%* %2% 1( %+ !/Č0+,.+2% !ý3(!// mood light

Internal Corner Connector

đ $!,.+ü(!*!100+*5.!-1%.!  length and corner

1

• Connectors are available for any kitchen style

External Corner Connector

Code

Qty

Length

SINGLE

SE98210

1

1m

(End caps included)

SINGLE

SE98220

1

2m

(End caps included)

ACCESSORIES Code

Description

SE97990

External corner connectors kit (1 Top & 1 Base)

SE97890

Internal corner connectors kit (1 Top & 1 Base)

SE97790

1 Left End Cap + 1 x Right End Cap

8.21

Order Online www.pws.co.uk


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

BEAM - Ćľ*#(! Ćľ(1)%*%1).+Ăź(! â&#x20AC;˘ Can be surface mounted or used inside tall housing units or wardrobes â&#x20AC;˘ Use with the Compact, Viva or Primo Ă˝!4%(!/0.%, Ä&#x2018; ,( %Ăť1/!..!0!/+),(!0!(5 %Ăť1/!  ,+%*0/ â&#x20AC;˘ Flexible strip can be cut to length

16

.5 10

16

Code

Qty

Length

SINGLE

SE982120

1

1m

SINGLE

SE982220

1

2.2m

ACCESSORIES Code

Description

SE983050

ÇŤ!)ÄĄ

%0%+*(!* ,/!0"+.*#(! (1)%*%1),.+Ăź(!

SE984050

ÇŤ!)ÄĄ

%0%+*()+1*0%*#.'!0/!0"+.*#(! (1)%*%1),.+Ăź(!

LINIA - !!//! Ćľ(1)%*%1).+Ăź(! Ä&#x2018; +1/!/((!*/%+Ă˝!4%(!/0.%,/

1

â&#x20AC;˘ End caps and mounting brackets supplied 3%0$!$,.+Ăź(!ĨÄ&#x201A;3%0$0$!Ä Ä&#x152;Ä&#x2026;3%0$ the 2.2M) â&#x20AC;˘ Perfect for use under cabinets, inside larders or inside wardrobes

Code

Qty

Length

SINGLE

SE980120

1

1m

SINGLE

SE980220

1

2.2m

ACCESSORIES Code

Description

SE980050 Ä&#x201A;4* ,/"+..!!//! ,.+Ăź(! SE981050

Ä&#x201A;4 +1*0%*#.'!0/"+./1."!)+1*0! ÄĽ.!!//! ,.+Ăź(!

T: 01325 505599 (North) | 88 (South)

8.22


PLINTH LIGHTING LUCE - SLS LED Square Plinth Light Cool/ Warm LED Colour

130o

1.5 metres

• No visible LED points 75

đ %#$0/%0/ý1/$0+,(%*0$ • Fittings can be daisy chained together

180

• Can be used with a range of Sensio switches and dimmers

7

8.8

1.5m

Image shows how this product is wired to a driver Each cable on the product is 1m

PACK

Code

Wattage

Voltage

Qty

Driver

LED Colour

SE15090C4.1

2.4W

24V

4

6W included

Cool White

PACK

SE15090W4.1

2.4W

24V

4

6W included

Warm White

PACK

SE15090C8.1

4.8W

24V

8

6W included

Cool White

PACK

SE15090W8.1

4.8W

24V

8

6W included

Warm White

PURO - LED Round Plinth Light Cool/ Warm LED Colour

90o

đ Ă4ā (!/,!.ü00%*# • Fitting can be daisy chained together • Can be used with a range of Sensio switches and dimmers 15

14.4

1.5m

Each cable on the product is 1m Image shows how this product is wired to a driver

PACK

Code

Wattage

Voltage

Qty

Driver

LED Colour

SE15094C4.1

0.96W

24V

4

6W included

Cool White

PACK

SE15094W4.1

0.96W

24V

4

6W included

Warm White

PACK

SE15094C8.1

1.92W

24V

8

6W included

Cool White

PACK

SE15094W8.1

1.92W

24V

8

6W included

Warm White

8.23

Order Online www.pws.co.uk

1.5 metres


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

SPECTO - LED Round Plinth Light Cool/ Warm LED Colour

90o

1.5 metres

• Fitting can be daisy chained together • Can be used with a range of Sensio switches and dimmers 39.5

