Issuu on Google+

NEW +(1'(56 '58*6 528*+5,'(5&/27+,1* NOW IN STOCK! 9 am - 9 pm Monday to Friday, 9 am - 6 pm Saturday, 12 noon - 4 pm Sundays & Holidays

/LNHXV

1220 4th Street, Estevan • Phone: 634-3666

SOUTHEAST SASKATCHEWAN’S FREE DISTRIBUTION PAPER

SOUTHEAST TRADER

EXPRESS Cont. Circulation - 9,239

Looking for a job?

www.estevanmercury.ca

See pages 21 - 24

Friday, July 6, 2012

One, Two, Three ... Pull So many activities Estevan’s summer sports camps offer lots of choices.

3

Speedway Finally Racing Season opens after four cancelled events. *

FLYER CHECK

6

This week's entry into the 2012 front page photo contest was submitted by Laurie Bouchard. If you would like to submit a photo email it to editor@estevanmercury.ca. The winner will receive a digital SLR camera. Please ensure that when sending photos they are sent at the highest possible resolution. Contest sponsored by:

• Co-op • Sobeys • Menards

6HQFKXN

)RUG6DOHV/WG

• Peavey Mart • Sears • Home Hardware • Bargain! Shop • Smart Source • Canadian Tire

• Leons

6RXULV$YH1(VWHYDQ 7ROO)UHH VDOHV

 VHUYLFH

(PDLOVDOHV#VHQFKXNFRP‡ZZZVHQFKXNIRUGFD


Page 2

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Cheers&Jeers Cheers to the Leader Post carrier in the Pleasantdale area. Thank you for such great early morning delivery. And with a smile on your face too!

Cheers to the SaskPower line crews who were out there during terrible weather conditions restoring power for customers right across the province, including southeast Saskatchewan.

5ISQVO<QUM.TaAW]Z?Ia

?M 7NNMZ KPIZ\MZ IQZ [MZ^QKM _Q\P [INM\a IVL XI[[MVOMZ KWUNWZ\ I[ W]Z PQOPM[\XZQWZQ\a

 

Cheers to Councillor Roy Ludwig for giving the electorate a chance to put an X beside his name. Regina has how many candidates running for the top job? It is time for people to come forward to put their name on the ballot, especially the gentleman who has time to follow city sanding trucks, the waste management trucks picking up garbage from our trash bins, watch for offenders on the â&#x20AC;&#x153;Truck Routeâ&#x20AC;?. I am not endorsing Councillor Ludwig at this point, but good for him to put his name out there. It would be a shame for a city this size with all the advantages we have, not to have a full-slate of candidates. Jeers to the vandals who go into private yards and take their LED lights and then smash them all over the streets. And to those who also dump peopleâ&#x20AC;&#x2122;s flower pots. Anyone can smash these things, maybe you should try making something instead.

Jeers to the business owner for the potholes bigger than swimming pools in the parking lots. Are you gonna pay for my vehicle to get fixed for the damage that your parking lot has done to my vehicle? Jeers to the law enforcement officer that was driving while talking on his cellphone July 3, what a nice way to set an example to the young kids you ticket for talking on their phones. Shame on you!

Jeers to the guy in the black Ford ext. cab with the Princecraft deck boat who almost ran over my one-year-old son in his stroller at 1st Street and 14th Avenue. Jeers to the person in the cowboy boots whistling a tune at 2 a.m in the Pleasantdale area. You tried to break into my neighbourâ&#x20AC;&#x2122;s vehicle moments after you walked by my house. Buddy, you had better think again before whistling a tune and walking in your clodhoppers on a quiet night past houses with the windows open because that noise woke me up and gave you away! The police have been called. And then thereâ&#x20AC;&#x2122;s also Karma to consider.

Send your Cheer or Jeer to jbaker@estevanmercury.ca or send us a message on the Mercuryâ&#x20AC;&#x2122;s Facebook page

2USKHXP7KHDWUH 'RZQWRZQ(VWHYDQÂ&#x2021;+U0RYLH,QIRUPDWLRQ/LQHÂ&#x2021;

BRAVE IN 3D

+L0HPSKLVLVP\QDPH,¡PD IHPDOH EODFN DQG ZKLWH GRJJ\ DQG VXFK D FKDUDFWHU , ORYH EHLQJ VSUD\HG GRZQ ZLWK WKH SUHVVXUH ZDVKHU ZDQG DQG WU\LQJ WR FDWFK DQG HDW  WKH RYHUVSUD\,DOVROLNHWRIHWFKDQG QRWUHWXUQZLWKWKHEDOO,JXHVV ,¡PMXVWDOLWWOHPLVFKLHYRXV

Friday, July 6 - Thursday, July 12 7 pm *Wednesday, July 11 in 2D Saturday, July 7, 2 pm in 2D, All Seats $6.00 Sunday, July 8, 2 pm in 3D all seats $9.00

,¡P 3HUFHH , NQRZ , ZRXOG ORYHWROLYHRQDIDUPDQGEHD JRRG JX\ ,¡G VWLFN DURXQG DQG KHOSRXWZKHUH,FRXOG,VWKHUH VRPHRQH ZLOOLQJ WR JLYH PH D FKDQFH"

+L P\ QDPH LV )DZQ ,¡P D %R[HU &URVV IHPDOH DQG VWLOO D SXS %HFDXVH ,¡P \RXQJ LW ZRXOGEHDJUHDWWLPHIRUPHWR Ă&#x20AC;QGP\IRUHYHUKRPHVR,FRXOG EH WDXJKW DOO PH ´GR¡V DQG QR¡VÂľ%HOLHYHPH,¡PDSUHWW\ JLUO , KDYH D GRFNHG WDLO ZLWK VKRUW KDLU *RUJHRXV ZLWK OLWWOH PDLQWHQDQFH

We would like to thank Justin Linthicum and family for their donation of cat and dog food, treats and toys. Thank-you for thinking of our dear sweet animals.

General Violence

Watch for The Amazing Spiderman, opening July 13th!

Visit us on the web!! www.estevanmercury.ca

or on facebook www.facebook.com/EstevanMercury

7KH(VWHYDQ+XPDQH6RFLHW\UHVHUYHVWKHULJKWWRUHIXVHDQ\DGRSWLRQ

7KDQN\RXIRU\RXUFRQWLQXHGVXSSRUW 7KLVVSDFHLVVSRQVRUHGE\WKLVFRPPXQLW\PLQGHGEXVLQHVV

1. Brave (PG) animated 2. Madagascar 3: Europeâ&#x20AC;&#x2122;s Most Wanted (PG) animated 3. Abraham Lincoln: Vampire Hunter (R) Benjamin Walker, Rufus Sewell 4. Prometheus (R) Noomi Rapace, Michael Fassbender 5. Snow White and the Huntsman (PG-13) Kristen Stewart, Chris Hemsworth 6. Rock of Ages (PG13) Tom Cruise, Catherine Zeta Jones 7. Thatâ&#x20AC;&#x2122;s My Boy (R) Adam Sandler, Andy Samberg 8. Marvelâ&#x20AC;&#x2122;s The Avengers (PG-13) Robert Downey Jr., Chris Evans 9. Men in Black III (PG-13) Will Smith, Tommy Lee Jones 10. Seeking a Friend for the End of the World (R) Steve Carell, Keira Knightley (c) 2012 King Features Synd., Inc.


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Page 3

Sports camps open for registration Estevanâ&#x20AC;&#x2122;s summer sports camps are hoping to bounce back this summer after a year where attendance numbers dropped. The program is designed for children between the ages of nine and 14, and offers a wide variety of sports to try throughout the summer. This summer kids will have a wide variety of sports to choose from, including: squash, skateboarding, diving, lacrosse and golf. The more popular camps like skateboarding and golf do have limited spaces, so that kids can the most out of their instructors. The camps are for children of all skill levels and are designed so the kids can improve, as well as have some fun. For each sport there is a specialized instructor to teach the camp. Laura Desautels from SaskDiving will be teaching children

July 25 to 27 the proper techniques of diving, Keenan Cummings from Sask Lacrosse will teach the kids in the lacrosse camp Aug. 22 and 23, and Chris Moerike from Squash Sask will kick things off July 7 and 8 with squash camp. Although there are participant limits on some of the camps there is also a minimum number and if enough people donâ&#x20AC;&#x2122;t register they could be cancelled with at least seven days notice. For more information or questions about the 2012 summer sports camps, people can contact Liisa Kleemola at 634-1884 or by e-mail at playparks@estevan. ca. To register for the camp, people may drop off registration forms at the Souris Valley Aquatic and Leisure Centre or sign up on ActiveNet online by visiting www.estevan.ca.

Another year of sports camps is here and registration is now open for children age nine to 14.

Money Problems?

Marla Adams CA CIRP Trustee in Bankruptcy

Start Fresh. We can help. FREE consultation 1-800-961-DEBT (3328) www. bankruptcy. deloitte. ca 900-2103 11th Ave., Regina

MARITIMES BY MOTORCOACH

Several Tours to Choose From HDUV s Year 34<  FH ice HUYL serv of6 RI

Canada Day Festivities

Floats of all shapes and sizes took part in the annual Canada Day parade held in Beinfait on Sunday







www.nageltours.com

Call Your Travel Agent or 1-800-562-9999

3LOORZV 0DWWUHV  3URWHFW V &RPIRU RUV  W6HWV WK6WUHHW(VWHYDQ

3KRQH

'HVLJQLQJ2QH5RRPDWD7LPH FREE DELIVERY â&#x20AC;˘ INTEREST FREE FINANCING AVAILABLE O.A.C. www.roombyroomfurniture.net


SOUTHEAST TRADER

EXPRESS

JULY 6, 2012

Member Canadian Community Newspapers Assoc. Member Saskatchewan Weekly Newspapers Assoc. Audited by Audit Bureau of Circulations.

SOUTHEAST TRADER

EXPRESS General Manager: Brant Kersey Editorial Staff: Norm Park Chad Saxon Jordan Baker Josh Lewis Advertising Sales Manager: Cindy Beaulieu Advertising Sales Representatives: Deanna Tarnes Kristen O'Handley Teresa Hrywkiw Candace Wheeler Production Department: Melanie Tribiger Jodi Gagnon Trinda Jocelyn Manuela Fors Accounting: Kim Schoff Reception: Gayle Worsnop Classifieds: Carol Toth Contributors: Calvin Daniels Tonaya Marr Brian Zinchuk Bruce Penton Susan Sohn

Published weekly by Prairie Newspaper Group Limited Partnership, 68 Souris Avenue N., Estevan, Saskatchewan. Postal address: Box 730 Estevan, Saskatchewan, S4A 2A6 Advertising rates are available upon request and are subject to change without notice. Conditions of editorial and advertising content: The Southeast Trader Express attempts to be accurate in Editorial and Advertising content; however, no guarantee is given or implied. The Southeast Trader Express reserves the right to revise or reject any or all editorial and advertising content as the newspaper's principals see fit. The Southeast Trader Express will not be responsible for more than one incorrect insertion of an advertisement, and is not responsible for errors in advertisements except for the space occupied by such errors. The Southeast Trader Express will not be responsible for manuscripts, photographs, negatives and other related material that may be submitted for possible publication. All of the The Southeast Trader Express' content is protected by Canadian Copyright laws. Reviews and similar mention of material in this newspaper is granted on the provision that The Southeast Trader Express receives credit. Otherwise, any reproduction without the permission of the publisher is prohibited. Advertisers purchase space and circulation only. Rights to any advertisement produced by The Southeast Trader Express, including artwork, typography, photos, etc., remain the property of this newspaper. Advertisements or parts thereof may not be reproduced or assigned without the consent of the publisher. Published weekly in Southeast Saskatchewan by the Prairie Newspaper Group, a subsidiary of Glacier Media Inc. The Glacier group of companies collects personal information from our customers in the normal course of business transactions. We use that information to provide you with our products and services you request. On occasion we may contact you for purposes of research, surveys and other such matters. To provide you with better service we may share your personal information with our sister companies and also outside, selected third parties who perform work for us as suppliers, agents, service providers and information gatherers. Our subscription list may be provided to other organizations who have products and services that may be of interest to you. If you do not wish to participate in such matters, please contact us at the following address: The Southeast Trader Express, Box 730, Estevan, Saskatchewan, S4A 2A6; or phone (306) 634-2654. For a complete statement of our privacy policy, please go to our Website at: www.estevanmercury.ca The Southeast Trader Express is owned and operated by Prairie Newspaper Group, a subsidiary of Glacier Media Inc.

We acknowledge the financial support of the Government of Canada through the Publications Assistance Program toward our mailing costs.

Contact us: Phone: 634-2654 Fax: 634-3934 www.estevanmercury.ca Street Address: 68 Souris Ave. N., Estevan By mail: Box 730, Estevan, Sask. S4A 2A6

Perspective

Page 4

I’ll show you a bumpy road Welcome to the world of Rhys Kelso. With Jordan Baker doing some work for Pipeline News for the next couple of weeks, I have been put on Southeast Trader Express duty. One of the great things about this job is that I now have a regular spot to write about whatever my little heart desires and with that, it’s go time. Everyone will want to pay close attention here, because like my co-worker Norm Park, and the 90s band House of Pain, I like to jump around. I was born and raised in Winnipeg, Man., and after living outside of the province for a few years now, I have come to realize a few things about my hometown. One of those things is that Winnipeggers like to complain a lot. In fact, if you were to ask any outsider about what they know about the city, most of the answers would be negative. For example, the horrible wind in the winter, the mass number of mosquitoes in the summer or that the city has been awarded, on multiple occasions, as the murder capital of Canada (per capita). Although there are some bad things about living in the ‘Peg, I have come to appreciate the good things, with my time

Rhys Kelso Rhys’ Pieces away from home. I have been out of the city for awhile, but I still like to complain, and holy flying squirrels the roads in Estevan are horrible. When I first arrived to Estevan I was greeted by having to use the back entrance of The Mercury office because there was a big hole in our road. I thought to myself, not a big issue, water main breaks happen all the time, plus I’m from Winnipeg, where if you’re not careful, you will be swallowed by potholes. As the months went on though, I started developing a hate for the roads in Estevan. Each time I hit one in my little car, I would just think of the potential damage it could do to my car and cringe. I still wasn’t complaining. Then winter ended and spring arrived and the roads turned into something I have never seen before. Add that on to the fact that the majority of my eight months

working in Estevan I have had to park across the road from the office because of construction, and now the Winnipegger in me is out and I’m complaining about the roads. The thing that has pushed me over the edge and made me decide to write this column was what I saw recently on the streets of Estevan. Recently the streets of Estevan have been getting a makeover. No, they aren’t fixing potholes. They’re painting lines on the crappy streets. Whose brilliant idea is that? How did that conversation go? John Doe: “The streets of Estevan are really a problem?” Jane Doe: “Maybe we should improve them?” John: “How about we just paint over the deteriorating roads that need fixing?” Jane: “Brilliant idea!” If something needs to be fixed, a fresh coat of paint is not going to help at all. I understand at crosswalks it could be a safety issue, so go ahead and paint those, but painting lines, really? And the rant ends here. Although I said I was complaining like a Winnipegger, I almost feel more like a local now after venting about our roads.

Fairs bring out the child in me I suppose this is what I knowingly recognize as my redundant annual column, but there is something about this time of year that always makes me nostalgic for agricultural fairs. It is more than the fact the Yorkton Exhibition Association’s annual fair is being held in the city this week, and that means my trekking to the familiar grounds for the local regional 4-H show, dairy goat show and, of course, a plate of curly fries and an elephant ear. When I was a youngster, my summer holidays were not spent at some camp for kids. Instead it was a near solid six weeks of attending summer fairs - Saskatoon, Yorkton, Melfort, Connaught, Nipawin, Prince Albert, Golburn, Invermay, Swan River, Shand. We showed livestock, and in that era 30 to 40 years ago, it meant being an important part of the fair. Everybody had a tie to the farm in those days, and so most people attending fairs walked through the barns. It was just the thing to do. Of course farming itself was different back then. Operations were smaller. They were generally mixed. Over the years, we always showed registered hogs - as far afield as the Toronto Royal twice - but also sheep, dairy goats, even chickens and grain sheaves. People would walk through the barns and look. They would stop to talk, usually about the animals they had at home. In those days,

Calvin Daniels Trader Agriculture Columnist almost every farmer had a few cows, pigs, raised chickens for eggs and milk. That was the way of farming. Those days are past. Yes, there are those who want to get back to being more self-sufficient on the farm. They see value in raising chickens on grain they grow to produce eggs, or to raise pigs to have a deep freeze full of meat without a cash outlay at the grocery store each week. In some respects it was a simpler time, which I suppose is something every generation says as it looks back, but it seems true through my eyes. Farmers had the time, or at least made it, to take their stock to shows all over the Prairies. It was part of growing up for many kids of my generation. You knew you were coming of age when your father let you stay alone at some fair to look after the show stock. It was another step when you got to drive the truck with the 28-foot trailer behind. You had earned a level of trust and responsibility, at least that is how I saw

such things. Today, in a world of cellphones and laptops and GPS, there doesn’t seem to be time for anything. It is hard to imagine a farmer giving up a day, let alone four, five, six, to haul their animals to a summer fair, where they would show one day, and the rest of the time relax and market to the farmers walking through each day. Today’s livestock producers tend toward large-scale operations, highly specialized in what they do. The intensive rearing systems of some sectors aren’t popular with consumers, but economic factors, rates of gain and feed conversion tell the tale for farmers. They are far superior to what the mixed farmer achieved a few decades back. And so summer fairs have evolved. They are all about midways and grandstand shows and entertainment. Few attending venture to even look at the 4-H animals, or goats - which somehow maintain a tenacious foothold as part of a fair like the one in Yorkton. Those at the fair no longer have that close connection to the farm. For most, they disconnect with that world completely. So while I wax nostalgic about fairs as the calendar turns to July, I know the clock won’t turn back, even if I wish at times like this that it would. Still for me, summer fairs will be remembered as far more than they are now, and frankly better than they now are too.

Read the Full Edition of the Southeast Trader Express online www.estevanmercury.ca


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Page 5

Is it wrong to spank children?

He She He She Said

I would first like to offer a warning at the start of this debate. Iâ&#x20AC;&#x2122;m not a parent and have zero experience with raising a child, so by no means am I an expert in this situation. But itâ&#x20AC;&#x2122;s my opinion that parents should start trying something new when it comes to forms of discipline. However, I do not have this opinion because of the new study that came out suggesting that spanking can cause mental illness. The study stated that people who have been spanked as kids have a two to seven per cent greater chance of encountering mental issues. I think if you were to do a study about most anything, you would find similar results. Mental illness is a growing problem in society and it is harder to find people who havenâ&#x20AC;&#x2122;t been affected by it. That two to seven per cent isnâ&#x20AC;&#x2122;t a big enough number for me. If everyone stopped spanking their children, I donâ&#x20AC;&#x2122;t think we would see a drop in our mental illness numbers. However, I do believe it may be time for parents to try a new discipline technique. Spanking/hitting children has been a popular technique for many years. I donâ&#x20AC;&#x2122;t have any ideas of what else to do, Iâ&#x20AC;&#x2122;m no Dr. Phil. But maybe a change in disciplining children could have a bigger effect on how kids grow up and view the world. Instead of punishing children with a violent act, is there a way to do it peacefully and still get your point across? I think we should be looking for this new form of discipline and hope one day it will turn into us living in a less violent world. â&#x20AC;&#x201C; Rhys Kelso

Said

6DVN)DUPV 5DQFKHV

Fun Time Summer Time

Maia Flaman, 4, shows of her artwork at Churchill Park July 4. Children in the area started to enjoy the playparks 2012 activities this past week.

Congratulations! The Estevan Mercury & Southeast Trader Express would like to congratulate

Zachary Beahm

Based on my own experience, I donâ&#x20AC;&#x2122;t have an issue with spanking children. Assuming, of course, that the spanker remembers to be a parent. A parent shouldnâ&#x20AC;&#x2122;t beat the crap out of their children, and while a spanking is meant to be a punishment, you want to make your school-aged kid realize he/she was wrong, not walk funny for a week. A parent still loves the child. But I guess thereâ&#x20AC;&#x2122;s a fine line between going too far and discipline. I read about the study that suggests spanking can cause mental illness, but honestly, what canâ&#x20AC;&#x2122;t? If you have the predisposition to have a mental disorder, thatâ&#x20AC;&#x2122;s going to be an issue whether or not youâ&#x20AC;&#x2122;re spanked as a child. I also assume there is a lot of being able to understand your childâ&#x20AC;&#x2122;s personality that needs to be considered. Clearly Iâ&#x20AC;&#x2122;m no parent, but either through trial-and-error or just observation, you might know if spanking your kid for stealing a toy from his friend will send him into a death spiral of emotion. Not everyone wants to spank their children, either, and thatâ&#x20AC;&#x2122;s OK. It could be a moral thing, or just the fact that they arenâ&#x20AC;&#x2122;t physical people. Seriously, thatâ&#x20AC;&#x2122;s your call. I still donâ&#x20AC;&#x2122;t think spanking will give a child a mental disorder in their adulthood. So go ahead, as far as Iâ&#x20AC;&#x2122;m concerned. I think itâ&#x20AC;&#x2122;s more dangerous to kids to keep giving everyone a ribbon in track and field and refusing to give out zeros on assignments. We have a whole history that shows that an approach thatâ&#x20AC;&#x2122;s a little harsh raises strong, realistic people like our parents and their parents. If you donâ&#x20AC;&#x2122;t do the work, you get a low grade. If you donâ&#x20AC;&#x2122;t win the race, you donâ&#x20AC;&#x2122;t get a first place ribbon. And if a child constantly breaks the rules, maybe a spanking is the answer. â&#x20AC;&#x201C; Tonaya Marr

(67(9$1DFWDPHKD\IHQFHG [DF [DF SDGGRFNV ZHOOGXJRXWZDWHUSLSHWRSDGGRFNEXVWHHOJUDLQ VWRUDJH VKHG VKHOWHU WDFN VKHG WUHHG \DUG VLWH  VT IW   VWRUH\KRPH 2;%2:DFFXOWZHOOVWHHOJUDLQELQVZRUNVKRSPDWXUH WUHHG\DUGVLWHVWRUH\KRPH YDFDQW DFZLWKKRXVHEXLOGLQJV DYDLOVHSDUDWHO\ 2;%2:DFFXOWDYJQHZVFDOHDVVHVVSRZHU ERUGHUVSURSHUW\SULYDWHURDGWKURXJKSURSHUW\PLOHRI6RXULV5LYHU IURQWDJH

winner of our $100 monthly draw for all our carriers. The Estevan Mercury and Southeast Trader Express would like to thank you, Zachary and all our carriers for their hard work and dedication.

)RUDOO\RXUEX\LQJRUVHOOLQJQHHGVFRQWDFW-DVRQ%HXWOHU 3+21(  

/$1(5($/7<&253 6DVNDWFKHZDQ V)DUP 5DQFK6SHFLDOLVWVÂ&#x152; 3+(0$,/ODQHUHDOW\FRUS#VDVNWHOQHW

1RZUHSUHVHQWLQJSXUFKDVHUVIURPDFURVV&DQDGDDQGDURXQGWKHZRUOG

7RYLHZIXOOFRORUIHDWXUHVKHHWVIRUDOORIRXU&855(17/,67,1*6YLVLWRXUZHEVLWHDW

ZZZODQHUHDOW\FRP

Call now to view one of these properties!

912 1st Street, Estevan

830 Albert Street, Estevan

160 Railway Avenue, Glen Ewen

Welcome to this great starter or investment home. The open dining/kitchen concept has a patio door that leads to the recently poured concrete patio. Great for outdoor entertaining or cooking your favourite meals on the BBQ. www.9121ststreet.bhgress.ca

Well kept approx. 998 sq. ft. 3 bdrm home. Many upgrades in the past 10 years including: PVC windows, rear door, garage vinyl siding, shingles, soffits, fascia & eaves, kitchen cabinets. Single 14â&#x20AC;&#x2122;x24â&#x20AC;&#x2122; detached garage and double rear parking. www.830AlbertStreet.bhgress.ca MLS# 428293 $318,000

This 896 approx. sq. ft. 2 bdrm home is in the heart of the oil industry. It is situated on 8 lots totalling 23,000 sq. ft. The three outbuildings include a single 12â&#x20AC;&#x2122; 2â&#x20AC;? x 22â&#x20AC;&#x2122; garage, 32â&#x20AC;&#x2122; 2â&#x20AC;? x 28â&#x20AC;&#x2122; 2â&#x20AC;? shop/shed & a 12â&#x20AC;&#x2122; x 8â&#x20AC;&#x2122; garden shed www.160RailwayAvenue.bhgress.ca MLS# 429320 $109,900

MLS# 432757

$165,000

)(@4,(+6>3(5+05. 7RZQKRXVHVSULFHGIURP (QMR\XSWRIRXUEHGURRPVDQGVTIW RIOLYLQJVSDFHLQWKHVHJRUJHRXVORFDOO\ EXLOWWRZQKRXVHV



2QO\  VTIW

(VWHYDQ6KRSSHUV0DOO

Â&#x2021;Â&#x2021;

ZZZEKJUHVVFD

&RQWDFW -DPLH'\HU  www.jamiedyer.bhgress.ca


Page 6

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Speedway finally gets 2012 season underway Estevan Motor Speedwayâ&#x20AC;&#x2122;s much-belated season opener fi nally went ahead on June 29 after the first four race nights of the year were stymied by rain. The action was worth the wait, as all three classes were full of cars and two of the three features boasted late lead changes. Action at the track continues tomorrow with the McComb Automotive Fast 40, a modified feature which boasts a prize of $3,000 to the winner. Shortly after that, on Tuesday, the Dakota

Classic Modified Tour will make its annual stop in Estevan. During last Fridayâ&#x20AC;&#x2122;s races, Spencer Wilson passed Marlyn Seidler on the second-last lap of the modified feature to earn his first career mod victory. Seidler, who is from Underwood, N.D., led the 24-car field for virtually the entire race until he was overtaken by Wilson and his 75W car. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a little bit of an advantage to start near the back so you can watch where the trackâ&#x20AC;&#x2122;s going and

sneak up on those guys,â&#x20AC;? Wilson said. Wilson said the track conditions for the feature were conducive to a lot of movement. â&#x20AC;&#x153;In the heat race, I was a little bit nervous. It was a pretty heavy track. But it was nice to see that the track kind of slicked off a little bit, not a whole lot, but it made it so a guy can move around on the track and do some passing.â&#x20AC;? Jay Noteboom of Hinton, Iowa, won last yearâ&#x20AC;&#x2122;s tour stop at EMS. In the stock car fea-

ture, Joe Flory of Williston earned victory after pulling off a late comeback of his own. Defending points champion Rocky Alexander led for most of the race after starting on the pole, but Flory got past him late in the race to take the checkered flag. In the hobby feature, Michael Dionne grabbed the lead on the fifth lap and never let it go, despite three cautions after that point. Gary Goudy Sr. led the first four laps before being passed by Dionne.

