Issuu on Google+

+(1'(56 '58*6 1220 4th Street, Estevan • Phone: 634-3666

SOUTHEAST SASKATCHEWAN’S FREE DISTRIBUTION PAPER

SOUTHEAST TRADER

EXPRESS Cont. Circulation - 9,239

www.estevanmercury.ca

Looking for a job?

See pages 21-24

Friday, July 27, 2012

Dog Days of Summer

New Fire Truck “They actually took it out of service early to give it to us.�

Trail Ride “I just hope lots of people come and join us and have a good time.� *

FLYER CHECK

3

7

This week's entry into the 2012 front page photo contest was submitted by Lorie Tedford. If you would like to submit a photo email it to editor@estevanmercury.ca. The winner will receive a digital SLR camera. Please ensure that when sending photos they are sent at the highest possible resolution. Contest sponsored by:

• Co-op • Home Hardware • M & M Meat Shops • Smart Source • Sobeys • Sears

6HQFKXN

)RUG6DOHV/WG

• SportChek • The Bargain! Shop • Canadian Tire

6RXULV$YH1(VWHYDQ 7ROO)UHH VDOHV

 VHUYLFH

(PDLOVDOHV#VHQFKXNFRP‡ZZZVHQFKXNIRUGFD


Cheers&Jeers Page 2

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Cheers to the people in Estevan who continue in their efforts to beautify our city. Cheers to the installation of the statues at the Estevan Comprehensive School. I drive by it every day and it looks great. Cheers to the pancake breakfast at Rusty Duce playpark. It was fantastic! Cheers to the people who picked up the cat in the middle of the road and moved it to the side of the road. Cheers to my husband for all of his efforts in the backyard. It looks fabulous!

Send your Cheer or Jeer to jbaker@estevanmercury.ca or send us a message on the Mercury’s Facebook page

ARIES (March 21 to April 19) A strong social whirl brings a new round of good times to fun-loving Rams and Ewes. Cupid also

is busy aiming arrows at single Lambs hoping for a heart-to-heart encounter. TAURUS (April 20 to May 20) A romantic incident could take a more serious turn if the Divine Bovine considers meeting Cupid’s challenge.

Jeers to the people who can’t be bothered to close their garbage can lids and those who don’t bag their grass clippings, etc., thus sharing all those odours with their neighbors. Jeers to those who don’t call for a replacement garbage container when theirs gets damaged during garbage pickup. Jeers to those maintaining the Westview playpark. It has had nothing done with it for too long.

Jeers to garbage collectors who no longer care about the garbage totes. For about a month, all of the totes come down with the lid open and nowhere close to where they were. The speed the truck is dumping the totes is also breaking them. There is a minimum of three broken totes now in our block. Meanwhile, a professional opportunity is also about to turn up. GEMINI (May 21 to June 20) A bit of hardheaded realism could be just what the Twins need at this emotionally challenged time. Face the facts as they

are, not as you want them to be. Good luck. CANCER (June 21 to July 22) Many opportunities open up. But you need to be aware of their actual pros and cons. Check them all out and make your choice from those that offer more of what you seek. LEO (July 23 to August 22) A more stable situation begins, allowing you to feel more secure about making important decisions. Mean-

while, be sure to meet your project deadline so you can move on to other things. VIRGO (August 23 to September 22) Congratulations. A new personal relationship thrives as you learn how to make room in your busy life for this wonderfully warm and exciting emotional experience. LIBRA (September 23 to October 22) A new contact opens some doors. That’s the good news. But

2USKHXP7KHDWUH 'RZQWRZQ(VWHYDQ‡+U0RYLH,QIRUPDWLRQ/LQH‡

HELD OVER UNTIL THURSDAY, AUGUST, 2!

THE DARK KNIGHT RISES 6SDUN\ LV P\ QDPH , DP D PDOH DERXW  PRQWKV ROG , DP DQ RUDQJH WDEE\ ZLWK D ZKLWH FKHVW DQG IRXU ZKLWHSDZV,ZDVIRXQG XQGHUVRPHRQHV FDUDW 'RPLQRV , KDYH KDG P\Ă€UVWYDFFLQDWLRQDQG ,KDYHEHHQGHZRUPHG , DP D UHDO FKDUDFWHU DQGDKDOI

7KHVH  OLWWOH GDUOLQJV ZLOO EH UHDG\ IRU DGRSWLRQ DW WKH HQG RIWKLVZHHN7KH\ZHUHERUQDW (+6 RQ -XQH UG 7KH\ DUH DOO EODFNVRPHKDYHVKRUWKDLUDQG VRPHDUHOLWWOHIXUEDOOV7KH\DUH DOOVRFXWH

2XUIDUPSURJUDP LVLQIXOOVZLQJZH KDYHDYDULHW\RIFDWV WRFKRRVHIURPWKH EHVWGHDOLQWRZQ

0\ QDPH LV 0U %HOOV , KDYH EHDXWLIXO ORQJ VLOYHUJUH\KDLU,DPD \RXQJ DGXOW , KDYH D JUHDW SHUVRQDOLW\ DQG , DP ORRNLQJ IRU P\ IRUHYHU KRPH , KDG WR OHDYH P\ ODVW KRPH EHFDXVHRIDOOHUJLHV

5HPEHU6SD\LQJDQGQHXWHULQJ\RXUIHOLQHVDQGFDQLQHVZRXOGVXUH HOLPLQDWHDOOWKHVHXQZDQWHGDQLPDOV$JDLQWKLVZHHNZHJRWSXSSLHVWKDW ZHUHREYLRXVO\GXPSHG+RZFUXHOLVWKDW" 7KH(VWHYDQ+XPDQH6RFLHW\UHVHUYHVWKHULJKWWRUHIXVHDQ\DGRSWLRQ

7KDQN\RXIRU\RXUFRQWLQXHGVXSSRUW 7KLVVSDFHLVVSRQVRUHGE\WKLVFRPPXQLW\PLQGHGEXVLQHVV

7:30 p.m. nightly PG Violence 0HUFKDQWVLQ)LQH-HZHOOHU\

)RXUWK6WUHHW(VWHYDQ6.‡

2SHQLQJ$XJXVW0DJLF0LNH

there’s a caution involved: Be sure you protect your rights to your work before showing it to anyone. SCORPIO (October 23 to November 21) A former colleague might seek to resume a working partnership. Ask yourself if you need it. If yes, get more information. If no, respectfully decline the request. SAGITTARIUS (November 22 to December 21) Good times dominate your aspect. So why not have a party to celebrate a loved one’s success? And do invite that special person you want to know better. CAPRICORN (December 22 to January 19) The shy side of the Sea Goat soon gives way to your more assertive self. This should help you when it comes time to speak up for yourself and your achievements. AQUARIUS (January 20 to February 18) A new period of stability will help you deal with some recently reworked plans. Once you get your current task done, you can devote more time to personal matters. PISCES (February 19 to March 20) Things are finally much more stable these days, so you can restart the process of meeting your well-planned goals with fewer chances of interruption or delay. BORN THIS WEEK: You love being the brightest light wherever you are, and people love basking in your warmth and charm. (c) 2012 King Features Synd., Inc.


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Page 3

Money Problems?

Marla Adams CA CIRP Trustee in Bankruptcy

Start Fresh. We can help. FREE consultation 1-800-961-DEBT (3328) www. bankruptcy. deloitte. ca 900-2103 11th Ave., Regina

FEATURED HOMES 12:9,(:,1* Brian Smyth, Bienfait’s fire chief, stands with the fire department’s new truck, which was bought in Texas and brought to Canada at the end of June.

Bienfait firefighters have their new toy There’s a shiny new truck in Bienfait. Residents received their first glimpse of the town’s new fire truck when it was first unveiled at the Canada Day parade in Bienfait. The Bienfait Fire Department’s recently purchased truck was brought into Canada just days before that at the end of June. Engine 4 is not yet in service, but Brian Smyth, Bienfait’s fire chief, said that if they needed it, they could send it to a fire. The search for the new truck sent them looking at about 500 trucks online before finding the one they wanted. He and two others went down to Port Neches, Texas to look at the truck. The small city is just north of the Gulf of Mexico near the Louisiana border. “We had a look at the truck, and it was spotless, and it was clean,� said Smyth. “It wasn’t the only one we had picked out. There was another one at the same fire hall sitting right next to it. We spent five minutes looking at it and five hours looking at this one. This was the better deal, and it was their front line truck.� The truck with a 750-gallon tank was well looked after, with low mileage and low hours on it. Almost new, said Smyth. The truck is a 1999, although when they went down to Texas, they thought they would be looking at a 1998 truck because it was advertised as such. It wasn’t until they got to customs heading

back into the country that they realized it was one year newer. Smyth noted it has five self-contained breathing apparatus seats and it allows them to haul all their firefighters inside with equipment as well. “It has a huge pump on it, that we probably didn’t need anything that size, but when you’re shopping used, you take what you can get.� After bringing the truck to Canada, they immediately got the vehicle safetied and installed the decals on it. The fire department’s older trucks are hovering around 40 years, so the new wheels are very welcome to the 14 firefighters currently serving the town of Bienfait. Smyth noted that it isn’t just that the vehicle is newer and has fewer miles on it, but that the equipment is a big step forward in technology. Their old truck pumped water at 500 gallons per minute, while the new one pumps 2,000 gallons in that time. The truck was left with about $30,000 to $35,000 worth of equipment on it. The Port Neches department left hose, nozzles and valves. “This city had two fire trucks that they were trading in on one new truck, so they had an extra set of equipment. I just asked the fire chief if he wouldn’t mind leaving what he doesn’t want on the truck and sending it to us. There’s probably $25,000 worth of

hose,� said Smyth, adding that, “They actually took it out of service early to give it to us, because Port Neches was having a new truck built.� It means they don’t have to buy the equipment, which is specific to that truck. The fire department has no immediate plans to take any of their older trucks out of service but said eventually that is the plan. “Eventually they’ll all be retired or pensioned off,� said Smyth. “What we need with this is about a 2,500 or 3,000-gallon tanker that we’ll have to work on down the road. That’s because we have some areas in town that aren’t serviced by fire hydrants, so we need that water supply.� The truck was bought for $105,000, and there are also some other costs for shipping to the border and going through customs. Smyth takes some pride in the fact that the truck is paid for entirely through donations, not taxpayer dollars. Brian’s wife Candy is part of the six-person fundraising committee, and they are continuing to raise funds, with about $35,000 still needed to cover all of the costs. On Aug. 8, there will be an outdoor drive-in theatre at the soccer fields on the

east side of town. Gainer the Gopher will be attending the screening of We Bought A Zoo. “It’s a family event,� she said. “There will be raffle tables, auction items. There will be games for the kids beforehand.� There will also be some cars from Estevan Motor Speedway. So far they’ve raised about $87,000 and are waiting for a grant to come in for $15,000. They are now selling tickets for a threemonth daily lottery draw beginning Oct. 1 until the end of December. Tickets can be purchased from any member of the fire department, the fire auxiliary, Spectra Credit Union and the town office.

HDUV s Year 34<  FH ice HUYL serv of6 RI

www.nageltours.com

Call Your Travel Agent or 1-800-562-9999

7RZQKRXVHVSULFHGIURP (QMR\XSWRIRXUEHGURRPVDQG VTIWRIOLYLQJVSDFHLQWKHVH JRUJHRXVORFDOO\EXLOWWRZQKRXVHV





2QO\ VTIW

402 Galloway Street, Estevan

Upgrades, upgrades, upgrades. This 1335 sq. ft. home is beautifully done. The many upgrades in the last year including kitchen counter top, sink & faucet and bay window. Beautiful backyard with 7 man waterfall hot tub. Completely renovated basement & detached single car garage. www.402gallawaystreet.bhgress.ca

MLS# 437910

$449,000

(VWHYDQ6KRSSHUV0DOO

Â&#x2021;Â&#x2021;

ZZZEKJUHVVFD

Tan FX, Estevan

Great investment opportunity in Estevan. Perfect time to buy a Tan FX franchise set up & ready to run. All equipment is only a year old. Equipment includes 6 tanning beds & 1 mystic spray tan. Excellent client base that continues to grow. Purchase includes all equipment, shelving & inventory to run the store. Financial statements available to qualified buyers. www.2419kensingtonavenue.bhgress.ca

MLS# 438256



912 1st Street, Estevan

Welcome to this great starter or investment home. The open dining/kitchen concept has a patio door that leads to the recently poured concrete patio. Great for outdoor entertaining or cooking your favourite meals on the BBQ. www.9121ststreet.bhgress.ca

MLS# 432757

$165,000

&RQWDFW

-DPLH'\HU  www.jamiedyer.bhgress.ca

Hear the Laugh that says, â&#x20AC;&#x153;I Love You! â&#x20AC;? Are you missing the best sounds of summer? Whether itâ&#x20AC;&#x2122;s a story from an old friend or a child telling you about their latest adventure, AleraÂŽ hearing aids help you hear better even in the most challenging summer environments!

DUNLOP HEARING SERVICES & CONSULTING

Call us today to book an appointment at our weekly hearing clinics!

July 21st, 28th and August 4th, 11th, 18th

306-771-9991 Marlo Dunlop, BC-HIS

5ISQVO<QUM.TaAW]Z?Ia

MARITIMES BY MOTORCOACH Several Tours to Choose From

)(@4,(+6>3(5+05.

?M 7NNMZ KPIZ\MZ IQZ [MZ^QKM _Q\P [INM\a IVL XI[[MVOMZ KWUNWZ\ I[ W]Z PQOPM[\XZQWZQ\a

 

4U+PTFQIT)PTQJUBMt/JDIPMTPO3PBEt&TUFWBO4,


SOUTHEAST TRADER

EXPRESS

JULY 27, 2012

Member Canadian Community Newspapers Assoc. Member Saskatchewan Weekly Newspapers Assoc. Audited by Audit Bureau of Circulations.

SOUTHEAST TRADER

EXPRESS General Manager: Brant Kersey Editorial Staff: Norm Park Chad Saxon Jordan Baker Josh Lewis Advertising Sales Manager: Cindy Beaulieu Advertising Sales Representatives: Deanna Tarnes Kristen O'Handley Teresa Hrywkiw Candace Wheeler Production Department: Melanie Tribiger Trinda Jocelyn Katsina Whitechurch Lorie Medwid Accounting: Kim Schoff Reception: Gayle Worsnop Classifieds: Carol Toth Contributors: Calvin Daniels Tonaya Marr Brian Zinchuk Bruce Penton Susan Sohn

Published weekly by Prairie Newspaper Group Limited Partnership, 68 Souris Avenue N., Estevan, Saskatchewan. Postal address: Box 730 Estevan, Saskatchewan, S4A 2A6 Advertising rates are available upon request and are subject to change without notice. Conditions of editorial and advertising content: The Southeast Trader Express attempts to be accurate in Editorial and Advertising content; however, no guarantee is given or implied. The Southeast Trader Express reserves the right to revise or reject any or all editorial and advertising content as the newspaper's principals see fit. The Southeast Trader Express will not be responsible for more than one incorrect insertion of an advertisement, and is not responsible for errors in advertisements except for the space occupied by such errors. The Southeast Trader Express will not be responsible for manuscripts, photographs, negatives and other related material that may be submitted for possible publication. All of the The Southeast Trader Express' content is protected by Canadian Copyright laws. Reviews and similar mention of material in this newspaper is granted on the provision that The Southeast Trader Express receives credit. Otherwise, any reproduction without the permission of the publisher is prohibited. Advertisers purchase space and circulation only. Rights to any advertisement produced by The Southeast Trader Express, including artwork, typography, photos, etc., remain the property of this newspaper. Advertisements or parts thereof may not be reproduced or assigned without the consent of the publisher. Published weekly in Southeast Saskatchewan by the Prairie Newspaper Group, a subsidiary of Glacier Media Inc. The Glacier group of companies collects personal information from our customers in the normal course of business transactions. We use that information to provide you with our products and services you request. On occasion we may contact you for purposes of research, surveys and other such matters. To provide you with better service we may share your personal information with our sister companies and also outside, selected third parties who perform work for us as suppliers, agents, service providers and information gatherers. Our subscription list may be provided to other organizations who have products and services that may be of interest to you. If you do not wish to participate in such matters, please contact us at the following address: The Southeast Trader Express, Box 730, Estevan, Saskatchewan, S4A 2A6; or phone (306) 634-2654. For a complete statement of our privacy policy, please go to our Website at: www.estevanmercury.ca The Southeast Trader Express is owned and operated by Prairie Newspaper Group, a subsidiary of Glacier Media Inc.

We acknowledge the financial support of the Government of Canada through the Publications Assistance Program toward our mailing costs.

Contact us: Phone: 634-2654 Fax: 634-3934 www.estevanmercury.ca Street Address: 68 Souris Ave. N., Estevan By mail: Box 730, Estevan, Sask. S4A 2A6

Perspective

Page 4

The best two weeks in athletics The Olympics are back, so for the next couple of weeks we can cheer on our Canadian athletes and celebrate everyone else’s. There are a number of reasons to get excited about the London Olympics. These Summer Games will see the competition of the first bionic man. Oscar Pistorius will be competing in the 400-metre race without legs. Who isn’t going to want to watch that guy run? He’s the bionic man. The Atlanta Games of 1996 are the first Olympics I remember. I was nine and I remember Donovan Bailey winning gold in the 100-metre event, breaking the world and Olympic records, finishing the dash in 9.84 seconds. I was at my buddy Scott Campbell’s place. That’s significant because I don’t really remember anything from my childhood beyond little glimpses here and there, and that is one of those glimpses. That’s the kind of impact the Olympics can have on someone. Obviously, there are plenty of ways to groan about the Olympics nowadays. What used to be exclusive to amateur athletes is now the playground for professionals too; they still ban women from participating in some sports; the Games are all about generating money and getting sponsorship deals now, as soda and fast food companies sponsor the Games,

Jordan Baker Thoughts From My Fingers advertising stuff that no athlete would ever put in their body; doping is rampant in the public eye, whether the athletes provide clean samples or not because it’s not just about who can get the better edge but also about which athlete has the doctor who can cover it up the best. There was even a documentary made about IOC members taking bribes during the host city bidding process for the 2012 Games. It’s alleged the London committee offered bribes to a number of IOC members to vote in their city’s favour. Worst of all, it may be so cold in London that the female volleyballers are going to be forced to cover up. That isn’t even a joke; I saw a whole special earlier this week on what that will mean for spectators. Despite all that, I still love the Olympics. No matter what nationality, we can all celebrate and recognize who the fastest man in the world is or the strongest woman because once they capture gold, they truly are the best in the world.

Best in the world is a pretty exclusive club. Only one person can be the best in the world at any given time. Every week at work, I really just try for a personal best, something not everybody wants to hear from their Olympic athletes. Don’t go for a personal best; that’s what we do everyday at work. We want to live through these athletes for the two weeks the Olympics dominate are television experience, and if we were you, we wouldn’t shoot for a personal best. We’d go for broke and leave it all out there. I’ve already suggested that Canada is coming away with 30 medals, a figure that led to me being laughed at by another Canadian who is clearly not as patriotic as I. Our athletes may not be as athletic as the rest of the world’s, but we have some decent shot putters and track cyclists, right? There is also a little bit of science behind my lofty expectations and it all has to do with genetics. In 1984, Canada mopped the floor with the competition — perhaps because of a boycott from some countries — raking in 44 medals, the fourth highest that year. It’s high time those athletes’ kids become the next great generation of Canadian sport, so expect to see a lot of athletes in London sired by Canada’s best athletes from the mid-1980s. Though success is not measured by the medal count, I like Canada’s chances.

Bigger is no longer always better Sometimes a common theme seems to pop up and take over at times in terms of writing a column on a sector for some 20-plus years, and this month it seems to be the changing view of the optimum size of cattle. The Yorkton summer fair a couple of weeks ago brought the moderation in the size of beef cattle into focus for me. It was following the fair that I wrote about how show judges at the exhibition were not automatically looking at the biggest animal in the show ring for the red ribbon. It was at the Regional 4-H Beef Show at the exhibition, Judge Gerry Bertholet talked about moderate frames, and in heifer classes, big females were not always class winners over more moderate-sized ones. And the Saskatchewan Angus Gold show judge Garner Deobold remarked in an interview with this writer about how big might have been the key to winning a decade ago, but it was no longer automatic. He said while small cattle don’t have the efficiencies needed by the industry, and suggested in some situations big can work, moderation is where the industry is now focused.

Calvin Daniels Trader Agriculture Columnist However, at times there has been a disconnect between what judges look for in the show ring, and what works best on the farm. In this case that may well be why this recent trend is rather interesting because ranchers seem to have already come to the conclusion that a more moderate-sized cow may well be the more profitable. Ivan Olynyk, for one, is a producer who thinks smaller is better. Olynyk used to run purebred red Angus and while he sold out his herd a few years ago, he did not stay out of the business, purchasing a few cows to run on a quarter section of grass he has divided into small grass cells allowing for rotational grazing. Olynyk said he believes the trend toward bigger cows and calves was made because there was cheap barley through the years to feed them. That is no longer

the case, and as cereal crops have risen in value, with a likelihood they will stay higher than in the past, cattlemen have to turn back to grass. With an eye to maximizing grass, Olynyk said he had always been interested in seeing just how efficient a pasture could be by utilizing rotational grazing, and this was the reason he fenced 30 paddocks on the quarter section. Olynyk next went looking for some smaller framed cows, ones he thought might fit better into a low maintenance system. He settled on some belted-Galloway, weighing it at about 1,000-pounds. “The Galloway go out and graze a couple of hours, then sit down and ruminate,” he said. “The big cows (from the stockyards) have to graze longer.” The smaller cows will not produce the same calf of larger cows, but Olynyk said gross dollars are not the key to profitability. “It’s not how much you get in town at the end, but how much it cost to get there,” he said. And that, of course, is the key. Controlling input costs and maximizing returns is where grass and smaller cows can shine.


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Page 5

The Bachelorette Canada *Spoilers. Don’t read if you haven’t seen the end of this season’s The Bachelorette.

I used to hate everything about The Bachelor and The Bachelorette. Without ever watching the show, I judged it to be stupid, demeaning and probably as scripted as Keeping Up With the Kardashians, though with better actors. Then I accidentally sat down and watched an early episode of this

Tonaya Marr Maybe It’s Just Me season’s The Bachelorette, and I have to say, wow. It is every bit as vapid, as annoying and as fake as I predicted, but what I didn’t see coming was the pure

awesomeness hidden on the show. I’m not interested in what goes on on-screen. It’s great when the guys cry or Emily has a meltdown or

someone mocks her child, but it’s what we don’t see that I enjoy the most. I like to imagine what is going through the heads of each contestant, and most importantly, Emily, while the competition is going on. My favourites are the guys who are clearly there for the game. They want to see how far they can get into Emily’s heart and how far they can get into the competition. These are the competitive guys who want to win more than they want a wife. They’re heartless, ruthless and sometimes, very convincing actors. I really like them. With this is mind, if I went on The Bachelor, I would definitely be the girl that the audience hates passionately. Not to say I’m mean-spirited, against love or anything like that. I just think some of the contestants get too wrapped up in finding the right person; they forget that they’re on a freakin’ reality TV show. This isn’t real life. You aren’t going to stay together. Might as well really live it up. So I think “The Bachelor: Survivor Style” would be a lot of fun. I’d be the one in there making al-

liances, sabotaging the front-runners and being sweet as pie to the man whose affections I was trying to win. When the other girls ratted me out for being spiteful and mean, it would be too late! He’d be so far in love that he’d believe my puppy-dog eyes and fake tears. Victory! Romantic TV proposal! Tabloid covers for months! Just kidding. While I would mess with the other contestants, I’m not quite vicious enough to purposely break some poor guy’s heart. If he didn’t kick me off the show before the final set of rose ceremonies, I’d confess my wicked ways and excuse myself. Nothing like showing a little emotion, a little conscience and exiting on a positive note. If I was the bachelorette, I’d play it a bit different. All those cruel punishments that Emily submitted the guys to this season, like meeting her friends or playing with kids, or choosing the loser of competitions for oneon-one dates, I’d totally be doing that, only at a higher level. Meet kids? Sure, but one of them is my imaginary daughter

Tongue Waggingly Hungry

Dayton Fraser can’t wait to sit down and devour his pancakes as he moves through the toppings line at the playpark’s pancake breakfast on July 20.

