Issuu on Google+

0DUFK

theroar &+$036 9RLFHRIWKH6WXGHQWV

,16,'( +XQJU\"

&ROOLQV¶WULORJ\ JRHVWRWKHELJ VFUHHQ3DJH

3URPWDVWLF %HHSEHHS

6KRSSLQJIRUGDQFH :LOODGYHUWLVHPHQWV GRHVQ¶WQHHGWREUHDN ¿QGWKHLUZD\RQWR WKHEDQN3DJHV VFKRROEXVHV"3DJH

:+,&+*2335(6,'(17,$/&$1','$7(6+$5(6<2859,(:6"3$*(


Meredithâ&#x20AC;&#x2122;s Bridal & Formalwear

%ZEWXZEVMIX]SJWM^IWWLETIWERH WX]PIW]SYEVIKYEVERXIIHXSFIXLI SRP]SRIMR]SYVWTIGMEPHVIWW ;2I[,EZIR%ZI1IPFSYVRI*0  4LSRI  

Meredithâ&#x20AC;&#x2122;s Tuxedos & suits

%[MHIVERKISJEPP]SYVTVSQERH JSVQEP[IEVRIGIWWMXMIWJSVWEPIERH VIRX6IRXEPWWXEVXMRKEX ;2I[,EZIR%ZI1IPFSYVRI*0  4LSRI  


theroar 7DEOHRI&RQWHQWV

PDUFK bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

(QWHUWDLQPHQW

<RXUWXUQ /HWWHUV

´7KLV0HDQV:DUµ

3KRQHVRQFDPSXV DQGDSOD\HUÒ&#x2039;VWKDQNV

3UHGLFWDEOHSORWOHDYHV Ã&#x20AC;OPEHKLQGRQEDWWOHÃ&#x20AC;HOG

2XUWXUQ 6DYHVLEOLQJV

6KHGGLQJVRPHOLJKW %RRNUHYLHZRI´'DUN/LIHµ 2QHWRDGGWR\RXUOLVW

7KHSURVDQGFRQVRI WKHSUHIHUHQFHSROLF\

6WDIIHGLWRULDO *RY6FRWWVKRXOGYHWR VFKRROSUD\HUOHJLVODWLRQ 5RVHVDUH5HG&RUVDJH

$WKOHWLFV &DWWDOHV

SKRWR&DUOHLJK:DOWHU

)HDWXUHV 3X]]OLQJSROLWLFV

&ROXPQLVW6DP/DFN NLFNVIRRWEDOO VWLFNVZLWKVRFFHU

.QRZWKHYLHZVRIWKH*23FDQGLGDWHV EHIRUH\RXJRWRWKHSROOVLQ1RYHPEHU

/HIWDWWKHDOWDU

6HH\DODWHUVLVWHU

0RYLHUHYLHZ-XVWVD\ ´,GRQÒ&#x2039;WµWR´7KH9RZµ

%URWKHUO\ORYH

7DONDWWKHVFKRROERDUGDERXWHQGLQJ WKHVLEOLQJSUHIHUHQFHFODXVH

7KHULJKWFKRUG

7DLQWHGWDWWRRV

:=5'Ò&#x2039;VGHEXWDOEXP JDUQHUVDJRRGUHYLHZ

:LWKLOOHJDOSURFHGXUHVRQWKHULVH FRQVHQWIRUPVLQFUHDVLQJO\LUUHOHYDQW

&RPLFV

)DPLOLHVKDYHPXOWLSOH VRQVRQVSRUWVWHDP

+HÒ&#x2039;VDNHHSHU (LJKWKJUDGHJRDOLH SURYHVKLPVHOI

6FLHQFHVXSHUVWDU

6WDWHFKDPSV :LOGFDWVZLQLWDOO

-XQLRU0LFKHOOH&KLQWDNHV WKHELRORJ\ZRUOGE\VWRUP

)RUVDOH 6WDWHORRNVIRUZD\VWRVDYHWKHVXIIHULQJ VFKRROEXGJHW&RXOGEXVDGYHUWLVHPHQWV EHWKHDQVZHU"

3UHWW\SHQQ\

6FKRROVSLULW $MRXUQH\WKDWWRRN WKHVWXGHQWERG\ IRUWKHULGHRILWVOLIH

8SFRPLQJ3URPFRXOGJRGHHSLQWRZDOOHWV

(DWXS ´+XQJHU*DPHVµVHULHVFDXVHVDVWLU ZLWKDSSURDFKLQJPRYLHSUHPLHUH

*LIW6DZDQJNXP 0DOLD%DODQFLD 

1RWMXVWEUDLQV 6WXGHQWEDQG$JLOLW\ MXJJOHVVFKRRODQGPXVLF

/RYH+DWH 2SLQLRQVRIVWXGHQWV RQWKHPHGLD


newsfeed

westshoreroar.com/news

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb



3KRWRSDXOKRXVHJRY

3KRWRVDQWRUXPVHQDWHJRY

GOP PRESIDENTIAL

CAMPAIGN 3KRWR05RVDVFR

3KRWR05RVDVFR

7,0(72&+226(

:LWKWKH5HSXEOLFDQSULPDULHVXQGHUZD\WKHIRXUPDMRU5HSXEOLFDQFDQGLGDWHVKDYHGLIIHULQJYLHZVRQLVVXHV\RXQJSHRSOH FDUHDERXW)RUHDFKLVVXHFLUFOHWKHUHVSRQVH\RXPRVWVWURQJO\DJUHHZLWK7KHGHVFULSWLRQRIWKHFDQGLGDWHZKRUHSUHVHQWV HDFKFROXPQFDQEHIRXQGDWWKHHQGRIWKHSDJH *UDSKLF0LOOLH5RVDVFR

,668( /(*$/,=(' 0$5,-8$1$



0HGLFDORUQRWPDULMXDQD VKRXOGQRWEHOHJDOL]HG

,00,*5$7,21

,PPLJUDQWVVKRXOGEH DOORZHGLQ$PHULFD,W¶V PDGHRXUFRXQWU\WKH EHVWDQGWKHEULJKWHVW

*$< 0$55,$*(

,WZRXOGGHVWUR\WKH FXOWXUHDQGGDPDJH WKHHGXFDWLRQV\VWHP WKHUHIRUHGDPDJLQJWKH ZHOOEHLQJRIWKHFKLOGUHQ

$%257,21

$ERUWLRQ¶VZURQJDQG VKRXOGEHLOOHJDOH[FHSW IRUFDVHVRILQFHVW UDSHDQGVDYLQJWKH PRWKHU¶VOLIH

('8&$7,21







0HGLFDOPDULMXDQDLV 2.EXWLI\RXDEXVHWKDW SULYLOHJH\RXVKRXOGORVHLW

%HHQWKHUHGRQHWKDW,¶P OHDUQLQJIURPP\PLVWDNHV DQGLWVKRXOGQ¶WEHOHJDO

0DULMXDQDVKRXOGEH OHJDOL]HGLW¶VQRQHRIWKH JRYHUQPHQW¶VEXVLQHVV

,WPDNHVVHQVHZK\SHRSOH LPPLJUDWH,WVKRXOGEH EODPHGRQRXUODFNRI ERUGHUSDWUROPRUHWKDQD GHVLUHIRUDEHWWHUOLIH

$OORZLQJLPPLJUDQWVLQWR $PHULFDGDPDJHVRXU FRXQWU\²HFRQRPLFDOO\ DQGVRFLDOO\

,IRXUFRXQWU\ZDVQ¶W LQVXFKDEDGSODFH HFRQRPLFDOO\VSHDNLQJ, ZRXOGQ¶WFDUHEXWZHDUH DQGZHVKRXOGWDNHFDUH RIRXUVHOYHV¿UVW

*D\PDUULDJHVKRXOGQ¶W EHOHJDOEXWWKH\VKRXOG KDYHVRPHULJKWVWRVHH SDUWQHUVLQWKHKRVSLWDO

$QLPSULVRQHGIDWKHUDQGD FUDFNKHDGPRPDUHEHWWHU WKDQJD\SDUHQWV

:KRDP,WRVD\ZKR FDQJHWPDUULHG"

3UROLIHFRPSOHWHO\1R SODQQHGSDUHQWKRRG

$ERUWLRQVVKRXOGEHLOOHJDO 0\YRWHFRXQWVIRUDOOWKH LQQRFHQWEDELHVWRR,GRQ¶W WKLQNWKHPRWKHUVDUHDW PXFKIDXOWDVWKHGRFWRUV ZKRSHUIRUPWKHDERUWLRQ

6WURQJO\SUROLIHEXW 3ODQQHG3DUHQWKRRG VKRXOGEHOHJDO

³1RFKLOGOHIWEHKLQG´ LVVWXSLGDQG VKRXOGQ¶WH[LVW

<RXKDYHDULJKWWR\RXU OLIHEXWHGXFDWLRQLV QRWDULJKW(GXFDWLRQ LVVRPHWKLQJ\RXPXVW HDUQ

0LOLWDU\VWUDWHJLHVVKRXOG 6WXGHQWVVKRXOGKDYHWR EHLPSOHPHQWHGLQWKH WDNHDPDWKDQG(QJOLVK H[DP DQGSDVV LQRUGHU HGXFDWLRQV\VWHP*LUOVZKR WRJUDGXDWHKLJKVFKRRO JUDGXDWHKLJKVFKRROKDV YLUJLQVVKRXOGEHUHZDUGHG

<RXPRVWDJUHHZLWK0LWW5RPQH\*URZLQJXSDVD0RUPRQ5RPQH\KROGVIDPLO\DVDVWURQJIRXQGDWLRQIRURXUFRXQWU\,W¶VQRWHGWKDWKLV DFFHVVWRODUJHDPRXQWVRIPRQH\KDVKHOSHGKLPLQKLVUHFHQWFDPSDLJQLQJ<RXPRVWDJUHHZLWK1HZW*LQJULFKDVWURQJVXSSRUWHURIWKH VSDFHSURJUDPDQGRQHGD\ZDQWVWRPDNHWUDYHOLQJWRWKHPRRQDQHYHU\GD\HYHQW<RXPRVWDJUHHZLWK5LFN6DQWRUXPZKRLVNQRZQIRU KLVVWURQJRSLQLRQVRQSUROLIHDQGRSSRVLQJSODQQHGSDUHQWKRRG+HDOVRVWURQJO\EHOLHYHVJD\PDUULDJHVKRXOGEHLOOHJDO<RXPRVWDJUHH ZLWK7H[DV5HS5RQ3DXODOLEHUWDULDQZKRGRHVQ¶WRSSRVHJD\PDUULDJHRUOHJDOL]LQJPDULMXDQD

Otheroar OPDUFK


)RUWKHFXUUHQWVFKRRO\HDUWKHUHDUHIDPLOLHV ZLWKPXOWLSOHFKLOGUHQHQUROOHGDW:HVW6KRUH

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

%RDUGH\HVVLEOLQJVSOLW :LQQLQJWKHORWWHU\LV 2IĂ&#x20AC;FLDOVFRQVLGHUDEROLVKLQJSUHIHUHQFHFODXVH 

WKHRQO\ZD\WRJHWLQ

7DQLD0DUWLQ

%ULWWDQ\&KR

6SHFLDOWR7KH5RDU

0DQDJLQJ(GLWRU

According to Lack, without the guarantee that siblings will attend school together, some parents Most students gain entrance into might not send their children to a these schools through the lottery, choice school in the first place. but under the original schools-ofâ&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m glad my son is at West choice charter, siblings of lottery Shore, and pleased that his brother winners are automatically eligible will be able to attend this school for enrollment if they meet aca- next year,â&#x20AC;? she said. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t know demic requirements. if I would have applied for my But some Brevard County School older son to attend West Shore if board members argue that since a I couldnâ&#x20AC;&#x2122;t be reasonably certain his sibling is automatically accepted, younger brother would attend as the chances for outside applicants well. Teachers and administrators to be accepted is get to know families lowered. Last month, with multiple sibmore than 1,000 aplings really well, and plied for 175 slots. usually, thatâ&#x20AC;&#x2122;s a very Though decision positive experience all has not yet been around.â&#x20AC;? made, Donna Lack, Principal Rick Flemthe mother of a curing says a focus on rent student and a families is essential to future seventh-grad- 7KH.HOOQHUVMXQLRU the experience. er, is concerned that $EELHHLJKWKJUDGHU â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve worked reremoving the sibling $VKO\QDQGVHYHQWK ally hard to make West clause will lead to JUDGHU$OOLH Shore have a more painful consequences. family aspect,â&#x20AC;? he said. â&#x20AC;&#x153;I feel that if the school board â&#x20AC;&#x153;Having siblings here together does away with the sibling pref- helps to build the family connecerence clause, it will effectively tion. We will definitely be affected dismantle the wonderful family if this was to be taken away.â&#x20AC;? atmosphere that is a positive charOne concern is that more older acteristic of West Shore, and prob- students would likely be admitted. ably the other schools of choice as â&#x20AC;&#x153;We start at seventh grade and well,â&#x20AC;? she said. â&#x20AC;&#x153;Our school may work our way up to higher levels of miss out on a whole new and di- academics,â&#x20AC;? Fleming said. â&#x20AC;&#x153;Coming verse group of students that will here from another middle school bypass the opportunity to attend might give the student a disadvansince the parents do not want their tage. It might be a harder transichildren to be at separate schools.â&#x20AC;? tion, but it is clearly possible.â&#x20AC;? Junior Liam Wixted, a school According to district records, 40 soccer player, says ending the sib- percent of 175 incoming seventhling preference would be a mistake. graders were admitted under â&#x20AC;&#x153;We have three sets of brothers the sibling clause in the 2010-11 [on the soccer team], so it brings school year, but Fleming says that everyone together. The older percentage does not paint an enbrothers help the younger broth- tirely accurate picture. ers,â&#x20AC;? he said. â&#x20AC;&#x153;They donâ&#x20AC;&#x2122;t want the â&#x20AC;&#x153;People donâ&#x20AC;&#x2122;t realize that 12 to younger brothers out-competing 15 applicants of that 40 percent them so it kind of just brings ev- would have gotten into West Shore erything together and makes us even if we didnâ&#x20AC;&#x2122;t have the grandfacompete more.â&#x20AC;? ther clause,â&#x20AC;? he said.