Here are the top 10 drivers in each class from the race program at Estevan Motor Speedway on June 29:

MODIFIEDS 1. Spencer Wilson, #75W 2. Marlyn Seidler, #7 3. Les McLenehan, #29 4. Tyson Turnbull, #10 5. Joey Galloway, #01 6. Jim Harris, #117 7. John Flory, #19 8. Aaron Turnbull, #21R 9. Tyler Wagner, #77 10. Allen Kent, #33A HOBBY STOCKS 1. Michael Dionne, #55 2. Blaine Durward, #12D 3. Leevi Runge, #25R 4. Rod Pickering, #22 5. Ryan Swenson, #36

6. Chris Dukart, #20 7. Keith Cassidy, #74 8. Cole Bourassa, #77 9. Gary Goudy Sr., #7 10. Gary Goudy Jr., #12 STREET STOCKS 1. Joe Flory, #20 2. Rocky Alexander, #99 3. Gregg Mann, #95 4. Kelly Henderson, #11 5. Robby Rosselli, #0 6. Austin Daae, #17 7. Geoff Mann, #46 8. Gregory Gutt, #620 9. Dalton Flory, #20F 10. Wes Baier, #21B

;OHUR`V\[V

$WKHQD5HVRXUFHV/WG MVYW\YJOHZPUNT`/Z[LLY

Stu Veroba (31) battles with another driver on the backstretch during a modified heat at the season opener at Estevan Motor Speedway on Friday.

*HZZPK`2SH[[ (SHTLKH)LLM /*S\I

+DVDQRSHQLQJLQWKHLU

3URGXFWLRQ'HSDUWPHQW 7KH(VWHYDQ0HUFXU\UHTXLUHVDIXOOWLPH DGEXLOGHULQWKHLUSURGXFWLRQGHSDUWPHQW IRUWZRPDWHUQLW\OHDYHSRVLWLRQV $SSOLFDQWVPXVWEHDEOHWRPXOWLWDVNLQD IDVWSDFHGGHDGOLQHGULYHQHQYLURQPHQW +HVKHPXVWEHDWHDPSOD\HUZLWKDQH\H IRUGHWDLO.QRZOHGJHRI0DF&RPSXWHUVDQG $GREH&UHDWLYH6XLWHLVDQDVVHWEXWZHDUH ZLOOLQJWRWUDLQWKHULJKWDSSOLFDQW 7KHSRVLWLRQLV0RQGD\WR)ULGD\ DPSP2XUFRPSDQ\RIIHUVD KHDOWKEHQHĂ&#x20AC;WSDFNDJH 3OHDVHPDLORUHPDLOUHVXPHWR

0HODQLH7ULELJHU3URGXFWLRQ0DQDJHU SUHSUHVV#HVWHYDQPHUFXU\FD 7KH(VWHYDQ0HUFXU\ %R[ (VWHYDQ6.6$$

6XQGD\$XJXVW 1 12:216$/( 7LFNHWVFDQEHSXUFKDVHGWKURXJK 7LFNHWPDVWHURQOLQHDWKWWSWLFNHWPDVWHUFD RU7LFNHWPDVWHU&KDUJHE\3KRQHDW

(67(9$16.

facebook.com/SpectraPlace

KWWSVSHFWUDSODFHFD twitter.com/SpectraPlace


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Page 7

Parenting tips from a veteran mom Yesterday I found myself looking through some older articles on our website and was happy when I landed on this one. Sometimes you just stumble upon something that acts as a wise reminder when it comes to life and all of its angles. This article is all about parenting tips my friendâ&#x20AC;&#x2122;s mother had written for her (some 18 years ago) before she became a mother. As we enjoy the long days of summer and the warmth it brings, allow yourself time to spend with your children - whatever their age(s). These tips serve as great reminders on how we can build strong, healthy relationships in our homes. Add your own tips and ideas to this list and make it your own. Print it out, post it on your bathroom mirror to remind you everyday to be the best parent you can pos-

sibly be. Our kids need us to dig deep and build them up. They deserve it. Take what you will and build your home and without you knowing, you will be creating a haven for your children and others to run toward. Happy parenting, all. Parenting tips from a wise mother 1. Tell them at least once a day how much they are loved. 2. Talk about God daily ... look at scenery, sunsets, etc., thanking God. 3. Encourage a grateful heart. 4. Refrain from criticism. 5. Listen to them. 6. Read to them as much as possible. Lead by example ... switch off the TV or computer and read. 7. Praise good behaviour. 8. Instil confidence in

Susan Sohn Welcome to Real Life them by assuring them they can do it. 9. Teach them itâ&#x20AC;&#x2122;s OK to say no. 10. Remind them they donâ&#x20AC;&#x2122;t have to have everything advertised on TV. 11. Encourage them to be an individual. 12. Everybody may be doing it ... they are not â&#x20AC;&#x153;everybody.â&#x20AC;? 13. Take pride in their appearance ... present them well. 14. Eat together at the table thereby encouraging communication. 15. Forbid labelling

others ... e.g. stupid, fat, etc. 16. Punish labelling by loss of privileges. 17. Allow them to build cubby houses inside, no matter the mess. 18. Discourage â&#x20AC;&#x153;sheepâ&#x20AC;? mentality ... have an opinion. 19. Encourage creative play. 20. Treat them with respect. 21. Value their health and feed them homemade nourishing meals. 22. Write letters to them ... post them in the house, place them on their

pillows, etc. 23. Encourage independence from an early age by allowing them to dress themselves and giving them chores. 24. Tell them how they came to be ... they love stories about themselves. 25. Lie on the bed at night with them and just let them talk. 26. Allow them to help. 27. Saturday mornings, let them all pile into your bed. 28. Give them breakfast in bed as a treat. 29. Distinguish between childish irresponsibility and sheer naughtiness. 30. Set boundaries and keep them ... they need it. 31. Separate the act from the child ... e.g. â&#x20AC;&#x153;That was a silly thing you didâ&#x20AC;? rather than â&#x20AC;&#x153;you are silly.â&#x20AC;? 32. Donâ&#x20AC;&#x2122;t argue in front of them.

33. Show affection to your spouse in front of them ... this increases their security. 34. Spend time with them ... walks, bike rides, playing hide-and-seek, throw a ball, etc. 35. Teach them to look you in the eye when they are talking. 36. Try to spend independent time with each child. 37. Teach your boys how to treat a woman. 38. Teach them the importance of good manners. 39. Teach them compassion and to care for others. 40. Donâ&#x20AC;&#x2122;t take sides in an argument with children ... unless necessary. 41. Love them, love them, love them! Susan J Sohn getreallive.com

New Orleans Bread Pudding

2 (4-serving) packages sugar-free vanilla cook-andserve pudding mix 4 cups skim milk 1 teaspoon coconut extract 1/2 teaspoon ground nutmeg 8 slices reduced-calorie French or white bread, torn

into pieces 1/2 cup raisins 2 tablespoons flaked coconut 2 tablespoons chopped pecans 1 teaspoon rum extract 2 teaspoons reducedcalorie margarine 1. Preheat oven to 360 F. Spray an 8-by-8-inch baking dish with butter-flavored cooking spray. 2. In a large skillet, combine 1 package dry pudding mix and 2 1/2 cups skim milk. Cook over medium heat until

mixture starts to boil, stirring constantly with a wire whisk. Remove from heat. Stir in coconut extract and nutmeg. Add bread pieces, raisins, coconut and pecans. Mix gently to combine. 3. Pour mixture into prepared baking dish. Bake for 30 to 35 minutes. Place baking dish on a wire rack while preparing sauce. 4. In a medium saucepan, combine remaining package of dry pudding mix and remaining 1 1/2 cups skim milk. Cook over medium heat until mixture thickens and starts to boil, stirring constantly with a wire whisk. Remove from heat. Stir in rum extract and margarine. 5. Cut bread pudding into 6 pieces. For each serv-

ing, place a serving of bread pudding on a dessert plate and spoon about 1/4 cup warm rum sauce over top. â&#x20AC;˘ Each serving equals: 211 calories, 3g fat, 10g protein, 36g carb., 652mg sodium, 1g fiber; Diabetic Exchanges: 1 Starch, 1 Skim Milk, 1 Fruit, 1/2 Fat. (c) 2012 King Features Synd., Inc.

Need to sell something?? Classifieds will get it done! Call Today to Book â&#x20AC;˘ 634-2654

Bridal Guide 2012

(VWHYDQ6KRSSHUV0DOO Â&#x2021;Â&#x2021;

ZZZEKJUHVVFD

$PDQGD/HZLV .HDJDQ&ROHPDQ -XO\ 0HODQLH+DOERUJ 7RGG%UDQGRZ -XO\ 0HJDQ9DQ'H:RHVW\QH -D\9DQVWRQH -XO\ 0D\UD&*RQ]DOH] $QLEDO%UDYR -XO\ 0DUOHQH7D\ORU 7RGG$GDPV -XO\ -HVVLH(OLDV $QGUHZ6PROLDN -XO\ -DLPH&URVVOH\ 6SHQFHU/DORQGH -XO\ $PDQGD+HQWRQ 'XVWLQ0DFN $XJXVW -DQHOOH'DDH 7ULVWDQ0DFN $XJXVW $VKOH\)RUUHVWHU 'DQLDO%D\OLVV $XJXVW 5DFKHOOH.LFNOH\ &UDLJ&DLVVLH $XJXVW 6DUDK0RQWH\QH .RU\&OHDUZDWHU $XJXVW .DWHO\Q+HUVFKH 0LNH%HQGHU $XJXVW $PDQGD/LQGHQEDFK $GDP/RMHZVNL $XJXVW &KDQQ\+RXVH $DURQ0DFN 6HSWHPEHU -HQQD+HLGLQJHU .\OH/XF 6HSWHPEHU $PDQGD/XKU &KDG0XQUR 6HSWHPEHU 7UDFH\'RQDLV -HII:DUG 6HSWHPEHU 7UDF\7\WODQGVYLN 5REHUW%ORZDWW 6HSWHPEHU &KULVWLQD'RUZDUG -HUHP\6WURQJ 6HSWHPEHU /DFH\*LOO 6FRWW6\NHV 6HSWHPEHU -DPLH&DPSEHOO .HYLQ0F&XUG\ 6HSWHPEHU 'DUF\3LHUVRQ (ULF/RUDQJH 6HSWHPEHU $GULHQQH'DZVRQ %UDG'L[RQ 6HSWHPEHU $PEHU)OHFN -DVRQ.XFKLQND 1RYHPEHU 6KHODJK%DQJVXQG $DURQ(VNUD 'HFHPEHU

&$7(5,1* )URPODUJHZHGGLQJVWRVPDOOHULQWLPDWHDIIDLUV (%¡V'LQLQJ(PSRULXP /HWXVORRNDIWHUWKHFDWHULQJ FDQPDNH\RXU6SHFLDO(YHQWD 'D\WR5HPHPEHU )URPODUJHZHGGLQJVWRVPDOOHU LQWLPDWHDIIDLUV /HWXVORRNDIWHUWKHFDWHULQJ 6RXULV$YH (VWHYDQ

 )$6+,21 &RWHDX$YH( :H\EXUQ6. 3K

Â&#x2021;%HDXWLIXOJRZQVIRUWKHJUDGXDWH Â&#x2021;)DQF\DWWLUH0RWKHURI%ULGH Â&#x2021;-HZHOOHU\7LDUDV $OZD\V7KDW3HUVRQDOL]HG6HUYLFH $SSRLQWPHQWVPD\EHPDGH

&DOO WR $QQRXQFH <RXU 8SFRPLQJ :HGGLQJ )RU )UHH


Page 8

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

MP Oda resigns, spending habits questioned National OTTAWA - Embattled International Co-operation Minister Bev Oda is stepping down as an MP at the end of this month, just as speculation heats up about a shake-up in the cabinet ranks. Odaâ&#x20AC;&#x2122;s spending habits had become national watercooler talk earlier this year, when it was revealed she had rejected one five-star hotel in London for another swankier establishment at more than double the cost. She had also hired a luxury car and driver for an average of $1,000 per day. Details of her expenses were released to The Canadian Press under the Access to Information Act. Oda repaid the difference in rooms, the limo service, and the cost of a $16 glass of orange juice during an intense week of criticism in the House of Commons and in the public sphere. But it was not the first time she had reimbursed the public purse for spending, and the talk around Ottawa was that her days in cabinet were numbered. In a statement on Tuesday, Oda said it had been a privilege to have served the constituents in the riding of Durham. She did not say why she was resigning, and her office said was not available for comment. *** MONTREAL - An Albertan man attempting to run across Canada for charity was arrested in Quebec for taking his journey along

the shoulder of the busy Trans-Canada Highway. Curtis Hargrove faces a charge of obstructing justice after he refused a police officerâ&#x20AC;&#x2122;s demand Monday that he get off the autoroute near St-Jean-Port-Joli, about 120 kilometres northeast of Quebec City. Hargrove didnâ&#x20AC;&#x2122;t understand why he was asked to leave the roadside, particularly since he said other Quebec police patrollers had stopped to talk to him the day before without a hint of a warning. Right before his arrest, he told police he would keep running regardless. â&#x20AC;&#x2DC;â&#x20AC;&#x2122;They said, â&#x20AC;&#x2DC;Well, unfortunately weâ&#x20AC;&#x2122;ll have to arrest you,â&#x20AC;&#x2122; â&#x20AC;&#x153; said Hargrove, whoâ&#x20AC;&#x2122;s raising money for a childrenâ&#x20AC;&#x2122;s hospital in Edmonton. â&#x20AC;&#x153;I kinda was being stubborn to kinda prove a point that I am doing something for charity.â&#x20AC;? The 23-year-old, who has been running about 50 kilometres a day since he left Newfoundland in early May, slipped out of his reflective vest and took off his iPod before police drove him to a station in Quebec City. Hargrove was handed a Sept. 21 court date and released a few hours later after signing a written promise not to run on the Trans-Canada in Quebec. The runner â&#x20AC;&#x2122;s route through the rest of the province has since been redrawn to follow a secondary highway parallel to the

Trans-Canada. His goal is to raise $1 million for the Stollery Childrenâ&#x20AC;&#x2122;s Hospital Foundation and he has so far collected $14,000 during a run he expects to complete in the fall. *** TORONTO - A Canadian woman kidnapped in Kenya says it was five minutes of shock as gunmen seized her and three other aid workers from a refugee camp. After that, Qurat-UlAin Sadazai, of Gatineau, Que., says they were driven off then marched by night some 70 kilometres into Somalia. Speaking from Nairobi, Sadazai, 38, says she believes the kidnapping was motivated by money rather than ideology. The four were rescued Monday after three days in Somalia, when Kenyan authorities swooped down on the group, killing one kidnapper. Also kidnapped and rescued were Steven Dennis, 37, of Toronto, Astrid Sehl, 33, of Norway, and Glenn Costes, 40, a Filipino, who was shot and injured during the initial kidnapping.

International RALEIGH, N.C. President Barack Obama says he is saddened to hear that Andy Griffith has died at age 86 and called the actor an extraordinary talent. Obama said in a statement Tuesday that Griffith was beloved by generations and revered by entertainers. Obama was one of many people to speak fondly of Griffithâ&#x20AC;&#x2122;s career. Griffith was most famous for his character Sheriff Andy Taylor from â&#x20AC;&#x153;The Andy Griffith Show.â&#x20AC;? Ron Howard played Sheriff Taylorâ&#x20AC;&#x2122;s son, Opie, on the show. Howard says Griffith was inspiring to grow up around and the show was an amazing environment. Don Knotts was the goofy Deputy Barney Fife. Knottsâ&#x20AC;&#x2122; widow, Francey Yarborough Knotts, says Griffith was in good spirits when she spoke with him June 1, his birthday. Knotts died in 2006 at age 81. *** GENEVA - Police say five foreign climbers have died in a mountain accident in Switzerland near the Ital-

is Served h c n u r B

LEASE TRACKER OIL FIELD GPS NAVIGATION Now Available for iPhone & Android

$14.99 one time fee LSD - Manitoba, Sasktchewan, Alberta & BC

Map Tech Inc.

403-804-6630

Sunday Brunch 10-2

634-3534 â&#x20AC;˘ Downtown Estevan

ian border. Police in the southern Valais region of Switzerland said the mountaineers successfully reached the 4,010-meter (13,155-foot) high Lagginhorn summit on Tuesday but plunged more than several hundred meters (yards) to their deaths after beginning to descend. A sixth member of the group who had stopped before reaching the summit immediately alerted rescue authorities, but the five climbers died on the spot. Police had no immediate information on the cause of the accident. Details on the victimsâ&#x20AC;&#x2122; identities and their nationalities were not immediately available. Prosecutors opened an investigation. *** BERLIN - A gunman in southern Germany took hostages and fired shots, possibly killing one person, when court bailiffs sought to remove him from his apartment Wednesday morning in a dispute over rent, police said. Karlsruhe police spokesman Juergen Scheufer said two bailiffs went to the manâ&#x20AC;&#x2122;s apartment building at about 9 a.m. to eject him for failing to pay his rent, and then multiple shots were filed.

Scheufer said there have been reports of one person killed and several taken hostage, but it was not possible to confirm them at this point. â&#x20AC;&#x153;We have heard there could be one dead but we canâ&#x20AC;&#x2122;t confirm that because we havenâ&#x20AC;&#x2122;t had any contact with the hostage taker,â&#x20AC;? Scheufer said in a telephone interview. *** PORT ANGELES, Wash. - Several reports of aggressive mountain goats have prompted Olympic National Forest officials to close a popular trail on Mount Ellinor for at least two weeks. The emergency closure affects both the upper and lower portions of Mount Ellinor Trail No. 812, KINGTV reported. Stephanie Neil, recreation manager for the forestâ&#x20AC;&#x2122;s Hood Canal Ranger District, told the Peninsula Daily News that in the last two weeks rangers have received a number of reports of goats coming within 10 feet of hikers. â&#x20AC;&#x153;Nobody has been hurt by the goats,â&#x20AC;? she said. â&#x20AC;&#x153;But a number of people have felt threatened.â&#x20AC;? Forest rangers will reevaluate the closure in about two weeks, Neil said.

6XQ&RXQWU\+HDOWK5HJLRQ UHJUHWIXOO\DQQRXQFHV WKHWHPSRUDU\VXVSHQVLRQ RIHPHUJHQF\GHSDUWPHQWVHUYLFHV DW*DOORZD\+HDOWK&HQWUH2[ERZ IURPDP0RQGD\-XO\ WR DP0RQGD\-XO\ ,I\RXUFRQGLWLRQLVXUJHQW SOHDVHFDOOIRU$PEXODQFH6HUYLFHV +HDOWKOLQHLVDOVRDYDLODEOHDWDQG 77<RU RQWKHZHEDWZZZKHDOWKOLQHRQOLQHFD (PHUJHQF\'HSDUWPHQW6HUYLFHV DUHDYDLODEOHDWWKHVHORFDWLRQV 6W-RVHSKŇ&#x2039;V+RVSLWDO²(VWHYDQ $UFROD+HDOWK&HQWUH :H\EXUQ*HQHUDO+RVSLWDO

2 - bedrooms Large Deck 1 - bath Septic Tank 1120 Square Cistern Feet Fully Furnished

YEAR ROUND LIVING- MOVE IN READY!

306-848-1000


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

5),<RX 4773

Rookie coach has perfect start That was one nice birthday present for Carter Chamblin. While the infant son of Saskatchewan Roughriders head coach Corey Chamblin was celebrating his first birthday back home in Regina, his father was getting splashed with a Gatorade shower in Hamilton after winning his CFL coaching debut against the Tiger-Cats. Actually it was just before he won his coaching debut, which is worth pointing out. Rider running back Brandon West, and a few of his teammates, doused Chamblin with the cooler while 54 seconds still remained in the Ridersâ&#x20AC;&#x2122; season-opening 43-16 blowout over the Ticats Friday night. Chamblin smiled, but was seen pointing at the score clock while swatting ice cubes off his shirt in the sweltering southern Ontario heat. â&#x20AC;&#x153;I told them â&#x20AC;&#x2DC;Letâ&#x20AC;&#x2122;s finish!â&#x20AC;&#x2122;â&#x20AC;? Chamblin said after the game, which gives you some idea of his style. The game is to be played full out for 60 minutes, no shortcuts. And letâ&#x20AC;&#x2122;s be honest. There isnâ&#x20AC;&#x2122;t a soul out there who believed the Roughriders would go into Ivor Wynne Stadium and thoroughly dominate the Ticats like they did last week. Not even Chamblin who was confident in his troops going in but admitted â&#x20AC;&#x153;I thought it would he close going into the fourth quarter.â&#x20AC;? It wasnâ&#x20AC;&#x2122;t. The Riders opened a 7-0 lead 10 minutes into the game on the first of three Weston Dressler touchdown passes from Darian Durant and they never relinquished the lead the rest of the game. They led 7-3, 16-13 and 33-16 by quarter on the way to a nearly four touchdown

his hand on the yellow hanky. Then one play after that, Durant threw a 29yard touchdown to Chris Getzlaf. What does this mean? It means this Chamblin coaching staff is â&#x20AC;&#x153;with itâ&#x20AC;?, itâ&#x20AC;&#x2122;s sharp, and along with the players, theyâ&#x20AC;&#x2122;re all singing from the same hymn book, to coin a phrase. Weâ&#x20AC;&#x2122;ve discussed the many similarities between Chamblin and Rider legend Kent Austin, but as each day goes by, it becomes spooky how their methods parallel one another. Each has taken criticism for their â&#x20AC;&#x153;my way or the highway approach,â&#x20AC;? but their results speak for themselves. As for last Friday evening in Hamilton, it was a pretty good night for the Chamblin boys.

Rod Pedersen Rider Insider blowout win. And hereâ&#x20AC;&#x2122;s where you get some â&#x20AC;&#x153;Rider Insiderâ&#x20AC;? stuff. Perhaps the biggest turning point in the game came midway through the second quarter with the Riders leading by a point. Durant hooked up with a 52-yard pass to Dressler which replays clearly showed wasnâ&#x20AC;&#x2122;t a completion. But the Rider offence raced down the field with quarterbacks coach Khari Jones screaming in the headset â&#x20AC;&#x153;Get on the ball! Get on the ball!â&#x20AC;? They got the next play off before the Ticats could challenge even though Hamilton coach George Cortez had

In the business of buying or selling a home?

*2:,7+ *21$6

Page 9

7KH)LUVWUXOHRIDGYHUWLVLQJLVFDWFKLQJWKHLUH\H7KH6HFRQGLV VXVWDLQHGUHSHDWHGDGYHUWLVLQJ$GYHUWLVLQJ'RHVQ W&RVWLW3D\V

Shop Local All Summer Long! Enter at local participating businesses to

Win

A Grand Prize worth $Hundreds$ in Gift CertiďŹ cates!