12074DE00

SOUTHEAST TRADER

EXPRESS

and I’m not going to point her out, so you’d better be careful! I’d also introduce them to friends that I don’t actually like, just to see if they would be polite and attentive to the crazies I’ve known and tried to defriend throughout my life. In the end, I’d probably have the winner picked from day one, just like Emily has had a thing for Arie since their first date. You just have something with some people, and despite having to go through months of meeting and being interested in other guys, there’s still going to be the one who first caught your attention. By the way, I know that Emily chooses Jeff. I haven’t had time to see the end of the season, but I do know this. And having not seen the season finale, I still maintain that she has a thing for Arie. Tonaya Marr isn’t as mean-spirited as she comes across in this column. Nor will she ever be on a reality TV show, mostly because there aren’t a lot of Canadian options. Anyway, send Tonaya an e-mail at tonaya.marr@ gmail.com or tweet her @ TonayaMarr.


Page 6

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Would you eat edible packaging?

He She He She Said

The good people in marketing have been warming us all up for this one since they started making bowls out of bread. Bowls have been edible for some time now, and it was only a matter of time before other packaging would be manufactured for the purpose of consumption. The idea is that if people are eating their coffee cups, there is no garbage, and no garbage is a good thing. The biggest concern when it comes to edible packaging is exactly how edible these containers will be. Apparently the packaging is made from the same kinds of polymers used to cover pills, but companies have been known to introduce all kinds of crazy chemicals into our foods and maybe our packaging. Some popular sports drinks include ingredients like petroleum. Do we trust our drink cups to be freer of toxins than what weâ&#x20AC;&#x2122;re actually drinking? Will the contents of the package be subject to a nutritional facts sheet? And these edible package manufacturers want to take things a few steps further than just soup bowls, coffee cups and freezie packages. They see all packaging being edible as the only way to make the process of delivering a product to a consumer sustainable. Go buy four sleeves of golf balls, and come back with a snack for the round. Wouldnâ&#x20AC;&#x2122;t that be a great thing to do to your buddy on the first tee? Crack open a sleeve of balls, throw them in you bag and then start devouring the empty sleeve. You could buy a new shirt, and then remove the tag and put it on your sandwich. We are incredibly frivolous with our resources, and I would love to reduce the amount of waste we create. The edible packaging solution does have its limitations, however. People can probably wrap their heads around coffee cups and dissolvable drink powder shells, but when it comes to chowing down on a parcel that came in the mail, we may all have to draw a line. â&#x20AC;&#x201D; Jordan Baker

Said

Iâ&#x20AC;&#x2122;m really grossed out by this idea. I like to throw away packaging. I donâ&#x20AC;&#x2122;t buy foods so I can eat the wrap it comes in, even bananas, which arguably have edible packaging naturally. Itâ&#x20AC;&#x2122;s just gross. For some reason, the idea of eating the packaging of food makes me think of Babybel cheese. I love these circular cheeses. They are adorable and delicious. But I never want to eat the weird, red packaging that surrounds their

cheesy goodness. My main issue with eating packaging comes from my dislike for germs. It seems disgusting to eat the wrapper of something that has sat on a store shelf and been handled by dozens of people on its way into my dinner. Thatâ&#x20AC;&#x2122;s like pealing the skin off an apple and passing it around to a group of strangers before finally eating it. Gross. No thanks. If the packaging is durable enough to survive shelf time in a grocery store, why would I want to put that in my body? Doesnâ&#x20AC;&#x2122;t sound very healthy to me. The only reason I can find to eat the packaging of food is that itâ&#x20AC;&#x2122;ll stay out of landfills, and over-flowed landfills are undoubtably a problem. I admit that I do like the prospect of fewer items landing in the dump, but my disgust toward eating germs wins out in the end. No, thank you. Iâ&#x20AC;&#x2122;m actually going to rub some hand sanitizer into my hands now, because of how grossed out I am. â&#x20AC;&#x201D; Tonaya Marr

Set plants in turban vacation

â&#x20AC;˘ â&#x20AC;&#x153;When painting, write the name and brand of paint under the roomâ&#x20AC;&#x2122;s light switch. If you ever need to go out and buy more, you will know where to start.â&#x20AC;? -- R.K. in Montana â&#x20AC;˘ â&#x20AC;&#x153;My family has always used mayonnaise as a salve on minor burns. I heard you can use toothpaste too.â&#x20AC;? -S.P., via e-mail â&#x20AC;˘ Add these to the list of

items to eliminate the odour of cooking cabbage: a heel of bread, a whole walnut or a pinch of baking soda. â&#x20AC;˘ To travel with pleated skirts, use this packing trick: Turn the skirt inside out and straighten all the pleats. Then tape the bottom so that all the pleats are held together. Next, feed the skirt into a leg of pantyhose with the foot cut off. Youâ&#x20AC;&#x2122;ll end up with a nice tube, which you can tuck into the sides of your luggage. â&#x20AC;˘ â&#x20AC;&#x153;When traveling for more than a few days, put your plants in the bathtub with a little bit of water. Theyâ&#x20AC;&#x2122;ll soak it up, and you wonâ&#x20AC;&#x2122;t have to have someone

come over and water your plants. This will only work for a week or less, though.â&#x20AC;? -- J.M. in Louisiana â&#x20AC;˘ â&#x20AC;&#x153;I keep grocery lists on my computer. When I am going shopping, I print out the list and fold the paper in half. Then I slip my coupons into the fold. Keeps them handy when Iâ&#x20AC;&#x2122;m shopping.â&#x20AC;? -- A Reader in Maryland Send your tips to Now Hereâ&#x20AC;&#x2122;s a Tip, c/o King Features Weekly Service, P.O. Box 536475, Orlando, FL 32853-6475 or e-mail JoAnn at heresatip@yahoo.com. (c) 2012 King Features Synd., Inc.

)KKQLMV\[0IXXMV _PMV\PMaLW \Z][\ 1LMITNWZaW]Z I]\WJWLaZMXIQZ[ 6HUYLQJ6(6DVNIRU<HDUV 12074DM01

U-

Â&#x2021;7RZLQJ6HUYLFH Â&#x2021;&RXUWHV\&DUV Â&#x2021;6*,$FFUHGLWHG

&DOO%LOOWRGD\ WK6WUHHW(VWHYDQ



â&#x20AC;&#x2DC;EM WE MEND â&#x20AC;&#x2DC;EM Owners - Lance Mack & Yancey Hagel

Call

634-6060


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Page 7

The Roche Percee Trail Ride and Wagon Trek is back in 2012, after an absence in 2011, as the hooves are set to hit the trail on Aug. 10 for the start of the three-day event.

Wagon trek sends riders back to trails For equine lovers, the summer will once again be complete when they get back on the trails at Roche Percee. The Roche Percee Trail Ride and Wagon Trek is back on in 2012 following devastating floods last year that led to the cancellation of this event and many others, along with destroying much of the village where this trail ride begins. Mary Jacobs is one of the organizers of the trail ride and noted that they werenâ&#x20AC;&#x2122;t able to host the ride last year after the flooding had subsided. â&#x20AC;&#x153;We didnâ&#x20AC;&#x2122;t do anything last year, there was just too much flooding,â&#x20AC;? said Jacobs. â&#x20AC;&#x153;The building that the meals were supplied in was unusable, and itâ&#x20AC;&#x2122;s apparently still not usable, but theyâ&#x20AC;&#x2122;re going to barbecue stuff.â&#x20AC;? Without the facility, she said they will probably be setting up some picnic tables and barbecuing in the

Book Your Career ad today! Call 634-2654

middle of the village. After established events have a year off it can sometimes be difficult to get them running again. Jacobs said that was something they took into consideration heading into this year. â&#x20AC;&#x153;Our numbers are down this year of people that have registered,â&#x20AC;? she said, noting people have until Aug. 4 to register at the regular price. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m hoping that in the next week or so, weâ&#x20AC;&#x2122;ll get lots more, but Iâ&#x20AC;&#x2122;m not sure.â&#x20AC;? With the break however, she said that they are keen to get everybody together and back out on the trails. â&#x20AC;&#x153;We are (eager) because itâ&#x20AC;&#x2122;s a fun time,â&#x20AC;? she added. â&#x20AC;&#x153;Even with all of the work that it takes. I donâ&#x20AC;&#x2122;t go on the ride myself, but I go down and help out.â&#x20AC;? It isnâ&#x20AC;&#x2122;t just the organiz-

ers who miss the fun of the trail ride and wagon trek. Jacobs has spoken to a number of registrants, and they are just as eager to get back on the trails after a long, two-year wait. â&#x20AC;&#x153;They seem to be (excited). I know weâ&#x20AC;&#x2122;ve had phone calls and e-mails from Moosomin, Manitoba and Saskatoon, so I think people are looking forward to it.â&#x20AC;? She hasnâ&#x20AC;&#x2122;t yet heard about what shape the trails are in, but said they have had people map them out. The organizers just havenâ&#x20AC;&#x2122;t had a meeting yet to hear what plans there are for the trails. The ride will begin on Aug. 10, and continue for the next two days over the weekend. The ride begins on the 10th at 1 p.m., followed by a full-day ride on Saturday. Sundayâ&#x20AC;&#x2122;s ride will commence following a

The Marvelous I\3-67;--4)3-

Cabaret & Restaurant

$8*867/21*:((.(1' 3$57<*8,'( 1,*+762)1216723 &5$=,1(66

Â&#x2021;'$1&,1*1,*+7/<30$0 Â&#x2021;)5,'$< $8* (QWHUWKH'DWLQJ*DPH Â&#x2021;6$785'$< $8* +RW%RG&RPSHWLWLRQ Â&#x2021;681'$< $8* 6SDJHWWL(DWLQJ&RQWHVW

$:(620(%$1' )520:,11,3(*

)5,6$76811,*+7$8* 7KH0$5&/$%266,(5(%DQG &ODVVLF3DUW\5RFN

&$%$5(76(9(5<:((.(1' 'LQLQJURRP 3L]]HULDRSHQHYHU\QLJKWDWSP

&DOOIRUWDNHRXW

church service. â&#x20AC;&#x153;I just hope lots of people come and join us and have a good time. Even if they donâ&#x20AC;&#x2122;t ride, come on down and see us in the

evenings. Jacobs said she is expecting some last-minute registrations, as she attested that there are â&#x20AC;&#x153;a lot of lastminute people in the world.â&#x20AC;?

Those who wish to register may call Jacobs at 6342432 or Joyce Schapkohl at 634-4380. They can also e-mail Jacobs at jacobs@ sasktel.net

12074TW00


Page 8

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Our Past July 27, 1994

D.J. Cairns of Madden, Alta. races out of the chute after his calf during the calf-roping event in last Tuesday nightâ&#x20AC;&#x2122;s rodeo performance. Each week the Southeast Trader Express shares recent stories from the community but weâ&#x20AC;&#x2122;ll also give you a look into the past. If you have a photo you think readers of the Southeast Trader Express would find interesting please submit it to Jordan Baker at jbaker@estvanmercury.ca.

Â&#x2021;&DUGORFNÂ&#x2021;/XEULFDQWVÂ&#x2021;3URSDQH

3523$1(

%X\LQJ"6HOOLQJ"-XVW/RRNLQJ" Call Estevanâ&#x20AC;&#x2122;s

Largest Brokerage

),//83 <285 3523$1( %277/(

 ( 6 8 $ & 7 $ ( 5 * :((1 $

/3 %(7 7( ( ' ( + /  / , ' ) $1 /'21$ 277/(

<% :(:,/ 5 ( 9 (  )25 $8* -8/<



62/'

72

$LU$PEXODQFH

*LUDUG%XON6HUYLFH/WG

/LVD0RQWH\QH 

0LNH'H%UX\QH 

-DFNLH)LW]VLPPRQV 

-DPLH'\HU 

0HODQLH3HWHUV 

-RVK/H%ODQF

0HLJDQ*HGDN

.HQ5RZDQ





/RUL*RQDV 

(67(9$1WK6WUHHW

 2;%2:

$/,'$

 

&$5/</( 5('9(56 



3DUWWLPH



SDUWWLPH

3DUWWLPH

0DWW'RPLQTXH] 5HDO(VWDWH5HODWLRQV



(VWHYDQ6KRSSHUV0DOOaÂ&#x2021;Â&#x2021;aZZZEKJUHVVHVWHYDQFD


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Page 9

A pack of hobby stock cars, including Cole Bourassa (77), wheels around a turn during a heat at Estevan Motor Speedway on Saturday.

HOBBY STOCK STATS Here are the top 10 drivers from the hobby stock feature at the weather-shortened race program at Estevan Motor Speedway on Saturday: 1. Brad King, #43 6.Blaine Durward, #12D 2. Eric Sinness, #88 7. Cole Bourassa, #77 3. Dustin Byler, #97 8. Chris Dukart, #20 4. Gary Goudy Sr., #7 9. Gary Goudy Jr., #12 5. Cory Evans, #33 10. Dylan Crozier, #8D

0$&. $8&7,21 )$50(48,30(17

521&$55,(5( 6$785'$<$8*867 (67(9$16$6. ',5(&7,216)520(67(9$1*20,/(61257+21+:<)$5021:(676,'(2) +:<6$/(67$576#$0Â&#x2021;:$7&+)256,*16 75$&7256 -2+1 '((5(  :' 75$&725  +RXUV  6SHHG  +\GUDXOLFV 'XDOV615:6 Â&#x2021;&$6(:'75$&725 $//,('  )(/  +RXUV  +\GUDXOLFV  7LUHV 61 Â&#x2021; -2+1'((5($5:'75$&725372 %HOW3XOOH\7LUHV61$*5Â&#x2021; &$6(/$:'75$&72561$Â&#x2021; )25'621:'75$&72537237+ +$59(67(48,30(17 &$6(,+63&20%,1((QJLQH +RXUV3LFN8S+HDGHU61  Â&#x2021; &$6( ,+  675$,*+7 &87 +($'(5  )7 8,, 3LFNXS 5HHO 61--&2Â&#x2021;9(56$7,/()737 6:$7+(5Â&#x2021;.2(1'(5632/<'580 6:$7+52//(5 6((',1* 7,//$*( %285*$8/7  $,5 6(('(5  %285*$8/7  $,5 7$1.  )7 6LQJOH 6KRRW 3RO\ 3DFNHUV 7RZ %HKLQG $LU 7DQN +\G )DQ  $XJHU Â&#x2021; &$6( ,+  &8/7,9$725  )7 'HJHOPDQ+DUURZVÂ&#x2021;,17(51$7,21$/  ',6&(56 Â&#x2021; )/(;,&2,/ )7 7,1( +$552:6 Â&#x2021; '(*(/0$1 6

*5281''5,9(52&.3,&.(5Â&#x2021;5,7( :$< 52&. 5$.( Â&#x2021; 52&.20$7,& 52&.3,&.(5 *5$,16725$*( % ( + / , 1       % 8 6 + ( /  + 2 3 3 ( 5 %27720 %,1 Â&#x2021; :(67((/   %86+(/ +233(5 %27720 %,16 Â&#x2021; :(67((/526&2 %86+(/ %,1621&(0(17Â&#x2021;6725.,1*721 )(57,/,=(5+233(5%,1Â&#x2021;)/$0$1 +3$5($7,21)$1Â&#x2021;*5$,1*8$5'+3 $5($7,21)$1 *5$,1+$1'/,1* 6$.81',$.  ;  6:,1* $8*(5 Â&#x2021; 6$.81',$.;$8*(5 .2+/(5 +3 (1*,1( :,7+ 029(5  %,1 6:((3 Â&#x2021; %5$1'7  ;  $8*(5  .2+/(5 (1*,1( Â&#x2021; 9(56$7,/(  ;  $8*(5  %5,**6 (1*,1( Â&#x2021; 75$,/(5 02817('*5$,19$&:,7+,+8% *$6(1*,1( 758&.6 '2'*(;3,&.83758&. ([WHQGHG&DE61%+)=<- Â&#x2021;  '2'*(  ; 3,&.83 758&. 5HJXODU &DE  6SHHG )ODW 'HFN 61%.:+6 Â&#x2021;  )25' ) 7$* $;/( *5$,1

758&. 7UDQVPLVVLRQ5ROO7DUS .PV61)&9'*Â&#x2021; '2'*(  6,1*/( $;/( *5$,1 758&. 7UDQVPLVVLRQ5ROO7DUS 61')0- /,9(672&.(48,30(17 %/8(+,//6Ă´;*226(1(&. 672&. 75$,/(5 Â&#x2021; +,*+/,1( %$/( 352  %$/( 352&(6625 Â&#x2021; 1(: +2//$1'  $872 :5$3 5281' %$/(5 Â&#x2021; 1(: +2//$1'   )7 +$<%,1(Â&#x2021;*(+/*5,1'(50,;(5 Â&#x2021; ,17(51$7,21$/ 6,'( '(/,9(5< +$<5$.(Â&#x2021;-2+1'((5(0$185( 635($'(5 Â&#x2021; 75$,/(5 7<3( 3267 3281'(5 Â&#x2021; 0,$0, :(/',1*  %86+(/ 6(/) )(('(5 Â&#x2021; 3257$%/( )73$1(/6 :,1'%5($.3$1(/6 Â&#x2021; 48$17,7< 2) *$7(6  3$1(/6 Â&#x2021; 5281' %$/( )(('(56 Â&#x2021; 523,1*  :(67(516$''/(6Â&#x2021;3$/&2&$77/( &+87( Â&#x2021; 1(: 6,1*/( '5,9,1* +$51(66Â&#x2021;75$,/(502817('*5$,1 52//(5 Â&#x2021;1(: +2//$1' 648$5( %$/(5 6+23722/6 &203/(7(/,1(2)6+23(48,30(17

Career Training Opportunities

Office Education Certificate This 32-week SIAST accredited certificate program provides practical and applied training related to the business environment. Graduates are prepared for employment as administrative assistants, administrative support staff or receptionists in fields such as government, education, law, medicine, engineering, manufacturing, travel, insurance, banking and business. Register now as seats are limited!

Location: Saskatchewan Energy Training Institute Campus, Estevan

Start Date: September 4, 2012

Contact our Registrations department to have a course package mailed to you, or visit our website for more information. &$4(SBETUhe new Saskatchewan Advantage Scholarship could save you JOtuition for this program! Contact our Career Counsellors to learn more. %R[(VWHYDQ6.6$$ 3K       /LFHQVHG%RQGHG ,QVXUHG3/

ZZZPDFNDXFWLRQFRPSDQ\FRP

Call toll-free 1-866-999-7372

www.southeastcollege.org


Page 10

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Health organizations call for asbestos ban National MONTREAL - More than 150 international and Canadian public health organizations and individual scientists are demanding a worldwide ban on the mining, export and use of asbestos. The demand on Tuesday comes after last monthâ&#x20AC;&#x2122;s announcement by the Quebec government it would lend $58 million to help reopen the Jeffrey Mine in the town of Asbestos. â&#x20AC;&#x153;The science is clear that all forms of asbestos cause ill health and premature death,â&#x20AC;? said Colin Soskolne, a professor in the School of Public Health at the University of Alberta and one of those demanding the ban. â&#x20AC;&#x153;According to the World Health Organization, over 107,000 people die each year from working with asbestos of any type,â&#x20AC;? added Soskolne, a former president of the Canadian Society of Epidemiology and Biostatistics. But Serge Boislard, president of the Mouvement pro chrysotile, said thatâ&#x20AC;&#x2122;s not the whole picture. â&#x20AC;&#x153;Everyone knows that chrysotile, like all other forms of asbestos, is carcinogenic,â&#x20AC;? he said. â&#x20AC;&#x153;What is not addressed is the levels of danger. These are halftruths.â&#x20AC;? *** OTTAWA - Fewer crimes were reported to po-

lice in Canada in 2011 than at any other time in the last 40 years, Statistics Canada said Tuesday â&#x20AC;&#x201D; a revelation that comes as political leaders wrestle with how to curb gun violence on the streets of Toronto. Finding an answer to that question â&#x20AC;&#x201D; Mayor Rob Ford met Monday with Premier Dalton McGuinty, then Tuesday with Prime Minister Stephen Harper â&#x20AC;&#x201D; should be the focal point of the debate, not the numbers, according to at least one crime expert. Though the cityâ&#x20AC;&#x2122;s wounds are still raw from two recent deadly shootings, the agency reported that the seriousness of crime in Toronto was down last year, as it was in almost every major Canadian city. And while the overall homicide rate was up seven per cent â&#x20AC;&#x201D; there were 598 homicides in Canada in 2011, 44 more than the previous year â&#x20AC;&#x201D; the number in Ontario actually hit record lows. *** OTTAWA - Conrad Black says it would heap â&#x20AC;&#x153;insult upon injuryâ&#x20AC;? to strip him of membership in the Order of Canada over U.S. criminal convictions when no Canadian court would have found him guilty of the same charges. In an affidavit filed in the Federal Court of Canada, the former media magnate

argues he must have an oral hearing â&#x20AC;&#x201D; complete with witnesses â&#x20AC;&#x201D; and look the Order of Canadaâ&#x20AC;&#x2122;s advisory council representatives â&#x20AC;&#x153;in the eyesâ&#x20AC;? as they decide whether to recommend revocation of the prestigious award he received in 1990. Supporters including former U.S. Secretary of State Henry Kissinger, a long-time friend and former business associate, have also made written pleas on Blackâ&#x20AC;&#x2122;s behalf, court records show. Black, 67, stands convicted in the United States of fraud and obstruction of justice while he was head of media giant Hollinger International. He served 37 months of a 42-month sentence, but contends he was unfairly maligned by the U.S. justice system. International LONDON - Scotlandâ&#x20AC;&#x2122;s government has announced plans to legalize same-sex marriages. Deputy First Minister Nicola Sturgeon said Wednesday that legislation permitting the marriages would soon be introduced. The measure has backing from the major Scottish political parties. It follows a public consultation on the issue. When enacted, Scotland could become the first part of the UK to allow same-sex

marriages. The UK government has conducted a public consultation on legalizing same-sex marriages, and it has the backing of Prime Minister David Cameron. But UK officials are waiting for the results of the public consultation before taking further steps. *** LONDON - The 11-year-old boy didnâ&#x20AC;&#x2122;t have a passport, didnâ&#x20AC;&#x2122;t have a ticket, didnâ&#x20AC;&#x2122;t have a boarding pass, and somehow managed to get all the way from England to Italy. Officials at Manchester airport and at the airline Jet2.

THE BOLD AND THE BEAUTIFUL Marcus and Dayzee were pronounced man and wife, but Dayzee was unaware that Marcus was keeping a secret from her. Brooke accidentally left the steamy video of Liam and Steffy on her computer, to which Hope also had access. After the wedding was over, Marcus came clean to Dayzee about what he had been hiding from her. Steffy and Liam spent a carefree afternoon together, but she later felt her old feelings resurfacing. After seeing the video, Hope realized that Liam didnâ&#x20AC;&#x2122;t tell her the whole truth about Italy. Wait to See:

6287+($6775$'(5

Early

DEADLINES $V0RQGD\$XJLV 6DVNDWFKHZDQ'D\ 7KH(VWHYDQ0HUFXU\Ň&#x2039;V%XVLQHVV 2IĂ&#x20AC;FHZLOOEH&ORVHG0RQGD\$XJ WRPDUNWKHVWDWXWRU\KROLGD\ DQGWKLVZLOOUHVXOWLQ

DGYHUWLVLQJGHDGOLQHFKDQJHV IRUWKH

:HGQHVGD\$XJXVW (VWHYDQ0HUFXU\

ClassiďŹ ed Advertising

%,*6$/(

2112:7,//$8*867 &HOOXODU6KDGHV :RRG%OLQGV

Democrats and Republicans showing voters their differences over taxing the well-off while accusing each other of threatening to shove the government over a fiscal cliff. Senators planned to vote Wednesday on a $250 billion Democratic bill that would extend expiring tax cuts next year for all but the highest earners. Democrats will need 60 votes to advance the proposal, which they do not have. It seemed unlikely that senators also would vote on a rival GOP plan that includes the best-off Americans in the tax reductions, a measure that was destined to lose.