15

1.5m

Each cable on the product is 750mm Image shows how this product is wired to a driver

PACK

Code

Wattage

Qty

Driver

LED Colour

SE15091C4.1

1.28W

4

6W included

Cool White

PACK

SE15091W4.1

1.28W

4

6W included

Warm White

PACK

SE15091C8.1

2.56W

8

6W included

Cool White

PACK

SE15091W8.1

2.56W

8

6W included

Warm White

HALO TRIOTONE - Colour Temperature Switchable Plinth Light Cool/ Natural/ Warm LED Colour

13.2

120o

• Stylish, discreet & recessed kitchen plinth light • Choose from warm white (3000K) to natural white (4000k) to cool white (5000k) by simply using the button +*0$!1* !./% !+"0$!ü00%*#

24

16.4

30

• Plug & Play Technology - multiple ü00%*#/*! %/5$%*! 0+#!0$!. • IP44 rated đ %û1/! +2!.Č*+2%/%(! ŏ/

750mm

Image shows how this productx is wired to a driver

SINGLE

Code

Wattage

Voltage

Qty

Driver

LED Colour

SE150000

0.5W

24V

1

ORequired

Warm/Natural/Cool

PACK

SE150008

4W

24V

8

ORequired

Warm/Natural/Cool

PACK

SE150004

2W

24V

4

ORequired

Warm/Natural/Cool

T: 01325 505599 (North) | 88 (South)

8.24


DRAWER & SHELF LIGHTING DURA PLUS - LED Battery Light with PIR Sensor Cool LED Colour

120º

• LED Technology đ ƫ+/0!û!0%2!/+(10%+*Ĩ*+!(!0.%( installation required) • Ideal for Wardrobes & Kitchen cabinets/ drawers • PIR Sensor with timer control switch Ĩ %û!.!*0/!00%*#/2%((!ĩ • Uses 4x AAA Alkaline batteries

SINGLE

Code

Voltage

Qty

Length

Driver

LED Colour

SE16097C0

6V

1

300mm

Not Required

Cool White

VERSO - LED Drawer Light Cool LED Colour

120º

đ %#$ !ü*%0%+* "+.+,0%)1)(%#$0 output đ $!* .3!.%/(+/! (%#$001.*/+ûġ saves energy • Low wattage - a full drawer pack can be powered from a single driver • Brackets and cable tidy supplied 17 562 / 862 / 962

• Fitting is suitable for use in both the kitchen and bedroom

24

Code

Wattage

Voltage

Qty

Length

Driver

SINGLE

SE7305HDCW.24

3.3W

24V

1

562mm

ORequired

LED Colour Cool White

SINGLE

SE7315HDCW.24

5.4W

24V

1

862mm

ORequired

Cool White

SINGLE

SE7320HDCW.24

6W

24V

1

962mm

ORequired

Cool White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

8.25

Order Online www.pws.co.uk

2 metres


DRIVERS REQUIRED More information Page 8.04

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

EDGE - SLS LED Glass Clip light Cool/ Warm LED Colour

2.5 metres

• Fits 6-8mm pane of glass • Provides soft, ambient mood lighting đ $%0!Č %û1/! ü*%/$ • Can be cut to length • Cut marks every 90mm or 7 LEDs apart • *0!#.0!  %û1/!.,.+2% !/*+2%/%(! +0/ 26

• Use two lengths together for longer units

14

450 15cm 1.5m

1.5m

The 450mm length can be cut down to size or 2 pieces can be run alongside one another for longer cabinets Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Length

Driver

SINGLE

SE9063HDCW

2W

24V

1

450mm

ORequired

LED Colour Cool White

SINGLE

SE9063HDWW

2W

24V

1

450mm

ORequired

Warm White

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

EDGE PRO (CCT) - Colour Temperature Changeable LED Glass Clip Light

CCT

Cool/ Natural/ Warm LED Colour

Dimmer

1.5 metres

đ $! #!.++û!.//1,!.(%#$0+10,10 and can transform a normal glass shelf into an illuminated shelf with the clip on ġ/$,!  ,.+ü(! • Using the Edge Pro in conjunction with the Duo Flex Receiver and 3-IN-1 Remote Control, brings the product to the forefront of modern technology, enabling the user to choose their desired colour temperature from a wide spectrum of 2700K to 6500k. 15cm 1.5m