/RRNIRUGHWDLOVLQWKH DQGWKH

6287+($6775$'(5

(;35(66

&RQWHVWHQGV0RQGD\$XJXVWWK

3XEOLFDWLRQ'DWH)ULGD\-XO\ 'HDGOLQH7KXUVGD\-XO\

2YHUGLVWULEXWLRQ 'LVWULEXWLRQWDUJHWLQJWKHRLOLQGXVWU\LQ 6DVNDWFKHZDQ0DQLWREDDQG$OEHUWD

421-9884 Lori Gonas $XJXVW,VVXH(GLWRULDO)RFXVLV

"SUPPLY STORES" 'HDGOLQHWRDGYHUWLVH-XO\ 12071MM02

Creative Marketing Ideas That Get Results

Speak with one of our advertising specialists today to find out how to make the most important impact on your customers

Cindy Beaulieu

Deanna Tarnes

Candace Wheeler

Teresa Hrywkiw

Kristen Oâ&#x20AC;&#x2122;Handley

3KRQH (PDLODGVDOHV#HVWHYDQPHUFXU\FD


Page 10

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

New stars sprinkled through All-Star game Casual baseball fans may be in for a surprise when they study the rosters of the American and National League teams for the mid-season classic, this year scheduled for July 10 at Kansas City. Oh, the usual, familiar names will be around - Josh Hamilton, Jose Bautista, Derek Jeter - thanks to fan voting, which is weighted heavily on popularity and name familiarity rather than merit. So when names like Trout, Trumbo, McCutcheon and Castro show up, donâ&#x20AC;&#x2122;t be surprised. There is a constant changing of the guard in the majors and this year is no different. So who is Trout? Heâ&#x20AC;&#x2122;s Mike, a great hitter with the Los Angeles Angels, whose offensive exploits this year were partially overshadowed by the non-hitting woes ofAl-

bert Pujols, the $256 million free-agent signee who barely hit his weight through the first two months of the season. Trout played 20 games in AAA Salt Lake City and batted .403 before being called up to the bigs. In his first 50 games, he had seven homers and a batting average of .344. Trumbo is Troutâ&#x20AC;&#x2122;s teammate, Mark. Remember the M and M Boys of the Yankees in the 1960s (Mantle and Maris)? This Angels T and T duo (TNT is the obvious nickname for the pair) might be just as explosive. A second-year thirdbaseman, Trumbo belted 18 homers in his first 65 games this season and had a slugging per cent of .610, trailing only Hamilton and â&#x20AC;&#x153;Big Papiâ&#x20AC;? David Ortiz in that category. McCutcheon isAndrew, of the Pittsburgh Pirates, who havenâ&#x20AC;&#x2122;t had a winning record since 1991. A centrefielder

Bruce Penton Sports Columnist and the epitome of a five-tool player (hits for average, for power, has speed, a strong arm and great fielder), McCutcheonâ&#x20AC;&#x2122;s name surfaces when fans start talking about the best player in the game today. And the Pirates? Theyâ&#x20AC;&#x2122;re over .500, thanks in large part to McCutcheonâ&#x20AC;&#x2122;s heroics. Castro? Heâ&#x20AC;&#x2122;s Starlin Castro of the Cubs and heâ&#x20AC;&#x2122;s a slick-fielding shortstop who plays for a lousy team. Somebody has to represent the Cubs in the Midsummer Classic, so heâ&#x20AC;&#x2122;s likely to be their representative.

I \ 6DIHW\ (QYLURQPHQWDO6HUYLFHV $OO FRXUVHV EHJLQ DW DP XQOHVVRWKHUZLVHQRWHG

12:$9$,/$%/( )LUHĂ&#x20AC;JKWLQJ7UDLQLQJ :LOOWUDLQDW\RXUORFDWLRQE\DSSRLQWPHQW

367,537UDLQLQJ

3UHUHJLVWUDWLRQ LV UHTXLUHG IRU DOO FRXUVHV &DQFHOODWLRQ QRWLFH LV UHTXLUHG  +UVLQDGYDQFH$OOQRVKRZVZLOOEH ELOOHGIRUWKHIXOOFRVWRIWKHFRXUVH

$YDLODEOHE\DSSRLQWPHQW

3LSHOLQH&RQVWUXFWLRQ $YDLODEOHE\DSSRLQWPHQW

-XO\

Tune in to the all-star game broadcast and youâ&#x20AC;&#x2122;ll certainly see the familiar names. It wonâ&#x20AC;&#x2122;t take long for the newcomers to become household names, too. â&#x20AC;˘ Janice Hough of leftcoastsportsbabe.com: â&#x20AC;&#x153;Ryan Leaf said at his sentencing, â&#x20AC;&#x2DC;Iâ&#x20AC;&#x2122;m lazy, selfish and dishonest.â&#x20AC;&#x2122;Was he talking about why he should be sent to prison, or announcing a future run for Congress?â&#x20AC;? â&#x20AC;˘ Greg Cote of the Miami Herald: â&#x20AC;&#x153;Major league umpires are now wearing military-style cooling packs under their heavy gear to combat the heat. Fans responded by saying theyâ&#x20AC;&#x2122;d prefer the umpires suffer.â&#x20AC;? â&#x20AC;˘Another one from Cote: â&#x20AC;&#x153;The Panthers picked 23rd in the NHL Draft, which is generally considered to be the largest gathering of white teenagers outside of an Eminem concert.â&#x20AC;? â&#x20AC;˘ Steve Simmons of Sunmedia, on Twitter: â&#x20AC;&#x153;First reason to worry about Leaf

draft pick Matt Finn: His favourite player growing up was Bryan McCabe.â&#x20AC;? â&#x20AC;˘ Twitter:@Dave_ Stubbs â&#x20AC;&#x153;With a $687,500 contract, #Habs Ryan White will only have $687,500 left after budgeting for his haircuts.â&#x20AC;? â&#x20AC;˘ R.J. Currie of sportsdeke.com: â&#x20AC;&#x153;White Sox slugger Adam Dunn is on pace for 260 strikeouts in one season. Which would beat the old record of striking out 223 times, set when I was dating.â&#x20AC;? â&#x20AC;˘ Currie again: â&#x20AC;&#x153;Word out of Winnipeg is the Bombersâ&#x20AC;&#x2122; new stadium wonâ&#x20AC;&#x2122;t be completed this season. Same goes for most of Buck Pierceâ&#x20AC;&#x2122;s passes.â&#x20AC;? â&#x20AC;˘ TNTâ&#x20AC;&#x2122;s Charles Barkley, explaining all the antiLeBron James sentiment: â&#x20AC;&#x153;Everybody hates the homecoming queen because sheâ&#x20AC;&#x2122;s pretty. All the ugly girls hate the homecoming queen. And all the dumb kids hate the smart kids. Thatâ&#x20AC;&#x2122;s just the way it is.â&#x20AC;? â&#x20AC;˘ English track coach Charles van Commenee, not worried about teen sprinter Adam Gemili competing in the Olympics: â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s not like I am sending my 12-year-old niece to fight al-Qaida.â&#x20AC;? â&#x20AC;˘ Another one from Currie: â&#x20AC;&#x153;The Toronto Blue Jays pitching in brief: Righthanded, left-handed and

short-handed.â&#x20AC;? â&#x20AC;˘ Ex-closer Eddie Guardado, when told in 2008 that the Twins had traded him for Rangers pitching prospect Mark Hamburger: â&#x20AC;&#x153;What? I was traded for a hamburger?â&#x20AC;? â&#x20AC;˘ Brad Dickson of the Omaha (Neb.) World-Herald, on college footballâ&#x20AC;&#x2122;s proposed four-team playoff: â&#x20AC;&#x153;Details still have to be worked out, including how to make sure that Boise State finishes fifth every year.â&#x20AC;? â&#x20AC;˘ Comedy writer Alex Kaseberg: â&#x20AC;&#x153;At the Olympic Trials, Ashton Eaton set a world record in the Decathlon, 9039 points, despite competing in a torrential downpour. But in the London Olympics he could face harsher conditions; a torrential downpour, bad food and virtually no dental care.â&#x20AC;? â&#x20AC;˘ Rick Ball, B.C. Lions radio broadcaster, when smoke obscured the uprights in Edmonton during a pointafter attempt: â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s like the back of Cheech and Chongâ&#x20AC;&#x2122;s van.â&#x20AC;? â&#x20AC;˘ Ben Burnett: â&#x20AC;&#x153;Toronto signed 49-year-old left-hander Jamie Moyer to a minor league contract, according to a report on the teamâ&#x20AC;&#x2122;s website. â&#x20AC;&#x153;His fastball sounds great if you convert to metric.â&#x20AC;? Care to comment? Email brucepenton2003@ yahoo.ca

6XQ0RQ7XH:HG7KX)UL6DW 



 &RQILQHG6SDFH /DPSPDQ

 )DOO3URWHFWLRQ /DPSPDQ

 +6 /DPSPDQ









 )LUVWDLGFSUDHG /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ&RQWÂś

 )ODJ7UDLQLQJ /DPSPDQ









 +6 /DPSPDQ

 &RQILQHG6SDFH /DPSPDQ

 *OREDO*URXQG 'LVWXUEDQFH /DPSPDQ









 )LUVWDLGFSUDHG /DPSPDQ 

$XJXVW  )LUVWDLGFSUDHG /DPSPDQ&RQWÂś







$XJXVW 6XQ0RQ7XH:HG7KX)UL6DW 



-XO\ )LUVWDLGFSUDHG /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ&RQWÂś

 &RQILQHG6SDFH /DPSPDQ







 67$7+2/,'$<

 

 )DOO3URWHFWLRQ /DPSPDQ











 +6 /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ

  )LUVWDLGFSUDHG /DPSPDQ&RQWÂś  *URXQG'LVWXUEDQFH /DPSPDQ







 5LJJLQJ +RLVWLQJ /DPSPDQ

 &RQILQHG6SDFH /DPSPDQ

 )LUH([WLQJXLVKHU /DPSPDQ









 +6 /DPSPDQ

 )DOO3URWHFWLRQ /DPSPDQ







7R5HJLVWHU&DOO7ULFLD# (PDLOWVWLQVRQ#Ă LQWHQHUJ\FRP

:HDUHRIIHULQJDYDULHW\RIVDIHW\FRXUVHV LQFOXGLQJ+6$OLYH(QIRUP:+0,67'* )LUVW$LGDQG&35&RQĂ&#x20AC;QHG6SDFHDQGPXFK PRUH *OREDO*URXQG'LVWXUEDQFH *HQHUDO2LOĂ&#x20AC;HOG'ULYHU,PSURYHPHQW *2', (QIRUP %DE\VLWWLQJ&RXUVHV :HDVVLVWLQ&256(&25DXGLWV,61HWZRUOGDQG&RPSO\ZRUNV

)RUIXUWKHULQIRUPDWLRQRUWRERRNFRXUVHVFRQWDFW 7UDFH\DW  RUWUDFH\#Ă \LQHFRP


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Page 11

Wild NHL signings in Minnesota National James Hinchcliffe once spent three hours waiting for the chance to meet his hero. When Greg Moore finally emerged to speak to the 12-year-old outside his team truck, Hinchcliffe was too awe struck to say much during what ultimately turned into a life-changing chat for the aspiring driver. â&#x20AC;&#x153;I barely could spit out any words, my sister had to ask most of the questions because I was just staring up at this guy like he was God,â&#x20AC;? Hinchcliffe said. â&#x20AC;&#x153;It changed my life, to this very day. He influenced the design of my helmet, heâ&#x20AC;&#x2122;s why I wear red gloves, heâ&#x20AC;&#x2122;s who I model myself after â&#x20AC;&#x201D; and it only took 10 minutes for him to make that impression on me.â&#x20AC;? Canadian drivers are revered at home, and Moore was quickly moving up through the ranks when he met a young Hinchcliffe at the 1999 race in Toronto. Moore died about four months later in an accident at the season-ending race in California. He was 24. The pressure is even more intense this week since Hinchcliffe is return-

ing home to race Sunday in Toronto. He arrives with some serious buzz: This second season of IndyCar has been a breakthrough for Hinchcliffe, who joined Andretti Autosport this year as Danica Patrickâ&#x20AC;&#x2122;s replacement, and heâ&#x20AC;&#x2122;s combined on-track success with strong marketing to become the seriesâ&#x20AC;&#x2122; newest star. Four-time series champion Dario Franchitti remembers the pressure on good friend Moore whenever the series raced in Canada. â&#x20AC;&#x153;I think the guys in the Canadian press and the Canadian fans, they want a home win and they are going to put a lot of pressure on James to deliver that,â&#x20AC;? Franchitti said. â&#x20AC;&#x153;I think if James can put that out of his head and get on with it, heâ&#x20AC;&#x2122;ll be just fine.â&#x20AC;? But, Franchitti said, itâ&#x20AC;&#x2122;s up to Hinchcliffe alone to manage the pressure and not let it interfere with his performance or his approach to Sunday. He has been impressed with Hinchcliffeâ&#x20AC;&#x2122;s performance so far this season, and sees many similarities between Hinchcliffe and Moore. â&#x20AC;&#x153;One thing Iâ&#x20AC;&#x2122;ve learned about James, I

think heâ&#x20AC;&#x2122;s very smart and heâ&#x20AC;&#x2122;ll treat it like any other race,â&#x20AC;? Franchitti said. â&#x20AC;&#x153;Obviously the next big break for James is winning an IndyCar race. Heâ&#x20AC;&#x2122;s been very consistent and done a hell of a job, and I think as long as he treats this race like any other week, heâ&#x20AC;&#x2122;ll be just fine. Hinchcliffe is still looking for his first IndyCar win, but team owner Michael Andretti believes it is coming soon. *** LONDON, Ont. Brett MacLean of the Phoenix Coyotes has been admitted to hospital after suffering a cardiac emergency. The team issued a statement on Tuesday saying the 23-year-old winger has been admitted to hospital in London, Ont., after suffering a medical emergency while playing hockey Monday night in Owen Sound, Ont. The Coyotes said MacLean received CPR on site before being taken by ambulance to hospital in Owen Sound. He was then taken by air ambulance to London, where he was admitted to the cardiac intensive care unit.

)RU6DOH 7UDLOHUVDOHVFRPSDQ\ZLWKDSSUR[LPDWHO\PLOOLRQ GROODUVSHU\HDULQVDOHV/RFDWHGLQWKHSURVSHURXV RLOULFK6(FRUQHURI6DVNDWFKHZDQ6HOOLQJWKHZHOO PDGHZHOOUHVSHFWHGKHDY\GXW\OLQHRI3-7UDLOHUV LQFOXGLQJXWLOLW\GXPSFDUKDXOHUHTXLSPHQWWLOW GHFNRYHUĂ DWGHFNDQGJRRVHQHFNWUDLOHUV%DFNKRH IRUXQORDGLQJWUDLOHUVLQFOXGHG:HDOVRKDYHWKHKLJK HQGDOODOXPLQXPIUDPH/LJKWQLQJHQFORVHGFDUJR WUDLOHUV0DQ\UHSHDWDQGZHOOHVWDEOLVKHGFXVWRPHUV /RWVRIRSSRUWXQLW\WRH[SDQGDQGJRLQWRRWKHUOLQHV RIVDOHV:LOOVHOOIRU WLPHVQHWLQFRPHSOXV LQYHQWRU\DQGSDUWVDW FRVW6DOHVDQGSURĂ&#x20AC;WV KDYHLQFUHDVHG VXEVWDQWLDOO\HDFK\HDU 5HDVRQIRUVHOOLQJ 5HWLULQJ

&DOO/HRQDUGDW IRU PRUHGHWDLOV

7.7UDLOHU6DOHV

0DQRU6DVN3K ZZZSMWUDLOHUVFRP

â&#x20AC;&#x153;Our thoughts and prayers are with Brett and his family,â&#x20AC;? Phoenix general manager Don Maloney said in a statement. â&#x20AC;&#x153;We request that everyone please respect their privacy at this time. We will provide an update on Brettâ&#x20AC;&#x2122;s status when information is available.â&#x20AC;? MacLean played most of last season with the Portland Pirates, the Coyotesâ&#x20AC;&#x2122; American Hockey League affiliate, where the London native had 25 goals and 23 assists in 63 games. *** CALGARY - A University of Calgary study measuring heart rates and electrical activity could eventually reduce deaths of chuckwagon horses. Lead researcher Renaud Leguillette says the study uses electrocardiogram (EKG) equipment to monitor horses before, during and after their morning exercise. It will continue with selected horses competing in evening chuckwagon races at the Calgary Stampede. Leguillette says there have been several cases over the years where horses have died from heart attacks after competing. Leguillette says he has studied horses at other chuckwagon races and says the animals are ex-

tremely fit and their stress levels remarkably low. International ST. PAUL PARK, Minn. - The Minnesota Wild have made the biggest splash in NHL free agency, signing coveted free agents Ryan Suter and Zach Parise to 13-year deals. The Wild confirmed the signings on its website Wednesday. Parise had 31 goals and 38 assists in 82 games for the New Jersey Devils last season, where he was the teamâ&#x20AC;&#x2122;s captain. Suter had seven goals and 39 assists in 79 games with the Nashville Predators last season and represented the team at the all-star game in Ottawa. â&#x20AC;&#x153;This is a great day in the history of the Minnesota Wild,â&#x20AC;? said general manager Chuck Fletcher. â&#x20AC;&#x153;We are extremely excited to add the collective skill, experience and character of Zach Parise and Ryan Suter to an already promising roster.â&#x20AC;? *** WIMBLEDON, England - Roger Federer earned a record 33rd Grand Slam semifinal berth and moved closer to a recordtying seventh Wimbledon title when he beat Mikhail Youzhny 6-1, 6-2, 6-2 Wednesday.

Federer had been tied with Jimmy Connors for the most major semifinals. He reached the final four at Wimbledon for the first time since 2009, when he won the title. Federer showed no sign of the back ailment that prompted him to seek treatment during the first set of his previous match. In the second game he converted his fifth breakpoint chance, and he pulled away from there. A brief rain delay couldnâ&#x20AC;&#x2122;t slow Federer, and neither could the No. 26-seeded Youzhny, who seemed pleased at times just to win a point. *** LONDON - Formula One test driver Maria de Villota has lost her right eye after a crash in testing for the Marussia team. Marussia says on We d n e s d a y t h a t t h e 32-year-old Spaniard is in a critical but stable condition in a hospital after the accident at an English airfield on Tuesday morning. She is the sportâ&#x20AC;&#x2122;s first full-time female driver since Italyâ&#x20AC;&#x2122;s Giovanna Amati with the Brabham team in 1992. Marussia Team Principal John Booth says â&#x20AC;&#x153;with regard to the accident, we have embarked on a very comprehensive analysis of what happened.â&#x20AC;?

Prairie Toons Orchard Saskatoon berries are Canadaâ&#x20AC;&#x2122;s #1 for antioxidants! Come see us for U-Pick or We-Pick Fresh or Frozen! Orchard open Saturday July 7th Hwy #18 East of Bienfait â&#x20AC;˘ Watch for our signs





*LEVRQ:HOGLQJ/WG

1HZ WRQ 1HZDQG DQGXVHG XVHG EDUUHO EDUUHOWDQNV WDQNVIRU IRUVDOH VDOH  WRQ SLFNHUDQGGRXEOHGURSWUDLOHUDYDLODEOHIRUGHOLYHU\ SLFNHUDQGGRXEOHGURSWUDLOHUDYDLODEOHIRUGHOLYHU\ &DOO-RKQDWIRUPRUHLQIRUPDWLRQ &DOO-RKQDWIRUPRUHLQIRUPDWLRQ 2LOILHOG7UXFNLQJ 5HQWDOV

-RKQ JLEVRQZHOGLQJ#KRWPDLOFRPÂ&#x2021;:H\EXUQ6.


Page 12

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Our Past July 14, 1990

A 12-foot mesh satellite dish was demolished during the wind and rain storm June 26. The dish was struck by a sheet of plywood, which came of a nearby mobile home. Each week the Southeast Trader Express shares recent stories from the community but weâ&#x20AC;&#x2122;ll also give you a look into the past. If you have a photo you think readers of the Southeast Trader Express would find interesting please submit it to Jordan Baker at jbaker@ estvanmercury.ca.

COLLECTOR CAR AUCTION July 20 & 21, 2012 â&#x20AC;&#x153;All Indoorsâ&#x20AC;? Credit Union Event Plex - Evraz Place - Regina, SK. Friday, July 20 - Viewing: 3-9 pm Saturday, July 21 - Doors Open: 8 am Auction Starts: 10 am Admission: $15.00 (wristband good for both days) Children 14 & Under: Free Bidders number: $20.00 Cheques will be accepted with an irrevocable bank letter of credit. Now accepting consignments - donâ&#x20AC;&#x2122;t delay consign today!

<RXU &RPPXQLW\ 1HZVSDSHU 6LQFH

David: (306) 693-4411/(306) 631-7207/Bob: (306) 690-6263 www.thecollectorcargroup.com Country Boy Ent. Inc. PL# 318206

(VWHYDQ6DVNDWFKHZDQ 3DUW\&RQVWLWXHQF\$QQXDO *HQHUDO0HHWLQJ

-XO\WK SP (VWHYDQ(ONV/RGJH 'RZQVWDLUV%DFN0HHWLQJ5RRP

:HHNE\ZHHN \HDUE\\HDU ÂąZHÂśYH DOZD\VEHHQ WKHUH V HY VW HYDQ (0 H HUFXU\


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Page 13

Fresh farmers market vegetables create options this versatile recipe. I love adding oilpacked, sun-dried or smoke-roasted tomatoes to finish the greens, but a drizzle of olive oil and a sprinkle of lemon peel also is tasty. Iâ&#x20AC;&#x2122;ve been losing my mind (and spending way too much money) at the Farmerâ&#x20AC;&#x2122;s Market. The vast array of beautiful fruits and vegetables overwhelms me every time. Last week, the bundles of Rainbow Swiss chard with its colorful stems and fan-like leaves were too tempting to resist. The watermelon radishes, which look like a rosecolored pinwheels inside, also captured my attention. I originally planned to cook the Swiss Chard with some smoke-roasted tomatoes and add the radishes to my coleslaw recipe. When it was time to prepare the greens, I decided to add a few cups of the leftover coleslaw vegetables (without any dressing on them) into the pot, too. Itâ&#x20AC;&#x2122;s wonderful! You also can add in kale or spinach, with or instead of the cabbage, if thatâ&#x20AC;&#x2122;s what you have on hand. Mixing fresh and frozen greens also works beautifully in

ground black pepper 3 tablespoons chopped, sun-dried or smoke-roasted tomatoes and the oil 1. In a large nonstick skillet or Dutch oven, heat the oil over medium heat. Add the Swiss chard stems, onion and carrot, and cook until the onion is translucent and the stems soften, about 5 minutes. Add the garlic and red pepper flakes and stir until garlic is fragrant, about 1 minute. Add the broth or water and soy sauce, stirring to combine. Increase heat to high and bring sauce to a boil. 2. Decrease the heat to medium-low, add the Swiss chard, cabbage and radishes, if desired, and toss to mix. Cover and cook for 7 to 10 minutes, until greens are tender. Stir in lemon zest, lemon juice, vinegar and black pepper. Remove from heat and serve with sun-dried or smoke-roasted tomatoes and a drizzle of the oil. Makes 6 servings.

MIXED GREENS WITH GARLIC AND LEMON 1 tablespoon olive oil 2 large bunches Swiss chard (about 2 pounds total), cleaned, stemmed and chopped, stems reserved (see Tip below) 1 large yellow onion, thinly sliced 1 large carrot, chopped 2 cloves garlic, minced 1/2 teaspoon red pepper flakes 1/2 cup reduced-sodium chicken broth or water 1 teaspoon reducedsodium soy sauce 1 small head green cabbage, finely shredded 2 small watermelon radishes, chopped (optional) 1 teaspoon finely grated lemon zest 1 teaspoon fresh lemon juice 1 tablespoon seasoned rice wine vinegar 1 teaspoon freshly

TIP: Store unwashed fresh greens in a plastic bag, removing as much of the air from the bag as possible, for up to 5 days. The longer they are stored, the more bitter the

-8/<

fl avor becomes. Do not wash greens before storing because exposure to water encourages spoilage. To clean fresh greens, discard any leaves that are wilted, brown, yellowing or damaged. Immerse greens in a sink full of water and wash well to remove sand, grit and any debris. Lift out, drain, rinse and repeat until the water is clean. To stem, make a Vshaped cut where the stem

meets the leaf. Use the stems the way you would use celery, and cook them with the onions. Stack the leaves and coarsely chop them into 3- to 4-inch ribbons, or roll several leaves together into a cigar shape and slice into thin ribbons. Angela Shelf Medearis is an award-winning childrenâ&#x20AC;&#x2122;s author, culinary historian and the author of seven cookbooks. Her new cookbook is â&#x20AC;&#x153;The

Kitchen Divaâ&#x20AC;&#x2122;s Diabetic Cookbook.â&#x20AC;? Her website is www.divapro.com. To see how-to videos, recipes and much, much more, like Angela Shelf Medearis, The Kitchen Diva! on Facebook and go to Hulu. com. Recipes may not be reprinted without permission from Angela Shelf Medearis. (c) 2012 King Features Synd., Inc., and Angela Shelf Medearis

PHOTO CREDIT: stock.xchg photo

6HFUHWV0DLQVWUHDP0HGLFLQH :LOO1HYHU5HYHDO

)HDWXUHV

2QH1LJKW2QO\ 'U5RVH%DFNPDQLVDQDWXUDOGRFWRUZLWK D 3K' LQ &OLQLFDO 1XWULWLRQ %DVHG RQ  \HDUV RI H[SHUWLVH VKH ZLOO HGXFDWH \RX RQ DOWHUQDWLYH WKHUDSLHV WR SUHYHQW KHDUW DWWDFNVVWURNHVDQGSODTXHSUHYHQWLRQ

Multi-Deal

  +HUVKH\ 

FOR

6LQJOHV

&RFD&ROD Multi-Deal P/

VLQJOHXQLWSXUFKDVHDWUHJXODUSULFH

J VLQJOHXQLWSXUFKDVHDWUHJXODUSULFH



 FOR

3OXVGHSRVLW HQYLURQPHQWDOOHYLHV ZKHUHDSSOLFDEOH

5RVH%DFNPDQ3K' .HORZQD%&

,QWKLVVHPLQDU\RXZLOOOHDUQVROXWLRQVWRKHOS DGGUHVVDP\ULDGRIKHDOWKULVNVLQFOXGLQJ

+HDUW'LVHDVH+LJK%ORRG3UHVVXUH'LDEHWHV6OHHS 6H[XDO'\VIXQFWLRQ+LJK&KROHVWHURO$O]KHLPHUŇ&#x2039;V 3DLQ0LJUDLQH+HDGDFKHV$UWKULWLV&LUFXODWLRQ 2VWHRSRURVLVDQGPRUHÂŤ ´,QRQHPRQWKP\YDULFRVHYHLQVZHUHEHWWHUÂľ6KDURQ:9DQFRXYHU%&

Feature -DFNV /LQN¡V -HUN\J



HDFK

Multi-Deal





6SLW] 6XQĂ RZHU 6HHGV FOR

J VLQJOHXQLW

SXUFKDVHDW UHJXODUSULFH

6287+(513/$,16

&223

&6725(*$6%$5 728&+/(66&$5:$6+ .HQVLQJWRQ$YHQXHÂ&#x2021;Â&#x2021;WK6WUHHWÂ&#x2021; (VWHYDQ6.+RXUVDPSPÂ&#x2021;0RQ6DWDPSPÂ&#x2021;6XQ

'DWH 0RQGD\-XO\

&DUGLR7HVW 3UHSDLG

)UHHVHPLQDULI \RXSUHUHJLVWHU

YDOXH

FDOO7HUU\QRZ

7LPH ²SP 'RRUVRSHQSP

 RU   DIWHU

&RVW )UHH SUHUHJLVWUDWLRQRQO\

DWWKHGRRU

2QO\

%\DSSRLQWPHQW :KHUH WVWHĂ&#x20AC;XN#\DKRRFD RQO\ 'D\V,QQ 6XSHU 7$</257215220 (VWHYDQ6DVN -XO\


Page 14

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Big Little Book

Promoting Roller Derby

The Hillbilly Hurt roller derby team entered a float in the Canada Day parade in Bienfait.