Upon hearing students have made it into the prestigious West Shore, the first question outsiders tend to ask is, how did they get in? Parents of children who havenâ&#x20AC;&#x2122;t made the lotterybased cut sometimes turn to conspiracy theories such as bribery or inside favors. While Principal Rick Fleming refutes such notions, he has seen attempts to bypass the admissions system. â&#x20AC;&#x153;The most profound case Iâ&#x20AC;&#x2122;ve ever had is when a mother called me from her hospital bed at Holmes Regional Medical Center,â&#x20AC;? he said. â&#x20AC;&#x153;She called from the cancer ward and was diagnosed with lymphoma. She had three months to live and her dying wish was for her son to come to the school, but he was not selected in the lottery. I checked her story and even went to the hospital to meet her and to explain the process and the bad news. There is nothing that can touch the integrity of the process.â&#x20AC;? Office Clerk Janice Kowing, who oversees the lottery process, cites various cases of parents trying to circumvent the system. â&#x20AC;&#x153;At least two or three times a year people try to use fake addresses that are either from a friend or a boyfriend or a cousin if their kids donâ&#x20AC;&#x2122;t live within the required area,â&#x20AC;? she said. Kowing says people have accused the school of taking bribes though the system is completely legitimate. â&#x20AC;&#x153;We welcome people to watch the process,â&#x20AC;? Kowing said. â&#x20AC;&#x153;Once the information is processed, the computer generates a random number for the student application. Those numbers are printed, cut into little strips and put in an actual lottery barrel.â&#x20AC;? Kowing says the school then holds an event in which members of the School Advisory Council, parents, students and administrators watch the process of each number getting picked and cross check the order to ensure accuracy. â&#x20AC;&#x153;No names are involved, itâ&#x20AC;&#x2122;s just numbers, so itâ&#x20AC;&#x2122;s a completely blind lottery,â&#x20AC;? Kowing said. Kowing says the lottery system is necessary because the school has more applications than available spots to fill. Last month, 1,025 students applied for the 2012-13 school semester, the most in school history. Some say only top-performing students should be admitted. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s against the design principles the school was set up with to discriminate against these students with the god-given aptitude,â&#x20AC;? Fleming said. â&#x20AC;&#x153;A school full of kids that are brilliant would give us an elitist image.â&#x20AC;? Eighth-grader Hyun Bak says he feels lucky to have made it into the school. â&#x20AC;&#x153;I heard it was super hard to get in and even my friends with straight Aâ&#x20AC;&#x2122;s who were good at everything tried three times and didnâ&#x20AC;&#x2122;t get in,â&#x20AC;? Bak said. â&#x20AC;&#x153;[When I applied] they told me itâ&#x20AC;&#x2122;ll never work.â&#x20AC;?

PDUFKO theroar O


newsfeed

westshoreroar.com/news

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

,OOHJDOLQNSRVHVERWKOHJDODQGKHDWKULVNV 0DUOH\%XWFKHU 0DQDJLQJ(GLWRU Tattoos are increasingly popular and while 18 is the legal age to get a tattoo without parental consent, increasingly teens are turning to alternative sources. “I know people who own an illegal tattoo parlor,” a senior girl said. “They don’t own a shop, they just run the parlor out of their house. They don’t have a license that I’m aware of, but I’m pretty sure they run a clean operation. They charge way less than normal tattoos and don’t ask for I.D. They normally tattoo friends of friends and, from what I’ve seen, the tattoos are really cool. I’ve never heard of anyone that got their tattoo there get an infection.” Student Resource Officer Charles Landmesser said people who provide such services have been arrested and sent to jail because of the seriousness of the health regulation requirements. “The first thing as an investigator that I would do is to check out the place in question,” he said. “I would determine whether the suspect was directly involved or if the place in question is being rented.

Then I would talk to the neighbors and see if there is a lot of traffic or shipments coming to the suspected house. If it turns out to be an illegal place of business the person could go to jail. The case gets turned over to the state attorney and from there to a judge who will try the case. It’s something you don’t want to get mixed up in.” Unregulated tattooing also poses serious health risks. Jennifer Corbin, a nurse at Holmes Regional Medical Center, has seen patients contract HIV and hepatitus as a result of tattoo infections. “You’re running the risk of getting seriously infected,” Corbin said. “And it’s serious. There are so many diseases that you could get from sharing needles, HIV being the major one. People who run their own tattoo places are not under any supervision and don’t have to follow any of the health regulations that other places do. More than the needles is the ink. The reused ink could carry Mersa which will give you staff infections. The bacteria is very harmful and is evolving to survive the dosage of antibiotics that we give you. Practicing clean hygiene is the only way to prevent getting these diseases, and getting a tattoo from a clean legal parlor is what will save you.”

-XQLRUҋVSDVVLRQIRUVFLHQFHUHDSVUHZDUGV 6DUDK'D\ 6WDIIZULWHU Ever hear the phrase “science is all around us”? It explains phenomena as complex as how man originated on Earth and as simple as why an object must fall once you throw it up in the air. But science has yet to explain a person’s willingness to sacrifice in pursuit of passion. Junior Michelle Chin has lived and breathed science for as long as she can remember. “Recently, I won the Senior Biological Best of Show 0LFKHOOH&KLQ Award and an invitation to compete at the 2012 Intel International Science and Engineering Fair in Pittsburgh at the Brevard Mainland Science and Engineering Fair,” Chin said. “I won first place in the Plant Sciences category. I was extremely happy to win Best of Show because I worked hard, and my efforts paid off.” The Intel ISEF 2012 is the premiere event

for more than 1,500 international student finalists. The symposium includes workshops, demonstrations and panel discussions, and opens the door to opportunities to win scholarships and internships. “I always have a strong interest in science since elementary school,” Chin said. “For the past three years, I have been doing independent science research in my spare time on top of my regular class schedules.” Chin admits her success didn’t arise solely through hard work. Her older brother Marcus, her parents and her teachers have help her realize her dreams. “Even though I have always been involved with science, my sincere interest sparked in 10th grade when my AP Biology class took a field trip to [University of Florida] to conduct a research lab. It was a wonderful learning experience,” Chin said. “Soon after, I participated and received first place awards in protein modeling, cell biology in the Florida regional and state and Science Olympiads which heightened my confidence to compete.”

Working ahead, Chin started on her science project during the summer. “This year, the idea for my project came from my Green Connection experience last summer,” Chin said. “I studied environmental conservation in France for two weeks and was inspired to conduct a research project on environmental cleanup.” Though it seems as if Chin has already accomplished the impossible, she doesn’t plan to stop anytime soon. She plans to double-major in biomedical engineering and international business in college and would like to pursue a career in science research on medicine or environment. Currently, Chin is preparing for the Florida State Science Fair in April and the International Science Fair in May. “I am very proud of my accomplishments so far,” Chin said. “There is so much more that goes on behind the scenes in order to become successful, especially in a field as tedious as science. I believe it takes years of discipline, hard work, solid scientific thought and creativity.”

Otheroar OPDUFK


5HYHQXHIRUVFKRROEXVDGVZRXOGKDYHEHHQDOORWWHGDVIROORZV SHUFHQWIRUVFKRROGLVWULFWWUDQVSRUWDWLRQSHUFHQWIRUGULYHUVŇ&#x2039;HG SURJUDPVDQGSHUFHQWIRURWKHUSURJUDPVFKRVHQE\WKHGLVWULFWV

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

3KRWR&:DOWHU

%86(6$6%,//%2$5'67KH)ORULGD/HJLVODWXUHFRQVLGHUHGDOORZLQJDGYHUWLVLQJRQEXVHVWRUDLVHIXQGVIRUVFKRROV

6HQDWHNLOOVELOOWRSODFHDGVRQVFKRROEXVHV )HOLFLD6ROD]]R 6WDIIZULWHU As school districts are impacted by the countryâ&#x20AC;&#x2122;s economic crisis, new measures are being taken to raise money. Such as putting advertisement on transportation. State lawmakers narrowly defeated a bill that would have permitted school districts to sell advertising space on their school buses. A similar issue was considered last year in the Florida Senate and House, but failed due to lack of support. Representatives once again pushed the bill in order to produce an income during these difficult financial times. The Florida Association for Pupil Transportation (FAPT) opposed the House and Senate bill in January of 2011, fearing an increase in motorist distractions and accidents. In addition, the FAPT said it would be difficult and legally expensive for the state to control the types of advertisements displayed on buses. In the state of Florida, no school districts currently advertise on school buses, as it would be in violation of the present Florida Statue and Florida Administrative Code. Mike Connors, director of transportation for Brevard District Schools, said the bill would not be considered in good economic times. â&#x20AC;&#x153;Legislators know state transportation funding is inadequate,â&#x20AC;? Connors said. â&#x20AC;&#x153;This is a way for them to appear to be helping transportation departments with their transportation costs.â&#x20AC;? Assistant Principal Jim Melia said a decision to put advertisements on buses would come with many consequences. â&#x20AC;&#x153;I like to think of school buses to be big and yellow,â&#x20AC;? Melia said.

â&#x20AC;&#x153;That way, people can know that vehicle carries special cargo â&#x20AC;&#x201D; someoneâ&#x20AC;&#x2122;s child.â&#x20AC;? In addition, Melia is concerned about the messages students could be receiving from the advertisements. In 2007, a conflict arose in Seminole County when McDonaldâ&#x20AC;&#x2122;s coupons were printed on student report cards. Parents complained that the county was promoting poor eating habits as child obesity was a growing issue in the country. Which begs the question: How can you differentiate whether an ad is offensive to someone or not? â&#x20AC;&#x153;That must be answered by the school board if the advertising on school buses bill is approved,â&#x20AC;? Connors said. â&#x20AC;&#x153;This issue is one we used when voicing our opposition to the bill. The â&#x20AC;&#x2DC;appropriate or notâ&#x20AC;&#x2122; line must be drawn, yet who determines the criteria?â&#x20AC;? Laura Brusca, a mother, said the state must take the safety of students into consideration if the bill is passed, as she has two daughters who ride the bus to and from school during the week. â&#x20AC;&#x153;I think advertising on school buses is an acceptable idea if the advertisements were limited to one per side for safety reasons,â&#x20AC;? Brusca said. â&#x20AC;&#x153;However, itâ&#x20AC;&#x2122;s a little embarrassing that schools have to resort to this.â&#x20AC;? Melia, in agreement with Brusca, also is upset with the lack of money that is provided for the school system. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s sad that education has come to the point where weâ&#x20AC;&#x2122;re so desperate for money, that we must turn our school buses into billboards,â&#x20AC;? Melia said. Both Sen. Mike Haridopolisâ&#x20AC;&#x2122; and Rep. Ritch Workmanâ&#x20AC;&#x2122;s offices did not return multiple phone calls to comment on this story, but observers expect the proposal to return next year.

PDUFKO theroar O


newsfeed

westshoreroar.com/news

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

67,&.(56+2&.