• Multi-functional, reduces multiple SKUís • Full spectrum of colour temperature • Fit 4-8mm pane of glass

1.5m

đ *0!#.0!  %û1/!. • Dimmable with 24V Sensio dimmers

Image shows how this product is wired to a driver

SINGLE

Code

Wattage

Voltage

Qty

Driver

LED Colour

SE97095P

2W

24V

1

ORequired

Warm/Natural/Cool

ACCESSORIES Code

Description

SE9009

  %*'ƫ(!ġĂċĆ)ġ40!* /0$!(!+*ü00%*#ċ$%/!40!*/%+*(!*!1/! 3%0$((,.+ 10/3$%$.!.1*2% .%2!.

T: 01325 505599 (North) | 88 (South)

8.26


DRIVERS REQUIRED More information Page 8.04

DRAWER & SHELF LIGHTING

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

GENOA - *0!#.0!  $!(".+ü(! LED Colour

120º 2 metres

• Transform a normal shelf into an illuminated shelf đ ġ/$,!,.+ü(!"+.!/5* /%),(! installation on 18mm thick shelves đ Ƶ2%((!%*ă %û!.!*0(!*#0$/ • Compatible with any Sensio 24V driver đ *0!#.0!  %û1/!.

2m

20mm 463 / 563mm

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

Dimensions

SINGLE

SE18492C0

8.9W

24V

1

ORequired

Natural White

463 (L) x 20mm (H) x 22 (W)

SINGLE

SE18592C0

10.8W

24V

1

ORequired

Natural White

563 (L) x 20mm (H) x 22 (W)

TORINO - Integrated LED Shelf LED Colour

• A sleek and stylish LED shelf with cool white LEDs embedded within the frame. • Available in 4 lengths • Available in black and silver • Compatible with Sensio LED drivers • Aluminium frame and tempered glass shelf • Supports up to 10kg weight

2m 900 / 600mm

200mm

Image shows how this product is wired to a driver

Code

Wattage

Voltage

Qty

Driver

LED Colour

Colour

Length

SINGLE

SE17232C0

5.4W

24V

1

ORequired

Natural White

SE17232C0 Silver

600x200x200

SINGLE

SE17262C0

8.4W

24V

1

ORequired

Natural White

SE17262C0 Silver

900x200x200

SINGLE

SE17238C0

5.4W

24V

1

ORequired

Natural White

SE17238C0 Black

600x200x200

SINGLE

SE17268C0

8.4W

24V

1

ORequired

Natural White

SE17268C0 Black

900x200x200

8.27

Order Online www.pws.co.uk


WARNING Ƶ(((%#$0ü00%*#/)1/0!ü00! 5 -1(%ü! !(!0.%%*ċƫ.!)1/0!0'!* where lights are enclosed in a cabinet, ensuring there is adequate ventilation.

%#$0ü00%*#//$+1( *+0!ü00! %*0$! 2%%*%05+"ý))(!/1."!/ċ

PENDANT LIGHTING BELLATRIX - Crushed Crystal Pendant Light

Warm LED Colour

Dimmer

đ +(%/$! $.+)!ü*%/$ 1200

• Beautiful crushed crystal layer in the +00+)+"0$!ü00%*# • 972 integrated LEDs

360

đ %#$0+1*!/+û.5/0(/,.+ 1%*# /,.'(%*#!û!0 • Cables are adjustable

1000

• Suitable for use with a wall dimmer

SINGLE

Code

Wattage

Voltage

Qty

LED Colour

SE32001W0

33.12W

240V

1

Warm White

ZIRCONIA - Crystal Cone Pendant Light Warm LED Colour

Dimmer

đ 05(%/$$.+)!ü*%/$ đ ƫ(!./!(! 3%0$ý+0%*#.5/0(/ đ (%#$0.!ý!0/".+)!$.5/0(#%2%*# /,.'(%*#!û!0 On

Off

• 24 integrated LEDs 1200

• 920mm stainless steel cable is adjustable

120

SINGLE

Code

Wattage

Voltage

Qty

LED Colour

SE32101W0

4.8W

240V

1

Warm White

T: 01325 505599 (North) | 88 (South)

