Page 1



12:10 AM

Page 1


Kudeta Matador

Gold Winner The Best of National Newspaper

IPMA 2013

NO 2804 TAHUN KE 8

Kemewahan Mutiara

)) Hal 25



Harga Rp3.000 Harga Langganan Rp65.000/bulan (Luar Jakarta + ongkos kirim)

)) Hal 33



Ungkap Pelaku Penyerangan Lapas Cebongan JAKARTA – TNI menyerahkan sepenuhnya pengungkapan insiden penyerangan ke Lembaga Pemasyarakat (Lapas) II B Cebongan, Sleman, Daerah Istimewa Yogyakarta (DIY) pada Sabtu lalu (23/3) kepada Polri.

Ikuti berita terkait di


Kebebasan pers adalah benteng besar kebebasan yang tidak akan pernah bisa dikendalikan kecuali oleh pemerintahan yang lalim. THOMAS JEFFERSON (1762-1826) Presiden ke-3 Amerika Serikat.

Panglima TNI Laksamana TNI Agus Suhartono pun berjanji akan menindak tegas bila ada anggota yang terlihat dalam kasus yang menewaskan empat tahanan tersebut. “Semua mari kita serahkan ke kepolisian untuk melakukan penyelidikan lebih lanjut, manakala ada kaitan dengan anggota saya, saya akan turunkan tim,” ujar panglima TNI di Istana Merdeka Jakarta kemarin. Kepala Staf Angkatan Darat Jenderal TNI Pramono Edhie Wibowo juga menyampaikan komitmennya

menunggu hasil penyelidikan kepolisian.”Ini bagaimana, kita juga tidak tahu. Saksinya pada meninggal semua, begitu ditanya bagaimana. Saya tidak boleh mendahului, nanti jadi tuduhan dong,” ucapnya. Adapun Kepala Badan Intelijen Negara (BIN) Letjen TNI Marciano Noorman meminta semua pihak menunggu hasil penyelidikan yang dilakukan kepolisian. Dia menegaskan, di era sekarang ini tindakan seperti yang ditunjukkan kelompok bersenjata tersebut tidak dapat ditoleransi dan sebaliknya penegakan hukum harus dikedepankan. “Mari kita sama-sama memberi dukungan pada kepolisian untuk melakukan proses penyelidikan berikutnya supaya nanti kita mendapatkan informasi yang terbaik. Dengan begitu, langkah yang diambil penegak

hukum dapat berjalan dengan baik,” katanya. Wakil Menteri Hukum dan Hak Asasi Manusia Denny Indrayana menyatakan pihaknya sudah berkoordinasi dengan TNI dan Polri untuk mengusut tuntas kasus tersebut. Dari koordinasi itu diketahui bahwa kepolisian sudah memeriksa saksi, barang bukti berupa selongsong peluru, dan bukti lain yang sudah terkumpul. ‘’Telah disepakati bahwa ini harus diusut tuntas di jajaran pimpinan juga tidak ada sedikit keraguan intinya harus ditemukan dan mereka harus mempertanggungjawabkan di depan hukum,” ucapnya. Sementara itu, Kapolri Jenderal Pol Timur Pradopo mengaku sudah memerintahkan jajarannya untuk mengungkap kasus tersebut. Ke Hal 15))


Awali Bismillah, Jaga Integritas etika menuliskan kolom ini, tragedi penyerangan di Lapas Kelas IIB Sleman sedang sangat mengemuka. Banyak yang menyarankan saya menuliskan tentang itu. Saya memutuskan untuk tidak membahasnya dulu. Alasan utamanya, siapakah pelaku penyerangan itu sedang dalam proses penyelidikan oleh kepolisian. Siapa pun pelakunya tentu harus diungkap tuntas. Mereka telah melakukan pembunuhan yang keji dan tentu tidak dapat di-


DENNY INDRAYANA Wakil Menteri Hukum dan Hak Asasi Manusia,Guru Besar Hukum Tata Negara UGM

toleransi, tidak dapat dibiarkan. Setiap tindakan main hakim sendiri, apa pun alasannya, tidak dapat dibenarkan. Ke Hal 15))


8 Korban Ditemukan Meninggal, 9 Masih Tertimbun BANDUNG BARAT – Tanah longsor memorak-porandakan tiga kampung diDusunLembang,DesaMukapayung, Kecamatan Cililin, Kabupaten Bandung Barat, Jawa Barat, kemarin pagi. Sedikitnya ada 17 warga yang menjadi korban tragedi memilukan tersebut. Hingga pukul 16.30 WIB kemarin delapan korban meninggal telah dievakuasi dan sembilan korban lagi masih dicari. Mereka diduga tertimbun tanah dengan ketebalan mencapai 3 meter. Longsor yang merupakan kejadian terburuk sepanjang Kabupaten Bandung Barat berdiri ini terjadi di Kampung Nagrok, RT 4/7, Kampung Cikareo, RT 3/7, dan Kampung Barumuncang, RT 4/9. Pada 2010 di sekitar wilayah ini pernah mengalami longsor, namun tidak menimbulkan korban jiwa. Longsor ini terjadi setelah hujan lebat sepanjang malam. Bencana ini pertama kali melanda Kampung

Barumuncang sekitar pukul 04.00 WIB, kemudian Kampung Cikareo pukul 05.00 WIB, dan terakhir Kampung Nagrok pukul 05.30 WIB. Selain menelan korban jiwa, harta benda dan hewan ternak milik warga juga banyak menjadi korban longsor. Saat ini tim evakuasi tengah mencari korban yang belum ditemukan. Mereka hanya menggunakan alatalat manual seperti skop, linggis, dan cangkul untuk mencari korban yang tertimbun tanah. Selasa (26/3) pagi ini direncanakan melanjutkan kembali pencarian korban tersisa. Medan berat menuju lokasi longsor menyulitkan tim evakuasi menggunakan alat berat. Saksi mata Pepen, 35, mengatakan, longsor terjadi sangat cepat. Awalnya dia melihat rumah tetangganya, Tardi, di Kampung Barumuncang ambruk akibat diterjang tanah. Ke Hal 15))



TNIPasrahkan ke Polri

Petugas SAR dibantu warga melakukan evakuasi korban yang masih tertimbun di lokasi longsor Desa Mukapayung, Kecamatan Cililin, Kabupaten Bandung Barat, Jawa Barat, kemarin.



11:05 PM

Page 2




Ketua Umum DPP Srikandi Hanura Miryam S Haryani ( empat kanan) didampingi Sekretaris Jenderal Srikandi Hanura Anita Firdaus (tengah) dan sejumlah pengurus memberikan keterangan pers di DPP Srikandi Hanura, Tebet, Jakarta Selatan, kemarin. Srikandi Hanura secara resmi menolak bergabungnya mantan Bupati Garut Aceng HM Fikri ke Partai Hanura.

Srikandi Hanura Tolak Aceng JAKARTA – DPP Srikandi Hanura menolak pencalonan mantan Bupati Garut Aceng HM Fikri sebagai anggota legislatif pada Pemilu 2014 melalui Partai Hanura. Ketua Umum DPP Srikandi Hanura Miryam S Haryani mengatakan, pihaknya sangat terusik dengan pemberitaan tentang pencalonan Aceng Fikri melalui Partai Hanura. ”Selama tiga hari berturut-turut kami banyak ditanya soal pandangan masuknya Aceng Fikri ke Hanura. Karena itu, kami minta DPP Hanura lebih selektif dalam menjaring caleg,” kata Miryam di Jakarta kemarin. Dia menilai pemakzulan Aceng membuktikan bahwa mantan bupati Garut itu telah melakukan kesalahan yang tidak hanya mencederai etika kepemimpinan dan melanggar sumpah janji sebagai pejabat publik. Lebih jauh, organisasi sayap perempuan Partai Hanura ini juga menilai Aceng sudah melecehkan lembaga pernikahan dan kaum perempuan. Meski begitu, Miryam yakin Hanura akan selektif dalam proses penjaringan caleg. Dia mengatakan penolakannya ini bukanlah tindakan menghalangi Aceng sebagai warga negara untuk dapat dipilih. ”Tapi, kami yakin DPP Hanura tidak akan menerima bakal caleg yang cacat moral,” katanya. Miryam mengatakan, Aceng telah terbukti melakukan pelecehan terhadap kaum perempuan. Jangan sampai ada celah bagi Hanura untuk caleg yang

sudah cacat secara moral. Jika Aceng tetap diterima sebagai caleg Hanura, hal itu bisa menjadi kemunduran bagi partai politik. Aceng dimakzulkan akibat skandal nikah kilatnya dengan FannyOktoraselamaempathari. Tindakan itu menuai protes dari sejumlahkalangantermasukKomisi Nasional Perlindungan Anak. DPRD Garut akhirnya mengajukan permohonan pemakzulan atas Aceng ke Mahkamah Agung (MA) dan dikabulkan. Adapun penolakan Srikandi Hanura merupakan masukan, saran, dan pertimbangan terkait proses seleksi caleg. Masukan itu dinilai tepat karena saat ini DPP masih memproses seleksi caleg sebelum diserahkan ke Komisi Pemilihan Umum (KPU). ”Jadi belum tentu semua yang mendaftar akan diterima sebagai caleg Hanura. Partai akan melihat, menimbang dedikasi, kompetensi, integritas, serta kualitas caleg,” katanya. Miryam yakin DPP akan mempertimbangkan saran dan kritik Srikandi Hanura tersebut. Apalagi masukan tersebut diputuskan secara kelembagaan dalam mengawal caleg yang kapabel dan berintegritas. Seleksi yang cermat dan didasari masukan publik akan menentukan siapa saja yang layak masuk daftar calon sementara (DCS). Sebelumnya Aceng memilih

bergabung dengan Partai Hanura untuk melanjutkan karier politiknya. Dia memilih bergabung dengan Hanura karena memiliki kecocokan dengan partai tersebut sebab partai yang dipimpin Wiranto itu tidak pernah dilanda persoalan konflik internal seperti di sejumlah partai lainnya. ”Saya mengagumi ketegasan beliau (Wiranto), kearifan, dan kebijakan internalnya. Dua periode membangun partai tidak ada percikan konflik,” kata Aceng.

”Selama tiga hari berturut-turut kami banyak ditanya soal pandangan masuknya Aceng Fikri ke Hanura. Karena itu, kami minta DPP Hanura lebih selektif dalam menjaring caleg.” MIRYAM S HARYANI

Ketua Umum DPP Srikandi Hanura

Ketua Badan Pemenangan Pemilu (Bappilu) Partai Hanura Yuddy Chrisnandi mengatakan, apa yang disampaikan Srikandi Hanura merupakan aspirasi yang harus didengar. Posisi Srikandi saat ini merepresentasikan suara perempuan. ”Srikandi merupakan organisasi sa-

kukan tindakan amoral, menjadi tersangka korupsi, serta beberapa catatan lain. Untuk Aceng, Erik menilai ada catatan positif selain juga negatif. Aceng merupakan mantan kepala daerah. Dia sudah memiliki nilai popularitas setidaknya di Kabupaten Garut. Ketua Dewan Pimpinan Cabang (DPC) Partai Hanura Kabupaten Garut Lela Nurlaela mengakui merapatnya Aceng Fikri untuk kepentingan pencalonan anggota legislatif di DPR. Namun, menurut dia, wewenang untuk bisa menjadi calon anggota legislatif dari Hanura ditentukan oleh tim seleksi di DPP. Sementara itu, Wakil Ketua Dewan Pimpinan Daerah (DPD) Partai Hanura Jawa Barat Ujang Fahful Wathan mengakui merapatnya Aceng ke Hanura masih sekadar wacana. Keputusan diterima atau tidaknya pencalonan Aceng sangat bergantung pada keputusan DPP. ”Itu bukan wewenang saya. Itu wewenang DPP. Ya, kita ikut saja,” ucapnya. Menurut dia, Hanura selalu terbuka menerima siapa pun yang berniat mencalonkan diri sebagaicalegdengancatatanmengikuti seluruh mekanisme yang telah ditetapkan. Disinggung track record Aceng yang sebelumnya diberhentikan dari jabatannya sebagai bupati Garut karena pernikahan siri dengan Fanny Oktora, Partai Hanura tak mengkhawatirkan itu sebab Partai Hanura memiliki parameter sendiri untuk menjaring caleg. dita angga/ andi setiawan

yap yang memiliki kontribusi, pengaruh, dan jaringan luas. Ini akan menjadi referensi DPP dalam seleksi caleg,” katanya kepada KORAN SINDOkemarin. Sebagai seorang yang masuk dalam tim seleksi, Yuddy mengatakan tidak bisa melarang seseorang mendaftarkan diri sebagai caleg. ”Yang namanya orang mendaftar jika memenuhi persyaratan, parpol mana pun tidak boleh menolak. Pencalonan Aceng bukan hal yang istimewa dan dia diperlakukan sama dengan yang lainnya,” ungkapnya. Meski begitu, kata dia, pihaknya tidak akan mengabaikan aspirasi Srikandi Hanura. Apalagi saat ini Hanura masih melangsungkan proses rekrutmen caleg. ”Aceng Fikri baru bakal caleg, belum menjadi caleg,” ucapnya. Ketua DPP Partai Hanura Erik Satria Wardhana mengatakan, Aceng belum tentu lolos seleksi pencalegan karena Hanura masih belum menggelar proses penjaringan nama-nama caleg. Dia mengakui sudah ada 1.000 orang yang mendaftarkan diri menjadi caleg Partai Hanura untuk DPR. Dari jumlah itu akan menciut menjadi 560 orang melalui berbagai tahapan seleksi. ”Semua orang boleh mendaftar, masa kita larang. Partai kita terbuka, tapi secara internal juga ada seleksi. Pak Aceng belum tentu bisa lolos,” ucapnya. Erik menjelaskan, proses seleksi itu di antaranya akan menelusuri jejak rekam calon, prestasi, dedikasi, dan catatan apakah seorang calon pernah mela-

JAKARTA– Ketua Umum DPP Partai Demokrasi Indonesia Perjuangan (PDIP) Megawati Soekarnoputri bertolak ke Korea Selatan (Korsel) untuk memenuhi undangan Gubernur Provinsi Jeju yang merupakan sister provincedari Provinsi Bali. Kunjungan tersebut sekaligus menghadiri undangan dari The Chousnilbo, salah satu surat kabar terkemuka di Korea Selatan. Menurut Sekretaris Jenderal (Sekjen) DPP PDIP Tjahjo Kumolo, The Chousnilbo mengundang Megawati selaku presiden kelima Republik Indonesia untuk menjadi pembicara kunci pada acara Asian Leadership Conference 2013. Acara yang diselenggarakan The Chousnilbo ini mengundang juga tokoh dunia lainnya seperti Colin Powell, Yasuo Fukuda, Kevin Rudd, dan Tarja Halonen. Dalam acara tersebut, kata Tjahjo, Mega akan menekankan perlunya memikirkan kembali desain kelembagaan dunia baru, khususnya institusi keuangan, yang berangkat dari kemampuan suatu bangsa untuk berdiri di atas kaki sendiri (berdikari) di bidang ekonomi untuk berperan lebih dalam tata dunia baru yang mengedepankan konsep

pembangunan ekonomi yang lebih berkeadilan. ”Tidak seperti saat ini, di mana negara sekadar penopang bagi berfungsinya mekanisme pasar, yang tidak hanya gagal di dalam menciptakan pertumbuhan yang lebih berkeadilan. Namun lebih jauh lagi, selalu menimbulkan krisis yang terus berulang sebagaimana terjadi di Eropa dan Amerika,” ungkap Tjahjo. Mega bertolak ke Korsel sejak Minggu (24/3) hingga 29 Maret 2013. Di sana, kata Tjahjo, suami Ketua MPR Taufiq Kiemas ini dijadwalkan bertemu Presiden Korsel HE Park Geunhye di Blue House. Selain itu, Megawati juga akan bertemu Ketua Partai Saenuri (partai yang berkuasa saat ini) Hwang Woo-yea dan Gubernur Provinsi Jeju Woo Keun-min. Dalam lawatan tersebut Mega didampingi Wakil Ketua Komisi I DPR TB Hasanuddin, Ketua DPP PDIP Nusyirwan Sujono, Rochmin Dahuri, serta Wasekjen DPP PDIP Hasto Kristianto. ”Dubes Korsel untuk Indonesia Mr Kim dan istri juga melepas kepergian Ibu Mega di Bandara Soekarno-Hatta,” katanya. rahmat sahid


Persyaratan Incumbent Harus Diperketat JAKARTA – Rancangan Undang-Undang (RUU) Pemilihan Kepala Daerah(Pilkada)diminta agarmemperketatsyaratdanpengawasan bagi incumbent atau petahana supaya tidak menyalahgunakan kekuasaan dalam pertarungan politik lokal. Guru besar ilmu politik Universitas Airlangga (Unair) Ramlan Surbakti mengatakan, pembatasan tersebut dapat dilakukan melalui pengetatan regulasi pada RUU Pilkada yang saat ini sedang dalam pembahasan di DPR. ”Regulasi untuk membatasi incumbent yang maju kembali dalam pilkada perlu diatur lebih rinci dalam RUU Pilkada. Ini dilakukan untuk menciptakan kompetisi yang lebih fairbagi setiap peserta pilkada,” kata mantan Wakil Ketua Komisi Pemilihan Umum (KPU) ini di Jakarta kemarin. Menurutdia,padapraktiknya incumbent sering menyalahgunakan wewenangnya untuk kepentingan pribadi dan golongan

di antaranya mengeluarkan kebijakan baru atau program yang bersentuhan langsung dengan masyarakat demi meraup suara. Hal senada diungkapkan anggota Komisi II DPR Abdul Malik Haramain. Dia sependapat dengan usulan penerapan aturan tegas terhadap para incumbentdalam RUU Pilkada. ”Pembuatan kebijakan strategis itu seperti merotasi pegawai negeri sipil (PNS) serta pemberian bansos. Pengaturan untuk petahana seperti ini sedang kami pikirkan pada pembahasan di Panitia Kerja (Panja) RUU Pilkada,” ungkapnya. Dia mengemukakan, dalam kesempatan ini salah satu agenda yang cukup alot dibahas dalam RUU Pilkada yakni terkait usulan agar penyelenggaraan pilkada cukup dilakukan dalam satu putaran. Di samping itu, Malik menyebutkan, harus juga ada batasan dana untuk seorang calon kepala daerah. radi saputro

”Regulasi untuk membatasi incumbent perlu diatur lebih rinci dalam RUU Pilkada.” RAMLAN SURBAKTI

Guru besar ilmu politik Unair


JAKARTA–Pemerintah dinilai berlebihan dalam menyikapi gerakan kelompok sipil dari Majelis Kedaulatan Rakyat Indonesia (MKRI). Presiden Susilo Bambang Yudhoyono (SBY) dinilai tak perlu khawatir dengan aksi tersebut apalagi sampai dikaitkan dengan isu kudeta. Wakil Ketua MPR Hajriyanto Y Thohari dan Lukman Hakim Saifuddin mengatakan, kudeta terhadap pemerintahan yang sah hanya bisa dilakukan oleh gerakan dan kekuatan rakyat (people power) atau kekuatan bersenjata. Adapun unjuk rasa yang digelar para aktivis hanyalah aksi biasa dalam menyampaikan aspirasi dan kritik kepada pemerintah. Karena itu, Hajriyanto dan Lukman menilai gerakan aktivis MKRI tidak berbeda dengan aksi-aksi sebelumnya yang menyampaikan kritik terhadap pe-

merintahan. Presiden SBY diminta tidak perlu khawatir unjuk rasa tersebut bakal berimplikasi pada penggulingan pemerintah. ”Demonstrasi tidak benar-benar bertujuan untuk menurunkan pemerintahan Presiden SBY, apalagi melakukan kudeta. Mereka hanya melancarkan kritik yang sangat keras,” kata Hajriyanto di Jakarta kemarin. Gerakan kelompok sipil tersebut, kata Hajriyanto, ibarat orang yang membunyikan radio atau televisi dengan nada sangat keras dengan volume paling maksimal. Mereka sudah menyuarakan volume yang standar pada waktu-waktu sebelumnya. ”Tentu suaranya menjadi sangat keras dan memekakkan telinga orang-orang yang sedang menduduki kekuasaan,” kata Ketua DPP Partai Golkar ini. Lukman Hakim Saifuddin mengaku tidak melihat ada ke-

kuatan rakyat yang begitu besar dan menyeluruh yang akan menggulingkan pemerintahan. ”Kalau ada satu atau dua kalangan di masyarakat yang merasa tidak puas dan berdemonstrasi mengkritik keras, itu hal biasa di era demokrasi saat ini,” katanya. Sementara itu, Ketua Presidium MKRI Ratna Sarumpaet mengingatkan agar istilah kudeta yang digaungkan Istana tidak lagi dipakai untuk menamai aksi MKRI. Namun, dia tidak menampik saat ditanya mengenai tuntutan agar Presiden SBY mundur dari jabatannya. ”Tapi jangan katakan kudeta. Kudeta hanya bisa dilakukan oleh tentara. Tapi, ini baru awal menuntut SBY mundur, jangan diributkan dulu. Biarkan masyarakat memilih, mana yang dia pilih,” kata Ratna di Jakarta kemarin. Dia mengakui bahwa aksi yang digelar di depan Kantor Ya-

yasan Lembaga Bantuan Hukum Indonesia (YLBHI), Jalan Dipenegoro, merupakan bentuk people power dan itu suatu yang wajar. Karena itu, dia meminta SBY mundur dengan lapang dada. Pengamat politik dari Universitas Indonesia (UI) Boni Hargens menilai isu kudeta muncul dari Istana. Menurut dia, sikap Presiden SBY yang seperti berhalusinasi bahwa akan kudeta hanya untuk mencari simpati publik. ”Itu hanya upaya menarik simpati masyarakat,” katanya. Menurut dia, Presiden SBY tidak perlu melemparkan isu kudeta penggulingan pemerintahannya hanya demi mendapatkan simpati karena citra SBY memang sudah melemah akibat kinerjanya. rahmat sahid/ okezone


Isu Kudeta Dinilai Berlebihan

Ketua Presidium MKRI Ratna Sarumpaet berorasi sebelum membagikan sembako di Gedung Yayasan Lembaga Bantuan Hukum Indonesia (YLBHI), Jakarta Pusat, kemarin. Kegiatan ini untuk menepis isu akan terjadinya demo besar-besaran yang dilakukan MKRI.



Mega Jadi Pembicara Kunci di Asian Leadership




PD Pecah Sikapi Usulan SBY Jadi Ketum JAKARTA – Usulan dari mayoritas DPD Partai Demokrat (PD) agar Ketua Dewan Pembina Susilo Bambang Yudhoyono (SBY) menjabat sebagai ketua umum DPP menuai pro-kontra di tingkat elite partai tersebut. Sejumlah elite Demokrat memaklumi usulan tersebut dengan alasan bahwa realitas politik saat ini membutuhkan sosok SBY sebagai perekat dan penyelamat partai. Apalagi elektabilitas Demokrat kian merosot hingga peringkat ketujuh sebanyak 4,3% di bawah Partai Gerindra dan Partai Hanura. Hal itu berdasarkan hasil survei Lembaga Survei Nasional (LSN) yang dirilis pada Minggu (24/3). Mereka yang setuju dengan usulan tersebut antara lain Wakil Sekjen DPP Partai Demokrat Saan Mustopa dan Ramadhan Pohan. Sekretaris Dewan Pembina PD Syarif Hasan dan anggota Dewan Pembina Amir Syamsuddin juga setuju dengan usulan tersebut karena kondisi Demokrat sekarang dianggap darurat. Syarif memastikan bahwa SBY sedang mempertimbangkan untuk menjabat ketua umum DPP. Ada juga elite Demokrat yang tidak menghendaki SBY diberi jabatan sebagai ketua umum DPP karena masih banyak kader yang bisa menakhodai Demokrat dan SBY sangat sibuk dengan urusan kenegaraan sebagai presiden. Pendapat ini disuarakan Ketua DPP Sutan Bhatoegana dan Ruhut Sitompul. Adapun anggota Dewan Pembina Partai Demokrat Ahmad Mubarok tidak secara langsung menolak usulan tersebut. Namun, dia yakin SBY

akan menolak permintaan dari para pengurus DPD. Menurut Saan Mustopa, apa yang diusulkan DPD merupakan aspirasi yang diyakini merepresentasikan suara-suara di DPC. Karena itu, semua akan dikembalikan pada bagaimana SBY menyikapi permintaan dari DPD. Jika bersedia, kongres luar biasa (KLB) akhir bulan ini tinggal ketok palu. “Kalau Pak SBY bersedia, pasti semua kader mendukungnya. Ini bergantung Pak SBY. Kita akan dukung,” kata Saan di Gedung DPR, Jakarta, kemarin. Soal apakah posisi SBY sebagai presiden tidak akan terganggu jika menjadi ketua umum, Saan menilai tidak masalah karena SBY tidak harus mengerjakan urusan teknis kepartaian. “Kita mengalami masa kritis dan mengalami fase-fase yang sulit. Masalah saat ini soal kepemimpinan. Ketum harus membawa partai keluar dari fase seperti ini,” ucapnya. Pendapat Saan diamini Wakil Sekjen DPP Partai Demokrat Ramadhan Pohan. Menurut dia, kader di daerah cukup realistis melihat dinamika politik saat ini di mana figur yang bisa menjadi perekat dan penyelamat adalah dari Cikeas. Suara dari daerah yang

menginginkan SBY menjadi ketua umum dianggap sebagai solusi yang tepat. “Maunya kalau bukan SBY, ya Bu Ani atau Ibas. Jadi kepercayaan besar untuk memimpin Demokrat diberikan kepada Cikeas. Itu realitas politik, tidak bisa dipungkiri,” ungkapnya. Sebaliknya, Ketua DPP Partai Demokrat Sutan Bhatoegana menilai, dari segi kepatutan, usulan tersebut harus dipertimbangkan kembali sebab SBY sudah terlalu sibuk sebagai kepala negara. Namun, jika SBY bersedia, dia menilai hal itu sah dan wajar. “Tetapi, kurang elok untuk regenerasi di Demokrat jika (SBY) menjadi ketua umum Demokrat. Masak dari sekian ribu kader sejati Demokrat tidak ada yang mumpuni jadi ketua umum,” katanya. AdapunanggotaDewanPembinaAhmadMubarokmenilaiaspirasi kader merupakan bentuk penghormatan terhadap

“Kurang elok untuk regenerasi di Demokrat jika (SBY) menjadi ketua umum Demokrat.” SUTAN BHATOEGANA

Ketua DPP Partai Demokrat

SBY. Meski menghargai usulan tersebut, dia yakin SBY tidak akan bersedia duduk di posisi yang ditinggalkan Anas Urbaningrum tersebut. “Tidak akan bersedia. Berisiko secara politik karena akan menjadi bahan kritikan,” ungkapnya. Lalu, bagaimana dengan sikap SBY sendiri? Sekretaris Dewan Pembina Demokrat Syarif Hasan mengatakan, Presiden SBY selaku pendiri Partai Demokrat mempertimbangkan untuk maju sebagai calon ketua umum melalui KLB akhir pekan ini. “Sedang dipertimbangkan oleh beliau (SBY) karena harapannya jangan sampai mengganggu tugas-tugas beliau,” ujar Syarif di Kompleks Istana Negara Jakarta kemarin. Menurut Syarif, tidak ada salahnya seorang presiden memiliki jabatan sebagai ketua umum partai.