Melanie calls from Salem tunnels

%OLQGVRIDOONLQGV

(;35(66

com said Wednesday they were investigating how the boy got aboard the flight to Rome and wasnâ&#x20AC;&#x2122;t detected until the cabin crew identified him during the flight. â&#x20AC;&#x153;This is an unusual and serious breach and we are keen to find out what has gone on,â&#x20AC;? the governmentâ&#x20AC;&#x2122;s transport secretary, Justine Greening, said. The unusual incident took place Tuesday amid heightened security concerns during the run-up to the Olympics. *** WASHINGTON - The Senate is bracing for a tax-cut showdown that is all about

5ROOHU6KDGHV 5RPDQ6KDGHV

$1'025( +Z\6RXWK (67(9$16.  %D\+Z\ &$5/</(6. 3K

Taylor and Ridge confront Bill. Brooke urges Liam to believe in fate. DAYS OF OUR LIVES Brady figured out that Melanie made her cell phone call from the Salem tunnels. Lucas accused Sami of falling under EJâ&#x20AC;&#x2122;s spell again after she bailed him out of jail. Jack told Abigail that he approved of her relationship with Cameron. EJ decided to jump bail. Maggie persuaded Victor to keep out of Daniel and Nicoleâ&#x20AC;&#x2122;s relationship. EJ saved Samiâ&#x20AC;&#x2122;s life as shots were fired during his attempt to flee. Melanie escaped after an explosion rocked the tunnels, but Chad might not have been so lucky. Madison felt jilted at the altar when Brady didnâ&#x20AC;&#x2122;t show up for their wedding. Nicole began having signs of early labor. Wait to See: Abigail is trapped in an elevator. Ian feeds Madisonâ&#x20AC;&#x2122;s insecurities. GENERAL HOSPITAL Anna rescued Luke from the fire that he accidentally set. Heather injected Olivia with a hallucinogenic. Connie paid Johnny a visit. Starr was grateful for having a new reason to live -- Michael. Patrick admitted that he didnâ&#x20AC;&#x2122;t want to give up pills because then

6800(56$/(

heâ&#x20AC;&#x2122;d have to face the reality of losing Robin. Todd sent Natalie a photo of John and Samâ&#x20AC;&#x2122;s kiss. Johnny lost his temper after receiving a visit from Anthony. Kate tried to regain her position at Crimson. Ewen tried to rekindle his budding relationship with Elizabeth. Oliviaâ&#x20AC;&#x2122;s family prayed for her recovery in the hospital. Patrick checked himself into a detox facility. Sam wasnâ&#x20AC;&#x2122;t ready to communicate with Jason. Wait to See: Alexis has a daring challenge for Shawn. Trey tries to get closer to Kristina. THE YOUNG AND THE RESTLESS Billy fired Phyllis from the magazine and decided to post her scandalous story on the cover. Later, Nick punched out Billy, unaware that the assault was caught on camera. Jack and Ashley fought over the future of Beauty of Nature. Jeff assured Gloria that he had no ties to Anita anymore. Adam surprised Chelsea with their new home -- a mansion by the lake. Cane suspected that Genevieve was lying about all the mysterious things that were happening to her. Neil refused to allow Sofia to move to New York with their son. Chelsea accused her parents of just wanting her money. Wait to See: Ashley makes a surprising decision about her future. Jack and Nikkiâ&#x20AC;&#x2122;s wedding day approaches. (c) 2012 King Features Synd., Inc.

 2)) 

)RU7+((67(9$10(5&85< 7KH'HDGOLQH:LOO%HÂŤ

7KXUVGD\$XJDWSP  

Display Advertising )RUWKH(VWHYDQ0HUFXU\ 7KH'HDGOLQH:LOO%HÂŤ

7KXUVGD\$XJDWSP

1225 4th St., Estevan

634-1033


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Page 11

Canadian coach guides Tigerâ&#x20AC;&#x2122;s comeback Statues are built for some coaches. Some have had stadiums named after them. A handful have been honoured with Hall of Fame selections. But generally, itâ&#x20AC;&#x2122;s sad but true: coaches are hired to be fired. Coaches are generally necessary, but unimportant components of successful teams. â&#x20AC;&#x153;I couldnâ&#x20AC;&#x2122;t have done it without the playersâ&#x20AC;? is a familiar joke among coaches who know that good players tend to make ordinary coaches good and good coaches great. Undoubtedly the sports coach with the highest profile in North America today is not in the NFL, NHL, NBA or Major League Baseball. The coach faced with the glare of the brightest spotlight in sports today is a Canadian who steers the swing of the worldâ&#x20AC;&#x2122;s most famous golfer, Tiger Woods. His name is Sean Foley, a Torontonian who uses some unique golf ideas and some unusual philosophical approaches to steer his stable of golfers, which also includes Hunter Mahan

Bruce Penton Sports Columnist and Justin Rose, both of whom are ranked among the worldâ&#x20AC;&#x2122;s Top 15, as is Woods. Coaching Woods is not easy. Foley has gone from the equivalent of behind the scenes on golf ranges to Hollywood, where Tigerâ&#x20AC;&#x2122;s every swing tweak is analyzed, dissected and discussed by the golf industry. If Tiger plays well, Foley is a genius. If things go bad in Tigerland, the tabloids may be calling for his head. Rose says Foley is â&#x20AC;&#x153;technical without being mechanical,â&#x20AC;? according to a story on golfworld.com. Oddly, Foley attended Tennessee State, a predominately black college, on a golf scholarship, but he always felt more comfortable on the range, working on his game and others, than on

the course. The golfworld. com story quoted his TSU roommate saying that Foley kept a black garbage bag in his room filled with clippings of instruction articles. His instruction dream led to a job at Glen Abbey, near Toronto, and he started helping Canadian Stephen Ames on the range one day. â&#x20AC;&#x153;... He changed what Iâ&#x20AC;&#x2122;d been trying to change for years,â&#x20AC;? Ames told golfworld.com Through Ames, Foley got to the inside of the PGA Tour and while Woods was going through coaches Butch Harmon and Hank Haney, he was on his way to reaching the low point in his golf career. Now that Foley has helped Woods get back on his game, the Canadian is getting much of the credit for

the resurgence. While Foley stands only five foot seven, he is becoming a big, big man in the world of golf. â&#x20AC;˘ Among the stupid things in sports, by Norman Chad of the Washington Post: â&#x20AC;&#x153;Football players dumping Gatorade on their coach in the waning moments of a victory. First of all, this celebratory gesture lost its appeal about 2,700 gallons of Gatorade ago. Second of all, Iâ&#x20AC;&#x2122;d consider it more appropriate to dump Gatorade on a coach after losing a game.â&#x20AC;? â&#x20AC;˘ Howard Rosenblatt of Albany, N.Y., as seen in Norman Chadâ&#x20AC;&#x2122;s Slouch column: â&#x20AC;&#x153;If MLBâ&#x20AC;&#x2122;s All-Star Game had ended in a tie, would the seventh game of the World Series have been played at a neutral site?â&#x20AC;? â&#x20AC;˘ Scott Ostler of the San Francisco Chronicle, via Twitter: â&#x20AC;&#x153;Next, preOlympics, U.S. hoopsters play Britain. Thatâ&#x20AC;&#x2122;s like prepping for the Henley Regatta by stirring your coffee vigorously.â&#x20AC;? â&#x20AC;˘ Ostler again, on Twitter: â&#x20AC;&#x153;Rex Ryan loses 100

pounds. Says itâ&#x20AC;&#x2122;s now much easier to get his foot into his mouth.â&#x20AC;? â&#x20AC;˘ Greg Cote of the Miami Herald: â&#x20AC;&#x153;Bobby Bowden said Penn State should take down the statue of Joe Paterno. Either that or maybe just position it so that it is constantly looking the other way.â&#x20AC;? â&#x20AC;˘ Headline at SportsPickle.com: â&#x20AC;&#x153;New York Post lays off its 32-person Jeremy Lin pun staff.â&#x20AC;? â&#x20AC;˘ Len Berman of ThatsSports.com, on reports that Olympic beach volleyballers might trade in their skimpy bikinis for leggings and sleeves because of cold-weather forecasts: â&#x20AC;&#x153;I think weâ&#x20AC;&#x2122;re about to find out who the real fans of beach volleyball are.â&#x20AC;? â&#x20AC;˘ Larry Bird, via Twitter, on Kobe Bryantâ&#x20AC;&#x2122;s claims that this yearâ&#x20AC;&#x2122;s U.S. Olympic basketballers could beat the legendary 1992 Dream Team: â&#x20AC;&#x153;They probably could. I havenâ&#x20AC;&#x2122;t played in 20 years, and weâ&#x20AC;&#x2122;re all old now.â&#x20AC;? â&#x20AC;˘ NBCâ&#x20AC;&#x2122;s Jimmy Fallon, on Saints QB Drew Brees getting $60 million guaran-

teed of his five-year, $100 million contract: â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s even better than Katie Holmesâ&#x20AC;&#x2122; deal.â&#x20AC;? â&#x20AC;˘Sportscaster Paul Romanuk, via Twitter, before Andy Murray played in the Wimbledon menâ&#x20AC;&#x2122;s singles final: â&#x20AC;&#x153;Good luck to Murray - British to the English if he wins, a Scot if he loses.â&#x20AC;? â&#x20AC;˘ Comedy writer Alex Kaseberg, after Roger Federer beat Murray for his record-tying seventh Wimbledon title: â&#x20AC;&#x153;He has done better on grass than Willie Nelson.â&#x20AC;? â&#x20AC;˘ R.J. Currie of sportsdeke.com: â&#x20AC;&#x153;The Winnipeg Blue Bombers roster includes a Buck and a Doe. Which must be great news to the Alsâ&#x20AC;&#x2122; Aaron Hunt.â&#x20AC;? â&#x20AC;˘ Kaseberg again: â&#x20AC;&#x153;You know those snappy Ralph Lauren blue blazers and matching berets our Olympic team is wearing at the Opening Ceremonies? Made in China. But donâ&#x20AC;&#x2122;t worry, the steroids theyâ&#x20AC;&#x2122;re on were made in the U.S.A.â&#x20AC;? Care to comment? Email brucepenton2003@ yahoo.ca

Summer fun with seashore shells Hunting for treasures at low tide along a favorite beach is one of lifeâ&#x20AC;&#x2122;s simple pleasures for tots, teens and adults alike. Thereâ&#x20AC;&#x2122;s so much to see, smell and discover in natureâ&#x20AC;&#x2122;s giant sandbox -scampering crabs, colorful seaweed, seagulls, jellyfish (they may sting you!) and all those shells. If youâ&#x20AC;&#x2122;re lucky, youâ&#x20AC;&#x2122;ll find lots and lots of

shells to hand pick and bring back home for a lasting souvenir of the day. Here are some simple lessons and activities that you can do with your young kids and grandkids when you get home. For those who arenâ&#x20AC;&#x2122;t hitting one of the coasts this summer, look for bags or baskets full of shells at neighborhood tag sales and thrift stores. Some specialty toy and craft stores sell them, too. CLEAN If you have just collected shells at a beach, wash them in a bucket with mild detergent and set them out in the sun on a towel to dry. Use old

toothbrushes to scrub the sand out of crevices. Let school-age kids try a science experiment with broken pieces. Place a piece in a jar and cover the piece with vinegar. Set overnight. Did it disappear? Explain that shells are composed of calcium carbonate. The acid in the vinegar dissolves the compound. EXAMINE Sort them by type in piles, and find their names online or in a field guide. Challenge your preschooler to arrange the shells from each pile in rows from largest to smallest.

Bridal Guide 2012

-HVVLH(OLDV $QGUHZ6PROLDN -XO\ -DLPH&URVVOH\ 6SHQFHU/DORQGH -XO\ $PDQGD+HQWRQ 'XVWLQ0DFN $XJXVW -DQHOOH'DDH 7ULVWDQ0DFN $XJXVW $VKOH\)RUUHVWHU 'DQLDO%D\OLVV $XJXVW 5DFKHOOH.LFNOH\ &UDLJ&DLVVLH $XJXVW 6DUDK0RQWH\QH .RU\&OHDUZDWHU $XJXVW .DWHO\Q+HUVFKH 0LNH%HQGHU $XJXVW $PDQGD/LQGHQEDFK $GDP/RMHZVNL $XJXVW &KDQQ\+RXVH $DURQ0DFN 6HSWHPEHU -LOO0DF'RQDOG 7\OHU6HON 6HSWHPEHU -HQQD+HLGLQJHU .\OH/XF 6HSWHPEHU $PDQGD/XKU &KDG0XQUR 6HSWHPEHU 7UDFH\'RQDLV -HII:DUG 6HSWHPEHU 7UDF\7\WODQGVYLN 5REHUW%ORZDWW 6HSWHPEHU &KULVWLQD'RUZDUG -HUHP\6WURQJ 6HSWHPEHU /DFH\*LOO 6FRWW6\NHV 6HSWHPEHU -DPLH&DPSEHOO .HYLQ0F&XUG\ 6HSWHPEHU 'DUF\3LHUVRQ (ULF/RUDQJH 6HSWHPEHU $GULHQQH'DZVRQ %UDG'L[RQ 6HSWHPEHU $PEHU)OHFN -DVRQ.XFKLQND 1RYHPEHU 0HLJDQ*HGDN 6KDZQ:LOKHOP1RYHPEHU 6KHODJK%DQJVXQG $DURQ(VNUD 'HFHPEHU

Talk about how the surfaces feel and use adjectives to describe colors and features. Use a magnifying glass to observe details. You might be surprised to discover the colors of the rainbow inside some. Abalone shells have brilliant, rainbow-like hues. PUT SEASHELLS ON DISPLAY Create a bowl full of memories, and keep it on an end table or on the center of your dining-room table for everyone to see. For a dramatic display, use a large, low pasta serving dish with edges. Fill it half-full with clean sand, and arrange shells and

other favorite mini seashore finds on top. Set flat shells such as scallops or clams upright in the sand. For added attractions, tuck in a travel postcard, a trip photo in a small Lucite frame and a tiny sailboat or other purchase from a souvenir shop. *** Donna Ericksonâ&#x20AC;&#x2122;s award-winning series â&#x20AC;&#x153;Don-

naâ&#x20AC;&#x2122;s Dayâ&#x20AC;? is airing on public television. To find more of her creative family recipes and activities, visit www. donnasday.com and link to the Donnaâ&#x20AC;&#x2122;s Day Facebook fan page. Her latest book is â&#x20AC;&#x153;Donna Ericksonâ&#x20AC;&#x2122;s Fabulous Funstuff for Families.â&#x20AC;? (c) 2012 Donna Erickson Distributed by King Features Synd.

+HDWHG6KRS )RU5HQW

&$7(5,1*

2YHUVTXDUHIHHWRQDFUHV

)URPODUJHZHGGLQJVWRVPDOOHULQWLPDWHDIIDLUV (%¡V'LQLQJ(PSRULXP /HWXVORRNDIWHUWKHFDWHULQJ FDQPDNH\RXU6SHFLDO(YHQWD 'D\WR5HPHPEHU

&DOO6WHYH

)URPODUJHZHGGLQJVWRVPDOOHU LQWLPDWHDIIDLUV /HWXVORRNDIWHUWKHFDWHULQJ 6RXULV$YH (VWHYDQ



<RXUKRPHLV\RXUFDQYDV &RORXULWXQLTXHZLWK\RXUVLJQDWXUHVW\OH

Â&#x2021;'HVLJQHUIXUQLWXUH Â&#x2021;5XJV Â&#x2021;'HFRUDFFHVVRULHV Â&#x2021;6,&2SDLQW VXSSOLHV

Â&#x2021;&XVWRPEHGGLQJ GUDSHULHV Â&#x2021;&XVWRPIUDPLQJ DUWZRUN Â&#x2021;:DOOSDSHU IDX[Ă&#x20AC;QLVKLQJ Â&#x2021;'HVLJQFRQVXOWDWLRQV

)$6+,21 &RWHDX$YH( :H\EXUQ6. 3K

Â&#x2021;%HDXWLIXOJRZQVIRUWKHJUDGXDWH Â&#x2021;)DQF\DWWLUH0RWKHURI%ULGH Â&#x2021;-HZHOOHU\7LDUDV

,QVSLUDWLRQV by Color

$OZD\V7KDW3HUVRQDOL]HG6HUYLFH $SSRLQWPHQWVPD\EHPDGH

&DOOWR$QQRXQFH<RXU8SFRPLQJ:HGGLQJ)RU)UHH

1101 - 5th Street, Estevan â&#x20AC;˘ 634-7008 Open Monday - Friday 9 am - 5 pm


Page 12

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Riders take eyes off ball, suffer consequences â&#x20AC;&#x153;I just took my eyes off the ball.â&#x20AC;? - Weston Dressler, July 20, 2012 He was speaking about himself, but he might as well have been speaking for the entire team. The Saskatchewan Roughriders took their eye off the ball in Week 4. Weâ&#x20AC;&#x2122;re speaking about the Ridersâ&#x20AC;&#x2122; 41-38 overtime loss in Calgary last Thursday that sent Canadaâ&#x20AC;&#x2122;s team to its first defeat of the season. In a fabulous football game on an unmatched summer evening in one of the CFLâ&#x20AC;&#x2122;s greatest cit-

ies, there were five lead changes in the first half before the Riders pulled away in the second. With half a quarter to go in the fourth, however, the Riders took their eye off the ball. Up 17 points, they seemed to put it into cruise control and allowed the proud Stampeders to crawl their way back into the game. Even as it was slipping away, from the broadcast booth, I never felt for one second like Saskatchewan would let this one get away. In case you missed it, the Riders even had a last-minute drive with the

Rod Pedersen Rider Insider game tied 35-35. However, a deep pass from Darian Durant well into Calgary territory went right through the hands of the Ridersâ&#x20AC;&#x2122; most sure-handed receiver, Weston Dressler. But he was far from the only culprit in this one. Calgary, of course,

won it in overtime on a Nik Lewis touchdown, while the Riders could only muster a 50-yard Chris Milo field goal. Both Rider coach Corey Chamblin and team president Jim Hopson were seething after the game but kept their thoughts to them-

selves. Chamblin stared straight ahead and gnawed on his lip while answering reportersâ&#x20AC;&#x2122; questions. However, no one would assign blame or point fingers. They may have had some private thoughts on whom to blame, and it was likely discussed behind closed doors, but weâ&#x20AC;&#x2122;ll never know. That will buy them both some serious equity within the locker room. Chamblin simply said there are no excuses for the loss, and that it will not happen again. Good Lord, I hope

not. It was bad enough in the 2009 Grey Cup, in that very stadium, where the Riders choked up a 16-point lead in the fourth quarter and lost to Montreal in the championship. This game had a similar stunning feeling but about one-hundredth less the pressure. Theyâ&#x20AC;&#x2122;re a very young team and theyâ&#x20AC;&#x2122;ll bounce back. The good news is we know the Riders ARE good enough to have gone 4-0 because they had the game under control ... until they took their eye off the ball.

Watermelon makes a sassy salsa

Watermelon shouldnâ&#x20AC;&#x2122;t be restricted to just fruit platters and buffet tables. Its versatility is astounding and can be incorporated into various menus. North Americans primarily treat watermelon as a fruit, eaten out of hand or in salads and sweet desserts. Yet, in countries such as China, watermelons are stir-fried and stewed, and in Russia and many other countries, pickled watermelon rind is considered a delicacy and widely enjoyed.

If youâ&#x20AC;&#x2122;re looking for a summertime salsa that combines sweetness, spice and everything nice, try this delicious Watermelon, Tomatillo and Jalapeno Salsa recipe. Best of all, you can use the watermelon as a festive serving dish. This recipe also works well with those small â&#x20AC;&#x153;personalâ&#x20AC;? sized watermelons, as they make the perfect individual â&#x20AC;&#x153;dishesâ&#x20AC;? for serving your salsa. WATERMELON, TOMATILLO AND JALAPENO SALSA 10 medium tomatillos, peel off parchment-like coating and rinse 2 tablespoons olive oil 1/2 purple onion, chopped

2 cloves garlic, chopped 3 jalapeno peppers or to taste, seeded and chopped 1 tablespoon ground cumin 2 teaspoons mild chili powder 1 cup tomato sauce or puree 2 teaspoons stevia, agave syrup or honey 4 cups seeded watermelon, diced, divided 1 teaspoon salt 1 teaspoon pepper 1. Cut the tomatillos into quarters. Heat the oil in a large heavy saute pan over medium-high heat, saute the onions for a few minutes and then add the tomatillos, garlic and jalapenos. Saute until onions and garlic begin to brown. Reduce

PHOTO CREDIT: stock.xchg photo

.LWFKHQHWWH 6XLWHV$YDLODEOH ZLWKIXOOVL]HDSSOLDQFHV

)RUIXUWKHUUHQWDOLQIRUPDWLRQ FDOO6WHYH

is Served h c n u r B

6XQGD\$XJXVW 1 12:216$/( Sunday Brunch 10-2

634-3534 â&#x20AC;˘ Downtown Estevan

7LFNHWVFDQEHSXUFKDVHGWKURXJK 7LFNHWPDVWHURQOLQHDWKWWSWLFNHWPDVWHUFD RU7LFNHWPDVWHU&KDUJHE\3KRQHDW

(67(9$16.

facebook.com/SpectraPlace

KWWSVSHFWUDSODFHFD twitter.com/SpectraPlace


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Page 13

Alouettes release Hunt to shake up defence National SURREY, B.C. - B.C. Lions defensive lineman Khalif Mitchell wasnâ&#x20AC;&#x2122;t letting a not-so-little thing like his appeal of a two-game suspension bother him Tuesday. Mitchell, known for being a gentle giant off the field and an ultra-competitive one on it, has formally appealed the punishment he received for hyperextending the arm of Edmonton offensive lineman Simeon Rottier during a 27-14 loss to the Eskimos on Friday night. As a result, Mitchell will play Saturday in Calgary against the Stampeders and have his appeal heard at an arbitration hearing during the week of August 6. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t mind being the centre of attention,â&#x20AC;? said Mitchell after practice at the Lionsâ&#x20AC;&#x2122; training facility. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t mind not being asked one question. Itâ&#x20AC;&#x2122;s not really a big gift or a courtesy. It comes with the business.â&#x20AC;? CFL commissioner Mark Cohon handed down the suspension Monday night after Mitchell violently pulled on Rottierâ&#x20AC;&#x2122;s arm, bending it grotesquely in an unnatural fashion that resulted in the joint being hyperextended. *** MONTREAL - Itâ&#x20AC;&#x2122;s been a tough start to the

CFL season for the Montreal Alouettes defence but coach Marc Trestman feels it will get better. The once-feared defence has surrendered nearly 35 points per game while forging a 2-2 record to start the season. The club is coming off a 39-24 loss in Hamilton on Saturday. The changes began when the team got back together on Tuesday to begin preparations for a visit on Friday night from quarterback Ricky Ray and the Toronto Argonauts. Aaron Hunt, the biggest name among their off-season free agent signings, was released, although Trestman was quick to note that the former B.C. Lion was not being made the scapegoat. *** TORONTO - Veteran defenceman Steve Staios is retiring and moving into the Toronto Maple Leafsâ&#x20AC;&#x2122; front office. The Hamilton native, who spent 18 seasons in the NHL, has been named Torontoâ&#x20AC;&#x2122;s new player development adviser. Staios, 39, will advise the Leafs management team on the prospects and players at all levels of the organization. He will also take on special assignments for both the amateur and pro scouting

departments. Staios spent last season with the New York Islanders, recording eight assists in 65 games. He finishes his career with 56 goals and 164 assists in 1,001 games with Boston, Vancouver, Atlanta, Edmonton, Calgary and the Islanders. International NEW YORK, N.Y. - Penn State starting quarterback Matt McGloin has tweeted that he intends to stay with the Nittany Lions. McGloin tweeted that the penalties announced by the NCAA on Monday were â&#x20AC;&#x153;extremely harsh.â&#x20AC;? â&#x20AC;&#x153;I am a Nittany Lion and will remain one.â&#x20AC;? he also tweeted. â&#x20AC;&#x153;I believe in the core values I have learned in this program. It is not Nittany Lion Football. It is Nittany Lion family.â&#x20AC;? Penn State players are allowed by the NCAA to transfer to another school without sitting out a year. McGloin, a former walk-on, was given the starting job last month by coach Bill Oâ&#x20AC;&#x2122;Brien. He completed just 54 per cent of his passes last season, and missed the TicketCity Bowl vs. Houston â&#x20AC;&#x201D; a 30-14 loss â&#x20AC;&#x201D; after sustaining a concussion in a locker-room scuffle with

a teammate. *** PHILADELPHIA Shea Weber can thank the Philadelphia Flyers for one of the richest and longest contracts in the NHL. But the Nashville Predators will pick up the tab. The small-market Predators made the bold move Tuesday to match the staggering offer sheet made by a deep-pocketed Flyers organization to keep the two-time Norris Trophy-

Bryant commit family violence against his mother? No.â&#x20AC;? Police arrested Bryant on July 16, two days after his mother, Angela Bryant, called 911 to complain her son was assaulting her. Authorities said they found her with a swollen wrist and thumb and bruising on her upper arms. Angela Bryant allegedly told authorities Dez Bryant hit her in the face with his ball cap and tore her shirt.

nominated defenceman in the franchise. Shea it ainâ&#x20AC;&#x2122;t so, Philly. Weber is still a Predator. *** DALLAS - The attorney for Cowboys wide receiver Dez Bryant asked prosecutors Tuesday not to pursue charges against his client, who was arrested after allegedly attacking his mother during an argument. â&#x20AC;&#x153;Did a family disagreement occur? Yes,â&#x20AC;? attorney Royce West said. â&#x20AC;&#x153;Did Dez