+ 3,==$ 1 28672

5HDO*RRG)RRG )DPLO\'LQLQJ +3/RXQJH

Q: I have a Big Little Book, “Lone Ranger and the Black Shirt Highwayman.” The only publishing date I can find is 1939. -- Steve, Southbury, Conn. A: The first Big Little Book was issued during the Christmas season of 1932 and was titled “The Adventures of Dick Tracy.” The nifty little books originally sold for a dime and were an immediate hit. I think your Lone Ranger book is worth about $25, but to find out for certain, I suggest you contact Larry Lowery, the Big Little Book Club, P.O. Box 1242, Danville, CA 94526; or larry@biglittlebooks.com. Also, check out the club’s dandy website at www.biglittlebooks.com. *** Q: I have inherited a box of salt and pepper shakers and am not certain if I have anything worth keeping. I need your advice. -- Ken, Laramie, Wyo. A: Most salt and pepper shakers that I’ve seen in shops and at antique malls are priced in the $5 to $10 range, but as with most collectibles, there are always exceptions. S&Ps that were made during World War II

and have a patriotic design, or ones that reflect Black Americana themes are always desirable, for example. One of the better guides is the Antique Trader Salt & Pepper Shaker Price Guide by Mark F. Moran (Krause, $19.99). You also might check out antique shops for S&Ps in your area to determine what the market is like in Wyoming. *** Q: I have a Kenwood turntable that requires a special stylus. I can’t find a replacement and hope you can help me. -- Johnny, Portsmouth, N.H. A: The Needle Doctor is one of the best sources for Victrola needles as well as styluses for the older HiFi systems. His address is 6006 Excelsior Blvd., St. Louis Park, MN 55416; info@needledoctor.com; and 800-229-0644. Write to Larry Cox in care of King Features Weekly Service, P.O. Box 536475, Orlando, FL 328536475, or send e-mail to questionsforcox@aol.com. Due to the large volume of mail he receives, Mr. Cox is unable to personally answer all reader questions. Do not send any materials requiring return mail. (c) 2012 King Features Synd., Inc.

12071TW00

7+(5(·6$/271(:$7+2867213,==$ New dine in menu

New seniors menu

New martinis & margaritas

New wine menu

New facebook page! Check it out; click ‘like’ and get in on the fun. (www.facebook.com/Houston-Pizza-Estevan)

Daily Specials Restaurant & Lounge Sunday: Brunch 10 - 2 Sunday Evening Family Pizza Night Lounge Special: $1.00 off draft Monday:

All you can eat English style fish and chips Lounge Special: Margaritas & Martinis

Tuesday:

Pasta Day (buy 1 get the 2nd half price) Lounge Special: Highball Happy Hour Prices

Wednesday: Seniors Day (10% off Seniors Menu) Lounge Special - Long Island Iced Teas Thursday:

All You Can Eat Mini Ribs (available in 8 flavours) Lounge Special - Buckets of Beer (6 Domestics 2 Kinds)

Fri. & Sat.

Steak Day (AAA Angus Beef) Lounge Special Friday: Double Daz (Double It Up For A Better Deal) Lounge Special Saturday: Paralyzers

Phone: 634-8880 5($/‡*22'‡)22'

76 Souris Ave. N., Estevan Debit on Delivery Take Out Menu Available Visit our website: www.houstonpizza.ca


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Page 15

Senior Pets Need Extra Checkups Itâ&#x20AC;&#x2122;s Our Anniversary & Weâ&#x20AC;&#x2122;re Extending the Savings to You!

D E A R P AW â&#x20AC;&#x2122; S CORNER: How often should my 12-year-old mutt, â&#x20AC;&#x153;Akira,â&#x20AC;? see the veterinarian? Heâ&#x20AC;&#x2122;s very healthy for an older dog, but my girlfriend says he needs to have more than a once-a-year physical. Is that true? -- Matt C., Longwood, Fla. DEAR MATT: Twice a year is a good guideline for senior pets to visit their veterinarian, if theyâ&#x20AC;&#x2122;re otherwise healthy. Thatâ&#x20AC;&#x2122;s because older dogs and cats can develop conditions common to pets of advanced age quickly -conditions that sometimes go unnoticed but should be treated sooner rather than later so the petâ&#x20AC;&#x2122;s quality of life doesnâ&#x20AC;&#x2122;t diminish. Itâ&#x20AC;&#x2122;s normal for a pet to slow down as it ages. But the reduced activity that an owner sees as normal can mask developing conditions like arthritis,

Recycle This Paper

thyroid imbalance, heart disease or cancer. A dog or catâ&#x20AC;&#x2122;s slowing pace also can lead to obesity, meaning owners need to regulate and monitor their diets closely so that senior pets get proper nutrition while avoiding excess calories. Many vets will recommend a twice-yearly exam once a pet reaches an age considered senior. (This varies a bit for dogs. Larger dogs are often considered senior pets after age 8 or 9; smaller dogs might be 10 or older.) Itâ&#x20AC;&#x2122;s not a moneymaking move -- itâ&#x20AC;&#x2122;s a good recommendation. The exam should include a full physical, along with testing for de-

veloping conditions like diabetes or other illnesses that, untreated, can drastically shorten a petâ&#x20AC;&#x2122;s life. A d d i t i o n a l l y, y o u should keep Akiraâ&#x20AC;&#x2122;s vaccinations up to date and read up on pet care for senior dogs. There are many things owners can do to improve their petâ&#x20AC;&#x2122;s quality of life beyond extra medications: special diets, specific exercises and modified play are among the steps owners can take. Send your questions or comments to ask@ pawscorner.com, or write to Pawâ&#x20AC;&#x2122;s Corner, c/o King Features Weekly Service, P.O. Box 536475, Orlando, FL 32853-6475. For more pet care-related advice and information, visit www.pawscorner. com. (c) 2012 King Features Synd., Inc.

Flyer prices in effect until July 21/2012

3- Pc. Contractor Job Box Set

$

Solid 16 gauge steel 48â&#x20AC;? and 36â&#x20AC;? boxes predrilled for casters and 20 gauge 30â&#x20AC;? box.

425

(7709892)

set

Charbroil BBQ â&#x20AC;˘ 665 square inches total cooking area 48,000 BTUâ&#x20AC;&#x2122;s (7908288)

$

26199

each

24-Ft. TYPE 1A Fibreglass Extension Ladder 300 lb. duty rating. Max extension length -21â&#x20AC;&#x2122; (1616465)

$

239

Congratulations

each

2 Door Cherry Cabinet Size: 24â&#x20AC;?w x 18â&#x20AC;?D x 32â&#x20AC;?H. 4â&#x20AC;? cultured marble top. (7200843)

Dream Vacation Lottery Winners! -XO\'UDZV

$

169

3RRO%7ULS.HYLQ:DOO .HYLQKDVZRQKLVFKRLFHRIDWULSWR 1HZ<RUN6DQ)UDQFLVFR&KLFDJR+RQROXOX

each

6HFRQGDU\3UL]H (OOHQ3KLOOLSV (OOHQKDVZRQDRQHQLJKWVWD\DW WKH5HJLQD,QQDQGWLFNHWVWRWKH $SSODXVH'LQQHU7KHDWUH

7LFNHWVDUHVWLOODYDLODEOH &RQWDFW-DQHOOHDW

Outdoor Fireplace (1938364)

$

12699

each

Heavy-Duty Reciprocating Saw Kit

V L) 6 6=) 4

š,-661;6--416 5-57:1)4:)+-º 2=4A

$

109

First Competitor to have a perfect light in the first round will receive $5000

Powerful 10.0 Amp motor (0140087)

each

Camping Chair - with Bag

.MI\]ZQVO\PMš);QLM;\ZMM\+IZ[º 6M`\:IKM

(4141438)

$

1299

each

Heavy-Duty Clean-Up Bags

$ 99

7

box (20 per box)

0HWDO&ODGGLQJ

7KLQNLQJZLQGRZV" 6KRSDQGFRPSDUH

0DQ\W\SHV SURĂ&#x20AC;OHVDYDLODEOH 1RZVWRFNLQJYDULRXVOHQJWKVRI *DOYDOXPH ZKLWHZKLWHPHWDO )DUPDQGLQGXVWULDOJDOYDQL]HGJDOYDOXPHDQGFRORXUHG  JDXJHPHWDORUGHUHGWRVXLW\RXUVL]HDQGQHHGV 3KRQHIRUSULFLQJZLWK\RXULQGLYLGXDOUHTXLUHPHQWV

,QVLVWRQ&:'ZLQGRZVDQGGRRUV 39&:LQGRZV0HWDOFODGZLQGRZV 3DWLRDQGJDUGHQGRRUV,QVXODWHGVWHHOGRRUV

&DOOIRUFRPSDUDWLYHSULFLQJ

:22'&28175< (67(9$10&/($17,6'$/( 3K  Â&#x2021;)D[  Â&#x2021;.HQVLQJWRQ$YHQXH(VWHYDQ +RXUV0RQ)ULDPSP6DWDPSP

VISIT US ON OUR WEBSITE: www.wood-country.com


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Page

Page 16

Energy

-XQH&RQWUDFW

&58'(2,/ ELECTRICAL CONSTRUCTION, MAINTENANCE & SERVICE PLCâ&#x20AC;&#x2122;S, VFDâ&#x20AC;&#x2122;S BATTERY CONSTRUCTION TRENCHING MOTOR SALES & REPAIRS

&ORVLQJSULFHDVRI )ULGD\-XQH



 6SRQVRUHGE\

 86'2//$56

Enform COR CertiĂ&#x20AC;ed 24 HOUR SERVICE 62 DEVONIAN ST. ESTEVAN, SK.

The

PH: 637-2180 FAX: 637-2181 LOCALLY OWNED & OPERATED

,QVWUXPHQWDWLRQ 0RWRU6DOHV5HZLQGV 5HSDLUV

Recycle This Paper +Z\(DVW(VWHYDQ 3KRQH )D[

:HOOKHDG6\VWHPV '5,//,1*/,&(16(6 1LQHOLFHQVHVLVVXHGWR7KXUVGD\-XQH )(ONKRUQ1RUWKJDWH(DVW+] $$ )(ONKRUQ1RUWKJDWH(DVW+] $$ )(ONKRUQ1RUWKJDWH+] $$ )5LIH9LHZĂ&#x20AC;HOG+]&& )$5&)ORUHQFH6RXWK  )0RVDLF.(VWHUKD]\6:'  )0LGDOH:LOOPDU&% )0LGDOH:LOOPDU&& )&DQHUD9LHZĂ&#x20AC;HOG+]&&

5,*5(3257

/&UXVDGHU 3%(16WRUWKRDNV(+]%& ($OOLDQFH 5HQHJDGH5HYHUV+] %% ($OOLDQFH %'2*0DLU  '3DUWQHU 92&6RXULV)ODW  )&KDPSLRQ /HJDF\$ODPHGD+]'$ )$GYDQFH 0LGDOH$ODPHGD(+] $$ &$NLWD %+3%0HOYLOOH  (&DQHOVRQ .LQZHVW$ODPHGD+]%& /%H+V $WKHQD$ODPHGD  &&KDPSLRQ&15/HWDO$ODPHGD:HVW+] $% &9RUWH[ 7UL:HVW:RUGVZRUWK(DVW+]&& &1DERXUV %+3%0HOYLOOH  &&DQHOVRQ /HJDF\HWDO.LVEH\+]%% ((QVLJQ3%(1HWDO.LVEH\&% .&DQHOVRQ&3(&%URZQLQJ+]&& ((QVLJQ3%(16WDU9DOOH\+]$' $(QVLJQ 3%(19LHZĂ&#x20AC;HOG+]%& &(QVLJQ /HJDF\HWDO5RFKH3HUFHH+]'& ((QVLJQ 3%(19LHZĂ&#x20AC;HOG+]&& )3DQWKHU&DSULFH9LHZ+LOO+]%' '/DVVR )ODJVWRQH0DFRXQ+]'' &(QVLJQ 3%(19LHZĂ&#x20AC;HOG+]&& &%LJ6N\3%(19LHZĂ&#x20AC;HOG' (6D[RQ:LOOLVWRQ+XQWHU7DEOHODQG+]&% (3DQWKHU:LOOLVWRQ+XQWHU7DEOHODQG+] %$ %9RUWH[ 3DLQWHG3RQ\9LHZĂ&#x20AC;HOG+] %% '+RUL]RQ $SDFKH0LGDOH8QLW+]'$ (7ULQLGDG $5&%URPKHDG+]$' (3DQWKHU +XVN\2XQJUH+] %$ %3UHFLVLRQ+XVN\2XQJUH+]$& &3UHFLVLRQ&9(HWDO:H\EXUQ8QLW\,QM+]'&

2LOĂ&#x20AC;HOG(OHFWULFDO &RQVWUXFWLRQ 6HUYLFH

.HQVLQJWRQ$YH(VWHYDQ6.

  +2856(59,&(

7+( (67(9$10(5&85< '5,//,1*5(3257 (&DQHOVRQ1$/+RIIHU+] %$ ($GYDQFH &3(&+RIIHU+] $$ ,+RUL]RQ 3DLQWHG3RQ\)ODW/DNH+] %% ,5HG'RJ3RVWHOOHWDO)ODW/DNH98+]'$ (3DUWQHU3RVWHOOHWDO)ODW/DNH+] %$ '(QVLJQ (QHUSOXV1HSWXQH+]%' '(QVLJQ(QHUSOXV)UHGD/DNH9,9+]%& '1DERUV9DOH5HJLQD  )+RUL]RQ<DQFHDO6RXWKH\  '3UHFLVLRQ3DVVSRUW0LQWRQ+]&$

:$,7,1*21352*5$0

'3HPRFR3DUNPDQ % '3HPRFR3DUNPDQ $ %4XHVWHUUHDWDOO)U\V(DVW'' %& '6SHFWUXPHWDO,QJROGVE\(DVW $ .3RVWHOOHWDO:RUNPDQ %+LJKURFN5\HUVRQ /4XHVWHUUHHWDO5\HUVRQ+] &' .(SSLQJHWDO%HOOHJDUGH6:' %0RVDLF.(VWHUKD]\:6: (0RVDLF(VWHUKD]\(+ *5HOLDEOH:DZRWD '%'2*3DUNPDQ -7ULZHVW$ODPHGD(DVW6:' $/HJDF\6WHHOPDQ '$ +.LQZHVW$ODPHGD %(ONKRUQ1RUWKJDWH+] '$ -&3(&9LHZĂ&#x20AC;HOG+] $' %$UUXJD9LHZĂ&#x20AC;HOG+]$% &6SHFWUXPHWDO9LHZĂ&#x20AC;HOG+] $& &&3(&9LHZĂ&#x20AC;HOG+]%% .&3(&9LHZĂ&#x20AC;HOG+] && %&3(&9LHZĂ&#x20AC;HOG+] %& $&3(&9LHZĂ&#x20AC;HOG+] && )&3(&9LHZĂ&#x20AC;HOG+]%$ %&3(&9LHZĂ&#x20AC;HOG+] &% .&3(&9LHZĂ&#x20AC;HOG+]$% %&3(&9LHZĂ&#x20AC;HOG+] &% $&3(&+RIIHU+]%$ %$UF7ULEXQH (&3(&+RIIHU+]$$ $5LR7LQWR6HGOH\ %%D\VKRUH5DGYLOOH %6SDUWRQ&H\ORQ .3%(13DQJPDQ'' %' $&((,+DUG\6RXWK

Industry Safety Training

www.southeastcollege.org

Skid Control Training (1/2 day theory, 1/2 day practical)

ATCHEWA SK

Y

ITU TE ST

E N E RG

TR

N

SA

Our full-size SUV and a state-of-the-art SKIDCAR system is designed to evaluate your driving skills and practice different skid control maneuvers. The theory portion includes topics such as driving on gravel roads, winter roads, 4x4, fatigue management, texting, DFMMQIPOFT wildlife, collision avoidance, and substance abuse.

AI N I N G I N

SASKATCHEWAN ENERGY TRAINING INSTITUTE

To schedule a course for your employees, please contact Ken, Paula, or Faye toll-free at 1-866-999-7372

A demo of our SKIDCAR simulator can be seen on Visit www.youtube.com/user/SoutheastCollege


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012 7+(75$'(5)5,'$<$8*867

(;35(66 6287+($6775$'(5



Page 17

3DJH

3OHDVHXVHWKHKDQG\IRUP IRXQGRQWKH&ODVVLILHG SDJHVWRVXEPLW\RXUDG HEALTH SERVICES

HOUSES FOR RENT

SLIMDOWN FOR SUMMER! Lose up to 20lbs in just 8 weeks. Call Herbal Magic today! 1-800-8545176.

SASKATOON TRAILER: Ideal for students who want to acquire equity rather than pay thousands in rent. A fully upgraded 1,166 sq. ft., 3 bedroom, 2 bathroom, 1983 mobile home on bus route to U of S and SIAST. 5 appliances, large porch and deck. Move-in ready. $74,900. Phone 306-270-9160.

PSYCHICS TRUE Advice! TRUE Clarity! TRUE PSYCHICS 1-877-342-3032 or 1-900-528-6256 or Mobile #4486 (18+) 3.19/min. www.truepsychics.ca

TRAVEL

ROOMS FOR RENT: Two fully furnished rooms with full bath - in basement. Many extras. Phone 421-1466 or 421-1477.

MOBILE/ MANUFACTURED

LOTS & ACREAGES FOR SALE FOR SALE BY OWNER: Prairie Lake Lodge, Lake of the Prairies, Russell, Manitoba still has a good selection of lots available for building on or trailer usage year around. Enjoy golf, excellent fishing or nature at its best. Reasonably priced starting at $27,500 and immediate titled possession. Contact Gerald: 204-773-0380 or keating@escape.ca MIDALE ACREAGE: Located close to Midale - RM of Cyrmi. 13 Acres - Large bungalow with double attached garage. Plus huge Quonset - 2002 Built Quonset, infloor heating, 2 overhead doors, bathroom. This is a great value. Call us your local Real Estate Agent for a viewing. Open to offers. MLS# 432022. Mack MacDonald, RE/MAX Joyce Tourney Realty, 306-539-6806. macdoma@accesscomm.ca

REAL ESTATE SERVICES

New Canadian Greenhouse: Majority interest in greenhouse joint venture / franchise. Exclusive to SK. This greenhouse grows pure, healthy food produce - year round in all weather and climates, with less water. Irrigation with 43 minerals is a first. It runs on heat and electricity from our new biomass generator - no fossil fuels. Value added products. We will build the structures, and train staff for operations and sales. The first phase is 1.5 acres and will expand. This business is sustainable and markets are Western Canada and the U.S. We can build low cost staff housing. 778 475 1561 in Coldstream B.C.

FOR SALE: Brand new 3 Bedroom, 3 bath, 1800 sq. ft. house on 10 acres. Fully fenced, with double car garage. Sunny kitchen has walk-in pantry and large island. Vaulted ceilings throughout kitchen, dining room and living room. Large master bedroom with walk-in closet. Basement dr y walled and painted. 7 miles west on Hwy. 18 and 1 1/4 mile south. For viewing call 634-9305.

TOWNHOUSES FOR SALE FOR SALE. WARMAN 55 PLUS AC T I V E A D U LT L I F E ST Y L E Large Ground Level Townhomes 306 241 0123 www.diamondplace.ca

FOR SALE In Stoughton: New modular home on own lot. 3 Bedrooms, 2 baths. Vacant. $8,000 down; Payments $800/month. Must have good credit and be able to bank qualify. Phone 1-587-4348525.

C U S T O M B U I LT R E A D Y T O MOVE HOMES: R. Barkman Constr uction, Cromer, Manitoba. Quality workmanship and materials. Please Phone Randy at 204662-4561 for Estimates and Design or Stop in to Visit Our Homes.

EXPRESS

Repeat the Same Ad in the

Estevan

Mercury www.estevanmercury.ca

FEED & SEED HEATED CANOLA WANTED!! - GREEN CANOLA - SPRING THRASHED - DAMAGED CANOLA FEED OATS WANTED!! - BARLEY, OATS, WHT - LIGHT OR TOUGH - SPRING THRASHED HEATED FLAX WANTED!! HEATED PEAS HEATED LENTILS "ON FARM PICKUP" Westcan Feed & Grain 1-877-250-5252

HAY/BALES FOR SALE FOR SALE: Standing Hay. NE 224-7-2. Phone 634-7704 after 7 p.m.

LAND WANTED

For

1/2 Price! Our ClassiĂ&#x20AC;ed Sale Never Ends!



Estevan Mercury & Southeast Trader Express CLASSIFIED INDEX

Engagements Wedding Annivers. Anniversaries Birthdays Announcements Prayer Corner In Memoriam Cards of Thanks Coming Events Garage Sales Memorial Services Personals Health/Beauty Lost Found Introduction Services Readings Psychics Travel Health Spas Tickets Childcare Available Childcare Wanted

SERVICES Accounting/

D E N I E D CA N A DA P E N S I O N PLAN DISABILITY BENEFITS? The Disability Claims Advocacy Clinic can help. Call Allison S c h m i d t a t 1- 8 7 7- 7 9 3 - 3 2 2 2 . www.dcac.ca HAVE YOU BEEN DENIED Canada Pension Plan Disability Benefits? The Disability Claims Advocacy Clinic can help. Contact Allison Schmidt at : 1-877-793-3222 www.dcac.ca

SOUTHEAST TRADER

COMMERCIAL BUILDING: 5,440 sq. ft., built in 2008 - for sale in Carlyle. Prime location. Phone 577-7809 for details.

BUSINESS SERVICES

HOUSE FOR SALE: Mesa, Arizona. 1807 sq. ft., 2 BR, two baths On Golf Course, gated community, built 2005. Has listed $380,000 Now for $310,000 - Trades considered from Estevan Area. Call Ron 306-421-6223.

At the Southeast Trader Express Pay Full Price for a CLASSIFIED in

INDUSTRIAL/ COMMERCIAL

WEYBURN PERSONAL CARE HOME: Owner wishing to Retire. Well established home in ideal location. Sale includes Home, Business, Equipment and Training. All inquiries are treated in a confidential nature. Be your own boss. Mack MacDonald, RE/MAX Joyce Tourney Realty, #1 RE/MAX Commercial Team in the World, 306539-6806. macdoma@accesscomm.ca

OUT OF TOWN

FOR RENT: One bedroom Apartment. Available Aug. 1, in quiet area. Use of yard, off-street parking. No pets; References needed. Phone 634-7063.

PARDON/WAIVER FOR WORK AND/OR TRAVEL? Guaranteed Fast, Affordable, Criminal Record Removal. Call for FREE Consultat i o n . Q u a l i f y To d ay & Save $250.00 (limited time offer). 1-800736-1209, www.pardonsandwaivers.ca. BBB Accredited.

BUSINESS OPPORTUNITIES

HOUSES FOR SALE

APARTMENTS/CONDOS FOR RENT

BUSINESS SERVICES

STEEL BUILDINGS / GRANARIES FOR SALE: Used steel grain bins, 14 to 19 ft. diameter, aeration fans. Phone 306-421-0205.