8.28


REMOTES, SENSORS & DIMMERS 3-IN-1 REMOTE CONTROL â&#x20AC;˘ The 3-in-1 remote will control all types of LED product in the Sensio range; single colour, dual colour and RGB â&#x20AC;˘ Multiple functions including: dimming, colour changing and control light zones Ä&#x2018; %Ăť!.!*005,!/+"(%#$0%*#*!6+*!  together following set-up

>1VOMMB?V

?,6(%LBF  



 -9PHM6@2V!4//;V

%10: 2:) )3,:

)11:1):0 1:2:0.: )!),:2#+.24/:91:2: %2).:"%:

(/?/V/MV V )&:*,00:1):08: 1:0&0:0),1: V "V$#V @(F/%J6?2VF624LA0JJV *-00:2):281:*, 

U  /+F/%K8@2VF635MA/KJV

Other Functions: Colour change speed: ,.!//Ă˝/$)+ !ÄĽ fade mode button and increasing brightness/ decreasing brightness at the same time to speed up/down.

SE790050 White light (single colour) receiver

SE1004100 Adjustable Colour Temperature Receiver

Code

Voltage

Qty

Power

SE791990

12V and 24V

1

2 x CR2032 (3V) lithium batteries (included)

Compatible receivers Code

Description

OSE790050

White light (single colour) receiver

OSE791050

Adjustable RGB colour receiver

OSE1004100

DuoFlex receiver

250W MOTION SENSOR SWITCH Wattage: 50W, Use with: 12V, 24V or 240V products, Cut-out: 20mm, Cable length: 1.5m Detection Range: 0.5m-2.5m This can be mounted inside a cabinet unit and will detect once the door is opened and 3%((/3%0$0$!(%#$0Ăź00%*#+*Ä&#x2039;

Code OSE40515

250W motion sensor switch

24W/48W CABINET/SWIPE - Sensor Switch Wattage: 24W/48W, Use with: 12V or 24V products (with an LED connector), Cut-out: 14mm, Cable length: 1.5m with 6 port JB4 connector, Detection Range: 5cm Designed for mounting on the underside of a cabinet, or recessed into the pelmet to act /*+*ÄĽ+Ăť/3%0$5/%),(5/3%,%*#5+1. hand past the sensor. Also suitable for use as a cabinet sensor, where cabinet lights are used. Lights illuminate when the door is +,!*! * 01.*+Ăť3$!*0$! ++.%/(+/! Ä&#x2039; This switch also has a dimming solution.

Code

Wattage

Qty

Driver

SE40516.1

24W or 48W*

1

ORequired

*Maximum 24W=12V, 48W+24V

8.29

Order Online www.pws.co.uk

SE791050 Adjustable RGB Colour Receiver


DRIVERS REQUIRED More information Page 8.04

REMOTES, SENSORS & DIMMERS

Code

Description

OSE490950 OSE491950 OSE492950 OSE40557.1

6W Driver with 6 ports 15W Driver with 6 ports 30W Driver with 6 ports 60W Driver with 12 port JB4 distributor

MODA HD LED DIMMING SWITCH Wattage: 15W or 30W, Use with: 12V or 24V products, Cable length: 1.5M cable from sensor to JB4 plug and 1.5M from the sensor to the 6 port JB4 distribution block, Detection Range: 5cm • Activates and dims lights with motion • Mount inside a cabinet - open door to activate light • Mount under cabinet

Code

Wattage

Qty

Driver

SE40520C

15W or 30W*

1

ORequired

*Maximum 15W = 12V, 30W = 24V, *Comes in coloured packaging.

CABINET SENSOR SWITCH Wattage: 250W, Use with: 12V, 24V or 240V products, CUT-OUT: 13M, Cable length: 2M, Detection Range: 5-10cm Recess into the front of an interior shelf inside the cabinet. On opening the door the connected internal lights will switch on, when 0$! ++.%/(+/! 0$!(%#$0/3%((/3%0$+ûċ

Code

Wattage

Qty

Driver

SE40518

250W*

1

ORequired

*Maximum

LINK S - Receiver, Magnet and Reed Switch The Link S Receiver, Magnet and Reed Switch is a cleverly designed solution to control lighting wirelessly through the opening and closing of doors. The magnet and reed switch are suitable for mounting on any door and frame, and upon opening will send a signal to the receiver to trigger the lighting. The Link S Receiver can control multiple lights within a kitchen, which means no more fumbling for switches in the dark, and no more wasted energy when you forget to 01.*0$!(%#$0+ûċ • Battery life > 3 years • Compatible with Sensio Drivers • > 8M range • Low power consumption • One receiver can support up to 5 Magnets + Reid switches