&DOOPHIRU\RXU5HVLGHQWLDO )DUP &RPPHUFLDO 5HDO(VWDWHQHHGV )ROORZPH

 2SHQ+RXVH 6DWXUGD\ -XO\ DP1RRQ

-RVK/H%ODQF 6XQ9DOOH\'ULYH(VWHYDQ

Â&#x2021;%HGURRPV Â&#x2021;%DWKV /RFDWHG LQ WKH TXLHW DUHD RI %D\ 0HDGRZV LV Â&#x2021;VTIWRQOHYHOV 0/6 WKLV XSGDWHG  OHYHO VSOLW KRPH 7KH \DUG LV QLFHO\ODQGVFDSHG KDVDODUJHGHFN SDWLR 

)UDQN¡VRQWK(VWHYDQ

7XPEOHZHHGV5HVWDXUDQW0LGDOH

7KULYLQJPHQ¡VDQG FKLOGUHQ¡VFORWKLQJ VWRUHLQWKHKHDUWRI GRZQWRZQ

/RFDWHGQHDU+Z\ :LQWKHERRPLQJ WRZQRI0LGDOH 0/6

0/6





,Q WKH VDPH ORFDWLRQ IRU DSSUR[  \HDUV )UDQN¡V RQ WK KDV 7XPEOHZHHGVLVDIXOOVHUYLFHOLFHQVHGUHVWDXUDQWRIIHULQJEUHDN IDVWOXQFKVXSSHUSL]]DDQGFDWHULQJVHDWFDSDFLW\H[WHQ SURYLGHGPHQRI6(6DVNZLWKIRUPDODQGFDVXDOFORWKLQJ VLYHO\UHQRYDWHG0RVWHTXLSPHQWXSGDWHG

WK6WUHHW(VWHYDQ

'XWND$FUHDJH%LHQIDLW 0DMRUSRWHQWLDODZDLWV \RXLQWKLVVT IWKRPH

*UHDWEHGURRP VWDUWHUUHYHQXHRU EDFKHORUKRPH

0/6

0/6





8SJUDGHGZLQGRZVĂ RRULQJVRPHSDLQWWULPFRXQWHUWRSVDQG DFUHVMXVWVHFRQGVRXWVLGHRI%LHQIDLWDQGVWLOOZLWKLQWRZQ EDFN VSODVK 7KHUH LV D GHFN RYHUORRNLQJ WKH VSDFLRXV EDFN OLPLWV 7KH \DUG VLWH KDV PDQ\ RXWEXLOGLQJV LQFOXGLQJ D EDUQ GRXEOHGHWDFKHGJDUDJHDQGVWRUDJHVKHGV \DUG

(VWHYDQ6KRSSHUV0DOO Â&#x2021;Â&#x2021;

ZZZEKJUHVVFD

iT m

p r u S ce Up Your Cabin?? o T e Larson Storm Door

0HWDO&ODGGLQJ 0DQ\W\SHV SURĂ&#x20AC;OHVDYDLODEOH 1RZVWRFNLQJYDULRXVOHQJWKVRI *DOYDOXPH ZKLWHZKLWHPHWDO )DUPDQGLQGXVWULDOJDOYDQL]HGJDOYDOXPHDQGFRORXUHG  JDXJHPHWDORUGHUHGWRVXLW\RXUVL]HDQGQHHGV 3KRQHIRUSULFLQJZLWK\RXULQGLYLGXDOUHTXLUHPHQWV

7KLQNLQJZLQGRZV" 6KRSDQGFRPSDUH 1536216

$20.66 Mistints Interior/Exterior $10.00/gallon

,QVLVWRQ&:'ZLQGRZVDQGGRRUV 39&:LQGRZV0HWDOFODGZLQGRZV 3DWLRDQGJDUGHQGRRUV,QVXODWHGVWHHOGRRUV

Regular: $216.95

Solignum Stain - 3.78 gallon

Buy 2 get 1 FREE

Special $199.50

&DOOIRUFRPSDUDWLYHSULFLQJ

Mintcraft 6 lb. & up Sledge Hammer with ďŹ berglass handle 4960134

Smart Screen Gutter Protection System $37.75

per package/20 linear ft.

$37.99

:22'&28175< :22'&28175< (67(9$10&/($17,6'$/( 3K  Â&#x2021;)D[  Â&#x2021;.HQVLQJWRQ$YHQXH(VWHYDQ +RXUV0RQ)ULDPSP6DWDPSP

VISIT US ON OUR WEBSITE:

www.wood-country.com


Page 14

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Cooling Off

Skylar Mack, four, splashes three-year-old Karys Mack in the pool at the Rusty Duce playpark last week.

Dessert is exclamation point with cream pie mix

If you’re like most folks, dessert is the exclamation point to the meal! Well, this delicious pie is quite a way to punctuate any menu. Be prepared to receive compliments and even share the recipe. 2 (4-serving) packages sugar-free instant white chocolate pudding

1 1/3 cups nonfat dry milk powder 2 cups water 3/4 cup reduced-calorie whipped topping 1 1/2 teaspoons coconut extract 6 (2 1/2-inch) chocolate graham crackers 1 (6-ounce) purchased chocolate piecrust 2 tablespoons flaked coconut 1. In a large bowl, combine dry pudding mixes, dry milk powder and water. Mix well using a wire whisk. Blend in whipped topping and

coconut extract. Coarsely crush 5 graham crackers. Fold in cracker crumbs. 2. Spread mixture evenly into piecrust. Crush remaining 2 graham crackers into fine crumbs. Evenly sprinkle coconut and fine cracker crumbs over top. Refrigerate for at least 2 hours. Serves 8. • Each serving equals: 206 calories, 6g fat, 6g protein, 32g carb., 516mg sodium, 1g fiber; Diabetic Exchanges: 1 1/2 Starch, 1/2 Fat-Free Milk. (c) 2012 King Features Synd., Inc.

Has your hair ever been cut? • It was beloved American comedian and film star Groucho Marx who made the following sage observation: “There’s one way to find out if a man is honest -- ask him. If he says ‘Yes,’ you know he is a crook.” • The ancient Egyptians were known to use crocodile dung as a contraceptive. • You may be surprised to learn that when the hit 1950s TV show “I Love Lucy” had its premiere, Lucille Ball was already 40 years old. • Talk about sneaky: In order to get a photo of Bing

Crosby in his coffin, The National Enquirer tabloid had a reporter dress as a priest and sneak into the private funeral service. To top it off, on his way out of the service, the disguised journalist toldABC reporter Geraldo Rivera not to pester the family at such a sensitive moment. • Every year, about $500 million is spent on beads for Mardi Gras. • Ever wonder how the statuette taken home by winners of the Academy Awards got its nickname? Evidently, in 1931 a secretary at the Academy of Motion Picture Arts and Sciences saw the statuette for the first time and exclaimed, “Why, he reminds me of my Uncle Oscar!” The

comment struck the fancy of a reporter who was present, and he put it in a story about the awards, and the name stuck. • Are you acersecomic? If your hair has never been cut, you are. • Confederate Gen. Robert E. Lee was not himself a slave owner. He reportedly did not believe in the institution of slavery. • If this is an average week, three manmade artifacts hurtling into the atmosphere from space will crash into the Earth. *** Thought for the Day: “The world is round; it has no point.” -- Adrienne E. Gusoff (c) 2012 King Features Synd., Inc.

2 - bedrooms Large Deck 1 - bath Septic Tank 1120 Square Cistern Feet Fully Furnished

YEAR ROUND LIVING- MOVE IN READY!

306-848-1000


EnergyPage THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

The

+Z\(DVW(VWHYDQ 3KRQH )D[

:HOOKHDG6\VWHPV '5,//,1*/,&(16(6

7ZHQW\VHYHQOLFHQVHVLVVXHGWR)ULGD\-XO\ * * * * * * * * * * * * * * * * * * * * * * * * * * *

92&HWDO3LQWR+=&$ 4XHVWHUUH:LOGFDW+LOO  4XHVWHUUH:LOGFDW+LOO  3%(19LHZÃ&#x20AC;HOG+] $$ 3RVWHOOHWDO(OVZLFN5(  &DQHUD2XQJUH+]&& &DQHUD2XQJUH+]'' 5LR7LQWR(GJHOH\  5LR7LQWR4X·DSSHOOH  3DVVSRUW0LQWRQ+]'$ 5HQHJDGH$XEXUQWRQ+]&' 5HQHJDGH$XEXUQWRQ+]%& (ONKRUQ1RUWKJDWH+]'' .LQZHVW$ODPHGD+]&% .LQZHVW$ODPHGD+] $$ /HJDF\6WHHOPDQ+]%& 6LOYHU6SXU9LHZÃ&#x20AC;HOG+]&% 6LOYHU6SXU9LHZÃ&#x20AC;HOG+] $$ 6LOYHU6SXU9LHZÃ&#x20AC;HOG+] $$ .LQZHVW%HQVRQ+] $$ .LQZHVW%HQVRQ+] %% (SSLQJHWDO&KDSHDX/DNH  3%(1&ODULODZ+]$' 3%(19LHZÃ&#x20AC;HOG+] $% 0RVDLF.(VWHUKD[\6:'  92&HWDO3LQWR+]'% 92&HWDO3LQWR+]&'

* ( ' ( ) ( ) ) * ( ) / ( ) ' ( & ( ( / ' ' % )

$GYDQFH 0LGDOH6LOYHUWRQ+] %$ $GYDQFH %'2*0DLU+]&& &DQHOVRQ 3HPRFR3DUNPDQ'' $% $OOLDQFH5HQHJDGH$GYDQFH'''& 5HG'RJ 6XUH4XHHQVLGH(DVW+] %% %LJ6N\$UF3DUNPDQ9,8+]'' 1DERUV0RVDLF.,(VWHUKD]\6:'  %HWWV (ONKRUQ1RUWKJDWH(DVW+] $$ 9RUWH[ 7ULZHVW$ODPHGD+]&& 3UHFLVLRQ5HQHJDGHHWDO&U\VWDO+LOO+] $$ (QVLJQ+DUYHVW:KLWHEHDU+]&' $NLWD %+3%0HOYLOOH  &DQHOVRQ (ONKRUQ1RUWKJDWH+]&$ $GYDQFH 0LGDOH6WHHOPDQ+] $% (QVLJQ/HJDF\6WHHOPDQ+] %% (QVLJQ 3%(1&ODULODZ:HVW+]&& &KDPSLRQ&15/6WHHOPDQ+]&' 5HG'RJ 6RXWKHUQ:RUGVZRUWK+] $% /DVVR)ODJVWRQH6WHHOPDQ+]'& (QVLJQ 3%(19LHZÃ&#x20AC;HOG+] %% %LJ6N\ 3%(19LHZÃ&#x20AC;HOG+] %$ (QVLJQ 3%(19LHZÃ&#x20AC;HOG+]'' (QVLJQ 3%(19LHZÃ&#x20AC;HOG+]&% 5\GHU &3(&6WRXJKWRQ6:'5( 

5,*5(3257

7+( (67(9$10(5&85< '5,//,1*5(3257 ( ) % ( $ ) % ( ' ( ( ) ' ) ) ' /

(QVLJQ 3%(19LHZÃ&#x20AC;HOG+] '& 1DERUV 375&,1-  9RUWH[ 3DLQWHG3RQ\9LHZÃ&#x20AC;HOG+] %% 6D[RQ:LOOLVWRQ+XQWHU7DEOHODQG+]'$ (QVLJQ 3%(19LHZÃ&#x20AC;HOG+] %% &DQHOVRQ1$3)RDP/DNH6  &UXVDGHU %D\WH[7DEOHODQFH+] %% 3DQWKHU:LOOLVWRQ+XQWHU7DEOHODQG+] $$ +RUL]RQ $SDFKH0LGDOH8QLW+]'$ 3DQWKHU +XVN\2XQJUH+] %% 3UHFLVLRQ +XVN\2XQJUH+]%' &DQHOVRQ1$/2XQJUH+]'' +RUL]RQ3DLQWHG3RQ\)ODW/DNH  (QVLJQ(QHUSOXV6NLQQHU/DNH+] %% 7ULQLGDG $UFHWDO6NLQQHU/DNH+] $% 1DERXUV 9DOH3LDSRW  &DQHOVRQ /HJDF\HWDO)U\V(DVW+]''

' % ( * ( . % / . % ( & & - + % % $ . - & & . % $ ) % . ( $ % ( $ % . '

%'2*3DUNPDQ 0RVDLF.(VWHUKD]\:6: 0RVDLF(VWHUKD]\(+ 5HOLDEOH:DZRWD %'2*0DLU6:' 3RVWHOOHWDO:RUNPDQ +LJKURFN5\HUVRQ 4XHVWHUUHHWDO5\HUVRQ+] &' (SSLQJHWDO%HOOHJDUGH6:' 4XHVWHUUHDWDOO)U\V(DVW'' %& 3KDVHHWDO0DQRU 2SHQÃ&#x20AC;HOG0DQRU %+3%0HOYLOOH 7ULZHVW$ODPHGD(DVW6:' .LQZHVW$ODPHGD (ONKRUQ1RUWKJDWH+] '$ 6SHFWUXPHWDO.LVEH\+]$$ /HJDF\3LQWR+] '' &3(&%URZQLQJ+] && &3(&9LHZÃ&#x20AC;HOG+] $' 6SHFWUXPHWDO9LHZÃ&#x20AC;HOG+] $& &3(&9LHZÃ&#x20AC;HOG+]%% &3(&9LHZÃ&#x20AC;HOG+] && &3(&9LHZÃ&#x20AC;HOG+] %& &3(&9LHZÃ&#x20AC;HOG+] && &3(&9LHZÃ&#x20AC;HOG+]%$ &3(&9LHZÃ&#x20AC;HOG+] &% &3(&9LHZÃ&#x20AC;HOG+]$% &3(&+RIIHU+]$$ &3(&+RIIHU+]%$ $UF7ULEXQH &3(&+RIIHU+]$$ 5LR7LQWR6HGOH\ 6SDUWRQ&H\ORQ 3%(13DQJPDQ'' %' 3DVVSRUW0LQWRQ+] &$

:$,7,1*21352*5$0

Industry Safety Training

www.southeastcollege.org

Skid Control Training (1/2 day theory, 1/2 day practical)

Y

ITUTE ST

E N E RG

TR

N

SA

Our full-size SUV and a state-of-the-art SKIDCAR system is designed to evaluate your driving skills and practice different skid control maneuvers. The theory portion includes topics such as driving on gravel roads, winter roads, 4x4, fatigue management, texting, DFMMQIPOFT wildlife, collision avoidance, and substance abuse. ATCHEWA SK

AI N I N G I N

Page 15

SASKATCHEWAN ENERGY TRAINING INSTITUTE

To schedule a course for your employees, please contact Ken, Paula, or Faye toll-free at 1-866-999-7372

A demo of our SKIDCAR simulator can be seen on Visit www.youtube.com/user/SoutheastCollege

Visit us on the web! www.estevanmercury.ca


Page 16

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

0,1(5$/5,*+76 ,I \RX DUH LQ WKH PDUNHW WR VHOO \RXU PLQHUDO WLWOH RU UR\DOW\ LQWHUHVW .H\VWRQH 5R\DOW\ &RUS LV SUHSDUHG WR WDNH DFWLRQ 2XU FRP SDQ\KDVEXLOWDUHSXWDWLRQRI EX\LQJ PLQHUDO WLWOHV TXLFNO\ DQGDWIDLUPDUNHWYDOXH:H ,ILQWHUHVWHGFRQWDFW DUHIXOO\SUHSDUHGWRHYDOXDWH -DUHG/XNRPVNL \RXU UR\DOW\ RU IHH PLQHUDO 93/DQG WLWOH SURSHUW\ IRU SXUFKDVH 3KRQH   ZLWK QR REOLJDWRQ WR VHOO )D[  

I \ 6DIHW\ (QYLURQPHQWDO6HUYLFHV )LUHÀJKWLQJ7UDLQLQJ 367,537UDLQLQJ

Enform COR CertiÀed 24 HOUR SERVICE 62 DEVONIAN ST. ESTEVAN, SK.

3LSHOLQH&RQVWUXFWLRQ $YDLODEOHE\DSSRLQWPHQW

$XJXVW

6XQ0RQ7XH:HG7KX)UL6DW 



-XO\ )LUVWDLGFSUDHG /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ&RQW¶

 &RQILQHG6SDFH /DPSPDQ







 67$7+2/,'$<

 

 )DOO3URWHFWLRQ /DPSPDQ











 +6 /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ

  )LUVWDLGFSUDHG /DPSPDQ&RQW¶  *URXQG'LVWXUEDQFH /DPSPDQ







 5LJJLQJ +RLVWLQJ /DPSPDQ

 &RQILQHG6SDFH /DPSPDQ

 )LUH([WLQJXLVKHU /DPSPDQ









 +6 /DPSPDQ

 )DOO3URWHFWLRQ /DPSPDQ







6HSWHPEHU 6XQ0RQ7XH:HG7KX)UL6DW 



LOCALLY OWNED & OPERATED



-XO\&RQWUDFW

PH: 637-2180 FAX: 637-2181

&58'(2,/











  67$7+2/,'$< *OREDO*URXQG 'LVWXUEDQFH /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ&RQW¶









 +6 /DPSPDQ

  &RQILQHG6SDFH )DOO3URWHFWLRQ /DPSPDQ /DPSPDQ











 

 *OREDO*URXQG 'LVWXUEDQFH /DPSPDQ





 &RQILQHG6SDFH /DPSPDQ

 +6 /DPSPDQ



    



&ORVLQJSULFHDVRI 0RQGD\-XO\



 6SRQVRUHGE\

 86'2//$56

&DQFHOODWLRQ QRWLFH LV UHTXLUHG  +UVLQDGYDQFH$OOQRVKRZVZLOOEH ELOOHGIRUWKHIXOOFRVWRIWKHFRXUVH

$YDLODEOHE\DSSRLQWPHQW

     

7R5HJLVWHU&DOO7ULFLD# (PDLOWVWLQVRQ#ÁLQWHQHUJ\FRP

2LOÀHOG(OHFWULFDO &RQVWUXFWLRQ 6HUYLFH ,QVWUXPHQWDWLRQ 0RWRU6DOHV5HZLQGV 5HSDLUV .HQVLQJWRQ$YH(VWHYDQ6.

  +2856(59,&(

MORE WAYS TO STAY UP TO DATE!

Visit us on the web!!

www.estevanmercury.ca

The Page Energy

PLC’S, VFD’S BATTERY CONSTRUCTION TRENCHING MOTOR SALES & REPAIRS

3UHUHJLVWUDWLRQ LV UHTXLUHG IRU DOO FRXUVHV

:LOOWUDLQDW\RXUORFDWLRQE\DSSRLQWPHQW

(PDLOMOXNRPVNL#NH\VWRQHJURXSFD

ELECTRICAL CONSTRUCTION, MAINTENANCE & SERVICE

$OO FRXUVHV EHJLQ DW DP XQOHVVRWKHUZLVHQRWHG

12:$9$,/$%/(


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012 7+(75$'(5)5,'$<$8*867

(;35(66 6287+($6775$'(5



Page 17

3DJH

3OHDVHXVHWKHKDQG\IRUP IRXQGRQWKH&ODVVLILHG SDJHVWRVXEPLW\RXUDG COMING EVENTS

HOUSES FOR SALE

GAT E WAY F E ST I VA L BENGOUGH JULY27-29 BIG WRECK JORDAN COOK GEORGE CANYON HEY ROMEO etc. tickets Bengough Drugs Assiniboia Escape Salon

4 LEVEL SPLIT HOUSE 1,800 sq. ft. Main area plus basement and double car garage. Fenced. Priced to sell. Call Ron: 634-7635 or Cell: 461-8840.

ROCHE PERCEE TRAIL RIDE & WAGON TREK August 10, 11, 12, 2012 634-4380 ~ 634-2432 jacobs@sasktel.net

GARAGE SALES

MOBILE/ MANUFACTURED

FEED & SEED

At the Southeast Trader Express Pay Full Price for a CLASSIFIED in

FOR SALE BY OWNER: Character House, 713 - 3rd Street. 4 Bedrooms, 3 baths, 6 appliances, central air and vac, new windows and water heater, newer fur nace, some furnishings. Living space 1,800 sq. ft. Asking $269,900. Open House - Saturday, July 21, 10 a.m. - 4 p.m. Viewing by appointment, Call Carole: 634-5720.

SOUTHEAST TRADER

EXPRESS

Repeat the Same Ad in the

Estevan

Mercury

TOWNHOUSES FOR SALE

GARAGE SALE Saturday, July 28 Sunday, July 29 9:00 a.m. to 7:00 p.m. 1417 - 5th Street Orthopedic bed, coveralls, childrenâ&#x20AC;&#x2122;s equipment, womenâ&#x20AC;&#x2122;s roller derby gear, etc.

FOR SALE. WARMAN 55 PLUS AC T I V E A D U LT L I F E ST Y L E Large Ground Level Townhomes 306 241 0123 www.diamondplace.ca

PERSONAL MESSAGES

OUT OF TOWN FOR SALE In Stoughton: New modular home on own lot. 3 Bedrooms, 2 baths. Vacant. $8,000 down; Payments $800/month. Must have good credit and be able to bank qualify. Phone 1-587-4348525. HOUSE FOR SALE in Kisbey: Approx. 1200 sq. ft. bungalow, 3 bedrooms and 1 bath upstairs, attached insulated 2-car garage, central air, well treed yard. Full sized basement with bathroom, bedroom, kitchen and living area could be used as rental income. Very nice house. $250,000. Phone 306-462-4461, 306-577-8519 or 306-577-1695.

www.estevanmercury.ca

For

Our ClassiĂ&#x20AC;ed Sale Never Ends!

C U S T O M B U I LT R E A D Y T O MOVE HOMES: R. Barkman Constr uction, Cromer, Manitoba. Quality workmanship and materials. Please Phone Randy at 204662-4561 for Estimates and Design or Stop in to Visit Our Homes.



Estevan Mercury & Southeast Trader Express CLASSIFIED INDEX

LOTS & ACREAGES FOR SALE FOR SALE: 10 Acre parcels of residential land, 1.5 miles west of Estevan. Phone 634-7920 or 4211753.

VACATION RENTALS

1/2 Price!

LAND FOR SALE

WANTED TO RENT LOOKING TO RENT: A D o u bl e car garage in Bienfait. Can be heated. Would like to rent for 4 months to a year. Doing SGI hail damage repair on vehicles. Phone 306-565-1995 or 306-536-2650.

ROOMS ROOMS FOR RENT: S i n g l e s $400 + Tax weekly; Doubles $500 + Tax weekly. All rooms have cable, microwave, fridge, free wireless Internet. Kitchenettes also available. Bus Depot access. Phone 634-2624. UPTOWN MOTEL Has rooms for rent - Daily or Weekly rates. Phone 634-2624.

MOBILE/ MANUFACTURED

Engagements Wedding Annivers. Anniversaries Birthdays Announcements Prayer Corner In Memoriam Cards of Thanks Coming Events Garage Sales Memorial Services Personals Health/Beauty Lost Found Introduction Services Readings Psychics Travel Health Spas Tickets Childcare Available Childcare Wanted

SERVICES Accounting/

FEED & SEED

HEALTH SERVICES SLIMDOWN FOR SUMMER! Lose up to 20lbs in just 8 weeks. Call Herbal Magic today! 1-800-8545176.

PSYCHICS TRUE Advice! TRUE Clarity! TRUE PSYCHICS 1-877-342-3032 or 1-900-528-6256 or Mobile #4486 (18+) 3.19/min. www.truepsychics.ca

SERVICES FOR HIRE NEED A HOME PHONE? Cable TV or High Speed Internet? We Can Help. Everyone Approved. Call Today. 1-877-852-1122 Protel Reconnect

Find it all in the Classifieds!

HEATED CANOLA WANTED!! - GREEN CANOLA - SPRING THRASHED - DAMAGED CANOLA FEED OATS WANTED!! - BARLEY, OATS, WHT - LIGHT OR TOUGH - SPRING THRASHED HEATED FLAX WANTED!! HEATED PEAS HEATED LENTILS "ON FARM PICKUP" Westcan Feed & Grain 1-877-250-5252

STEEL BUILDINGS / GRANARIES FOR SALE: Used steel grain bins, 14 to 19 ft. diameter, aeration fans. Phone 306-421-0205.