Bookkeeping Appliance Repairs Auctioneers Bricklaying Building/Contracting Building Supplies Drywalling Building/Contracting Electrical Handyperson Hauling Cleaning Janitorial Landscaping Lawn & Garden Moving Painting/Wallpaper Renos/Home Improvement Roofing Snow removal Services for Hire Vacuum Services

LEGAL Notices to Creditors Assessment Rolls Tax Enforcement Tenders Notices/Nominations Legal/Public Notices Judicial Sales Houses for Sale Apts./Condos for Sale Out of Town Cabins/Cottages/ Country Homes Apts./Condos for Rent Duplexes for Rent Houses for Rent Mobiles/Pads Housesitting Wanted to Rent Rooms for Rent Room & Board Shared Accomm. Mobile/Mft. Homes for Sale Recreational Property Revenue Property Garages Real Estate Services Investment Opport. Business Opportunities Hotels/Motels Business Services Financial Services Industrial/Commercial Storage Space for Lease Office/Retail for Rent Warehouses Farms for Sale Farms/Acreages for Rent Land/Pastures for Rent Mineral Rights Farm Implements Livestock Horses & Tack

Farm Services Feed & Seed Hay/Bales for Sale Certified Seed for Sale Pulse Crops/Grain Wanted Steel Buildings/ Granaries Farms/Real Estate Antiques For Sale/Miscellaneous Furniture Musical Instruments Computers/Electronics Firewood Sports Equipment Farm Produce Hunting/Firearms Plants/Shrubs/Trees Pets Wanted to Buy Auctions Adult Personals Domestic Cars Trucks & Vans Parts & Accessories Automotive Wanted RVs/Campers/Trailers Boats Snowmobiles Motorcycles ATVs/Dirt Bikes Utility Trailers Oilfield/Wellsite Equip. Heavy Equipment Career Opportunities Professional Help Office/Clerical Skilled Help Trades Help Sales/Agents General Employment Work Wanted Domestic Help Wanted Career Training Tutors Memorial Donations Obituaries


Page 18 THE TRADER EXPRESS, FRIDAY, JULY 6, 2012 STEEL BUILDINGS / FOR SALE - MISC GRANARIES STEEL BUILDING HUGE CLEARANCE SALE! 20X24 $4,658. 25X28 $5,295. 30X40 $7,790. 32X54 $10,600. 40X58 $14,895. 47X78 $19,838. One end wall included. Pioneer Steel 1-800-6685422. www.pioneersteel.ca.

DOMESTIC CARS

ECI STEEL INC. PRINCE ALBERT, SK. HWY # 3 E & 48 ST (306)922-3000

GUARANTEED BEST

FOR SALE - MISC

DOMESTIC CARS

PRICE

LARGE QUANTITIES OF SQUARE

&

RECTANGLE

TUBING AVAILABLE FOR IMMEDIATE SALE.

CALL

FOR DETAILS

BOSCH 6.5 Qt. Mixer - $449, ACTIFRY - 2 lb. of french fries or wings with 1 tbsp. oil - $229. 7 Qt. Kitchen Aid, Bunn 3 Min. Coffee Makers. Call Hometech Regina, 1888-692-6724. DISCONNECTED PHONE? ChoiceTel Home Phone Service. No One Refused! Low Monthly Rate! Calling Features and Unlimited Long Distance Available. Call ChoiceTel Today! 1-888-3331405. www.choicetel.ca. HOT TUB (SPA) COVERS Best Price, Best Quality. All Shapes & Colours Available. Call 1-866-652-6837 www.thecoverguy.com/newspaper

WANTED WANTED Shed Antlers and Old Tr a p s . P h o n e P h i l Pa t c h i n (306) 278-2299.

AUCTIONS

801 13th Ave., ESTEVAN Ph: 634-3661 or 1-888-634-3661

SOUTHEAST SASK USED CAR SUPERSTORE CARS

2011 CHEV MALIBU PLATINUM EDITION 30,000 kms, Was $18,900 .... $17,900 2009 PONTIAC VIBE auto, p.w., p.l., air, only 53,700 kms............................ $14,990 2009 PONTIAC G5 2 door, leather, sunroof, auto, 59,165 kms ....................... $11,990 2008 CHEV COBALT 4 door, sport red, 56,840 kms ...................................... $11,900 2008 CHEV COBALT COUPE auto, power roof, 40,800 kms ........ $11,900 2 - 2008 2008 CADILLAC CTS AWD, 3.6L, 66,700 kms .............................................. $29,700 2007 CHEV MAILBU LT Local trade, 77,000 kms ......................................... $10,981 2004 CHEV CORVETTE CONVERTIBLE auto, leather, chrome wheels, 8,600 kms ..................................................................................................... $29,983

TRUCKS, SUVS, VANS

2011 DODGE RAM QUAD CAB loaded, leather, 58,000 kms, nav,62/' roof ........ $34,900 2011 DODGE DAKOTA CREW 4X4 19,200 kms....................................... $25,700 2011 CHEV TRAVERSE AWD, LT, quad, buckets, 43,400 kms, Was $29,900... $28,700 2010 CHEV 1500 CREW LT2 pw roof, leather, 20â&#x20AC;? wheels & more, 77,600 kms ................................................................................................... $31,700 2010 CHEV EQUINOX LTZ 4cyl, leather, pw roof, 8 way pr. seat, 73,700 kms ................................................................................................... $26,900 2010 GMC 1 TON CREW CAB DURAMAX 163,000 kms ......................... $28,700 2010 CHEV CREW 4x4 very nice, black with 20â&#x20AC;&#x2122;s, local trade, 45,000 kms .... $28,814 2010 CHEV 1500 CREW 4X4 6.2L, max pkg, 137,000 kms, local trade ...... $21,980 2010 GMC TERRAIN AWD, rearview camera, 15,000 kms ............................. $24,900 2009 BUIK ENCLAVE AWD CXL2 leather, 7pass, excellent,168,300 kms...... $19,981 2009 FORD ESCAPE XLT tr.tow, remote start, 62,000 kms ........................... $21,900 2009 CADILLAC SRX 4.6 V8 SPORT power roof, 58,7000 kms ................. $32,700 2008 FORD F-150 CREW FX4, 4X4 leather, pw roof, only 69,400 kms ...... $27,900 2008 DODGE NITRO SXT white, only 62,000 kms ...................................... $19,900 2008 HUMMER H3 fully loaded, cloth buckets, very clean, 69,000 kms........... $24,987 2008 SATURN VUE AWD A/C, cruise, tilt, pw, pl, 78,000 kms ..................... $17,700 2008 FORD EDGE LIMITED AWD, black, local trade, 101,300 kms ................ $19,900 2008 FORD F-150 4X4 CREW leather, sunroof, bucket, 65,288 km, local trade, Was $28,900 ............................................................. $27,900 2007 JEEP LIBERTY 4X4 leather, local trade,123,000 kms ........................... $13,900 62/' $14,995 2006 PONTIAC TORRENT sunroof, AWD, 55,000 kms ................................. 2005 ACURA MDX leather, power roof, only 102,000 kms ............................ $17,900 2005 HUMMER H2 black, leather, 92,000 kms ............................................ $28,900

THE GM OPTIMUM ADVANTAGE â&#x20AC;˘ Manufacturerâ&#x20AC;&#x2122;s Warranty â&#x20AC;˘ Exchange Privilege â&#x20AC;˘ 150+ Point Inspection â&#x20AC;˘ 24hr Roadside Assistance

DOMESTIC CARS FOR SALE: 2009 Grand Marquis. White with beige leather interior, fully loaded, warranty. In mint condition, only 50,000 km. Phone 306-452-3879 or Ryan at 306-4536741.

RVS/CAMPERS/TRAILERS FOR SALE: 1985 Vanguard 36 ft. Motorhome. Good condition. Asking $9,000 - O.B.O. Phone 3882638.

CHARGED CLASSIFIED ADVERTISING RATES Businesses/Private Parties placing ClassiĂ&#x20AC;ed Advertising (Want Ads) in either The Estevan Mercury or the Southeast Trader Express and requesting these ads to be BILLED TO AN ACCOUNT WILL BE CHARGED THE FOLLOWING RATE: $9.95 for the First 20 Words + 20¢ for Each Additional Word ALL PRICES SUBJECT TO 5% GST Please remember â&#x20AC;Ś Each Abbreviation Counts as One Word (You donâ&#x20AC;&#x2122;t save money by abbreviating, you just make your ad more difĂ&#x20AC;cult to read) Web Sites (i.e. www.world.ca) count as three words

NOTICE

Payment for Classified Advertising Must be Made in Advance Prepaid Rates: $7.95 per week for up to 20 words Please add 20¢ for each additional word Remember To Add 5% GST! Cash â&#x20AC;&#x201C; Cheque â&#x20AC;&#x201C; Visa â&#x20AC;&#x201C; MasterCard Note: No refunds are issued for Classified Advertising. If you Cancel your Ad before expiry, Credit will be given which may be applied to future advertising. *** â&#x20AC;˘ CHECK YOUR ADS â&#x20AC;˘ We will only accept responsibility for errors the first time an ad appears â&#x20AC;˘ PLEASE NOTE â&#x20AC;˘ Rewording or Changing an Advertisement After it has been Printed in the Paper Requires Payment for a NEW AD â&#x20AC;&#x201C; No Credits Are Issued for Ads That Are Changed â&#x20AC;&#x201C; â&#x20AC;˘ Cancellation of Advertisements â&#x20AC;˘ Must be received by 3:00 p.m. Wednesday for the Trader and 4:00 p.m. Friday for the Mercury ****************

SOUTHEAST TRADER

EXPRESS Business Office located at 68 Souris Avenue North in Estevan (Across from the Water Tower) Please Phone 634-2654 for further information Office Hours: 8:00 a.m. - 5:00 p.m. Monday through Friday ****************

Use the Handy Form Below to Submit Your Advertisement to: The Southeast Trader Express Box 730, Estevan, SK S4A 2A6 or submit your ad through our website at www.estevanmercury.ca Please Select Your Category from the Classified Index A REMINDER â&#x20AC;Ś EACH ABBREVIATION Counts as One Word (You donâ&#x20AC;&#x2122;t save money by abbreviating, You just make your advertisement more difficult to read)

ADULT PERSONAL MESSAGES LOCAL HOOKUPS BROWSE4FREE 1-888-628-6790 or #7878 Mobile **************** HOT LOCAL CHAT 1-877-290-0553 Mobile: #5015 **************** Find Your Favourite CALL NOW 1-866-732-0070 1-888-544-0199 18+

CLASSIFIED DEADLINE WEDNESDAY AT 3:00 P.M.

PLEASE PRINT:

)DPLO\2ZQHG'HDOHUVKLS6LQFH WK675((7(67(9$1 3+21(  

Name ________________________________________

86('&$56

Number of Weeks ______________________________

&+(9<&$0$5266/RDGHG  0$='$&;NP  6(%5,1*7285,1*9HU\QLFHFDU  '2'*(&+$5*(5NPV  9:1(:%((7/(&219(57,%/(NPV  &+5<6/(56(%5,1*2QO\NPV 

86('758&.69$16 )25')&5(:&$%NPV  72:1 &28175<  *5$1'&+(52.((  '2'*(&5(:&$%%,*+251NPV  5$063257&5(:&$%  *5$1'&$5$9$16;7NPV  '2'*(-2851(<57$:'/RDGHG  )25';/7683(5&$%  *0&6,(55$&5(:&$%NPV  '2'*(&$/,%(5  5$0'LHVHO6/7  '2'*(-2851(<57/RDGHG  -((33$75,27/7'  )25'(6&$3(  '2'*(*5$1'&$5$9$16;7  5$0;4&  72:1$1'&28175<  '2'*(5$06/74&;'LHVHO  *0&&5(:&$%  )25');/7  '2'*(4&6/7:' 

75$,/(5602725+20(659V 1(:6211<%522.)W7+:+((/6OLGHVILUHSODFH FHQWUDOYDFORDGHG  *0&(;7&$%  53072<+$8/(5)W 62/' 52&.:22'75$,/(5)W%XQNV VOLGHRXW62/' 75$9(/$,502725+20()W 

3/86$33/,&$%/(7$;(6

Address _____________________________________ Telephone No. ________________________________ Amount Enclosed ______________________________ VISA/MC No. _________________________________ Card Expiry Date: ______________________________

YOUR AD _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________

The Worldâ&#x20AC;&#x2122;s Largest Shopping Centre is the CLASSIFIED SECTION of Your Newspaper


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012 DOMESTIC CARS

DOMESTIC CARS

6HQFKXNÂŻV6XSHU'HDOV 

8VHG&DUV

/,1&2/10.6ORDGHGZSRZHUURRIQDYLJDWLRQ NP )25'0867$1*9VSHHGORDGHGRQO\NPV )2&866(/ORDGHGZLWKOHDWKHURQO\NPV 0867$1*9ORDGHGRQO\NPV 0$='$5;*7ORDGHGNPV %0:=,&219(57,%/(PLOHV

8VHG7UXFNV689V 9DQV

5$3725683(5&5(:[RQO\NPV ('*(/,0,7('$//:+((/'5,9(IXOO\ORDGHGZLWK 1DYLJDWLRQ PRRQURRIVRQO\NPV62/' (6&$3(;/7;ORDGHGZLWKNPV )3/$7,180683(5&5(:[ORDGHG ZLWKNPV62/' );/7&5(:&$%NPV ));&5(:&$%ORDGHGOHDWKHUSZPRRQURRI RQO\NPV (6&$3(;/7[/9ORDGHGZLWKNPV *0&6,(55$6/(&5(:&$%;NPV ('*(/,0,7('$:'ORDGHGZLWKOHDWKHU 79'9' RQO\NPV62/' (6&$3(/,0,7(';ORDGHGNPV ('*(/,0,7('DOOZKHHOGULYHORDGHGNPV (;3/25(56325775$&[ORDGHGRQO\NPV *0&$&$',$6/(DOOZKHHOGULYHORDGHGNPV (;3(',7,21/,0,7('0$;[IXOO\ORDGHG ZLWKNPV (;3/25(56325775$&;/7;ORDGHG NPV (;3(',7,21('',(%$8(5;ORDGHGNPV62/' )+$5/(<'$9,'621&5(:&$%;ORDGHGZLWK1DYLJDWLRQ DQGSRZHUURRIRQ\NPV );/7&5(:&$%ONPVORDGHG '2'*(48$'&$%;ORDGHGNPV62/'

6HQFKXN )RUG6DOHV/WG

@V\YOVTLVMHM[LYZHSLZZLY]PJL

6RXULV$YHQXH1RUWK²(VWHYDQ6DVN

634-3696

,/.'#2%%+-/4/23 !QPK3=HAO 3ANRE?A3EJ?A ZZZORQJFUHHNPRWRUVFDUSDJHVFD *RYHUQPHQW+LJKZD\)XHO(FRQRP\5DWLQJV

&$56 &KHY,PSDOD/6GUIDFWRU\ZDUUDQW\NPPSJ &KHY&REDOW/7GUVXQURRIIDFWRU\ZDUUDQW\PSJ 3RQWLDF*6(GUIDFWRU\ZDUUDQW\ORDGHGPSJ &KHY0RQWH&DUOR66GU'DOH(DUQKDUGW-U6HULHVZDUUDQW\PSJ &KU\VOHU37&UXLVHUGUZDUUDQW\PSJ

758&.69$16 689·V 'RGJH*UDQG&DUDYDQ6(6WRZQJRNPIDFWRU\ZDUUDQW\PSJ 0LWVXELVKL5956(:'IDFWRU\ZDUUDQW\NPPSJ 'RGJH'DNRWDFFDE6;7[IDFWRU\ZDUUDQW\NPPSJ 'RGJH5DP6/76SRUW4XDGFDE[IDFWRU\ZDUUDQW\PSJ 'RGJH-RXUQH\6;7$:'SDVVORDGHGZDUUDQW\PSJ )RUG(VFDSH;/7:'IDFWRU\ZDUUDQW\NPPSJ &KHY7UDLOEOD]HU[NPVIDFWRU\ZDUUDQW\PSJ +RQGD&59/;$:'ORDGHGZDUUDQW\PSJ *0&6LHUUD6/(([WFDE=[9IDFWRU\ZW\PSJ )RUG);/7([W&DE[ORDGHGZDUUDQW\PSJ %XLFN5HQGH]YRXV$:'&;/GUSDVVZDUUDQW\PSJ *0&'HQDOL$:'SDVVOHDWKHUVXQURRIZDUUDQW\PSJ &KHY9HQWXUH9DQ(;7SDVVNPZDUUDQW\PSJ 'RGJH'DNRWD6/7(&DE[WRSSHUZDUUDQW\PSJ )RUG([SHGLWLRQ;/7[=ZDUUDQW\PSJ -HHS&KHURNHH6SRUWGU[ZDUUDQW\PSJ )RUG5DQJHU6WHSVLGH6/7ZDUUDQW\PSJ

Most of Our Vehicles are Covered by Lubrico Powertrain Warranty

3ULFHV5HGXFHGa:H7DNH7UDGHV 5HDVRQDEOH2IIHUV&RQVLGHUHG 3+21(&2//(&7)25.(1  $)7(5+2856&HOO

WK6WUHHW²(VWHYDQ6DVN HPDLOVDOHVORQJFUHHNPRWRUV#VDVNWHOQHW

RVS/CAMPERS/TRAILERS

CAREER OPPORTUNITIES

FOR SALE: 2007 - 27 ft. Trailer. Fully loaded. Light weight, Slideout. Sleeps 6. Air, TV. Please call 388-2967.

DRIVERS WANTED: Terrific career oppor tunit y outstanding growth potential to learn how to locate rail defects. No Experience Needed!! Extensive paid travel, meal allowance, 4 wks. vacation & benefits pkg. Skills Needed Ability to travel 3 months at a time Valid License w/ air brake endorsement. High School Diploma or GED. Apply at www.sperryrail.com under careers, keyword Driver. DO NOT FILL IN CITY OR STATE

Call The Southeast Trader Express at 634-2654 to place your ad today!

Try the Classifieds!

DOMESTIC CARS

Page 19

DOMESTIC CARS

8VHG&DUV

&+5<6/(5NPV &+(9<&259(77(NPV 3217,$&*5$1'35,;*76XSHUFKDUJHGEURQ]H NPV +21'$&,9,&(;%ODFNNPV 0,768%,6+,/$1&(5%ODFNNPV $8',$/%ODFNNPV

8VHG7UXFNV689V 9DQV &$',//$&(6&$/$'(:KLWHNPV

&+(9<7$+2(NPV -((33$75,276LOYHUNPV &+(9<6,/9(5$'2NPV 5$0&5(:/21*%2;7DQNPV -((3&200$1'(563257/HDWKHUNPV )25'(6&$3(;/75HGNPV -((33$75,275HGNPV -((33$75,2763257NPV )25'(6&$3(;/7NPV &+(96,/9(5$'2&5(:&$%/6:KLWHNPV &+(96,/9(5$'2&5(::KLWHNPV )25'('*(/7'NPV &+(9$9$/$1&+(/67DQNPV )25'(6&$3(;/75HGNPV *5$1'&+(52.((',(6(/ '2'*('$.27$NPV )25')/$5,$7%OXHNPV -((3/,%(57</7'5HGNPV '2'*('$.27$&5(:&$%*UH\NPV '2'*(5$048$'&$%'LHVHOEOXHNPV -((3*5$1'&+(52.((/$5('2%ODFNNPV62/' '2'*(5$00(*$&$%%OXHNPV62/' 72<27$781'5$NPV 

+20(2)7+(32:(57($0

.HQVLQJWRQ$YHQXHa(VWHYDQ6DVN 3KRQH ,I\RXKDYHQ¡WVKRSSHG32:(5'2'*(\RXPD\KDYHSDLGWRRPXFK

CAREER OPPORTUNITIES

GENERAL EMPLOYMENT

EMPLOYMENT ALBERTA: Journeyman Sheet Metal Mechanic Field and Shop Fabrication/Refrigeration Mechanic/Plumbers/Pipefitters. Overtime and Benefit Package. Email resumes to: toddw@peacer iverheating.com Fax: 780-624-2190. Contact Todd at 780-624-4140

INTERIOR HEAVY EQUIPMENT OPERATOR SCHOOL No Simulators. In-the-seat training. Real world tasks. Weekly start dates. Job board! Funding options. Apply online www.IHESchool.com 1-866-399-3853

FULL-TIME MEATCUTTER required at Eastalta Co-op in Vermilion. Benefits relocation assistance. Training or experience required. Good references; j.grimwood@eastalta.com. 5013 - 51 Ave., Vermilion, AB, T9X 1B2. Phone 780-853-5335. LO CA L R O C K Y M O U N TA I N HOUSE company looking for day rate and hourly vacuum truck operator. Must have current oilfield tickets and up-to-date drivers abstract. Benefit package. Fax 403845-3903. M AT C O. C l a s s 1 H o u s e h o l d Goods Drivers 2 years experience required. $5000 sign-on bonus. *Terms and conditions apply*. Competitive Wages Contact: Dana Watson dana.watson@matco.ca, Fax 780-484-8800

TRADES HELP REQUIRED IMMEDIATELY GAS FITTER/FURNACE SERVICE TECHNICIAN Full Time in Ft. St. John. Above Average wage potential for qualified person. Send resume to: dphl@telus.net or Fax: 250-787-1320

GENERAL EMPLOYMENT CRIMINAL RECORD? YOU CAN BE ARRESTED, JAILED OR DEPORTED if you enter the United States with a criminal record. A waiver clears you for entry. Call now, toll free: (1-8-NOW-PARDON) 1-866-972-7366. www.RemoveYourRecord.com In business since 1989. HELP WANTED!!! Make up to $1000 a week mailing brochures from home! Helping Home-workers since 2001! Genuine Opportunity! No experience required. Start Immediately! www.themailinghub.com

Looking for a bargain? You can get it for a song in the CLASSIFIEDS!

CAREER TRAINING M E D I CA L T R A N S C R I P T I O N RATED #2 FOR AT-HOME JOBS. Start training today. Graduates are in demand! Enroll now. Take advantage of low monthly payments. 1- 8 0 0 - 4 6 6 - 1 5 3 5 w w w . c a n scr ibe.com admissions@canscribe.com WELL-PAID/LOW-STRESS Career in Massage Therapy. Train without giving up your day job. How? Check out www.mhvicarsschool.com or call 1-866-491-0574 for a free career information package.

Top 10 Albums 1. Usher new entry â&#x20AC;&#x153;Looking 4 Myselfâ&#x20AC;? 2. Rush new entry â&#x20AC;&#x153;Clockwork Angelsâ&#x20AC;? 3. Adele No. 1 â&#x20AC;&#x153;21â&#x20AC;? 4. Josh Turner new entry â&#x20AC;&#x153;Punching Bagâ&#x20AC;? 5. Ed Sheeran new entry â&#x20AC;&#x153;+â&#x20AC;? 6. One Direction No. 6 â&#x20AC;&#x153;Up All Nightâ&#x20AC;? 7. Neil Young with Crazy Horse No. 4 â&#x20AC;&#x153;Americanaâ&#x20AC;? 8. Alan Jackson No. 2 â&#x20AC;&#x153;Thirty Miles Westâ&#x20AC;? 9. Soundtrack No. 15 â&#x20AC;&#x153;Rock of Agesâ&#x20AC;? 10. Waka Flocka Flame new entry â&#x20AC;&#x153;Triple F Life: Fans, Friends & Familyâ&#x20AC;?

ARIES (March 21 to April 19) Aspects favor socializing with family and friends, but an irksome workplace situation could intrude. No use grumbling, Lamb. Just do it, and then get back to the fun times. TAURUS (April 20 to May 20) Thereâ&#x20AC;&#x2122;s still time for you Ferdinands and Fernandas to relax and sniff the roses. But a major work project looms and soon will demand much of your attention through the 23rd. GEMINI (May 21 to June 20) Your enthusiasm persuades even the toughest doubters to listen to what youâ&#x20AC;&#x2122;re proposing. But donâ&#x20AC;&#x2122;t push too hard, or youâ&#x20AC;&#x2122;ll push them away. Moderate for best results. CANCER (June 21 to July 22) Your energy levels are rising, and you feel you can handle anything the job requires. Thatâ&#x20AC;&#x2122;s great. But donâ&#x20AC;&#x2122;t isolate yourself. Keep your door open to your workplace colleagues. LEO (July 23 August 22) A workplace change could lead to that promotion youâ&#x20AC;&#x2122;ve been hoping for. But youâ&#x20AC;&#x2122;ll have to face some tough competition before the Lion can claim his or her share of the goodies. VIRGO (August 23 to September 22) Your rigidity regarding a difficult workplace situation could be the reason your colleagues arenâ&#x20AC;&#x2122;t rushing to your assistance. Try being more flexible in your demands. LIBRA (September 23 to October 22) That uneasy mood could be your Libran inner voice reminding you that while itâ&#x20AC;&#x2122;s great to be

with your new friends, you need to take care not to ignore your old ones. SCORPIO (October 23 to November 21) A sudden spate of criticism could shake the Scorpionâ&#x20AC;&#x2122;s usually high sense of selfconfidence. Best advice: You made a decision you believed in -- now defend it. SAGITTARIUS (November 22 to December 21) Your reluctance to help restart a stalled relationship could be traced to unresolved doubts about your partnerâ&#x20AC;&#x2122;s honesty. Rely on a trusted friendâ&#x20AC;&#x2122;s advice. CAPRICORN (December 22 to January 19) The capricious Sea Goat is torn between duty and diversion. Best advice: Do both. Tend to your workaday chores, then go out and enjoy your well-earned fun time. AQUARIUS (January 20 to February 18) Cutting back on some of your activities for a few days helps restore your energy levels. You should be feeling ready to tackle your many projects early next week. PISCES (February 19 to March 20) A co-worker might be secretly carping about your work to mutual colleagues. But associates will come to your defense, and the situation will ultimately work to your advantage. BORN THIS WEEK: Your ambition makes you a success at whatever you choose to do -- especially if itâ&#x20AC;&#x2122;s in the world of the performing arts. (c) 2012 King Features Synd., Inc.