Rangkap jabatan ini juga pernah dilakukan Presiden RI kelima Megawati Soekarnoputri sebagai ketua umum PDI Perjuangan. Usulan SBY sebagai calon ketua umum Demokrat menggantikan Anas Urbaningrum muncul setelah 26 DPD Demokrat menyampaikan aspirasinya dalam rapat koordinasi di Puri Cikeas Bogor pada Minggu (24/3). Dari 33 DPD, menurut Syarif, lima di antaranya juga ada yang mengajukan Ibu Ani Yudhoyono untuk memimpin partai. Rapat yang berlangsung sejak pukul 13.00 WIB sampai 16.00 WIB tersebut antara lain membahas tentang persiapan akhir KLB yang akan berlangsung di INA Grand Sanur Bali pada 30-31 Maret. Dalam rapat itu juga dibahas mengenai kriteria calon ketua umum yang bisa dipilih pemegang hak suara. Kriteria calon ketua umum yang telah dirumuskan antara lain wajib memiliki kartu tanda anggota (KTA), memiliki pengalaman yang cukup, serta didukungdanditetapkanolehmayoritas peserta KLB yang memiliki hak suara. Atas dasar usulan mayoritas DPD, SBY selaku Ketua Majelis Tinggi, Ketua Dewan Pembina, dan Ketua Dewan Kehormatan mengatakan sangat menghargai masukan dan usulan dari 26 DPD tersebut. “Bapak sangat mendengarkan (usulan DPD) itu, tapi semua diserahkan nanti ke kongres. Kalau floor menghendaki begitu, akla-

masi,” ujar menteri Koperasi dan UMKM ini. Syarif memastikan peluang SBY untuk memimpin partai sangat terbuka luas mengingat seluruh kader Demokrat meninginkan hal itu. Meski demikian, menurut Syarif, Demokrat masih membuka peluang bagi kader yang akan maju sebagai calon ketum. “Mungkin saja (ada calon ketum lain). Kalau ada kader yang mencalonkan diri, silakan,” tutur suami anggota DPR Inggrid Kansil ini. Menanggapi hal itu, pengamat politik dari Universitas Gadjah Mada (UGM) Ari Dwipayana menilai ada dua kemungkinan yang bisa menjadi jebakan bagi SBY jika dalam KLB nanti secara aklamasi dikukuhkan sebagai ketua umum. Pertama, SBY akan terjebak pada ranah yang lebih politis di tengah kondisi bangsa yang seharusnya membutuhkan fokus SBY sebagai presiden. “Akan ada anggapan yang semakin melekat SBY hanya sibuk ngurusin politiknya, padahal sebelumnya sudah mengimbau para menteri agar fokus bekerja,” ungkapnya. Kedua, kata dia, SBY bisa terjebak pada kegagalan personal karena belum tentu mampu mengangkat elektabilitas partainya setelah mengambil alih Demokrat secara total. Nanti bisa jadi asumsinya akan menguat bahwa faktor utama penurunan elektabilitas partai ada pada SBY. Lebih lanjut Ari berpendapat, saat ini memang SBY sudah masuk pada pusaran politik internal yang tidak diantisipasi sebelumnya. Hal itu yang membuat posisi SBY semakin sulit ketika dihadapkan pada aspirasi pengurus daerah. rahmat sahid/ rarasati syarief

4 SELASA 26 MARET 2013


PKPI Jadi Parpol Terakhir Peserta Pemilu Dapat Nomor Urut 15, KPU Tak Beri Kelonggaran Penyusunan DCS

Penetapan PKPI sebagai parpol peserta pemilu dilakukan setelah melalui perdebatan yang alot dan proses yang panjang. Kepastian ini didapat setelah KPU memutuskan untuk menerima putusan Pengadilan Tinggi Tata Usaha Negara (PT TUN) terkait gugatan PKPI terhadap KPU. Gugatan tersebut diajukan PKPI kepada PT TUN lantaran KPU dianggap tidak patuh dalam melaksanakan Keputusan Badan Pengawas Pemilu (Bawaslu) No 012/SP-2/Set. Bawaslu/I/2013.Atas putusan ini, PKPI menyusul Partai Bulan Bintang (PBB) yang sebelumnya juga ditetapkan oleh KPU sebagai parpol peserta Pemilu 2014. Sama halnya PKPI, PBB juga memenangkan gugatan sengketa pemilu di PT TUN. “Berdasarkan Surat Keputusan (SK) KPU No 165/KPTS/KPU/2013 menetapkan PKPI sebagai peserta Pemilu 2014. Selanjutnya KPU juga menerbitkan SK KPU No 166/KPTS/KPU/2013 yang menetapkan PKPI untuk mendapatkan nomor urut 15,” tandas Ketua KPU Husni Kamil Manik saat menggelar jumpa pers di Kantor KPU Pusat, Jakarta, kemarin. Sebelumnya, Keputusan Badan Pengawas Pemilu (Bawaslu) melalui sidang ajudikasi menyatakan bahwa PKPI meme-

nuhi persyaratan untuk menjadi peserta Pemilu 2014. PT TUN akhirnya mengabulkan gugatan PKPI terhadap KPU dengan nomor perkara 25/G/2013/PTTUN.JKT. Husni mengatakan, keputusan KPU ini juga telah mendasarkan pada putusan Bawaslu yang ditegaskan oleh putusan PT TUN sepanjang menyangkut PKPI untuk ditetapkan sebagai peserta pemilu. Husni mengutarakan, tindak lanjut putusan PT TUN pada intinya merespons gugatan yang disampaikan oleh PKPI. Hal ini sebagaimana ketentuan UU No 8/2012 tentang Pemilu Anggota DPR, DPD, dan DPRD, Pasal 269 ayat 11 yang menyatakan bahwa KPU wajib menindaklanjuti PT TUN atau MA paling lama tujuh hari kerja. “Jika dihitung sejak putusan PT TUN dikeluarkan atas gugatan PKPI, hari ini merupakan hari ketiga sejak dibacakannya putusan. Kami memperhatikan data yang disampaikan oleh PT TUN yang pada intinya menyatakan Keputusan KPU No 5/KPTS/KPU/2013 tentang penetapan parpol pada Pemilu 2014 batal demi hukum,” paparnya. Husni mengaku, keputusan KPU ini diambil setelah sebelumnya menggelar rapat pleno. Dalam keputusan ini, selanjutnya tidak ada dispensasi kepada PKPI terkait penyerahan daftar


JAKARTA – Komisi Pemilihan Umum (KPU) akhirnya memutuskan Partai Keadilan dan Persatuan Indonesia (PKPI) sebagai partai politik (parpol) peserta Pemilu 2014. PKPI akan menempati nomor urut 15 parpol peserta pemilu.

Ketua Umum Partai Keadilan dan Persatuan Indonesia (PKPI) Sutiyoso (ketiga kanan) mengangkat tangan bersama jajaran pengurus DPP PKPI, setelah mengikuti pengumuman hasil pleno Komisi Pemilihan Umum (KPU) di Gedung KPU, Jakarta, kemarin. KPU memutuskan PKPI sebagai peserta Pemilu 2014 dengan nomor urut 15.

calon sementara (DCS) calon legislatif (caleg) parpol peserta pemilu. Menurut dia, semua parpol peserta pemilu harus bersedia mengikut tahapan yang telah ditetapkan KPU. Pasalnya, tahapan pemilu yang sudah dituangkanmelaluiaturantersebut sudah disepakati bersama. “PKPI menjadi partai terakhir yang menjadi peserta Pemilu 2014. Di PT TUN sudah tidak ada lagi perkara yang disidangkan. Alasannya sama persis dengan yang diterapkan kepada PBB. Kami

mengacu pada soal rentang waktu yang tidak memungkinkan jika KPU mengajukan kasasi ke Mahkamah Agung (MA) dengan masa tahapan yang terus berjalan,” paparnya. Ketua Umum DPP PKPI Sutiyoso (Bang Yos) menyambut baik keputusan KPU ini. Setelah adanya keputusan ini, pihaknya meminta para kader PKPI untuk segera melakukan tahapan pencalegan sesuai jadwal yang sudah ditentukan. Mantan gubernur DKI Jakarta ini menyampaikan, dari

perjalanan panjang yang ditempuh partainya untuk menjadi peserta Pemilu 2014, ada pelajaran yang bisa diambil yakni persoalan ini menandakan lembaga penyelenggara pemilu–KPU dan Bawaslu, selalu berbeda dalam menafsirkan undang-undang. “Yang menjadi korban parpol, dalam hal ini PKPI. Kondisi ini membuat PKPI dirugikan waktu selama satu bulan 20 hari untuk mempersiapkan tahapan pencalegan. Meskipun berat, tetap akan kami tempuh,” tan-


Pemerintah Usul Bupati/Wali Kota Dipilih DPRD perkuat kewenangan gubernur. Menurut mantan gubernur Sumatera Barat ini, dalam Pasal 18 UUD 1945 disebutkan bahwa otonomi daerah seluasnya diberikan kepada pemerintah daerah. “Tapi tidak disebutkan di mana otonomi seluasnya itu. Jadi, kita berpikir bisa diterapkan kepada pemerintah provinsi sebagai kepanjangan tangan pemerintah,” tandas Gamawan di Jakarta akhir pekan lalu. Meski demikian, menurut Gamawan, penerapan usulan itu tidak bisa diimplementasikan di seluruh provinsi. Dia mencontohkan, di Papua dengan pemberlakuan otonomi khusus, maka baik gubernur maupun bupati/wali kota harus dipilih DPRD. Hal ini untuk menghindari konflik sosial yang kerap terjadi pascapemilihan kepala daerah di provinsi tersebut. Kewenangan otonomi yang lebih luas oleh gubernur, lanjut Gamawan, tidak lantas meng-


JAKARTA – Setelah mengusulkan agar gubernur ditetapkan DPRD, kini pemerintah kembali meminta agar bupati/wali kota juga ditetapkan oleh wakil rakyat. Usulan itu muncul dalam pembahasanRancanganUndang-Undang Pemilu Kepala Daerah (RUU Pilkada) yang kini masih digodok pemerintah dan DPR. Sebelumnya, pemerintah justru mengusulkan hal sebaliknya, gubernur dipilih DPRD, sementara bupati/wali kota dipilih langsung oleh rakyat. Pemerintah tadinya bersikeras untuk mencantumkan pasal gubernur dipilih DPRD dalam RUU Pilkada. Alasannya, jika itu diterapkan maka bisa memangkas politik berbiaya tinggi dan mengurangi konflik. Menteri Dalam Negeri (Mendagri) Gamawan Fauzi mengatakan, usulan terakhir ini muncul seiring dengan keinginan kuat pemerintah untuk terus memperluas dan mem-



hilangkan kewenangan bupati/wali kota. Pemerintah kabupaten/kota akan tetap mengelola pelayanan yang langsung berhadapan dengan masyarakat, misalnya pendidikan dan kesehatan. “Karena pemerintah kabupaten/kota itu secara teknis langsung berhubungan dengan masyarakat, jadi tidak mungkin itu diserahkan ke pemerintah provinsi,” paparnya. Gamawan mengaku optimistis RUU Pilkada bisa rampung di awal bulan depan.

Targetnya, awal April ini RUU tersebut bisa disahkan. Sebelumnya, untuk penguatan kewenangan pemprov, pemerintah juga berencana untuk mencabut kewenangan pemerintah kabupaten/kota (bupati/wali kota) dalam hal pemberian izin pengelolaan sumber daya alam ekologis seperti perkebunan, pertambangan, kehutanan, dan perikanan. Selanjutnya, pemberian izin akan menjadi kewenangan pemprov atau gubernur. Direktur Jenderal (Dirjen) Otonomi Daerah Kementerian Dalam Negeri (Kemendagri) Djohermansyah Djohan mengatakan, jika disetujui legislatif maka pencabutan itu akan tertuang dalam revisi UU No 32/2004 tentang Pemerintah Daerah. Pemerintah dan DPR baru akan membahas rencana ini. Menurut dia, pengalihan kewenangan ini bertujuan untuk mempermudah pengawasan.

Selain itu, selama menjadi kewenangan pemerintah kabupaten/kota, pemerintah kerap menemukan penyimpangan pemberian izin. Misalnya izin yang berhimpit atau kongkalikong antara pemerintah daerah dengan para pengusaha. “Ini juga dalam rangka penguatan kewenangan pemerintah provinsi,” kata Djohan saat dihubungi kemarin. Djohanmemaparkan,jumlah pemerintah provinsi yang hanya 33 dibanding pemerintah kabupaten/kota yang mencapai hampir 500 bisa mempermudah pengawasan. Pelanggaran pemberian izin, ujarnya, marak terjadi karena izin usaha diberikan secara serampangan. “Apalagi ketika menjelang pilkada, marak sekalipelanggaran.Makaitu,kita menghindari hal-hal seperti itu,” tandasnya. Pemerintah,ujarnya, terus berupaya untuk memperbaiki iklim investasi. krisiandi sacawisastra


JAKARTA– Sanksi penghapusan keterwakilan (parpol) di daerah pemilihan (dapil) jika tidak memenuhi kuota 30% keterwakilan perempuan oleh KomisiPemilihanUmum(KPU), dinilai melanggar Undang-Undang (UU) No 8 Tahun 2012 tentang Pemilihan Umum (Pemilu). Anggota Komisi II DPR dari Fraksi PDIP Arif Wibowo mengatakan, aturan KPU yang memberikan sanksi kepada parpol terkait keterwakilan perempuan merupakan tindakan melanggar undang-undang. Dia mengatakan bahwa dalam UU Pemilu tidak disebutkan sanksi kepada partai yang tidak memenuhi 30% keterwakilan perempuan dalam daftar caleg. Karena itu, KPU tidak bisa membuat norma sendiri yang setara dengan UU. “Itu namanya membentuk norma baru bukan kewenangan KPU. Yang membuat UU kan DPR

bersama dengan pemerintah. KPU hanya membuat aturan teknis dari UU,” katanya saat ditemui di Gedung DPR kemarin. Peraturan KPU No 7 Tahun 2013 tentang Pencalonan Anggota DPR, DPRD Provinsi, dan DPRD Kabupaten/Kota mengatur sanksi penghapusan keterwakilan parpol di dapil, apabila tidak melaksanakan ketentuan di antara tiga calon ada satu calon perempuan dan tak menyertakan sekurang-kurangnya 30% caleg perempuandalamsuatudapil.Arif mengakui kuota caleg perempuan dalam UU Pemilu memang tidak disertai sanksi, karena kultur dan struktur yang patriarki menjadi pertimbanganutama.“Jadisengajatidakdiberisanksi,”ujarnya. Hal serupa diungkapkan Wakil Ketua Komisi II DPR Abdul Hakam Naja. Dia menilai aturan KPU tersebut melanggar asas kenasionalan pemilu. Menurutnya, dalam UU Pemilu, sanksi


DPR Tolak Penerapan Sanksi terhadap Parpol

Ketua Komisi Pemilihan Umum (KPU) Husni Kamil Manik berbincang dengan anggota Komisi II DPR, sebelum mengikuti rapat dengar pendapat dengan Komisi II DPR di Gedung DPR, Jakarta, kemarin.

yang diberikan adalah sanksi sosial. Hal itu tercantum dalam Pasal 67 ayat 2 UU Pemilu, yakni KPU, KPU provinsi, dan KPU kabupaten/kota mengumumkan persentase keterwakilan perem-

puan dalam daftar calon tetap partai politik di media massa cetak nasional dan media massa elektronik nasional. “Sebenarnya ada sanksinya, yakni pengumuman di media. Itu

sanksi sesungguhnya. Kalau sanksinya tidak boleh ikut pemilu di dapil tertentu, itu melanggar asas kenasionalan sebab pemilu bersifat nasional,” katanya. dita angga

dasnya. Dia menyatakan, kerugian lainnya akibat keterlambatan ini adalah banyak kader PKPI di daerah sudah mundur karena sebelumnya dinyatakan tidak lolos pemilu. Di samping itu, ada beberapa tokoh masyarakat dan parpol tidak lolos pemilu yang sebelumnya menyatakan ingin bergabung akhirnya mengurungkan niatnya. Namun, Bang Yos mengklaim, dengan diloloskannya PKPI saat ini, sudah ada parpol yang merapat. “Setidaknya ada

13 parpol yang tidak lolos verifikasi bertekad untuk menyatu dengan PKPI, sehingga kita akan berkompetisi dengan kekuatan yang cukup lumayan. Keyakinan ini didapat karena kami juga punya kader dan konstituen yang kuat di daerah,” ujarnya. Ditanya soal penempatan nomor urut 15, Bang Yos menyatakan dapat menerima keputusan KPU itu. “Saya akan terima nomor 15 dengan senang hati,” tandasnya. radi saputro

PBB Batal Ajukan Dispensasi DCS JAKARTA – Partai Bulan Bintang (PBB) mengurungkan niatnya meminta dispensasi kepada Komisi Pemilihan Umum (KPU) terkait batas waktu penyerahan daftar calon legislatif sementara (DCS). Ketua Umum DPP PBB MS Ka’ban mengatakan, pihaknya akan menaati jadwal dan proses tahapan pemilu yang sudah ditetapkan oleh KPU. Penyerahan DCS yang sudah dijadwalkan KPU sendiri 9 April 2013. “Sebetulnya kondisi atau waktu rekrutmen bakal calon legislator (caleg) bagi PBB memang sangat pendek. Namun, kami sekuat tenaga mengikuti proses yang sudah ditetapkan oleh KPU meskipun berat,” tukas dia saat diwawancarai wartawan di Jakarta kemarin. Dia menyampaikan, waktu yang singkat tersebut sangat sulit bagi PBB untuk menjaring bakal caleg yang berkualitas serta memenuhi kuota 30% caleg perempuan. Dia sendiri menilai KPU saat ini terlalu arogan dan tidak memperhatikan aspirasi parpol. Ka’ban mengakui, PBB sudah mengambil seluruh formulir pendaftaran bagi bakal caleg pada Senin (18/3) lalu. Saat ini, formulir tersebut mulai diisi oleh bakal caleg dari seluruh Indonesia. “Terhitung sudah ribuan calon yang ingin bergabung termasuk banyak tokoh masyarakat. Untuk bakal caleg perempuan, PBB seharusnya menyiapkan caleg perempuan sebanyak 200 orang. Namun, saat ini PBB hanya berhasil menjaring caleg perempuan sebanyak 155 orang,” paparnya. Ka’ban optimistis pada 9 April 2013 mendatang partainya bisa memenuhi kuota keterwakilan caleg perempuan tersebut. Pihaknya mengeluhkan terlalu ketatnya KPU mengatur jadwal. Ka’ban berujar, jangankan partainya, partai yang sudah jauh hari dinyatakan lolos pemilu saja merasa kesulitan, apalagi untuk PBB yang belum lama dinyatakan sebagai parpol pe-

serta Pemilu 2014. “Sudah pasti memang kami kesulitan.Partaiyangsudahjauh hari lolos saja kesulitan, apalagi PBB. Ini pekerjaan yang tidak mudah. Jika KPU tidak melunak pada PBB, perlakuan KPU seharusnya juga sama kepada partai-partai lain,” tuturnya.

’’Kami sekuat tenaga mengikuti proses yang sudah ditetapkan oleh KPU meskipun berat.’’ MS KA’BAN

Ketua Umum DPP PBB

Dia mengharapkan. KPU bisa menerapkan prinsip yang tegas pada partai lain yang nantinya tidak mampu memenuhi persyaratan pencalegan sebagaimana diatur undang-undang dan Peraturan KPU (PKPU). Ka’ban menyatakan pihaknya secara khusus akan memantau konsistensi KPU dalam menegakkan aturan. Dia meminta KPU bisa tegas terhadap semua parpol, termasuk parpol yang saat ini duduk di parlemen. Sementara itu, Ketua KPU Husni Kamil Manik mengatakan bahwa KPU akan melaksanakan PKPU dengan konsisten, termasuk penerapan kuota 30% caleg perempuan. Pihaknya juga akan mengembalikan daftar caleg parpol di dapil tertentu yang tidak memenuhi kuota hingga batas waktu yang ditentukan. “Aturan tersebut tetap akan kami terapkan, sehingga jika pada batas waktu parpol peserta pemilu tidak memenuhinya, KPU akan menggugurkan keterwakilan semua caleg parpol di dapil tersebut,” tegas dia. PU akan menggugurkan keterwakilan semua caleg parpol di dapil tersebut,” tegas dia. radi saputro


10:52 PM

Page 5




JAKARTA – Pemerintah akan meningkatkan program pembangunan untuk Provinsi Nusa Tenggara Timur (NTT) dengan memberikan dana alokasi khusus sebesar Rp931 miliar. Dana tersebut akan dipergunakan untuk pemberdayaan eks pengungsi Timor Leste. “Saat ini ada warga eks Timor Leste sekitar 26.000 kepala keluarga,” kata Menko Kesra Agung Laksono saat rapat koordinasi tingkat menteri di Jakarta kemarin. Menurut dia, selain untuk pemberdayaan warga eks Timor Leste, dana tersebut juga akan dimanfaatkan untuk pembangunan infrastruktur jalan. Karena itu, dalam pelaksanaannya kegiatan ini akan melibatkan kementerian terkait seperti kementerian sosial. “Untuk pemberdayaan akan kita gunakan program Kelompok Usaha Bersama(KUBE)dibawahKementerian Sosial (Kemensos),” ujarnya. Agung mengungkapkan, selain program Kube, pemerintah juga akan membantu warga melalui sektor pertanian. Kementerian Pertanian akan memberikan 15.000–25.000 ekor sapi

dan 20.000 ekor babi. Nantinya mereka akan mengelola secara berkelompok sehingga mudah dikontrol. Lebih lanjut dia menambahkan mengenai bantuan revitalisasi kebudayaan NTT agar tetap bisa dilestarikan. Melalui program itu, kehidupan warga NTT diharapkan meningkat dan lebih sejahtera. Sementara itu, Dirjen Pemberdayaan Sosial dan Penanggulangan Kemiskinan Kementerian Sosial (Kemensos) Hartono Laras mengatakan bahwa pemberdayaan warga NTT itu merupakan instruksi presiden secara langsung yang dikoordinasikan dengan Kemenko Kesra. Menurut dia, dalam pemberdayaan warga NTT nantinya akan melibatkan Kementerian Perumahan Rakyat dan Kementerian Pekerjaan Umum untuk sektor fisik. Sementara sektor pemberdayaan nelayan, petani, dan warga miskin akan ditangani oleh Kemensos dan Kementan. “Ada anggaran Rp2,5 miliar yang akan digunakan untuk pemberdayaan,” ujar dia. ●ayu rachmaningtyas


Pemerintah Bantu NTT Rp931 Miliar

AGENDA PEMBANGUNAN Dua personel Brimob melakukan pengamanan di sekitar tempat berlangsungnya pertemuan keempat Panel Tingkat Tinggi (High-Level Panel) tentang Agenda Pembangunan Pasca-2015 di Nusa Dua, Bali, kemarin. Pertemuan yang berlangsung pada 25 - 27 Maret tersebut rencananya dihadiri tiga kepala negara dan sejumlah tokoh dari berbagai belahan dunia untuk membahas kemitraan global dan agenda pembangunan pasca-2015.

Target Lulus UN 100% Dinilai Manipulatif Dinas Pendidikan Harus Dorong Kepala Sekolah Jujur JAKARTA – Kementerian Pendidikan dan Kebudayaan (Kemendikbud) meminta dinas pendidikan daerah realistis terhadap hasil ujian nasional (UN). Target pemerintah daerah yang mengharuskan siswanya lulus UN 100% cenderung manipulatif. Mendikbud Mohammad Nuh mengatakan, tahun ini sudah tidak boleh ada lagi pemerintah daerah yang menargetkan 100% kelulusan siswa di UN. Dengan target 100% kelulusan itu, sekolah akhirnya terdorong untuk melakukan pembenaran dan memanipulasi nilai. “Para guru sibuk mencari jawaban soal dan memberikannya ke siswa serta beragam modus pelanggaran lainnya,” katanya pada Sosialisasi UN kepada Kepala Dinas Pendidikan, di Jakarta kemarin.

Mantan rektor ITS itu mengungkapkan, bentuk intervensi pemerintah daerah tersebut harus dilawan. Menurut dia, saat ini UN semakin dihargai sebagai tiket masuk perguruan tinggi negeri (PTN). Karena itu, pemerintah daerah maupun pusat pun harus menghapus stigma negatif masyarakat yang menilai UN selalu terjadi kecurangan. “Kita harus buktikan UN bisa berjalan tanpa kecurangan. UN akan semakin dihargai sehingga tata kelolanya mesti kredibel,” katanya.

Mantan menkominfo ini menjelaskan, pemerintah daerah sebetulnya tidak perlu membuat target apa-apa karena persentase kelulusan tahun kemarin saja mencapai 99,50% untuk kelulusan SMA. Karena itu, pemerintah daerah pun diminta realistis dalam meraih kelulusan tinggi sebaiknya dicapai dengan ikhtiar dan persiapan pra-UN, bukan dengan merusak jiwa UN melalui bentuk pelanggaran lain. Menurut dia, jika kepercayaan terhadap UN hilang, konsekuensinya pemerintah harus membuat bentuk ujian baru yang memakan biaya tinggi. DalampelaksanaanUNtahun ini,tambahdia, diperkuatdarisisi soal dengan variasi 20 soal. Per 20 soal ini akan terbagi lagi menjadi empat kelompok soal, yakni soal kategori mudah, sangat mudah, sulit, dan lebih sulit. Dia menjelaskan, pengelom-


Perempuan dan Remaja Jadi Fokus Pemberdayaan NUSA DUA – Komposisi penduduk Indonesia yang saat ini didominasi usia muda dapat membawa keuntungan pada pertumbuhan ekonomi. Namun, pemerintah harus mengantisipasi dinamika ke-pendudukan melalui upaya pengendalian jumlah dan peningkatan kualitas penduduk. Dalam pertemuan di Nusa Dua, Bali, para pakar ekonomi dan kependudukan mengingatkan bahwa dinamika kependudukan akan berpengaruh pada tiga pilar pembangunan berkelanjutan, yaitu ekonomi, sosial, dan lingkungan. Plt Kepala Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) Sudibyo Alimoeso mengatakan, dinamika kependudukan sering kali dianggap sebagai hal yang harus diterima begitu saja. Intervensi yang dilakukan pun lebih kepada akibat dari dinamika kependudukan itu, misalnya kemiskinan, lapangan kerja, dan pendidikan. Padahal, intervensi bisa dilakukan di hulu, yaitu dengan merekayasa jumlah dan komposisi penduduk. “Kalau upaya kita merekayasa dinamika kependudukan itu tepat, bonus demografi akan kita peroleh pada sekitar tahun 2020–2030,” ujarnya di selasela pertemuan bertema Dinamika Kependudukan dan Agenda Pembangunan Pasca-2015. Menurut dia, momentum

yang singkat itu jika dimanfaatkandenganbaikakanmemacu investasi dan pertumbuhan ekonomi. Syaratnya, kualitas generasi muda harus ditingkatkan lagi, sebab mereka yang nantinya akan membawa gerbong itu.




Plt Kepala BKKBN

Dia menegaskan, pembangunankependudukanmestinya lebih mengarah pada peningkatan kualitas, terutama bagi usia produktif.Caranyaantaralaindengan memberikan pendidikan yang komprehensif dan pekerjaan yang kompetitif. Bagi kaum perempuan, intervensi juga bisa dilakukan melalui pendewasaan usia perkawinan. “Pada usia 16, banyak perempuan sudah menikah dan hanya lulus SMA atau drop out. Setelah menikah, mereka umumnya tidak meningkat pendidikannya,” bebernya. Menurut dia, pihaknya hingga kini juga terus mengampanyekan program Keluarga Berencana (KB) guna mengerem laju pertumbuhan penduduk. Berda-

sarkan Survei Demografi dan Kesehatan Indonesia (SDKI) 2012, angka kelahiran total (total fertility rate/TFR) masih berada di angka 2,6. Angka tersebut terbilang tinggi dalam sepuluh tahun terakhir ini. “Desentralisasi menjadi salah satu penyebab tingginya TFR,” ujarnya. Dewan Penasihat Badan Dunia untuk MDGs Jeffrey Sachs mengatakan, pengurangan angka kelahiran harus menjadi agenda prioritas dalam target pembangunan berkelanjutan. Program tersebut bisa mengurangi angka kemiskinan pada tahun 2030. Menurut Sachs, dalam periode 2010–2050, populasi penduduk di negara-negara miskin diperkirakan meningkat hingga dua kali lipat. Hal ini berdampak pada aspek kesehatan, ekonomi, sosial, dan politik. Senada, Wakil Presiden Konsil Kependudukan John Bongaarts mengatakan, jika Indonesia sukses menurunkan TFR, akan lebih mudah bagi pemerintah untuk mengembangkan pendidikan, layanan kesehatan, infrastruktur, dan perekonomian secara menyeluruh. Studi juga menunjukkan bahwa kaum wanita di negara-negara dengan TFR rendah umumnya memiliki kesempatan lebih besar untuk bekerja, angka kematian ibu yang rendah, serta produktivitas dan kesehatan yang lebih baik. ●inda susanti

“Kita harus buktikan UN bisa berjalan tanpa kecurangan. UN akan semakin dihargai sehingga tata kelolanya mesti kredibel.” MOHAMMAD NUH


pokan soal ini mengikuti pendekatan The Trends in International Mathematics and Science Study (TIMSS), sehingga pemerintah dapat mengetahui di mana kelemahan dan kekuatan siswa saat ini. Mantan menkominfo ini menyatakan saat ini proses pencetakan naskah soal UN sudah berjalan, dan diharapkan se-

minggu lagi sudah selesai untuk dikirim ke kabupaten/kota. Direktur Jenderal Pendidikan Tinggi (Dikti) Kementerian Pendidikan dan Kebudayaan (Kemendikbud) Djoko Santoso menambahkan, semua PTN telah menyepakati akan menggunakan hasil UN sebagai syarat masuk universitas untuk segala jurusan. Mantan rektor ITB ini mengungkapkan, sebetulnya jalur undangan tahun ini sudah memakai hasil UN sebagai prasyaratnya. Karena itu, meskipun nilai rapor siswa itu bagus semasa di sekolah, belum jaminan lulus UN. Secara otomatis, jika tak lulus UN berarti gagal masuk PTN. Kementerian memberikan keleluasaan kepada PTN untuk membuat daftar calon mahasiswa yang masuk melalui jalur undangan. “Tujuan kami menjaring calon mahasiswa yang baik

dan berprestasi, didukung sepenuhnya oleh PTN,” tegasnya. Diketahui,tahunlalu99,50% atau sebanyak 1.517.125 siswa SMA dinyatakan lulus UN. Sementara untuk nilai UN tingkat SMK tahun lalu, siswa yang dinyatakan lulus mencapai 1.036.478 siswa atau 99,72%. Adapun UN SMP dari 3.697.865 siswa yang mengikuti UN, sebanyak 15.495 siswa dinyatakan tidak lulus, persentase kelulusan UN SMP sebanyak 99,57%. Anggota Komisi X DPR Akbar Zulfakar menilai, ujian jangan dipandang sebagai satusatunya sistem penilaian atas hasil pembelajaran atau untuk meningkatkan mutu pendidikan. Menurut dia, sebaiknya delapan standar nasional pendidikan harus dikejar untuk memperbaiki mutu pendidikan. Selain itu, pelaksanaan wajib belajar sembilan tahun juga

perlu diperbaiki bukan lagi segi kuantitasnya, melainkan kualitas. Pasalnya, persentase keikutsertaan wajib belajar saat ini sudah mendekati 100%. Anggota Komisi X DPR Raihan Iskandar berpendapat, nilai UN belum ideal sebagai tiketmasukPTN.Diamenjelaskan, dengan keragaman sekolah-sekolahyangada,baikdarisegisarana dan prasarana maupun kualitasnya, berpengaruh terhadap kualitas peserta didiknya. Menurut dia, jika UN dijadikan tiket masuk ke PTN, hanya sekolahsekolah tertentu yang memiliki peluang besar untuk diterima di PTN. “Ini menjadi tidak fair bagi siswa di Tanah Air,” tandasnya. Dia meminta pemerintah untuk mengkaji potensi manipulasi oleh guru dengan mengatrol nilai rapor siswa yang rendah. neneng zubaidah


10:46 PM

Page 6




Wali Kota Bandung Dicekal KPK Dalami Keterlibatan Pihak Lain dalam Suap Wakil Ketua PN Bandung JAKARTA – Komisi Pemberantasan Korupsi (KPK) mencekal Wali Kota Bandung Dada Rosada. Dada dicekal karena diduga mengetahui, mendengar, dan melihat kasus dugaan suap terhadap Wakil Ketua Pengadilan Negeri Bandung Setyabudi Tedjocahyono.