/D\DZD\SODQVWKULIWLQJFDQKHOSHDVHFRVWVIRUIRUPDOGDQFH -XOLD/HY\

6WDIIZULWHU Junior Jackie Heller walked out of a local thrift store with her newly purchased Prom dress. Her wallet was only $5 lighter. â&#x20AC;&#x153;I actually wasnâ&#x20AC;&#x2122;t looking for a dress when I walked in that day,â&#x20AC;? Heller said. â&#x20AC;&#x153;I was looking for a costume and I just found it. It was everything I was hoping for in a dress, and it was so inexpensive. The dress just kind of found me.â&#x20AC;? But Heller is in the minority when it comes to spending on Prom. The average price teens spend is $566, according to a 2008 national survey conducted by 7KHULGH  Hearst. After purchasing tickets, attire 7LFNHWV    and other prom-related items, Prom costs &DSWXULQJWKHPRPHQW can add up. 7KHWX[     â&#x20AC;&#x153;The economy isnâ&#x20AC;&#x2122;t too awesome right 7KHGUHVV   now, plus weâ&#x20AC;&#x2122;re teenagers so itâ&#x20AC;&#x2122;s hard to $FFHVVRULHV  afford all of that,â&#x20AC;? junior Tyler Moscrip said. â&#x20AC;&#x153;I get that itâ&#x20AC;&#x2122;s supposed to be a fun +DLU night, but I donâ&#x20AC;&#x2122;t really believe in putting *URRPLQJ out hundreds of dollars for one night.â&#x20AC;? 1DWLRQDODYHUDJHVDFFRUGLQJWR86$7RGD\ Junior Class President Stephanie Delgado said the price of tickets should be about the same as last year, but thatâ&#x20AC;&#x2122;s not where teens put most of their money. â&#x20AC;&#x153;A lot of girls are buying dresses that are hundreds of dollars, and itâ&#x20AC;&#x2122;s pretty ridiculous if you think about it,â&#x20AC;? junior Desiree Corbin said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s kind of pointless because youâ&#x20AC;&#x2122;re only going to wear it once and itâ&#x20AC;&#x2122;s not worth all that money. Iâ&#x20AC;&#x2122;m determined to find a dress thatâ&#x20AC;&#x2122;s $50 or less because Iâ&#x20AC;&#x2122;m a bargain shopper. I think it can still

be simple and cute.â&#x20AC;? Meredith Ryder, owner of Meredithâ&#x20AC;&#x2122;s Bridal and Formalwear said that the economy hasnâ&#x20AC;&#x2122;t affected the sale of dresses much at all. â&#x20AC;&#x153;We sell about 150 dresses every year,â&#x20AC;? Ryder said. â&#x20AC;&#x153;The girls want that dress for Prom, and theyâ&#x20AC;&#x2122;ll do whatever they can to get it. Itâ&#x20AC;&#x2122;s an important day in their life and they want the most beautiful dress they can get.â&#x20AC;? Ryder said multiple plans have been developed to combat the economy so sales stay up. â&#x20AC;&#x153;We have layaway plans so the girls can put money down on the dresses gradually so theyâ&#x20AC;&#x2122;re not paying for the dress all  at once, and it doesnâ&#x20AC;&#x2122;t seem like theyâ&#x20AC;&#x2122;re  spending so much money,â&#x20AC;? Ryder said.  â&#x20AC;&#x153;We carry dresses as low as $80, so that  the girls donâ&#x20AC;&#x2122;t have to worry as much.â&#x20AC;?  Renting as opposed to buying tuxedos also has been the more popular option for  high school boys, according to Heather  Ryder, owner of Meredithâ&#x20AC;&#x2122;s Tuxedos &  Suits. â&#x20AC;&#x153;A lot of guys choose to rent a tuxedo instead of purchasing because itâ&#x20AC;&#x2122;s much less expensive,â&#x20AC;? Ryder said. â&#x20AC;&#x153;Renting one can run as low as $59. Buying one would be much more.â&#x20AC;? Prom is scheduled for April 21 at the Hilton Rialto. â&#x20AC;&#x153;All in all itâ&#x20AC;&#x2122;s going to be expensive no matter what,â&#x20AC;? Corbin said. â&#x20AC;&#x153;But I think we should make the best of it by trying to make it as affordable as possible, but still fun.â&#x20AC;?

 3ULFHRI3URP

Do y ou h ave every t h in g?

+RW5D\]/LPRXVLQHV

,VDEHOODŇ&#x2039;V'RZQWRZQ0HOERXUQH

0HUHGLWKŇ&#x2039;V0HOERXUQH

,VDEHOODŇ&#x2039;V'RZQWRZQ0HOERXUQH

5RVHVDUH5HG,QGLDODQWLF

,VDEHOODŇ&#x2039;V'RZQWRZQ0HOERXUQH

O theroar OPDUFK


3URPZLOOEHKHOGDWWKH+LOWRQ5LDOWRZLWKWKHWKHPHRI,WDOLDQ5LYHUDRQ$SULO 7LFNHWVJRRQVDOH$SULO7KHSULFHIRUMXQLRUVDQGIRUVHQLRUV

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

6KH6DLG

+H6DLG

Âł,ÂśYHEHHQORRNLQJ

Âł,KDYHQÂśWWKRXJKW

DW3URPGUHVVHVVLQFH

DERXWP\WLH,ÂśPPDWFKLQJ

'HFHPEHU,GRQÂśWZDQWWKLV

LWWRKHUGUHVVVR,GRQÂśW

WREHODVWPLQXWHDQG JHWDQXJO\RQH´

KDYHWRGRDQ\WKLQJ´

Âł,ÂśOOSUREDEO\JHWP\ QDLOVGRQHDQGDQ\RWKHU

Âł,ÂśOOQHHGWRRUGHUP\ FRUVDJHHDUO\EXWRWKHU

SULPSLQJWKDWFDQEHGRQH EHIRUHKDQGVR,ÂśP

WKDQWKDW,GRQÂśWWKLQN,ÂśOO KDYHPXFKWRGRâ&#x20AC;?

QRWVWUHVVHG´

Âł7KHGD\RI3URPLV

Âł,WÂśVQRWJRLQJWRWDNHD

JRLQJWREHSUHWW\KHFWLF,

ORQJWLPHIRUPHWRJHWUHDG\

KDYHWRVWDUWVWUDLJKWHQLQJ

DWDOO-XVWSXWRQDVXLWDQ

P\KDLUDWQRRQWRJHW LWSHUIHFW

KRXUEHIRUHDQG,œP GRQH´

)DVKLRQVFRXUWHV\RI0HUHGLWKŇ&#x2039;V%ULGDODQG)RUPDOZHDU

,I,KDYHDGDWH,¡OOSUREDEO\JR 1R$EVROXWHO\QRW ,¡YHEHHQGUHDPLQJDERXWLWVLQFH,ZDVIRXU :KHQ¡V3URP" :HVWVKRUHURDUFRP



 



PDUFKO theroar O


newsfeed

westshoreroar.com/news

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb ,W¶VSUHPLHUHQLJKW <RXSODQRQGUHVVLQJXSOLNH *UDSKLF'DQD%URZQ/HVOH\:ULJKW&DUOHLJK:DOWHU

(I¿H7ULQNHW

.DWQLVV(YHUGHHQ

W DLQPHQ HHQWHUW LVVLRQ RQVJDW SHUP E\ G VH X

SKRWROL

SKRWROL

RQVJDW HHQWH XVHGE\ UWDLQPHQW SHUPLV VLRQ

,I\RXZHUHDOORZHGRQH LWHPZLWK\RXLQWKH+XQJHU *DPHV\RXZRXOGEULQJ

<RXFDQ¶WKHOSEXWURRWIRU

%HVWSUHVHQW ZRXOGEH

<RXUFHOOSKRQH +DQGVDQLWL]HU

$IWHUVFKRRO\RX OLNHWRUHOD[E\

5XH

3OD\LQJYLGHR JDPHV

0RYLHQLJKW \RXUSLFN

)DVKLRQ GHVLJQHU ,I\RXFRXOGJR DQ\ZKHUHLQWKH86

7UDQVSRUWDWLRQRI FKRLFH 7521 /DPERUJKLQL $YHQWDGRU

7KH'HYLO :HDUV3UDGD 1HZ<RUN &LW\

'LVWULFW(OHFWURQLFV

<RXHQMR\OX[XU\ DQGKDYHDZHDNQHVVIRU

$VKHYLOOH 1&

6RPHSHRSOHVHH\RXDVD

'LVWULFW &RDO0LQLQJ

QHUG<RX¶UHUHVRXUFHIXODQG

<RX¶UHHI¿FLHQWEXWFDQEH

FDQ¿[DSUREOHPLQQRWLPH

'LVWULFW /X[XU\

*UHDWHVWMRE LQWKHZRUOG

6KRSSLQJ VSUHHLQ1<&

0DF%RRN3UR

%DNHU

7DNLQJD EXEEOHEDWK

3ULYDWHMHW

3HHWD

<RXEHOLHYHLQVHOIVDFUL¿FH IRUWKHJUHDWHU JRRGRIWKRVH DURXQG\RX

PRRG\DWWLPHVHLWKHUZD\

'LVWULFW 7H[WLOHV <RXGRQ¶WOLNH FRQÃ&#x20AC;LFWDQGZRXOGUDWKHU

EHDXWLIXO DQGH[SHQVLYH 

VHZWKHQ¿JKW<RXDUHD

WKLQJV<RXYDOXHEHDXW\

SHUVRQRISHDFH

\RXZLOOGRZKDWHYHULWWDNHV WRNHHS\RXUVHOI DQG\RXUORYHG RQHVVDIH

DQGFRQ¿GHQFH

O theroar OPDUFK


7KH2DNV3UHPLHUH7KHDWHUUHVHUYHGDOORILWVVFUHHQVIRUWKHUHOHDVHRI 7ZLOLJKWÂśV(FOLSVHVHOOLQJRXWDOOVHDWVRSHQLQJQLJKW

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

/DWHVWERRNWRPRYLHIUDQFKLVHKHDGVLQWRWKHDWHUV /HVOH\:ULJKW (GLWRULQFKLHI Suzanne Collinsâ&#x20AC;&#x2122; â&#x20AC;&#x153;Hunger Gamesâ&#x20AC;? trilogy is taking the school by storm. Every day a new student is introduced to the chaos and hairraising suspense that is the 74th Annual Hunger Games. Whatâ&#x20AC;&#x2122;s the reason for its ever-growing popularity? The trilogy appeals to readers of any age, any gender and any background. â&#x20AC;&#x153;I really like the futuristic theme, action-filled plotline and â&#x20AC;&#x2DC;fight to the deathâ&#x20AC;&#x2122; scenario,â&#x20AC;? senior Derek Dâ&#x20AC;&#x2122;Esposito said. â&#x20AC;&#x153;â&#x20AC;&#x2DC;The Hunger Gamesâ&#x20AC;&#x2122; appeals to a wider range of people than letâ&#x20AC;&#x2122;s say â&#x20AC;&#x2DC;Twilight.â&#x20AC;&#x2122; What I mean by that is I donâ&#x20AC;&#x2122;t think many guys like or want to watch â&#x20AC;&#x2DC;Twilightâ&#x20AC;&#x2122;.â&#x20AC;? Junior Eran del Castillo is equally as enthusiastic about the trilogy, which has more than 23 million copies in the U.S. alone. â&#x20AC;&#x153;I think â&#x20AC;&#x2DC;The Hunger Gamesâ&#x20AC;&#x2122; is innovative in that Suzanne Collins has been able to capture what itâ&#x20AC;&#x2122;s really like to be a teenager,â&#x20AC;? del Castillo said. â&#x20AC;&#x153;So far, itâ&#x20AC;&#x2122;s been really disappointing to see countless young adult novels where the protagonist doesnâ&#x20AC;&#x2122;t react to times of need or romance as a real 16- to 17-year-old would. Itâ&#x20AC;&#x2122;s refreshing to see a novel that so accurately depicts the main charactersâ&#x20AC;&#x2122; grief and sadness. Not only that, the highly anticipated first silver screen installment of the New York Times best-seller (for over 100 consecutive weeks) is set for release March 23. Directed by Gary Ross (â&#x20AC;&#x153;Seabiscuitâ&#x20AC;?), the film stars Jennifer Lawrence (â&#x20AC;&#x153;Winterâ&#x20AC;&#x2122;s Boneâ&#x20AC;?) as Katniss Everdeen, Josh Hutcherson (â&#x20AC;&#x153;Zathuraâ&#x20AC;?) as Peeta Mellark and Liam Hemsworth (â&#x20AC;&#x153;The Last Songâ&#x20AC;?) as Gale Hawthorne. Online movie ticket giant Fandango reported that â&#x20AC;&#x153;The Hunger Gamesâ&#x20AC;? accounted for 83 percent of the siteâ&#x20AC;&#x2122;s ticket sales Feb. 22, the first day show times became available for the projected spring blockbuster. â&#x20AC;&#x153;The Hunger Gamesâ&#x20AC;? even beat out â&#x20AC;&#x153;The Twilight Saga: Eclipseâ&#x20AC;&#x2122;sâ&#x20AC;? previous record set May 14, 2010, for Fandangoâ&#x20AC;&#x2122;s top first-day advanced ticket seller. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think â&#x20AC;&#x2DC;The Hunger Gamesâ&#x20AC;&#x2122; will outdo Harry Potterâ&#x20AC;&#x2122;s popularity, but I definitely think itâ&#x20AC;&#x2122;ll be a close competitor for â&#x20AC;&#x2DC;Twilight,â&#x20AC;&#x2122; or maybe even do better,â&#x20AC;? junior Michelle Morency said. Itâ&#x20AC;&#x2122;s hard for â&#x20AC;&#x153;The Hunger Gamesâ&#x20AC;? to not be compared to historically successful book-tomovie franchises such as â&#x20AC;&#x153;Twilightâ&#x20AC;? or â&#x20AC;&#x153;Harry Potter.â&#x20AC;? â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s such a huge obsession over â&#x20AC;&#x2DC;The