Quick cold drinks â&#x20AC;˘ Got lots of fresh herbs from your summer garden? Hang bunches upside down in a cool, dry place for a week or so, and then crumble the leaves into small jars. VoilĂĄ: your own dried herbs. â&#x20AC;˘ â&#x20AC;&#x153;Want super-crunchy fries at home? Soak potato pieces in very cold water for an hour (fridge is best, or add ice often); dry and fry. Drain well, dust LIGHTLY with flour and quick-fry one more time for only a minute or so.â&#x20AC;? -- T.C. in Idaho â&#x20AC;˘ If you want to cool your canned drinks quickly, add water to the cooler with a lot of ice, submerge all drinks below the ice line, and wait about 20 minutes. Without the water, it takes much longer. The water extends the surface contact of the ice.

â&#x20AC;˘ To keep your ladder from sinking into soft sand or dirt, put each leg into a can or bucket. It creates a much larger surface area, thereby stabilizing the legs. â&#x20AC;˘ If you run out of bleach, add four tablespoons of hydrogen peroxide to a small load of whites. Send your tips to Now Hereâ&#x20AC;&#x2122;s a Tip, c/o King Features Weekly Service, P.O. Box 536475, Orlando, FL 32853-6475 or e-mail JoAnn at heresatip@yahoo. com. (c) 2012 King Features Synd., Inc.


Page 20

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Rentals

A Space For You!

Contractors 6$/(6 6(59,&( ,167$//$7,21

20(72:1 5(129$7,216/7' 6HUYLQJ6DVNDWFKHZDQ

)UHH(VWLPDWHV /LFHQVHG %RQGHG

Â&#x2021;2IILFH7UDLOHUVÂ&#x2021;6NLG6WHHUVÂ&#x2021; 5RFN7UXFNVÂ&#x2021;'5&UDZOHUV Â&#x2021;0LQL([FDYDWRUV

+(5(

)$&725<',5(&7:,1'2:6 WINDOWS â&#x20AC;˘ Never Paint PVC Windows & Door Frames 6$6.$7&+(:$10$'( â&#x20AC;˘ Sealed Units â&#x20AC;˘ Bay & Bow Windows â&#x20AC;˘ Cladding :,1'2:6 '2256 0$,17(1$1&()5(( SIDING, SOFFIT & FASCIA 6287+(51 */$66 â&#x20AC;˘ Vinyl Siding & Insulation :25.6/7' â&#x20AC;˘ Aluminum SofďŹ t & Fascia Â&#x2021;)LQDQFLQJ$YDLODEOH DOORS â&#x20AC;˘ Steel Entrance Doors â&#x20AC;˘ Aluminum Storm Doors â&#x20AC;˘ Patio Doors â&#x20AC;˘ Garden Doors

 5(12  

0HPEHURI &KDPEHURI &RPPHUFH

Insulation & Drywall

Contact us for ALL of your renovation needs

635$<32/<85(7+$1( )2$0,168/$7,21

â&#x20AC;˘ New Construction & Renovation â&#x20AC;˘ Commercial & Residential â&#x20AC;˘ All types of roofing â&#x20AC;˘ Metal Buildings & Garage Packages

POLARFOAM SOYA Â&#x2021;=HUR2]RQH'HSOHWLRQ  6XEVWDQFH Â&#x2021;(FRORJLFDO,QVXODWLRQ Â&#x2021;+LJK59DOXHSHULQFK Â&#x2021;$GGVVWUHQJWKDQGVXSSRUW

Â&#x2021;'RHVQRWVXSSRUWJURZWKRI  PRXOGV Â&#x2021;$GKHUHVWRZRRGPHWDO  FRQFUHWH

:HDOVRLQVWDOOD&/$66)LUH5DWHGSURGXFW XVHDEOHLQ2LOĂ&#x20AC;HOGDSSOLFDWLRQV

&8)&$&HUWLĂ&#x20AC;HG,QVWDOOHUV

67$5'5<:$// ,168/$7256/7' (VWHYDQ6. 3KRQH )D[  

Hot Shot

â&#x20AC;˘ Windows & Doors â&#x20AC;˘ Fascia â&#x20AC;˘ Soffit â&#x20AC;˘ Decks & Fences â&#x20AC;˘ Seamless Eaves â&#x20AC;˘ Siding â&#x20AC;˘ Metal Cladding

Warren Seeman



5322/(&216758&7,21 5DQG\3RROH 6SHFLDOL]LQJ,Q  Â&#x2021;9LQ\O6LGLQJ  Â&#x2021;6RIILWDQG)DVFLD  Â&#x2021;:LQGRZVDQG'RRUV  Â&#x2021;0HWDO:LQGRZ&ODGGLQJ  DQGPXFKPRUH

$GYHUWLVH

:LQGRZ 6SHFLDOLVWV

,QIRUPDWLRQ &DOO RUHPDLO DGVDOHV#HVWHYDQPHUFXU\FD

Health & Mobility Aids /,)7&+$,56 :$/.(56 (/(&75,&%('6 $1'08&+025(

7UDLOEOD]HU6FRRWHU Â&#x2021;LQ%ODFN7LUHV Â&#x2021;)XOO6XVSHQVLRQ Â&#x2021;'HOX[H/LJKW3DFNDJH Â&#x2021;+3#03+ Â&#x2021;3RZHU6HDWRU/JH%DWWHULHV 23(17+856 6XLWHWK$YH(VWHYDQ VWGRRU6RXWKRI&,%& &$// IRUPHUO\6XQ/LIH%OGJ

72//)5((

Home & Auto Detailing

12:&RQWLQXRXV(DYHVWURXJKLQJ %HDWWKH5XVK DQG%RRN\RXU)5(( (67,0$7(6QRZ

+285'$<6$:((. +276+276(59,&( IRURLOĂ&#x2020;HOGFRPPHUFLDO  DJULFXOWXUDO VHUYLQJ6DVNDWFKHZDQ 0DQLWRED $OEHUWD

+RPH   &HOO  

<HDUVRIH[SHULHQFHEURXJKWWR\RXUKRPH

<%:HW 5RRILQJ/WG â&#x20AC;˘ INSURED â&#x20AC;˘ 10% SENIOR DISCOUNT â&#x20AC;˘ FREE ESTIMATES

Carpentry Daniel Methot Carpentry )URP6PDOO 5HQRYDWLRQVWR &XVWRP7XUQ.H\ +RPHV

 HVWHYDQEXLOGHU#JPDLOFRP )UDPLQJ0RXOGLQJ:LQGRZ 'RRU,QVWDOOV 6WDLUV)ORRULQJ'HFNV)RXQGDWLRQV6LGLQJ

Specializing in flat roof repairs & full installations

<%:HW5RRILQJ/WG & Home Improvement Contractor â&#x20AC;&#x153;The name that keeps you dryâ&#x20AC;? Quality craftmanship at prices that wonâ&#x20AC;&#x2122;t soak you!

Shawn Wells Cell: (306) 461-8849 â&#x20AC;˘ Fax: (306) 388-2594 Box 35, Bienfait, SK. S0C 0M0

ADS DPRQWK

21/<

&DOOWRDGYHUWLVH

PYRAMID HOME & AUTO

WHEN ITâ&#x20AC;&#x2122;S GRIMY, Iâ&#x20AC;&#x2122;LL MAKE IT SHINY BONDED & INSURED HOME & AUTO DETAILING

Phone/FAX: 306-340-0274 Cell/Text: 306-421-4669 www.pyramidcleaningcrew.ca

1521-3rd Street Estevan, SK S4A 0S5

Springwood Homes


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

2XQJUH0HPRULDO5HJLRQDO3DUN

CAREERS

Part-time Bookkeeper tEBZTQFSXFFL tLOPXMFEHFPG2VJDLCPPLTBOEQBZSPMMBOBTTFU tXBHFTOFHPUJBCMF 6HQGUHVXPHVWR -DQLFH$VKZRUWK2053 %R[2XQJUH6.6&= RUID[WR   RUHPDLOMDVKZRUWK#VDVNWHOQHW 3KRQH  

Kelly Panteluk Construction Ltd. has a full time

&ORVLQJ'DWH0RQGD\-XO\

Administrative Assistant position available in the office in Estevan, SK. KPCL is looking for a self-motivated, organized, and conscientious person who will pay attention to detail and is willing to follow directions accurately. The successful applicant will assist with accounts payable and receptionist procedures as well as general office duties including, but not limited to, answering phones, filing, running errands, etc. A valid driverâ&#x20AC;&#x2122;s license is required. Data Entry, Microsoft Excel and Word experience is an asset. Experience with web based applications is an asset. KPCL offers competitive wages, with overtime paid after forty hours per week.

Forward your resume, complete with references to: elly@kpcl.sk.ca Attention: Elly Panteluk

+877¡6

758&.,1*/7' LVORRNLQJIRU

3HUPDQHQW)XOO7LPH7UXFN'ULYHU :LQFKH[SHULHQFHDQDVVHW

3HUPDQHQW)XOO7LPH6ZDPSHU 3HUPDQHQW)XOO7LPH3LFNHU2SHUDWRU &RPSHWLWLYHZDJHV )D[UHVXPHWRRU HPDLOKXWWKROGLQJV#VDVNWHOQHW

No phone calls please.

  )8//7,0()5217&2817(5 0$,17(1$1&(3(5621 DQG

3$577,0(:$6+$77(1'$176 'URSUHVXPHRIIDW

Kitchen Helpers/ Short Order Cooks Tower Cafe is looking for 2 cooks for permanent full-time employment Prepare & cook pizzas, salads, sandwiches as ordered. Set up & stock line to maintain proper levels of ingredients required. Train new staff. Use proper weights & measurements to make/prepare consistent product. Clean equipment & clean line & work area as required. Must be available to work until midnight. $13.00 per hour permanent full time available. Apply in person with resume to

1124 4th Street Estevan

WK6W (VWHYDQ %ULQNR'HYHORSPHQW,QFRD6PLWW\Ň&#x2039;V5HVWDXUDQW(VWHYDQ6. QRZKLULQJIRUWKHIROORZLQJSRVLWLRQV

)RRGDQG%HYHUDJH6HUYHU 9DFDQFLHV

KU)XOOWLPH6RPH+LJK6FKRRO(GXFDWLRQRUKLJKHU1RH[SHULHQFH UHTXLUHG 3URĂ&#x20AC;FLHQF\ LQ (QJOLVK UHTXLUHG 'XWLHV LQFOXGLQJ *UHHW SDWURQV SUHVHQWPHQXVPDNHUHFRPPHQGDWLRQVUHJDUGLQJIRRG EHYHUDJHV7DNH RUGHUVDQGUHOD\WRNLWFKHQDQGEDUVWDII6HUYHIRRGDQGEHYHUDJHV &RRN 9DFDQFLHV

6WDUWLQJ ZDJH KU )XOO WLPH 0LQLPXP +LJK VFKRRO JUDGXDWHG )XQFWLRQDO (QJOLVK    \HDUV H[SHULHQFH LQ FRPPHUFLDO ZHVWHUQ FXLVLQH FRRNLQJUHTXLUHG3UHSDUHDQGFRRNZHVWHUQVW\OHGLVKHVDQGIRRGV3ODQ PHQXVLQFOXGLQJIXVLRQVW\OHGLVKHV(VWLPDWHIRRGUHTXLUHPHQWVDQGFRVWV 7UDLQVWDIILQSUHSDUDWLRQFRRNLQJDQGKDQGOLQJRIIRRG .LWFKHQ+HOSHU 9DFDQFLHV

KU )7 6RPH +LJK 6FKRRO (GXFDWLRQ RU KLJKHU 1R H[SHULHQFH UHTXLUHG %DVLF (QJOLVK UHTXLUHG 'XWLHV LQFOXGH :DVK SHHO DQG FXW YHJHWDEOHV DQG IUXLW &OHDQ DQG VDQLWL]H NLWFKHQ LQFOXGLQJ ZRUN VXUIDFHV VWRUDJHDUHDV6ZHHSDQGPRSĂ RRUV2SHUDWHGLVKZDVKHUVWRZDVKGLVKHV DQGRWKHULWHPVE\KDQG 'D\(YHQLQJDQG:HHNHQGVKLIWIRUDOOSRVLWLRQV 6HQG\RXUUHVXPHWRVPLWW\VHVWHYDQ#JPDLOFRPRU)D[WR

&+(0,&$/'(/,9(5<'5,9(5 (PSOR\HULVVHHNLQJDQLQGLYLGXDOZKRUHVLGHVLQ (VWHYDQWRVDIHO\DQGHIĂ&#x20AC;FLHQWO\GHOLYHUFKHPLFDOVWR YDULRXVRLOĂ&#x20AC;HOGVLWHV9HKLFOHLVSURYLGHG Â&#x2021;$SSOLFDQWVPXVWKDYHDYDOLGFODVVGULYHUVOLFHQVH ZLWKDFOHDQGULYHUVDEVWUDFW RLOĂ&#x20AC;HOGVDIHW\WLFNHWV Â&#x2021;*RRGVRXQGNQRZOHGJHRI6RXWKHDVW6DVNDQGWKH DELOLW\ WR QDYLJDWH SUHGHWHUPLQHG ORFDWLRQV DFFRUGLQJ WR/6'ORFDWLRQV Â&#x2021;%HQHĂ&#x20AC;WSDFNDJHDYDLODEOH

$SSO\WR

6287+(51&+(0,&$/ 6(59,&(6

Page 21

'(/,9(5<'5,9(5 IRU

&DQDGD3RVW0DLO6HUYLFH /HDVH RSHUDWRU UHTXLUHG ZLWK ODWH PRGHO PLQLYDQLQJRRGFRQGLWLRQIRU&$1$'$ 3267PDLOGHOLYHULHVLQWKH&LW\RI(VWHYDQ 3DUWWLPHSRVLWLRQDSSUR[LPDWHO\KRXUV SHU GD\ 0RQGD\ WR )ULGD\$EOH WR ZRUN LQGHSHQGHQWO\DQGDVSDUWRIDWHDP

3OHDVHID[UHVXPHWR $WW´0DQDJHUµ

(TXLSPHQW2SHUDWRU 0LQLPXP\HDUVH[SHULHQFH 'R]HU/RDGHU ([FDYDWRU H[SHULHQFHSUHIHUUHG PXVWEHZLOOLQJWRUHORFDWH 6HDVRQDOWHPSRUDU\IXOOWLPHZRUN -XO\WR6HSWHPEHULQ <XNRQ7HUULWRULHV 3ODFHU*ROG0LQLQJ -DEEHUZRFN\([SORUDWLRQ HPDLORUID[UHVXPHWR

SULGHXSNHHS#QHWVFDSHQHW )D[

7UXH,QWHJULW\'HYHORSHUV,QF ORFDWHGLQ&DUQGXII6N SRVLWLRQVDYDLODEOHIRU&DUSHQWHUV

:DJHVSHUKRXU GHSHQGLQJRQH[SHULHQFHDQG WUDGHVWDWXV $SSOLFDQWVPXVWKDYHDWOHDVW\HDUVRIH[SHUL HQFHLQUHVLGHQWLDOFRQVWUXFWLRQ6DVNDWFKHZDQ MRXUQH\PHQRUDSSUHQWLFHVKLSVWDWXVZRXOGEH DQDVVHWEXWQRWUHTXLUHG$SSOLFDQWVPXVWEH ZLOOLQJWRUHORFDWHWR&DUQGXIIDQGDOVRKDYHD YDOLGGULYHUŇ&#x2039;VOLFHQVH

3OHDVHVXEPLWUHVXPHWR WUXHLQWHJULW\#OLYHFD RUID[   )RUPRUHLQIRUPDWLRQSOHDVHFDOO/HHDW  

'DUF\Â&#x2021; GDUF\P#VDVNWHOQHW

12071PS01

Slickline Division

TOWER CAFĂ&#x2030; Help wanted for 5 food and beverage servers. Full time permanent employment to serve food, greet customers, present menu and bill. Salary $11.00 per hour. Previous experience preferred but not required. Contact Pete at 634-2220 or apply with resume in person.

We are seeking dynamic and motivated Field Assistants for our Estevan location. Do you possess? â&#x20AC;˘ A valid driverâ&#x20AC;&#x2122;s license (minimum Class 5) â&#x20AC;˘ Previous Slickline and E-Line experience is an asset but not required. We are willing train the right candidate! ** Guaranteed Salary, Job Bonuses and Full BeneďŹ ts!** *Successful applicants must be willing to submit to and pass pre-employment testing* Please apply online at: www.pure-energy.ca We thank all applicants for their interest; however, only those considered for an interview will be contacted.


Page 22

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

CAREERS

:;;& #'(.'(*#.' (+#=9= $#04<9>5><=3?;A9 ,04<9>5><=3?;@; 

   .

       /

     ,QVWUXPHQWDWLRQ7HFKV )(' #!))(&#$(!"(($/  '#2$#'(&)($#2"#(##$*&$)'!(&$#.!). "#!.%#)"(#+&!''*'#'-'("'  #($&#2')%&*'#%%&#('#%&$"$(#  '(-%&$&"  #(&(#+(!(&#'#$"")#($#'  #(##2($  #!#('(#&'

        ,QVWUXPHQWDWLRQ$SSUHQWLFHV )(' #!))(&#$(!"(($/

EMPLOYMENT OPPORTUNITY PERMANENT FULL-TIME HYDROVAC OPERATORS â&#x20AC;˘ Require class 3 or class 1 licence â&#x20AC;˘ Safety tickets HYDROVAC SWAMPERS â&#x20AC;˘ Require safety tickets

 '''(###'+(!!$#'(&)($##"#(##(' '  &#($  '(-%&$&"  &###*!$%#' !!'#''&-($$"%!(%%&#('% !'&'%$#($"%!$-"#(6#)'(&!!(&1

6287+($6775$'(5

CONSTRUCTION LTD.

EXCAVATING, SAND AND GRAVEL â&#x20AC;˘ REDE-MIX CONCRETE

Journeymen Electricians and Apprentices PowerTech Industries Ltd. in Estevan is seeking Journeymen Electricians and Apprentices for work in the Estevan and Carnduff areas. Experience: Safety Certificates are needed. 1st Aid/CPR, H2S. Applicants must have a valid driverâ&#x20AC;&#x2122;s license. Full benefits packages and RSP plan. Duties: Day to day electrical construction and maintenance in the oilfield. Wage/Salary Info: Depending on experience & qualifications. To Apply: Fax: (306) 637-2181, e-mail sschoff.pti@sasktel.net or drop off resume to 62 Devonian Street, Estevan, SK.

   /       0

         -RXUQH\PDQ(OHFWULFLDQV *)( $"**)'$%)"#))%0

is looking for individuals to fill the following full time positions:

TRUCK DRIVERS

Competitive wages are offered and a benefit plan is available. Interested individuals can fax, email or drop off resume to:

634-2654

.HYLQ (HFRO(OHFWULF 3HUNLQV6WUHHW RUFDOO

;<<'!$()/()+$/(!),$>:> %$15=:?6?=>4@<B: -15=:?6?=>4@<A< 

is looking for a Substitute

If interested call Gayle

Apply with resume in person to:

%&$('&%&$&"'.+(#,!!#('(-&$&#!)# &(($#1

(;35(66 for the Hillcrest area. July 12, 19, 26 and August 2, 9, 16. 280 papers. Earn $75.60 each week for a total of $453.60.

â&#x20AC;˘ full time Monday to Friday 7am - 4:30 pm â&#x20AC;˘ full benefits including pension â&#x20AC;˘ salary based on experience and ability â&#x20AC;˘ must have valid drivers license

$)+!!#$-+$& #$&"!-'$"%#-%&$*#%&")"#('#

â&#x20AC;˘ 1A licence â&#x20AC;˘ 3A licence â&#x20AC;˘ Resume & driverâ&#x20AC;&#x2122;s abstract required

Carrier

:DUHKRXVH3RVLWLRQ

&&#+!!*#($($'+()&&#(;#&'(2(&##1

Offering competitive wages, benefits available after 3 months. Offering living accomodations.

Email resumes to: extremeexcavating@hotmail.com or fax to: 306â&#x20AC;˘483â&#x20AC;˘2082

7,5('2)6+,)7:25.",55(*8/$5 +2856"/22.,1*)25620(7+,1* 021'$<72)5,'$<"

LABOURERS

6287+($675(*,21$/9,&7,06(59,&(6 (03/2<0(1723325781,7< 2QH\HDUWHUP

9LFWLP6HUYLFHV$VVLVWDQW&RRUGLQDWRU 6RXWKHDVW 5HJLRQDO 9LFWLP 6HUYLFHV LV D QRQSURĂ&#x20AC;W RUJDQL]DWLRQ ZKLFK ZRUNV LQ FRRSHUDWLRQ ZLWK WKH SROLFH WR SURYLGHDVVLVWDQFHWRSHRSOHZKRKDYHEHHQYLFWLPL]HGE\ FULPHRUWUDXPDWLFHYHQWV8QGHUWKHJXLGDQFHRIWKH9LFWLP 6HUYLFHV &RRUGLQDWRU DQG WKH GLUHFWLYH RI WKH 6RXWKHDVW 5HJLRQDO 9LFWLP 6HUYLFHV %RDUG RI 'LUHFWRUV \RX ZLOO EH UHVSRQVLEOHIRUWKHHIIHFWLYHGHOLYHU\RILQIRUPDWLRQUHIHUUDO VXSSRUWDQGDVVLVWDQFHWRSHRSOH7KHSRVLWLRQLVORFDWHG DWWKH(VWHYDQ3ROLFH6HUYLFHDQGZLOOLQFOXGHWUDYHOZLWKLQ WKH(VWHYDQ5&03'HWDFKPHQWDUHD 4XDOLĂ&#x20AC;FDWLRQV Â&#x2021;'HJUHHLQ+XPDQ6HUYLFHVRUFRPELQDWLRQRIHGXFDWLRQ  DQGUHODWHGZRUNH[SHULHQFH3UHYLRXVH[SHULHQFH  ZRUNLQJZLWKYLFWLPVZRXOGEHDQDVVHW Â&#x2021;$ELOLW\WRUHFUXLWWUDLQDQGFRRUGLQDWHYROXQWHHUV Â&#x2021;7KHVXFFHVVIXODSSOLFDQWZLOOEHDEOHWRZRUNZHOOLQD  WHDPHQYLURQPHQWDQGZLOOEHDEOHWRSURPRWHDSRVLWLYH  ZRUNLQJH[SHULHQFH Â&#x2021;3URYHQRUDODQGZULWWHQFRPPXQLFDWLRQRUJDQL]DWLRQDO  VNLOOVDQGFRPSXWHUH[SHULHQFHUHTXLUHG Â&#x2021;0XVWPHHWWKH5&036HFXULW\&OHDUDQFH Â&#x2021;0XVWKROGDYDOLGGULYHU¡VOLFHQFHDQGSURYLGHRZQYHKLFOH Â&#x2021;$ELOLW\WRZRUNĂ H[LEOHKRXUV )RUZDUGUHVXPHWR 6RXWKHDVW5HJLRQDO9LFWLP6HUYLFHV,QF $WWHQWLQ7DUD%DLOH\&RRUGLQDWRU %R[ :H\EXUQ6DVNDWFKHZDQ 6+.   $SSOLFDWLRQ'HDGOLQH 0RQGD\$XJXVWWK

 $*()'"3+.%##'"")'"%$()'*)%$$#$)$$  $)%'$3(*&'+($&&'$)($&'%#%)$  ().&'%'#  $)')$,) $()'*#$))%$$%##*$)%$(  $)$$3)%  $"$)()$'(

    /HYHO $SSUHQWLFHV *)( $"**)'$%)"#))%0  ((()$ %*'$.#$,)""%$()'*)%$$#$)$$)(!(  '$)%  ().&'%'#  '$$$+"%&$(!""($(('.)%%#&")&&'$)(&  ((()$#$)%'$ *$%'&&'$)")'$( "('(&%$)%#&"%.#$)7$*()'"")'2 ''$,""+$)%)%(,)*''$)<$'()3)'$$2 %*,""$ %.,%'!$%'#".(%#&$.&'%+$&'#*#$)($ &'%)('&'%'#(/,)$-""$)().'%'$"*$'))%$2


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

FOOD SERVICE WORKERS

12071AT01

CAREERS

We are accepting resumes for part & full time positions. Duties include: Food preparation, stock and inventory, serving customers, some baking, making sandwiches, operate cash register and be able to give proper change as well as general cleaning and equipment maintenance

Starting wage - $11.01/hr. If you are interested in joining our team apply in person with resume or call: Margaret - Subway 517 - 4th Street, Estevan • 634-6616