Bookkeeping Appliance Repairs Auctioneers Bricklaying Building/Contracting Building Supplies Drywalling Building/Contracting Electrical Handyperson Hauling Cleaning Janitorial Landscaping Lawn & Garden Moving Painting/Wallpaper Renos/Home Improvement Roofing Snow removal Services for Hire Vacuum Services

LEGAL Notices to Creditors Assessment Rolls Tax Enforcement Tenders Notices/Nominations Legal/Public Notices Judicial Sales Houses for Sale Apts./Condos for Sale Out of Town Cabins/Cottages/ Country Homes Apts./Condos for Rent Duplexes for Rent Houses for Rent Mobiles/Pads Housesitting Wanted to Rent Rooms for Rent Room & Board Shared Accomm. Mobile/Mft. Homes for Sale Recreational Property Revenue Property Garages Real Estate Services Investment Opport. Business Opportunities Hotels/Motels Business Services Financial Services Industrial/Commercial Storage Space for Lease Office/Retail for Rent Warehouses Farms for Sale Farms/Acreages for Rent Land/Pastures for Rent Mineral Rights Farm Implements Livestock Horses & Tack

Farm Services Feed & Seed Hay/Bales for Sale Certified Seed for Sale Pulse Crops/Grain Wanted Steel Buildings/ Granaries Farms/Real Estate Antiques For Sale/Miscellaneous Furniture Musical Instruments Computers/Electronics Firewood Sports Equipment Farm Produce Hunting/Firearms Plants/Shrubs/Trees Pets Wanted to Buy Auctions Adult Personals Domestic Cars Trucks & Vans Parts & Accessories Automotive Wanted RVs/Campers/Trailers Boats Snowmobiles Motorcycles ATVs/Dirt Bikes Utility Trailers Oilfield/Wellsite Equip. Heavy Equipment Career Opportunities Professional Help Office/Clerical Skilled Help Trades Help Sales/Agents General Employment Work Wanted Domestic Help Wanted Career Training Tutors Memorial Donations Obituaries


Page 18 THE TRADER EXPRESS, FRIDAY, JULY 27, 2012 STEEL BUILDINGS / FOR SALE - MISC GRANARIES STEEL BUILDING HUGE CLEARANCE SALE! 20X24 $4,658. 25X28 $5,295. 30X40 $7,790. 32X54 $10,600. 40X58 $14,895. 47X78 $19,838. One end wall included. Pioneer Steel 1-800-6685422. www.pioneersteel.ca. STEEL BUILDINGS - 33 1/3 to 50% off. Complete for Assembly. Ex. 20x24 Reg. $6,792, Disc. $5,660 (Quantity 1); 50x100 Reg. $42,500 Disc. $29,000 (Quantity 2). Call for Others. Source#18X. 800-964-8335.

FOR SALE - MISC ECI STEEL INC. PRINCE ALBERT, SK. HWY # 3 E & 48 ST (306)922-3000

GUARANTEED BEST

PRICE

LARGE QUANTITIES OF SQUARE

&

RECTANGLE

TUBING AVAILABLE FOR IMMEDIATE SALE.

CALL

Advertisements and statements contained herein are the sole responsibility of the persons or entities that post the advertisement, and the Saskatchewan Weekly Newspaper Association and membership do not make any warranty as to the accuracy, completeness, truthfulness or reliability of such advertisements. For greater information on advertising conditions, please consult the Associationâ&#x20AC;&#x2122; s Blanket Advertising Conditions on our website at www.swna.com. DISCONNECTED PHONE? ChoiceTel Home Phone Service. No One Refused! Low Monthly Rate! Calling Features and Unlimited Long Distance Available. Call ChoiceTel Today! 1-888-3331405. www.choicetel.ca. For Restless or Cramping Legs. A Fast acting Remedy since 1981, sleep at night, proven for 31 years. www.allcalm.com, Mon-Fri 8-4 EST 1-800-765-8660. HOT TUB (SPA) COVERS Best Price, Best Quality. All Shapes & Colours Available. Call 1-866-652-6837 www.thecoverguy.com/newspaper

FOR DETAILS

PROVINCE-WIDE CLASSIFIEDS. Reach over 550,000 readers weekly. Call this newspaper NOW or 306-649.1405 for details. SELLING: Rhinestone and rhinestud T-shirts and tank tops. I am also in the process of making sweatshirts for the winter to come. I have a variety of decals to choose from. Pick your own decal and top or choose what has been made already. Please call 306634-5646.

Look in the classifieds for the Best Deals on Wheels! DOMESTIC CARS

DOMESTIC CARS

,/.'#2%%+-/4/23 !QPK3=HAO 3ANRE?A3EJ?A ZZZORQJFUHHNPRWRUVFDUSDJHVFD

&$56 &KHY,PSDOD/6GUIDFWRU\ZDUUDQW\NP  %XLFN$OOXUH&;/GUOHDWKHUIDFWRU\ZDUUDQW\  &KHY&REDOW/7GUVXQURRIIDFWRU\ZDUUDQW\  3RQWLDF*6(GUIDFWRU\ZDUUDQW\ORDGHG  3RQWLD3XUVXLWGUZDUUDQW\  +RQGD$FFRUG(;GUZDUUDQW\ORDGHG  &KHY0RQWH&DUOR66GU'DOH(DUQKDUGW-U6HULHVZDUUDQW\  &KU\VOHU37&UXLVHUGUZDUUDQW\  +RQGD&LYLF/;GUZDUUDQW\ 

758&.69$16 689·V 0LWVXELVKL5956(GU:'NPIDFWRU\ZDUUDQW\  &KHY6LYHUDGR/7&UHZ&DE[=IDFWRU\ZDUUDQW\  'RGJH'DNRWDFUHZFDE6;7[NPIDFWRU\ZDUUDQW\  &KHY6LOYHUDGR/7&UHZ&DE[=IDFWRU\ZDUUDQW\  'RGJH-RXUQH\6;7$:'SDVVORDGHGZDUUDQW\  )RUG(VFDSH;/7:'GUNPIDFWRU\ZDUUDQW\  &KHY7UDLOEOD]HU[NPVIDFWRU\ZDUUDQW\  +\XQGDL7XVFRQGU/7'$:'ZDUUDQW\VXQURRI  )RUG5DQJHU5HJ&DE);5:'IDFWUR\ZDUUDQW\NPV  *0&6LHUUD6/(([WFDE=[/9IDFWRU\ZDUUDQW\  )RUG);/7([W&DE[ORDGHGZDUUDQW\  'RGJH5DP4XDG&DE/+HPL[ZDUUDQW\  %XLFN5HQGH]YRXV$:'&;/GUSDVVZDUUDQW\  &KHY9HQWXUH9DQ(;7SDVVNPZDUUDQW\  'RGJH'DNRWD6/7(&DE[WRSSHUZDUUDQW\  )RUG([SHGLWLRQ;/7[=ZDUUDQW\  &KHY9HQWXUH9DQ(;7GUZDUUDQW\  -HHS&KHURNHH6SRUWGU[ZDUUDQW\  )RUG5DQJHU6WHSVLGH6/7ZDUUDQW\ 

Most of Our Vehicles are Covered by Lubrico Powertrain Warranty

3ULFHV5HGXFHGa:H7DNH7UDGHV 5HDVRQDEOH2IIHUV&RQVLGHUHG

3+21(&2//(&7)25.(1

DOMESTIC CARS

DOMESTIC CARS

8VHG&DUV

&+5<6/(5NPV &+(9<&259(77(NPV 3217,$&*5$1'35,;*76XSHUFKDUJHGEURQ]H NPV 0,768%,6+,/$1&(5%ODFNNPV $8',$/%ODFNNPV

8VHG7UXFNV689V 9DQV &$',//$&(6&$/$'(:KLWHNPV

&+(9<7$+2(NPV -((33$75,276LOYHUNPV 5$063257%ODFNORDGHGNPV &+(9<6,/9(5$'2NPV 5$0&5(:/21*%2;7DQNPV -((3*5$1'&+(52.((57NPV5HG5RFN -((3&200$1'(563257/HDWKHUNPV )25'(6&$3(;/75HGNPV -((33$75,275HGNPV -((33$75,2763257NPV )25'(6&$3(;/7NPV &+(96,/9(5$'2&5(:&$%/6:KLWHNPV &+(96,/9(5$'2&5(::KLWHNPV62/' )25'('*(/7'NPV &+(9$9$/$1&+(/67DQNPV )25'(6&$3(;/75HGNPV *5$1'&+(52.((',(6(/ '2'*('$.27$NPV )25')/$5,$7%OXHNPV 72<27$781'5$NPV5HG -((3/,%(57</7'5HGNPV62/' '2'*('$.27$&5(:&$%*UH\NPV '2'*(5$048$'&$%'LHVHOEOXHNPV 72<27$781'5$NPV 

+20(2)7+(32:(57($0

.HQVLQJWRQ$YHQXHa(VWHYDQ6DVN 3KRQH ,I\RXKDYHQ¡WVKRSSHG32:(5'2'*(\RXPD\KDYHSDLGWRRPXFK

801 13th Ave., ESTEVAN Ph: 634-3661 or 1-888-634-3661

SOUTHEAST SASK USED CAR SUPERSTORE CARS

2011 FORD FUSION SEL AWD leather, pr. roof, V6, only 17,000 kms .......... $24,900 2009 CADILLAC CTS AWD, local trade, black, 82,500km................................ $29,700 2009 PONTIAC VIBE auto, p.w., p.l., air, only 53,700 kms............................ $14,990 2008 CHEV COBALT 4 door, sport red, 56,840 kms ...................................... $11,900 2008 CADILLAC CTS AWD, 3.6L, 66,700 kms .............................................. $29,700 2007 CHEV MAILBU LT Local trade, 77,000 kms ......................................... $10,981 2005 CHEV MALIBU LS local trade, 134,200km ............................................ $8,700 2004 CHEV CORVETTE CONVERTIBLE auto, leather, chrome wheels, 8,600 kms ..................................................................................................... $29,983

TRUCKS, SUVS, VANS

2011 DODGE DAKOTA CREW 4X4 19,200 kms.......................................62/' $25,700 2011 CHEV TRAVERSE AWD, LT, quad, buckets, 43,400 kms, Was $29,900... $28,700 2010 CHEV 1500 CREW LT2 pw roof, leather, 20â&#x20AC;? wheels & more, 77,600 kms ................................................................................................... $31,700 2010 CHEV EQUINOX LTZ 4cyl, leather, pw roof, 8 way pr. seat, 73,700 kms ................................................................................................... $26,900 2010 GMC 1 TON CREW CAB DURAMAX 163,000 kms ......................... $28,700 2010 CHEV CREW 4x4 very nice, black with 20â&#x20AC;&#x2122;s, local trade, 45,000 kms ....62/' $28,814 2010 CHEV 1500 CREW 4X4 6.2L, max pkg, 137,000 kms, local trade ...... $21,980 2010 GMC TERRAIN AWD, rearview camera, 15,000 kms .............................62/' $24,900 2009 BUICK ENCLAVE AWD CXL2 leather, 7pass, excellent,174,300 kms ... $19,981 2009 FORD ESCAPE XLT tr.tow, remote start, 62,000 kms ........................... $21,900 2009 CHEV AVALANCHE LTZ roof, D.V.D., local trade, 225,000 kms, clean ... $19,900 2009 CADILLAC SRX 4.6 V8 SPORT power roof, 58,7000 kms ................. $32,700 2008 DODGE NITRO SXT white, only 62,000 kms ...................................... $19,900 2008 HUMMER H3 fully loaded, cloth buckets, very clean, 69,000 kms........... $24,987 2008 CHEV TAHOE cloth buckets, 7 pass., power roof, 54,900 kms ................................................................................................... $32,900 2008 SATURN VUE AWD A/C, cruise, tilt, pw, pl, 78,000 kms ..................... $17,700 2008 FORD F-150 4X4 CREW leather, sunroof, bucket, 65,288 km, local trade, Was $28,900 ............................................................. $27,900 2007 CHEV TRAILBLAZER LTZ leather, local trade, very clean, 89,000 kms .. $16,900 2007 JEEP LIBERTY 4X4 leather, local trade,123,000 kms ........................... $13,900 2005 ACURA MDX leather, power roof, only 102,000 kms ............................ $17,900 2005 HUMMER H2 black, leather, 92,000 kms ............................................ $27,900 2002 CHEV TAHOE LT Leather, local trade, 115,000 kms .............................. $14,900 2001 CHEV SILVERADO E/C 4X4 5.3 L 177,000 kms ..............................62/' $8,900

THE GM OPTIMUM ADVANTAGE â&#x20AC;˘ Manufacturerâ&#x20AC;&#x2122;s Warranty â&#x20AC;˘ Exchange Privilege â&#x20AC;˘ 150+ Point Inspection â&#x20AC;˘ 24hr Roadside Assistance

CLASSIFIED DEADLINE WEDNESDAY AT 3:00 P.M. NOTICE

Payment for Classified Advertising Must be Made in Advance Prepaid Rates: $7.95 per week for up to 20 words Please add 20¢ for each additional word Remember To Add 5% GST! Cash â&#x20AC;&#x201C; Cheque â&#x20AC;&#x201C; Visa â&#x20AC;&#x201C; MasterCard Note: No refunds are issued for Classified Advertising. If you Cancel your Ad before expiry, Credit will be given which may be applied to future advertising. *** â&#x20AC;˘ CHECK YOUR ADS â&#x20AC;˘ We will only accept responsibility for errors the first time an ad appears â&#x20AC;˘ PLEASE NOTE â&#x20AC;˘ Rewording or Changing an Advertisement After it has been Printed in the Paper Requires Payment for a NEW AD â&#x20AC;&#x201C; No Credits Are Issued for Ads That Are Changed â&#x20AC;&#x201C; â&#x20AC;˘ Cancellation of Advertisements â&#x20AC;˘ Must be received by 3:00 p.m. Wednesday for the Trader and 4:00 p.m. Friday for the Mercury ****************

SOUTHEAST TRADER

EXPRESS Business Office located at 68 Souris Avenue North in Estevan (Across from the Water Tower) Please Phone 634-2654 for further information Office Hours: 8:00 a.m. - 5:00 p.m. Monday through Friday ****************

Use the Handy Form Below to Submit Your Advertisement to: The Southeast Trader Express Box 730, Estevan, SK S4A 2A6 or submit your ad through our website at www.estevanmercury.ca Please Select Your Category from the Classified Index A REMINDER â&#x20AC;Ś EACH ABBREVIATION Counts as One Word (You donâ&#x20AC;&#x2122;t save money by abbreviating, You just make your advertisement more difficult to read)

PLEASE PRINT: Name ________________________________________ Address _____________________________________ Telephone No. ________________________________ Number of Weeks ______________________________ Amount Enclosed ______________________________ VISA/MC No. _________________________________ Card Expiry Date: ______________________________

YOUR AD _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________



_____________________________________________

$)7(5+2856&HOO

The Worldâ&#x20AC;&#x2122;s Largest Shopping Centre is the CLASSIFIED SECTION of Your Newspaper

WK6WUHHW²(VWHYDQ6DVN ZZZORQJFUHHNPRWRUVFDUSDJHVFD HPDLOVDOHVORQJFUHHNPRWRUV#VDVNWHOQHW

Classified Advertising Delivers


DOMESTIC CARS



DOMESTIC CARS

UTILITY TRAILERS

UTILITY TRAILERS

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012 Page 19 ADULT PERSONAL WANTED MESSAGES LOCAL HOOKUPS BROWSE4FREE 1-888-628-6790 or #7878 Mobile **************** HOT LOCAL CHAT 1-877-290-0553 Mobile: #5015 **************** Find Your Favourite CALL NOW 1-866-732-0070 1-888-544-0199 18+

6HQFKXN¯V6XSHU'HDOV 8VHG&DUV

0867$1**76+(/%<NPV+3 )25'0867$1*9VSHHGORDGHGRQO\NPV62/' )86,216(/ORDGHGNPV /,1&2/10.6ORDGHGZSRZHUURRIQDYLJDWLRQ NP )2&866(/ORDGHGZLWKOHDWKHURQO\NPV %0:=,&219(57,%/(PLOHV

8VHG7UXFNV689V 9DQV

5$3725683(5&5(:[RQO\NPV (6&$3(;/7;ORDGHGZLWKNPV );/7&5(:&$%NPV (6&$3(/,0,7(';ORDGHGOHDWKHUQDYLJDWLRQ NPV (6&$3(;/7[/9ORDGHGZLWKNPV )&5(:&$%',(6(/;NPV *0&6,(55$6/(&5(:&$%;NPV (6&$3(/,0,7(';ORDGHGNPV ('*(/,0,7('DOOZKHHOGULYHORDGHGNPV 62/' (;3(',7,21/,0,7('0$;[IXOO\ORDGHG ZLWKNPV (;3(',7,21('',(%$8(5[OHDWKHU SRZHUPRRQURRINPV (;3/25(56325775$&;/7;ORDGHG NPV )+$5/(<'$9,'621&5(:&$%;ORDGHGZLWK1DYLJDWLRQ DQGSRZHUURRIRQ\NPV );/7&5(:&$%ONPVORDGHG

6HQFKXN )RUG6DOHV/WG

@V\YOVTLVMHM[LYZHSLZZLY]PJL 6RXULV$YHQXH1RUWK²(VWHYDQ6DVN

634-3696

WK6WUHHW(VWHYDQ  KLJKHQHUJ\#VDVNWHOQHW ZZZKLJKHQHUJ\WUDLOHUVFD

DOMESTIC CARS

&KHY\8SODQGHU 3DVVHQJHU9DQ  

75$,/(56

+DXOPDUN[6OHG$79  IW$OXPLQXPµ:KHHOV  +DXOPDUNEODFNRUDQJH;9QRVH/RZ+DXOHU +DXOPDUN.RGLDN[ +DXOPDUN[YQRVH 1HZPDQIW$OXPLQXPWLOWµ:KHHOV  1HZPDQIW$OXPLQXPµ:KHHOV  +DXOPDUN[9 62/' 5DLQERZ'XPS;  5DLQERZ['XPS  5DLQERZ·'RYHWDLO& (.*9:  5DLQERZ·&DU+DXOHU*9:  5DLQERZ·&DU*9: 

758&.6

&KHY\SDVVHQJHUYDQ 3DVVHQJHU9DQNPV

:(+$9(5(17$/6 )/$7'(&.6(1&/26('75$,/(56&$56 758&.6 3$66(1*(59$16 5HQWDOVIRU%XVLQHVV/HLVXUH:HGGLQJV RU6FKRRO6SRUWV7HDPV

:($5(-867$&$//$:$<

Sell Your Unwanted Items with an Ad in

The CLASSIFIEDS! Phone 634-2654 Today!

Carpentry

Health & Mobility Aids

WANTED: Johnson 70 HP Outboard motor for parts - 1985 Mod CJ 70TLCOS. Allan Duffus, 4823660 - leave message, Cell: 4838849.

AUCTIONS FOR AUCTION Aquadeo SK: FULL FEATURED 2 year old 2674 s.f. lake view home. August 10 7:00 p.m. Call 306-445-5000 or view www.kramerauction.com . KRAMER AUCTION REAL ESTATE DIV MLS 434251

ADULT PERSONAL MESSAGES CANCEL YOUR TIMESHARE. NO RISK program. STOP Mortgage & Maintenance Payments Today. 100% Money Back Guarantee. Free Consultation. Call us Now. We can Help! 1-888-356-5248

TRUCKS & VANS FOR SALE: 2002 Ford Explorer Sport 2 Door. Like new condition, or iginal owner. 17â&#x20AC;&#x2122; aluminum wheels, leather seats, multi CD player, power windows and locks, air conditioning, glass sunroof, automatic transmission with overdrive, 57,000 km, 4 litre V6. No accidents. Stored year round in ga r a g e . S m o ke - f re e . A s k i n g $12,700. Phone 306-543-9436, Regina. FOR SALE: 2003 Dodge Magnum Ram 2500, Hemi, 5.7 Litre V8, 4X4, Crew Cab. Green. New tires. Very clean, 210,000 km - $14,500. Phone 306-861-4592.

RVS/CAMPERS/TRAILERS FOR SALE: 2009 - 35 ft. Toy Hauler. Loaded, excellent condition. $39,500 - O.B.O. Phone 4619595.

Springwood Homes

7UDLOEOD]HU6FRRWHU Â&#x2021;LQ%ODFN7LUHV Â&#x2021;)XOO6XVSHQVLRQ Â&#x2021;'HOX[H/LJKW3DFNDJH Â&#x2021;+3#03+ Â&#x2021;3RZHU6HDWRU/JH%DWWHULHV

 HVWHYDQEXLOGHU#JPDLOFRP )UDPLQJ0RXOGLQJ:LQGRZ 'RRU,QVWDOOV 6WDLUV)ORRULQJ'HFNV)RXQGDWLRQV6LGLQJ

/RRNLQJIRUD UHOLDEOHFUDIWVPDQ" 7( /$0,1$

Guaranteed approval drive away today! We lend money to everyone. Fast approvals, best interest rates. Over 500 vehicles sale priced for immediate deliver y OAC. 1-877-796-0514. www.yourapprovedonline.com.

/,)7&+$,56 :$/.(56 (/(&75,&%('6 $1'08&+025(

Daniel Methot Carpentry )URP6PDOO 5HQRYDWLRQVWR &XVWRP7XUQ.H\ +RPHV

FOR SALE: 2000 Buick Regal LS, 3.8L V6, Leather, Power roof, Rear spoiler, Custom wheels, Only 114,000 km. Extra clean, nonsmoker - Only $5,950. Phone 4217020 or 634-7857; Drive by 222 Spruce Drive and have a look.

+$5 ': 22'

7,/ 5. (:2 6721

(:

25

.

&DOO$GDP7RGD\

23(17+856 6XLWHWK$YH(VWHYDQ VWGRRU6RXWKRI&,%& &$// IRUPHUO\6XQ/LIH%OGJ

72//)5((

ADS DPRQWK

21/<

&DOOWRDGYHUWLVH


Page 20

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

CAREER OPPORTUNITIES AG SALES Representative required. Experience necessary to cover a Case & New Holland protected territory. Excellent salary and benefits. Territory is diversified with grain and cattle operations. Apply in confidence to: Hi Line Farm Equipment, 4723 - 39 Ave., Wetaskiwin, AB, T9A 2J4 or admin@hilinecnh.com.

CAREER TRAINING M E D I CA L T R A N S C R I P T I O N RATED #2 FOR AT-HOME JOBS. Start training today. Graduates are in demand! Enroll now. Take advantage of low monthly payments. 1- 8 0 0 - 4 6 6 - 1 5 3 5 w w w . c a n scr ibe.com admissions@canscribe.com

CLASSIFIED ADS WORK!

TRADES HELP BAKER HUGHES A leader in oilfield services, we currently have outstanding opportunities available for: 1. Equipment Operators for Coiled Tubing and Cementing #1212681. 2. Coiled Tubing Service Supervisor - Red Deer #1214944. 3. Coiled Tubing Service Supervisor - Clairmont #124936. 4. Cementing Service Supervisors #1215317. To apply, search for jobs at bakerhughes.com/careers

MORE WAYS TO STAY UP TO DATE!