Hunger Gamesâ&#x20AC;&#x2122; right now because the books themselves are fantastic and â&#x20AC;&#x2DC;Harry Potterâ&#x20AC;&#x2122; is over while â&#x20AC;&#x2DC;Twilightâ&#x20AC;&#x2122; is quickly coming to a close,â&#x20AC;? Morency said. â&#x20AC;&#x153;Fans are looking for the next best thing.â&#x20AC;? Collinsâ&#x20AC;&#x2122; trilogy seems to have that obsessive quality hidden within each of its less than 400page books. â&#x20AC;&#x153;Donâ&#x20AC;&#x2122;t start one of the books unless you donâ&#x20AC;&#x2122;t have anything amazingly important to do. Theyâ&#x20AC;&#x2122;re just not books you can read spread out over a couple weeks,â&#x20AC;? del Castillo said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s so cliche, but the story line seems to be made so you canâ&#x20AC;&#x2122;t put the book down. Every time I started one of the books, I finished within 24 hours.â&#x20AC;? Freshman Rachel Ho says the books hold multiple meanings. â&#x20AC;&#x153;â&#x20AC;&#x2DC;The Hunger Gamesâ&#x20AC;&#x2122; teaches readers about romance, friends, competition and just life in general,â&#x20AC;? Ho said. The movieâ&#x20AC;&#x2122;s hype has invaded popular clothing stores such as Hot Topic, which selling merchandise in every shape and form. â&#x20AC;&#x153;The other day I stopped by the mall to check to see if any â&#x20AC;&#x2DC;Hunger Gamesâ&#x20AC;&#x2122; stuff had come in, and I found all of these cool shirts with Katniss, Peeta, Gale, the other tributes and the District 12 emblem,â&#x20AC;? senior Lauren Brown said. â&#x20AC;&#x153;They even had Peeta pillowcases. However, they only had sizes large and extra large in the shirts, which shows just how popular the movie will be. Die-hard fans, affectionately named â&#x20AC;&#x153;Tributesâ&#x20AC;? after the contestants of the â&#x20AC;&#x153;Hunger Games,â&#x20AC;? are prepared with pre-purchased tickets, handmade shirts and mockingjay pins in check. â&#x20AC;&#x153;â&#x20AC;&#x2DC;The Hunger Gamesâ&#x20AC;&#x2122; movie will have to follow the series closely but the cinematic creativity that the producers and directors have to work with is limitless, I cannot wait,â&#x20AC;? senior Vivian Taylor said. Premiere Oaks Stadium 10 theater has prepared for Thursdayâ&#x20AC;&#x2122;s midnight premiere. â&#x20AC;&#x153;We have three theaters reserved for just the midnight premiere,â&#x20AC;? Oaks employee Michelle Osterloh said. â&#x20AC;&#x153;Although â&#x20AC;&#x2DC;Twilightâ&#x20AC;&#x2122;s Eclipseâ&#x20AC;&#x2122; sold out in all 10 of our auditoriums, I still believe â&#x20AC;&#x2DC;The Hunger Gamesâ&#x20AC;&#x2122; will be crazy as well.â&#x20AC;? Critics speculate that â&#x20AC;&#x153;The Hunger Gamesâ&#x20AC;? has been hyped too much hype, which could lead to a letdown for fans. But for all the Tributes out there with the utmost faith in director Gary Ross, in the words of Collins herself, â&#x20AC;&#x153;may the odds be ever in your favor.â&#x20AC;?

³7KH+XQJHU*DPHV´WKH¿UVWERRN LQWKHWULORJ\LV¿OOHGZLWKDFWLRQDQG URPDQFHWKDWLVLQLWLDOO\LQWHUHVWLQJ ZLWK D QHZ XQIRUJHWWDEOH SORW $W WLPHVWKURXJKRXWWKHFRXUVHRIWKH ERRNLWLQFUHDVLQJO\EHFRPHVERULQJ DQGFOLFKp3HUVRQDOO\,ZRXOGQRW UHUHDGLWGXHWRLWVGU\HPRWLRQVDQG FKDUDFWHUVZKLFKIDLOWRHQWHUWDLQ PHDVDUHDGHU ²6\GQH\6DXQGHUV

³&DWFKLQJ)LUH´LVDTXLFNSDFHG UHDGWKDWNHHSVWKHHVVHQFHRIWKH ¿UVW ERRN :KLOH ³&DWFKLQJ )LUH´ KDVDVORZEHJLQQLQJLWSURYHVWR EHMXVWDVDFWLRQSDFNHGDQGVWLOO PDLQWDLQVDOOWKHURPDQFHDJJUHV VLRQDQGJXLOW\SOHDVXUHURPDQFH WKH RULJLQDO GLG 6RPH DUJXH WKDW ³&DWFKLQJ)LUH´ZDVWKHEHJLQQLQJ RI  D VOLSSHU\ VORSH DIWHU WKH ¿UVW ERRNEXWUHDOO\LWLVMXVWDVJRRG MXVWQRWDVDSSUHFLDWHG ²0DGGLH'LPRQG

7KH ODVW ERRN LV D OHWGRZQ FRP SDUHG WR WKH RULJLQDO SRWHQWLDO ³7KH +XQJHU *DPHV´ SUHVHQWHG ZKLFKRQO\GZLQGOHGDVWKHVHULHV SURJUHVVHG :KDW VWDUWHG DV D IXOOIOHGJHG VSULQW LQWR JRU\ DJJUHVVLRQGLVDSSURYHG EXWVWLOO ZHOFRPHG URPDQFHDQGEH\RQG UHDFK FRQVSLUDF\ WKHRULHV EXUQV RXWFROODSVLQJLQWRDSLOHRIRYHUO\ RSWLPLVWLFGHWDLOVLQ³0RFNLQJMD\´  ²0RUJDQ0LOOHU

PDUFKO theroar O


ZZZMRVWHQV\HDUERRNVFRP

MICHELLE LACEY KELSEY Master Colorist-Designer-Stylist For Insertion Date:  Talking Heads Salon Client: #  Job Number:    !"! $ Product/Pub: !" 5000 Stack Blvd Revision 4 Size:  $ 

3KRQH   Melbourne, FL 32901 Production:  )D[   Work Date:  Bus: (321) 984-9795

%RE%UDQGW 6WRUH'LUHFWRU Revision 1 Creative Proofer 1: Creative Proofer 2:

Revision 2 Revision 3 :LQQ'L[LH6WRUH 86+LJKZD\ AS Proofer 1: AS Proofer 2: 0LFFR)/

Cell: (321) 265-4739

Inc.

3520 63(&,$/ 2))

The Shortest Distance To Your Success Keiser University can show you the way  

  

Health Careâ&#x2014;&#x2020; Criminal Justice â&#x2014;&#x2020; Legal Studies* â&#x2014;&#x2020; Business â&#x2014;&#x2020; Culinary â&#x2014;&#x2020; Computers & Technology â&#x2014;&#x2020; Interdisciplinary Studies* Call for a complete list of programs

â&#x153;&#x201C; Associate, bachelorâ&#x20AC;&#x2122;s and masterâ&#x20AC;&#x2122;s* degrees â&#x153;&#x201C; Career placement assistance â&#x153;&#x201C; One class at a time â&#x153;&#x201C; Financial aid available to those who qualify â&#x153;&#x201C; Day, evening and online classes

Call Today to speak with an Admissions Counselor

1.888.438.5504 *Online only

www.KUMelbourne.com

Admissions Hours: Mon - Thurs 9am - 8pm, Fri 9am - 5pm, Sat 9am - 1pm

Otheroar OPDUFK


ourturn

westshoreroar.com/opinions

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

7KHÃ&#x20AC;JKWEHWZHHQ DJDLQVWVLEOLQJV

6FKRRO%RDUGGHEDWHVZKHWKHUVLEOLQJVVKRXOGVWLOOEH DOORZHGDXWRPDWLFDFFHSWDQFHLQWRFKRLFHVFKRROV

3526

-HQQLIHU*DUULGR (GLWRULQFKLHI

0LOOLH5RVDVFR 6WDIIZULWHU

&216 *UDSKLF%ULWWDQ\&KR

,WJLYHVVRPHLQFRPLQJVWXGHQWVD VHQVHRIVHFXULW\WRDOUHDG\NQRZ VRPHRQHRQFDPSXV

&RPPXQLW\

7KHV\VWHPH[WLQJXLVKHVWKHSRVVLELOLW\ RIGLYHUVLW\,WOLPLWVWKHDPRXQWRISDUHQW YROXQWHHUVZKLFKIXUWKHUVKLHOGVWKH VFKRROIURPXQORFNLQJQHZDELOLWLHV

$GDPDQG(PLO\'DYLGVRQ

7DNLQJRXWWKHVLEOLQJFODXVHZRXOG DOWHUPXOWLSOHIDPLOLHV¶SODQVIRU DOUHDG\HQUROOHGVWXGHQWV

7UDGLWLRQ

&KDQJLQJWKHQRUPDOPRGHORIHQWUDQFH FRXOGWHDFKSDUHQWVWRNHHSRSWLRQVRSHQ DQGQRWGHSHQGRQDSURJUDP¶VUHOLDELOLW\

7\OHUDQG$PDQGD0RVFULS

,WGRHVQ¶WSXWSDUHQWVLQWKHSRVLWLRQ RIIDYRULQJRQHFKLOGRYHUDQRWKHU

)DPLO\

,WDOORZVHDFKVWXGHQWWRIRUPWKHLU RZQLGHQWLW\

-DFNLHDQG&KULVWLQH6KHUU\

,WDOORZV:HVW6KRUHWREXLOGDFUHG LEOHUHSXWDWLRQFRPSHWLQJDJDLQVW QHLJKERUKRRGKLJKVFKRROV

,PSDFW

,WJLYHVVWXGHQWVDIDOVHKRRGRI UHDOLW\&ROOHJHVDQGMREVGRQ¶WJLYH DGYDQWDJHVWRZDUGVLEOLQJV

-DNHDQG/DXUHQ6DGRZVNL

1RQVLEOLQJVWXGHQWVVWDQGDVWKH PDMRULW\RI:HVW6KRUH¶VVWXGHQW SRSXODWLRQ

/RWWHU\'DWD

5HVHUYLQJSHUFHQWRIVSRWVIRU VLEOLQJVVNHZVWKHGDWDDQGJLYHV WKHPDQXQIDLUDGYDQWDJHRYHURWKHU LQWHUHVWHGVWXGHQWV

-HQQDDQG.DLWO\Q)RUU\

.HHSLQJWKHFODXVHZRXOGVHFXUH FRQVLVWHQWDQGUHOLDEOHZRUNHWKLFRI IDPLOLDUIDPLOLHV

$FDGHPLF&RQWLQXLW\

5HPRYLQJWKHFODXVHZRXOGDOORZ QHZVWXGHQWVWR³UDLVHWKHEDU´ LQFUHDVLQJFRPSHWLWLRQDPRQJ SUHVHQW:LOGFDWV

&DVH\DQG0DF6FKDXPDQ

PDUFKO theroar O


yourturn

westshoreroar.com/letters-to-the-editor

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

Cell phone use in school may be beneficial  I donâ&#x20AC;&#x2122;t think that the use of cell phones in school should be completely prohibited. Though they are disruptive during class, outside of class they arenâ&#x20AC;&#x2122;t a nuisance. I think that students should be allowed to use them during certain times of the day. This would keep them from texting secretly during class and having to sneak around school to use their cell phones where no faculty can see them. I donâ&#x20AC;&#x2122;t know how many times Iâ&#x20AC;&#x2122;ve seen people texting during class, but most of the time itâ&#x20AC;&#x2122;s not just to socialize. With so many extracurricular activities, coordinating pick up times with parents and making sure you have a ride to lacrosse practice or back home from rehearsal is necessary. Not to mention parents want to be able to keep in touch with their kids if thereâ&#x20AC;&#x2122;s an emergency or sudden switch-up of plans. My mom goes out of town for her job, and when she leaves the country she always texts or calls me to keep in touch. My dad does the same to coordinate his work schedule with pick-up times and doctorâ&#x20AC;&#x2122;s appointments. I canâ&#x20AC;&#x2122;t count on my fingers how many times Iâ&#x20AC;&#x2122;ve turned on my phone after school to find several texts telling me to ride the bus or to change plans and go home with a friend. If we were able to check our phones outside of class during school hours, it would save us the panicked sprint to catch the bus when our plans are changed. Students should be able to take out their

phones during lunch when they donâ&#x20AC;&#x2122;t have class and donâ&#x20AC;&#x2122;t need to pay attention. Itâ&#x20AC;&#x2122;s a perfect time to call their parents to make sure that their schedules are organized. â&#x20AC;&#x201D; Emily Dubec-Hunter, freshman