Kepala Bagian Humas dan Tata Usaha Direktorat Jenderal (Ditjen) Imigrasi Kementerian Hukum dan HAM Heriyanto mengatakan, pencekalan dilakukan per 23 Maret hingga enam bulan ke depan. “Ya, benar sudah dicekal berdasarkan pengajuan KPK,” kata Heriyanto saat dikonfirmasi kemarin. KPK mengirimkan surat keputusan tentang Pencegahan dengan nomor KEP 224/ 01/2013 atas nama Wali Kota Bandung Dada Rosada kepada Ditjen Imigrasi. Seiring dengan putusan ini, Ditjen Imigrasi akan menarik paspor dan melarang Dada Rosada untuk bepergian ke luar negeri guna kepentingan penyidikan KPK. Juru Bicara KPK Johan Budi SP memaparkan, pencegahan Dada Rosada ini terkait dengan pengembangan



Hakim Persoalkan Ahli dari Kejaksaan JAKARTA – Ahli dari Kejaksaan Agung yang dihadirkan pada persidangan perkara korupsi proyek bioremediasi PT Chevron Pacific Indonesia (CPI), dipersoalkan pihak terdakwa dan majelis hakim. Kapasitas ahli diragukan independensinya dan diduga pernah terkait dengan tender proyek bioremediasi Chevron di sejumlah lokasi di Riau. Kedua ahli itu adalah Edison Effendi dan Prayitno. Hotma Sitompul, penasihat hukum terdakwa Herland bin Ompo, menegaskan keberatannya terhadap dua ahli yang dihadirkan jaksa penuntut umum (JPU) dalam perkara itu. Alasannya, dua ahli itu dimintai keterangan oleh penyidik Kejagung dalam hari, tanggal, dan waktu yang bersamaan.

“Bahkan isinya, sampai titik dan komanya sama,” kata Hotma di sela-sela persidangan. Tidak hanya keberatan, Hotma juga mengancam melaporkan Edison dan Prayitno ke polisikarenatelahmemberikanketerangan palsu saat diperiksa di Kejaksaan ataupun di persidangan. Hotma juga akan mengadu ke Komisi Yudisial, Mahkamah Agung, dan ke Kejagung. “Keterangan dua saksi ini tidak dapat kami percaya. Saya tak mau dibohongi dengan keterangan dua orang ini,” ucapnya. Pada persidangan serupa yang digelar terpisah dengan terdakwa Ricksy Prematuri, status Edison sebagai ahli juga dipertanyakan. Penasihat hukum Ricksy, Najib Aligismar, mengungkapkan bahwa Edison

pernah mewakili PT Riau Kemari dalam proses tender bioremediasi di PT CPI. Namun, Effendi menegaskan bahwa posisinya di PT Riau Kemari hanya konsultan. “Tidak ada nama saya di akta perusahaan,” kelitnya. Pengakuan Effendi sempat membuat anggota majelis, Sofialdi, meradang. Pasalnya, Effendi seolah tidak mau mengakui bahwa dirinya ikut dalam proses tender bioremediasi. Terlebih lagi, Effendi sempat mengakui bahwa dirinya memang memproduksi mikroorganisme yang bisa digunakan untuk bioremediasi. Majelis pun menunjukkan absensi rapat PT Chevron yang juga dihadiri Effendi selaku wakil dari PT Riau Kemari. Namun, tetap saja Effendi berkelit. ● alif ahmad

MA Harus Terbuka terhadap Publik JAKARTA – Kepercayaan publik terhadap reformasi peradilan dinilai masih lemah. Masih banyak ditemukan putusanputusan pengadilan yang dinilai aneh dan janggal sehingga menimbulkan kecurigaan di masyarakat. Pernyataan tersebut disampaikan mantan Jaksa Agung Abdul Rahman Saleh saat menjadi pembicara dalam diskusi bertajuk “Refleksi dan Arah Pembaruan Peradilan Indonesia” di Jakarta kemarin. Menurut Rahman, banyaknya putusan aneh yang terungkap di publik, justru memunculkan kecurigaan adanya motif korupsi di balik penjatuhan putusan itu. MA, kata dia, seharusnya responsif dan segera menyikapi persoalan ini dengan mengoptimalkan fungsi-fungsi pengawasan dan pembinaan. “Setelah melaksanakan reformasi peradilan lebih dari 12 tahun, nyatanya kepercayaan publik terhadap lembaga peradilan masih lemah jika diban-




Mantan Jaksa Agung

dingkan dengan zaman Orde Lama maupun Orde Baru,” ujar Rahman. Untuk itu, dirinya memberikan saran agar MA lebih membuka pikiran dan wawasan serta masukkan dari luar. “Sudah sepatutnya memperhatikan dan melibatkan diri dalam diskusi besar, masif, dan berskala nasional dalam mendorong reformasi peradilan yang bersih, jujur, adil, dan berwibawa,” imbuhnya. Dia meminta putusan yang dijatuhkan karena motif koruptif harus dibongkar dan ditindak

tegas dengan seluruh jaringannya. Sementara itu, putusan yang kurang penguasaan terhadap substansi hukum harus diatasi berbagai pelatihan atau kursus. “Ini usaha yang never ending,” kata Abdul Rahman. Mantan Ketua MA Harifin A Tumpa mengatakan, dukungan publik terhadap jalannya reformasi peradilan harus diperjuangkan oleh para aparat peradilan sendiri. “Dukungan publik itu tidak bisa datang sendiri tanpa ada upaya para hakim sendiri,” katanya. Menurut dia, untuk meraih dukungan publik, hakim harus menjaga integritas dan perilakunya yang diwujudkan dengan sikap yang bersih, jujur, adil, dan profesional, sebab sikap bersih dan jujur masih menjadi barang langka di lembaga peradilan. Independensi hakim dinilai belum sepenuhnya terwujud karena masih ada hakim yang masih menerima suap terkait perkara yang ditangani. ●nurul adriyana

kasus penyuapan yang menyeret nama Wakil Ketua PN Bandung Setyabudi Tedjocahyono oleh KPK Jumat (23/3) lalu. KPK, kata Johan, memerlukan keterangan Dada terkait kasus ini. “Statusnya sebagai saksi,” kata Johan di Jakarta, kemarin. Pencekalan itu, ucap Johan, diperlukan agar Dada tidak sedang berada di luar negeri saat penyidik membutuhkan kesaksiannya. KPK akan segera memeriksa Dada yang dianggap mengetahui, mendengar, dan melihat kebenaran dalam kasus yang tengah disidik. Sayangnya, Johan tidak mengungkapkan kapan mantan sekretaris daerah Kota Bandung itu diperiksa. “Belum ada jadwal, namun segera kita periksa,” ujar Johan. Dalam kasus ini, KPK menangkap tangan hakim Setyabudi yang menerima uang senilai Rp150 juta dari kurir bernama Asep. Asep diduga diperintah Plt Kepala Dinas Pendapatan Daerah Kota Bandung Heri Nurhayat dan seorang pengusaha, Toto Hutagalung. Keduanya juga sudah ditetapkan menjadi tersangka. KPK, kata Johan tengah menelusuri siapa yang memerintahkan Toto untuk menyerahkan uang kepada Setyabudi. Berdasarkan penelusuran, Toto selain pengusaha merupa-

kan pimpinan Organisasi Masyarakat (Ormas) Gasibu Padjajaran. Toto juga diketahui orang dekat Wali Kota Bandung Dada Rosada. Saat ditanya apa ada keterlibatan Dada dalam kasus ini, Johan belum mengungkapnya. “Ini yang sedang dicari, apakah dia yang berinisiatif atau ada pihak-pihak lain. Ini masih didalami,” jelas dia. Johan mengatakan, KPK masih menelusuri adanya pihak lain yang memerintahkan Toto. “Apakah berhenti di TH atau ada lagi,” jelas dia.

“Ya, benar Dada Rosada sudah dicekal berdasarkan pengajuan Komisi Pemberantasan Korupsi.” HERIYANTO

Kabag Humas dan TU Ditjen Imigrasi Kemenkumham

Selain Dada, KPK juga mengajukan pencekalan untuk Toto. Johan menjelaskan, sedianya pada Jumat (22/3) atau berbarengan dengan penangkapan hakim Setyabudi serta Asep dan Heri, KPK juga akan menangkap Toto. “Tapi TH tidak ada di tempat. Nanti akan kita panggil dan diperiksa sebagai tersangka secepatnya,” tandas Johan. Ketiga tersangka, Setyabudi, Heri, dan Asep sudah ditahan. Setyabudi mendekam di Rumah Ta-

hanan Guntur, Jakarta, sedangkan Heri dan Asep di rutan KPK. Sementara Toto akan segera dijemput untuk diperiksa sebagai tersangka sebelum diajukan untuk ditahan. “Jadi, konteksnya itu dipanggil tapi suratnya dibawa langsung oleh penyidik ke yang bersangkutan, kemudian oleh penyidik diantar ke KPK,” papar dia. Johan mengungkapkan, pada operasi tangkap tangan itu, di mobil Asep KPK menemukan Rp350 juta di luar Rp150 juta yang diberikan kepada Setyabudi. Belum diketahui uang Rp350 juta itu akan diberikan kepada siapa. “Akan kita kembangkan siapa penerima yang lain,” kata Johan. Pada kesempatan terpisah, mantan Ketua Mahkamah Agung (MA) Harifin A Tumpa mengaku kecewa atas perbuatan hakim Setyabudi yang terlibat korupsi dengan menerima suap dana Bansos. Dia meminta para hakim berhenti melecehkan profesinya dalam menjalani tugasnya. “Saya berharap bahwa mudah-mudahan ini yang terakhir. Jangan lagi ada hakim yang memperjualbelikan atau pun memperdagangkan atau pun melecehkan profesinya,” kata Harifin,” di Jakarta kemarin. Harifin menilai tindakan Hakim Setyabudi telah merendahkan martabat hakim di mata publik. Perbuatan menerima suap sama halnya dengan melecehkan profesi dan menghancurkan martabatnya sebagai hakim. Untuk itu, kasus Setyabudi harus menjadi pelajaran bagi semua hakim. ●krisiandi sacawisastra

IJTI Sesalkan Perusakan Kantor TVRI Gorontalo JAKARTA – Ikatan Jurnalis Televisi Indonesia (IJTI) mengecam keras tindakan sekelompok orang yang merusak dan menduduki kantor TVRI Gorontalo, kemarin. Peristiwa perusakan tersebut diduga terkait berita Pemilihan Wali Kota Gorontalo. Selain merusak dan menduduki kantor TVRI, sejumlah orang yang mengaku dari salah satu pendukung pemilihan wali kota Gorontalo yang kalah tersebut, juga mengintimidasi sejumlah jurnalis yang sedang meliput peristiwa tersebut. Mereka juga merampas sejumlah kamera milik jurnalis ANTV, Trans 7,dan SCTV. Atas peristiwa ini, Ketua Umum IJTI Yadi Hendriana meminta aparat kepolisian segera menindak pelaku kekerasan dan perampasan alat peliputan yang terjadi dalam aksi tidak terpuji tersebut. Selain itu, aksi ini juga mengancam kerja jurnalistik, karena diduga ada pemaksaan pemuatanpernyataandaricalonwalikota yang kalah di Gorontalo untuk dinaikkan dalam berita di TVRI Gorontalo.“Iniperistiwamemalukan, terjadi tindakan biadab terhadap jurnalis,” ujar Yadi. “IJTI mendesak aparat kepolisian untuk menangkap pelaku kriminal yang telah menduduki kantor TVRI Gorontalo,” ungkap Yadi di Jakarta kemarin. Untuk menginvestigasi kasus tersebut, IJTI pusat menugaskan Ketua IJTI Gorontalo Zaenal Achmad segera memberikan advokasi yang diperlukan dalam keadaan darurat. ● alif ahmad



9:34 PM

Page 7




SEMARANG – Ratusan warga di Jawa Tengah menjadi korban penipuan biro umrah dan haji, Iqro’ Management. Kecewa karena gagal menunaikan umrah, kemarin, mereka ramairamai melaporkan Direktur Utama Iqro’ Management, Agung Akhmad ke polisi. Para korban antara lain dari Kota Semarang, Kabupaten Demak, Kendal, dan Magelang. Di Kota Semarang,ratusanjamaahkemarin melaporkan Agung Akhmad ke Polda Jawa Tengah. Langkah hukum ini terpaksa mereka lakukankarenatidakadaniatbaik dari Iqro’ Management memberangkatkan umrah ataupun mengembalikan biaya yang sudah mereka setorkan. Sebelum ke Polda Jateng, ratusan calon jamaah umrah mendatangi Kantor Iqro’ Management di Jalan dr Wahidin Nomor 58, Candisari, Gajahmungkur, Semarang. Namun , upaya menemui pimpinan Iqro’ Management tidak membuahkan hasil. Di pintu dan kaca depan tertempel kertas pengumuman bertulis “Maaf gedung ini sudahdisegelkarenaIqro’Management belum melunasi sewa”. Selain ke Polda, sebagian nasabah juga melaporkan dugaan penipuan ini ke Polsek Gajahmungkur. Meski baru berdiri kurangdarilimatahun,Iqro’Management dalam waktu cepat dapat menggaet calon jamaah umrah mencapai ratusan orang. Ini tak lepas dengan strategi investasi umrah, seperti sistem titipan uang dengan bagi hasil.

Seperti model reward umrah dengan titipan minimal Rp10 juta, maka calon jamaah akan mendapat dana bagi hasil setara 1,3% per bulannya. “Kami akan bekerja sama dengan Polrestabes Semarang dan berkoordinasi dengan Polda Jateng terkait kasus dugaan penipuan itu agar cepat diproses dan ditindaklanjuti,” ujar Kapolsek Gajahmungkur Kompol Eva Guna Pandia.

“Tapi sampai Jakarta, tidak ada kejelasan dan kami terpaksa kembali lagi ke rumah alias tidak jadi berangkat,” SURYATI

Calon jamaah asal Magelang

Di Magelang, sedikitnya 73 calon jamaah umrah juga mendatangi kantor Iqro’ Management di kompleks Ruko Singosari, Kampung Karang Gading, Kelurahan Rejowinangun Utara, Kota Magelang. Tutut,39, salah seorang na-

sabah, mengaku ditipu karena berangkat umrah yang dijanjikan Iqro’ Management tidak terpenuhi hingga batas waktu terakhir. Padahal, dia sudah membayar melunasi biaya umrah bersama tiga keluarganya sebesar Rp48,5 juta. “Agustus 2012 lalu, saya melunasi biaya umrah dan dijanjikan berangkat pada 21 Februari 2013. Tapi jadwal diundur dan sampai sekarang belum jelas,” katanya kemarin. Suryati, 50, nasabah lainnya asal Grabag, menyatakan bersama suami terpaksa menahan kecewa dan malu karena tidak jadi berangkat umrah. Pada 5 Maret lalu, dia sudah ke Jakarta untuk ke Tanah Suci esok harinya. “Tapi sampai Jakarta, tidak ada kejelasan dan kami terpaksa kembali lagi ke rumah alias tidak jadi berangkat,” paparnya. Ketua Bimbingan Umrah Lukman Hakim mengatakan, pihaknya sudah berulang kali mencoba menghubungi Direktur UtamaIqro’ManagementAgung Akhmad yang berkedudukan di kantor pusat di Jalan Gajah Birowo, Tlogosari Kulon, Semarang. “Namun memang tidak ada jawaban,” jelasnya. Salah seorang nasabah asal Kendal, Slamet Askini, 65, me ngungkapkan, beberapa waktu lalu dia didatangi petugas dari sebuah bank yang memintanya untuk melunasi utang Rp25 juta. Padahal, uang biaya naik haji Rp50 juta sudah dibayar lunas ke pihak Iqro’ Management. amin fauzi/ wikha setiawan


Biro Umrah Tipu Ratusan Orang

GUNUNG LOKON MELETUS Gunung Api Lokon mengeluarkan debu vulkanik serta lava di Kota Tomohon, Sulawesi Utara, kemarin. Letusan disertai dentuman kuat terdengar hingga radius 5 km. Adapun lontaran material terjadi pada pukul 05.10 Wita setinggi 2.000

Feri Ditabrak, 4 Mobil Tenggelam KUTAI KARTANEGARA – Empat mobil tenggelam di perairan Sungai Mahakam, tepatnya di Desa Perjiwa, Tenggarong Seberang, Kabupaten Kutai Kartanegara, Kalimantan Timur, akibat feri yang mengangkut kendaraan itu kemarin ditabrak kapal barang. Beruntung 10 penumpang dan anak buah kapal selamat dalam peristiwa ini. Kecelakaan ini terjadi sekitar pukul 11.00 Wita saat feri penyeberangan yang terbuat dari kayu, KM Mitra 1, berangkat dari Dermaga Pasar Seni, Tenggarong hendak me-

nyeberangi Sungai Mahakam menuju Desa Perjiwa. Saat Mitra 1 hampir sampai di dermaga tujuan, sebuah kapal barang yang juga terbuat dari kayu, KM Rahmat B7, dari arah Samarinda hendak menuju Hulu Mahakam menabrak bagian belakang Mitra 1. Akibatnya Mitra mengalami kebocoran pada bagian yang ditabrak dan tenggelam. Berdasarkan informasi yang dihimpun di lokasi kejadian, saat Mitra tenggelam, ABK kapal melempar semua alat keselamatan untuk digunakan. Tidak hanya baju pelampung, jeri-

ken kosong juga dilemparkan agar penumpang bisa memanfaatkannya. Berkat bantuan beberapa kapal yang bergerak cepat menuju lokasi kecelakaan, seluruh penumpang bisa diselamatkan. “KM Mitra 1 sudah berusaha mempercepat kapalnya, namun upaya itu meleset. KM Rahmat B7 akhirnya menabrak bagian belakang kapal feri,” kata Kasubbag Humas Polres Kutai Kartanegara AKP Suwarno. Polres Kukar memeriksa juragan KM Rahmat B7 atas nama Hamzan dan juragan KM Mitra

1 atas nama Anwar Efendi. Selain keduanya, Polres Kukar juga memeriksa awak kapal kedua kapal tersebut. Belum diketahui pasti penyebab tabrakan tersebut, termasuk total kerugian. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Kabupaten Kutai Kartanegara Daramansyah membenarkan tidak ada korban jiwa pada tabrakan ini. Hingga sore kemarin, satuan tugas BPBD Kutai Kartanegara masih berupaya mengevakuasi keempat mobil yang tenggelam tersebut. awwaluddin jalil/ ant

2013, Tahun Bekerja Secara Fleksibel M

eneruskan tren bisnis di tahun 2012, diperkirakan pada tahun 2013 ini penggunaan ruang kantor yang fleksibel tetap akan menjadi pilihan bagi para pebisnis. Semakin banyak perusahaan yang memilih untuk tidak terikat pada kontrak sewa ruang kantor jangka panjang dengan ruang-ruang yang besar yang tentunya membutuhkan biaya besar.

Tren bekerja secara fleksibel dan prospeknya Ada banyak elemen yang mendukung aspirasi untuk ruang kantor yang lebih fleksibel, di antaranya: Lebih banyak orang yang bekerja secara berpindah Keinginan perusahaan untuk mengurangi pengeluaran bagi penyewaan properti Meningkatkan produktivitas karyawan dengan tidak membuang waktu di jalan Kebutuhan untuk lebih cepat tanggap dalam meraih kesempatan baru atau cepat berpindah dari pasar yang kurang menguntungkan Iklim ekonomi yang masih belum stabil Hasilnya, semakin banyak perusahaan di banyak negara menginginkan akses pada tempat berbisnis yang fleksibel

– mungkin untuk 1 (satu) orang atau bahkan mungkin untuk seluruh tim. Regus telah lama mengerti dan melayani kebutuhan semacam itu, dengan terus menerus membuka ruang kantor fleksibel di lokasi yang dibutuhkan oleh para pebisnis. Kurang lebih telah satu dekade Regus memperluas jaringannya di 16 negara Asia Pasifik, sekarang telah menjangkau Kamboja, Srilangka, Jepang hingga Selandia Baru. Di tahun 2013 ini, ekspansi Regus di Asia Pasifik bertambah satu negara lagi yaitu Nepal. Sementara itu, khusus di Indonesia, Regus juga akan memperluas jaringan dengan penambahan setidaknya 10 lokasi baru, dari 7 lokasi yang telah ada sekarang.

Tantangan fleksibilitas bisnis pemula dan UKM Pada bisnis pemula dan UKM, fleksibilitas adalah menjadi sangat penting terutama dalam menghadapi berbagai tantangan yang umum dihadapi oleh bisnis berskala kecil – seperti aliran uang tunai, layanan administratif, penambahan tenaga kerja hingga perencanaan bisnis ke depan. Di Asia Pasifik, 60% perusahaan berpendapat bahwa biaya layanan administratif dan properti adalah tantangan terbesar mereka. Solusi menggunakan ruang kantor yang fleksibel dapat membantu mengatasi kedua tantangan terbesar tersebut, dan Regus hadir sebagai partner yang tepat untuk memberi fasilitas terbaik. Salah satu daya tariknya adalah Regus memiliki jenis produk dan layanan yang dapat mendukung bisnis pemula dan UKM sejalan dengan perkembangan bisnisnya. Bahkan, produk Regus begitu fleksibel hingga pebisnis tidak perlu menggunakan ruang kantor secara fisik sama sekali, mereka dapat memulai

dengan yang paling sederhana seperti layanan menjawab telepon dari produk Regus Virtual Office. Para pemilik bisnis dapat dengan leluasa memusatkan perhatian pada perkembangan perusahaan dan peningkatan penjualan, sementara staf Regus secara profesional akan menangani surat menyurat bisnis, menjawab telepon atas nama perusahaan, menyediakan dukungan administrasi sesuai permintaan dan tentunya menyediakan alamat bisnis yang bergengsi sebagai daya jual perusahaan. Uniknya, Regus virtual office tidak hanya menawarkan koneksi di Indonesia tapi juga di seluruh Asia Pasifik, yang memungkinkan perusahaan berskala kecil untuk memiliki imej bergengsi dengan biaya yang sangat minim.

Sarana untuk berkembang Mengikuti lajunya pertumbuhan perusahaan, banyak bisnis yang pada akhirnya berkembang pesat dan

membutuhkan ruang kantor fisik di Regus. Dengan menyewa ruang kantor di lokasi yang sama dengan virtual office artinya perusahaan tidak harus mengganti alamat, ini hal yang penting untuk diperhitungkan pada saat awal pemilihan lokasi. Pada semua produk yang ditawarkan oleh Regus, tidak ada keharusan untuk komitmen jangka panjang atau anggaran besar. Perusahaan dapat memilih untuk menggunakan sesuai kebutuhan, sesuai anggaran dan pada waktu yang leluasa. Tanpa kehilangan fleksibilitas, dukungan layanan terbaik, kesempatan untuk memperluas jaringan dan terbukanya akses ke jaringan internasional dengan sistem kerja profesional. Tidak jauh berbeda dengan apa yang sudah terjadi di tahun 2012, pada tahun 2013 ini prospek ekonomi akan tetap mengalami ketidakpastian. Tentu akan ada berita baik dan optimis tetapi juga akan muncul tantangan. Pada situasi semacam ini, tidaklah mengejutkan

bahwa ruang kantor yang fleksibel tetap menjadi tren karena tidak peduli seberapa besar tingkatan perusahaan Anda alternatif tersebut dapat membantu Anda menjalankan bisnis secara maksimal dengan biaya minimal. [**/Info]

Cari tahu lebih lanjut mengenai fleksibilitas bekerja di kantor Regus: Menara BCA Lt. 50, Menara Standard Chartered Lt. 30, Tempo Scan Tower Lt. 32, Menara Kadin Lt. 30, Wisma Metropolitan I Lt. 3A, Ciputra World One Office Tower Lt. 28. Dapat juga klik atau hubungi (021) 2555 5700.



11:16 PM

Page 8






Massa Blokade Stasiun Bekasi

Aksi massa saat memblokade Stasiun Bekasi, kemarin. Blokade dilakukan untuk menolak penghapusan KRL Ekonomi. Unjuk rasa ini menyebabkan 20 perjalanan KRL dibatalkan.


Aksi massa untuk menyuarakan tuntutan mereka makin tidak terkendali. Sebelumnya para buruh memblokade tol, dan kemarin ribuan orang memblokade jalur di Stasiun Bekasi. Aksi menutup fasilitas umum ini tak urung mengganggu perjalanan KRL maupun KA jarak jauh. Perjalanan ribuan warga pun terganggu. Perlu ketegasan dari aparat keamanan agar unjuk rasa tidak mengganggu aktivitas warga.

25 Mar 2013


Ribuan orang memblokade Stasiun Bekasi, Senin (25/3) sekitar 4,5 jam. Aksi ini sebagai aksi menolak penghapusan KRL Ekonomi Bekasi-Jakarta dan Serpong-Jakarta pada 1 April 2013.

27 Januari 2012 ribuan buruh Kabupaten Bekasi melakukan aksi demonstrasi. Mereka memblokade Tol Jakarta-Cikampek, menimbulkan kemacetan panjang, bahkan berimbas ke beberapa akses jalan lain. Aksi buruh dipicu putusan PTUN Bandung yang memenangkan gugatan Apindo Bekasi. Malam harinya tercapai kesepakatan antara buruh dan pengusaha.

Forum Aliansi Rakyat Bersatu Pengguna Kereta Api Ekonomi dan commuter line Indonesia Bersatu itu melumpuhkan aktivitas stasiun sejak pukul 06.30 WIB dengan menduduki lima jalur. Blokade baru berakhir pukul 10.30 setelah tuntutan pengunjuk rasa secara tertulis diterima PT Kereta Api Indonesia (KAI). Tuntutan pengunjuk rasa yakni dibatalkannya penghapusan KRL Ekonomi, menambah jadwal perjalanan KRL Ekonomi, penurunan tarif KRL commuter line, hapus sistem transit, dan semua KRL Ekonomi berhenti di Stasiun Bekasi. Blokade membuat sekitar 20 perjalanan KRL Ekonomi dan KRL commuter line batal diberangkatkan. KA ekonomi, bisnis, dan eksekutif jarak jauh tujuan Jawa Barat, Yogyakarta, Jawa Tengah, dan Jawa Timur juga tertunda kedatangan serta keberangkatannya.



Pembongkaran kios PKL di Stasiun Pondok Cina, Beji, Depok, berlangsung ricuh. Bentrokan terjadi antara petugas PT Kereta Api Indonesia (KAI) dengan mahasiswa Universitas Indonesia (UI) dan pedagang yang tak ingin lapak mereka digusur.

4 Mei 2012

Massa menghadang KA RangkasbitungPasar Senen di Stasiun Daru, Tangerang. Aksi ini untuk menolak rencana PT KAI yang tidak memberhentikan kereta di beberapa stasiun.

Blokade mulai pukul 12.00-17.15 WIB. Aksi untuk menolak pembongkaran kios pedagang juga diwarnai bentrokan. Aksi dilakukan karena pembongkaran dilakukan tanpa dialog dengan para pedagang dan mahasiswa.

Gugatan Apindo diprotes Buruh


Dalam aksinya, mereka berdiri di tengah rel dan menaruh kayu serta beton secara melintang di atas rel.

memutuskan kebijakan itu. Ditanya kerugian akibat aksi blokade, Agus mengaku tidak mengetahuinya. PT KAI masih menghitung kerugian akibat blokade tersebut. ”Kemungkinan kerugiannya berdampak sangat banyak,” ujarnya. Setelah kesepakatan itu ada, akhirnya massa perlahan membubarkan diri. Sementara puluhan anggota kepolisian masih berjagajaga. Bahkan, sekitar 50 anggota Brimob bersenjata lengkap diturunkan untuk mengamankan jalannya aksi itu. Para anggota Brimob tersebut tampak siaga di peron, tepat di atas para pengguna KRL yang menduduki rel lintasan 1, 2, dan 3. Namun, mereka hanya memantau dan berjaga agar unjuk rasa itu tidak berubah anarki. ”Kita siagakan puluhan anggota Brimob dan Dalmas di lokasi untuk menjaga adanya tindakan anarkis. Tapi aksi ini berjalan damai,” kata Kabag Operasional Polresta Bekasi Kota Kompol Victor Alexander. 20 Perjalanan Dibatalkan Aksi itu membuat KA Ekonomi lokal khusus yang sedianya hanya melintas di jalur 1 menjadi tertahan.


Kabid Humas Polda Metro Jaya

Tercatat, blokade ini membuat sekitar 20 perjalanan KRL ekonomi dan KRL commuter line batal diberangkatkan. KA ekonomi, bisnis, daneksekutifjarakjauhtujuanJawa Barat, Yogyakarta, Jawa Tengah, dan Jawa Timur juga tertunda kedatangan serta keberangkatannya. Leonardus,koordinatoraksi,mengatakan bahwa blokade ini sebagai bentuk penolakan rencana penghapusan KRL ekonomi. Menurutnya, penghapusan KRL ekonomi menegaskan bahwa pemerintah tidak berpihak kepada rakyat miskin. Leonardus mengingatkan, tarif

KRL ekonomi Rp1.500– 2.000, sementara KRL commuter line Rp8.500– 9.000. Untuk itu, dia mendesakagarKRLekonomitetap dijalankan. Jika dihapuskan, tarif KRL commuter line harus diubah paling mahal Rp3.500. Jika tidak ada solusi, Leonardus mengancam bahwa massa yang lebih banyak akan melakukan aksi lebih besar lagi. Menurutnya, KRL ekonomi bisa membantu masyarakat miskin. ”Kalau tetap dihapus pada 1 April mendatang, tiga hari mendatang kita akan lakukan blokade lebih besar,” tegasnya. Aksi blokade juga memaksa ribuan calon penumpang KRL ekonomi dan KRL commuter line batal berangkat. Penumpang akhirnya berpindah angkutanlain. Ada yang naik, angkot, minibus, dan bus. Bahkan, tidak sedikit calon penumpang yang bekerja di Jakarta kembali lagi ke rumah. Humas PT KAI Daop I Jakarta Agus Sutijono menuturkan, penghapusan KRL ekonomi dilakukan karena PT KAI mencatat telah terjadi 4.400 kali gangguan jadwal pemberangkatan kereta selama 2012 akibat kerusakan mesin. Ini akibat KRL ekonomi memang sudah sangat tua usianya. Menurut dia, PT KAI saat ini memiliki sembilan rangkaian KRL ekonomi, yang terdiri atas tujuh rangkaian untuk trayek Jakarta– Bogor, satu rangkaian Jakarta–


Ribuan buruh Kabupaten Bekasi, Jawa Barat, menutup tujuh akses pintu tol kawasan industri hingga mengakibatkan kemacetan lalu lintas di tol JakartaCikampek hingga 22 km.