Visit us on the web!! www.estevanmercury.ca t

GENERAL EMPLOYMENT HELP WANTED!!! Make up to $1000 a week mailing brochures from home! Helping Home-workers since 2001! Genuine Opportunity! No experience required. Start Immediately! www.themailinghub.com

Remember Your Loved Ones with a Memorial Tribute in The Mercury

CHARGED CLASSIFIED ADVERTISING RATES Businesses/Private Parties placing ClassiĂ&#x20AC;ed Advertising (Want Ads) in either The Estevan Mercury or the Southeast Trader Express and requesting these ads to be BILLED TO AN ACCOUNT WILL BE CHARGED THE FOLLOWING RATE: $9.95 for the First 20 Words + 20¢ for Each Additional Word ALL PRICES SUBJECT TO 5% GST Please remember â&#x20AC;Ś Each Abbreviation Counts as One Word (You donâ&#x20AC;&#x2122;t save money by abbreviating, you just make your ad more difĂ&#x20AC;cult to read) Web Sites (i.e. www.world.ca) count as three words

Contractors

Rentals 20(72:1 5(129$7,216/7'

6$/(6 6(59,&( ,167$//$7,21

Contact us for ALL of your renovation needs

6HUYLQJ6DVNDWFKHZDQ

)UHH(VWLPDWHV /LFHQVHG %RQGHG

Â&#x2021;2IILFH7UDLOHUVÂ&#x2021;6NLG6WHHUVÂ&#x2021; 5RFN7UXFNVÂ&#x2021;'5&UDZOHUV Â&#x2021;0LQL([FDYDWRUV

Insulation & Drywall 635$<32/<85(7+$1( )2$0,168/$7,21

POLARFOAM SOYA Â&#x2021;=HUR2]RQH'HSOHWLRQ  6XEVWDQFH Â&#x2021;(FRORJLFDO,QVXODWLRQ Â&#x2021;+LJK59DOXHSHULQFK Â&#x2021;$GGVVWUHQJWKDQGVXSSRUW

Â&#x2021;'RHVQRWVXSSRUWJURZWKRI  PRXOGV Â&#x2021;$GKHUHVWRZRRGPHWDO  FRQFUHWH

)$&725<',5(&7:,1'2:6 WINDOWS â&#x20AC;˘ Never Paint PVC Windows & Door Frames 6$6.$7&+(:$10$'( â&#x20AC;˘ Sealed Units â&#x20AC;˘ Bay & Bow Windows â&#x20AC;˘ Cladding :,1'2:6 '2256 0$,17(1$1&()5(( SIDING, SOFFIT & FASCIA 6287+(51 */$66 â&#x20AC;˘ Vinyl Siding & Insulation :25.6/7' â&#x20AC;˘ Aluminum SofďŹ t & Fascia Â&#x2021;)LQDQFLQJ$YDLODEOH DOORS â&#x20AC;˘ Steel Entrance Doors â&#x20AC;˘ Aluminum Storm Doors â&#x20AC;˘ Patio Doors â&#x20AC;˘ Garden Doors

 5(12  

0HPEHURI &KDPEHURI &RPPHUFH

5322/(&216758&7,21 5DQG\3RROH 6SHFLDOL]LQJ,Q  Â&#x2021;9LQ\O6LGLQJ  Â&#x2021;6RIILWDQG)DVFLD  Â&#x2021;:LQGRZVDQG'RRUV  Â&#x2021;0HWDO:LQGRZ&ODGGLQJ  DQGPXFKPRUH

:LQGRZ 6SHFLDOLVWV

12:&RQWLQXRXV(DYHVWURXJKLQJ %HDWWKH5XVK DQG%RRN\RXU)5(( (67,0$7(6QRZ

:HDOVRLQVWDOOD&/$66)LUH5DWHGSURGXFW XVHDEOHLQ2LOĂ&#x20AC;HOGDSSOLFDWLRQV

+RPH   &HOO  

&8)&$&HUWLĂ&#x20AC;HG,QVWDOOHUV

<HDUVRIH[SHULHQFHEURXJKWWR\RXUKRPH

67$5'5<:$// ,168/$7256/7' (VWHYDQ6. 3KRQH )D[  

Hot Shot

Ladies Fashions

Warren Seeman



<%:HW 5RRILQJ/WG â&#x20AC;˘ INSURED â&#x20AC;˘ 10% SENIOR DISCOUNT â&#x20AC;˘ FREE ESTIMATES

Specializing in flat roof repairs & full installations

<%:HW5RRILQJ/WG & Home Improvement Contractor â&#x20AC;&#x153;The name that keeps you dryâ&#x20AC;? Quality craftmanship at prices that wonâ&#x20AC;&#x2122;t soak you!

Shawn Wells Cell: (306) 461-8849 â&#x20AC;˘ Fax: (306) 388-2594 Box 35, Bienfait, SK. S0C 0M0

Home & Auto Detailing

<285-($163(&,$/,67

(GCVWTKPI +285'$<6$:((. +276+276(59,&( IRURLOĂ&#x2020;HOGFRPPHUFLDO  DJULFXOWXUDO VHUYLQJ6DVNDWFKHZDQ 0DQLWRED $OEHUWD

â&#x20AC;˘ Windows & Doors â&#x20AC;˘ Fascia â&#x20AC;˘ Soffit â&#x20AC;˘ Decks & Fences â&#x20AC;˘ Seamless Eaves â&#x20AC;˘ Siding â&#x20AC;˘ Metal Cladding

â&#x20AC;˘ New Construction & Renovation â&#x20AC;˘ Commercial & Residential â&#x20AC;˘ All types of roofing â&#x20AC;˘ Metal Buildings & Garage Packages

PYRAMID HOME & AUTO

WHEN ITâ&#x20AC;&#x2122;S GRIMY, Iâ&#x20AC;&#x2122;LL MAKE IT SHINY BONDED & INSURED HOME & AUTO DETAILING

WK6WUHHW(VWHYDQ

Phone/FAX: 306-340-0274 Cell/Text: 306-421-4669 www.pyramidcleaningcrew.ca

1521-3rd Street Estevan, SK S4A 0S5

&DOO7R%RRN<RXU$G7RGD\


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

Whiskey bottles Q: Since the 1970s I have been a collector, and especially interested in Jim Beam bottles. I need to sell my collection and appreciate any help you can give me. -- Peter, Albuquerque, N.M. A: Jim Beam bottles are difficult to sell, and they donâ&#x20AC;&#x2122;t seem to be as popular with collectors as they were three or four decades ago. One of the better clubs is the Evergreen Jim Beam Club, 509 NE 165th, No. 154, Seattle, WA 98155; www.jimbeamclub.com. For bottle questions, contact Tom at beamclub@aol.com. *** Q: I have three ingots honoring the 1973 TripleCrown winner, Secretariat. They were struck in limited editions, and each has a certificate of authenticity. I would like to know their real value. -- Efren, Kissimmee, Fla. A: I examined the Xerox copies you sent me and

noted that the ingots were issued by Silver Creations, Ltd., of Emerson, N.J. That is where you should begin. This might be difficult, since I was not able to track down an address or even verification that the company still exists. Your next option is to show them to an established coin dealer in your area. I predict you are going to be disappointed in what you discover. *** Q: I have hundreds of sports cards and thousands of comic books that originally belonged to my late husband. I want to know what they are all worth. -- Rhonda, Albuquerque, N.M. A: For comics, I recommend the Comic Book Checklist & Price Guide, which features more than 125,000 comics with current values. This book was compiled by Maggie Thomson, Brent Frankenhoff and Peter Bickford, all comic book experts. It is $19.95 and available through the publisher, www.Krause.com. For sports cards, there are

also excellent references, including The Standard Catalogue of Football Cards (KP Books, 24.99), and The Standard Catalogue of Baseball Cards edited by Don Fluckinger (Krause, $39.99). *** Q: I have a black dial-up telephone. What is it worth, and is anyone interested in buying it? -- Trudy, Sun City, Ariz. A: The black dial-up phones are fairly common and seem to be selling in the $10 to $25 range in metro-Phoenix near where you live. Write to Larry Cox in care of King Features Weekly Service, P.O. Box 536475, Orlando, FL 328536475, or send e-mail to questionsforcox@aol.com. Due to the large volume of mail he receives, Mr. Cox is unable to personally answer all reader questions. Do not send any materials requiring return mail. (c) 2012 King Features Synd., Inc.

Viruses not the only cause of hepatitis DEAR DR. DONOHUE: For the past year, my wife has had to deal with autoimmune hepatitis. Itâ&#x20AC;&#x2122;s something that hardly anyone knows about or understands, and that makes it even more difficult to cope with. Everyone thinks she has an infection. I can only haltingly explain what she has. Will you tell your readers about this illness? -- D.R. ANSWER: Say â&#x20AC;&#x153;hepatitis,â&#x20AC;? and people automatically think of a viral infection. Say â&#x20AC;&#x153;cirrhosis,â&#x20AC;? which is sometimes the last stage of hepatitis, and people think of alcohol as the cause. Not all hepatitis is virus-caused, and not all cirrhosis is alcoholcaused. Your wifeâ&#x20AC;&#x2122;s illness is an example. Her liver is inflamed (hepatitis), not from an infection but from an attack on her liver by her immune system. The reason why a personâ&#x20AC;&#x2122;s immune system, a system designed to keep us healthy, turns on the

liver is obscure. Signs that the immune system is the cause are demonstrable by finding antibodies in the blood. Antibodies are the ammunition the immune system makes to fend off dangerous invaders. One special antibody, the antinuclear antibody, is a big indication that the liver has come under an immune attack. The course of autoimmune hepatitis is unpredictable. It might be mild with few symptoms, or it may take a more aggressive course in which the skin and eye whites turn yellow, where fatigue is immobilizing, where abdominal pain is common and where the skin develops an itch. Quite often, a liver biopsy is the procedure that provides evidence of autoimmune hepatitis. Prednisone, one of the cortisone drugs, often is the treatment of choice. It reins in an out-of-control immune system. Another immune-modifying drug, azathioprine, can be added

to the regimen. It sounds like your wife is responding well to treatment (from parts of your letter that I had to delete). The booklet on hepatitis details the various forms of the illness, and how they are acquired and treated. Readers can obtain a copy by writing: Dr. Donohue -- No. 503W, Box 536475, Orlando, FL 32853-6475. Enclose a check or money order (no cash) for $4.75 U.S./$6 Canada with the recipientâ&#x20AC;&#x2122;s printed name and address. Please allow four weeks for delivery. *** Dr. Donohue regrets that he is unable to answer individual letters, but he will incorporate them in his column whenever possible. Readers may write him or request an order form of available health newsletters at P.O. Box 536475, Orlando, FL 32853-6475. (c) 2012 North America Synd., Inc. All Rights Reserved

Page 21

5),-<RX4773 7KH)LUVWUXOHRIDGYHUWLVLQJLV FDWFKLQJWKHLUH\H7KH6HFRQGLV VXVWDLQHGUHSHDWHGDGYHUWLVLQJ $GYHUWLVLQJ'RHVQ W&RVWLW3D\V

3XEOLFDWLRQ'DWH)ULGD\$XJXVW 'HDGOLQHWRERRNDGYHUWLVLQJVSDFH 7KXUVGD\$XJXVW

2YHUGLVWULEXWLRQ 'LVWULEXWLRQWDUJHWLQJWKHRLOLQGXVWU\LQ 6DVNDWFKHZDQ0DQLWREDDQG$OEHUWD

6HSWHPEHU,VVXH(GLWRULDO)RFXVLV

"STIMULATION/THERMAL" 'HDGOLQHWRDGYHUWLVH$XJXVW

Creative Marketing Ideas That Get Results

Speak with one of our advertising specialists today to find out how to make the most important impact on your customers

Cindy Beaulieu

Deanna Tarnes

Candace Wheeler

Teresa Hrywkiw

Kristen Oâ&#x20AC;&#x2122;Handley

3KRQH (PDLODGVDOHV#HVWHYDQPHUFXU\FD


Page 22

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

CAREER OPPORTUNITIES Recycle This Paper

FOOD SERVICE WORKERS We are accepting resumes for part & full time positions. Duties include: Food preparation, stock and inventory, serving customers, some baking, making sandwiches, operate cash register and be able to give proper change as well as general cleaning and equipment maintenance

Starting wage - $11.01/hr. If you are interested in joining our team apply in person with resume or call: Margaret - Subway 517 - 4th Street, Estevan â&#x20AC;¢ 634-6616

®

5(48,5('5(6,'(17,$/ 3523(57<,163(&725

7R PHHW RXU JURZLQJ EXVLQHVV ZH DUH VHHNLQJ D 5HVLGHQWLDO 3URSHUW\ ,QVSHFWRU WR VXSSRUW RXU RSHUDWLRQV LQ 6RXWK (DVW 6DVNDWFKHZDQ 7KH SRVLWLRQ LQYROYHV FRQGXFWLQJ D YLVXDO UHYLHZ RQ UHVLGHQWLDO SURSHUWLHV RI UHDGLO\DFFHVVLEOHDUHDVIRUSRVVLEOHVWUXFWXUDOLVVXHVXQVDIHVLWXDWLRQV DQGKD]DUGPDWHULDOVDQGWKHQGHYHORSLQJDUHSRUWEDVHGRQWKHLQVSHFWLRQ GDWDREVHUYHG7KHVXFFHVVIXOFDQGLGDWHPXVWKDYHDUHOLDEOHYHKLFOHDQG EHZLOOLQJWRWUDYHOWKURXJKRXW6(6DVNDWFKHZDQ,GHDOO\FDQGLGDWHVKRXOG KDYH D EDFNJURXQG DQG NQRZOHGJH RI WKH YDULRXV IDFHW RI UHVLGHQWLDO FRQVWUXFWLRQ EH DEOH WR FRPPXQLFDWH HIIHFWLYHO\ KDYH FRPSXWHU VNLOOV DQG EH VHOI ²PRWLYDWHG ZLWK D SRVLWLYH DWWLWXGH &DQGLGDWH PXVW EH HQWUHSUHQHXULDODQGDEOHWRGHDOHWKLFDOO\DQGHIIHFWLYHO\ZLWKSHRSOH7KLV LVDIXOOWLPHSRVLWLRQZLWKHDUQLQJVEDVHGRQDIHHVFKHGXOH7UDLQLQJZLOO EHSURYLGHGGXULQJZKLFKDWUDLQLQJDOORZDQFHZLOOEHJLYHQWRVXFFHVVIXO FDQGLGDWH 6HULRXVFDQGLGDWHVRQO\² VHQGUHVXPHWR,QVSHFWRU$SSOLFDQWV#VDVNWHOQHW

:25/':,'(/($'(5

7$/(17('7($0

6WDUWZRUNLQJZLWKDQLQGXVWU\OHDGHULQDSRVLWLRQZLWKURRPWR JURZH[FHOOHQWWUDLQLQJSURJUDPDQGFRPSUHKHQVLYHEHQHILWVDQG ERQXVHV6WDUWWKLQNLQJ1DWLRQDO2LOZHOO9DUFR2XU3RUWDEOH 3RZHUWHDPLVFXUUHQWO\UHFUXLWLQJIRU

$UHD0DQDJHU â&#x20AC;¢ \HDUVRIPDQDJHPHQWH[SHULHQFHLQRLODQGJDVRU SRUWDEOHSRZHURSHUDWLRQV â&#x20AC;¢ ([FHOOHQWFRPPXQLFDWLRQVNLOOV â&#x20AC;¢ $ELOLW\WRPHQWRUDQGWUDLQHPSOR\HHV â&#x20AC;¢ $ELOLW\WRPDQDJHEXGJHWV

6DOHV5HSUHVHQWDWLYH â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

([SHULHQFHZLWKSRUWDEOHSRZHUJHQHUDWLRQRUUHQWDOV ([FHOOHQWFRPPXQLFDWLRQDQGFRPSXWHUVNLOOV :LOOLQJWRWUDYHO 5RRPIRUJURZWK

129RIIHUVDFRPSHWLWLYHEHQHILWVSDFNDJHLQFOXGLQJ LQGXVWU\FRPSHWLWLYHVDODU\FRPSDQ\SDLGEHQHILWVYHKLFOH DOORZDQFHDQGHPSOR\HHGLVFRXQWV 7RDSSO\SOHDVHFDOOID[RU HPDLO&DQDGDUHFUXLWLQJ#QRYFRP :HWKDQNDOODSSOLFDQWVRQO\WKRVHXQGHUFRQVLGHUDWLRQZLOOEH FRQWDFWHG

3257$%/( 32:(5

Book Your Career ad today! Call 634-2654


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

CAREERS



'R$OO0HWDO)DEULFDWLQJ/WG (VWHYDQ6. (PDLO5HVXPHWR NVZLGQLFNL#GRDOOPHWDOFRP RUID[



EMPLOYMENT OPPORTUNITY PERMANENT FULL-TIME HYDROVAC OPERATORS â&#x20AC;¢ Require class 3 or class 1 licence â&#x20AC;¢ Safety tickets HYDROVAC SWAMPERS â&#x20AC;¢ Require safety tickets Offering competitive wages, benefits available after 3 months. Offering living accomodations.

Email resumes to: extremeexcavating@hotmail.com or fax to: 306â&#x20AC;¢483â&#x20AC;¢2082

Journeymen Electricians and Apprentices PowerTech Industries Ltd. in Estevan is seeking Journeymen Electricians and Apprentices for work in the Estevan and Carnduff areas. Experience: Safety Certificates are needed. 1st Aid/CPR, H2S. Applicants must have a valid driverâ&#x20AC;&#x2122;s license. Full benefits packages and RSP plan. Duties: Day to day electrical construction and maintenance in the oilfield. Wage/Salary Info: Depending on experience & qualifications. To Apply: Fax: (306) 637-2181, e-mail sschoff.pti@sasktel.net or drop off resume to 62 Devonian Street, Estevan, SK.

7UDQVSRUW2SHUDWRU 0XVWKDYH9DOLG&ODVV$/LFHQVH &OHDQ'ULYHUV$EVWUDFW 9DOLG3DVVSRUW 0$1'$725<

0LQLPXP\HDUH[SHULHQFH :LQFKH[SHULHQFHFRQVLGHUHGDQDVVHW 'XWLHV5HVSRQVLELOLWLHV2SHUDWH:LQFKWUXFN KDXOLQJWR1'$%DQGZLWKLQ6.6RPH\DUG GXWLHVDVUHTXLUHGZKHQQRWGULYLQJ (PSOR\PHQW)XOO7LPH 7\SH3HUPDQHQW 6DODU\1HJRWLDEOHXSRQH[SHULHQFH :HRIIHUFRPSHWLWLYHZDJHVDERYHDYHUDJH EHQHÃ&#x20AC;WVDQGJURXS5563SURJUDP

<($55281')8//7,0( (03/2<0(17 3URJUHVVLYH -RKQ 'HHUH GHDOHUVKLS LQ 6RXWKHUQ 6DVNDWFKHZDQ KDV LPPHGLDWH RSHQLQJV IRU VHUYLFH WHFKQLFLDQV VKRS IRUHPDQDQGDORFDWLRQVHUYLFHPDQDJHU 1HOVRQ 0RWRUV  (TXLSPHQW KDV Ã&#x20AC;YH EUDQFKHV ORFDWHG LQ $YRQOHD (VWHYDQ 5DGYLOOH 5HGYHUV DQG2[ERZ :HRIIHUIXOOWLPH\HDUURXQGSRVLWLRQVFRPSHWLWLYH ZDJHV SHQVLRQ EHQHÃ&#x20AC;W SODQV DQG FDUHHU SDWK WUDLQLQJ FRXSOHG ZLWK WKH RSSRUWXQLW\ WR OLYH LQ FRPPXQLWLHVZLWKDQH[FHOOHQWTXDOLW\RIOLIH 3OHDVHVHQGUHVXPHWR 1HOVRQ0RWRUV (TXLSPHQW %R[$YRQOHD6.6+& )D[ (PDLOVHUYLFH#QHOVRQPRWRUVFRP RUYLVLWRXUZHEVLWHKWWSZZZQHOVRQPRWRUVFRP

Page 23

Now Hiring

DRIVER FOR TAKE-OUT ORDERS Resumes can be dropped off at: The Black Grasshopper Pub Attention: Chris

96 King St. Estevan, SK

0DLQWHQDQFH3HUVRQ 7KH9LOODJHRI)URELVKHULVDFFHSWLQJ ZULWWHQDSSOLFDWLRQVIRUWKHSRVLWLRQRI 0DLQWHQDQFH3HUVRQIRUWKH9LOODJH 'XWLHVZRXOGLQFOXGHORRNLQJDIWHUWKH ZDWHUSODQWVHZDJHOLIWVWDWLRQODJRRQ PRZLQJDQGRWKHUPDLQWHQDQFHGXWLHV ,QWHUHVWHGDSSOLFDQWVPD\DSSO\EHIRUH $XJXVWWRWKH 9LOODJHRI)URELVKHU%R[ )URELVKHU6.6&< VWDWLQJZDJHVH[SHFWHG

;<<'!$()/()+$/(!),$>:> %$15=:?6?=>4@<B: -15=:?6?=>4@<A< 

   /       0

         -RXUQH\PDQ(OHFWULFLDQV *)( $"**)'$%)"#))%0

-2+1'((5(

+LJKZD\:HVW(VWHYDQ6.   $YRQOHD(VWHYDQ5DGYLOOH5HGYHUV2[ERZ

 $*()'"3+.%##'"")'"%$()'*)%$$#$)$$  $)%'$3(*&'+($&&'$)($&'%#%)$  ().&'%'#  $)')$,) $()'*#$))%$$%##*$)%$(  $)$$3)%  $"$)()$'(

    /HYHO $SSUHQWLFHV *)( $"**)'$%)"#))%0  ((()$ %*'$.#$,)""%$()'*)%$$#$)$$)(!(  '$)%  ().&'%'#  '$$$+"%&$(!""($(('.)%%#&")&&'$)(&  ((()$#$)%'$ *$%'&&'$)")'$( "('(&%$)%#&"%.#$)7$*()'"")'2 ''$,""+$)%)%(,)*''$)<$'()3)'$$2 %*,""$ %.,%'!$%'#".(%#&$.&'%+$&'#*#$)($

7ULDOWD2LOÃ&#x20AC;HOG,QGXVWULHV/WGORFDWHGLQ(VWHYDQ 6DVNDWFKHZDQLVDQHVWDEOLVKHGRLOÃ&#x20AC;HOGPDQX IDFWXULQJFRPSDQ\VXSSO\LQJURGSXPSSDUWVDQG DFFHVVRULHVWRWKHRLOLQGXVWU\:HDUHORRNLQJWR H[SDQGRXUFXUUHQWRSHUDWLRQVDQGDUHFXUUHQWO\ DFFHSWLQJUHVXPHVIURPTXDOLÃ&#x20AC;HGDSSOLFDQWVIRU WKHIROORZLQJSRVLWLRQVLQRXUIDFLOLW\ 7UXFN'HOLYHU\'ULYHU7KHLGHDOFDQGLGDWHZLOO KDYHH[SHULHQFHLQKLJKZD\GULYLQJDQGGHOLYHU LQJIUHLJKW'XWLHVZLOOLQFOXGHPRYLQJIUHLJKW EHWZHHQ(GPRQWRQ$%DQG(VWHYDQ6.PDN LQJURXWLQHGHOLYHULHVWRFXVWRPHUORFDWLRQVDQG XQORDGLQJVRUWLQJIUHLJKWLQRXU(VWHYDQZDUH KRXVH7KLVSHUVRQZLOOZRUNZLWKWKHPDQDJHULQ DVKRSVHWWLQJWRHQVXUHRXUFXVWRPHUUHTXLUH PHQWVDUHPHW5HTXLUHPHQWVLQFOXGH&ODVV OLFHQVHZLWK$LU%UDNHVHQGRUVHPHQWDQGFOHDQ GULYLQJUHFRUG7KLVSHUVRQPXVWEHZLOOLQJWR ZRUNZHHNHQGVDQGQLJKWV7UDLQLQJIRU6DIHW\ 7LFNHWVZLOOEHSURYLGHG 7ULDOWDRIIHUVDZLGHDUUD\RIEHQHÃ&#x20AC;WVLQFOXGLQJ KHDOWKGHQWDODQGOLIHLQVXUDQFHDORQJZLWKYHU\ FRPSHWLWLYHVDODULHV6HL]HWKLVH[FHOOHQWRSSRU WXQLW\WRJURZ\RXUFDUHHUZLWKLQDWKULYLQJVPDOO Ã&#x20AC;UPLQWKHKHDUWRI&DQDGD

5HSO\E\ID[RQO\WR $WWQ0DQDJHU

&'%)('&'%'#(/,)$-""$)().'%'$"*$'))%$2

+DVDQRSHQLQJLQWKHLU

3URGXFWLRQ'HSDUWPHQW 7KH(VWHYDQ0HUFXU\UHTXLUHVDIXOOWLPH DGEXLOGHULQWKHLUSURGXFWLRQGHSDUWPHQW IRURQHPDWHUQLW\OHDYHSRVLWLRQ $SSOLFDQWVPXVWEHDEOHWRPXOWLWDVNLQD IDVWSDFHGGHDGOLQHGULYHQHQYLURQPHQW +HVKHPXVWEHDWHDPSOD\HUZLWKDQH\H IRUGHWDLO.QRZOHGJHRI0DF&RPSXWHUVDQG $GREH&UHDWLYH6XLWHLVDQDVVHWEXWZHDUH ZLOOLQJWRWUDLQWKHULJKWDSSOLFDQW 7KHSRVLWLRQLV0RQGD\WR)ULGD\ DPSP2XUFRPSDQ\RIIHUVD KHDOWKEHQHÃ&#x20AC;WSDFNDJH 3OHDVHPDLORUHPDLOUHVXPHWR

0HODQLH7ULELJHU3URGXFWLRQ0DQDJHU SUHSUHVV#HVWHYDQPHUFXU\FD 7KH(VWHYDQ0HUFXU\ %R[ (VWHYDQ6.6$$

:;;& #'(.'(*#.' (+#=9= $#04<9>5><=3?;A9 ,04<9>5><=3?;@; 

   .