Soccer fans are appreciated

As a player who experienced the thrill of the state finals game I can say that a big part of what made it memorable was the number of West Shore fans present at the game. As soon as I walked onto the field I glanced at the fans section of the USF stadium to see, to my delight, that 3/4â&#x20AC;&#x2122;s of the seats were filled with our fans. The chants of the fans, the encouragement, the singing, the signs, all factors that made the team feel as if we were playing a professional game in the presence of a Barclayâ&#x20AC;&#x2122;s Premier League crowd. It made the game feel that much more authentic and for that I give great thanks to the fans. There was no way that West Shore could lose when we were being backed by the entirety of the school. I know I speak for the rest of the team when I say that the fan support was absolutely appreciated. Through the rain, the bad calls, and the nail-biting moments you guys were there. Thank you to the fans, the parents, my teammates, the coaches, and of course the dance team. â&#x20AC;&#x201D; Jimmy Madden, junior

publicationpolicies theroar :HVW6KRUH-U6U+LJK :LOGFDW$OOH\0HOERXUQH)/  H[W)$;   (GLWRUVLQFKLHI -HQQLIHU*DUULGR /HVOH\:ULJKW 0DQDJLQJHGLWRUV %ULWWDQ\&KR 0DUOH\%XWFKHU %XVLQHVVPDQDJHU $DOHNK\D7HQDOL 1HZVHGLWRU &DUOHLJK:DOWHU 2SLQLRQVHGLWRU 6WHSKDQLH6KDZ 6SRUWVHGLWRUV -XVWLQ/DQHXYLOOH 6DP/DFN

(QWHUWDLQPHQW(GLWRU 0RUJDQ0LOOHU :HE0DQDJHU 'DQD%URZQ 6WDIIZULWHUV 6DUDK'D\ 0DGGLH'LPRQG 6RPPHU+LG\ -XOLD/HY\ .UXQDO3DWHO 0LOOLH5RVDVFR )HOLFLD6ROD]]R 6\GQH\6DXQGHUV 0LFDK:HEHU &LHUD0,VQHU

)DFXOW\DGYLVHU0DUN6FKOHGRUQ

feedback Q: Which story/movie do you prefer: â&#x20AC;&#x153;Harry Potter,â&#x20AC;? â&#x20AC;&#x153;Twilightâ&#x20AC;? or â&#x20AC;&#x153;The Hunger Games?â&#x20AC;? â&#x20AC;&#x153;I prefer â&#x20AC;&#x2DC;The Hunger Games.â&#x20AC;&#x2122; Itâ&#x20AC;&#x2122;s more action packed and suspenseful.â&#x20AC;? â&#x20AC;&#x201D; Marissa Patel, 9th

Q: What are you planning to do during Spring Break? â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m going to St. Thomas in the Virgin Islands because my grandpa lives there.â&#x20AC;? â&#x20AC;&#x201D; Brooke Robertson, 11th

Q: Who do you want to be the next president?

other.â&#x20AC;? 7KH5RDUUHFRJQL]HVLWVHOIDVDSXEOLFIRUXPDQGHQFRXU DJHVOHWWHUVIURP:HVW6KRUHVWXGHQWVDQGPHPEHUVRIWKH FRPPXQLW\ 7KH5RDUFDQQRWSULQWDGVSURPRWLQJDFWLYLW\LOOHJDOE\ )ORULGD ODZ DGV RSSRVLQJ DQ\ UHOLJLRXV EHOLHIV DGV ZULW WHQLQSRRUWDVWHDGVZLWKUDFLDORUVH[LVWFRPPHQWVDGV FRQVLGHUHGLQDSSURSULDWHE\WKHVWDIIRUDGVFRQWDLQLQJOLEHO 7KH5RDULVQRWUHVSRQVLEOHIRUZHEVLWHVYLHZHGWKURXJK OLQNVIRXQGRQSDJHVPHQWLRQHGLQWKHSXEOLFDWLRQ 7KH5RDUYDOXHVOHWWHUVIURPRXUUHDGHUVWKHPD[L PXPOHQJWKIRUOHWWHUVLVZRUGV1RPRUHWKDQRQH OHWWHUDVHPHVWHUZLOOEHSXEOLVKHGIURPDZULWHU/HWWHUV DQGFROXPQVDUHHGLWHGIRUOHQJWKFRQWHQWDQGFODULW\ 7KH5RDUPDLQWDLQVWKHULJKWWRHGLWDOOVXEPLVVLRQVIRU SRRUWDVWHOHQJWKJUDPPDUDQGOLEHO9LHZVH[SUHVVHG LQ WKH ´2SLQLRQVÂľ VHFWLRQ GR QRW QHFHVVDULO\ UHSUHVHQW WKH YLHZV RI WKH %UHYDUG &RXQW\ 6FKRRO %RDUG WKH :HVW 6KRUH DGPLQLVWUDWRUV IDFXOW\ VWXGHQW ERG\ RU 7KH5RDUVWDII 6HQGOHWWHUVWR5RRPRUHPDLOXVDW WKHURDUOHWWHUV#JPDLOFRP

O theroar OPDUFK

â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t like any of the candidates. None of them are convincing and they trash each

â&#x20AC;&#x201D; Varsha Sahoo, 12th

Q: What do you think about tattoos? â&#x20AC;&#x153;I think theyâ&#x20AC;&#x2122;re cool - itâ&#x20AC;&#x2122;s a way to express yourself. It could be a distraction at school if it is visible and large.â&#x20AC;? â&#x20AC;&#x201D; Carissa Sage, 10th


ourturn

westshoreroar.com/staff-editorials

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

,OOXVWUDWLRQ.HOO\6WRNHV

staffeditorial

Prayer legislation will have unintended consequences

Imagine the graduation caps flying into the air, and a Muslim boy taking the stage as the crowd quiets down. He begins speaking in Arabic and praising Allah. The students, mainly Christians, are uncomfortable with the message, and the principal’s email is flooded with threatening messages from fuming parents. If signed into law by Gov. Rick Scott, the school prayer recently passed by the Florida House and Senate would crumble the religious equality in our fragile school system. The bill allows students the opportunity to project religious messages everywhere from graduations to Friday night football games. Clearly sponsors of the prayer bill are coming from the religious majority: in this case, overwhelmingly Christian. Sen. Gary Siplin, the Democrat who proposed the legislation, is a devout Baptist with six references to God on his homepage. Supporting Sens. Erik Fresen, Oscar Braynon II, and Evelyn Lynn are Catholic, Episcopal, and Methodist, respectively. House sponsor Charles Van Zant, a Republican, is a selfproclaimed Baptist preacher with a doctorate in theology. Their dreams are images of students standing up to pray for peace and inner strength, but with a catch: in the name of Jesus Christ. Like countless other political hypocrites, the prayer bill’s cheerleaders are ready for freedom of speech, on their terms.

Christian speakers are all well and good, but what happens when a Muslim or Hindu steps up to the podium? And even if these lawmakers can be open-minded about a reference to Allah or Krishna, what happens when, as Rep. Luis Garcia Jr. astutely articulates, “[students start] worshipping the devil?” God forbid. But his hypothetical brings up some tricky questions. What religious beliefs are appropriate to be vocalized at a student event, and what defines a religion, anyway? While the first religions that come to mind may purport themes of peace and moral values, there’s a broad spectrum of beliefs that fall under the term “religion,” from the mainstream to the enigmatic. Ever heard of Santeria, an Afro-Caribbean faith in which animal sacrifice is central? Do you know a Wiccan, who ritually practices witchcraft and wears a pentagram? However obscure, these religions exist, and school administrators would fall into a heap of trouble if parents complain about a student’s Satanic prayers at graduation. The U.S. Supreme Court issued two bans on prayer at public schools events in 1962-63. If Gov. Scott signs this new legislation into law, it will be challenged and struck down. Rather than spending taxpayer money defending a losing cause, the governor should veto this proposal.

PDUFKO theroar O


gametime

westshoreroar.com/sports

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

)RUJHWIRRWEDOOOHWÂśVVWLFNZLWKI~WERO I love reading the letters to the editor, and I love them even more when they have to do with sports. It really gives me hope for the future of our school. What I love most about reading said letters is when they are positively wrong. Before I begin, I absolutely mean no disrespect to any student, faculty member, or administrator. I also want to extend my heartiest congratulations to the boysâ&#x20AC;&#x2122; soccer team, our schoolâ&#x20AC;&#x2122;s celebrities, on its fantastic performance and victory in the Class 2A State Championship game. I guess I should get to the point. In the previous of The Roar, a student wrote a letter to the editor regarding our schoolâ&#x20AC;&#x2122;s lack of a football team, how it is a disgrace to the school not to have one, and how it would strengthen morale if we did. Now I firmly believe that this school has some magnificent athletes, as is clearly evident by our boysâ&#x20AC;&#x2122; soccer state championship, but to say that we have more than say, eight football-built students is, at best, an exaggeration.

the

sportsslant $WKOHWH

&DW 7DOHV 6DP/DFN 6SRUWV(GLWRU That is not to say that if the school added a football program that it would never succeed. But with the high standard of success this years boysâ&#x20AC;&#x2122; soccer team has set, I canâ&#x20AC;&#x2122;t stomach the thought of anything but victory, and I donâ&#x20AC;&#x2122;t see that happening in the early years. I donâ&#x20AC;&#x2122;t think it would be difficult to recruit players for a football team, but I think it would be difficult to keep these players happy after 72-point beat-downs or with a lousy record. Not to mention the fact that football costs hundreds of dollars per player for pads, a helmet and cleats. Playing football takes tremendous conditioning because being able to run full

:KRÂśV<RXU IDYRULWH VXSHUKHUR"

+DPEXUJHU 3HDQXW KRWGRJ EXWWHUDQG RUWRIX" BBBBBBBB"

speed under heavy pads is no easy task. The grueling conditioning necessary might be a huge turnoff for potentially talented players. Temporarily ignoring the legality of the issue, as it is against our schoolâ&#x20AC;&#x2122;s charter to have a football, baseball, softball or wrestling team, I do not believe it is in our best interests to even consider a football team. We would have to suffer through countless embarrassing defeats, numerous painful injuries and far too much humiliation from football dominant schools. These schools pride themselves on their abundance of large and athletic students. We definitely have stellar athletes, but there is a huge difference between basketball athletes and football athletes, specifically hundreds of pounds. I applaud the confidence, I admire the pride, but honestly, keep West Shore as far away from the football field as possible. FĂştbol, definitely. Football, no thanks.

:KDWÂśVRQ \RXUL3RG"

:KRPZRXOG \RXPRVWOLNH WRZUHVWOH"

$IULFDQ $PHULFDQ 5DSSHUV

$Q\ERG\EXW 5REHUW 0DWWKHZV

$DURQ :DONHU

'Z\DQH :DGH ³)ODVK´

FKHHVHEXUJHU

LFH FUHDP

6RSKRPRUH 6RFFHU3OD\HU

%DWPDQ

,V FKHHVHEXUJHU DQRSWLRQ"

Ă&#x20AC;XII

-DFN -RKQVRQ

1RQH7KDWÂśV DOOQDVW\

FKRFRODWH FKLSV

%URDGZD\

FKRFRODWH

7XSDF

&RDFK 5REHUW 6DOD]DU

ULFH

%UHDNLQJ %HQMDPLQ

*KDQGL

6HQLRU %DVNHWEDOO3OD\HU

-HQQD )RUU\ 6RSKRPRUH %DVNHWEDOO3OD\HU

/DXUHQ %XUQV

6SLGHUPDQ

9DUVLW\ %DVNHWEDOO&RDFK

0\GDG

7RQ\ 5LRSHOOH -XQLRU 6RFFHU3OD\HU

-LPP\ 0DGGHQ

'DVK IURP³7KH ,QFUHGLEOHV´

Otheroar OPDUFK

KDPEXUJHU

WRIX

$VKWRQ .XWFKHU 0U 5LRSHOOH


7KH:HVW6KRUHER\VŇ&#x2039;VRFFHUWHDPKDVEHHQUDQNHGLQ(631Ň&#x2039;V 3RZHUDGH)DEIRUWKHSDVWZHHNVUHDFKLQJDVKLJKDV

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

7UDFNWHDPVSULQWLQJLQWRVXFFHVV 0LFDK:HEHU 6WDII:ULWHU Dashing off into a new track season, Coach Sue Gregory says the goals for the team are going to be winning events, setting personal records and having the most people possible move on to the regional meet. The focus is not going to be solely on winning meets.  â&#x20AC;&#x153;I think this takes the pressure off and allows everyone to perform their best in the events they focus on,â&#x20AC;? Gregory said. In addition to allowing runners to perform their best, the small size of the team is also the reason why the main focus this year is not winning meets. â&#x20AC;&#x153;In track, much like swimming, you need to have a lot of depth and a lot of people who can score in every event in order to win a meet,â&#x20AC;? Gregory said. â&#x20AC;&#x153;We don't have that, but we do have a lot of people who can win or place really high in particular events.â&#x20AC;? This year, the teamâ&#x20AC;&#x2122;s coaches have put an emphasis on leadership. Team captains include Kate Crowley, Jacob Smithe, Maegan Muir, Geofrey Pena, Joel Wadzinski and Ed Balboni. â&#x20AC;&#x153;I definitely consider it a big deal and an honor to be picked as a team captain,â&#x20AC;? Gregory said. â&#x20AC;&#x153;Track tends to be divided in areas, like  jumping events, throwing events, sprints and distance events so captains were nominated by the team, had to be approved by the coaches and for the most part represent those areas where they spe-

scoreboard %R\V6RFFHU 

&HQWUDO&DWKROLF 9LHUD 5RFNOHGJH 7UHDVXUH&RDVW &RFRD (GJHZRRG (DX*DOOLH 6DWHOOLWH 7LWXVYLOOH 6SDFH&RDVW &RFRD%HDFK (GJHZRRG 6DWHOOLWH /DNH+LJKODQG3UHS %LVKRS0RRUH 7'H:LWW7D\ORU %ROOHV %HUNHOH\3UHS