Apindo Kabupaten Bekasi bersedia mencabut gugatan terkait UMK. Pencabutan gugatan akan dilakukan Kamis, 19 Januari 2012. Keputusan tersebut disampaikan dalam pertemuan antara Apindo dengan perwakilan buruh.

26 Jan 2012 PTUN Bandung mengabulkan gugatan Apindo Bekasi. Dalam amar putusannya, PTUN memerintahkan gubernur Jabar mencabut SK Gubernur Jawa Barat Nomor 561/Kep.1558-Bansos/2011 dan menggantinya dengan SK baru.

Serpong, dan satu rangkaian Jakarta–Bekasi. ”Gangguan jadwal itu kerap berdampak luas ke sejumlah stasiun lainnya,” jelasnya. Kerusakan mesin KRL ekonomi kerap terjadi karena hampir seluruh rangkaian suku cadangnya dipasang secara kanibal. Menurut Agus, pihaknya sudah kesulitan memperoleh suku cadang baru dari produsen di Jepang. Langkanya suku cadang itu membuat PT KAI memutuskan KRL ekonomi dihapus. Jika dipaksakan beroperasi, biaya perawatannya bisa lebih mahal. ”Kami juga melihat keselamatan pengguna jasa kereta,” terangnya. Manajer Komunikasi PT KAI Commuter Jabodetabek (KCJ) Eva Chairunisa mengatakan, yang harus dipahami masyarakat saat ini kondisi KRL ekonomi sudah renta. Suku cadang KRL ekonomi juga sudah tidak ada lagi. Karena itu, tidak ada upaya lain selain mengganti KRL ekonomi dengan KRL commuter line. ”Penggantian kereta ekonomi mutlak dilakukan agar tidak mengganggu

perjalanan kereta, sebab saat ini kereta ekonomi kerap mengalami gangguan,” tuturnya. Para pengunjuk rasa yang melakukan tindakan anarkistis dan mengganggu ketertiban masyarakat akan ditindak tegas dan bisa dikenai pasal pidana. Kabid Humas Polda Metro Jaya Kombes Pol Rikwanto mengatakan, setiap orang yang menyampaikan pendapat di muka umum harus menghormati menjaga keamanan dan ketertiban umum. Terkait blokade Stasiun Bekasi, Polda Metro Jaya masih mengusut insiden tersebut. ”Koordinatornya sedang kita periksa, apa maksud dan tujuannya melakukan penutupan rel tersebut,” ujarnya. Menurutnya, bila memang ditemukan ada pelanggaran maka tidak menutup kemungkinan akan berlanjut ke tingkat penyidikan. Selain itu, pihaknya juga akan menyelidiki apakah ada paksaan dalam unjuk rasa tersebut. Seandainya ada maka provokatornya bisa dituntut. ●abdullah m surjaya/ helmi syarif/ridwansyah

Sumber: Diolah KORAN SINDO

Kemenhub Tolak Penghapusan KRL Ekonomi JAKARTA – Direktorat Jenderal Perkeretaapian Kementerian Perhubungan (Kemenhub) menolak rencana PT Kereta Api Indonesia (KAI) menghapuskan KRL ekonomi. Penolakan itu disampaikan melalui surat Direktur Jenderal Perkeretaapian kepada PT KAI. ”Dalam surat tersebut dinyatakan bahwa kereta (KRL) tetap dioperasikan sesuai slot waktu pada lintas pelayanan saat ini,” kata Kepala Pusat Komunikasi Publik Kemenhub Bambang S Ervan saat dihubungi KORAN SINDO di Jakarta kemarin. Dia mengatakan, layanan KRL ekonomi tetap diberikan kepada masyarakat. Menurut dia, pernyataan PT KAI yang menganggap KRL ekonomi sudah tidak layak tidak boleh dija-

dikan alasan untuk menghilangkan pelayanan KRL ekonomi. ”Masalahnya dikatakan tidak layak karena selama ini perawatannya juga tidak benar, sehingga kinerjanya juga tidak maksimal,” ujarnya. Dia menegaskan, PT KAI bersama Direktorat Jenderal Perkeretaapian hanya perlu duduk bersama menghitung biaya yang dikeluarkan untuk pengoperasian KRL ekonomi. ”Sebab selama ini kereta kelas ekonomi itu disubsidi melalui skema public serviceobligation(PSO),”ucapnya. Komisi V DPR Sigit Sosiantomo meminta PT KAI mempertimbangkan rencana penghapusan KRL ekonomi. Alasannya, penghapusan tersebut merupakan wewenang pemerintah, bukan PT KAI. ”Kalau

Dalam surat tersebut dinyatakan bahwa kereta (KRL) tetap dioperasikan. ISTIMEWA

Massa demonstran menamakan diri Forum Aliansi Rakyat Bersatu Pengguna Kereta Api Ekonomi dan Commuter Line Indonesia Bersatu itu melumpuhkan aktivitas stasiun sejak pukul 06.30 WIB, dengan menduduki lima jalur dan memberhentikan KA ekonomi lokal khusus dari Cikampek. Blokade baru berakhir pukul 10.30 setelah tuntutan pengunjuk rasa secara tertulis diterima PT Kereta Api Indonesia (KAI). Tuntutan pengunjuk rasa yakni dibatalkannya penghapusan KRL ekonomi, menambah jadwal perjalanan KRL ekonomi, menurunkan tarif KRL commuter line, menghapus sistem transit, serta semua KRL ekonomi berhenti di Stasiun Bekasi. Kerumunan massa mencair setelah blokade sekitar 4,5 jam. Saat itu PT KAI, Kapolresta Bekasi Kota, dan Dandim 0507 Bekasi menyepakati serta menampung semua tuntutan masyarakat Bekasi. ”Kita tampung tuntutan mereka dahulu,” kata Hariyanto kemarin. Kepala Humas PT KAI Daerah Operasi (Daop) I Jakarta Agus Sutijono akan membawa keluhan penumpang ke direksi PT KAI. Pasalnya, pihaknya tidak bisa

KRL commuter line di jalur 2 juga batal berangkat menuju Jakarta. Bahkan, KA Ekonomi jurusan Purwakarta–Jakarta nyaris mengalami kecelakaan akibat berhenti secara mendadak. Pasalnya, seorang pengguna KRL tiba-tiba saja melempar sebuah tong besi dan besi ke arah relsehingga akhirnya kereta berhenti mendadak di jalur 1.


BEKASI – Ribuan orang memblokade Stasiun Bekasi selama 4,5 jam, kemarin. Blokade ini dilakukan untuk menolak rencana penghapusan KRL Ekonomi Bekasi– Jakarta dan Serpong–Jakarta pada 1 April 2013.

Blokade berakhir setelah PT KAI melakukan mediasi serta memberikan jaminan kepada pedagang dan mahasiswa.

19 Jan 2012

16 Jan 2012

Sedikitnya sebanyak 93 perjalanan KRL Jakarta-Bogor dan sebaliknya dibatalkan.

14 Jan 2013

11 Jan 2012

Ribuan buruh menggelar aksi unjuk rasa di depan Gerbang Tol Cibitung Kawasan MM 2100, Kabupaten Bekasi. Akibatnya terjadi kemacetan di tol Jakarta-Cikampek hingga 10 km.

mau dihapus, juga harus mempertimbangkan kondisi perekonomian dan daya beli masyarakat khususnya untuk masyarakat kecil,” tuturnya. Komisi V sendiri tetap mendukung rencana PT KAI meningkatkan kualitas layanan, salah satunya mengganti KRL eko-

BAMBANG S ERVAN Kepala Pusat Komunikasi Publik Kemenhub

nomi menjadi KRL commuter line. Namun, kebijakan itu harus tetap mempertimbangkan daya beli masyarakat. ”Kalau masih banyak masyarakat yang tidak mampu dengan tarif single class yang akan diterapkan, ya harus ditunda dulu,” ucapnya. Di sisi lain, Sigit menilai

penghapusan KRL ekonomi menjadi single class melanggar UU No 23/2007 tentang Perkeretaapian yang mengatur tentang wewenang kereta api berada di tangan pemerintah. Menurutnya, selama masyarakat belum mampu maka kelas ekonomi harus tetap ada sebagai bentuk pelayanan publik. Jika pemerintah ingin menghapuskan kelas ekonomi, kata Sigit, harus ada dasar yang jelas dan survei yang mendukung bahwa masyarakat sudah mampu membayar tarif yang ditetapkan PT KAI. Sigit mengaku banyak mendapat laporan dari pengguna kereta mengenai layanan PT KAI yang diskriminatif antara kelas ekonomi dengan kelas bisnis/eksekutif. Pengurus Harian Yayasan

Lembaga Konsumen Indonesia (YLKI) Tulus Abadi mengungkapkan, PT KAI dan Kemenhub bersama DPR harus duduk bersama menyelesaikan permasalahan KRL ekonomi. Dia juga menerangkan, kereta api merupakan urusan regulator dan PT KAI juga tidak berhak menghapus kereta ekonomi tanpa persetujuan pemerintah dan DPR. Namun, regulator juga tidak bisa membiarkan kereta ekonomi yang sudah tidak layak. Pasalnya, masyarakat perlu pelayanan memadai dengan harga murah. ”Pemerintah ada PSO. Nah, itu yang wajib diawasi penggunaannya. Apakah anggaran PSO sudah sesuai dengan kualitas layanan dan jumlah kereta ekonomi yang ada,” jelasnya. ● ichsan amin



8:05 PM

Page 10




JAKARTA – Sistem contra flow (lawan arus) yang diberlakukan di ruas tol dalam kota Grogol hingga Slipi, Jakarta Barat, mulai kemarin belum berjalan optimal. Sejumlah pengendara masih enggan menggunakan sistem tersebut. Akibatnya, kepadatan kendaraan di jalan tol tidak terelakkan. Lalu lintas baru lancar selepas jalur contra flow di depan RS Kanker Dharmais, Jakarta Barat. Pantauan KORAN SINDOdi lapangan menunjukkan, beberapa kendaraan sudah menggunakan jalur contra flow yang berada di sisi kanan. Mereka diarahkan para petugas dari kepolisian dan PT Jasa Marga yang berjaga di sepanjang jalur tersebut. Namun, kendaraan yang menggunakan jalur reguler tetap banyak sehingga lalu lintas tersendat. Kepala Bagian Komunikasi Perusahaan PT Jasa Marga Wasta Gunadi mengatakan, banyak pengendara yang belum menggunakan contra flow. Wasta menduga para pengendara khawatir melintas. “Banyak yang belum tahu nanti pintu keluarnya (contra flow) di mana, sehingga takut menggunakannya,” kata Wasta kemarin.

Pihaknya optimistis beberapa hari ke depan masyarakat makin banyak menggunakan jalur contra flow sehingga bisa mengurai kepadatan lalu lintas. “Seperti pada jalur Cawang– Semanggi (contra flow) dulu juga banyak yang tidak menggunakan, tapi setelah seminggu, baru banyak yang melintasnya,” paparnya. Wasta memastikan sistem contraflowhanya berlaku sementara sebagai alternatif jangka pendek. “Kalau JORR W2 misalnya sudah rampung maka volume kendaraan yang masuk ke tol dalam kota juga akan berkurang. Dan, contra flow tidak perlu lagi diterapkan,” terangnya. JORR W2 menghubungkan Kembangan, Jakarta Barat dan Ulujami, Jakarta Selatan dan ditargetkanselesaiawal2014.“Jika sudah jadi, warga yang ingin ke bandarapuntidakperlumelintas di pusat kota,” tambahnya. Kasubdit Patroli Jalan Raya

(PJR) Polda Metro Jaya AKBP Jazari mengatakan, pelaksanaan uji coba hari pertama masih banyak pengendara yang kebingungan. Namun, hal tersebut tidak menjadi masalah karena sudah diantisipasi oleh pihaknya. “Masih banyak yang kebingungan, tapi kita sudah siapkan petugas di setiap persimpangan untuk masuk dan keluar jalur contra flow,” katanya.

“Banyak yang belum tahu nanti pintu keluarnya (contra flow) di mana, sehingga takut menggunakannya.” WASTA GUNADI

Kepala Bagian Komunikasi Perusahaan PT Jasa Marga

Selanjutnya, pihaknya akan melakukan evaluasi setelah pelaksanaan uji coba selesai pada 28 Maret mendatang. Pihaknya menyarankan pengendara yang masuk jalur contra flow agar menyalakan lampu. Pengamat transportasi dari

Universitas Gadjah Mada (UGM) Danang Parikesit menjelaskan, contra flow yang diterapkan PT Jasa Marga merupakan sistem lama yang digunakan untuk mengurangi volume kendaraan di ruas jalan tertentu. “Tujuannya agar beban volume kendaraan bisa dibagi,” jelas Danang. Menurut dia, sistem ini cukup efektif untuk mengatasi kemacetan dikarenakan mampu mengurangi kepadatan kendaraan hingga 15–20%. Hanya, lanjut Danang, contra flow memiliki kelemahan dalam pelaksanaan, termasuk laju kendaraan yang dibatasi serta faktor keamanan, karena melintas di jalur cepat yang saling berlawanan. “Sangat berbahaya sekali karena itu faktor safety harus dipastikan,” imbuhnya. Ketua MasyarakatTransportasi Indonesia (MTI) ini menyarankan petugas menyediakan sarana dan kelengkapan alat yang mendukung pengendara untuk melintas di jalur contra flow agar aman dan nyaman. “Rambunya harus jelas. Bukan hanya sekadar segitiga pembatas saja, tetapi juga ada rambu yang dapat menyala untuk menuntun pengendara,” ucapnya. Meskipun demikian, Danang juga mengingatkan bahwa



Pengendara RaguIkuti Contra Flow

Kendaraan melintas di ruas berlawanan saat pemberlakukan contra flow di tol dalam kota kawasan Grogol (foto kiri) dan kawasan Tomang, Jakarta Barat, kemarin (foto kanan). Pemberlakuan contra flow untuk mengurai kemacetan di Ibu Kota hingga 15%.

sistem ini bukanlah langkah jangka panjang yang efektif untuk mengurai kemacetan di jalan tol. Menurutnya, jika penambahan kendaraan khususnya roda empat yang menggunakan jalan tol tidak dikendalikan maka sistem contra flow menjadi tidak berguna dan tetap akan menimbulkan kemacetan. “Pemerintah harus bisa menyediakan angkutan massal itu yang murah dan nyaman. Jika tidak, contra flow hanya akan bertahan paling lama tiga

tahun saja,” tandasnya. Direktur Institut Studi Transportasi (Instran), Darmaningtyas mengatakan, kebijakan contra flow untuk memperlancar lalu lintas di jalan tol tidak selamanya efektif. Sebab, jumlah kendaraan di Jakarta terus bertambah setiap harinya. Namun untuk saat ini kebijakan itu masih cukup efektif, karena belajar dari pengalaman sebelumnya di jalur JakartaTangerang). Contra flow sangat membantu pengendara hingga

akhirnya pengelola jalan tol menerapkannya di ruas lainnya. Ke depannya, agar jalan tol bisa lebih lancar dan kemacetan dapat berkurang, operator jalan tol menerapkan tarif berbeda. Ketika jam sibuk diterapkan tarif sangat tinggi. ”Sehingga pemilik kendaraan mengatur waktu perjalanannya, ketika penggunaan jalan tol mulai berkurang atau tidak sesibuk saat jam kerja,” terangnya.  dian ramdhani/ helmi syarif


8:40 PM

Page 11




BEKASI – Karyawan SPBU yang hendak menyetorkan uang ke bank kembali menjadi sasaran perampok. Kali ini Ponijan, 26, karyawan SPBU 34-171114, harus merelakan uang Rp81 juta milik tempatnya bekerja dibawa kabur perampok bersenjata api. Aksi perampokan ini terjadi di Jalan Bambu Kuning RT 01/02, Rawalumbu, Kota Bekasi, kemarin pagi. Alan Winarya, 23, mengatakan, perampokan itu berlangsung sangat cepat. Dia dan sejumlah warga yang melihat kejadian itu awalnya mengira terjadi keributan sesama pengendara sepeda motor. Namun, korban yang seorang diri itu berteriak meminta pertolongan hingga warga pun menyadari telah terjadi perampokan. ”Pelaku itu mengacungkan senjata api, jadi warga tidak ada yang berani mendekat,” kata lelaki yang membuka warung 50 meter dari lokasi perampokan ini. Menurutnya, sejumlah warga berani melempar beberapa batu ke arah perampok. Sayangnya tidak ada satu pun yang mengenai pelaku. Para pelaku bergegas kabur setelah berhasil membawa tas ransel milik korban. Kapolsek Bekasi Timur Kompol Suyud menerangkan, perampokan ini bermula ketika korban yang mengendarai sepeda motor Suzuki Shogun hendak menyetorkan uang penjualan BBM. Tanpa mendapatkan pengawalan, pemuda ini tanpa curiga

melajukan sepeda motornya sambil membawa uang Rp81 juta di dalam ransel.

”Pelaku enam orang, mereka mengenakan helm dan penutup wajah.” KOMPOL SUYUD

Kapolsek Bekasi Timur

Sekitar 300 meter dari SPBU Sepanjang Jaya tempat korban bekerja, tiba-tiba saja tiga sepeda motor memepet sepeda motor korban. Salah satu pelaku bahkan menendang sepeda motor bernopol B 6124 KFB yang dikendarai karyawan SPBU itu. Ponijan pun terjatuh dari sepeda motornya. Kesempatan ini dimanfaatkan dua pelaku turun dan menghampiri korban. Sejumlah saksi melihat dua pelaku itu mengacungkan senjata api dan sebilah pedang. Pelaku yang membawa pistol menodong korban dan dengan cepat merampas tas berisi uang itu. ”Pelaku enam orang, mereka

mengenakan helm dan penutup wajah. Dugaan kami, pelaku telah membuntuti korban sesaat setelah keluar dari SPBU,” terang Kompol Suyud kemarin. Menurut Suyud, sebelumnya para pelaku diduga telah mengetahui bahwa manajemen SPBU akan menyetorkan uang kemarin. Perampokan terhadap karyawan SPBU yang hendak menyetorkan uang telah terjadi berulang kali. Pada 15 Februari lalu, Iim Permana, 35, karyawan SPBU 34-13403 di Jalan Raya Pondok Bambu, Duren sawit, Jakarta Timur, menderita luka tembak di bagian kakinya. Perampokan ini bermula saat karyawan SPBU lain yakni Jumari, 46, hendak menyetorkan uang Rp115 juta dan giro Rp7 juta ke sebuah bank di seberang SPBU tersebut. Pelaku berjumlah empat orang hendak mengambil tas yang dipegang Jumari. Selanjutnya Jumari melemparkan tas berisi uang kepada Iim yang berada di belakangnya. Salah seorang pelaku berperawakan gendut tiba-tiba saja membacok tangan Iim. Setelah Iim dibacok, pelaku lain menembakkan pistol ke kaki Iim. Uang Rp115 juta dan giro Rp7 juta dibawa kabur pelaku. Pada 22 Januari, dua karyawan SPBU dan seorang anggota TNI yang hendak menyetorkan uang Rp634 juta tak berkutik ketika para perampok menghadang mobil yang mereka gunakan. Perampokan ini terjadi di Jalan Rawamangun Muka, Pulogadung, Jakarta Timur. abdullah m surjaya


Lagi, Karyawan SPBU Dirampok

Warga mengantre untuk membeli KORAN SINDO di mobil promo Semangat Baru di kawasan Jalan Sudirman, Jakarta, kemarin. Selain mendapatkan koran, warga yang membeli koran di mobil promo ini juga mendapatkan sarapan gratis.

Mobil Semangat Baru Hadirkan Menu Baru JAKARTA – Terhitung sejak 1 Maret2013,harianSeputarIndonesia telah berganti nama dan logo menjadi KORAN SINDO. Bersamaan rejuvenasi tersebut, KORAN SINDOmelangsungkan gerakan Generasi Semangat Baru KORAN SINDO. Salah satunya yaitu kegiatan Mobil Semangat Baru. Mobil Semangat Baru adalah kegiatan semangat baru yang diusung KORAN SINDO, khusus masyarakat untuk menyambut pagi agar dapat menjalankan hari lebih bersinergi. Sambil melewati kemacetan dari rumah menuju kantor, mobil Semangat Baru siap kembali mengisi semangat masyarakat yang mulai berkurang akibat kemacetan yang menyertai

setiap harinya. Untuk lebih menarik masyarakat, KORAN SINDO mengemas secara unik program Mobil Semangat Baru. Masyarakat cukup membeli Paket Semangat Baru seharga Rp3.000, maka akan mendapatkan KORAN SINDO yang progresif dan dilengkapi dengan menu breakfast yang siap menyempurnakan menu pagi anda. Dalam menu breakfastselain makanan, juga dilengkapi minuman untuk melengkapi semangat baru setiap pagi. Salah satunya yaitu Nescafe Ready to Drink. Minuman kopi ini sengaja disediakan dalam kemasan kaleng ataupun kotak dengan beraneka ragam rasa, seperti caramelicious, french

vanilla, mochacino, latte, mocha, dan original. Mobil Semangat Baru hadir sampai akhir Maret, tepatnya 28 Maret 2013. Bagi yang ingin melengkapi pagi dengan Paket Semangat Baru, Anda dapat berkunjung ke salah satu Mobil Semangat Baru yang tersebar di 12 lokasi, seperti Rawamangun tepatnya di depan Terminal Rawamangun, Kampung Melayu di samping atau bawah flyover arah Casablanca, Cililitan tepatnya di Halte Cililitan seberang UKI, Bulungan tepatnya di seberang pangkalan DAMRI, Kuningan tepatnya Menara Imperium, Bendungan Hilir (Benhil) tepatnya dekat Pasar Benhil, Fatmawati tepatnya di depan Lotte Mart, kawasan

Senen tepatnya di tikungan Pasar Senen arah halte busway, Sudirman tepatnya depan Wisma BNI 46, Pasar Rebo tepatnya setelah lampu merah pertama RS Pasar Rebo, Sudirman tepatnya Citywalk, dan Bekasi tepatnya depan Mega Mall Bekasi. Jika Anda melewati daerah tersebut, Mobil Semangat Baru hadir setiap pagi sekitar pukul 07.00 WIB sampai dengan 09.00 WIB. Untuk mengakses info lebih lengkap Mobil Semangat Baru dan lokasinya, Anda dapat menghubungi Talk Center KORAN SINDO di 021.3911518 atau melihat video Mobil Semangat Baru di YouTube. balqis eghnia n

JAKARTA – Petugas Direktorat Narkoba Polda Metro Jaya menangkap pemasok ratusan pil happy five, yang disita dari pengemudi dan penumpang Porsche yang terlibat kecelakaan di kawasan SCBD, Jakarta Selatan. Direktur Narkoba Polda Metro Jaya Kombes Pol Nugroho Aji menjelaskan, setelah memeriksa dua pelaku yakni Danny Leonardi dan Hardi Arga Ciputra, pengemudi serta penumpang mobil mewah itu, petugas mendapatkan nama pemasok barang haram tersebut. Pemasoknya ialah Yung-Yung, mahasiswa salah satu universitas ternama di Jakarta. Pemuda berusia 24 tahun ini pun tanpa perlawanan dibekuk di tempat indekosnya di Kemanggisan, Jakarta Barat. “Pil happy fiveitu berasal dari Jepang, kualitasnya nomor satu. Harga jual per butirnya Rp300.000,” jelas Nugroho Aji kemarin. Menurut Nugroho, Yung-Yung memberikan ratusan butir happy fiveitukepadaDannydanHardidi


Direktur Narkoba Polda Metro Jaya

sebuah kafe di kawasan SCBD. Malam sebelum kecelakaan itu, mereka bertemu di kafe tersebut. Yung-Yung memberikan pil haram itu untuk dijual kembali oleh Danny dan Hardi. Selama di kafe, ketiganya menenggak minuman keras yang akhirnya membuat Danny tidak bisa mengendalikan mobil mewahnya, sehingga bertabrakan dengan Daihatsu Sirion. “Kami masih mengembangkan kasus ini untuk menangkap bandar besar pil happy five itu,” tukasnya. Nugroho menutur-

kan, dari hasil pemeriksaan, barang haram itu berasal dari Jepang yang dikirim melalui Malaysia. Namun, sampai saat ini pihaknya masih menyelidiki bagaimana pil tersebut bisa masuk Indonesia. Kabid Humas Polda Metro Jaya Kombes Pol Rikwanto menambahkan, penyidik telah menetapkan Danny dan Hardi sebagai tersangka dalam kasus kecelakaan serta kepemilikan narkotika. Untuk kasus kecelakaan, mereka dikenakan UU No 22/2009 tentang Lalu Lintas, Angkutan dan Jalan, Pasal 283 jo Pasal310ayat1dan2.“Keduanya ditahan di Rutan Narkoba Polda Metro Jaya,” tukasnya. Seperti diketahui, Minggu (24/3) dini hari lalu, mobil mewah Porsche jenis Panamera nopol B 8 DAN bertabrakan dengan Sirion di kawasan SCBD, Jakarta Selatan. Polisi yang menangani kasus ini menemukan 598 butir pil happy five milik pengemudidan penumpang Porsche. helmi syarif


Rasyid Dihukum Percobaan Enam Bulan Penjara JAKARTA – Muhammad Rasyid Amrullah Rajasa, terdakwa kasus kecelakaan yang menewaskan dua orang, divonis lima bulan penjara dengan masa percobaan enam bulan oleh Majelis Hakim Pengadilan Negeri (PN) Jakarta Timur, kemarin. “Terdakwa divonis lima bulan penjara dengan masa percobaan enam bulan,” kata Ketua MajelisHakimJSuharjonodiPN Jakarta Timur. Selain penjara, Rasyid dijatuhi hukuman denda senilai Rp12 juta subsider enam bulan kurungan. Atas vonis yang dijatuhkan ini, Rasyid tidak akan mendekam di dalam jeruji besi, karena hukuman yang dijatuhkan kepadanya bersifat

percobaan atau berlaku apabila dirinya mengulangi tindakannya tersebut. “Menetapkan hukuman kurungan tidak akan dijalankan kecuali apabila dalam kurun waktu enam bulan melakukan pidana kembali,” ujar Suharjono. Menurut Suharjono, majelis hakim menggunakan teori restorative justice, di mana terdakwa Rasyid dinilai telah bertanggung jawab dan mengakui kesalahan atas tindakannya. Selain itu, sikap Rasyid yang turut aktif membantu korban di lokasi kejadian, menolong korban, mengunjungi, memberi santunan bantuan dan materi, pergantian kendaraan korban,

menjadi pertimbangan hakim. Dengan keputusan ini, Rasyid dipastikan bisa melanjutkan kuliahnya di London, Inggris tanpa harus takut terkena cekal oleh petugas imigrasi. ”Rasyid memang tidak pernah dicekal, jadi bisa bepergian ke luar negeri, meskipun dalam masa percobaan,” ujar Ananta Budiartika, kuasa hukum Rasyid, seusai sidang berlangsung. Atas putusan ini pun, Ananta mengaku puas dan tidak berniat mengajukan banding. “Saya sampaikan hakim cukup tajam. Selain itu, terlihat hati-hati sekali memberikan keputusan ini,” ungkapnya.  dian ramdhani


Pemasok Happy Five ke Pengemudi Porsche Dibekuk DOK.KORAN SINDO


Alfred Rinaldi Triestanto Head of Investment & Treasury Wealth Management, Consumer Banking Standard Chartered Bank

Eastspring Investments Alpha Navigator

Produk Investasi Ideal Lembaga Keuangan Dunia


ondisi fundamental ekonomi Indonesia te r u s m e m b a i k y a n g te rce r m i n dari pertumbuhannya yang positif. Sebagaimana tercatat dalam Badan Pusat Statistik, berdasarkan kenaikan Pr o d u k D o m e s t i k B r u t o ( P D B ) , pertumbuhan ekonomi Indonesia mencapai 6,1% dibandingkan tahun sebelumnya. Kondisi ini sangat baik bagi iklim investasi. Tidak heran bila kebutuhan masyarakat untuk berinvestasi ikut terbawa naik. Memenuhi kebutuhan tersebut, Standard Chartered Bank menawarkan produk investasi terbaru yang sangat fleksibel dan inovatif bernama Reksa Dana Eastspring Investments Alpha Navigator. Inilah produk investasi dari Eastspring Investments, bagian dari Prudential Corporation Asia yang merupakan perusahaan manajer investasi dari Grup Prudential di Asia. Eastspring Investments merupakan salah satu perusahaan manajer investasi terbesar di Asia yang beroperasi di 12 negara, memiliki lebih dari 2.000 karyawan di Asia dan mengelola sekitar US$90 miliar dana kelolaan ( per 30 September 2012). Di Indonesia, Standard Chartered Bank saat ini menjadi satu-satunya bank yang mendistribusikan produk investasi menarik ini. Reksa Dana S a h a m E a s t s p r i n g I nve s t m e n t s Alpha Navigator adalah reksa dana terbuka dengan komposisi utama pada saham-saham pilihan yang ditawarkan dan diperdagangkan melalui Bursa Efek Indonesia. “Makna Alpha Navigator sendiri adalah upaya aktif untuk mendapatkan alpha, yang

dalam istilah investasi, bermakna nilai tambah,” kata Alfred Rinaldi Triestanto, Head of Investment & Treasury Wealth Management, Consumer Banking Standard Chartered Bank. Nama ini mencerminkan filosofi reksa dana yang memberik an nilai tambah bagi investor dengan secara aktif dan berkesinambungan melakukan navigasi atas saham-saham terbaik melalui seleksi, perumusan, dan pembobotan saham berdasarkan nilai fundamentalnya. Pengelolaan dana investasi Reksa Dana Saham Eastspring Investments Alpha Navigator ini melalui tiga strategi, pertama strategi portofolio saham yang terfokus. Ini mencakup pemilihan saham menggunakan strategi bottom up, portofolio hanya memiliki 25-30 saham dengan pengelolaan portofolio secara aktif dan menyeluruh. Kedua, fokus pemikiran terbaik tim investasi. Strategi ini meliputi saham-saham hasil pemikiran terbaik, portofolio lebih terfokus pada saham yang memiliki nilai terbaik, di mana hanya berisikan saham-saham pilihan. Ketiga, pengelolaan risiko holistik dengan diversifikasi atas sektor dan tema investasi, tujuan portofolio secara menyeluruh, disiplin dalam transaksi jual dan beli, pemantauan, pemilihanserta eksekusi saham. Inilah yang dimaksud dengan fleksibel dari produk investasi ini. “Manajemen investasi kami akan memilihkan saham-saham bernilai tambah tanpa terikat pada sektor, model, indeks harga saham tertentu. Tujuan akhir dari proses ini adalah

memberikan nilai lebih atas kinerja portofolio,” tambah Alfred. Dengan tingkat pengembalian yang kompetitif, tak heran sejak diluncurkan pada Januari lalu, dana kelolaan yang berhasil dikumpulkan dari produk ini mencapai lebih dari Rp200 miliar per Februari 2013. Alfred optimis Reksa Dana Eastspring Investments Alpha Navigator akan terus tumbuh dengan pesat. Untuk lebih mengenalkan masyarakat pada produk investasi ini, Standard Chartered Bank memperkenalkannya melalui agenda seminar keuangan tahunan, Wealth On Wealth (WOW). Tahun ini, acara WOW tersebut diadakan secara road show di kota-kota besar mulai dari Jakarta, Bandung, Surabaya dan Medan. Reksa Dana Eastspring Investments Alpha Navigator dapat dijangkau dan dibeli di semua kantor cabang Standard Chartered Bank. Produk ini merupakan instrumen ideal untuk tujuan investasi jangka panjang (misalnya, 5 tahun ke atas). “Kalau ekonomi bertumbuh 6% saja, artinya laba perusahaan diperkirakan tumbuh 20%-30%. Harga saham naik, tingkat pengembalian yang didapatkan pun jelas sangat menarik,” kata Alfred. Selain itu menurut Alfred pasar untuk produk investasi di Indonesia masih sangat besar. Sebanyak 95% masyarakatnya masih menyimpan dana sebagian besar di deposito. Padahal bunga deposito hanya 4%-5% per tahun termakan oleh laju inflasi. “Kecenderungan ini karena masyarakat kita belum banyak yang mengenal produk investasi,” kata Alfred. [aris kurniawan/Info]