       /

     ,QVWUXPHQWDWLRQ7HFKV )(' #!))(&#$(!"(($/  '#2$#'(&)($#2"#(##$*&$)'!(&$#.!). "#!.%#)"(#+&!''*'#'-'("'  #($&#2')%&*'#%%&#('#%&$"$(#  '(-%&$&"  #(&(#+(!(&#'#$"")#($#'  #(##2($  #!#('(#&'

        ,QVWUXPHQWDWLRQ$SSUHQWLFHV )(' #!))(&#$(!"(($/  '''(###'+(!!$#'(&)($##"#(##(' '  &#($  '(-%&$&"  &###*!$%#' !!'#''&-($$"%!(%%&#('% !'&'%$#($"%!$-"#(6#)'(&!!(&1 &&#+!!*#($($'+()&&#(;#&'(2(&##1 $)+!!#$-+$& #$&"!-'$"%#-%&$*#%&")"#('# %&$('&%&$&"'.+(#,!!#('(-&$&#!)# &(($#1


Page 24

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

CAREERS

/LQH/RFDWRU$VVLVWDQW Wanted for outdoor work in the oilfield, combination of walking, standing and bending. Attention to detail, hand-eye coordination and willingness to learn are definite assets. H2S and First Aid/CPR required, employer willing to train. No experience necessary. Apply in person to:

LVVHHNLQJD

+($9<'87< 0(&+$1,&

Quest Line Locators Ltd. 104C Perkins Street or email questlocators@sasktel.net

$GYDQFH'ULOOLQJDOHDGLQJGULOOLQJFRPSDQ\LVORRNLQJIRUD +HDY\'XW\0HFKDQLFORFDWHGLQ(VWHYDQ6DVNDWFKHZDQ 7KHVXFFHVVIXOFDQGLGDWHZLOOEHDOLFHQVHGPHFKDQLFZLWK H[SHULHQFHSURYLGLQJSUHYHQWDWLYHPDLQWHQDQFHDQGUHSDLUV WRGLHVHOPRWRUVWUDLOHUVDQGSHUIRUPLQJLQVSHFWLRQVDQG VDIHWLHV ,QGHSWKNQRZOHGJHRIK\GUDXOLFV\VWHPVGLHVHOHQJLQHV $ELOLW\WRGLDJQRVHDQGWURXEOHVKRRW $EOHWRSHUIRUPFRPSOHWHUHSDLUDQGRYHUKDXOIXQFWLRQV :LOOLQJQHVVWRZRUNRYHUWLPHZKHQUHTXLUHG 0DLQWDLQDFOHDQGULYLQJUHFRUG &OHDQ'ULYHU·VDEVWUDFWDQGYDOLG'ULYHU·V/LFHQVH $EOHWROLIWOEV &DQGLGDWHVPXVWEHDEOHWRZRUNLQGHSHQGHQWO\PDLQWDLQ DVDIHDQGFOHDQZRUNDUHD$GYDQFH'ULOOLQJRIIHUVDQ H[FHOOHQWEHQHÃ&#x20AC;WDQGZDJHSDFNDJHWKRXJKWKHVXFFHVVIXO DSSOLFDQWVKRXOGEHSUHSDUHGWRVXSSO\WRROVIRUWKHSRVLWLRQ

,QWHUHVWHGFDQGLGDWHVGURSUHVXPHRIIDW 'HYRQLDQ6WUHHW 32%R[ (VWHYDQ6DVNDWFKHZDQ 6$+ (PDLONDXEHUW#PHFRP 3KRQH   )D[   3OHDVHQRWH7KDQN\RXLQDGYDQFHIRUDOOWKDWKDYH VXEPLWWHGUHVXPHVEXWRQO\WKRVHZKRKDYHEHHQ FKRVHQIRUDQLQWHUYLHZZLOOEHFRQWDFWHGGLUHFWO\

+($/7+$1'6$)(7< &225',1$725 $GYDQFH'ULOOLQJDOHDGLQJGULOOLQJFRPSDQ\LVORRNLQJIRU D+($/7+$1'6$)(7<&225',1$725WREHSDUWRIRXU LQGXVWU\OHDGLQJRUJDQL]DWLRQ 7KHH[SHULHQFHGLQGLYLGXDOZLOOEHUHVSRQVLEOHIRU LPSOHPHQWLQJFRPSDQ\KHDOWKVDIHW\DQGHQYLURQPHQWDO  SROLFLHVDQGSURFHGXUHV LGHQWLI\KHDOWKDQGVDIHW\KD]DUGVHYDOXDWHULVNV  FRPSOHWHVLWHLQVSHFWLRQVLQFLGHQWLQYHVWLJDWLRQV PDLQWDLQFRPSOLDQFHZLWKVDIHW\GDWDEDVHVLQFOXGLQJ  ,61HWZRUOGDQG&RPSO\ZRUNV HQIRUFHFRPSOLDQFHZLWKJRYHUQPHQWUHJXODWLRQVSROLFLHV  DQGVWDQGDUGV 7KH+6(FRRUGLQDWRUZLOOKDYHWKHSURYHQDELOLW\WRSURYLGHVWURQJ OHDGHUVKLSFRPPLWPHQWZKLOHZRUNLQJZLWKLQDGLYHUVHJURXSRI SHRSOHWRPDLQWDLQDVWURQJVDIHW\DWWLWXGH7KH\ZLOOKDYHDÃ&#x20AC;UP XQGHUVWDQGLQJLQLQFLGHQWLQYHVWLJDWLRQSURFHGXUHVDQGUHODWHG OHJLVODWLRQVDQGUHJXODWLRQVDWWKHIHGHUDOSURYLQFLDODQGORFDO ORFDOOHYHOV7KH\ZLOOKDYHH[FHOOHQWFRPPXQLFDWLRQVNLOOVDQG FRPSXWHUVNLOOVZLWKSURÃ&#x20AC;FLHQF\LQ06:RUGDQG([FHO7KH\ZLOO DOVRKDYHDVWURQJNQRZOHGJHDQGXQGHUVWDQGLQJRIWKHRLODQG JDVLQGXVWU\7KHVXFFHVVIXODSSOLFDQWZLOOEHFRQVWDQWO\VHHNLQJ ZD\VWRLPSURYHLPSURYHDOODVSHFWVRIWKH+6(SURJUDPVRIWKH FRPSDQ\DQGPRWLYDWLQJDSRVLWLYHFKDQJHWRDFKLHYHSURIRXQG VDIHW\JRDOV

Class 1A Drivers Pay will be according to experience, Medical & Dental benefits available. Fax resume with references and Drivers Abstract to: (306) 634-4167 or email: chamneycrushing@hotmail.com

  CONSTRUCTION LTD. EXCAVATING, SAND AND GRAVEL â&#x20AC;¢ REDI-MIX CONCRETE SEWER & WATER INSTALLATIONS â&#x20AC;¢ CUSTOM CRUSHING & WASHING AVAILABLE

*OHQ3HWHUVRQ&RQVWUXFWLRQ6. OHDGHU LQ DJJUHJDWH WUXFNLQJ FRQFUHWH FRQVWUXFWLRQ DQGVHZHUDQGZDWHULQVWDOODWLRQVLVJURZLQJ ,PPHGLDWHRSHQLQJVIRU 6DIHW\&RRUGLQDWRU 0XVWKDYH&25VDIHW\SURJUDPDQGDOOVDIHW\TXDOLÃ&#x20AC;FDWLRQV IRU6HZHUDQG:DWHU&RQFUHWHFRQVWUXFWLRQDQGDJJUHJDWH RSHUDWLRQV)XOOWLPHSRVLWLRQ7RSZDJHVIRUULJKWSHUVRQ

)8//7,0()5217&2817(5 0$,17(1$1&(3(5621 DQG

3$577,0(:$6+$77(1'$176 'URSUHVXPHRIIDW

WK6W (VWHYDQ

7HFKQLFDO(QJLQHHU \HDUVH[SHULHQFH0XVWEHDEOHWRUXQOLHFDVXUYH\HTXLSPHQW )XOOWLPH:DJHVGHSHQGRQH[SHULHQFH 6HZHU :DWHU/DERXUHUV2SHQLQJV KRXUGHSHQGLQJRQH[SHULHQFH (TXLSPHQW2SHUDWRU ([SHULHQFHLQRSHUDWLQJORDGHUVKRHVGR]HUVDQGFUXVKHUD GHÃ&#x20AC;QLWHSOXV0XVWEHGHSHQGDEOH)XOOWLPHSRVLWLRQ:DJH GHSHQGLQJRQH[SHULHQFH 'LHVHO0HFKDQLF 0XVWKDYHWRROV([SHULHQFHLQGLHVHOK\GUDXOLFVHOHFWULFDO V\VWHPV:HOGLQJDELOLW\SUHIHUUHG7RSZDJHIRUULJKWSHUVRQ

,QWHUHVWHGDSSOLFDQWVFDQFDOO 7\OHUDWRU ID[UHVXPHWR &RQFUHWH)RUHPDQ2SHQLQJV \HDUVH[SHULHQFHLQDOOSKDVHVRIFRQFUHWHZRUN:DJH GHSHQGLQJRQH[SHULHQFH

LVVHHNLQJD

Local SE Gravel operation is looking for experienced

Kitchen Helpers/ Short Order Cooks Tower Cafe is looking for 2 cooks for permanent full-time employment Prepare & cook pizzas, salads, sandwiches as ordered. Set up & stock line to maintain proper levels of ingredients required. Train new staff. Use proper weights & measurements to make/prepare consistent product. Clean equipment & clean line & work area as required. Must be available to work until midnight. $13.00 per hour permanent full time available. Apply in person with resume to

1124 4th Street Estevan

&RQFUHWH/DERXUHUV2SHQLQJV 0XVW KDYH UHOLDEOH WUDQVSRUWDWLRQ :DJH   KRXU GHSHQGLQJRQH[SHULHQFH 'ULYHUSRVLWLRQV ([SHULHQFH ZLWK WDQGHPV EHOO\ GXPSV ORDGHUV $7UDLQ DQG%7UDLQOLFHQFHUHTXLUHG/RRNLQJIRUDORQJWHUP RSSRUWXQLW\"

12074AT00

,I\RXZRXOGOLNHWRDSSO\IRU DQ\RIWKHVHSRVLWLRQVSKRQH 6DPDWRUID[UHVXPHWR *OHQ3HWHUVRQ&RQVWUXFWLRQ/WGLVDQHTXDORSSRUWXQLW\ HPSOR\HUGHGLFDWHGWRDVDIHGUXJIUHHZRUNSODFH:H RIIHUH[FHOOHQWZDJHVDQGEHQHÃ&#x20AC;WVSOXVRYHUWLPH LQFHQWLYHVDQGERQXVHV 

3URXGWRVHUYH (VWHYDQDQG$UHDIRURYHU

\HDUV

Glen Peterson Construction Ltd. 314 - 6th Street, Estevan, SK S4A-2V7 Ph: 306â&#x20AC;¢634â&#x20AC;¢2741 Fax: 306â&#x20AC;¢634â&#x20AC;¢4643 or E-mail construction@glenpeterson.ca

,I\RXDUHGHGLFDWHGWRSURYLGLQJDVDIHDQGKHDOWK\ZRUNLQJ HQYLURQPHQWSOHDVHVHQG\RXUUHVXPHDQGFXUUHQW+6 &RQÃ&#x20AC;QHG6SDFH)LUVW$LGDQG:+0,6FHUWLÃ&#x20AC;FDWHVWR 'HYRQLDQ6WUHHW 32%R[ (VWHYDQ6DVNDWFKHZDQ 6$+ (PDLONDXEHUW#PHFRP 3KRQH  

)D[  

See career ads online! www.estevanmercury.ca


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

6DIHW\ &RQVWUXFWLRQVLWHFRXOGEHGDQJHURXV ,I\RXKDYHFKLOGUHQSOHDVHDVNWKHP WRNHHSDVDIHGLVWDQFHIURPWKHVLWH :H ZLOO WDNH HYHU\ SUHFDXWLRQ WR HQVXUHSXEOLFVDIHW\EXWZHQHHG\RXU DVVLVWDQFH WR FRQVWUDLQ WKH QDWXUDO FXULRVLW\ RI \RXQJHU FKLOGUHQ 3OHDVH '2127DWWHPSWWRJRFORVHWRDUHDV DIIHFWHG 7KHIWRU9DQGDOLVP ,I \RX VHH DQ\ DFW RI YDQGDOLVP WKHIW RUDQ\RQHVXVSLFLRXVO\WDPSHULQJZLWK HTXLSPHQW VLJQDJH RU EDUULFDGHV SOHDVHFRQWDFWFDOO3ROLFH 4XHVWLRQVDQG&RQFHUQV 7KH &LW\ RI (VWHYDQ (QJLQHHULQJ 6HUYLFHV DSRORJL]H IRU DQ\ LQFRQYHQLHQFHV WKDW WKLV ZRUN PD\ FDXVHDQGWKDQN\RXLQDGYDQFHIRU\RXUFRRSHUDWLRQDQGSDWLHQFH,I\RXKDYHDQ\TXHVWLRQRU FRQFHUQVSOHDVHFDOODWRUDSSURDFKWKHVXSHUYLVRURUIRUHPDQRQVLWH ´'XULQJDVSKDOWDQGSDYLQJRIURDGVFRXOGDOOFLWL]HQVSOHDVHEHUHVSHFWIXORIFRQVWUXFWLRQVLWHVDQG REVHUYHEDUULFDGHVDQGVLJQDJHIRUWKHLURZQVDIHW\)LQHVZLOOEHLVVXHGWRDOOSHRSOHQRWREH\LQJ

$UH\RXORRNLQJIRUVRPHWKLQJWRGR"7LUHG RI79DVDQDFWLYLW\":DQWWRPDNHD GLIIHUHQFHDQGEHSDUWRIVRPHWKLQJELJJHU

4PE]4EVOW -XO\²$XJXVWZLOOEH0XVLF0DGQHVVDWWKH3OD\3DUNV 5XVW\'XFH0RQGD\²7DOHQW6KRZ7XHVGD\²(DUWK'D\:HGQHVGD\²&RORXULQJ&RQWHVW7KXUVGD\² 1LJKW6ZLP SP )ULGD\²&UD]\+DW'D\ +LOOFUHVW0RQGD\²6LGHZDON&KDON'UDZLQJ&RQWHVW7XHVGD\²0RUQLQJ6ZLP:HGQHVGD\²$XJXVW %LUWKGD\V&HOHEUDWLRQ7KXUVGD\²'DQFH)UHH]H)ULGD\²%DFNZDUGV'D\ +LOOVLGH0RQGD\²&UD]\+DLU'D\7XHVGD\²0DUEOH6ZLP:HGQHVGD\²)UHH]LH6DOH7KXUVGD\² 0RUQLQJ6ZLP)ULGD\²7DOHQW6KRZ &KXUFKLOO0RQGD\²0XVLF0RQGD\7XHVGD\²1LJKW6ZLP SP :HGQHVGD\²&RORXULQJ&RQWHVW 7KXUVGD\²*OLWWHU6ZLP)ULGD\)UHH]LH6DOH 7URMDQ3DUN7XHVGD\²:HDU<RXU)DYRXULWH&RQFHUW76KLUW'D\:HGQHVGD\²$XJXVW%LUWKGD\V &HOHEUDWLRQ7KXUVGD\²6LGHZDON&KDON'UDZLQJ&RQWHVW)ULGD\²'DQFH)UHH]H 3OD\3DUNV0RYLH1LJKW 7KXUVGD\$XJXVWWK#SP +LOOVLGH3OD\3DUN 'U6HXVVÒ&#x2039;7KH/RUD[

8SFRPLQJ6DWXUGD\6ZLPV SP  -XO\²5XVW\'XFH $XJXVW²1R6DWXUGD\6ZLP

)RUDOOWKHODWHVW3OD\3DUNXSGDWHVVHQG\RXUHPDLODGGUHVVWR SOD\SDUNV#HVWHYDQFDDQGFKHFNRXWWKHIXOOVFKHGXOHVRQZZZHVWHYDQFD

6SRUWV&DPSV &$//,1*$//$7+/(7(6,I\RXDUHEHWZHHQWKHDJHVRIDQGIHHOLQJDOLWWOHERUHGWKLV VXPPHU«6SRUWV&DPSVDUHIRU\RX &KHFNRXWWKHVHXSFRPLQJVSRUWVFDPSV 'URSLQ6SRUWV²$XJXVW 'LYLQJ²-XO\ %0;²$XJXVW /LIH6DYHUV²$XJXVW /DFURVVH²$XJXVW 7KHUHLVVWLOOOLPLWHGURRPDYDLODEOH5HJLVWHUTXLFNO\3LFNXSDIXOOVFKHGXOHDQGUHJLVWHUDWWKH/HLVXUH &HQWUH,QIRUPDWLRQ'HVNWRGD\ ,I\RXKDYHDQ\TXHVWLRQVFRQWDFW/LLVD.OHHPRODDW

0(',&$/67$)),1(67(9$1 0(',&$/&(175( .LQJ6WUHHW(VWHYDQ6$7 3KRQH   )$;   Â&#x2021;'U$OOLVRQ&KULVWLH Â&#x2021;'U+DNDQ3HKOLYDQ Â&#x2021;'U(GZDUG7VRL Â&#x2021;1XUVH3UDFWLWLRQHU²/RLV&RIIH\ (67(9$10(',&$/*5283

²1LFKROVRQ5RDG (VWHYDQ6$6 3KRQH   )$;   Â&#x2021;'U-LPL$NLQVHWH Â&#x2021;'U$QGUp*UREOHU Â&#x2021;'U0HKGL+RUUL

0(',&$/&/,1,&6$767-26(3+Ò&#x2039;6+263,7$/35,0$5<+($/7+&$5(&(175( 1LFKROVRQ5RDG(VWHYDQ6$9 Â&#x2021;'U<XVXI.DVLP²6XLWH 3KRQH  )$;   Â&#x2021;'U&KDUOHV22PRVLJKR²6XLWH 6KDORP0HGLFDO&OLQLF 3KRQH   )$;  

Â&#x2021;'U.KDOLG06KHLNK²6XLWH 3KRQH   )$;  

(VWHYDQ)LUH5HVFXH6HUYLFHVLVDFFHSWLQJDSSOLFDWLRQVIRU 3$,'21&$//),5(),*+7(56 WKHVHDUHQRWIXOOWLPH SRVLWLRQV

&DQ\RXDQVZHU\HVWRWKHIROORZLQJTXHVWLRQV" ¾$UH\RXORRNLQJWRKHOS\RXUFRPPXQLW\VWD\ VDIH" ¾'R\RXOLNHWRKHOSSHRSOHWKDWDUHLQQHHG" ¾$UH\RXDWHDPSOD\HU" ¾'R\RXZDQWWREHSDUWRIDQREOHSURIHVVLRQ" :HZRXOGORYHWRKHDUIURP\RX$SSOLFDWLRQIRUPVDUH DYDLODEOHDWWKH)LUH+DOOUG6WUHHW(VWHYDQ

Ever wonder what happens at a major event? Do you want to make extra money? No plans for the weekend? We are searching for Events staff to assist with the set-up/tear down, seating and parking for events held at Spectra Place.

We offer: â&#x20AC;¢ Opportunity to meet great people â&#x20AC;¢ Flex scheduling â&#x20AC;¢ Chance to be part of the show experience

Do you: â&#x20AC;¢ Have an attention to detail â&#x20AC;¢ Thrive in a fast paced environment â&#x20AC;¢ Work well under pressure â&#x20AC;¢ Enjoy tight deadlines

Be part of a great team, apply to: Kelvin Pillipow, Human Resources Manager 1102 4th Street, Estevan, SK S4A 0W7 E-mail: hr@estevan.ca Phone (306)461-5905

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&RQVWUXFWLRQ%XOOHWLQ

7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQFUHWHZRUNDQGURDGZRUNVDW 'XQFDQ5RDG²3HUU\&UHVFHQWWR0F'RQDOG5RDG7KHSXUSRVHRIWKLVZRUNLVWRSURYLGHWLPHO\ DQGFRVWHIIHFWLYHUHSODFHPHQWRIH[LVWLQJFDVWLURQZDWHUPDLQZLWK39&SLSHUHSODFHPHQWRI H[LVWLQJZDWHUDQGVDQLWDU\VHZHUVHUYLFHVIURPZDWHU VHZHUPDLQXSWRWKHSURSHUW\OLQHDQG VXUIDFHUHVWRUDWLRQ7KLVZRUNZRXOGUHTXLUHFORVXUHRILPPHGLDWHDUHDVRIH[FDYDWLRQDQGPD\ QHFHVVLWDWHSDUNLQJUHVWULFWLRQLQDGMDFHQWDUHDV7KLVZRUNZLOOFRPPHQFHGXULQJWKHZHHNRI -XQHDQGZLOOWDNHDSSUR[LPDWHO\(LJKW  WR7HQ  :HHNVWRFRPSOHWH VXEMHFW WRZHDWKHU *OHQ3HWHUVRQ&RQVWUXFWLRQ/WGZLOOSHUIRUPWKLVZRUNZLWKLQWKHFXUUHQW%\ODZ UHJXODWLRQV :RRGODZQ5HVHUYRLU 7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQVWUXFWLRQRID7UHDWHG'ULQNLQJ:DWHU5HVHUYRLU 7KHDIIHFWHGDUHDLQFOXGHV7KH:RRGODZQ$YHQXH5LJKWRI:D\1RUWKRIWKH6W-RVHSK·V+RVSLWDO 7KLV5LJKWRI:D\LVQRWDWKRXJKURDGDQGQRWUDIÃ&#x20AC;FZLOOEHDOORZHGLQWKHDUHDWKDWLVQRWLQYROYHG ZLWKWKHUHVHUYRLUFRQVWUXFWLRQ 7KLVZRUNZLOOFRPPHQFH0DUFKDQGZLOOWDNHDSSUR[LPDWHO\WHQ  PRQWKVWRFRPSOHWH /HGFRU &RQVWUXFWLRQ /WG DQG -9 0 &RQVWUXFWRUV ,QF ZLOO SHUIRUP WKLV ZRUN ZLWKLQ WKH FXUUHQW %\ODZUHJXODWLRQVDQGVSHFLÃ&#x20AC;FDWLRQV &RQVWUXFWLRQRQ$OH[DQGUD$YHQXH .LQJ6WUHHWWR+HQU\6WUHHW

7KLVZRUNZRXOGUHTXLUHFORVXUHRILPPHGLDWHDUHDVRIH[FDYDWLRQDQGPD\QHFHVVLWDWHSDUNLQJ UHVWULFWLRQLQDGMDFHQWDUHDV7KLVZRUNZLOOFRPPHQFHGXULQJWKHZHHNRI-XO\DQGZLOO WDNHDSSUR[LPDWHO\WKUHH WR ZHHNVWRFRPSOHWH VXEMHFWWRZHDWKHU 

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

Page 25

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


Page 26

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

(67(9$16. 7LFNHWVFDQEHSXUFKDVHGWKURXJK WLFNHWPDVWHUÂ&#x160;RQOLQHDWKWWSWLFNHWPDVWHUFD RUWLFNHWPDVWHUÂ&#x160;&KDUJHE\3KRQHDW

6XQGD\$XJXVW 12:216$/(

At The Library.....

There will be no Baby Time, Toddler Time or Story Time Programs for July & August. Regular sessions will start in September.

Effective 17 June, we will be closed Sundays during the summer months. Please pre-register for all programs unless otherwise indicated. Call 636-1621.