                 

*LUOVŇ&#x2039;6RFFHU 

(DX*DOOLH 7LWXVYLOOH %D\VLGH 6SDFH&RDVW &RFRD 5RFNOHGJH 3DOP%D\ (GJHZRRG &RFRD%HDFK $WODQWLF  &HQWUDO&DWKROLF 6DWHOOLWH 9LHUD $VWURQDXW %LVKRS0RRUH

              

6HEDVWLDQ5LYHU 6DWHOOLWH %LVKRS0RRUH %R\VŇ&#x2039;%DVNHWEDOO 

&HQWUDO&DWKROLF %UHYDUG&KULVWLDQ 6DWHOOLWH &RFRD%HDFK $VWURQDXW (GJHZRRG &RFRD 6SDFH&RDVW (GJHZRRG &HQWUDO&DWKROLF )W3LHUFH:HVWZRRG &RFRD $VWURQDXW &RFRD%HDFK 6SDFH&RDVW -RKQ&DUUROO (GJHZRRG 6DWHOOLWH &RYHQDQW&KULVWLDQ -RKQ&DUUROO %UHYDUG&KULVWLDQ

                       

*LUOVŇ&#x2039;%DVNHWEDOO 

%D\VLGH (GJHZRRG (DX*DOOLH $VWURQDXW 6DWHOOLWH +RO\7ULQLW\ 0HUULWW,VODQG &RFRD &RFRD%HDFK %UHYDUG&KULVWLDQ $VWURQDXW 3DOP%D\

           

cialize.â&#x20AC;? Coach Angel Gonzalez is new this year and brings experience and intensity to the team that Gregory thinks will pay off at the end of the season. Coach Jason Whitworth is serving as an assistant coach in charge of distance runners. "The coaches are doing a fantastic job of leading the team, especially for coming on with such short notice," junior Luke Redito said.  â&#x20AC;&#x153;I think maybe in the past, people put participating on the track team in more of an â&#x20AC;&#x2DC;intramuralâ&#x20AC;&#x2122; perspective than a â&#x20AC;&#x2DC;varsity sportâ&#x20AC;&#x2122; perspective,â&#x20AC;? Gregory said. â&#x20AC;&#x153;I think anyone on the team now realizes what the coaches expect, and there will hopefully be a real sense of pride and accomplishment for those who earn varsity letters at the end of the season.â&#x20AC;? The season is already off to a much better start than last year, as the team has had two meets so far and almost everyone has improved from the first meet to the second.  â&#x20AC;&#x153;It was rough at the beginning of the season with the big changes in coaches but now it is going well,â&#x20AC;? senior captain Kate Crowley said.  Team goals for this year include trying to win a meet. Individually, runners are trying for their best times. "I am hoping to get my fastest times for colleges to see me," Redito said. The Wildcats close their season in early April at the district championship meet. 0HUULWW,VODQG 6SDFH&RDVW %UHYDUG&KULVWLDQ 6DLQW(GZDUGŇ&#x2039;V &HQWUDO&DWKROLF &RFRD%HDFK 3DOP%D\ &RFRD (GJHZRRG 6SDFH&RDVW &RYHQDQW&KULVWLDQ %D\VLGH (DX*DOOLH

            

%R\VŇ&#x2039;7HQQLV 

&HQWUDO&DWKROLF  0DVWHUŇ&#x2039;V$FDGHP\RI9HUR%HDFK -RKQ&DUUROO  6DLQW(GZDUGŇ&#x2039;V  9HUR%HDFK  (GJHZRRG  )ORULGD$LU$FDGHP\ 0DUFK +RO\7ULQLW\ 0DUFK &RFRD%HDFK  5RFNOHGJH 0DUFK 9HUR%HDFK 0DUFK 0HUULWW,VODQG 0DUFK *LUOVŇ&#x2039;7HQQLV 0HOERXUQH&HQWUDO&DWKROLF 9LHUD  -RKQ&DUUROO  6DLQW(GZDUGŇ&#x2039;V  9HUR%HDFK  +RO\7ULQLW\  &RFRD%HDFK  (GJHZRRG  +HULWDJH  +RO\7ULQLW\ 

5RFNOHGJH 0DUFK 9HUR%HDFK 0DUFK 0HUULWW,VODQG 0DUFK %R\VŇ&#x2039;/DFURVVH 

6HEDVWLDQ5LYHU  :HNLYD  6DWHOOLWH  +RO\7ULQLW\  0HUULWW,VODQG  &HQWUDO&DWKROLF  6DWHOOLWH  9LHUD 0DUFK +RO\7ULQLW\ 0DUFK 0HUULWW,VODQG 0DUFK &HQWUDO&DWKROLF $SULO 9LHUD $SULO -RKQ&DUUROO $SULO *LUOVŇ&#x2039;/DFURVVH 

9LHUD  6DWHOOLWH  &HQWUDO&DWKROLF  0HUULWW,VODQG  9LHUD  6DWHOOLWH 0DUFK 0HUULWW,VODQG 0DUFK 0HOERXUQH&HQWUDO&DWKROLF $SULO 7UDFNDQG)LHOG $VWURQDXW 9LHUD (DX*DOOLH 9LSHU7UL0HHW 5RFNOHGJH 9LHUD

WKSODFH UGSODFH WKSODFH QGSODFH WKSODFH 0DUFK

PDUFKOtheroar O


gametime

westshoreroar.com/sports

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

)DPLO\WLHV ELQGWHDP WRJHWKHU 6DP/DFN 6SRUWV(GLWRU Children’s author Marc Brown once wrote “sometimes being a brother is even better than being a superhero.” For the three sets of brothers on the school’s Class 2A state champion boys’ soccer team, this statement rings true. The Wildcats had Liam and Aiden Wixted, John and James Bocinsky and Jimmy and Robert Madden, all pivotal players on their quest for success. Now, along with their 15 other teammates, the brothers are state champions. For junior James Bocinsky, having a brother on the team means he had better play hard, or face the consequences. “Of course I push [James] to work harder,” senior midfielder John Bocinsky said. “No one wants to lose to their younger brother.” Occasionally, outside issues among brothers can manifest themselves on the soccer field. “There’s a little bit of fire between us,” freshman striker Aidan Wixted said. “In the end though, brothers always work it out.” Sometimes, for junior defender Jimmy Madden, dealing with a brother on the team is more of an annoyance than an asset. “[Robert] bothers me for no good reason,” Madden said. “I have to mentor him, and it’s tough to not get angry.” Harder practices and better in-game performance result from these sibling rivalries. “We get along really well off the field,” James Bocinsky said. “During practice though, we duke it out. It’s intense.” The brothers’ presence on the team embodies the team’s family spirit. “Having these sets of brothers just symbolizes us as a whole team,” sophomore midfielder Ryan Robidoux said. “We are like one big brotherhood.”

Photo: Dean Stewart Photography

(LJKWKJUDGHUNHHSHU$OODQ-R\QHUSUDFWLFHVFDWFKLQJEHIRUHWKH)HEWLWOHJDPH

1HZJRDOLHGHOLYHUVWDOORUGHU E\VWD\LQJFRROXQGHUSUHVVXUH .UXQDO3DWHO 6WDIIZULWHU “There were a bunch of emotions running through me at the start of the game. I was pumped, very excited, overwhelmed and very nervous,” said eighth-grader Allan Joyner, the soccer team’s rookie goalie after the title game. “I was proud to have the opportunity to represent the school in the state championship game.” When the announcer called Joyner’s name and grade while introducing the team before the Class 2A title game Feb. 17, the entire Berkeley team turned and looked, apparently surprised to be facing so young an opponent. “I used this as a source of inspiration,” Joyner said. “I wanted to go out and show them how well I could play.” Joyner began turning heads as a goalie when he became keeper for the junior varsity team in seventh grade. After being promoted to

the varsity squad this year, he immediately began to contribute to the Wildcats’ success. “This team has also been nothing but a great support and inspiration for me too,” Joyner said. “As a seventh-grader, I marveled everything they have done, and I couldn’t wait to be a part of it.” Throughout the season, Joyner’s fans, teammates and parents provided him with support and advice to help him improve. “My parents are extremely proud and believe I am breaking barriers and raising the bar for other keepers to try and achieve,” Joyner said. “The team has also been very friendly and has shown to be a great help to my success by always pushing me harder.” As for his future, his coaches see much in store for him as a developing keeper. “Amazing, he’s a young kid and has a lot of talent,” volunteer assistant coach Bob Robidoux said. “I think this will give him a huge confidence boost.”

Otheroar OPDUFK


)RUWKH6SDFH&RDVW$OO6WDU7HDPVHQLRU &DSWDLQ-RKQ%RFLQVN\ZDVQDPHGWKH6SDFH&RDVW3OD\HU RIWKH<HDU

â&#x20AC;&#x153;Every night before I have a big game, starting during districts, I watch â&#x20AC;&#x153;Miracleâ&#x20AC;? right before I go to sleep and then listen to the speech on the way to the game. It inspires me,â&#x20AC;? Moscrip said. With 17 minutes to go, Berkeley evened up the score again at 2-2 to send the two teams into sudden-death overtime. â&#x20AC;&#x153;Going into that overtime we knew it was going to be a fight. The entire game had been a fight,â&#x20AC;? Bocinsky said. â&#x20AC;&#x153;We needed to score quickly and get it done fast. I have a lot of faith in Allan [Joyner], but that can break a goalie no matter how experienced.â&#x20AC;? The game wasnâ&#x20AC;&#x2122;t going as the captain had initially hoped. The two teams held out and went into double overtime with 10 minutes left before they went to penalty kicks to decide the game. Leaving their hearts on the field and giving it their all was what the Wildcats were sent to do for the next 10 minutes that would decide the destiny of the season. They had made it to where no other team had in the history of the school. Only one team was going to end its season with a victory. The goalie coming out for the tackle, senior John Bocinsky trapped the pass from Nabil Motlagh, a senior, and took a shot to end the game that make the Wildcats state champions.

Photo: C. Walter Photo Credit: Dean Stewart

â&#x20AC;&#x153;Honestly I donâ&#x20AC;&#x2122;t even know, I didnâ&#x20AC;&#x2122;t even look, I knew the way it came off my foot it was going in the net and the roar of the crowd confirmed it,â&#x20AC;? captain and senior John Bocinsky said. â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t even see the ball go in. I hit the shot, turned and sprinted to the fans.â&#x20AC;? These were the words from senior who would win it all. Bocinsky made the score 3-2 against Tampa Berkeley Prep in the last eight minutes of the sudden-death, double-overtime in the state championship match played Feb. 17 in the University of South Florida Arena. To support the schoolâ&#x20AC;&#x2122;s first sports team to ever make it to the state championship, approximately 300 wildcats traveled by bus and car to make it to the big game. â&#x20AC;&#x153;This team, this group of players, will never play that team again,â&#x20AC;? Assistant Coach â&#x20AC;&#x2DC;Scottyâ&#x20AC;&#x2122; Armstrong said during the pre-game talk. â&#x20AC;&#x153;The school may, but you wonâ&#x20AC;&#x2122;t. Tonight is your night. This is your time, not theirs. You go out there tonight and you win. You go out there tonight, and youâ&#x20AC;&#x2122;re a state champion.â&#x20AC;? Scoring the first goal of the game with five minutes and 27 seconds left in the first half, Ryan Robidoux, a sophomore, gave West Shore the lead. The team never trailed after this goal, being tied 30 of the 92 minutes in the game. â&#x20AC;&#x153;We kept pushing. We kept working hard. We never quit and we just believed in each other and that we could do it,â&#x20AC;? Robidoux said. Berkeley, answering back in the first five minutes of the second half, put one in the back of the net to make it 1-1. The Wildcats followed it up with a quick goal by defensive player Tyler Moscrip, a junior. Having his own special way of preparing himself before the game, Moscrip shared his pregame ritual.