10:08 PM

Page 8

12 SELASA 26 MARET 2013

OPINI Produksi Minyak Tidak Tercapai arget produksi minyak tahun ini sulit tercapai. Berdasarkan prediksi Satuan Kerja Khusus Pelaksana Kegiatan Usaha Hulu Minyak dan Gas Bumi (SKK Migas) produksi minyak tahun ini hanya berkisar pada 840 bph. Padahal, dalam anggaran pendapatan dan belanja negara (APBN) 2013 produksi minyak dipatok sebanyak 900.000 barel per hari (bph). Penetapan target produksi minyak dalam APBN selalu meleset dari tahun ke tahun. Menjadi pertanyaan serius mengapa pemerintah selalu menetapkan target yang besar, sementara realitas produksi turun terus menerus? Target produksi minyak yang meleset jelas akan memengaruhi postur APBN. Kalau melihat target produksi minyak yang selalu dipatok dalam APBN, pemerintah sepertinya memang tidak realistis melihat kondisi industri minyak belakangan ini. Sebagaimana dipublikasikan SKK Migas bahwa sepanjang 20 tahun ini produksi minyak Indonesia terus menurun karena tidak ada sumur minyak baru. “Tahun ini produksi sekitar 830.000 hingga 840.000 bph, titik. Meski demikian, bukan berarti saya akan tidur. Kita akan tetap bekerja keras,” kata Kepala SKK Migas Rudi Rubiandini pada acara Indonesia Oil and Gas Industry Outlook 2013 kemarin. Berdasarkan data SKK Migas bahwa dalam 10 tahun terakhir ini hanya 10 perusahaan migas yang berhasil mendapat lahan positif di Indonesia dan baru dalam tahap rencana pengembangan (plan of development/POD) untuk eksplorasi gas bukan minyak. Padahal tidak kurang dari 174 kontraktor kontrak kerja sama (KKKS) atau perusahaan migas yang menandatangani kontrak untuk eksplorasi. Jadi, fakta di lapangan memang sulit menggenjot angka produksi minyak saat ini. Kendala tersebut belum termasuk hambatan yang dialami perusahaan yang sudah beroperasi seperti faktor cuaca buruk yang belakangan ini menekan angka produksi sejumlah sumur minyak lepas pantai. Meningkatkan produksi minyak di tengah tingkat konsumsi bahan bakar minyak (BBM) yang terus meroket memang tidak gampang. Karena itu, kita berharap pemerintah bisa mengeluarkan berbagai kebijakan yang produktif terhadap perusahaan migas dan melakukan koordinasi yang konsisten dengan sejumlah instansi yang terkait lahan yang menjadi sasaran eksplorasi. Beberapa kasus membuat sejumlah investor migas memilih menarik diri ketimbang harus berurusan dengan persoalan birokrasi yang ruwet. Misalnya, persoalan lahan yang tumpang tindih yang wajib berkoordinasi dengan Kementerian Kehutanan. Meski demikian, kita tetap harus memberi apresiasi kepada Kementerian Energi dan Sumber Daya Mineral (ESDM) yang masih punya keberanian di atas kertas untuk terus mendongkrak produksi minyak meski tersumbat berbagai persoalan serius. Tahun depan Menteri ESDM Jero Wacik optimistis produksi minyak bisa mencapai 1 juta bph. Dari mana angka produksi itu berasal? Menurut menteri yang juga salah seorang petinggi Partai Demokrat itu, sejumlah KKKS diminta memaksimalkan produksinya di antaranya ladang minyak Cepu yang akan menghasilkan sekitar 165.000 bph tahun depan. Seandainya produksi minyak tahun depan tembus sekitar 1 juta bph, bukan berarti negeri ini sudah bisa bernafas lega dalam mengatasi kebutuhan BBM. Saat ini pemerintah mengimpor minyak tak kurang dari 1,5 juta bph. Jadi, sejarah Indonesia yang sempat tercatat sebagai negeri pengekspor minyak hanya tinggal kenangan. Dulu produksi minyak rata-rata mencapai 1,6 juta bph, sementara tingkat konsumsi dalam negeri hanya berkisar 700.000 bph. Dengan demikian, kelebihan sekitar 900.000 bph menjadi sumber penambah kocek pemerintah karena diekspor. Data terbaru versi Pertamina, total impor minyak sebanyak 98,21 juta barel atau sekitar 300.000 barel per hari selama 2012.


Gunung Es Harta Haram Polisi?

Wakil Pemimpin Redaksi: Nevy AN Hetharia, Pung Purwanto Redaktur Pelaksana: Djaka Susila, Dwi Sasongko, Masirom Wakil Redaktur Pelaksana: Alex Aji Saputra, Hanna Farhana Redaktur: Achmad Faisal Nasution, Abdul Hakim, Alviana Harmayani Masrifah, Army Dian Kurniawan, Azhar Azis, Boy Iskandar, Danang Arradian, Hatim Varabi, Mohammad Ridwan, Mohammad Faizal, Nurcholis, Shalahuddin, Sujoni, Supriyadi, Syahrir Rasyid, Widaningsih, Wuri Hardiastuti, Yani Adryansah, Zen Teguh Triwibowo Asisten Redaktur: Abdul Haris, Abdul Rochim, Adam Prawira, Ahmad Baidowi, Agus Warsudi, Agung Nugroho BS, Ainun Najib, Andri Dwi Ananto, Anton Chrisbiyanto, Chamad Hojin, Donatus Nador, Edi Purwanto, Edi Yulianto, Fakhrur Haqiqi, Harley Ikhsan, Hatta Sujatmin, Helmi Firdaus, Hermanto, Herita Endriana, Hendri Irawan, Juni Triyanto, Kastolani, Ma’ruf, Maria Christina Malau, Muhammad Yamin, Muhibudin Kamali, M Iqbal, Nur Iwan Tri Hendrawan, Paijo, Pangeran Ahmad Nurdin, Puguh Hariyanto, Rakhmat Baihaqi, Rusman Hidayat Siregar, Sali Pawiatan, Sazili Mustofa, Slamet Parsono, Sudarsono, Sugeng Wahyudi, Suriya Mohamad Said, Sunu Hastoro Fahrurozi, Suwarno, Syarifudin, Tedy Achmad, Thomas Pulungan, Titi Sutinah Apridawaty, Vitrianda Hilba Siregar, Wasis Wibowo, Wahyu Sahala Tua, Wahyono, Yanto Kusdiantono, Yogi Pasha Reporter: Bernadette Lilia Nova, Denny Irawan, Fefy Dwi Haryanto, Haryudi, Hendrati Hapsari, Helmi Syarif, Hermansah, Inda Susanti, Islahuddin, Jujuk Erna, Krisiandi Sacawisastra, M Purwadi, Maesaroh, Megiza, MN Latief, Neneng Zubaidah, Novia Sang Ayu Lesthia K, Nurul Huda, Radi Saputro, Rahmat Sahid, Rarasati Syarief, Rendra Hanggara, Sri Noviarni, Susi Susanti, Sofian Dwi, Sucipto, Teguh Mahardika, Wahab Firmansyah Manager Litbang: Wiendy Hapsari Redaktur Bahasa: Jaelani Ali Muhammad Koordinator Fotografer: Aziz Indra Fotografer: Arie Yudhistira, Astra Bonardo, Eko Purwanto, Hasiholan Siahaan, Ratman Suratman, Yulianto, Yudhistiro Pranoto Manager Artistik: Wisnu Handoko, I Masyhudi Direktur Keuangan/CFO: Ahmad Sugiri Direktur Sirkulasi & Distribusi: Sugeng H.Santoso VP Sales: Lia Marliana GM Biro: Kiki Subarkah VP Marketing & Communications: Caecilia Hamzah GM Sirkulasi & Distribusi: Donny Irawan Rate Iklan Edisi Nasional 2013 Halaman Dalam Display FC : Rp138.000/mmk, Display BW: Rp92.000/mmk, Island Ad: Rp156.000/mmk, Center Spread Rp150.000/mmk Halaman 1 Display FC: Rp218.000, Halaman 3 Display FC: Rp165.000/mmk, Halaman 5 Display FC: Rp158.000/mmk Laporan Keuangan FC : Rp26.000/mmk BW: Rp20.000/mmk, Liputan Khusus FC: Rp125.000/mmk, BW: Rp85.000/mmk Business Event FC: Rp 25.000.000/Kavling; BW Rp15.000.000/Kavling Halaman Informasia Baris BW: Rp37.000/baris , Kolom FC: Rp50.000/mmk, Kolom BW: Rp39.000/mmk, Layanan Langganan: (021) 3911518, Fax : (021) 3929758 Iklan Display: (021) 3915634, Fax : (021) 3927721 Iklan Baris/Kolom, Divisi Sirkulasi dan Distribusi: Gedung SINDO Jalan Wahid Hasyim No. 38, Jakarta 10340 Telepon / Fax. (021) 391 4672, E-mail:,;

Penerbit: PT Media Nusantara Informasi, Percetakan: PT Media Nusantara Press Bank: BCA Cabang Wahid Hasyim A/C 478-301152-5, Anggota SPS Nomor 404/2005/11/2011, Terbit Tujuh Kali Seminggu. Alamat : Gedung SINDO Jalan Wahid Hasyim No. 38, Jakarta 10340 Telepon (Hunting): (021) 3926955, Fax: (021) 392 9758, Redaksi: (021) 392 6955, Fax: (021) 392 7721 Wartawan Koran SINDO selalu dibekali tanda pengenal dan dilarang meminta / menerima apa pun dari narasumber

atau (bagi akademisi) meneliti kondisi intern Polri terkait sistem dan perilaku aktor-aktornya. Apalagi pada awal-awal langkah KPK menyelidiki indikasi keterlibatan DS, resistensi Polri sangat tinggi. Sampaisampai ada upaya kriminalisasi seorang penyidik KPK yang ikut menangani kasus korupsi simulator SIM (Noval, yang kebetulan anggota Polri) dengan tuduhan pernah terlibat melakukan pembunuhan saat bertugas di Bengkulu.


Masyarakat luas bisa menyaksikan secara langsung tampilan fisik harta dari sejumlah petinggi dan anggota Polri termasuk pimpinan Polri, namun tetap saja dibiarkan karena mungkin dianggap wajarwajar saja.

Jika diletakkan pada perilaku DS saja, kita akan sangat terganggu dengan sistem pengawasan dan kendali perilaku dalam kepemimpinan Polri. Apalagi terhadap figur perwira tinggi Polri yang jumlahnya terbatas, di mana seharusnya perilaku mereka akan mudah terdeteksi, termasuk sumbersumber perolehan hartanya. Tepatnya, pimpinan Polri seharusnya tak ada alasan untuk tidak tahu menahu dengan kelakuan, perolehan harta, dan atau cara-cara korup (termasuk mark up anggaran proyek simulator SIM) yang dilakukan seorang DS. Atau, jika memang para kolega tidak tahu perilaku dan praktik korup DS, kepemimpinan di intern Polri sungguhsungguh lemah dan sekaligus membuka ruang untuk korup yang sekaligus bisa menguntungkan diri atau pihaknya.

Pada tingkat tertentu, Presiden RI sebagai pengusul dan sekaligus mengangkat Kapolri (setelah fit and proper test oleh DPR) bisa berarti telah secara terbuka menunjukkan kekeliruannya karena memberi mandat pada figur yang tak pantas. Kecurigaan lain pun kemudian bisa terarah pada Presiden RI yakni mempertahankan seorang pimpinan Polri yang lemah lantaran pihaknya memperoleh cipratan atau keuntungan materi melalui jaringan oknum “yang beroperasi” pada jabatan lapis bawah. Penjelasan di atas, pada tataran praktik, bisa diterima akal sehat. Soalnya, yang menghandlesecara langsung berbagai proyek atau kebijakan operasional lain “yang menghadirkan materi secara ilegal” pada dasarnya bukanlah pimpinan, melainkan figur-figur yang berperan dan berwenang di jabatan level operasional, di mana pemimpin di atasnya “tinggal terima bersih” dan “akan selalu terkesan bersih”. Jika ada temuan masalah dan inilah yang kerap terjadi termasuk pada kasus DS, pimpinan yang sebenarnya memperoleh “porsi harta ilegal” lebih banyak dibanding dengan figur yang menangani langsung proyeknya tetap aman-aman saja. Akan ada cerita lain, tentu saja, jika figur bawahan yang tengah nahas itu mau bernyanyi atau bukanbukan di mana hal ini juga jadi bagian yang diharapkan publik bangsa ini terhadap DS. Apa yang mau dikatakan di sini bahwa kasus DS boleh jadi hanya butiran gunung es di tengah perilaku dan kebiasaan korup yang berlangsung lama terjadi di intern Polri. Kita semua masih ingat misalnya terungkapnya “rekening gendut” dari sejumlah petinggi Polri yang sempat mencuat beberapa tahun lalu, di mana kini tenggelam seolah lenyap terhisap waktu. KPK pun

seperti tak peduli dan terus saja membiarkan pemilik rekening gendut itu bebas menikmatinya bersama keluarga. Masyarakat luas juga, harihari ini, bisa menyaksikan secara langsung tampilan fisik harta (berupa rumah dan mobil-mobil pribadi nan mewah serta gaya hidup beserta keluarga yang berada di atas standar layak) dari sejumlah petinggi dan anggota Polri termasuk pimpinan Polri, namun tetap saja dibiarkan karena mungkin dianggap wajar-wajar saja. Presiden SBY pun tampaknya tak mau peduli atau bersikap kritis tentang semua itu sehingga wajar jika ada kritikan bahwa negara ini “surga bagi para pejabat korup” karena yang tertangkap dan dipenjarakan hanyalah mereka yang kebetulan lagi nahas. Persoalannya kemudian, instansi Polri juga terus saja diberi kewenangan untuk menjadi penyidik kasus-kasus korupsi. Padahal dengan fenomena di atas, seharusnya Polri sudah tidak memiliki legitimasi moral lagi untuk tetap diberi kewenangan untuk memberantas korupsi sebab bagaimana mungkin bisa membersihkan yang lain sementara dalam dirinya sendiri bercampur kotoran berbau busuk. Boleh jadi, kewenangan untuk memberantas korupsi hanyalah tameng, dan jadi “sebuah proyek” yang bisa disalahgunakan untuk, lagilagi, mengumpulkan harta. Singkatnya, jika Presiden SBY memiliki kesadaran kritis untuk membersihkan instansi polisi dari figur-figur korup, sebenarnya sudah harus mengambil langkah untuk (1) mendeteksi seluruh harta kekayaan para petinggi Polri dan (2) mengambil langkah-langkah konkret agar melepaskan kewenangan Polri menangani kasus korupsi. *) Artikel ini pandangan pribadi

Gerakan Konstitusionalisme di Indonesia DR FRANS H WINARTA

Pemimpin Umum: Syafril Nasution Wakil Pemimpin Umum/Pemimpin Perusahaan: Priscilla Diana Airin Pemimpin Redaksi /Penanggungjawab: Sururi Alfaruq

antan Kepala Korps Lalu Lintas Kepolisian RI Irjen Polisi Djoko Susilo (DS) tampaknya sangat nahas. Kini ia jadi tahanan KPK, tersangka korupsi proyek simulator pengadaan SIM, hartanya disita, dan beberapa istri mudanya bukan saja tersingkap ke publik, melainkan juga terpaksa berhadapan dengan proses hukum. Soalnya harta para selir itu tampaknya juga dicurigai berasal dari sumber ilegal alias “haram” sehingga bukan mustahil semua yang sebelumnya dinyatakan “milik para istri” juga akan beralih status ke milik negara. Harta DS memang diperkirakan mencapai lebih dari Rp100 miliar, sungguh sangat fantastis. Secara logis dan empiris, besaran harta seperti itu tak bisa diterima akal sehat jika dibandingkan dengan total pendapatan resmi dari seorang perwira tinggi polisi. Sangat beralasan ketika resmi ditetapkan sebagai tersangka korupsi oleh KPK, jejak-jejak harta yang terkait DS ditelusuri dan (sebagian) sudah ditemukan. Cara KPK ini mungkin akan sangat efektif menciptakan efek jera pada koruptor dengan “memiskinkan” dan mempermalukan pelakunya serta mengembalikan harta rampokan koruptor itu pada negara. Pertanyaannya, apakah DS hanya individu oknum yang berperilaku menyimpang dan korup ataukah sudah jadi semacam tren perilaku kolektif di intern Polri di mana satu sama lain sudah saling tahu sama tahu (TST)? Ataukah juga perilaku seperti itu produk dari sebuah sistem yang selama ini telah dinikmati, di mana DS hanya secara kebetulan terbuka pintu masuknya lantaran ditemukan fakta hukum terlibat korupsi proyek simulator SIM? Pertanyaan-pertanyaan itu tentu perlu dijadikan pijakan untuk selanjutnya memeriksa



Dosen Fakultas Hukum Universitas Pelita Harapan, Anggota Governing Board Komisi Hukum Nasional (KHN), dan Ketua Umum Persatuan Advokat Indonesia (Peradin)

erakan konstitusionalisme (constitutionalism) didefinisikan sebagai suatu sistem terlembagakan yang menyangkut pembatasan yang efektif dan teratur terhadap tindakan-tindakan pemerintah. Ide gerakan konstitusionalisme ini di Indonesia dirasakan lemah yang berakibat pada penyalahgunaan kekuasaan (abuse of power) atau kekuasaan yang berlebihan (excessive power), baik itu dilakukan oleh lembaga eksekutif, legislatif, maupun yudikatif. Konstitusionalisme itu sendiri merupakan abstraksi lebih tinggi dari “rule of law” (rechtsstaat), yang maksudnya kekuasaan negara dibatasi oleh konstitusi dan dipagari hukum agar tidak sewenang-wenang dan berlebihan. Seperti ditulis oleh Eric Barendt tentang pernyataan Montesquieu mengenai konstitusionalisme: “is a belief in the imposition on government by means of a constitution.” Sebagai negara hukum (rechtsstaat) yang dijamin dalam UUD 1945, golongan menengah Indonesia, politisi, aktivis, cendekiawan, akademisi, pengusaha, dan profesional Indonesia seharusnya menggandrungi gerakan konstitusionalisme, sehingga pelanggaran-pelanggaran terhadap UUD 1945 tidak separah sekarang ini. Para elite di Indonesia termasuk politisi, pejabat pemerintahan, dan DPR, terjebak dalam sentimen materialisme, ekonomi pasar, dan perdagangan bebas yang tujuannya bukan memberantas kemiskinan, me-


lainkan malah menimbulkan kerentanan dan ketidakmerataan ekonomi (economicinsecurity and inequality). Globalisasi dan/atau pertumbuhan ekonomi yang diharapkan kelak pada waktunya akan menetes ke bawah (trickle down effect) ternyata hanya ilusi belaka. Perusahaan multinasional yang diberi kebebasan dalam era globalisasi hanya mengejar keuntungan dan pertumbuhan ekonomi dan tidak peduli terhadap kemiskinan yang melanda 80% penduduk di negara berkembang, yang ditandai dengan pendapatan dan pendidikan yang rendah serta angka pengangguran yang sangat tinggi. Hal ini merupakan suatu keadaan yang sangat menyakitkan dan menyedihkan. Hanya India dan China yang berani melawan globalisasi. Mereka mengalami perbaikan ekonomi dengan perlahan tetapi pasti dalam mengurangi jumlah kemiskinan dan menata ekonominya tanpa bantuan IMF dan World Bank. Tatanan ekonomi kita bila mengacu pada konstitusi, khususnya Pasal 33 ayat (1) UUD 1945 menyatakan bahwa: “Perekonomian disusun sebagai usaha bersama berdasar atas asas kekeluargaan.” Namun, semangat kebersamaan dan ekonomi kekeluargaan tidak tercermin dalam perekonomian Indonesia saat ini, apalagi semangat kemakmuran sebagai salah satu syarat negara sejahtera (welfare state).

Gerakan Konstitusionalisme Dalam paham seorang yuris Prancis Montesquieu, jika kekuasaan eksekutif dan kekuasaan legislatif yang sedang berkuasa dikhawatirkan menjelma menjadi tirani, kekuasaan yudikatif harus independen dari kekuasaan eksekutif dan kekuasaan legislatif yang berwenang membuat hukum. Dalam hal ini, khususnya bebas dan imparsial dalam membuat

putusan sebagai pembatasan terhadap kekuasaan eksekutif dan kekuasaan legislatif yang membuat hukum dan peraturan yang represif. Keselarasan (compatibility) undang-undang terhadap konstitusi ini harus selalu dijaga oleh kekuasaan yudikatif. Di sinilah letak pentingnya pembagian kekuasaan (separation of power) yang dikemukakan Montesquieu dalam bukunya yang berjudul: “L’Esprit des Lois”. Menurut Montesquieu konstitusi mempunyai dua arti, yaitu: “The first, the constitution of a state is the written document or text which outlines the powers of its parliament, government, courts, and other important national institutions…. Secondly, constitutions are drawn up to establish the fundamental principles of a new system of government subsequent to a revolution. That was the case with the first French Constitution of 1791.” Jadi, dokumen konstitusi ini memuat garis besar kekuasaan parlemen, pemerintah, lembaga peradilan, dan lembagalembaga negara lain yang dianggap penting. Juga dijamin hak-hak dasar individu seperti kebebasan mengemukakan pendapat atau bicara dan hak untuk diadili secara adil. Perlindungan hak dasar individu bertujuan membatasi kekuasaan legislatif dan eksekutif yang cenderung otoriter atau semena-mena. Selanjutnya, konstitusi dimaksudkan untuk mengembangkan prinsip-prinsip dasar dari suatu pemerintahan hasil dari suatu revolusi. Itulah ide konstitusi pertama Prancis pada tahun 1791. Perlindungan hak dasar individu, diadili oleh pengadilan yang adil (fair) serta perlindungan atas kesewenangan merupakan sesuatu yang mahal dan langka di Indonesia. Tatanan ekonomi yang tidak sesuai dengan Pasal 33 ayat (1) UUD 1945 merupakan persoalan utama bagaimana tatanan eko-

nomi kita ke depan harus ditata atau dikelola.

Janji Globalisasi Apa yang dijanjikan globalisasi yang menekankan pada ekonomi pasar, perdagangan bebas, dan pertumbuhan ekonomi tidak banyak bermanfaat bagi Indonesia dan negara-negara berkembang lain. Pemikiran mencabut subsidi dan membuka pasar bagi negaranegara anggota WTO tidak membawa hasil sebagaimana janji semula. Kemakmuran segelintir manusia Indonesia, kebanyakan pengusaha dan pejabat, tidak menetes ke bawah (trickle down effect)seperti yang dijanjikan semula dalam globalisasi, ekonomi pasar, dan perdagangan bebas. Ketika negara-negara berkembang dianjurkan mencabut subsidi yang diberikan kepada industri yang baru tumbuh, negaranegara maju justru melindungi para petaninya dengan memberikan subsidi yang besar, menurunkan harga alat-alat pertanian, sehingga hal tersebut merongrong standar kehidupan di negara berkembang. Perusahaan-perusahaan multinasional begitu rakusnya, sampai menganjurkan bayi untuk tidak minum air susu ibu (ASI) agar produk susu kaleng buatan perusahaan mereka laris, perusahaan farmasi menyewa lobbyistuntuk memengaruhi dan menyuap pejabat atau pemerintahan negara-negara berkembang agar produknya laris, dan rokok yang pemasarannya dibatasi di negara-negara maju malah diiklankan dengan gencar di negara-negara berkembang. Pertanyaannya sekarang adalah apa tatanan ekonomi dan sosial seperti inilah yang dicita-citakan dan dijamin UUD 1945? Tentu tidak, tetapi apa daya kita memperbaiki keadaan seperti ini. Tidak lain gerakan konstitusionalisme harus ditingkatkan agar semua peraturan perundang-undangan selaras (compatible) dengan

UUD 1945 dan putusan-putusan pengadilan harus mengacu pada konstitusi dan hak dasar (hak asasi manusia). Konstitusi merupakan hukum yang lebih tinggi atau bahkan paling tinggi serta paling fundamental sifatnya, karena konstitusi merupakan sumber legitimasi atau landasan otorisasi bentuk-bentuk hukum atau peraturan perundangundangan lainnya. Sesuai dengan prinsip hukum yang berlaku universal, maka agar peraturan-peraturan yang tingkatnya berada di bawah Undang-Undang Dasar dapat berlaku dan diberlakukan, peraturan-peraturan itu tidak boleh bertentangan dengan hukum yang lebih tinggi tersebut. Atas dasar logika demikian itulah, Mahkamah Agung Amerika Serikat menganggap dirinya memiliki kewenangan untuk menafsirkan dan menguji materi peraturan produk legislatif (judicial review) terhadap materi konstitusi, meskipun konstitusi Amerika Serikat tidak secara eksplisit memberikan kewenangan demikian kepada Mahkamah Agung. Hakim Agung John Marshall dalam kasus Marbury v. Madison (1803) di Amerika Serikat menyatakan bahwa segala undang-undang buatan kongres, apabila bertentangan dengan konstitusi sebagai ‘the supreme law of the land’ harus dinyatakan batal demi hukum (null and void). “Thus, the particular phraseology of the constitution of the USA confirms and strengthens the principle, supposed to be essential to all written constitution, that a law repugnant to the constitution is void; and that courts, as well as other departments, are bound by that instrument.” Semoga tulisan ini dapat memberikan sumbangan bagi gerakan konstitusionalisme di Indonesia di mana UUD 1945 dijadikan hukum paling tinggi dan fundamental (grund norm). 



10:07 PM

Page 9

13 SELASA 26 MARET 2013


Menunggu Pemimpin Profetik dengan Kecerdasan Sosial ABDUL MUNIR MULKHAN Komisioner Komnas HAM 20072012, Wakil Sekretaris Pimpinan Pusat Muhammadiyah 2000-2005, Guru Besar Fakultas Tarbiyah & Keguruan UIN Sunan Kalijaga Yogyakarta

raktik korupsi yang belakangan mulai melibatkan elite partai berlatar belakang gerakan keagamaan mengindikasikan pola rekrutmen tidak sehat, kesalahan (baca: dosa) kolektif, selain praktik keagamaan dengan ketuhanan utopis. Surga-neraka seolah merupakan wilayah dunia antah berantah dengan Tuhan tak tersentuh. Korupsi dipandang sebagai bukan dosa besar yang tidak mungkin memperoleh ampunan Allah. Menelantarkan rakyat dan umat bukan sebuah maksiat atau dosa, melainkan sekadar sebuah kekeliruan kecil seperti salah-ucap (slip of the tongue). Dalam situasi demikian, rakyat negeri ini merindukan kehadiran pemimpin yang memiliki kesadaran profetik dan keberpihakan humanis dengan kecerdasan sosial tinggi. Suatu kecerdasan yang meletakkan dosa-pahala sebagai wilayah empirik tentang kemampuan memenuhi kebutuhan sebagian besar warga yang tidak beruntung alias miskin, papa, dan menderita. Tuhan bukan sesuatu yang jauh, surga-ne-


raka bukan wilayah utopis, melainkan hadir dalam praksis kehidupan sehari-hari. Pemimpin dengan kecerdasan sosial tinggi demikian tidak meletakkan jabatan sebagai kehormatan dengan sejumlah aksesori protokoler dan ajudan. Pemimpin berkecerdasan sosial tinggi menempatkan diri sebagai manusia biasa dengan tanggung jawab sosial-politik yang setiap saat tampil bersama rakyat dan umat yang dipimpin. Pemimpin yang terus membuka diri berdialog dengan rakyat tanpa aksesori protokoler yang sering menjadi penghalang rakyat berhubungan langsung dengan sang pemimpin. Pemimpin berkecerdasan sosial tinggi itulah yang disebut pemimpin profetik yang menyatu dengan jiwa rakyat dan umat. Secara sosiologis ia berbeda dengan pemimpin imam yang lebih cenderung mengurusi Tuhan utopis sehingga tidak jarang menjadikan umatnya sebagai tumbal surgawi. Di mana posisi pemimpin profetik dalam berbagai survei tentang calon presiden negeri ini? Sayang, survei-survei yang dilakukan berbagai lembaga belum memasukkan kecerdasan sosial sebagai salah satu variabel yang patut dilacak dalam dunia empirik. Kendati demikian, bukan berarti namanama yang beredar dalam berbagai survei tidak ada yang memiliki kecerdasan sosial tinggi. Soalnya, bagaimana mengenali kecerdasan sosial seseorang calon pemimpin?