Image shows how this product is wired to a driver

• One Reid switch + Magnet can support up to 5 receivers • IP20 Rating

Code

Wattage

Voltage

Qty

Driver

PACK

SE79095

72W

24V Receiver, 3V Magnet

1

ORequired

SINGLE

SE79195

72W

24V Receiver

1

ORequired

SINGLE

SE79295

3V Magnet

1

ORequired

T: 01325 505599 (North) | 88 (South)

8.30


SENSIOPODS SENSIOPOD 2.5 metres

â&#x20AC;˘ Two USB ports integrated to charge USB devices

100

130

â&#x20AC;˘ IP54 rated with in-built water channels â&#x20AC;˘ Quick release catch for secure closing 322

Cut out 90 - 92mm diameter hole in work surface. Allow minimum 25mm clearance around the cut hole. When choosing location, select a surface between 10mm and 50mm thick.

25

m

m

m

25

m

Ă&#x2DC;90 - 92mm

100

Code

Connection

Power Supply

Qty

Colour

SE80050AL

13A plug*

Sockets: 3 x power & 2 x USB

1

Ćľ(1)%*%1)Ăť!0

*Included. Please note: if charging a Smart device with a high mA requirement, please only charge one item at a time.

SENSIOPOD+ 2.5 metres

â&#x20AC;˘ Two USB ports integrated to charge USB devices

100

130

â&#x20AC;˘ Maximum allowance across both ports is 2100mA â&#x20AC;˘ Quick release catch for secure closing

322

â&#x20AC;˘ Can be retracted fully whilst products are plugged in 25

Cut out 90 - 92mm diameter hole in work surface. Allow minimum 25mm clearance around the cut hole. When choosing location, select a surface between 10mm and 50mm thick.

m

100

Ă&#x2DC;90 - 92mm

Code

Connection

Power Supply

Qty

Colour

SE80050CH

13A plug*

Sockets: 3 x power & 2 x USB

1

+(%/$! ĆŤ$.+)!Ăť!0

SE80050GM

13A plug*

Sockets: 3 x power & 2 x USB

1

ÇŤ('%'!(Ăť!0

SE80050SS

13A plug*

Sockets: 3 x power & 2 x USB

1

0%*(!//0!!(Ăť!0

*Included. Please note: if charging a Smart device with a high mA requirement, please only charge one item at a time.

Code

Colour

SE80050CH Polished Chrome

8.31

Order Online www.pws.co.uk

m

m

25

m

Code

Colour

Code

SE80050SS

Stainless Steel

SE80050GM Black Nickel

Colour


EVOLINE SOCKET PORTS

Ƶ((,+.0/*!)+1*0! %* %û!.!*035/%*0+āĀĂ)) %)!0!.$+(!%*/1."!Ĩ3+.'/1."!+./!+"3((1*%0ĩ3%0$)4%)1)0$%'*!//+"ĆĀ))ċ

3 SOCKETS + 2 USB - Supplied with 3m cable, 13A plug attached EVOLINE PORT 2,1A max. 5V

271 271mm mm

• Plug n’ play solution, quick and easy to install into ANY type of surface, from 10–50mm

347 347 mm mm

1A max. 5V

• Ideal solution for worktop, island or even inverted applcation, i.e. underside of a wall cabinet

• Designed and engineered to counteract against spillages and liquid ingress • Patented ‘rocking’ cover allows appliances to be plugged in and Port fully retracted into surface whilst still in use • Aesthetically pleasing, small and discreet footprint đ Ƶ*+ %/! (1)%*%1),.+ü(!* /+(%  brushed Stainless Steel cover • Multiple international award-winner, long-standing market leader

Ø Ø100 100 mm mm ØØ127 127 mm mm

• Designed and made in Germany • EVOline best seller

Brushed solid stainless steel PC3SSUSB

T: 01325 505599 (North) | 88 (South)

8.32


EVOLINE BACKFLIP $!2+(%*!ǫ'(%,/%0/*!.(5ý1/$+*0$!3+.'/1."!ċƵ00+1$ +"ü*#!.Č%001.*/āĉĀ !#.!!/0+.!2!(03+,+3!./+'!0/* ǫ$.#!.ċ %0$0+0(%*/0((0%+*$!%#$0+"&1/0Ćă))Č0$!ǫ'(%,*!ü00! +2!)+/0 drawers, including a cutlery drawer.