³7KHH[SHULHQFH RIORVLQJODVW\HDU JDYHXVDQHGJH:H QHYHUZDQWHGWRIHHO WKDWIHHOLQJDJDLQ´ ²7\OHU0RVFULS

Photo Credit: Dean Stewart

1HZV(GLWRU

Photo: C. Walter

&DUOHLJK:DOWHU

Photo Credit: Dean Stewart

%RFLQVN\ÂśVGRXEOHRYHUWLPHVKRW SXWVVRFFHUSURJUDPRQWKHPDS

Photo Credit: Dean Stewart

Photo Credit: Dean Stewart

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

PDUFKO theroar O


gametime

westshoreroar.com/sports

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb &RDFK-RKQ .UHKELHO

â&#x20AC;&#x153;When I get older, I will be stronger. Theyâ&#x20AC;&#x2122;ll call me freedom, just like a wavinâ&#x20AC;&#x2122; flag.â&#x20AC;? â&#x20AC;&#x201D;Kâ&#x20AC;&#x2122;naan, â&#x20AC;&#x2DC;Waving Flagâ&#x20AC;&#x2122;

5(0(0%(57+(

:,/'&$76

&KDPSLRQVKLSWHDPFHPHQWVSODFHLQKLVWRU\ 1HZVHGLWRU

At a place that is know as the â&#x20AC;&#x153;nerd schoolâ&#x20AC;? to most other public schools in the county, students have the almost inevitable answer of â&#x20AC;&#x153;I was up â&#x20AC;&#x2DC;til like one doing homework,â&#x20AC;? when asked the simple question of â&#x20AC;&#x153;Whatâ&#x20AC;&#x2122;d you do last night?â&#x20AC;? But that all changed when members of the student body took a journey with a team of its own and went all the way to state. â&#x20AC;&#x153;Everybody knows our academic achievements, we won this, we won that,â&#x20AC;? Principal Rick Fleming said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s time that they recognize weâ&#x20AC;&#x2122;re not all brains. We excel in everything.â&#x20AC;? In the beginning of the season, and in some cases even before it started, the boysâ&#x20AC;&#x2122; soccer team told anyone who would listen that they were going all the way. Oftentimes the response was something between laughter and snide comments such as â&#x20AC;&#x153;sure you are, just keep telling yourself.â&#x20AC;? It was more than improbable in the minds of the student body. It was impossible. Never in school history had a team gone so far, and for the team that hadnâ&#x20AC;&#x2122;t even won a district title, it simply didnâ&#x20AC;&#x2122;t add up. But someone did the math wrong and thatâ&#x20AC;&#x2122;s exactly what happened. â&#x20AC;&#x153;They have to make a movie about this in the future,â&#x20AC;? senior Kevin â&#x20AC;&#x153;Ginga Ninjaâ&#x20AC;? Kurtz said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s just really unreal, and someoneâ&#x20AC;&#x2122;s going to have to make this movie.â&#x20AC;? After winning the regional crown against Dewitt Tayor at home on Feb. 3 , co-captain Nabil Motlagh inspired the team with his post-game talk. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ll never forget you,â&#x20AC;? he said. â&#x20AC;&#x153;You guys are my family, and tonight weâ&#x20AC;&#x2122;ve made history. And weâ&#x20AC;&#x2122;re still making it.â&#x20AC;? Immediately after winning the state championship, head coach John Krehbiel said appeared overwhelmed. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a combination of excitement and disbelief,â&#x20AC;? he said. â&#x20AC;&#x153;It was an amazing game. Like what the heck, theyâ&#x20AC;&#x2122;re a great group of soccer players but this is some amazing stuff. We played so well,

and it was just so exciting.â&#x20AC;? New assistant coach â&#x20AC;&#x153;Scottyâ&#x20AC;? Armstrong help provide the blueprint for success. â&#x20AC;&#x153;The first meeting I had with the boys I told them that weâ&#x20AC;&#x2122;d win states,â&#x20AC;? Armstrong said. â&#x20AC;&#x153;It took hard work and determination and they left all they had on the field.â&#x20AC;? As the team progressed, school spirit increased and the boysâ&#x20AC;&#x2122; preseason prophecy of going to state echoed through the halls with students exclaiming â&#x20AC;&#x153;weâ&#x20AC;&#x2122;re going to win state.â&#x20AC;? Storming the fields and painting not only signs but bodies, soccer came alive in the hearts of the fans and became the focus of the campus. It went as far as interrupting class during third period Feb. 10 to have a surprise â&#x20AC;&#x153;farewellâ&#x20AC;? fire drill for the team as it prepared to travel to Bolles High School in Jacksonville for the state semifinals. The administration brought out the whole school, complete with signs, introducing the team, and a speech from Fleming and Krehbiel. 5REHUW This game marked the beginning of the pep 0DGGHQ buses that were loaded up with the firstcome-first-serve fans who followed the team throughout the state tournament, first to Jacksonville and then to the University of South Florida stadium in Tampa. â&#x20AC;&#x153;I like having the fans come to our games,â&#x20AC;? said varsity player Liam Wixted, a junior. â&#x20AC;&#x153;It gives us a little boost to try harder, and we donâ&#x20AC;&#x2122;t want to let the people down who drove and took the time to come see us.â&#x20AC;? Full of enthusiasm, the crowd was one to be reckoned with. A handful of fans rushed the field after the championship victory, resulting in a $500 dollar fine and the threat of probation from the Florida High School Athletic Association. Photo: C. Walter

&DUOHLJK:DOWHU

O theroar OPDUFK


&RDFK6FRWW\$UPVWURQJVLJQHGRQWRKHOSFRDFKWKHER\VÂśVRFFHUWHDPWKLV\HDUDQG LPSOHPHQWHGYDULRXVFKDQJHVLQDWWLWXGHDQGVWUDWHJ\$UPVWURQJKDGFRPHIURP (QJODQGWRSOD\IRUORFDOFROOHJH)ORULGD7HFKEHIRUHJRLQJEDFNWR(QJODQG

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb $GULDQ $ULDV

7\OHU 0RVFULS

0LFKDHO %DWHK

1DELO 0RWODJK

-DPHV %RFLQVN\

-LPP\ 0XUUHQ

-RKQ %RFLQVN\

1RDK 4XLQRQHV

â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think the FHSAA has any idea as to what this victory means to all of us as a school,â&#x20AC;? Fleming said. â&#x20AC;&#x153;So we got a little too excited. Itâ&#x20AC;&#x2122;s not a crime.â&#x20AC;? Fleming wasnâ&#x20AC;&#x2122;t the only on who appreciated overthe enthusiastic fans. â&#x20AC;&#x153;The fan support is great. They mean a lot to us. Itâ&#x20AC;&#x2122;s just unbelievable,â&#x20AC;? eighth-grade keeper Joyner said after the game. â&#x20AC;&#x153;Now that weâ&#x20AC;&#x2122;re state champs, Iâ&#x20AC;&#x2122;m getting all of the ladies.â&#x20AC;? A record of 22 wins, 5 losses and no ties, the West Shore boysâ&#x20AC;&#x2122; 2A State Champion altered the image

%UDG 'HDYHUV

'RXJ )LVKHU

5\DQ 5RXELGRX[

0LFKDHO6HQIW *UHHQEHUJ

'DUVKDQ *KD\DO

%DODML 7KRJXOXYD

$OOHQ -R\QHU

&DVH\ 7RGG

of the school so that now when someone talks about â&#x20AC;&#x153;hittingâ&#x20AC;? it means more than just hitting the books. For those few weeks the answer changed. No longer was the climax of studentsâ&#x20AC;&#x2122; nights all about finishing their homework. In one shining season, when students were asked what they did the previous night their answer was not â&#x20AC;&#x153;homeworkâ&#x20AC;? but rather â&#x20AC;&#x153;I went to a soccer game, and we won.â&#x20AC;? Remember the season that changed everything. Remember the Wildcats.

.HYLQ .XUW]

$LGDQ :L[WHG

-LPP\ 0DGGHQ

/LDP :L[WHG

%,*6(1'2))-XQLRUV (ULQ%HUXEH6FRWW$GDPV 6KDZQ0F.HHIHU\.\OLH :HQJHU&LHUD0LVQHU $QWKRQ\:DWWZRRGDQG 7LPP\3KDPVKRZWKHLU VXSSRUWGXULQJWKHÂľIDUHZHOOÂś ÂżUHGULOOEHIRUHWKHWHDP OHIWIRU-DFNVRQYLOOHWR SOD\%ROOHVLQWKHVWDWH VHPLÂżQDOV

PDUFKO theroar O


cultureshock

westshoreroar.com/lifestyles

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

63<*$0(6 5RPFRP¶VVODSVWLFNZLOOJLYHYLHZHUVWKHHGJHWKH\¶UHORRNLQJIRU

result, has Heinrich swearing for revenge as he escapes the CIA. 6WDIIZULWHU Later, the scene cuts to the two friends Almost any romantic comedy ever made discussing how Tuck wants a meaningful can be broken down into a basic formula. relationship with a girl, causing him to This formula contains two main characters sign up for an online dating website. This who have a cute meeting, then they become happens to be the same dating website friends, get close to coming together, they that Lauren Scott (Reese Witherspoon) is a will probably get into a fight and finally member of, thanks to her meddling friend come together for a mushy over-the-top Trish (Chelsea Handler) signing her up. make-up scene that The two are connected on makes any real life Director: Joseph “McG” 3DUDPRXQW3LFWXUHV the site and begin dating; relationship appear Nichol at the same time this is weak and lackluster. Cast: Reese Witherspoon, happening, Lauren also Rated PG-13 Seriously, think about meets FDR by chance and it for a while and try to Chris Pine, Tom Hardy, Chelsea Handler the two begin dating, each find one rom-com that being unaware who the does not fit into this basic plot line. While other is. Eventually the men discover they there is no denying “This Means War” fits are both after the same girl and decide to let the stereotypical girl-movie equation just her chose, and agree that they will compete like the rest of them, there is also a spy and until it ruins their friendship. The two end action aspect that makes gives it a bit of a up becoming competitive with each other twist. over Lauren and an excellent mix of hilarity The movie starts out with CIA agents and chaos ensues as the two use their CIA and best friends FDR (Chris Pine) and agent technology to help them win the girl. Tuck (Tom Hardy) on a mission to prevent “This Means War” makes up for its crime. Tuck, in the process of halting illegal predictability with a clever humor and also activity, kills Heinrich’s brother and, as a some pretty wicked action scenes.

0DGGLH'LPRQG

*ULSSLQJSORWLOOXPLQDWHVҊ'DUN/LIHҋ

es. To escape and find land to farm, some people have migrated to the seafloor, with the help of technology. The protagonist of “Dark Life” is 15-year-old Ty, the first child born in the subsea When I went to Barnes and Noble for the first time in months, Benthic Territory. The oppressive national government, the ComI wasn’t really looking for a great read. That would be nice, but monwealth, threatens to cut off Benthic Territory’s supplies until my real intention was to spend money for the group of outlaws plundering government the West Shore book fair so that my teachships and homesteads, the Seablite Gang, is 'DUN/LIH ers could afford to pass out papers instead caught. In his first encounter with the gang, %\.DW)DOOV of making us print them off Edline. So I Ty meets a mainland resident named Gemma grabbed “Dark Life” off the shelf because who is in Benthic Territory to search for her of the pretty jellyfish on the cover and brother, Roger. As Ty helps Gemma look for Publisher:Scholastic added it to the very bottom of my to-read Roger, he also delves into the mysteries surlist, below the long, rather gruesome book rounding the Seablite Gang and the possible about Lincoln’s death and funeral and Jefexistence of “Dark Gifts,” special talents subferson Davis’s half-hearted attempt to flee the country. sea children may have evolved due to pressure on their developOnce I finally started to read “Dark Life,” though, I was harding brains. put to stop. I had to place it in another room to finish my math Despite its slightly predictable plot and too-tidy conclusion, homework, and even after my copy started to fall apart, I couldn’t “Dark Life” is a gripping tale and definitely a good read. Whether turn the loose pages fast enough. Dark Life is about a dystopian the projected sequel, “Rip Tide,” can live up to its predecessor refuture where global warming has caused the oceans to rise and mains to be seen, but the excerpt at the end of “Dark Life” looked people on the remaining land live crammed into minuscule spacpromising, so it’s one book I’ll be watching for.