Larisnya lembaga survei mengenai elektabilitas partai dan sosok seseorang sebagai calon presiden menjadi salah satu penanda negeri ini merindukan pemimpin baru. Soalnya, apakah pemimpin baru yang lahir dari proses demokrasi Pemilihan Umum Presiden 2014 nanti dijamin bisa mengangkat harkat dan martabat sebagian besar rakyat yang hingga kini belum menikmati hidup layak dalam alam yang merdeka? Hanya pemimpin dengan kecerdasan sosial tinggi yang memiliki kemampuan memahami kebutuhan rakyat banyak dan bersedia secara gigih (tanpa pamrih) memperjuangkan pemenuhan kebutuhan rakyatnya terutama yang miskin dan menderita tersebut. *** Korupsi yang melibatkan orang-orang berlatar belakang pendidikan tinggi, pemimpin gerakan keagamaan, atau partai berbasis keagamaan, mendorong banyak orang mulai mencari penjelasan dari sudut pandang ekstrem. Sementara pertumbuhan ekonomi tinggi negeri ini ternyata bukan indikasi rakyat miskin memperoleh layanan kesehatan memadai. Rakyat miskin seolah dilarang sakit, dilarang bersekolah, dan dilarang cerdas. Konstitusi memang memberi mandat pada negara untuk mencerdaskan kehidupan bangsa, namun faktanya banyak rakyat miskin yang gagal bersekolah dan gagal


berobat di tengah tebaran iklan pendidikan gratis. Praktik bernegara dan beragama utopis tidak bisa menjamin pengelolaan kehidupan bersama menjadi lebih nyaman bagi semua orang. Kecerdasan inteligensi tinggi tidak memberi jaminan seseorang bertindak lebih bijak dan arif dalam kehidupan sosial. Di sini pandangan Socrates lebih 2000 tahun lalu mengenai fungsi ilmu atau filsafat sebagai penggesa hidup manusia lebih bijak dan lebih cerdas menjadi penting. Kuncinya terletak pada penempatan ilmu (filsafat) bukan sekadar instrumen pencapaian material kehidupan, melainkan pencarian kebajikan dan pengembangan hidup bajik itu sendiri. Ironisnya, jalan ilmu atau filsafat yang bisa membuat hidup bersama berbangsa ini lebih nyaman dan lebih bajik adalahjalansulitnansunyitanpa

POROS MAHASISWA ”Memajukan Sektor Pertanian” Artikel dapat dikirim ke email:


Melindungi Pertanian


Kedaulatan Petani

Sektor pertanian merupakan Untuk memperbaikinya ada Para petani mempunyai peran Keberadaan irigasi yang mesektor yang mempunyai pe- beberapa solusi yang bisa di- strategis dalam upaya menjaga rupakan infrastruktur penting ranan strategis dalam struktur tempuh. Pertama, optimalisasi ketersediaan kebutuhan pa- bagi kehidupan sektor perpembangunan perekonomian program pertanian organik ngan. Melalui kerja keras petani, tanian di beberapa tempat juga nasional, tetapi tidak men- secara menyeluruh di Indonesia hasil-hasil tanaman pangan bisa memprihatinkan. Banyak sisserta menuntut pe- dinikmati. Ketika dapatkan perhatian tem irigasi yang timanfaatan lahan ketersediaan pasecara serius dari dak terawat setidur untuk per- ngan bisa dijamin pemerintah dalam hingga tidak bisa tanian yang pro- maka diharapkan pembangunan berfungsi secara duktif dan ramah ketahanan pangan bangsa. Padahal, maksimal untuk lingkungan. Kedua, bisa diwujudkan sebagian besar penpengairan dan tak penguatan sistem yang akhirnya akan duduk Indonesia jarang tercemar MAT PRIYADI hidupnya sangat DIAN WIDYA PUTRI kelembagaan tani bermuara pada teroleh polusi. dan pendidikan ke- capainya kemanbergantung pada Di musim tasektor pertanian. Mahasiswa Departemen pada petani. Ketiga, dirian pangan. nam pun, petani keMahasiswa Fakultas Indonesia harus Berdasarkan data Gizi Masyarakat, Oleh karena itu, Teknik Universitas sulitan mendapatmampu keluar dari aspek-aspek yang Muhammadiyah Badan Pusat Sta- Fakultas Ekologi kan bibit dan puWTO dan segala terkait dengan ke- Magelang tistik (BPS) Mei Manusia puk. Selain langka, Institut Pertanian Bogor bentuk perdagang- berlangsungan ke2012, tenaga kerja harganya pun sean bebas dunia. Ke- hidupan sektor perhatian harus langit. Bagai jatuh tertimpa di sektor pertanian mencapai 41,20 juta jiwa atau ikutsertaan dalam perjanjian mendapatkan jaminan ke- tangga, pada masa panen tiba sekitar 43,4% dari jumlah total perdagangan bebas tanpa ada- pastian. Misalnya ketersediaan harga jual produk tanaman penduduk Indonesia. Persen- nya kesiapan yang matang, lahan produktif, ketersediaan pangan luluh lantak dimainkan tase petani Indonesia menem- praktis membuat pasar dalam infrastruktur pertanian, ke- mekanisme pasar yang tidak pro pati urutan ke-3 dunia setelah negeri dibanjiri oleh produk dari tersediaan bibit tanaman dan petani. Oleh karena itu, banyak China (66%) dan India (53,2%). luar negeri. pupuk serta harganya yang petani yang justru mengalami Keempat, perbaikan in- tidak membebani biaya pro- kerugian, karena untuk meSayangnya, perjalanan pembangunan pertanian Indonesia frastruktur pertanian dan pe- duksi. Kemudian juga, jaminan ngembalikan modal awal saja hingga saat ini masih belum ningkatan teknologi tepat guna kepastian harga hasil produk tidak bisa. dapat menunjukkan hasil yang yang berwawasan pada konteks pertanian yang berpihak pada Sangat ironis memang kemaksimal jika dilihat dari kearifan lokal. Kelima, bim- kepentingan peningkatan ke- tika pertanian ditetapkan dan tingkat kesejahteraan petani bingan lanjutan bagi lulusan sejahteraan petani. dipandang sebagai sektor stradan kontribusinya pada pen- bidang pertanian yang terinteSayangnya, kondisi riil tak tegis, tetapi yang terjadi justru grasi melalui penumbuhan sebagus harapan ideal. Akhir- kesejahteraan masyarakat yang dapatan nasional. Masalah pertanian di Indo- wirausahawan dalam bidang akhir ini ancaman alih fungsi berprofesi sebagai petani masih nesia secara garis besar dapat di- pertanian (inkubator bisnis). lahan kian tidak terkendali yang rendah dan memprihatinkan. kelompokkan menjadi dua fak- Keenam, melibatkan mahasiswa akan menyeret turun angka Sudah saatnya petani di tor, yaitu internal dan eksternal. dari berbagai disiplin ilmu, tidak produksi pertanian kita. Upaya negara ini memiliki kedaulatan Di faktor internal ada masalah hanya mahasiswa jurusan per- menjaga ketersediaan lahan dengan adanya jaminan bagi permodalan, prasarana pro- tanian, dalam program pem- harus diikuti dengan adanya mereka untuk mendapatkan duksi yang minim, keterampil- bangunan pertanian. jaminan terhadap pasokan air. kemudahan dalam mendapatan, rendahnya visi usaha untuk kan akses yang terkait dengan maju, manajemen produksi, aktivitasnya. Kedaulatan pePOROS MAHASISWA serta motivasi untuk bertani tertani dapat terwujud ketika seMulai 1 Maret 2013 rubrik “Suara Mahasiswa” akan berganti nama kadang menurun bahkan hilang. mua aspek yang terkait dengan menjadi “Poros Mahasiswa”. Selain berganti nama, konsep rubrik juga Sementara di faktor eksterkehidupan petani mampu terakan berubah, yaitu memuat pro-kontra pendapat dari tiap kampus negeri nal, yang menjadi permasalahan penuhi dengan baik mulai keatau swasta se-Indonesia terhadap adalah kebijakan pemerintah tersediaan sarana produksi suatu tema yang diberikan Redaksi. mengenai impor, kebijakan sampai dengan kesejahteraan Ketentuan panjang artikel yang dikirimkan antara subsidi yang tidak memihak ekonominya. Membangun ke400 hingga 450 kata. Artikel dapat dikirim ke e-mail petani, kebijakan alih fungsi tahanan dan kemandirian poros.mahasiswa.sindo@gmail.comdilengkapi dengan identitas lengkap, foto terbaru, scankartu tanda mahasiswa (KTM), serta nomor rekening. lahan, kebijakan finansial, kepangan harus dimulai dengan Dalam mengirimkan artikel harap mencantumkan nama lengkap dan asal lembagaan di sektor pertanian, bagaimana mewujudkan kekampus di judul e-mail. kebijakan dan isu global seperti daulatan petani yang menjadi Tema Poros Mahasiswa 19–30Maret: “Memajukan Sektor Pertanian” perdagangan bebas. ujung tombaknya. 

aksesori indah. Sementara jalan indah penuh aksesori yang mengundang selera dan syahwat adalah jalan politik dan kekuasaan. Jalan ilmu dan filsafat adalah jalan panjang bagai pohon yang lama berbuah. Jika berbuah, rasanya kadang pahit. Barulah jika diolah melalui proses yang rumit, buah ilmu itu terasa lezat yang bisa membuat ketagihan. Akibatnya, banyak orang lebih bersyahwat meniti jalan politik dan kekuasaan daripada jalan filsafat dan ilmu, lebih-lebih lagi menjelang tahun politik 2014. Dalam situasi demikian itulah banyak orang mulai mencari tolok ukur kepemimpinan yang bisa membawa bangsa ini menjadi lebih makmur dan berkeadilan. Secara berseloroh seorang teman melontarkan gagasan kecerdasan sosial sebagai basis utama kepemimpinan ideal. Pemimpin yang memilih jalan praksis ilmu dan filsafat guna mencapai kearifan dan kecerdasan sekaligus. Berbeda dari kecerdasan inteligensi yang sudah berlaku berabadabad dengan baku-uji terukur, kecerdasan sosial belum banyak dikenal dan belum banyak menjadi fokus kajian. Kecerdasan sosial lebih banyak berkaitan dengan persoalan kepemimpinan dalam kehidupan bersama dalam sebuah formula kebangsaan dan kenegaraan. *** Kecerdasan inteligensi seseorang tidak menjamin yang bersangkutan berhasil men-

jalanihidupsosialnya.Suksessosial seseorang dengan kecerdasan inteligensi tinggi masih memerlukankecerdasanemosional agar bisa berkomunikasi dengan orang lain atau kelompok lain secara lebih baik. Namun, bagi orangyangmenghadapipersoalan rumit yang belum pernah dihadapi sebelumnya yang membutuhkan sikap dan daya kritis tinggi, kecerdasan lain yang dikenal sebagai kecerdasan spiritual diperlukan. Kemampuan orang yang memiliki kecerdasan spiritual disebut para ahli sebagai fungsi variabel “Titik Tuhan” atau “God Spot”. Mereka yang memiliki kepedulian sosial tinggi sekaligus dikaruniai “Titik Tuhan” karena mampu menerobos melampaui tradisi (birokrasi dan lainnya) menyatu dengan jiwa rakyat hampir tanpa batas guna mencapai tujuan kolektif. Itulah pemilik kecerdasan sosial. Seorang kepala daerah tanpa aksesori yang blusukan ke loronglorong kumuh untuk mengerti rakyatnya, tidak segan masuk gorong-gorong, menyeberang jembatan yang mau roboh ikut merasakan kegetiran warganya, tanpa pengawal dan protokoler, merupakan beberapa contoh yang memberi indikasi kepemilikan kecerdasan sosial tinggi. Kepemimpinan profetik mendahulukan kepentingan publik menempatkan birokrasi dan lembaga sebagai alat memenuhi kepentingan publik. Jika perlu, pemimpin profetik itu melakukan tindakan yang bahkan melampaui tradisi

birokrasi menciptakan tradisi dan tata-nilai baru yang tidak lazim pada zamannya. Indikasi sosok pemimpin profetik demikian akan terlihat dari respons warga yang muncul dari berbagai kelompok melampaui batas-batas etnis, keagamaan, dan partai. Seperti seorang nabi, meski memperoleh mandat Tuhan, ia hidup menyatu dengan sesama sebagai manusia biasa membangun tradisi baru menerobos melampaui tradisi pada zamannya. Dalam dunia pewayangan kita kenal tokoh Semar, seorang dewa yang menjalani hidup sebagai pelayan para ksatria. Semarlah yang sebenar-benarnya sang pemimpin. Perilaku profetiknya menjadi dasar bagi semua orang untuk menempatkannya sebagai bagian dari hidupnya sebagai wonge dewe (Jawa), wong kito (Palembang), orang kita. Sosok pemimpin profetik demikian menjadi milik bersama diakui sebagai bagian kehidupan melampaui batas-batas etnis, keberagamaan, dan keberpartaian. Jalan sunyi kepemimpinan profetik tersebut secara primordial lebih dikenal sebagai almahdiatau satrio piningit(Jawa) yang semakin hari semakin dirindukan kehadirannya. Siapa mau meniti jalan sunyi kekuasaan sebagai pemimpin profetik bagai dewata yang mewujud sebagai pelayan rakyat seperti Semar? Mungkin muncul pada 2014 atau sekadar sebuah harapan. Lumayan ... Sekurangnya masih ada harapan, ada asa, bukan putus asa! 



9:21 PM

Page 1




China Borong 24 Jet Tempur Rusia BEIJING – China sepakat membeli 24 pesawat tempur Su-35 Rusia. Ini merupakan pembelian senjata berteknologi tinggi terbesar China dalam kurun waktu satu dekade terakhir. Laporan People’s Daily kemarin menyebutkan, selain pesawat tempur, Beijing juga membeli empat kapal selam Rusia. Kesepakatan itu ditandatangani pada akhir pekan lalu sebelum kunjungan Presiden China Xi Jinping ke Rusia. Sayangnya, tidak disebutkan berapa nilai transaksi tersebut. Kesepakatan ini sebagai bukti kuat keinginan Beijing untuk meningkatkan kemampuan militer mereka. Apalagi, China juga sedang terlibat ketegangan teritorial dengan Jepang dalam perebutan kepulauan di Laut China Timur. ”Dua kapal selam bakal dirakit di Rusia, dan dua lainnya dibuat di China. Pesawat tempur Su-35 dapat efektif untuk mengurangi tekanan terhadap pertahanan udara China sebelum pesawat siluman China dapat beroperasi,” demikian laporan koran propaganda Partai Komunis China ini. China dan Rusia diperkirakan bakal meningkatkan kerja


sama pengembangan teknologi militer, termasuk misil jarak jauh anti-pesawat S-400, mesin berkekuatan besar 117S, pesawat transportasi IL-476, dan tanker pesawat pengisi bahan bakar di udara IL-78. Namun, Kementerian Pertahanan China tidak memberikan komentar menge-

nai laporan tersebut. Sebelumnya Presiden Xi berkunjung ke Moskow pada Jumat (22/3) hinggaMinggu(24/3)laluuntuk mempererat kerja sama dalam berbagaibidangdenganRusia.Xi juga bertemu langsung dengan Presiden Rusia Vladimir Putin. Itu merupakan perjalanan pertama Xi ke luar negeri sejak menjadi kepala negara pada awal bulan ini. Rusia dan China juga menan-

datangani sekitar 30 perjanjian di bidang energi dan bidang lainnya selama kunjungan itu. Xi juga bertemu Menteri Pertahanan Rusia Sergei Shoigu dan menjadi pemimpin asing pertama yang mengunjungi pusat kendali angkatan bersenjata Rusia. Dalam kunjungan tersebut, Xi dan Putin ingin menunjukkan bahwa kedua negara itu memiliki persamaan pandangan.

Kedua pemimpin juga ingin menunjukkan kepada dunia bahwa hubungan politik tingkat tinggi mereka dapat diwujudkan dalam kerja sama yang lebih konkret. Selain itu, Xi bertemu dengan Perdana Menteri (PM) Rusia Dmitry Medvedev. ”Hubungan China dan Rusia merupakan salah satu hal penting di dunia dan juga menjadi salah satu pemain penting dalam kekuatan dunia,” kata Xi dalam pidatonya di Moscow State Institute of International Relation pada Sabtu (23/3) lalu. Kedua negara juga berjanji

Pemimpin Oposisi Suriah Mundur


AS-Korsel Buat Kesepakatan Militer Baru

BEIRUT – Pemimpin oposisi Suriah Ahmed Moaz al-Khatib menyatakan pengunduran dirinya dari kepemimpinan Koalisi Nasional (NC) pada Minggu (24/3) waktu setempat. Langkah yang diambil Khatib menjadikan kubu oposisi semakin kacau menjelang Konferensi Tingkat Tinggi (KTT) Arab. ”Saya mengumumkan pengunduran diri dari NC sehingga saya dapat bekerja dengan kebebasan yang tidak mungkin dimiliki oleh institusi resmi,” kata Khatib dalam pernyataan yang diunggah di akun situs jejaring sosial Facebook, dikutip AFP. Pengunduran diri Khatib menyebabkan oposisi Suriah di ambang perpecahan. Padahal, negara-negara Arab memberikan kesempatan bagi kubu oposisi untuk duduk bersama Liga Arab.


SEOUL – Korea Selatan (Korsel) dan Amerika Serikat (AS) resmi membuat pakta baru terkait militer gabungan untuk merespons provokasi yang dilakukan Korea Utara (Korut). Kedua negara sekutu sepakat perjanjian ini sebagai bentuk tekanan baru bagi Pyongyang yang telah mengecam latihan militer yang dilakukan kedua negara tersebut. Perjanjian sebelumnya mengatur keterlibatan AS dalam konflik sekala besar. Sementara, protokol baru ini membahas respons terhadap tindakan tingkat rendah seperti penyerangan di lintas perbatasan. ”Perjanjian ini memperbolehkan kedua negara bergabung untuk merespons provokasi lokal Korut,” terang juru bicara Kementerian Pertahanan Korsel Kim Min-Seok dikutip AFP. Sebagai informasi, AS telah memiliki 30.000 pasukan yang ditempatkan di Korsel dengan tugas membawa bala bantuan dari pangkalan militer di Jepang. (susi susanti)



Pengunduran diri Khatib hanya beberapa hari setelah Ghassan Hito terpilih sebagai perdana menteri (PM) kubu oposisi. Terpilihnya Hito berusaha memecahkan kebuntuan dalam pemberontakan terhadap Presiden Bashar al-Assad. ”Dalam dua tahun terakhir, kita menjadi korban pembunuhan oleh rezim yang kecam, ketika dunia hanya melihat,” kata Khatib.


Dia menuturkan kerusakan infrastruktur Suriah, pembebasan puluhan ribuan tahanan, dan berbagai bentuk penderitaan rakyat Suriah, tidak cukup bagi komunitas internasional untuk membuat keputusan bagi rakyat untuk membela diri sendiri. ”Saya telah membuat janji kepada rakyat kita bahwa saya akan mengundurkan diri jika garis merah telah dilintasi.” Dia juga menegaskan kalau dunia gagal membantu para pemberontak dan dia berjanji akan bekerja sama dengan pihak luar koalisi. Kantor NC maupun Dewan Umum NC belum menerima pengunduran diri Khatib. “Beberapa anggota koalisi telah meminta Khatib untuk kembali ke posisinya,” ujar sumber oposisi yang enggan disebutkan namanya. NC juga belum memutuskan untuk menerima

untuk membangun hubungan dua kekuatan besar dengan model baru di dunia. “Kerja sama ini bakal menjadi jaminan penting dalam keseimbangan strategis internasional,” papar Xi, seperti dikutip Xinhua. Pandangan Xi dibenarkan Sergei Lousianin, Deputi Direktur Institut Timur Jauh di Rusia. Lousianin memandang hubungan China dan Rusia sebagai “stabilisator” dalam keamanan dan perdamaian global. Hal senada juga diungkapkan YakovBergerdariInstitutTimur Jauh. “Hubungan China-Rusia itu bukan sebuah blok, per-

satuan atau persekutuan, tetapi sebuah kemitraan sejati,” kata Yakov Berger. Dulu, Moskow dan Beijing sempat bermusuhan selama Perang Dingin. Namun, kini kedua negara justru memperkuat kerja sama dalam beberapa tahun terakhir untuk mengimbangi dominasi global Amerika Serikat (AS). Apalagi, Presiden AS Barack Obama memfokuskan konsentrasi kebijakan luar negeri di Asia Pasifik. Pada awal bulan ini China mengumumkan kenaikan lebih dari dua digit anggaran pertahanannya dengan menaikkannya sebesar 10,7% sehingga menjadi USD116,3 miliar pada 2013. Anggaran pertahanan China selalu menunjukkan kenaikan dari tahun ke tahun. Sebenarnya China berulang kali meminta dunia agar tidak perlu khawatir dengan besarnya belanja militer Beijing. Mereka berkilah bahwa anggaran militer China masih sedikit dibandingkan Pentagon. Sebelumnya China telah mengumumkan ambisi militer jangka panjangnya, termasuk di antaranya uji coba pesawat tempur siluman pada awal 2011 dan peluncuran sebuah kapal induk. Dua teknologi tempur terbaru China itu masih membutuhkan beberapa tahun pengembangan sebelum mencapai tahap kematangan. Beijing juga membangun kapal selam baru dan kapal anti-rudal balistik sebagai bagian dari modernisasi angkatan laut. ● andika hendra m


pengunduran diri Khatib atau tidak. Qatar selaku pendukung oposisi Suriah menyerukan agar Khatib membatalkan keputusannya. Perdana Menteri (PM) Qatar Sheikh Hamad bin Jassem Al-Thaniberharap,Khatibmempertimbangkan keputusan pengunduran dirinya. ”Karena, saat ini merupakan masa kritis dan momen yang sangat penting,” kata Hama, dikutip QNA, kantor berita Qatar. Sumber oposisi di Doha, tempat KTT Liga Arab pada Selasa (hari ini), mengungkapkan bahwa Khatib menuding negara tertentu, khususnya Qatar, ingin mengontrol oposisi setelah terpilihnya Hitto. Sedangkan,MenteriLuar Negeri Amerika Serikat (AS) John Kerry mengaku tidak terkejut dengan pengunduran diri Khatib.

Khatib terpilih memimpin NC pada November 2012. Dia dianggap sebagai pemimpin yang dihargai dan tokoh pemersatu di Suriah. Meskipun, dia membuat kontroversi pada Januari lalu saat menawarkan perundingan dengan Presiden Suriah Bashar al-Assad dengan syarat pembebasan 160.000 tahanan. ● andika hendra m

Malaysia Pindah Warga dari Daerah Konflik KUALA LUMPUR – Perdana Menteri (PM) Malaysia Najib Tun Razak memerintahkan untuk segera merelokasi warga yang berada di sejumlah wilayah yang rentan dimasuki penyusup asing. Langkah ini diputuskan setelah pemerintah menyadari beberapa wilayah pemukiman yang rentan, terutama di wilayah perbatasan, menjadi jalan masuk yang mudah bagi imigran ilegal, termasuk orangorang yang tidak memiliki kewarganegaraan. Ini menjadi penyebab utama penyusupan 200 orang pemberontak Sulu di Lahad Datu dan wilayah lain di timur Sabah. Pemberontak atau yang disebut teroris ini pun telah menimbulkan masalah pelik di timur Sabah, dekat selatan Filipina. ”Sebab utama penyusupan teroris adalah pemukiman warga setempat diperkirakan mudah disusupi imigran gelap dan orang tanpa kewarganegaraan,” terang Najib, dikutip AFP. Diketahui, para pemberontak yang mengaku pendukung Sultan Filipina mendarat di Sabah sejak enam pekan lalu. Mereka mengklaim Sabah adalah milik mereka. Konflik berdarah ini telah menewaskan

lebih dari 70 orang yang kebanyakan berasal dari pemberontak. Insiden ini juga telah membuat hubungan Malaysia dengan Filipina mengalami ketegangan. Dia menambahkan, relokasi akan memengaruhi wilayah di dekat tempat penyerangan namun bisa diperluas hingga ke seluruh negara bagian. Sayangnya Najib tidak memberikan informasi detil terkait rencana relokasi tersebut. ”Keputusan untuk memindahkan individu atau kelompok orang adalah bagian dari menjaga keamanan publik,” terangnya. ”Dalam melakukan relokasi ini, pemerintah akan mempertimbangkan faktor keamanan dan kesejahteraan, bukan hanya untuk warga yang dipindahkan tapi juga warga yang telah tinggal di wilayah tersebut sebelumnya,” ungkapnya saat parade kebersamaan perayaan Hari Polisi Ke-206 di Pusat Pelatihan Polisi (Pulapol). Saat ini diperkirakan, sekitar 800.000 orang Filipina tinggal di Sabah, di mana jumlah penduduknya mencapai lebih dari 3 juta orang. Pemerintah memastikan pemukiman itu nantinya tidak akan merugikan warga terkait hak politiknya. ● susi susanti



12:23 AM

Page 2




TNI Pasrahkan ke Polri (( dari Hal 1 Dia berjanji akan memeriksa secara utuh, mulai dari proses pelanggaran hukum yang dilakukan para korban, penetapan tersangka,sampaipenitipanmereka dari Markas Polda (Mapolda) Daerah DIY ke Lapas Cebongan. Namun, Timur menggariskan bahwa pihaknya tidak akan terburu-buru memberikan hasil penyelidikan di lapangan. Menurut dia, penyidik juga membutuhkan hasil laboratorium dan analisis guna memastikan kepastian barang bukti. “Kita minta ke rekanrekan untuk memberikan kesempatan melakukan olah TKP (tempat kejadian perkara),” ungkap Timur. Dari Yogyakarta, Kapolda DIY Brigjen Pol Sabar Rahardjo mengungkapkan, proses olah tempat kejadian perkara (TKP)

penyerangan di Lapas Cebongan sudah selesai dilakukan. Namun, untuk mengaitkan hasil olah TKPdenganprosespenyelidikan selanjutnya, dia mengakui pihaknya masih kesulitan. “Kita masih menganalisis. Itu membutuhkan waktu yang lama,” katanya. Sejak kasus penyerangan itu hingga kemarin kepolisian terus melakukan penyelidikan intensif. Hanya, Kapolda enggan membeberkan hasil perkembangan penyelidikan yang telah dilakukan, termasuk jenis proyektil yang dikabarkan berkaliber 7,62 milimeter dan merupakan standar senjata jenis AK dan Stayer. “Masih saya rahasiakan, tidak boleh saya buka, masih dianalisis oleh Labfor Mabes Polri,” tandasnya. Pengamat militer dari Lembaga Ilmu Pengetahuan Indo-

nesia (LIPI) Jaleswari Pramodawardhani meminta penyelesaian bentrokan antara anggota TNI dan Polri harus dilakukan secara komprehensif dan berorientasi jangka panjang agar kasus tersebut tidak akan terulang lagi. Dia meyakini penyerangan Lapas Cebongan yang menewaskan empat tahanan tersebut buntut dari kematian seorang anggota TNI yang dikeroyok di sebuah kafe di Sleman, Yogyakarta. “Kita juga mengimbau PresidenSusiloBambangYudhoyono untuk memerintahkan Kapolri dan Panglima TNI segera mengusut dan menyelesaikan kasus penyerbuan ke Lapas Cebongan,’’ ucapnya. Lapas Cebongan pada Sabtu (23/3) dini hari lalu diserang kelompok terlatih dan bersenjata yang diduga berjumlah

17 orang. Penyerangan dilakukan untuk mengeksekusi empat tahanan tersangka pembunuhan anggota TNI AD dari Kesatuan Kopassus Kandang Menjangan, Kartasura, Sersan Satu Heru Santoso, 31, di Hugo’s Cafe Maguwoharjo yang terjadi sebelumnya. Para korban yaitu Angel Sahetapi alias Deki, 31, Adrianus Candra Galaga alias Dedi, 33, Gameliel Yermiayanto Rohi alias Adi, 29, dan Yohanes Yuan, 38. Mereka tewas setelah diberondong dari jarak dekat. Total peluru yang dimuntahkan sebanyak 31 buah. Hingga kemarin kelompok dimaksud belum bisa diidentifikasi. Empat jenazah kemarin sudah diterbangkan ke daerah asal mereka, Nusa Tenggara Timur, melalui kargo Bandara Internasional Adisutjipto de-

ngan pesawat Lion Air. Pemberangkatan dilakukan dalam dua tahap yaitu pukul 06.50 WIB dan pukul 09.35 WIB masingmasing dua jenazah.