7(1'(5

7KH&LW\RI(VWHYDQLQYLWHVWHQGHUVWRFRPSOHWHWKHIROORZLQJZRUNV  7HQGHU(66L[WK6WUHHW:DWHUPDLQ5HSODFHPHQW  WK$YHQXHWK$YHQXH

   7HQGHUSDFNDJHVDUHDYDLODEOHDWWKH/HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ²/RZHU/HYHO ²&LW\+DOO)RUIXUWKHULQIRUPDWLRQUHJDUGLQJWKLVWHQGHUSOHDVHFRQWDFW-DQNLW3DWHODW )D[RUHPDLOHQJWHFK#HVWHYDQFD  ,QWHUHVWHG&RQWUDFWRUVDUHLQYLWHGWRVXEPLWVHDOHGHQYHORSHVPDUNHGZLWKWKH UHVSHFWLYH7HQGHU1XPEHUWRWKHIROORZLQJE\30ORFDOWLPH7KXUVGD\$XJXVW  /HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ 0DLQ)ORRU²)RXUWK6WUHHW &LW\RI(VWHYDQ (VWHYDQ6.6$:  3XEOLFRSHQLQJRIWHQGHUVVKDOOWDNHSODFHDW30ORFDOWLPH7KXUVGD\$XJXVW LQWKH&RXQFLO&KDPEHUV&LW\+DOO(VWHYDQ6DVNDWFKHZDQ 7KH&LW\RI(VWHYDQUHVHUYHVWKDWULJKWWRUHMHFWDQ\RUDOOWHQGHUVDQGWKHORZHVWWHQGHU PD\QRWQHFHVVDULO\EHDFFHSWHG

&,7<2)(67(9$1127,&( People are reminded that boulevards cannot be used for parking of any private property such as but not limited to the following:

Ă&#x2DC;  Fishing Shacks Ă&#x2DC;  Vehicles

KWWSWZLWWHUFRP6SHFWUD3ODFH

32/,&(&2167$%/(

Monday & Wednesday, August 8, 13, 15, 20, 272, 29 @ 3:00, 3:30 & 4:00 pm â&#x20AC;&#x201C; Hello Computer! â&#x20AC;&#x201C; Come and get answers to your computer questions in â&#x20AC;&#x2DC;one-on-oneâ&#x20AC;&#x2122; thirty minute sessions. Bring your own laptop or use a public computer. When registering please indicate what you would like to learn. Thursday, August 2 â&#x20AC;&#x201C; Teen Movie Madness: 50 First Dates @ 1:00-2:45 & 17 Again @ 6:00-7:30 â&#x20AC;&#x201C; Both movies recommended for ages 13+. Refreshments provided or bring your own if you prefer. No registration necessary. Tuesday, August 7 @ 1:00-3:00 pm â&#x20AC;&#x201C; Black Ink! Workshop with Sheena Koops â&#x20AC;&#x201C; For grades 7-12. Do you hear voices? When your black ink hits the page, can you be held responsible? Does it jump from your pen onto the page and freak out your friends? Do your teachers think you need help? Come to the Black Ink! Workshop. Itâ&#x20AC;&#x2122;s time you took charge of the voices, harness that black ink; let it live on the page, so it can die â&#x20AC;Ś like you wish that song would die. You know, the one thatâ&#x20AC;&#x2122;s been stuck in your brain for the past month. Black Ink! Let it out. 20 spots available. Thursday, August 9 - Begins @ 11:00 am â&#x20AC;&#x201C; National Book Lovers Day â&#x20AC;&#x201C; Stop in and help us celebrate National Book Lovers Day. Weâ&#x20AC;&#x2122;ll be serving lemonade and cupcakes at 11:00 while supplies last. Fill out a ballot and be entered to win one of several gift certificates and other door prize items. Help us celebrate the joy of reading!! Open to all ages! Enter one per person, please. Thursday, August 9 @ 6:00 pm â&#x20AC;&#x201C; Food Fear Factor â&#x20AC;&#x201C; Are you fearless? Do you have an iron stomach? Test yourself. Come compete in Food Fear Factor at the library â&#x20AC;&#x201C; a race through five rounds of creatively disgusting food to make it to the final â&#x20AC;&#x153;Gross-Outâ&#x20AC;? table, where finalists will compete to be named champion gastronome. Please indicate any allergies. Ages 13 and up. Saturday, August 11 @ 2:00 pm â&#x20AC;&#x201C; Sojourns in Spain â&#x20AC;&#x201C; Curious about Spain? Join Lori Myer, teacher from the Estevan Comprehensive School and experienced traveler for an informative discussion. Although the discussion will center on Spain, she is willing to answer questions about other locales she has visited, namely, Australia, Germany, Italy, Greece, Ireland, and Switzerland. She has been taking groups of students to exotic locales for over 20 years. Refreshments will be served. Wednesday, August 15 @ 2:00-3:00 pm â&#x20AC;&#x201C; Cool Kid Craft: Popsicle Stick Bracelets â&#x20AC;&#x201C; Ages 8-16. Popsicle sticks arenâ&#x20AC;&#x2122;t only for holding a delicious summer treat! Come out & make wearable, funky bracelets for you or your friends! 15 spots available. Thursday, August 16 @ 6:30 pm â&#x20AC;&#x201C; Cover to Cover Book Club â&#x20AC;&#x201C; This month we will be discussing The Forgotten Garden by Kate Morton. This book features an abandoned child, an old book of dark fairy tales, a secret garden, an aristocratic family, a love denied, and a mystery. It is a captivating, atmospheric and compulsively readable story of the past, secrets, family and memory. Call 636-1621 to pick up your copy today! New members always welcome.

Ă&#x2DC;  Boats Ă&#x2DC;  Campers Ă&#x2DC;  Trailers

KWWSVSHFWUDSODFHFD KWWSIDFHERRNFRP6SHFWUD3ODFH

Ă&#x2DC;  Skidoos Ă&#x2DC;  Quads

As well, people are reminded that City property cannot be used for any purpose such as storing construction materials, dirt or materials while working on your own property without permission from the City and that permits are required from Engineering Division for any work being done on City Property .  For further information contact 306-634-1800 and your co-operation is appreciated.

7KH(VWHYDQ3ROLFH6HUYLFHZDVHVWDEOLVKHGLQDQGKDVEHHQEXLOWRQDWUDGLWLRQRIH[FHOOHQFH 7KH&LW\RI(VWHYDQKDVH[SHULHQFHGDJUHDWGHDORIJURZWKLQWKHSDVWWKUHH\HDUVHVSHFLDOO\LQWKH HQHUJ\VHFWRULQFOXGLQJRLOFRDOPLQLQJDQGSRZHUJHQHUDWLRQ7KLVJURZWKDQGHFRQRPLFERRPKDV FUHDWHGVHYHUDOFKDOOHQJHVZLWKLQWKH&LW\RI(VWHYDQLQFOXGLQJWKH3ROLFH6HUYLFH 7KH (VWHYDQ 3ROLFH 6HUYLFH LV LQFUHDVLQJ WKH VL]H RI WKH 3ROLFH 6HUYLFH DQG FXUUHQWO\ KDV WZR YDFDQFLHV IRU WKH SRVLWLRQ RI &RQVWDEOH 7KH (VWHYDQ 3ROLFH 6HUYLFH KDV D ULJRURXV DSSOLFDWLRQ SURFHVVKRZHYHUWKLVSURFHVVLVWRHQVXUHWKDWWKHSHRSOHZHKLUHWRZHDUWKH(VWHYDQ3ROLFH6HUYLFHXQLIRUP DUHWKHULJKWSHRSOHIRUWKHMRE ,I\RXDUHKLUHGDVDQHZUHFUXLW\RXZLOOHQWHUDULJRURXVWUDLQLQJSHULRGRIZHHNV7KHĂ&#x20AC;UVWZHHNVZLOO EHDWWKH6DVNDWFKHZDQ3ROLFH&ROOHJHLQ5HJLQD6DVNDWFKHZDQZKHUH\RXZLOOUHFHLYHLQVWUXFWLRQLQFULPLQDO ODZ RIĂ&#x20AC;FHU VDIHW\ VHOI GHIHQFH Ă&#x20AC;UHDUPV UHSRUW ZULWLQJ DQG FURVV FXOWXUDO WUDLQLQJ $IWHU JUDGXDWLQJ IURP WKH 3ROLFH&ROOHJH\RXZLOOUHFHLYHDIXUWKHUZHHNVRIĂ&#x20AC;HOGWUDLQLQJXQGHUWKHJXLGDQFHRID)LHOG7UDLQLQJ2IĂ&#x20AC;FHU ([SHULHQFHGPHPEHUVDUHHQFRXUDJHGWRDSSO\7KH(VWHYDQ3ROLFH6HUYLFHRIIHUVDQH[FLWLQJFDUHHULQODZ HQIRUFHPHQWZLWKH[FHOOHQWEHQHĂ&#x20AC;WVDQGDFRPSHWLWLYHVDODU\

COMMUNICATIONS OFFICER (Dispatcher) Duties and Responsibilities: The successful candidate will demonstrate excellent interpersonal communication skills. This person will handle incoming telephone calls, general public inquiries and complaints, and will communicate via radio transmissions with members on patrol. Must be able to work independently under stress as well as produce a high degree of accuracy.

7RDSSO\RUUHFHLYHIXUWKHULQIRUPDWLRQSOHDVHVHHFRQWDFWLQIRUPDWLRQEHORZ $SSOLFDWLRQSDFNDJHVFDQEHSLFNHGXSDWWKH(VWHYDQ3ROLFH6HUYLFHRUPDLOHGRXWXSRQUHTXHVW 3OHDVHUHWXUQWKHFRPSOHWHGSDFNDJHZLWKDQXSGDWHGUHVXPHLQDVHDOHGHQYHORSHWR

(VWHYDQ3ROLFH6HUYLFH WK$YH(VWHYDQ6DVNDWFKHZDQ6$&RUFDOO <RXFDQDOVRHPDLOVFKDUWUDQG#HVWHYDQSROLFHFDRU MSLHUVRQ#HVWHYDQSROLFHFD 'HO%ORFN²&KLHIRI3ROLFH(VWHYDQ3ROLFH6HUYLFH Only successful candidates will be contacted.

/,)(*8$5'6 0RUHWKDQDJUHDWSD\FKHTXHDFDUHHUZLWKDGLIIHUHQFH 3HUPDQHQW)XOO7LPH3RVLWLRQV 5HTXLUHPHQWV Â&#x2021;&XUUHQW&HUWLĂ&#x20AC;FDWLRQLQ Â&#x2021;1DWLRQDO/LIHJXDUGLQJ6HUYLFHV  %URQ]H&URVV0HGDOOLRQ

Â&#x2021;$VVLVWDQW:DWHU6DIHW\,QVWUXFWRU:6, Â&#x2021;)LUVW$LG&35 Â&#x2021;(QVXUHWKHVDIHW\RI$TXDWLF&HQWUH*XHVWV

(QMR\ Â&#x2021;*UHDWZRUNHQYLURQPHQW Â&#x2021;&RQWLQXRXVOHDUQLQJRSSRUWXQLWLHV Â&#x2021;2XWVWDQGLQJEHQHĂ&#x20AC;WSDFNDJH Â&#x2021;:RUNLQJZLWKJUHDWSHRSOH

Â&#x2021;,QVWUXFWOHVVRQVIRUFKLOGUHQDQGDGXOWV DOLNH Â&#x2021;$GPLQLVWHU)LUVW$LGLQWKHHYHQWRIDQ HPHUJHQF\ Â&#x2021;.HHSHQYLURQPHQWFOHDQDQGIUHHRI KD]DUGV

$SSO\WR .HOYLQ3LOOLSRZ+XPDQ5HVRXUFHV )RXUWK6WUHHW(VWHYDQ6.6$: 3KRQHÂ&#x2021;)D[ (PDLOKU#HVWHYDQFD

&,7<2)(67(9$17(1'(5

7KH&LW\RI(VWHYDQLQYLWHVWHQGHUVWRFRPSOHWHWKHIROORZLQJ3URMHFW 7HQGHU(6²:HOORFN5RDG 3DUFHO)'HYHORSPHQW²(DUWKZRUNV 8QGHUJURXQG &RQFUHWH 5RDG:RUNV 7HQGHUSDFNDJHVDUHDYDLODEOHDWWKH/HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ²0DLQ)ORRU² &LW\+DOO )RUIXUWKHULQIRUPDWLRQUHJDUGLQJWKLVWHQGHURUWRDUUDQJHDPHHWLQJEHIRUHFORVLQJGDWH RIWHQGHUSOHDVHFRQWDFW*UHJ:RFN$6F7)D[HPDLOHQJPDQ# HVWHYDQFD ,QWHUHVWHG&RQWUDFWRUVDUHLQYLWHGWRVXEPLWVHDOHGHQYHORSHVPDUNHGZLWKWKH UHVSHFWLYH7HQGHU1XPEHUWRWKHIROORZLQJE\306.7LPH7XHVGD\$XJXVW  /HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ 0DLQ)ORRU²)RXUWK6WUHHW &LW\RI(VWHYDQ(VWHYDQ6.6$: 3XEOLFRSHQLQJRIWHQGHUVVKDOOWDNHSODFHDW306.7LPH7XHVGD\$XJXVWLQ WKH&RXQFLO&KDPEHUV&LW\+DOO(VWHYDQ6DVNDWFKHZDQ 7KH&LW\RI(VWHYDQUHVHUYHVWKDWULJKWWRUHMHFWDQ\RUDOOWHQGHUVDQGWKHORZHVWWHQGHU PD\QRWQHFHVVDULO\EHDFFHSWHG

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

6DIHW\ &RQVWUXFWLRQVLWHFRXOGEHGDQJHURXV ,I\RXKDYHFKLOGUHQSOHDVHDVNWKHP WRNHHSDVDIHGLVWDQFHIURPWKHVLWH :H ZLOO WDNH HYHU\ SUHFDXWLRQ WR HQVXUHSXEOLFVDIHW\EXWZHQHHG\RXU DVVLVWDQFH WR FRQVWUDLQ WKH QDWXUDO FXULRVLW\ RI \RXQJHU FKLOGUHQ 3OHDVH '2127DWWHPSWWRJRFORVHWRDUHDV DIIHFWHG 7KHIWRU9DQGDOLVP ,I \RX VHH DQ\ DFW RI YDQGDOLVP WKHIW RUDQ\RQHVXVSLFLRXVO\WDPSHULQJZLWK HTXLSPHQW VLJQDJH RU EDUULFDGHV SOHDVHFRQWDFWFDOO3ROLFH 4XHVWLRQVDQG&RQFHUQV 7KH &LW\ RI (VWHYDQ (QJLQHHULQJ 6HUYLFHV DSRORJL]H IRU DQ\ LQFRQYHQLHQFHV WKDW WKLV ZRUN PD\ FDXVHDQGWKDQN\RXLQDGYDQFHIRU\RXUFRRSHUDWLRQDQGSDWLHQFH,I\RXKDYHDQ\TXHVWLRQRU FRQFHUQVSOHDVHFDOODWRUDSSURDFKWKHVXSHUYLVRURUIRUHPDQRQVLWH ´'XULQJDVSKDOWDQGSDYLQJRIURDGVFRXOGDOOFLWL]HQVSOHDVHEHUHVSHFWIXORIFRQVWUXFWLRQVLWHVDQG REVHUYHEDUULFDGHVDQGVLJQDJHIRUWKHLURZQVDIHW\)LQHVZLOOEHLVVXHGWRDOOSHRSOHQRWREH\LQJ

$UH\RXORRNLQJIRUVRPHWKLQJWRGR"7LUHG RI79DVDQDFWLYLW\":DQWWRPDNHD GLIIHUHQFHDQGEHSDUWRIVRPHWKLQJELJJHU

4PE]4EVOW -XO\²$XJXVWZLOOEH0XVLF0DGQHVVDWWKH3OD\3DUNV 5XVW\'XFH0RQGD\²7DOHQW6KRZ7XHVGD\²(DUWK'D\:HGQHVGD\²&RORXULQJ&RQWHVW7KXUVGD\² 1LJKW6ZLP SP )ULGD\²&UD]\+DW'D\ +LOOFUHVW0RQGD\²6LGHZDON&KDON'UDZLQJ&RQWHVW7XHVGD\²0RUQLQJ6ZLP:HGQHVGD\²$XJXVW %LUWKGD\V&HOHEUDWLRQ7KXUVGD\²'DQFH)UHH]H)ULGD\²%DFNZDUGV'D\ +LOOVLGH0RQGD\²&UD]\+DLU'D\7XHVGD\²0DUEOH6ZLP:HGQHVGD\²)UHH]LH6DOH7KXUVGD\² 0RUQLQJ6ZLP)ULGD\²7DOHQW6KRZ &KXUFKLOO0RQGD\²0XVLF0RQGD\7XHVGD\²1LJKW6ZLP SP :HGQHVGD\²&RORXULQJ&RQWHVW 7KXUVGD\²*OLWWHU6ZLP)ULGD\)UHH]LH6DOH 7URMDQ3DUN7XHVGD\²:HDU<RXU)DYRXULWH&RQFHUW76KLUW'D\:HGQHVGD\²$XJXVW%LUWKGD\V &HOHEUDWLRQ7KXUVGD\²6LGHZDON&KDON'UDZLQJ&RQWHVW)ULGD\²'DQFH)UHH]H 3OD\3DUNV0RYLH1LJKW 7KXUVGD\$XJXVWWK#SP +LOOVLGH3OD\3DUN 'U6HXVVÒ&#x2039;7KH/RUD[

8SFRPLQJ6DWXUGD\6ZLPV SP  -XO\²5XVW\'XFH $XJXVW²1R6DWXUGD\6ZLP

)RUDOOWKHODWHVW3OD\3DUNXSGDWHVVHQG\RXUHPDLODGGUHVVWR SOD\SDUNV#HVWHYDQFDDQGFKHFNRXWWKHIXOOVFKHGXOHVRQZZZHVWHYDQFD

6SRUWV&DPSV &$//,1*$//$7+/(7(6,I\RXDUHEHWZHHQWKHDJHVRIDQGIHHOLQJDOLWWOHERUHGWKLV VXPPHU«6SRUWV&DPSVDUHIRU\RX &KHFNRXWWKHVHXSFRPLQJVSRUWVFDPSV 'URSLQ6SRUWV²$XJXVW 'LYLQJ²-XO\ %0;²$XJXVW /LIH6DYHUV²$XJXVW /DFURVVH²$XJXVW 7KHUHLVVWLOOOLPLWHGURRPDYDLODEOH5HJLVWHUTXLFNO\3LFNXSDIXOOVFKHGXOHDQGUHJLVWHUDWWKH/HLVXUH &HQWUH,QIRUPDWLRQ'HVNWRGD\ ,I\RXKDYHDQ\TXHVWLRQVFRQWDFW/LLVD.OHHPRODDW

0(',&$/67$)),1(67(9$1 0(',&$/&(175( .LQJ6WUHHW(VWHYDQ6$7 3KRQH   )$;   Â&#x2021;'U$OOLVRQ&KULVWLH Â&#x2021;'U+DNDQ3HKOLYDQ Â&#x2021;'U(GZDUG7VRL Â&#x2021;1XUVH3UDFWLWLRQHU²/RLV&RIIH\ (67(9$10(',&$/*5283

²1LFKROVRQ5RDG (VWHYDQ6$6 3KRQH   )$;   Â&#x2021;'U-LPL$NLQVHWH Â&#x2021;'U$QGUp*UREOHU Â&#x2021;'U0HKGL+RUUL

0(',&$/&/,1,&6$767-26(3+Ò&#x2039;6+263,7$/35,0$5<+($/7+&$5(&(175( 1LFKROVRQ5RDG(VWHYDQ6$9 Â&#x2021;'U<XVXI.DVLP²6XLWH 3KRQH  )$;   Â&#x2021;'U&KDUOHV22PRVLJKR²6XLWH 6KDORP0HGLFDO&OLQLF 3KRQH   )$;  

Â&#x2021;'U.KDOLG06KHLNK²6XLWH 3KRQH   )$;  

(VWHYDQ)LUH5HVFXH6HUYLFHVLVDFFHSWLQJDSSOLFDWLRQVIRU 3$,'21&$//),5(),*+7(56 WKHVHDUHQRWIXOOWLPH SRVLWLRQV

&DQ\RXDQVZHU\HVWRWKHIROORZLQJTXHVWLRQV" ¾$UH\RXORRNLQJWRKHOS\RXUFRPPXQLW\VWD\ VDIH" ¾'R\RXOLNHWRKHOSSHRSOHWKDWDUHLQQHHG" ¾$UH\RXDWHDPSOD\HU" ¾'R\RXZDQWWREHSDUWRIDQREOHSURIHVVLRQ" :HZRXOGORYHWRKHDUIURP\RX$SSOLFDWLRQIRUPVDUH DYDLODEOHDWWKH)LUH+DOOUG6WUHHW(VWHYDQ

Ever wonder what happens at a major event? Do you want to make extra money? No plans for the weekend? We are searching for Events staff to assist with the set-up/tear down, seating and parking for events held at Spectra Place.

We offer: â&#x20AC;¢ Opportunity to meet great people â&#x20AC;¢ Flex scheduling â&#x20AC;¢ Chance to be part of the show experience

Do you: â&#x20AC;¢ Have an attention to detail â&#x20AC;¢ Thrive in a fast paced environment â&#x20AC;¢ Work well under pressure â&#x20AC;¢ Enjoy tight deadlines

Be part of a great team, apply to: Kelvin Pillipow, Human Resources Manager 1102 4th Street, Estevan, SK S4A 0W7 E-mail: hr@estevan.ca Phone (306)461-5905

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&RQVWUXFWLRQ%XOOHWLQ

7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQFUHWHZRUNDQGURDGZRUNVDW 'XQFDQ5RDG²3HUU\&UHVFHQWWR0F'RQDOG5RDG7KHSXUSRVHRIWKLVZRUNLVWRSURYLGHWLPHO\ DQGFRVWHIIHFWLYHUHSODFHPHQWRIH[LVWLQJFDVWLURQZDWHUPDLQZLWK39&SLSHUHSODFHPHQWRI H[LVWLQJZDWHUDQGVDQLWDU\VHZHUVHUYLFHVIURPZDWHU VHZHUPDLQXSWRWKHSURSHUW\OLQHDQG VXUIDFHUHVWRUDWLRQ7KLVZRUNZRXOGUHTXLUHFORVXUHRILPPHGLDWHDUHDVRIH[FDYDWLRQDQGPD\ QHFHVVLWDWHSDUNLQJUHVWULFWLRQLQDGMDFHQWDUHDV7KLVZRUNZLOOFRPPHQFHGXULQJWKHZHHNRI -XQHDQGZLOOWDNHDSSUR[LPDWHO\(LJKW  WR7HQ  :HHNVWRFRPSOHWH VXEMHFW WRZHDWKHU *OHQ3HWHUVRQ&RQVWUXFWLRQ/WGZLOOSHUIRUPWKLVZRUNZLWKLQWKHFXUUHQW%\ODZ UHJXODWLRQV :RRGODZQ5HVHUYRLU 7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQVWUXFWLRQRID7UHDWHG'ULQNLQJ:DWHU5HVHUYRLU 7KHDIIHFWHGDUHDLQFOXGHV7KH:RRGODZQ$YHQXH5LJKWRI:D\1RUWKRIWKH6W-RVHSK·V+RVSLWDO 7KLV5LJKWRI:D\LVQRWDWKRXJKURDGDQGQRWUDIÃ&#x20AC;FZLOOEHDOORZHGLQWKHDUHDWKDWLVQRWLQYROYHG ZLWKWKHUHVHUYRLUFRQVWUXFWLRQ 7KLVZRUNZLOOFRPPHQFH0DUFKDQGZLOOWDNHDSSUR[LPDWHO\WHQ  PRQWKVWRFRPSOHWH /HGFRU &RQVWUXFWLRQ /WG DQG -9 0 &RQVWUXFWRUV ,QF ZLOO SHUIRUP WKLV ZRUN ZLWKLQ WKH FXUUHQW %\ODZUHJXODWLRQVDQGVSHFLÃ&#x20AC;FDWLRQV &RQVWUXFWLRQRQ$OH[DQGUD$YHQXH .LQJ6WUHHWWR+HQU\6WUHHW

7KLVZRUNZRXOGUHTXLUHFORVXUHRILPPHGLDWHDUHDVRIH[FDYDWLRQDQGPD\QHFHVVLWDWHSDUNLQJ UHVWULFWLRQLQDGMDFHQWDUHDV7KLVZRUNZLOOFRPPHQFHGXULQJWKHZHHNRI-XO\DQGZLOO WDNHDSSUR[LPDWHO\WKUHH WR ZHHNVWRFRPSOHWH VXEMHFWWRZHDWKHU 

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

Page 27

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


Page 28

THE TRADER EXPRESS, FRIDAY, JULY 27, 2012

S D I TH KEN    E E  W XO\

in the Estevan Shoppers Mall

,6+2/',1*7+(

T S E T A E GR GIFTCARD GIVEAWAY ! ! R E V E :KHQ\RXEX\IXUQLWXUHRUPDWWUHVVWKLV -

ZHHNHQG\RXZLOOUHFHLYHJLIWFDUGV $

BUY $499 $

BUY 999 BUY $1999

100

RECEIVE

RECEIVE

$

250

$

RECEIVE

600

7DNHDGYDQWDJHRI&DQDGDҋVHDVLHVWDQGPRVW ÁH[LEOHRIIHUVDQGWDNHXSWRPRQWKV  + & 7 6&5$$9( SWR 6 QFHVX

DSSOLD RQDOO

I

RI

DO NOT PAY!

7KLVLVZK\1RERG\DEVROXWHO\1RERG\%HDWV \RXUORFDOO\RZQHGQDWLRQDOO\SULFHG

 (VWHYDQ6KRSSHUV0DOO.LQJ6W(VWHYDQaZZZWKHEULFNFRP 0RQGD\7XHVGD\:HGQHVGD\)ULGD\6DWXUGD\‡7KXUVGD\‡6XQGD\


Trader July 27, 2012