®

See career ads online! www.estevanmercury.ca

Page 23

Book Your Career ad today! Call 634-2654


Page 24

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

3HUVRQDO$GPLQLVWUDWLYH 6XSSRUW1HHGHG 6RPHRQHWRSURYLGHJHQHUDOVXSSRUW LQDGPLQVHFWRULQDWLPHO\PDQQHU 0XVWEHGHSHQGDEOHKDUGZRUNLQJ VHOIPRWLYDWLQJ $SSOLFDQWVDUHWRUHSO\WR EDUU\FROHGXW\#JPDLOFRP

Visit us on the web! www.estevanmercury.ca

7XUQEXOO([FDYDWLQJ/WGLVD JURZLQJDQGVXFFHVVIXOFRQVWUXFWLRQ FRPSDQ\KDVVHYHUDORSSRUWXQLWLHV DYDLODEOHLPPHGLDWHO\ 2XUFRPSDQ\KDVDVROLGDQGVDIHUHSXWDWLRQIRUSHUIRUPLQJTXDOLW\ ZRUNDQGLI\RXDUHDWWKHWRSRI\RXUJDPHZHDUHLQWHUHVWHGLQ\RX 2XU FRPSDQ\ KDV KLJK VWDQGDUGV DQG ZLOO SD\ WRS ZDJHV IRU WRS TXDOLW\KLJKO\VNLOOHGDQGH[SHULHQFHGSHRSOH 7KHVHDUHIXOOWLPH\HDUURXQGSRVLWLRQVDQGRYHUWLPHLVDYDLODEOH 7RS ZDJHV EHQHÃ&#x20AC;WV SURÃ&#x20AC;W VKDULQJ DFFRPPRGDWLRQ DVVLVWDQFH DQGPRUH«&RQWDFWXVWRGD\

326,7,216$9$,/$%/(,00(',$7(/<

Â&#x2021;%REFDW2SHUDWRU Â&#x2021;+HDY\'XW\0HFKDQLF Â&#x2021;&RQFUHWH)RUHPDQ)LQLVKHU Â&#x2021;/DERXUHUV

(PDLOGDYHWXUQEXOOH[FDYDWLQJ#VDVNWHOQHW 2U)D[WR

&,7<3$*(

/,)(*8$5'6

0RUHWKDQDJUHDWSD\FKHTXHDFDUHHUZLWKDGLIIHUHQFH 3HUPDQHQW)XOO7LPH3RVLWLRQV 5HTXLUHPHQWV Â&#x2021;&XUUHQW&HUWLÃ&#x20AC;FDWLRQLQ Â&#x2021;1DWLRQDO/LIHJXDUGLQJ6HUYLFHV  %URQ]H&URVV0HGDOOLRQ

Â&#x2021;$VVLVWDQW:DWHU6DIHW\,QVWUXFWRU:6, Â&#x2021;)LUVW$LG&35 Â&#x2021;(QVXUHWKHVDIHW\RI$TXDWLF&HQWUH*XHVWV (QMR\ Â&#x2021;*UHDWZRUNHQYLURQPHQW Â&#x2021;&RQWLQXRXVOHDUQLQJRSSRUWXQLWLHV Â&#x2021;2XWVWDQGLQJEHQHÃ&#x20AC;WSDFNDJH Â&#x2021;:RUNLQJZLWKJUHDWSHRSOH

Â&#x2021;,QVWUXFWOHVVRQVIRUFKLOGUHQDQGDGXOWV DOLNH Â&#x2021;$GPLQLVWHU)LUVW$LGLQWKHHYHQWRIDQ HPHUJHQF\ Â&#x2021;.HHSHQYLURQPHQWFOHDQDQGIUHHRI KD]DUGV

$SSO\WR .HOYLQ3LOOLSRZ+XPDQ5HVRXUFHV )RXUWK6WUHHW(VWHYDQ6.6$: 3KRQHÂ&#x2021;)D[ (PDLOKU#HVWHYDQFD

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

(67(9$17+((1(5*<&,7<

Outdoor Fire Pit Safety

With summer just around the corner, itâ&#x20AC;&#x2122;s time for families to enjoy an evening around their backyard fire pits. To ensure your summer fun is not dampened, keep in mind a few fire safety tips while using your outdoor fire pit. -Many people are allergic to smoke, so be courteous to your neighbours and donâ&#x20AC;&#x2122;t allow smoke from your fire to interfere with their enjoyment of the outdoors. -Keep your fire manageable. Large fires can give off excessive amounts of heat, which could easily ignite surrounding combustible materials (fences, decks, sheds). -Never start a fire in your pit with flammable liquids. Remember your boy scout days, and start it with small kindling. -Small children should always be kept a safe distance from the fire pit. -Keep a garden hose nearby, just in case hot embers do escape. -Never leave your fire unattended. Before you retire for the evening, soak your fire down with water to ensure all hot embers are completely extinguished. -A permit is required for all outdoor fire pits. Theyâ&#x20AC;&#x2122;re free. Just drop by the Fire Hall for a permit application. -If requested to extinguish your fire by a City Official (Police or Fire), please do so immediately. Failure to comply will result in a revoked permit, and a fee for service should the Fire Department be called to extinguish it on your behalf. Be fire safe and enjoy your fire pit this summer.

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

&LW\RI(VWHYDQ 38%/,&127,&( 7KH&RXQFLORIWKH&LW\RI(VWHYDQSXUVXDQWWR6HFWLRQRIWKH3ODQQLQJDQG'HYHORSPHQW$FWJLYHVQRWLFHRI LWVLQWHQWLRQWRDPHQG=RQLQJ%\ODZ WKHFRUUHVSRQGLQJ=RQLQJ0DSDVKHUHLQDIWHUSURYLGHG  7RUHSHDO%\ODZ  7RUH]RQHWKHIROORZLQJSURSHUW\DVGHVFULEHGEHORZ D    

6XUIDFH3DUFHO1XPEHUORFDWHGLQWKH1RUWKZHVW4XDUWHU6HFWLRQ7RZQVKLS 5DQJH:HVWRIWKH6HFRQG0HULGLDQ(VWHYDQ6DVNDWFKHZDQWREHUH]RQHGWRWKHIROORZLQJ ]RQHGHVLJQDWLRQVLQDFFRUGDQFHZLWKD3ODQRI3URSRVHG6XEGLYLVLRQSUHSDUHGE\7KRPDV 6DPVRQ6/60LGZHVW6XUYH\V,QFDQGGDWHG-XQH

L 

Residential Low Density-Single Detached Zone (R1) Â&#x2021; %ORFNV05

LL 

Residential Medium Density Zone (R3) Â&#x2021; %ORFNV

LLL Residential Manufactured Home Neighborhood Zone (R6)  Â&#x2021; %ORFNV05050505 LY Residential High Density Mixed-Use Zone (R4)  Â&#x2021; %ORFNV0505 Reason7KH%\ODZLVLQWHQGHGWRVXSSRUWSURSRVHGFKDQJHVIRUDSODQQHG¶PL[HGXVH·5HVLGHQWLDOVXEGLYLVLRQ QHLJKERUKRRGGHYHORSPHQWNQRZQDV´WKH0HDGRZVµ7KH%RXQGDULHVRIWKHYDULRXVSURSRVHG]RQLQJGHVLJQDWLRQVDUH VKRZQRQWKHDFFRPSDQ\LQJSODQ 7KHDPHQGLQJ%\ODZ  PD\EHLQVSHFWHGE\DQ\SHUVRQDWWKH/HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ&LW\ +DOOWK6WUHHW(VWHYDQ6DVNDWFKHZDQEHWZHHQWKHKRXUVRIDPSP0RQGD\WR)ULGD\ &LW\&RXQFLODWLW·VPHHWLQJWREHKHOGRQ0RQGD\-XO\DWSPLQWKH&RXQFLO&KDPEHUV&LW\+DOO )RXUWK6WUHHW(VWHYDQ6DVNDWFKHZDQZLOOKHDUDQ\SHUVRQ V ZLVKLQJWREHKHDUGZLWKUHVSHFWWRWKHSURSRVHG UH]RQLQJE\ODZDQGZLOOIXUWKHUFRQVLGHUDQ\ZULWWHQVXEPLVVLRQVUHVSHFWLQJWKHSURSRVHG]RQLQJDPHQGPHQWSURYLGHG VXFKLQWHQWLRQVDQGRUVXEPLVVLRQVDUHUHFHLYHGE\WKH&LW\&OHUN·V2IÃ&#x20AC;FH/HJLVODWLYH6HUYLFHV&LW\+DOO)RXUWK 6WUHHW(VWHYDQ6DVNDWFKHZDQ6$:QRODWHUWKDQSPRQ:HGQHVGD\-XO\ 'DWHGDWWKH&LW\RI(VWHYDQWKLVWK'D\RI-XQH

Journeyman Electrician

7D[1RWLFHV 7D[1RWLFHVZHUHPDLOHGRXWRQ7KXUVGD\-XQH ,I\RXKDYHQRWUHFHLYHG\RXUQRWLFHSOHDVHFRQWDFW7ULQDDW  7D[HVDUHGXHRQ-XO\ 3HQDOWLHVDUHDFFXPXODWLYHDQGVWDUW$XJXVWVWLQWKH DPRXQWRI6HSWHPEHU2FWREHU1RYHPEHU 'HFHPEHU$UUHDUV3HQDOW\RIZLOOEHDGGHG WRDOORXWVWDQGLQJDPRXQWVRQ-DQXDU\

The City of Estevan is searching for a reliable self-starter who is independent, has initiative and takes pride in their trade. What weâ&#x20AC;&#x2122;re looking for; â&#x20AC;¢ Licenced Interprovincial Journeyman Electrician â&#x20AC;¢ Proficiency in Computer Software â&#x20AC;¢ Monday to Friday availability - occassional weekends for special events â&#x20AC;¢ Driverâ&#x20AC;&#x2122;s Licence - Class 5 Kelvin Pillipow, Human Resources Co-ordinator We offer; 1102-4th Street â&#x20AC;¢ Great schedule with varied duties Estevan, SK S4A 0W7 â&#x20AC;¢ Strong work life balance P: (306) 634-1842 â&#x20AC;¢ Competitive wage F: (306) 634-9790 â&#x20AC;¢ Great people to work with hr@estevan.ca

3/($6(&$//,1 :DWHU0HWHU5HSODFHPHQWLQWKH3OHDVDQWGDOH$UHD 7KH&LW\RI(VWHYDQZLOOEHFKDQJLQJWKHZDWHUPHWHUVIRUDOOWKRVHUHVLGHQWVWKDWGRQRWFXUUHQWO\ KDYHUDGLRUHDGPHWHUV7KHUHLVQRIHHIRUWKLVVHUYLFHKRZHYHUZHUHTXHVWWKDW\RXFDOO&LW\ +DOOWRPDNHDQDSSRLQWPHQWWRDUUDQJHDWLPHWKDWLVFRQYHQLHQWIRU\RX3OHDVHFDOO$SULODW WRVHWXSDQDSSRLQWPHQWWRGD\

&LW\RI(VWHYDQ 38%/,&127,&( 7KH&RXQFLORIWKH&LW\RI(VWHYDQSXUVXDQWWR6HFWLRQRIWKH3ODQQLQJDQG'HYHORSPHQW$FWJLYHVQRWLFHRI LWVLQWHQWLRQWRDPHQG=RQLQJ%\ODZ WKHFRUUHVSRQGLQJ=RQLQJ0DSDVKHUHLQDIWHUSURYLGHG &RQVLGHUDWLRQLVEHLQJJLYHQWRDPHQGWKH=RQLQJ%\ODZ0DSE\UH]RQLQJWKHIROORZLQJSURSHUW\DV GHVFULEHGEHORZ ´$OOWKDWSRUWLRQRIWKH1RUWKHDVW4XDUWHU6HFWLRQ7RZQVKLS5DQJH:HVWRIWKH6HFRQG0HULGLDQ (VWHYDQ6DVNDWFKHZDQHQFRPSDVVLQJDSSUR[LPDWHO\KHFWDUHVDVVKRZQRQD3ODQRI3URSRVHG 6XEGLYLVLRQSUHSDUHGE\60'UHZ6/6DQGGDWHGWKHWK'D\RI-XQHµWREHUH]RQHGDVIROORZV D 3URSRVHG/RWV Â&#x2039; WKURXJK%ORFN Â&#x2039; WKURXJK%ORFN Â&#x2039; WKURXJK%ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR5(6,'(17,$//2:'(16,7<6,1*/('(7$&+('=21( 5  E 3URSRVHG/RWV Â&#x2039; DQG%ORFN Â&#x2039; WKURXJK%ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR5(6,'(17,$//2:'(16,7<0,;=21( 5  F 3URSRVHG/RWV Â&#x2039; %ORFN Â&#x2039; %ORFN Â&#x2039;  %ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR5(6,'(17,$/0(',80'(16,7<=21( 5  F 3URSRVHG/RWV Â&#x2039; %ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR&200(5&,$/$57(5,$/+,*+:$<=21( &  F 3URSRVHG/RWV Â&#x2039; %ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR,167,787,21$/=21( ,1  5HDVRQ5H]RQLQJLVEHLQJXQGHUWDNHQWRVXSSRUWWKHSURSRVHGGHYHORSPHQWRIWKH'RPLQLRQ+HLJKWV3KDVH 6XEGLYLVLRQ %RXQGDULHVRI5H]RQLQJDUHVKRZQRQWKHDFFRPSDQ\LQJ3ODQ

7KHDPHQGLQJ%\ODZ  PD\EHLQVSHFWHGE\DQ\SHUVRQDWWKH/HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ&LW\ +DOOWK6WUHHW(VWHYDQ6DVNDWFKHZDQEHWZHHQWKHKRXUVRIDPSP0RQGD\WR)ULGD\ &LW\&RXQFLODWLW·VPHHWLQJWREHKHOGRQ0RQGD\-XO\DWSPLQWKH&RXQFLO&KDPEHUV&LW\+DOO )RXUWK6WUHHW(VWHYDQ6DVNDWFKHZDQZLOOKHDUDQ\SHUVRQ V ZLVKLQJWREHKHDUGZLWKUHVSHFWWRWKHSURSRVHG UH]RQLQJE\ODZDQGZLOOIXUWKHUFRQVLGHUDQ\ZULWWHQVXEPLVVLRQVUHVSHFWLQJWKHSURSRVHG]RQLQJDPHQGPHQWSURYLGHG VXFKLQWHQWLRQVDQGRUVXEPLVVLRQVDUHUHFHLYHGE\WKH&LW\&OHUN·V2IÃ&#x20AC;FH/HJLVODWLYH6HUYLFHV&LW\+DOO)RXUWK 6WUHHW(VWHYDQ6DVNDWFKHZDQ6$:QRODWHUWKDQSPRQ:HGQHVGD\-XO\ 'DWHGDWWKH&LW\RI(VWHYDQWKLVWK'D\RI-XQH LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

Page 25

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


Page 26

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

Ever wonder what happens at a major event? Do you want to make extra money? No plans for the weekend? We are searching for Events staff to assist with the set-up/tear down, seating and parking for events held at Spectra Place.

We offer: â&#x20AC;¢ Opportunity to meet great people â&#x20AC;¢ Flex scheduling â&#x20AC;¢ Chance to be part of the show experience

Do you: â&#x20AC;¢ Have an attention to detail â&#x20AC;¢ Thrive in a fast paced environment â&#x20AC;¢ Work well under pressure â&#x20AC;¢ Enjoy tight deadlines

Be part of a great team, apply to: Kelvin Pillipow, Human Resources Manager 1102 4th Street, Estevan, SK S4A 0W7 E-mail: hr@estevan.ca Phone (306)461-5905

6XPPHU&DPSDWWKH($*0 $UH\RX"$UH\RXH[FLWHGDERXWPDNLQJDZHVRPH DUW"7KHQWKH(VWHYDQ$UW*DOOHU\DQG0XVHXPKDV H[FLWLQJQHZVIRU\RX:HÒ&#x2039;UHUXQQLQJWKUHHDPD]LQJ VXPPHUDUWFDPSVDQGZHZDQW<28WRFRPHMRLQXV %HJLQQHU%DVLF -XO\SPSP ZLOOKHOS\RXFUHDWHGLIIHUHQWNLQGVRIDUWOLNHGUDZLQJ SKRWRJUDSK\DQGVFXOSWXUH,WÒ&#x2039;VDQDUWH[WUDYDJDQ]D ([SORULQJ$UW+LVWRU\ -XO\DPQRRQ25SPSP LVDQDGYHQWXUHWKURXJKWLPHWR LPSRUWDQWDUWVW\OHVSHULRGVDQGDUWLVWVWKDW\RXZLOOJHWWKHFKDQFHWRUHFUHDWHLQ\RXUYHU\ RZQPDVWHUSLHFHV ,QFUHGLEOH,QVWDOODWLRQV -XO\DPQRRQ25SPSP ZLOOOHW\RXZRUNZLWK\RXUSHHUV WR OHDUQ DERXW LQVWDOODWLRQ DUW DQG FUHDWH \RXU YHU\ RZQ H[KLELW HQYLVLRQLQJ WKH IXWXUH RI (VWHYDQ:HÒ&#x2039;OOKDYHDQRSHQLQJMXVWIRU\RXUZRUNRQ+HULWDJH'D\-XO\DWSPDQG\RXU ZRUNZLOOKDQJLQWKHJDOOHU\IRUDOORI$XJXVW

Warning Signs of Tornadoes: â&#x20AC;¢ Severe thunderstorms with frequent thunder and lightning â&#x20AC;¢ An extremely dark sky sometimes highlighted by green or yellow clouds â&#x20AC;¢ A rumbling sound, such as a freight train or a whistling sound similar to a jet aircraft â&#x20AC;¢ A funnel cloud at the rear of a thunder cloud often behind a curtain of heavy rain or hail  What to Do During a Tornado:  If you are near a building: 1. Listen to your radio during severe thunderstorms 2. If a Tornado Warning has been issued take cover immediately. 3. Go to the basement or take shelter in a small interior ground floor room, closet or hallway. 4. Protect yourself by sitting under a heavy table or desk. 5. Stay away from windows and outside walls and doors. 6. Do not use elevators. 7. Avoid large halls, churches, arenas etc.: their roofs are more likely to collapse. 8. Stay close to the ground, protect your head and hide from flying debris. If you are driving: 1. If you are driving try to get to a nearby shelter â&#x20AC;&#x201C;drive away from the tornado at a right angle. 2. Do not get caught in a car or mobile home â&#x20AC;&#x201C; take shelter elsewhere. If no shelter is available, lie face down in a ditch or culvert away from the vehicle or mobile home. 3. If a tornado seems to be standing still, it is either traveling away from you or heading right for you. 4. Stay close to the ground, protect your head and hide from flying debris.zv Hail: Hail forms when updrafts in thunderclouds carry raindrops upwards into extremely cold areas and freeze layer upon layer until they are too heavy and fall to the ground Hailstones vary in size from peas to grapefruits and fall at great speed. People have been seriously injured by hailstones. What to Do When It Hails: 1. Take cover when hail begins to fall. 2. Do not go out to cover plants, cars or garden furniture or to rescue animals. For more information regarding Emergency Preparedness, please contact Helen Fornwald, EMO Coordinator at 634â&#x20AC;&#x201C;1860. 

&RQVWUXFWLRQ%XOOHWLQ

7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQFUHWHZRUNDQGURDGZRUNVDW 'XQFDQ 5RDG ² 3HUU\ &UHVFHQW WR 0F'RQDOG 5RDG 7KH SXUSRVH RI WKLV ZRUN LV WR SURYLGH WLPHO\ DQG FRVW HIIHFWLYHUHSODFHPHQWRIH[LVWLQJFDVWLURQZDWHUPDLQZLWK39&SLSHUHSODFHPHQWRIH[LVWLQJZDWHUDQGVDQLWDU\ VHZHUVHUYLFHVIURPZDWHU VHZHUPDLQXSWRWKHSURSHUW\OLQHDQGVXUIDFHUHVWRUDWLRQ7KLVZRUNZRXOGUHTXLUH FORVXUHRILPPHGLDWHDUHDVRIH[FDYDWLRQDQGPD\QHFHVVLWDWHSDUNLQJUHVWULFWLRQLQDGMDFHQWDUHDV7KLVZRUN ZLOOFRPPHQFHGXULQJWKHZHHNRI-XQHDQGZLOOWDNHDSSUR[LPDWHO\(LJKW  WR7HQ  :HHNVWR FRPSOHWH VXEMHFWWRZHDWKHU *OHQ3HWHUVRQ&RQVWUXFWLRQ/WGZLOOSHUIRUPWKLVZRUNZLWKLQWKHFXUUHQW%\ODZ UHJXODWLRQV :RRGODZQ5HVHUYRLU 7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQVWUXFWLRQRID7UHDWHG'ULQNLQJ:DWHU5HVHUYRLU 7KHDIIHFWHGDUHDLQFOXGHV7KH:RRGODZQ$YHQXH5LJKWRI:D\1RUWKRIWKH6W-RVHSK·V+RVSLWDO 7KLV5LJKWRI:D\LVQRWDWKRXJKURDGDQGQRWUDIÃ&#x20AC;FZLOOEHDOORZHGLQWKHDUHDWKDWLVQRWLQYROYHGZLWKWKHUHVHUYRLU FRQVWUXFWLRQ 7KLVZRUNZLOOFRPPHQFH0DUFKDQGZLOOWDNHDSSUR[LPDWHO\WHQ  PRQWKVWRFRPSOHWH /HGFRU&RQVWUXFWLRQ/WGDQG-9 0&RQVWUXFWRUV,QFZLOOSHUIRUPWKLVZRUNZLWKLQWKHFXUUHQW%\ODZUHJXODWLRQVDQG VSHFLÃ&#x20AC;FDWLRQV &RQVWUXFWLRQRQ$OH[DQGUD$YHQXH .LQJ6WUHHWWR+HQU\6WUHHW

7KLVZRUNZRXOGUHTXLUHFORVXUHRILPPHGLDWHDUHDVRIH[FDYDWLRQDQGPD\QHFHVVLWDWHSDUNLQJUHVWULFWLRQLQ DGMDFHQWDUHDV7KLVZRUNZLOOFRPPHQFHGXULQJWKHZHHNRI-XO\DQGZLOOWDNHDSSUR[LPDWHO\WKUHH  WR ZHHNVWRFRPSOHWH VXEMHFWWRZHDWKHU 

5HJLVWHU 12:  2QO\  SHU ZHHN SHU FKLOG  &DOO XV DW  HPDLO .DUO\ DW JDOOHU\HG#VDVNWHOQHWRUFRPHWRWKH($*0DWWK6W5HJLVWHUHDUO\VSDFHLVOLPLWHG

(VWHYDQ$UW*DOOHU\DQG0XVHXP*DUDJH6DOH)XQGUDLVHU )ULGD\-XO\WKDP²SP 6DWXUGD\-XO\WKSP²SP 'RQÒ&#x2039;WPLVVWKLVWKUHHGD\JDUDJHVDOHHYHQWDWWKH($*0ORFDWHGDW²WK6WUHHW7RQVRI IXUQLWXUHERRNVIROGLQJFKDLUVDQGWDEOHVDUWVXSSOLHVFORWKHVKRPHGHFRUNLWFKHQLWHPV DQGPXFKPXFKPRUH,I\RXÒ&#x2039;UHWLUHGRI\RXURZQFOXWWHUIHHOIUHHWRPDNHDGRQDWLRQWRRXU VDOH:HZLOOEHDFFHSWLQJGRQDWLRQVXQWLO-XQHWK'RQÒ&#x2039;WPLVVRXWRQWKHEHVWJDUDJHVDOH DQGWKHEHVWGHDOVRIWKHVXPPHU &RQWDFW.DUO\DWIRUPRUHLQIRUPDWLRQ

&,7<2)(67(9$1127,&( People are reminded that boulevards cannot be used for parking of any private property such as but not limited to the following: Ã&#x2DC;  Boats Ã&#x2DC;  Vehicles Ã&#x2DC;  Campers Ã&#x2DC;  Skidoos Ã&#x2DC;  Trailers Ã&#x2DC;  Quads Ã&#x2DC;  Fishing Shacks As well, people are reminded that City property cannot be used for any purpose such as storing construction materials, dirt or materials while working on your own property without permission from the City and that permits are required from Engineering Division for any work being done on City Property .  For further information contact 306-634-1800 and your co-operation is appreciated.