Sudah Berkoordinasi Kapolda DIY Brigjen Pol Sabar Rahardjo menuturkan, pemindahan tahanan dari Mapolda DIY ke Lapas Cebongan sudah melalui prosedur yang tepat. Prosedur dimaksud mulai dari kecepatan memproses berkas yang sudah selesai, persoalan kondisi ruang tahanan polda yang tidak memadai, dukungan jaminan keamanan untuk melakukan pemindahan, dan persetujuan dari petugas lapas. “Saya sudah koordinasikan dengan aparat keamanan danrem, panglima saya telepon, saya jamin dik, tidak akan ter-

8 Korban Ditemukan Meninggal, 9 Masih Tertimbun (( dari Hal 1 Dia lantas ke luar rumah dan berusaha menolong karena ada penghuni rumah yang terjebak di dalamnya. Tidak lama kemudian dia mendengar suara ledakan yang berasal dari Bukit Arca yang tepat berada di atas rumahnya. “Begitu mendengar ledakan keras, saya langsung ingat keluarga. Pas saya tiba di rumah, kondisi rumah sudah hancur. Beruntung, anak dan istri saya sudah menyelamatkan diri di luar,” kata Pepen yang rumahnya ikut hancur dihantam longsoran tanah. Warga Kampung Nagrok, Asep Litah, 28, mengungkapkan, bencana longsor di kampungnya terjadi paling akhir setelah sebelumnya di Kampung Barumuncang dan Cikareo. Dia melihat bagaimana awalnya tanah retak dan longsor dari Bukit Dipatiukur. Longsor tanah setinggi kurang lebih 1 kilometer itu terjadi selama 5 menit sebelum gundukan tanah menghantam rumahrumah warga. “Saya lagi di depan rumah. Tiba-tiba melihat tanah bergerak dari atas bukit yang menimbun satu per satu

rumah yang dilaluinya,” kata Asep. Warga lain, Siti Rohmah, 23, mengakui pada malam sebelum kejadian mendengar suara teriakan anak kecil yang meminta tolong. Dari balik hutan yang menjadi titik longsoran, dia bahkan mendengar suara burung-burung aneh yang berbunyi saling bersahutan. Sejak itu tidurnya tidak pulas dan selalu gelisah sebelum akhirnya pada pukul 05.30 WIB bencana longsor terjadi. “Setelah ledakan keras, tanah bergetar, lalu ada suara gemuruh. Selang beberapa waktu, suara teriakan minta tolong terdengar yang membuat saya dan suami keluar ke rumah,” kata Siti yang mengaku masih tidak percaya dengan kejadian yang menimpa kampungnya. Pengalaman lebih tragis dituturkan Ipon. Dia melihat rumah tetangganya, Dedi, tertimbun seluruhnya oleh material tanah merah yang berasal dari Bukit Arca. Dia tidak menyangka pertemuannya dengan Dedi pada Minggu (24/3) sore merupakan yang terakhir. Tidak ada ihwal aneh yang dia

lihat sebelum kejadian. Hanya sebagian warga di Kampung Nagrok cukup dibuat khawatir dengan hujan yang turun terusmenerus. Apalagi rumahrumah di daerah ini rata-rata berada di lokasi yang tanahnya miring. “Saya selesai menjemur pakaian, tiba-tiba mendengar suara gemuruh seperti pesawat dan suara pohon-pohon yang patah,” ungkapnya.

Tanggap Darurat KepalaBadanPenanggulangan Bencana Daerah (BPBD) Kabupaten Bandung Barat Maman Sulaiman mengatakan, pencarian dihentikan untuk sementara pada pukul 16.30 WIB kemarin karena kondisi alat yang terbatas, cuaca hujan, dan penerangan minim. Berdasarkan data di lapangan, mereka yang sudah teridentifikasi meninggal dunia atas nama Tedi, 13, Dedi, 27, Agus, 5, Tika, 26, Fitri, 8, Aditia, 3, dan Teten, 28, dan Safaat, 8. Sedangkan yang masih dalam pencarian adalah Entis, 55, Tuti, 48, Imas, 55, Iis, 18, Jesica Aulia, 3 bulan, Taryati, 26, Cecep Hadiansyah, 22, Ros, 32, dan Resti, 3.

Adapun warga yang mengalami luka dan dibawa ke rumah sakit yakni Adin, 47, Aneng, 40, Cici, 10, Yeni, 30, Siti Nabila, 8, dan Lapi Saputra, 2. “Korban yang sudah ditemukan setelah disalatkan langsung dimakamkan oleh keluarga (korban). Beberapa dari mereka ada yang kondisi tubuhnya rusak,” kata Maman. Keluarga korban yang selamat sudah dievakuasi ke posko bencana yang berada di rumah warga, sekolah, dan masjid. Menurut Maman, longsor susulan masih berpotensi terjadi terlebih jika hujan deras mengguyur kembali daerah tersebut. Dusun Lembang oleh BPBD terindikasi masuk wilayah zona merah yang memiliki kerentanan sangat tinggi terhadap longsor karena kondisi geografisnya yang banyak dikelilingi bukit. “Kondisi tanggap darurat ditetapkan selama tujuh hari ke depan dan bisa diperpanjang hingga dua puluh satu hari karena lokasi ini masih berpotensi longsor susulan akibat tanahnya masih labil,” paparnya. Gubernur Jawa Barat Ahmad Heryawan beserta Bupati Ban-

dung Barat Abubakar meninjau lokasi longsor di Kampung Nagrok. “Warga yang selamat harus diungsikan ke tempat yang lebih aman. Jangan dulu memaksakan tinggal di rumah yang kondisinya terancam. Kita ambil upaya preventif sebelum jatuh korban tambahan,” ucap Heryawan. Berdasarkan keterangan Pusat Vulkanologi Mitigasi Bencana dan Geologi (PVMBG), hampir seperempat wilayah di Jawa Barat masuk zona kerentanan gerakan tanah tinggi. Menurut Penyelidik Gerakan Tanah PVMBG Yunara Dasa Triana, zona tersebut sebaiknya dihindari sebagai lokasi permukiman atau bangunan vital dan strategis. Berdasarkan catatannya, selama 2013 terjadi 18 kali pergerakan tanah yang tersebar di 19 lokasi berbeda di Jawa Barat. Dari peristiwa itu, 13 orang meninggal dunia dan 10 orang lain menderita luka-luka. “Jumlah tersebut belum ditambah jumlah korban peristiwa di Cililin,” tambahnya. ● adi haryanto/ agung bakti sarasa/ yugi prasetyo

Sehari sebelum pengumuman kelulusan CPNS Kemenkumham Jatim, yaitu tanggal 15 Oktober 2012 malam hari, aku bermimpi. Dalam mimpiku itu bapak memakai baju dinasnya lengkap dengan atribut yang dipakai sedang melambaikan tangan sambil tersenyum memanggilku. Aku pun datang menghampiri bapakku. Bapak berkata, “Le, ini bapak bawa Surat Keputusan CPNS buat kamu. Kamu keterima, le. Selamat ya? Terus ini baju dinas yang kupakai aku berikan ke kamu. Jadilah pegawai yang baik.” Keesokan harinya ternyata apa yang aku mimpikan selama ini menjadi kenyataan. Apa yang aku perjuangkan selama ini ternyata berhasil. Apa yang aku doakan ternyata dikabulkan. Terima kasih ya Allah, atas izinmu aku lolos tes CPNS Kemenkumham tahun 2012 dengan cara yang bersih, tidak curang, tidak lewat calo, dan tidak mengeluarkan uang sepeser pun kecuali untuk keperluan-keperluan tes. Aku hari itu sangat bahagia. Semua anggota keluargaku mendatangiku

mengucapkan selamat sambil menangis haru.” Cerita kedua yang saya ingin bagi adalah dari Muhammad Ilham. Dia menuliskan, pada hari kelulusan, Ilham mengecek situs pengumuman: “Saya terus scroll ke atas dan akhirnya saya menemukan nama saya urutannya paling atas di Formasi Pengaman Pemasyarakatan. Saya berteriak Alhamdulillah, keras sekali sampai tetangga saya bertanya, ada apa. Saya langsung sujud syukur dan menangis gembira tiada hentihentinya. Saya telepon ibu saya agar pulang ke rumah. karena ibu saya jualan sembako dan hanya saya yang bantu-bantu. Beliau berjualan di pasar. Ibu saya tanya, “ada apa”. Tapi saya belum memberitahukannya dan hanya menyuruhnya pulang sebentar ke rumah. Sesampainya ibu di rumah, beliau melihat saya menangis. Beliau kaget ada apa. Akhirnya, saya memberitahukan bahwa saya lolos seleksi CPNS Kemenkumham 2012. Saya langsung peluk dan cium ibu saya. Ibu saya pun juga me-

jadi apa-apa, begitu,” ucapnya kemarin. Dia juga menuturkan, sebelum penyerangan di Lapas Cebonganterjadi,pihaknyatidak menerima laporan dari ajudan ada permintaan bantuan pengamanan seperti yang disampaikan petugas lapas maupun kakanwil Kemenkumham DIY. Namun, dirnarkoba yang menerima telepon langsung menghubungi wakapolda. “Wakapolda sudah berkoordinasi dengan danrem. Saya ditugaskan patroli ke sana. Menurut informasi danrem katanya sudah memerintahkan ke denpom,” paparnya. Kepala Kanwil Kemenkumham DIY Rusdianto saat dihubungi terpisah menuturkan, sebelum kejadian malam itu, dia dihubungi kalapas Cebongan yang menginformasikan ada

kekhawatiran terkait penitipan empat tahanan dari polda. Dia lantas meminta bantuan ke polda untuk memberikan bantuan pengamanan. “Saya malam itu di Bandung saat dihubungi kalapas. Tapi, saya kuatkan menghubungi kapolda, tidak terhubung. Saya hubungi direskrimum, ya tidak bisa. Kemudian hubungi dirnarkoba,” tuturnya. Selanjutnya dirnarkoba langsung menghubungi ajudan kapolda. Namun, menurut laporan yang dia terima, saat dihubungi dirnarkoba, ajudan mengatakan bahwa kapolda tengah istirahat. “Tapi yang jelas katanya sudah ada pengamanan secara tertutup,” ungkapnya. ● rarasati syarief/ muji barnugroho/ priyo setyawan/ rahmat sahid/ant

Tiga Nama Calon KSAD Disetor ke Presiden JAKARTA – Kepala Staf TNI Angkatan Darat (KSAD) Jenderal TNI Pramono Edhie Wibowo mengajukan tiga nama calon KSAD kepada Presiden Susilo Bambang Yudhoyono (SBY). Tiga kandidat itu kader terbaik TNI yang dinilai pantas dan kredibel untuk memegang puncak komando TNI AD. “Syukur alhamdulillah, ada beberapa (calon KSAD) yang saya ajukan sebagai alternatif karena ada beberapa wewenang juga dari panglima TNI,” kata Pramono di Kompleks Istana Merdeka, Jakarta, kemarin. Adik kandung Ibu Negara Ani Yudhoyono ini memastikan, tiga calon KSAD itu berpangkat letnan jenderal atau bintang tiga. Soal nama dia enggan membocorkan. Mengenai siapa nanti yang terpilih, itu wewenang Presiden. ”Nanti (kalau saya sebut), mendahuluiPresiden.Jaditunggu saja,” kata mantan Pangkostrad ini. Pramono akan memasuki masa pensiun pada 5 Mei mendatang atau tepat saat dirinya

berusia 58 tahun. Berdasarkan peraturan militer, dia harus diganti sebelum akhir Mei. ”Tidak boleh berganti bulan karena status saya sudah pensiun,” kata jenderal kelahiran Magelang, 5 Mei 1955 ini. Ketua Komisi I DPR Mahfudz Siddiq mengungkapkan, siapa yang akan menggantikan Pramono Edhie sebagai KSAD merupakan wewenang penuh Presiden SBY. Mahfudz mengaku sudah mengetahui namanama yang disiapkan. ”Tetapi biarlah itu menjadi ranahnya Presiden untuk memilih yang tepat dan dinilai mampu mengemban tugas ke depan,” katanya. Anggota Komisi I DPR dari Fraksi Partai Demokrasi Indonesia Perjuangan (FPDIP) Tjahjo Kumolo mengatakan, Wakil KSAD Letjen TNI Moeldoko memiliki kans kuat untuk menggantikan Pramono. ”Dia berpotensi sebagai salah satu calon,” katanya. ● rarasati syarief/ rahmat sahid

nangis. Mengingat banyak tetangga yang berkata kepada ibu saya, “Berat bu, Ilham bisa lolos, karena pasti banyak “bawaan””. Tapi, ibu saya tidak pernah menanggapinya. Alhamdulillah terbukti omongan orang lain itu tidak benar. Bahwa saya dapat lolos seleksi Kemenkumham dengan hasil murni tanpa mengeluarkan uang sepeser pun. Semua tetangga pada terkejut, dan memberi ucapan selamat kepada saya dan ibu. Tidak lama berita itu cepat tersebar dari mulut ke mulut. Mereka seakan tidak percaya saya bisa lolos dengan hasil murni tanpa mengeluarkan uang seperti yang mereka bicarakan. Semua teman mengaji memberi selamat kepada ibu dan ada yang sampai menangis terharu. Anak yatim yang dibesarkan hanya dari kasih sayang seorang ibu membuat bangga keluarga. Ibu saya sangat bangga kepada saya dan saya persembahkan kelulusan ini kepada Alm. Ayah saya.” Demikian dua contoh cerita CPNS 2012. Masih banyak cerita lain yang juga inspiratif dan menguatkan semangat

kami agar terus menjaga setiap proses seleksi CPNS betul-betul menjadi “calon pegawai nihil setoran”. Proses yang fair, adil, tanpa titipan, tanpa setoran, dan nihil penyimpangan dalam bentuk apa pun. Kepada semua CPNS 2012 yang akan memulai darma baktinya pada 1 April 2013, izinkan kami menitipkan pesan. Selain memulai dengan bismillah, tolong jaga proses penanaman benih yang telah kami lakukan. Kami, panitia CPNS 2012, telah menyemaikan benih seleksi yang penuh integritas. Tolong benih itu dirawat dengan baik. Tolong jaga integritas itu. Bawa dia ke mana pun rekan-rekan CPNS 2012 melaksanakan tugas. Jadilah pohon-pohon integritas yang kokoh, yang tidak akan mempan dengan pungli, yang akan terus berjuang melawan korupsi, membasmi ketidakadilan dalam bentuk apa pun. Demi Indonesia yang lebih baik, lebih antikorupsi. Keep on fighting for the better Indonesia. ●

Awali Bismillah, Jaga Integritas (( dari Hal 1 Karena itu, Kemenkumham akan memberikan seluruh dukungan (full support) dan seluruh kekuatan (full power) untuk membantu pengungkapan siapa pelaku pembunuhan tersebut. Sampai di situ dulu tahapan pembahasan tragedi penyerangan ke Lapas Sleman, selebihnya mari kita kawal dan dukung agar aparat kepolisian menyelesaikan penyelidikan dan menemukan pelakunya. Prosesnya memang perlu transparan dengan catatan. Catatannya, setiap proses hukum tetap mempunyai ruang cukup untuk kerahasiaan. Tidak semua proses hukum dapat diketahui karena jika setiap informasi terbuka secara prematur, justru dapat mengganggu proses penyelidikan kasus yang bersangkutan. Dengan pertimbangan demikian, saya memutuskan untuk menulis topik yang lain. Saya memilih untuk menuliskan lagi kolom terkait seleksi CPNS (calon pegawai negeri

sipil) yang harus dijaga agar tetap bersih, tanpa titipan, tanpa sogokan, dan nihil penyimpangan. Senin depan, pada 1 April, secara serentak di seluruh Indonesia lebih kurang 2.500 CPNS Kemenkumham hasil seleksi 2012 akan mulai masuk kerja, memulai dedikasinya menjaga hukum dan menegakkan hak asasi manusia di Tanah Air. Beberapa dari CPNS 2012 mengirimkan pesan Twitter menanyakan apa modal mereka memulai kerja. Saya katakan, “Mulai dengan bismillah, jaga integritas.” Seleksi CPNS tahun 2012 di Kemenkumham memang kami jaga agar betul-betul bersih, betul-betul fair buat semua peserta. Karena itu, di samping diawasi oleh pengawasan internal oleh Inspektorat Jenderal, kami juga mengajak pengawas internal dari elemen LSM, Ombudsman, dan mahasiswa. Hasilnya, insya Allah, adalah hasil seleksi yang lebih bersih. Banyak cerita menarik dari para CPNS yang kemudian saya

minta untuk dituliskan. Beberapa di antaranya cerita inspiratif dan mengharukan dari yang berlatar belakang keluarga sederhana seperti anak-anak sipir di Kemenkumham sendiri hingga penjual martabak. Cerita-cerita ini sengaja saya kumpulkan dan akhirnya akan diterbitkan. Berikut adalah cuplikan saja dari beberapa di antaranya. Cerita pertama adalah pengalaman Putra Adi Taqwa. Ayahnya seorang sipir penjara di Rumah Tahanan Negara, Trenggalek. Putra juga mengikuti tiga kali tes CPNS sebelum akhirnya ia lulus pada 2012. Putra menuliskan: “Pada pertengahan bulan Juli 2012 itu pula aku mendapat kabar dari bapak bahwa telah dibuka pendaftaran CPNS Kemenkumham. Aku ikut lagi untuk yang keempat kalinya. Hawa pesimistis untuk diterima begitu kuat menghantui perasaanku waktu itu. Maklum saja aku sudah tiga kali daftar namun gagal. Namun sebisa mungkin rasa pesimistisku harus kubuang jauh-jauh.



12:06 AM

Page 16












25 - 32

22 - 30

23 - 32

24 - 33

23 - 32

24 - 34

24 - 34

Palembang Pontianak

24 - 33

23 - 34




25 - 32

25 - 34

23 - 33


Sumber: Badan Meteorologi Klimatologi dan Geofisika (BMKG)

Agus Martowardojo menyapa fotografer dan wartawan yang menunggunya sebelum menjalani fit and proper test di Gedung DPR Jakarta kemarin. Anggota Dewan puas atas jawaban Agus dalam tes tersebut.


Ratusan Kepala Roket Asap Diekspor ke Cile MALANG-Industripertahanan Tanah Air kembali membuktikan mampu bersaing di level global. PT Sari Bahari, perusahaan alat pertahanan di Malang, Jawa Timur,berhasilmengekspor260 kepala roket asap (smoke warhead) kaliber 70 milimeter ke Cile. Ini ekspor perdana pabrik swasta tersebut.

”Teknologi smoke warhead merupakan karya anak bangsa dan sudah dipatenkan.” RICKY HENDRIK EGAM

Direktur Utama PT Sari Bahari

Direktur Utama PT Sari Bahari Ricky Hendrik Egam menjelaskan, ekspor bekerja sama dengan perusahaan asal Cile, Fabricas y Maestranzas del Ejercito (Famae). “Kami berhasil menyisihkan 43 negara dalam tender internasional untuk pengadaan smoke warhead ini,” ujar Ricky seusai peluncuran ekspor di workshop PT Sari Bahari, Kota Malang, kemarin. Hadir dalam acara ini Direktur Jenderal Potensi Pertahanan Kementerian Pertahanan Pos M Hutabarat. Ricky mengungkapkan, ekspor kepala roket asap membuktikan ada pengakuan terhadap kualitas produksi alat pertahanan buatan dalam negeri. Dalam tender tersebut, smoke warhead produksi PT Sari Bahari mengungguli produk serupa dari beberapanegaramajusepertiAmerika Serikat dan Rusia. ”Smoke warheadini sudah digunakan jajaran TNI sejak 2000 untuk latihan ketepatan menembak, baik dari udara ke darat maupun dari darat ke udara,” katanya.

Menurut dia, smoke warhead merupakan kepala roket dengan diameter 70 mm, berfungsi memberikan informasi pada pilot tentang posisi persis jatuhnya roket mereka. Smoke warhead ini memiliki sejumlah keunggulan. Dari sisi teknologi, dia mampu mengepulkan asap hingga dua menit setelah mengenai sasaran. ”Sementara produk lain hanya satu menit,” ungkapnya. Berdasarkan spesifikasi, smoke warhead memiliki berat 3 kilogram (kg), panjang 250 mm, diameter 70 mm, dan berat isi 130 gram. Adapun smoke content adalah TiCL4PA-Grade. ”Teknologi smoke warhead merupakan karya anak bangsa dan sudah dipatenkan,” kata Ricky. Direktur Jenderal Potensi Pertahanan Kementerian Pertahanan Pos M Hutabarat mengatakan, ekspor alutsista itu melengkapi pencapaian yang telah dilakukan beberapa industri pertahanan lain seperti PT Pindad dan PT Dirgantara Indonesia. “PT Pindad memproduksi senjata serbu (SS) 2 yang selalu menjadi juara dalam ketepatan menembak di tingkat internasional,” ucapnya. Adapun PT DI misalnya telah mengekspor pesawat angkut militer VIP, CN235 ke Senegal, Afrika. Hal senada diungkapkan Rektor Universitas Muhammadiyah Malang Muhajir Efendi. Menurut dia, kemampuan PT Sari Bahari menembus pasar Amerika Selatan merupakan prestasi luar biasa. Sebab, pasar di kawasan itu sedang dikuasai Brasil. Peningkatan anggaran pertahanan, Hutabarat mengatakan, akan dilaksanakan bertahap hingga keseluruhan tercapai pada 2024. Saat ini anggaran pertahanansebesarRp82triliun. yuswantoro

Agus Marto Dicecar tentang Century JAKARTA – Calon tunggal gubernur Bank Indonesia (BI), Agus Martowardojo, dicecar soal keterlibatannya pada kasus Hambalang dan Bank Century dalam fit and proper test di Gedung DPR kemarin. Anggota Komisi XI dari Fraksi Partai Demokrasi Indonesia Perjuangan Arif Budimanta memberondong Agus Marto dengan pertanyaan yang berkaitan dengan Bank Century. Tema yang sama juga diusung anggota PDIP lain, Maruarar Sirait. Merespons pertanyaan yang datang dari anggota Dewan, Agus mengaku tidak tahu sama sekali. “Saya menyampaikan bahwa presentasi Bank Century jangan dijadikan atau dianggap sebagai meeting. Karena tidak ada dokumen sebagai dasar. Ada sesi lanjutan dan saya tidak pernah ikut lagi,” ujar Agus. Terkait kasus Hambalang, Agus menegaskan, jika ditetapkan sebagai tersangka dia bersedia mengundurkan diri dari jabatan gubernur BI jika terpilih kelak. “Tapi hanya untuk kasus Hambalang. Kalau untuk kasus lain, saya enggak ikut tahu. Apalagi banyak kasus yang tidak jelas, tapi dijadikan tersangka,” imbuh Agus. Sementara itu secara keseluruhan, ketua Komisi XI DPR Emir Moeis menyebut tanggapan Agus dalam fit and proper test sangat rasional. “Kalaupun disuruh memilih siapa calon lainnya, saya juga bingung. Dia yang paling siap,” ujar Emir selepas fit and proper test calon gubernur BI kemarin. Emir menambahkan, keputusan Komisi XI DPR untuk menerima atau menolak Agus sebagai gubernur BI akan ditentukan hari ini sekitar pukul 15.00-16.00 WIB. Sebelumnya Komisi XI akan menggelar rapat internal pukul 13.00 WIB. “Ini peluangnya masih 50:50, bisa jadi aklamasi, musyawarah mufakat, atau malah voting.” Walau sempat mencecar soal Century, Maruarar Sirait melihat ada penambahan pengalaman dalam diri Agus setelah menjabat menteri keuangan. Agus pernah menjalani tes serupa pada 2008, namun ditolak DPR karena dinilai tidak kom-

peten menangani sektor makroekonomi. Tapi, kini Agus dinilai semakin menguasai dan memahami fungsi BI. Selain itu, Agus juga dianggap berkualitas dan layak. Sementara itu, Wakil Ketua Komisi XI Harry Azhar Azis mengaku, meski belum ada keputusan bulat dari Fraksi Partai Golkar, dia mengaku puas atas jawaban-jawaban Agus. “Kepuasan 70%. Itu kalau di perguruan tinggi B,” katanya. Dalam fit and proper testyang berlangsung kemarin sejak pukul 10.20 WIB itu, Agus dibanjiri pertanyaan tentang berbagai hal di antaranya inflasi, financial inclusion, perbankan syariah, serta asas resiprokal. Kepada anggota Dewan, Agus menjabarkan integritas serta sikapnya selama memimpin sejumlah instansi serta menyampaikan pandangan tentang ekonomi makro dan mikro. Masalah inflasi menjadi perhatian besar dalam tes tersebut. Setidaknyalebihdaridelapandari 24 anggota Komisi XI DPR yang hadir mengajukan pertanyaan terkait inflasi. Selain mengenai peran BI ke depan dalam menekan inflasi, anggota DPR juga banyak yang mendalami kemampuan Agus dalam mengendalikan inflasi. Anggota Fraksi Golkar Kamaruddin Sjam misalnya mempertanyakan kemampuan Tim Pengendali Inflasi Daerah (TPID) yang merupakan perpanjangan tangan BI dalam mengelola inflasi di daerah. Agus secara khusus menjabarkan peningkatan inflasi yang terjadi akhir-akhir ini. Menurutnya, inflasi tahun kalender 2013 (Januari–Februari) yang mencapai 1,79% sudah melebihi rata-rata historisnya yang berada di level 1,28%. “Inflasi yang cukup tinggi dengan rata-rata historisnya yang utamanya disebabkan oleh kenaikan harga pangan,” ujarnya. erichson sihotang/ maesaroh

membahas kolonialisasi dari sudut pandang seorang Afrika. Berkisah tentang kehancuran tragis tokoh terpandang dan pemimpin berpengaruh Okonkwo dan budaya Igbo, novel ini mengulas kolonialisasi modern ala kulit putih yang juga terjadi lewat misi keagamaan. Nigeria tak hanya kehilangan Achebe sebagai seorang sastrawan, tapi juga lebih pada kehilangan sosok perekam sejarah. Dalam interviu dengan The Paris Review, Achebe berkata, “Ada peribahasa terkenal menyebut bahwa hingga seekor singa memiliki sejarawan sen-

diri, sejarah perburuan akan selalu memuliakan si pemburu.” Achebe mengambil peran sejarawan bagi bangsanya. Dia bergumul dengan isu-isu konflik dalam sejarah perjuangan bangsa Nigeria keluar dari penjajahan. Achebe tokoh penting dalam menuliskan sendiri sejarah Nigeria lewat sudut pandang anak negeri, bukan dari sisi Barat. Untuk itu, kesedihan yang dialami rakyat Nigeria bisa dipahami. Ibarat sebuah perburuan yang melibatkan singa dan pemburu, Achebe adalah sang singa yang fasih menuliskan kisahnya. 

Chinua Achebe

Melawan Penjajahan lewat Tulisan Amerika Serikat

esedihan yang menimpa sebuah negeri tak hanya terjadi ketika ditinggal sang pemimpin, tapi bisa juga saat penulis meninggal dunia. Demikian yang terjadi pada Nigeria. Kepergian Chinua Achebe, penulis novel Things Fall Apart, Kamis (21/3) pada usia 82 tahun membawa duka yang mendalam. Di Afrika, Achebe dikenal sebagai Bapak Sastra Modern Afrika. Things Fall Apartyang ditulis saat Achebe berusia 28


tahun ditahbiskan sebagai novel terbesar dalam sejarah sastra modern Afrika. Nelson Mandela menyebut Achebe sebagai penulis yang mengenalkan Afrika pada dunia. Sebelum kematiannya, Achebe menghabiskan lebih dari dua dekade di kursi roda akibat kecelakaan mobil saat menuju Lagos. Sempat dirawat di Inggris dan akhirnya bermukim di Amerika Serikat (AS), Achebe mengembuskan nafas terakhir di Boston, AS. Tahun lalu Chinua menulis buku terakhir, There was a Country: A personal History of Biafra,satu lagi kisah tragis yang

mengusung tema penjajahan. Mengapa Achebe begitu berarti bagi rakyat Nigeria? Kekuatan karya Achebe terwujud dari semangat melawan kolonialisasi yang dia suguhkan dalam tulisannya. Meski bukan penerima nobel sastra, karyakarya Achebe mendapat tempat paling terhormat dalam sastra Afrika dan dunia. Dia menerima penghargaan tertinggi dari Nigeria, The Nigerian National Merit Award untuk kategori pencapaian intelektual. Pada 1986, Anthills of the Savannahmendapat nominasi Booker Prize. Pada 2010, Achebe

“Sejarah perburuan akan selalu memuliakan si pemburu.” CHINUA ACHEBE

Sastrawan Nigeria IST


terpilih sebagai penerima penghargaan seni bergengsi Dorothy and Lilian Gish Prize. Novelnya yang paling terke-

nal, Things Fall Apart, diterbitkan pada 1958, tak lama setelah Nigeria merdeka dari Inggris. Novel ini karya pertama yang



8:42 PM

Page 17



Kebijakan Energi Harus Pro-Rakyat

17 IHSG: 4.777,90



KURS RP: USD 9.728

15 l

EUR 12.670



GBP 14.832



JPY (100) 10.309

48 l

HKD 1.254


l SGD 7.809 14 l AUD 10.160


Dua Opsi BBM Dibawa ke Istana Kementerian ESDM Usulkan Larangan Mobil Pelat Hitam Pakai Premium yang kurang mampu naik motor dan kendaraan umum masih disubsidi,” tutur istri almarhum mantan Wakil Menteri ESDM Widjajono Partowidagdo melalui pesan singkatnya kepada KORAN SINDO kemarin. Sementara,DirekturGasPertamina Harry Karyuliarto mengatakan, sampai saat ini pelaksanaan program konversi BBM ke bahan bakar gas (BBG) masih terhambat anggaran untuk infrastruktur pembangunan stasiun pengisian bahan bakar gas(SPBG). Pada 2012 anggaran pengembangan mencapai Rp3,5 triliun, namun pada 2013 menjadi Rp500 miliar.