EVOLINE BACKFLIP • Ideal solution for horizontal, vertical or even inverted position, i.e. underside of a wall cabinet • Plug n’ play solution, quick and easy to install into ANY type of surface, from 10–40mm • Only 53mm total depth from underside of cover • Designed and engineered to counteract against spillages and liquid ingress • Aesthetically pleasing, provides a contemporary, innovative and compact solution • Slick push-to-open function, spins 180° to reveal Sockets and USB Charger • Versatile solution for around the home • Alternative solution if looking to omit wall sockets, i.e. within glass splashbacks • Multiple international award-winner, market leader • Designed and made in Germany • EVOline best seller

1

* European socket is shown for display purposes only. This product will come with a UK socket.

AVAILABLE FINISHES

Code

Colour

Code

Colour

Code

Colour

BF2BK

Black Glass (Gloss)

BF2SS

Stainless Steel

BF2WH

White Glass (Gloss)

8.33

Order Online www.pws.co.uk


T: 01325 505599 (North) | 88 (South)

8.34


DISPATCH AND COLLECTION Standard delivery for stocked products within mainland UK is five to seven working days. Orders for stocked products placed before 1pm will be dispatched the following business day. Delivery for non-stocked and processed products (such as paint-to-order or bespoke sizes) are subject to advertised lead times. By prior arrangement, orders can be made available for collection at our Trade Counter in Newton Aycliffe. Collections by third-party carriers are not permitted. Minimum order values, carriage terms and charges are stated at the time of order.

PREMIUM DELIVERY SERVICES The following premium options are also available as a charged service* â&#x20AC;˘ Delivery on a specific day of choice â&#x20AC;˘ Next-day delivery (delivery within close of business on the next working day)* is in line with regional cut off times. Please speak to your customer services team for further information. â&#x20AC;˘ Pre-10:30, pre-noon and Saturday (a.m.) delivery also available.* Äľ1&!00+2%(%(%05* +. !./%6!Ä&#x2039;. !./)1/0!,(! !"+.!Ä&#x192;,)

RESIDENTIAL ADDRESSES Deliveries to residential or third-party non-business addresses will incur a supplement fee to the cost of carriage.

RE-DELIVERY A re-delivery charge will be applicable if delivery is attempted during normal working hours but cannot be made â&#x20AC;&#x201C; for both residential and business addresses. The charge is usually relative to the size and original delivery cost.

SIGNING FOR GOODS â&#x20AC;˘ Before signing the receipt of goods, please count the number of items delivered. â&#x20AC;˘ Inspect your delivered goods for obvious signs of damage to the outer packaging such as dented corners. â&#x20AC;˘ If you notice any missing or damaged goods, please advise our Customer Service department within 36 hours of receipt. â&#x20AC;˘ Take a photograph of all damage to packaging before unpacking the goods for further inspection. â&#x20AC;˘ For all damaged products which are not affected by transit please inform Customer Service within seven working days.

COLLECTION OF GOODS We can arrange to collect returned goods upon prior agreement. Please contact our Customer Service team for a quote to use our return service. To receive credit on returned goods, we must receive all products in their original packaging so that they can be re-stocked. Insufficient transit packaging often causes damage to the product.

Your Directory Online www.pws.co.uk


PWS Distributors Ltd PO BOX 20, Station Road Ćľ5(%Ăť!ÇŤ1/%*!//.' !30+*Ćľ5(%Ăť! Co. Durham DL5 6XJ, UK t: +44(0)1325 505555 !Ä?)%(ÄŽ,3/Ä&#x2039;+Ä&#x2039;1' 333Ä&#x2039;,3/Ä&#x2039;+Ä&#x2039;1' 333Ä&#x2039;,3/3+.'/1."!/Ä&#x2039;+Ä&#x2039;1'

Profile for Sinc Kitchens

Sinc Kitchens - PWS Catalogue 2020  

Sinc Kitchens - PWS Catalogue 2020  

Advertisement