6833257:25.(561(('(' 6RXWKHDVW5HJLRQDO9LFWLP6HUYLFHVLVORRNLQJIRUYROXQWHHUVLQWKH(VWHYDQ&LW\3ROLFH(VWHYDQ 5&03 GHWDFKPHQW DUHD WR ZRUN ZLWK YLFWLPV RI FULPH DQG WUDXPDWLF HYHQWV E\ SURYLGLQJ LQIRUPDWLRQDGYRFDF\VXSSRUWDQGUHIHUUDO9LFWLP6HUYLFHVLVDSROLFHDIÃ&#x20AC;OLDWHGSURJUDP 7KHIROORZLQJTXDOLÃ&#x20AC;FDWLRQVDUHQHHGHG \HDUVRIDJHRUROGHU SDVVDSROLFHVHFXULW\VFUHHQLQJDQGWDNHDQRDWKRIFRQÃ&#x20AC;GHQWLDOLW\ VLQFHUHLQWHUHVWLQDQGWKHDELOLW\WRZRUNZLWKSHRSOH VXFFHVVIXOO\FRPSOHWHLQLWLDOWUDLQLQJSURJUDPDQGSDUWLFLSDWHLQRQJRLQJWUDLQLQJDQG VWDIIPHHWLQJV 7UDLQLQJLVSURYLGHGIUHHRIFKDUJH )XQGHGE\6DVNDWFKHZDQ-XVWLFH )RUIXUWKHULQIRUPDWLRQSOHDVHFDOO

6DIHW\ &RQVWUXFWLRQVLWHFRXOGEHGDQJHURXV,I\RXKDYHFKLOGUHQSOHDVHDVNWKHPWRNHHSDVDIHGLVWDQFHIURPWKHVLWH :HZLOOWDNHHYHU\SUHFDXWLRQWRHQVXUHSXEOLFVDIHW\EXWZHQHHG\RXUDVVLVWDQFHWRFRQVWUDLQWKHQDWXUDOFXULRVLW\ RI\RXQJHUFKLOGUHQ3OHDVH'2127DWWHPSWWRJRFORVHWRDUHDVDIIHFWHG 7KHIWRU9DQGDOLVP ,I\RXVHHDQ\DFWRIYDQGDOLVPWKHIWRUDQ\RQHVXVSLFLRXVO\WDPSHULQJZLWKHTXLSPHQWVLJQDJHRUEDUULFDGHVSOHDVH FRQWDFWFDOO3ROLFH 4XHVWLRQVDQG&RQFHUQV 7KH&LW\RI(VWHYDQ(QJLQHHULQJ6HUYLFHVDSRORJL]HIRUDQ\LQFRQYHQLHQFHVWKDWWKLVZRUNPD\FDXVHDQGWKDQN\RXLQ DGYDQFHIRU\RXUFRRSHUDWLRQDQGSDWLHQFH,I\RXKDYHDQ\TXHVWLRQRUFRQFHUQVSOHDVHFDOODWRUDSSURDFK WKHVXSHUYLVRURUIRUHPDQRQVLWH ´'XULQJDVSKDOWDQGSDYLQJRIURDGVFRXOGDOOFLWL]HQVSOHDVHEHUHVSHFWIXORIFRQVWUXFWLRQVLWHVDQG REVHUYHEDUULFDGHVDQGVLJQDJHIRUWKHLURZQVDIHW\)LQHVZLOOEHLVVXHGWRDOOSHRSOHQRWREH\LQJ WKHUXOHVµ

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

SUMMER SEVERE WEATHER CONDITIONS  Environment Canada monitors the weather 24 hours a day, every day of the year. If a severe storm is on the way, the weather service uses the local media and Environment Canadaâ&#x20AC;&#x2122;s Weather Radio to alert the public. There are two basic types of alerts:  A Weather watch is provided when conditions are favorable for a severe storm to develop. These are usually issued early in the day. It is a good idea to pay attention to the weather and listen to the radio or TV for up-dated information.  A Weather Warning means that severe weather is happening or that severe weather conditions are very likely. A thunderstorm develops in an unstable atmosphere when warm moist air near the earthâ&#x20AC;&#x2122;s surface rises quickly and cools. The moisture condenses to form rain droplets and dark thunder clouds. These storms are often accompanied by hail, lightning, heavy rain, high winds and tornadoes. Thunderstorms are usually over in an hour, although a series of thunderstorms can last for several hours. Lightning â&#x20AC;&#x201C;During a thunderstorm the air is charged with electricity. Bolts of lightning hit the ground at about 40,000 km per second â&#x20AC;&#x201C; so fast that the series of strikes hitting the ground appear as a single bolt.  What To Do When There Is Lightning:  1. Estimate how far away the lightning is. Every second between the flash of lightning and the thunderclap equals 300 meters. If you count fewer than 30 seconds, take shelter immediately. 2. If indoors, stay away from windows, doors, fireplaces, radiators, sinks, bathtubs, appliances, metal pipes, telephones and other things which conduct electricity. (You can use a cell phone) 3. Unplug radios, computers and televisions. 4. Do not go to rescue the laundry on the clothesline as it conducts electricity. If outdoors, take shelter in a building, ditch or a culvert but never under a tree. 5. If caught in the open, do not lie flat but crouch in the leap frog position and lower your head. 6. Do not ride bicycles, motorcycles or golf carts or use metal tools as they conduct electricity. 7. If swimming or in a boat, get back to shore immediately. 8. If you are in a car, stay there but pull away from trees which might fall on you. 9. You may resume activity 30 minutes after the last clap of thunder.  Tornadoes  Tornadoes are violent windstorms identified by their twisting funnel- shaped cloud. They are always produced by thunderstorms, but not every thunderstorm produces a tornado. They travel between 20 to 90 km/h, are erratic and can change course suddenly. Do not chase tornadoes. Tornado Watch means the weather could develop a tornado. Tornado Warning means a tornado has been seen or it is very likely that one will develop shortly.

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

(67(9$16. 7LFNHWVFDQEHSXUFKDVHGWKURXJK WLFNHWPDVWHUÂ&#x160;RQOLQHDWKWWSWLFNHWPDVWHUFD RUWLFNHWPDVWHUÂ&#x160;&KDUJHE\3KRQHDW

6XQGD\$XJXVW 12:216$/( At The Library..... Mondays & Wednesdays @ 3:00, 3:30 & 4:00 pm â&#x20AC;&#x201C; Hello Computer! â&#x20AC;&#x201C; Come and get answers to your computer questions in â&#x20AC;&#x2DC;one-on-oneâ&#x20AC;&#x2122; thirty minute sessions. Bring your own laptop or use a public computer. **When registering please indicate what you would like to learn. Tuesday, 10 July @ 6:00 pm â&#x20AC;&#x201C; Holiday Local! â&#x20AC;&#x201C; Spending the summer in Estevan? Looking for something new and exciting to do? Join Kevin Dâ&#x20AC;&#x2122;Souza from Tourism Estevan for an introduction to all the fun and interesting activities available in the Estevan area. Take the time to discover whatâ&#x20AC;&#x2122;s available in our community and experience how much fun it can be; holiday local! Wednesday, 11 July @ 2:00 pm â&#x20AC;&#x201C; Movie Madness: Dr. Seussâ&#x20AC;&#x2122;s The Lorax & Horton Hears a Who â&#x20AC;&#x201C; Rated PG. Anyone is welcome & no registration is required. Refreshments provided. Thursday, 12 July @ 6:00 pm â&#x20AC;&#x201C; Lucky Charms â&#x20AC;&#x201C; We will be redecorating horseshoes and crafting simple jewelry from meaningful stones and minerals. If you already have a good luck charm, bring it along. We will watch video clips on the origins of Friday the 13th and old superstitions. There will also be trivia and a chance to win other lucky items! Families welcome. Tuesday, 17 July @ 5:30 pm â&#x20AC;&#x201C; Silverware Wind Chimes â&#x20AC;&#x201C; Need to liven up your porch? Come make a beaded silverware wind chime at the library. It could be just the unique touch youâ&#x20AC;&#x2122;re looking for! Call 636-1621 to register. Adults only. Wednesday, 18 July @ 1:00 to 4:30 pm â&#x20AC;&#x201C; Go! Science â&#x20AC;&#x201C; For children Grades K-5. Take a quest through these three Summer programs with the Saskatchewan Science Centre in a fun, interactive learning environment & make-and-takehome craft! 1. Undiscovered Territories, 2. Kinetic concoctions, 3. Fantastical machines. Thursday, 19 July @ 6:30 pm â&#x20AC;&#x201C; Cover to Cover Book Club â&#x20AC;&#x201C; This month we will be discussing Bossypants, an autobiographical comedy by American comedian Tina Fey. From her humble roots to her early sketches on Saturday Night Live, Fey gives us a fascinating glimpse behind the curtain of modern comedy with equal doses of wit, candor, and selfdeprecation. There will be no Baby Time, Toddler Time or Story Time Programs for July & August. Regular sessions will start in September. The Library will be closed July 2. Effective 17 June, we will be closed Sundays during the summer months. Please pre-register for all programs unless otherwise indicated. Call 636-1621.

KWWSVSHFWUDSODFHFD KWWSIDFHERRNFRP6SHFWUD3ODFH KWWSWZLWWHUFRP6SHFWUD3ODFH

32/,&(&2167$%/( 7KH(VWHYDQ3ROLFH6HUYLFHZDVHVWDEOLVKHGLQDQGKDVEHHQEXLOWRQDWUDGLWLRQRIH[FHOOHQFH 7KH&LW\RI(VWHYDQKDVH[SHULHQFHGDJUHDWGHDORIJURZWKLQWKHSDVWWKUHH\HDUVHVSHFLDOO\LQWKH HQHUJ\VHFWRULQFOXGLQJRLOFRDOPLQLQJDQGSRZHUJHQHUDWLRQ7KLVJURZWKDQGHFRQRPLFERRPKDV FUHDWHGVHYHUDOFKDOOHQJHVZLWKLQWKH&LW\RI(VWHYDQLQFOXGLQJWKH3ROLFH6HUYLFH 7KH (VWHYDQ 3ROLFH 6HUYLFH LV LQFUHDVLQJ WKH VL]H RI WKH 3ROLFH 6HUYLFH DQG FXUUHQWO\ KDV WZR YDFDQFLHV IRU WKH SRVLWLRQ RI &RQVWDEOH 7KH (VWHYDQ 3ROLFH 6HUYLFH KDV D ULJRURXV DSSOLFDWLRQ SURFHVVKRZHYHUWKLVSURFHVVLVWRHQVXUHWKDWWKHSHRSOHZHKLUHWRZHDUWKH(VWHYDQ3ROLFH6HUYLFHXQLIRUP DUHWKHULJKWSHRSOHIRUWKHMRE ,I\RXDUHKLUHGDVDQHZUHFUXLW\RXZLOOHQWHUDULJRURXVWUDLQLQJSHULRGRIZHHNV7KHĂ&#x20AC;UVWZHHNVZLOO EHDWWKH6DVNDWFKHZDQ3ROLFH&ROOHJHLQ5HJLQD6DVNDWFKHZDQZKHUH\RXZLOOUHFHLYHLQVWUXFWLRQLQFULPLQDO ODZ RIĂ&#x20AC;FHU VDIHW\ VHOI GHIHQFH Ă&#x20AC;UHDUPV UHSRUW ZULWLQJ DQG FURVV FXOWXUDO WUDLQLQJ $IWHU JUDGXDWLQJ IURP WKH 3ROLFH&ROOHJH\RXZLOOUHFHLYHDIXUWKHUZHHNVRIĂ&#x20AC;HOGWUDLQLQJXQGHUWKHJXLGDQFHRID)LHOG7UDLQLQJ2IĂ&#x20AC;FHU ([SHULHQFHGPHPEHUVDUHHQFRXUDJHGWRDSSO\7KH(VWHYDQ3ROLFH6HUYLFHRIIHUVDQH[FLWLQJFDUHHULQODZ HQIRUFHPHQWZLWKH[FHOOHQWEHQHĂ&#x20AC;WVDQGDFRPSHWLWLYHVDODU\

COMMUNICATIONS OFFICER (Dispatcher)

Duties and Responsibilities: The successful candidate will demonstrate excellent interpersonal communication skills. This person will handle incoming telephone calls, general public inquiries and complaints, and will communicate via radio transmissions with members on patrol. Must be able to work independently under stress as well as produce a high degree of accuracy.

7RDSSO\RUUHFHLYHIXUWKHULQIRUPDWLRQSOHDVHVHHFRQWDFWLQIRUPDWLRQEHORZ $SSOLFDWLRQSDFNDJHVFDQEHSLFNHGXSDWWKH(VWHYDQ3ROLFH6HUYLFHRUPDLOHGRXWXSRQUHTXHVW 3OHDVHUHWXUQWKHFRPSOHWHGSDFNDJHZLWKDQXSGDWHGUHVXPHLQDVHDOHGHQYHORSHWR

(VWHYDQ3ROLFH6HUYLFH

7LSRIWKH:HHN $FFRUGLQJWR6HFWLRQ  RIWKH7UDIĂ&#x20AC;F6DIHW\$FW1RSHUVRQVKDOORSHUDWHDPRWRUYHKLFOH WUDLOHURUVHPLWUDLOHURQDKLJKZD\XQOHVVDFHUWLĂ&#x20AC;FDWHRIUHJLVWUDWLRQRUUHJLVWUDWLRQSHUPLWLV REWDLQHGSXUVXDQWWRWKLV$FWZLWKUHVSHFWWRWKHYHKLFOH WKLVDOVRDSSOLHVLI\RXUYHKLFOHWUDLOHU RUVHPLWUDLOHULVSDUNHGRQWKHVWUHHWRUKLJKZD\ )LQHVIRUWKLVRIIHQFHFDQEHXSWR IRUYHKLFOHV DQG IRUXQUHJLVWHUHGWUDLOHUV DQG\RXUYHKLFOHPD\EHVHL]HGXQGHU 6HFWLRQRIWKH7UDIĂ&#x20AC;F6DIHW\$FW  $FFRUGLQJWR%\ODZ6HFWLRQ$1RSHUVRQVKDOOULGHDVNDWHERDUGRQWKHIROORZLQJ VWUHHWV )URPWKDYHQXHWRWKDYHQXH )URPUGVWUHHWWRWKVWUHHW 1RSHUVRQVKDOOULGHDVNDWHERDUGRQDQ\SULYDWHRUSXEOLFSURSHUW\RQZKLFK VLJQVDUHORFDWHGSURKLELWLQJVNDWHERDUGLQJ $Q\3ROLFH2IĂ&#x20AC;FHUPD\LPSRXQGDQ\VNDWHERDUGWKDWLVXVHGLQFRQWUDYHQWLRQWRWKLV6HFWLRQ$Q\ VNDWHERDUGLPSRXQGHGVKDOOEHVWRUHGDWDQ\SODFHDXWKRUL]HGE\WKH3ROLFH&KLHIIRUDQ\SHULRG QRWH[FHHGLQJGD\VIURPWKHGDWHRILPSRXQGPHQW

:+$7Ň&#x2039;6+$33(1,1* $77+((67(9$1$576&281&,/ :HDUHEDFNRQWUDFN &XOWXUHRQWKH*R9LVXDO$UWV6WXGLR ´6HOI*XLGHGÂľ7RXU /HWXVLQWURGXFH\RXWRORFDOWDOHQWHGDUWLVWV *DOOHULHV6WXGLRVDQG´DUWRULHQWHGÂľEXVLQHVVHV &KRRVHWKHGD\DQGWLPHWKDWVXLWV\RX -8/<²²6LWHVRSHQIURP²SPHDFKGD\ 3LFNXS\RXUEURFKXUHJXLGHDW7RXULVPDQGEHJLQWKHWRXUIURPHLWKHUWKH (VWHYDQ7RXULVP%RRWKRUIURPWKH1RUWK3RUWDO7RXULVP%RRWK

&ODVVHV :RUNVKRSV6WDUWXSLQ$XJXVW Â&#x2021;6FUHHQ3ULQWLQJZLWK$VWULG3KLOOLSV²$XJXVW Â&#x2021;5RVHPDOLQJ 6FDQGLQDYLDQDUWVW\OHRISDLQWLQJRQZRRG

ZLWK&KHU\O$QGULVW²2FWREHU  Â&#x2021;:RRGFDUYLQJZLWK'RULV6KHOGRQ ZZZFRWWDJHBFRXQWU\FDUYLQJFRP ²1RY  Â&#x2021;3RWWHU\ZLWK'DUOHQH0DUWLQ&KLOGUHQFODVVHV²1RY 'HF    $GXOW6HVVLRQV²1RY 'HF

$QQXDO$GMXGLFDWHG$UW6KRZ1RYHPEHU  )RUGHWDLOVSOHDVHFDOORXURIĂ&#x20AC;FHDW $QGRUYLVLWRXUZHEVLWHZZZHVWHYDQDUWVFRXQFLOFRP (QWU\)RUP21/,1( 9LVLWRXUZHEVLWHIRUIXUWKHULQIRUPDWLRQRQWKLVDQGRWKHUFODVVHV /,.(8621

)RUGHWDLOVSOHDVHFDOORXURIĂ&#x20AC;FHDW $QGRUYLVLWRXUZHEVLWHZZZHVWHYDQDUWVFRXQFLOFRP

WK$YH(VWHYDQ6DVNDWFKHZDQ6$&RUFDOO <RXFDQDOVRHPDLOVFKDUWUDQG#HVWHYDQSROLFHFDRU MSLHUVRQ#HVWHYDQSROLFHFD 'HO%ORFN²&KLHIRI3ROLFH(VWHYDQ3ROLFH6HUYLFH Only successful candidates will be contacted.

8TIa8IZS[ $ELJWKDQN\RXWRDOOWKHGHGLFDWHG.LQVPHQDQG.LQHWWHVZKRPDGHRXU&DQDGD'D\3DUW\DKXJHVXFFHVV:H FRXOGQHYHUKDYHDVPXFKIXQZLWKRXW\RX  +RSH\RX¡UHHQMR\LQJ\RXU.LFN2IIWR6XPPHU:HHNVSRQVRUHGE\$5&5HVRXUFHV

5ROORQGRZQWRWKH3DUNVIRURXU7UDQVSRUWDWLRQ:HHN-XO\&KHFNRXW\RXU3DUNIRUWKHVHVSHFLDOHYHQWV +LOOVLGH0RQGD\²%DFNZDUGV'D\7XHVGD\²6FDYHQJHU+XQW:HGQHVGD\²1LJKW6ZLP SP 7KXUVGD\ :DWHU)LJKW)ULGD\%DOORRQ6ZLP +LOOFUHVW 0RQGD\6DQG &DVWOH &RPSHWLWLRQ 7XHVGD\ ²&OHDQXS &RPSHWLWLRQ :HGQHVGD\ ² -XO\ %LUWKGD\ &HOHEUDWLRQ7KXUVGD\²1LJKW6ZLP SP )ULGD\6WRU\7LPH 5XVW\ 'XFH 0RQGD\ ² %DOORRQ 6ZLP 7XHVGD\ ² )UHH]LH 6DOH Â&#x201E;  7KXUVGD\0RUQLQJ 6ZLP   )ULGD\3DUHQW¡V'D\ &KXUFKLOO0RQGD\*OLWWHU6ZLP7XHVGD\0RUQLQJ6ZLP  :HGQHVGD\3LFQLF7KXUVGD\:DFN\+DLU 'D\ 7URMDQ 3DUN 7XHVGD\²&OHDQXS &RPSHWLWLRQ :HGQHVGD\-XO\ %LUWKGD\ &HOHEUDWLRQ 7KXUVGD\)UHH]LH 6DOH Â&#x201E; )ULGD\&DQG\-DU*XHVV 7KLV6DWXUGD\ZLOOEHRXUĂ&#x20AC;UVW6DWXUGD\6ZLPDW+LOOFUHVW3DUN²-XO\%ULQJ\RXUIDPLO\IRUVZLPPLQJIURP SPSP7KHQH[WRQHZLOOEH-XO\DW+LOOVLGH -RLQWKH3OD\3DUNV0DLOLQJ/LVW6HQG\RXUHPDLOWRSOD\SDUNV#HVWHYDQFDWRVWD\XSWRGDWHZLWKDOOWKHODWHVW SDUNVLQIRUPDWLRQ 5HPHPEHUWRZHDU\RXUKDWVXQVFUHHQDQGGULQNORWVRIZDWHUZKHQ\RXFRPHWRWKHSDUN ,I\RXKDYHDQ\TXHVWLRQVFRQWDFW/LLVD.OHHPROD3OD\SDUNV6XSHUYLVRUDWRUSOD\SDUNV#HVWHYDQFD ;XWZ\[+IUX[ 1RQHHGWREHERUHGWKLVVXPPHUÂŤ 6SRUWV&DPSVDUHKHUH 5HJLVWUDWLRQLVVWDUWLQJIRUWKHIROORZLQJ FDPSV 6TXDVK&DPS-XO\ 6NDWHERDUGLQJ&DPS-XO\

*ROI&DPS-XO\ 'LYLQJ&DPS-XO\ %0;&DPS$XJ /LIH6DYHUV&DPS$XJ /DFURVVH&DPS$XJ 'URSLQ6SRUWV-XO\  $XJ

(YHU\RQHDJHVFDQKDYHIXQWKLVVXPPHULPSURYLQJWKHLUVNLOOVLQDIXQHQYLURQPHQW 5HJLVWHUDWWKH/HLVXUH&HQWUH,QIRUPDWLRQ'HVNRU$FWLYH1HWRQOLQH6RPHFDPSVKDYH OLPLWHGVSRWVDYDLODEOHVRUHJLVWHUTXLFNO\ )RUPRUHLQIRUPDWLRQFRQWDFW/LLVD.OHHPRODDW

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

Page 27

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


Page 28

THE TRADER EXPRESS, FRIDAY, JULY 6, 2012

B >  N O X a ;  O <\

 $  0   I"

WƵƌĐŚĂƐĞh 'ĞƚŽdžKĨZŝĚƐĞĞƌĚ>ZŝŐǀΘ ŚƚƐ͊

0LQDUG V/HLVXUH:RUOG/WG_*RYHUQPHQW5RDG6RXWK_:H\EXUQ6._6+/_7ROO)UHH

…mq{q

…mo{q …mo{q

nmÛ7]f]bSÛno7F

t"MVNJOVNFYUFSJPSt+BDL,OJGF4PGBt"XOJOH

[k …

…no{ …mm{q

…k{kkk

nmÛ7WbObW]\ÛG·^`S[S mkkrÛ;]ZRS\Û:OZQ]\Ûnq:?6 $IFWEVBMMZt2VFFOCFEt5PJMFUtTMJEF

t"XOJOHt#VOLTt#JLFSBDL

 Hm ^

[k …

tQPQPVUTt4MJEFtMCT

…mm{k …nj{q

contactmlw@sasktel.net njÛG^]`ba[S\Ûnjn@9

 Hm ^

 Hm ^

[k …

k s - "" 0 k 3 "" "< …

^ĞĞKŶĞzŽƵ>ŝŬĞ͍DĂŬĞhƐŶKīĞƌ͊ϯϬĂLJtĂƌƌĂŶƚLJKŶůůhƐĞĚZsƐ

…mp{q …mr{k

t+BDL+JMMCVOLTt372t-JGULJU

…mr{k

nmmÛG^`SSÛnpF6G t4UPSBHFt(SJMMt4MJEF

^[

Hm

^[ Hm 



Hm

^[

nlÛ?·ab][Û?]OQVÛ?Hnrl nlÛ?·ab][Û?]OQVÛ?Hon t3FBSLJUDIFOt&YUFSJPSJOTVMBUJPOt$BOBEJBO.BEF t:FBSSPVOEMJWJOHt4UBJOMFTTBQQMJBODFTt$BOBEJBO.BEF

…mq{q …mp{q nqÛ>OfQ]Û>OfÛ:ZWUVbÛnlq6<G

…np{q …mj{q

npÛKO\RS`S`ÛnqmAG

tUIXIFFMIJUDIJODMtKBDLLOJGFTPGBt"$

…mp{q …op{



…mr{q

…mo{q …op{q

…nl{q …nq{jq

nkÛAOeÛG^]`bÛnoFG

njÛ6WUÛ7]·\b`fÛopk6<G

t3FBSTMJEFt%PVCMFCVOLTt0VUTJEFTIPXFS

t2VBECVOLTt1PXFSKBDLTt3FBSCFE

…nk{k …no{q

…mk{k …nk{rq

…no{q

nmÛGOP`SÛom:?8G t'SPOU,JUDIFOt$MPTFU4MJEFt&VSP$IBJS

…nr{q …mq{q

…mp{q

nmÛ;]ZRS\Û:OZQ]\ÛorH?G

nmÛ7`·WaS`ÛomA?

npÛHS``fÛ8OY]bOÛjnlG

tTMJEFTt)JHIJOTVMBUJPOWBMVFT

tTMJEFTt-VYVSZmGUIXIFFMt&YUFSJPSJOTVMBUJPO

t5SJQMFTMJEFtw57t&VSPDIBJST

t3FBSMJWJOHt4MJEFt'JCFSHMBTT



Hm

^[

njÛ6WUÛ7]·\b`fÛooF@

…mp{k

…mo{q …mp{l

…mn{k

…j{k …mq{q

…mo{k

mkklÛF·abZS`Ûnq6

nqÛ:`]\bWS`Ûnpoq@

t"$t"XOJOHt&MFDUSJDKBDLT

t#VOLTtt/P"$

t'JCFSHMBTTt4NBMMTMJEFtMCT

Hm ^[ 



Hm ^[

nÛD`]dZS`Ûnlq@G

noÛ:`]\bWS`ÛnoqoD: t$BNQLJUDIFOt4PGBTMJEFtMCT

…k{kkk …nj{qۅmk{kۅmj{q …pq{ nÛHS``fÛlnle

nlÛG^`SSÛonÛ6<G

t"$t"XOJOHt+BDLLOJGFTPGB

t1PXFSBXOJOHt1PXFSKBDLTt++CVOLT

…oo{q …mq{q

…mo{q

nkÛ6WUÛ<]`\ÛorlÛFH

nlÛD`]dZS`Û@f\e

tTMJEFTt1PXFSBXOJOHt-PBEFE

t'JCFSHMBTTt.BYBJSWFOUTtTMJEF

>Kt&/EE/E'Zd^Ͳs/>>KEd,^WKd͊ 0RUH8QLWV2QOLQHZZZPLQDUGVOHLVXUHZRUOGFRP


S E Trader Express July 6