'DQD%URZQ :HE0DQDJHU

Otheroar OPDUFK


$WDQDWLRQDOOHYHOEULGHVEX\PRUHWKDQPLOOLRQEULGDOPDJD]LQHVD\HDUEX\LQJ IURPIRXUWRVL[LVVXHVRIWKHLUIDYRULWH6WLOORYHUSHUFHQWRIDOOEULGHVDQGJURRPV XVHWKHLQWHUQHWWRDVVLVWLQWKHSODQQLQJ 6RXUFH1DWLRQDO0DLO2UGHU$VVRFLDWLRQ

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

Ň&#x160;7KH9RZŇ&#x2039;XOWLPDWHO\IDLOVWRZRZ romantic scenes awkward to watch. The actorsâ&#x20AC;&#x2122; performance was mediocre at best, especially because Leo seemed more eager to flex his muscles and play his guitar than Lately, â&#x20AC;&#x153;cuteâ&#x20AC;? seems to have been to win back his girl, while Paigeâ&#x20AC;&#x2122;s laugh exchanged for â&#x20AC;&#x153;clicheâ&#x20AC;? when it comes to sounded like a hyena, and ruined whatever romantic movies. Based on the trailer, The charm the moment might have had. Vow initially seemed a very promising The movieâ&#x20AC;&#x2122;s plot line was underdeveloped movie with the perfect blend of notable and contained too many irrelevant scenes actors and a sweet, and subplots. The fact that Director: Michael Sucsy Spyglass Entertainment touching story line. the film revolved more Initially, the movie Cast: Channing Tatum, around Paigeâ&#x20AC;&#x2122;s parents and Rated PG-13 begins by showing Rachel McAdams, her ex-boyfriend than around the coupleâ&#x20AC;&#x2122;s doting her and Leoâ&#x20AC;&#x2122;s relationship relationship. However, their perfect love was very unsatisfying and disappointing. story is ruined when they are parked at Once Paige gets tired of having to deal with the wrong place at the wrong time and are being married to a â&#x20AC;&#x153;strangerâ&#x20AC;? she decides rear-ended by a semi-truck. The accident that sheâ&#x20AC;&#x2122;s better off without him and stays causes Paige (Rachel McAdams) to suffer a with her parents. For the next half hour, a brain injury that causes long term amnesia, bunch of unnecessary drama ranging from placing enormous strain on the coupleâ&#x20AC;&#x2122;s her dadâ&#x20AC;&#x2122;s infidelity, to her sisterâ&#x20AC;&#x2122;s random relationship, seeing as she can no longer wedding is shown in great detail. remember her husband, Leo (Channing Eventually, after many tears, fights, Tatum). breakups, tempers and more bad acting, After this attention-getting beginning, the Paige and Leo â&#x20AC;&#x153;coincidentallyâ&#x20AC;? run into movie heads on a downward spiral. The each other in town and get back together actors lack on-screen chemistry, which in the final scene which is perhaps the most makes Leoâ&#x20AC;&#x2122;s attempts during the filmâ&#x20AC;&#x2122;s abrupt one in the entire movie.

6\GQH\6DXQGHUV$DOHNK\D7HQDOL 6WDIIZULWHUV

:=5'DEOHQGHGH[SHULHQFHJRQHULJKW But after I listened to it a few more times I started to focus less on Kid Cudiâ&#x20AC;&#x2122;s older sound and more on his current one. Thereâ&#x20AC;&#x2122;s a reason WZRD made it to the iTunes Top 10 Albums list: it sounds unique. Maybe itâ&#x20AC;&#x2122;s so popular because it doesnâ&#x20AC;&#x2122;t sound like Cudiâ&#x20AC;&#x2122;s In an interview with MTV, Kid Cudi said that the self-entitled other music, but it still sounds awesome in a different way because debut album from WZRD would have no cursing or rapping. heâ&#x20AC;&#x2122;s directing his talent into an alternative type of music. Whether thereâ&#x20AC;&#x2122;s cursing or not is debatable depending on your One thing that disappointed me about the album is its definition of the word, but there definitely lack of original lyrics in a few songs. Although â&#x20AC;&#x153;High Off isnâ&#x20AC;&#x2122;t rapping. While one would expect the :=5' Lifeâ&#x20AC;? has a positive message, lyrics like â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m high off life/ brainchild of Kid Cudi and Dot da Genius Ň&#x160;:=5'Ň&#x2039; taking hits off of experienceâ&#x20AC;? sound too much like an Above to be full of hip-hop tracks, itâ&#x20AC;&#x2122;s actually the Influence commercial for me to really appreciate the entirely rock and even includes a cover of /DEHO8QLYV5HSXEOLF song. Even though the lyrics threw off the album a bit, the a Nirvana song. instrumentals made up for it. Occasionally it gets a little To be honest, the first time I listened overwhelming because there isnâ&#x20AC;&#x2122;t much percussion, but overall the to this album I didnâ&#x20AC;&#x2122;t enjoy it. I like Cudiâ&#x20AC;&#x2122;s usual style of rap with sound helps the album fit its rock theme. its catchy melody, rhythm and a little singing thrown in, maybe Cudiâ&#x20AC;&#x2122;s previous music aside, the album has a different sound that some sampling. Although I generally donâ&#x20AC;&#x2122;t listen to much rap, I has gained popularity among both rock and hip-hop crowds. In a grew to love his style when my brother introduced me to Cudiâ&#x20AC;&#x2122;s tweet Cudi said: premier album Man on the Moon a few years ago. I like how his â&#x20AC;&#x153;No major promo, no single on the radio, no music video. Just the music sounds and how unique his style is; the way he raps about Music. All for the music.â&#x20AC;? real things, not just partying and clubs. I guess this is why I was But this surprising twist in Kid Cudiâ&#x20AC;&#x2122;s career wonâ&#x20AC;&#x2122;t last forever; surprised when he exclusively dedicated an entire album to rock. his next album Man on the Moon III (which he claims is for fans of It seemed like WZRD limited his musical ability by restricting him his older style) is slated to be released within two years. to the confines of rock.

0RUJDQ0LOOHU

(QWHUWDLQPHQW(GLWRU

PDUFKO theroar O


cultureshock

westshoreroar.com/connect

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb surveysays :KDWGR\RXWKLQN DERXWWDWWRRV"



7KH\Ň&#x2039;UHWDFN\DQG JURVV



7KH\Ň&#x2039;UHDZHVRPH ,ZDQWRQH

 ,EHOLHYHWKDWLWŇ&#x2039;VD SHUVRQDOFKRLFH

 7KH\Ň&#x2039;UH2.EXW, ZRXOGQHYHUJHWRQH

:KRGR\RXZDQW WREHWKHQH[W 86SUHVLGHQW"

 %DUDFN2EDPD

 0LWW5RPQH\

 1HZW*LQJULFK

 5RQ3DXO

 5LFN6DQWRUXP

:KLFKVWRU\PRYLH GR\RXSUHIHU"



+DUU\3RWWHUIDQVLQFH DJH



+XQJHU*DPHVDOO WKHZD\



,ZLOODOZD\VEHD 7ZLOLJKWIDQ 7DNHRXUZHHNO\SROOVDW ZZZZHVWVKRUHURDUFRP

Otheroar OPDUFK


:LWKWKHKHOSRIĂ&#x20AC;OPPDNHU-DVRQ5XVVHOORUJDQL]DWLRQ,QYLVLEOH&KLOGUHQKDVUHOHDVHGD YLGHRH[SRVLQJ/RUGŇ&#x2039;V5HVLVWDQFH$UP\Ň&#x2039;VOHDGHU-RVHSK.RQ\7KHVKRUWGRFXPHQWDU\ DERXWWKH8JDQGD&KULVWLDQWHUURULVWJURXSKDGQHDUO\PLOOLRQYLHZVLQWZRGD\V

bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb

%5$,16,17+(%$1'

6FKRODUO\VHQLRUVJLYHWKHWHUPÂľPXVLFDOJHQLXVÂśDQHZPHDQLQJ In fact, the Basement Scene has a song titled â&#x20AC;&#x153;Physics, â&#x20AC;? which they wrote at a practice Issitt 6WDIIZULWHU could not attend because of a science commitment. Juggling multiple Advanced Placement As far as being Merit Scholars, both said they courses, extracurricular activities and were aiming for the recognition. preparing for college while maintaining â&#x20AC;&#x153;I just found out Iâ&#x20AC;&#x2122;m a finalist, so there might downtime can take a toll on students. But be some scholarships there,â&#x20AC;? Goffinet said. While National Merit Finalist D.K. Issitt and Jack he said he is unsure of his college plans, Crown Goffinet and Semifinalist Anthony Crown plans to attend the University of Florida to study have it all figured out. The seniors play in science engineering. He said he wants his music the jazz combo Agility. Crown and Issitt to be heard, but his priority is having fun. also play in The Basement Scene, a local â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m guessing next year Agility will do what Stork indie band. is doing now, mostly playing shows during school â&#x20AC;&#x153;Agility started last school year as breaks,â&#x20AC;? Goffinet said. Stork is led by Matt Verdier, 3KRWR$6DQFKH] â&#x20AC;&#x2DC;Groovinâ&#x20AC;&#x2122; Hardâ&#x20AC;&#x2122;, but Dex [Wilbourn] and who graduated last year. Brett [Wendrzyk] graduated, so this year -DP6HVVLRQ'.,VVLWW$QWKRQ\&URZQ The Basement Scene, which Crown describes we have a different lineup and name,â&#x20AC;? DQG-DFN*RIÂżQHWSHUIRUPDV$JLOLW\DWD6XQ as everywhere â&#x20AC;&#x201D; jazz, punk rock, grunge and 6KRSSHJLJ Goffinet said. acoustic â&#x20AC;&#x201D; released its first album â&#x20AC;&#x153;Everything is Crown said school work is never sacrificed for music. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s probably Going to be OKâ&#x20AC;? March 3 at a show at the Sun Shoppe in Downtown a 60-40 ratio,â&#x20AC;? he said. â&#x20AC;&#x153;Sometimes we have to try to find time to Melbourne. The CD sells for $10 and is available through members practice, but being in a band helps me remain sane.â&#x20AC;? of the band.

6RPPHU+LG\

love/hate

British Boy Band â&#x20AC;&#x2DC;One Directionâ&#x20AC;&#x2122;

š

š

,WŇ&#x2039;VDIUHVK QHZVRXQG OLNHIUHVKZLWKD PRQH\VLJQÂľ

,GRQŇ&#x2039;WWKLQNWKH\ DUHFXWHÂľ

(PLO\'DYLGVRQWK

š

&KULV0LNXODVWK

Broadway Themed Show â&#x20AC;&#x2DC;Smashâ&#x20AC;&#x2122;

7KHUHŇ&#x2039;VQRWKLQJ HOVHRQ79OLNHLWDQG LWŇ&#x2039;VQRWDXWRWXQHGOLNH *OHHÂľ

š

*OHHLVEDG HQRXJKZHGRQŇ&#x2039;W QHHGDQRWKHUVKRZ MXVWOLNHLWÂľ

0D\D%XUOH\WK

$QGUHZ(DWRQWK

š

Party-movie â&#x20AC;&#x2DC;Project Xâ&#x20AC;&#x2122;

,WPDGHPH UHDOL]HWKHGDQJHUV RISDUW\LQJ'RQŇ&#x2039;W GRGUXJVNLGVÂľ $-'UDSHUWK

š

,WZDVQRW DQDFFXUDWH UHSUHVHQWDWLRQRIKLJK VFKRROSDUWLHVÂľ $QNXU0HKLQGUXWK

PDUFKO theroar O


Mark Miller, M.D. Robert Paige, M.D. David Pearse, M.D. Whatâ&#x20AC;&#x2122;s New: UWe have one of Brevardâ&#x20AC;&#x2122;s only 1.5T high field strength OPEN MRI magnets UCardiac CT available using 64-slice CT scanners UOur imaging services are American College of Radiology (ACR) accredited

6%DEFRFN6W 0HOERXUQH)/ 

RII ZLWKWKLV$G Otheroar OPDUFK


HIGHER SCORES MEAN MORE COLLEGE OPTIONS. For more than 30 years, Huntingtonâ&#x20AC;&#x2122;s tutoring method has been proven to help significantly raise SAT/ PSAT and ACT scores for thousands of students. Classes available after school, nights, and weekends. Choose from 3 great options: Premier Program - Personalized, one-to-one tutoring designed specifically around the studentâ&#x20AC;&#x2122;s strengths and weaknesses. 28-hour Program - Comprehensive, one-to-one tutoring for a boost in all key subject areas of the target test. 10-hour Program - Concentrated, one-to-one tutoring in a single subject area.

Your Tutoring

Solution

SAVE 50 $

EXAM PREP

ÂŽ

1 800 CAN LEARNÂŽ

*

WHEN YOU CALL BEFORE 00/00/00

ACADEMIC SKILLS K-12 3FBEJOHt8SJUJOHt.BUIt4UVEZ4LJMMT 4QFMMJOHt7PDBCVMBSZt1IPOJDT SUBJECT TUTORING MIDDLE SCHOOL -COLLEGE 1SFBMHFCSBt"MHFCSBt(FPNFUSZ 5SJHPOPNFUSZt1SFDBMDVMVTt$BMDVMVT &BSUI4DJFODFt#JPMPHZt$IFNJTUSZt1IZTJDT EXAM PREP 4"5 14"5t"$5t"EWBODFE1MBDFNFOU "1

4UBUF5FTUTt)415t*4&&t44"5t(&%t"47"#

Cherry Hill 856-795-1933 123 Street Name

HuntingtonHelps.com Š2012 Huntington Mark, LLC. Independently Owned and Operated. SAT and PSAT are registered trademarks of the College Entrance Examination Board. ACT is a registered trademark of ACT, Inc. The College Entrance Examination Board and ACT, Inc. were not involved in the production of, and do not endorse, this program. *Offer valid for Academic Evaluation or Tuition, new students only. Not valid with any other offer.

HPA103-1


March 2012 issue