Anggota Komisi VII DPR Satya W Yudha berpendapat campuran pertamax dan premium justru akan menimbulkan masalah baru. Jika terdapat jenis baru, maka komoditas beserta permainannya akan berubah. ”Pemerintah harus mengerti suasana kebatinan masyarakat. Pagi masyarakat harus mengeluarkan Rp4.500, kemudian lusa dipaksa harus beli BBM dengan harga Rp6.500 karena RON-nya berubah,” kata dia. Dia meminta lebih baik pemerintah berterus terang saja kalau ingin menaikkan harga BBM bersubsidi. Satya mengatakan, dalam Undang-Undang (UU) APBN tahun 2013 Pasal 8 ayat 10 telah dijamin untuk melakukan penyesuaian harga BBM jika terjadi deviasi asumsi makro. ”Karena, pergantian RON ini lebih tidak bagus,” tandas Satya. Opsi berbeda sebelumnya diajukan Badan Kebijakan Fiskal (BKF) Kementerian Keuangan. Pelaksana tugas (Plt) Kepala BKF Bambang Brodjonegoro mengungkapkan, BKF menawarkan tiga opsi untuk menekan pembengkakan subsidi BBM, yakni dengan menaikkan harga, mengendalikan konsumsi tanpa kenaikan harga, serta kombinasi pilihan pertama dan kedua. Wakil Direktur ReforMiner Institute Komaidi Notonegoro mempersilakan pemerintah

lebih mudah dilaksanakan. ”Karena ini yang terkena dampaknya kan kalangan mampu, punya mobil. Sedangkan

TTL Dorong Inflasi Di sisi lain, tarif tenaga listrik (TTL) yang akan kembali dinaikkan pada April mendatang diyakini mendorong inflasi. Menteri Keuangan Agus Martowardojo mengungkapkan, kenaikan tarif listrik secara otomatis akan mendorong inflasi. Namun, dia menolak untuk memberikan prediksi berapa kisaran inflasi April mendatang. ”Kalau ada kenaikan listrik pasti ada dampaknya ke inflasi. Kalau misalnya ada kenaikan harga cabai, juga ada inflasi,” tandas Agus Marto di sela-sela fit and proper test calon Gubernur Bank Indonesia (BI), di Gedung DPR/MPR, kemarin. Kendati demikian, dia memastikan bahwa pemerintah bersama BI akan tetap berupaya agar inflasi bisa dikelola dengan baik. Sebagai informasi, seperti tertuang dalam Nota Keuangan APBN 2013, kenaikan TTL bakal diberlakukan setiap tiga bulan. nanang wijayanto/ maesaroh

utang Laiki dan rekapitalisasi Bank of Cyprus melalui konversi tabungan. Tabungan lebih dari 100.000 euro tidak dijamin dalam undang-undang UE. ”Penyitaan tabungan yang tidak dijamin di Laiki itu diperkirakan mencapai 4,2 miliar euro,” ujar Chairman Eurogroup Jeroen Dijssebloem, dikutip Reuters. Penutupan Laiki mengakibatkan pemberhentian hubungan kerja (PHK) terhadap ribuan pegawainya. Menurut pejabat pemerintah, para pemegang saham di Laiki akan dihapus dan pemegang saham di Bank of Cyprus harus memberikan kontribusi. Juru bicara UE menjelaskan bahwa tidak ada beban pajak yang akan diberlakukan terha-

dap tabungan di bank-bank lain di Siprus. Meski demikian, kesepakatan terbaru ini mengakibatkan para pemilik rekening dalam jumlah besar di Laiki dan Bank of Cyprus kehilangan dana lebih besar dibandingkan rencana undang-undang awal. Negosiasi awal yang dilakukan pekan lalu gagal saat parlemen Siprus menolak usulan untuk menerapkan pajak pada seluruh tabungan. ”Kami menghindari kekacauan akibat kebangkrutan perbankan yang akan mengakibatkan Siprus harus keluar dari zona euro dengan konsekuensi lebih buruk,” ungkap juru bicara pemerintah Siprus Christos Stylianides, dikutip Reuters. syarifudin

Petugas mengisi bahan bakar di salah satu SPBU di kawasan Kuningan, Jakarta, kemarin. Kementerian ESDM mengajukan dua opsi untuk penghematan BBM yaitu melarang mobil pelat hitam menggunakan premium dan meminta Pertamina menyediakan BBM jenis premix.

mengambil dua opsi dari Kementerian ESDM. Namun, risiko yang harus diambil adalah mengorbankan APBN. ”Artinya, pemerintah mengedepankan pencitraan dibandingkan menyelamatkan anggaran,” kata dia saat dihubungi KORAN SINDO, di Jakarta, kemarin. Menurut Komaidi, pembuatan premix tidak mudah dilakukan. Alasannya, Pertamina harus menyediakan kilang khusus untuk menyediakan campuran BBM jenis pertamax dan premium. ”Tapi, itu pilihan yang akan diambil. Silakan saja dengan konsekuensi yang ada,” tuturnya. Anggota Komite Ekonomi Nasional (KEN) Ninasapti Triaswati menilai, di antara dua op-








(Rp triliun) 81,1

78,56 61,8

54,3 48,16

80,943 65,5


65 44,9

25,8 2007





APBN 2012

APBN-P 2012


Wakil Menteri ESDM Susilo Siswoutomo mengatakan, Kementerian ESDM telah menyelesaikan kajian dua opsi terkait pengendalian BBM bersubsidi yang kemudian akan diserahkan kepada Presiden Susilo Bambang Yudhoyono untuk disetujui. Kajian tersebut yakni melarang mobil pelat hitam menggunakan BBM bersubsidi atau premium dan meminta Pertamina menyediakan BBM jenis premix. Dia memaparkan, premix adalah bahan bakar berkadar oktan (RON) 90 yakni campuran pertamax beroktan 92 dan premium beroktan 88. Susilo menilai premix akan dibeli oleh banyak konsumen terutama pengguna kendaraan pribadi. ”Usulan dari (Kementerian) ESDM dan kementerian terkait sudah diusulkan, kita sudah sampaikan data-data, mobil ada berapa dan data lain,” kata dia seusai diskusi IATMI, di Jakarta, kemarin. Menurut Susilo, usulan pengadaan premix merupakan alternatif harga BBM bagi masyarakat yang tidak semahal pertamax, dan di sisi lain dapat mengurangi beban subsidi BBM. Apalagi, BBM beroktan 90 berpotensi memiliki pangsa pasar yaitu pengguna kendaraan mewah yang tidak ingin mengonsumsi BBM bersubsidi terlalu banyak tapi juga tidak memakai pertamax karena harganya terlalu mahal.


JAKARTA – Berbagai kajian terkait bahan bakar minyak (BBM) bersubsidi terus digodok. Kali ini giliran Kementerian Energi dan Sumber Daya Mineral (ESDM) yang mengusulkan dua opsi.


Subsidi energi di APBN 2013 Subsidi BBM: 46 juta kiloliter: Rp193,8 triliun Subsidi listrik: Rp80,94 triliun

si tersebut yang lebih efektif adalah opsi melarang mobil pelat hitam untuk tidak menggunakan BBM bersubsidi, daripa-

Subsidi BBM

da menggunakan premix dan kenaikan harga. Dia menilai opsi tersebut lebih adil ketimbang sekadar menaikkan harga dan

Subsidi Listrik Sumber: Kemenkeu


Sri Mulyani Peringatkan Krisis Siprus Dapat Menular bergejolak. Namun menurut Sri Mulyani, krisis Siprus dapat menular dan mengancam negara-negara lain yang rentan, khususnya di Eropa. ”Dampak pertama di lingkungan global terkait situasi Eropa berasal dari persepsi karena ini psikologis. Dan penularan ini karena masalah tersebut berasal dari pasar modal, dari pasar saham, dari sektor keuangan,” ungkap Sri Mulyani, dikutip Reuters. ”Kami terus mengawasi dengan sangat hati-hati tentang apa yang terjadi di Siprus. Tidak hanya secara psikologis tapi kesepakatan terkait sistem perbankan dan kebijakan terhadap tabungan nasabah. Ekonomi global tidak boleh bergejolak la-

gi. Itulah mengapa para pembuat kebijakan harus melakukan tindakan yang tepat dengan sangat cepat untuk mengurangi kelabilan dan ketidakpastian,” papar Sri Mulyani. Sementara, Siprus menutup bank terbesar kedua di negaranya, Popular Bank of Cyprus, demi mendapatkan bailout (dana talangan) dari UE sebesar USD13 miliar. Kesepakatan itu tercapai beberapa jam menjelang batas waktu untuk menghindari runtuhnya sistem perbankan di pulau tersebut. Sebelumnya, negosiasi alot dilakukan oleh Presiden Siprus Nicos Anastasiades, pemimpin Uni Eropa, Bank Sentral Eropa (ECB), dan Dana Moneter Internasional (IMF).

”Penularan ini karena masalah tersebut berasal dari pasar modal.” DOK. KORAN SINDO

BEIJING – Managing Director Bank Dunia Sri Mulyani Indrawati memperingatkan bahwa negara-negara berkembang harus siap dengan keruntuhan pasar keuangan jika sektor perbankan Siprus hancur. Sri Mulyani mendorong agar krisis Siprus segera diatasi. Saat wawancara di sela-sela sebuah forum di Beijing, dia mengatakan, pihaknya terus mengawasi hasil negosiasi agar Siprus mendapatkan bailout (dana talangan) sebesar 10 miliar euro dari Uni Eropa (UE). Pernyataan Sri Mulyani berbeda dengan pendapat para politisi Jerman bahwa dampak krisis Siprus akan terbatas. Pasar keuangan Eropa juga bersikap tenang sejak krisis Siprus

Hasil kesepakatan yang didukung para menteri keuangan UE itu diharapkan dapat menghindari keruntuhan ekonomi Siprus dengan menutup Popular Bank of Cyprus. Bank yang sebagian besar sahamnya dimiliki pemerintah dan dikenal dengan sebutan Laiki, dihentikan


Managing Director Bank Dunia

operasinya. Selain itu, tabungan nasabah Laiki di bawah 100.000 euro dipindahkan ke Bank of Cyprus untuk menciptakan ”bank yang bagus”. Tabungan lebih dari 100.000 euro di Laiki dan Bank of Cyprus akan dibekukan dan digunakan untuk menutup


8:27 PM

Page 1





05:00 05:30 06:30 07:30 08:30


09:00 10:00 10:30 11:30 12:30


13:30 14:00 15:00 16:00 16:30


17:00 18:00 19:00 20:00 21:00


22:00 23:00 23:30 00:00


01:00 02:00 03:00 04:00


Kebijakan Energi Harus Pro-Rakyat JAKARTA – Indonesia perlu menggunakan pendekatan endogeneus development untuk mengelola sumber daya manusia dan alamnya yang besar. Ketua Himpunan Mahasiswa Islam (HMI) bidang Kewirausahaan dan Pengembangan Profesi Nur Rendra Bagas Prakoso mengatakan, melalui pendekatan tersebut akan tercipta kebijakan energi yang mementingkan kebijakan energi untuk kesejahteraan rakyat. “Misalnya, Blok Mahakam yang justru diberikan ke pihak asing, padahal BUMN kita yaitu Pertamina bisa meng-cover dan mengeksplorasinya. Saya yakin, hal itu akan lebih bermanfaat bagi masyarakat Indonesia,” kata kandidat Ketua HMI ini dalam konferensi pers bertajuk “Meneguhkan Kedaulatan Ekonomi dan Energi untuk Menjadi Tuan Rumah di Negeri Sendiri”,di Jakarta, kemarin. Dia menegaskan, pemerintah berkewajiban memberikan garansi kenyamanan dan keamanan kesejahteraan ekonomi bagi masyarakat. Karena itu, kebijakan energi yang diambil pun harus mencerminkan tekad untuk memberikan kesejahteraan bagi masyarakat. Terkait dengan itu, Rendra mengatakan, HMI tidak mem-

permasalahkan beban subsidi yang selalu naik, selama itu digunakan demi kepentingan masyarakat banyak. “Jangan pandang besarnya anggaran subsidi. Kalau subsidi bahan bakar minyak (BBM) dari APBN dirasa berat, maka pemerintah hendaknya mengencangkan ikat pinggang,” tegasnya. Namun, Rendra meminta pemerintah terus melakukan efisiensi. Dia menegaskan, penting pula bagi rakyat Indonesia untuk dengan bijak mengelola sumber daya alamnya, terlebih jumlah subsidi BBM yang semakin tahun semakin naik. Dia juga mengusulkan agar Komisi Pemberantasan Korupsi (KPK) ikut dilibatkan dalam pengawasan subsidi BBM supaya tidak ada kebocoran. Selain kebijakan energi, Rendra menyoroti kontrak eksploitasi sumber daya alam oleh pihak asing. Menurut dia, Pemerintah Indonesia tidak perlu ragu merenegosiasi kontrak yang dinilai tidak menguntungkan. “Kita seperti belum menjadi tuan rumah di negeri sendiri. Padahal kita yang punya tanah



Kandidat Ketua Umum PB HMI Periode 2013-2015 Nur Rendra Bagas Prakoso berbicara dalam konferensi pers bertajuk “Meneguhkan Kedaulatan Ekonomi dan Energi untuk Menjadi Tuan Rumah di Negeri Sendiri”, di Jakarta, kemarin. HMI mendorong pemerintah menggunakan pendekatan endogeneus development untuk mengelola sumber daya manusia dan alam Tanah Air.

namun kita hanya mendapat sedikit keuntungan dari kerja sama,” cetusnya. Terkait kebijakan subsidi, pengamat ekonomi Sunarsip mengatakan, pemerintah memang perlu melakukan sesuatu terhadap kecenderungan semakin tingginya beban subsidi BBM. Kenaikan harga bertahap atau mewajibkan mobil berpelat hitam mengonsumsi BBM


Pelaksanaan Proyek Diminta melalui Tender JAKARTA – Pemerintah diminta transparan terkait rencana pembangunan 23 ruas jalan tol Trans-Sumatera dari Pelabuhan Bakauheni hingga Bandara Hang Nadim, Batam. Terkait dengan itu, penunjukan BUMN secara langsung sebagai pelaksana dinilai rawan manipulasi. “Seharusnya jangan ada penunjukan langsung. Tetapi, harus memberikan kesempatan yang sama kepada semua BUMN di bidang karya untuk dapat berpartisipasi dan lewat proses tender yang transparan, bukan dengan tunjuk langsung,” kata pengamat kebijakan publik Feizal Syahmenan, di Jakarta, kemarin. Menurut dia, dari ruas jalan tol tersebut, hanya ruas tol Medan-Binjai dan Palembang-Indralaya yang prosesnya melalui tender. Karena itu, Feizal meminta, agar proses pembuatan peraturan presiden yang akan menjadi payung hukum penun-

“Seharusnya jangan ada penunjukan langsung. Tetapi, harus memberikan kesempatan yang sama kepada semua BUMN di bidang karya.” FEIZAL SYAHMENAN

Pengamat Kebijakan Publik

jukan langsung PT Hutama Karya (Persero) sebagai pembangun dan pengelola jalan tol TransSumatera segera dihentikan. Sementaraitu,KetuaJurusan Administrasi Negara Universitas Nasional Jakarta Budi Kusuma mengatakan, permasalahan utama pembangunan jalan tol termasuk Tol Trans-Sumatera adalah di pembebasan lahan, bukan

pada masalah anggaran. “Jika belum apa-apa PT Hutama Karya yang akan ditunjuk langsung melaksanakan pembangunan jalan tol tersebut sudah minta dana sebesarRp5triliun,sementarawaktu penyelesaiannya tidak dapat dipastikan,makadanasebesaritu tidak jelas pemanfaatan dan pertanggungawabannya. Bahkan pemerintah masih akan terus menggelontorkan dana. Ini harus diawasi,” jelasnya. Seperti diketahui pemerintah menunjuk PT Hutama Karya untuk melaksanakan pembangunan proyek 23 ruas jalan tol Trans-Sumatera. Penunjukan itu dilakukan dengan memanfaatkan jaminan dari pemerintah dalam bentuk penyertaan modal negara. Dia mengatakan, BUMN akan memanfaatkan bank untuk meminjam uang sehingga skema pendanaan 23 ruas tol itu menghindari penggunaan dana APBN. ●ichsan amin

Keanggotaan di WTO Perlu Dimaksimalkan JAKARTA – Komisi VI DPR meminta pemerintah mengoptimalkan fungsi keanggotaan Indonesia dalam Organisasi Perdagangan Dunia (World Trade Organization/WTO). Dengan begitu diharapkan, sektor perdagangan dan industri nasional dapat lebih diuntungkan. Anggota Komisi VI DPR Ida Ria Simamora dalam rapat dengar pendapat antara Komisi VI dengan dua direktur jenderal (Dirjen) Kementerian Perdagangan mengatakan, keanggotaan di WTO antara lain bisa dimanfaatkan untuk meminta penurunan tarif ekspor. Dengan demikian, neraca perdagangan Indonesia yang kini masih defisit dapat diperbaiki. “Kita usahakan meminta tarif ekspor diturunkan di negara-

negara yang menjalin kerja sama perdagangan dengan Indonesia, seperti India misalnya. Soal keanggotaan di WTO, selama ini Indonesia hanya diuntungkan dalam sengketa perdagangan, jadi sekarang tinggal efisiensinya saja yang belum dioptimalkan sebagai anggota,” ujar dia, kemarin. Pada rapat tersebut Komisi VI DPRdanKemendagjugamembahasmengenaitahapandankemajuan yang sudah dicapai terkait perjanjian perdagangan internasional yang dilakukan pemerintah Indonesia. Komisi VI ingin melihat sejauh mana perjanjianperjanjian perdagangan internasional yang telah dilakukan pemerintah mempunyai dampak pada masyarakat, apakah itu positifataunegatif.“Selainitu,halini

juga akan kami gunakan sebagai masukan untuk pembahasan RUU (Rancangan Undang-Undang) Perdagangan,” kata Ketua Komisi VI Airlangga Hartarto. Seperti diketahui, Pasal 11 Undang-Undang Dasar (UUD) 1945 mengatur, semua bentuk perjanjian internasional, baik ekonomi maupun politik antara pemerintah dan negara lain harus melalui persetujuan DPR. Perjanjian-perjanjian internasional yang selama ini berlaku untuk bidang ekonomi, perdagangan, dan investasi, kecuali WTO, serta perjanjian yang lain belum melalui ratifikasi DPR. “Inilah yang akan kami usulkan dalam pembahasan RUU Perdagangan agar perjanjian itu juga melalui DPR,” imbuh Airlangga. ●ant

non-subsidi menurutnya bisa dilakukan. “Pengguna BBM mayoritas adalah mobil. Kalau kebijakan ini bisa dijalankan maka akan sangat membantu mengurangi beban subsidi BBM hingga 50%,” kata Sunarsip kepada KORAN SINDO. Diamenambahkan,daripada membiarkan beban subsidi terus naik, lebih baik menaikkan

harga BBM subsidi sebesar Rp1.500 per liter. Dengan harga premium Rp6.000, disparitas BBM subsidi dan non-subsidi akan berkurang. Namun, dia tak yakinkebijakanyangtidakpopuler ini bisa diambil pemerintah. SKK Migas Putus 18 Kontrak Perusahaan Satuan Kerja Khusus Pelaksana Kegiatan Usaha Hulu Mi-

nyak dan Gas Bumi (SKK Migas) akan memutus pengelolaan 18 wilayah kerja oleh kontraktor kontrak kerja sama (KKKS) tahun ini. Hal itu merupakan konsekuensi bagi kontraktor yang tak memenuhi komitmen eksplorasi. Kepala SKK Migas Rudi Rubiandini mengatakan, di luar wilayah kerja yang diterminasi tersebut, terdapat 42 wilayah

kerja yang telah memenuhi komitmen eksplorasi di atas tiga tahun. Sedangkan yang tengah berproses memenuhinya sebanyak 54 wilayah kerja. “Tapi selain 18 KKKS yang dalam proses terminasi, ada pula lima kontraktor lain yang belum memenuhikomitmen,”ujarRudi di sela acara diskusi bertajuk “Indonesia Oil and Gas Industry Outlook 2013: Opportunity and Challenges” yang digagas Ikatan Ahli Teknik Perminyakan Indonesia (IATMI) di Kantor Kementerian ESDM, Jakarta, kemarin. Dia menjelaskan, terdapat beberapa hal yang memengaruhi realisasi kontraktor dalam pencapaian produksinya. Salah satunya adalah masalah tumpang tindih lahan, perizinan, dan operasi lapangan. “Porsinya mencapai 33% dari keseluruhan masalah yang ada,” ujar Rudi. Di tempat yang sama Anggota DPR Komisi VII Satya W Yudha menilai, pemutusan wilayah kerja migas merupakan langkah tepat yang diambil SKK Migas. Pasalnya, jika wilayah kerja tersebut hanya didiamkan kemudian KKKS tidak melakukan kegiatan eksplorasi dan eksploitasi, justru merugikan negara. “Sementara, ada pemain lain yang lebih serius yang bisa mengembangkan,” kata dia. ●akhmad nur huda/ nanang wijayanto


Nilai-Nilai Kuno dalam Kekinian ARIES HERU PRASETYO Ketua Program Sarjana PPM School of Management

erumuskan sebuah daya saing di tengahtengah kompleksitas persaingan dewasa ini harus diakui bukanlah hal yang mudah. Pebisnis dan pengelola perusahaan harus mampu membangun cara pandang fundamental yang kuat dalam menentukan arah bagi pola pengembangan organisasi di masa depan. Kealpaan nilai-nilai fundamental tersebut akan berdampak negatif pada umur strategi, juga perusahaan sebagai entitas bisnis. Tak jarang bahkan perusahaan harus ikhlas melepas citra sebagai pelopor pasar kepada pemain baru. Itulah mengapa dalam konteks kewirausahaan di Tanah Air sering muncul premis: generasi pertama mendirikan, generasi kedua mengembangkan, generasi ketiga menutup perusahaan. Cukup dramatis memang, namun dengan komitmen dan cara pandang yang tepat niscaya manajemen akan mampu meraih kembali predikat tersebut.


“Alih-alih mempertahankan profit demi stabilitas operasional perusahaan, tak jarang generasi baru memilih untuk menggadaikan idealisme demi melayani kompetisi pasar dalam jangka pendek.”

Membangun cara pandang dasar dalam pengembangan bisnis dapat diawali dari pemahaman nilai-nilai yang dianut oleh generasi pertama ketika mendirikan perusahaan. Konsep ini yang harus diakui sering dilupakan oleh generasi-generasi berikutnya. Tak selamanya nilai-nilai baru yang dibawa generasi lanjutan secara otomatis dapat menggantikan nilai-nilai dasar yang dibangun oleh pendiri. Sebuah studi mendalam tentang fenomena tersebut menyimpulkan bahwa orientasi profit yang dibawa oleh generasi lanjutan sering menjadi senjata yang mematikan bagi kelangsungan organisasi. Alih-alih mempertahankan profit demi stabilitas operasional perusahaan, tak jarang generasi baru memilih untuk menggadaikan idealisme demi melayani kompetisi pasar dalam jangka pendek. Tak jarang langkah ini berakibat pada ditinggalkannya produk tua yang telah membesarkan perusahaan demi produk baru yang mungkin belum jelas masa depannya. Nah, pada kondisi itulah tercipta peluang emas bagi pemain (baca: pendatang) baru untuk mengambil alih kepemimpinan pasar. Jika bukan profit, lalu apa? Anda pasti kenal dengan peribahasa “berakit-rakit ke hulu berenang-renang ke tepian”, yang dimaknai sebagai “bersakit-sakit dahulu, bersenang-senang kemudian”. Meski dipahami sebagai hal yang sederhana, peribahasa tersebut sangat tepat sebagai nilai-nilai fundamental pengembangan organisasi bisnis di masa depan. Setidaknya ada dua semangat utama yang dapat diciptakan. Pertama, peribahasa terse-

but memberikan semangat bagi perusahaan untuk mengalami bisnis sebagai sebuah pembelajaran. Kelompok positivisme meyakini bahwa tak selamanya keberhasilan merupakan sebuah prestasi. Demikian pula kegagalan, tak selamanya ketidakberhasilan manajemen dalam meraih target harus dipahami sebagai sebuah pelajaran berharga. Keduanya sama-sama berpeluang menciptakan sebuah pembelajaran efektif. Tinggal kini dari sudut mana kita ha-


rus menyikapinya. Manajemen perlu melihat prestasi sebagai langkah awal bagi teraihnya target-target berikutnya. Keyakinan bahwa pencapaian prestasi tidak terlepas dari kekuatan nilainilai yang dianut merupakan hal yang krusial. Karena inilah yang akan mendudukkan nilai-nilai tua pada posisi tuahnya. Demikian pula ketika ma-

najemen harus menelan pil pahit, tak teraihnya target pada suatu kurun waktu tertentu. Realitas tersebut hendaknya direfleksikan sebagai kekurangjelian manajemen dalam menempatkan nilainilai dasar pada strategi perusahaan. Kesadaran akan kondisi tersebut diharapkan mampu membangkitkan semangat untuk terus meraih target di masa depan. Kedua, peribahasa tersebut memberikan semangat bagi pengelola untuk memahami waktu sebagai sarana bagi pendewasaan entitas bisnis. Pengalaman di lapangan perlu dipadankan dengan kedewasaan berpikir dari manajemen. Di titik inilah sebenarnya peran pengetahuan (baca: knowledge) sangat dibutuhkan. Selain untuk mengintepretasikan fenomena yang tengah dihadapi, pengetahuan juga membantu pengambil keputusan untuk melihat dimensi masa depan dari sebuah bisnis. Dengan pemahaman bahwa bisnis adalah pertautan historis dari masa depan, maka padu padan tersebut diharapkan mampu merumuskan strategi yang akan menjadi primadona dalam jangka panjang. Tak selamanya nilai-nilai “kuno” itu kuno bukan? Sukses menyertai Anda! ●



8:18 PM

Page 19






Pengawasan Produksi Migas Ditingkatkan

ASEAN ECONOMIC COMMUNITY Bendahara Umum Himpunan Pengusaha Muda Indonesia (Hipmi) Bayu Priawan Djokosoetono (tengah) didampingi Ketua Kompartemen Perindustrian dan Manufaktur Hipmi Adrian Singawinata (dua kanan) berdiskusi dengan jajaran redaksi KORAN SINDO saat berkunjung ke Gedung SINDO, Jakarta, kemarin. Dalam diskusi ini dibahas kesiapan industri Indonesia menghadapi ASEAN Economic Community mulai 2015 serta event Indonesia Young Leader Forum (IYLF) yang akan digelar pada April mendatang.

Kilang TPPI Diharapkan Segera Beroperasi JAKARTA – Direktorat Jenderal Migas Kementerian Energi dan Sumber Daya Mineral (ESDM) berharap, kilang PT Trans Pacific Petrochemical Indotama (TPPI) segera beroperasi kembali. Sebab, pengoperasian kilang itu akan mengurangi impor sejumlah produk bahan bakar, antara lain elpiji. ”Concernkami adalah kilangnya beroperasi kembali,” tegas Dirjen Migas Edy Hermantoro seusai diskusi di Kementerian ESDM Jakarta kemarin. Kilang TPPI beroperasi komersial sejak 2006. Namun, akibat berbagai masalah, kilang itu berhenti operasi sejak Desember 2011. Selain elpiji, produksi kilang TPPI antara lain paraksilen sebesar 500.000 ton per tahun dan benzen 300.000 ton per tahun. Selain itu, kata Edy, Kementerian ESDM berkepentingan agar TPPI melunasi utang kondensat. Pihaknya pun akan berkoordinasi dengan instansi lain di bawah menteri koordinator bidang perekonomian untuk menyelesaikan utang tersebut. Seperti diketahui, pemerintah melalui PT Perusahaan Pengelola Aset (PPA) akan memiliki kilang pengolahan minyak TPPI di Tuban, Jawa Timur, jika PT Tuban Petrochemical Industries (Tuban Petro) selaku pemi-

lik 59,5% saham tidak bisa melunasi utang kepada PPA senilai Rp2,83 triliun yang batas akhirnya adalah hari ini. Batas waktu itu mengacu penerbitan notice of default oleh PPA qq Menteri Keuangan kepada Tuban Petro pada 27 September 2012.

”Pengoperasian kembali kilang TPPI ini akan memberikan manfaat kepada negara.” BOBBY RIZALDI

Anggota Komisi VII DPR

Per 27 November 2012, TPPI diketahui memiliki utang pokok, bunga, dan denda kepada 362 kreditur sebesar Rp17,88 triliun atau USD1,8 miliar yang terdiri dari separatis Rp9,746 triliun dan konkuren Rp8,135 triliun. Utang separatis tercatat kepada 12 kreditur dengan porsi terbesar adalah PT Pertamina (Persero) sebesar Rp4,135 triliun, lalu JGC Corporation Rp2 triliun, SKK Migas Rp1,348 triliun, United Overseas Bank Ltd Rp932 miliar, Polytama International Finance BV Rp372

miliar, dan sisanya milik tujuh kreditur lainnya. Utang konkuren tercatat kepada 350 kreditur dengan porsi terbesar Pertamina Rp2,444 triliun, disusul Argo Capital BV Rp1,61 triliun, Polytama International BV Rp773 miliar, dan Argo Fund Ltd Rp688 miliar. Sementara, aset nonkas TPPI per 30 September 2012 hanya berjumlah USD899 juta, atau jauh di bawah liabilitasnya yang mencapai USD1,8 miliar. Sebelumnya anggota Komisi VII DPR Bobby Rizaldi mengatakan, setelah diambil alih, pemerintah harus segera menyerahkan kilang TPPI kepada Pertamina agar bisa dioperasikan kembali. ”Pengoperasian kembali kilang TPPI ini akan memberikan manfaat kepada negara,” tegasnya. Kilang TPPI yang memproduksi sejumlah produk petrokimia seperti paraksilen dan benzen–selama ini diimpor–bisa mengurangi pemborosan negara akibat impor produk-produk turunan minyak tersebut. Tanpa produksi dari TPPI diperkirakan, pada 2015 Indonesia masih akan mengimpor paraksilen sebesar 900.000 ton dan benzen 400.000 ton. nanang wijayanto

kontraktor produksi untuk melaporkan jumlah produksi harian dari lapangan minyak dan gas masing-masing. Ke depan, kata dia, akan dikembangkan sistem operasi terpadu untuk mengawasi produksi migas yang secara langsung yang ter-update dari sistem hydrocarbon accounting systemmilik kontraktor. Sementara, Wakil Menteri Energi dan Sumber Daya Mineral (ESDM) Susilo Siswoutomo mengatakan, untuk mendukung produksi nasional, pemerintah berharap, penyediaan data di lingkungan SKK Migas dan kontraktor dilakukan secara transparan. Selain itu, ESDM ingin adanya sistem terintegrasi, akurat, dan mudah terakses bagi yang berkepentingan, dengan tetap mengacu pada peraturan perundangan yang berlaku.  nanang wijayanto

BUMN Peti Kemas Segera Dibentuk JAKARTA – Kementerian Badan Usaha Milik Negara (BUMN) akan membentuk PT Peti Kemas Indonesia dalam dua minggu ke depan. Jika terealisasi, perusahaan baru itu ditargetkan menjadi pelabuhan peti kemas terbesar kelima di dunia. PT Peti Kemas Indonesia ke depan juga akan menjadi induk usaha perusahaan terminal kontainer di Indonesia. Nantinya, perusahaan itu akan didorong untuk bekerja sama dengan seluruh pelabuhan peti kemas di seluruh Indonesia, seperti pelabuhan Tanjung Priok (Jakarta), Pelabuhan Tanjung Perak (Surabaya), dan Pelabuhan Terminal Batu Ampar (Batam). ”Pembentukan perusahaan ini untuk meningkatkan distribusi logistik nasional,” ujar Menteri BUMN Dahlan Iskan seusai menghadiri diskusi bertajuk Peran Industri Semen Indonesia dalam Pembangunan Ekonomi di Indonesia dan Asia, di Jakarta, kemarin. Dia menambahkan, mayoritas saham PT Peti Kemas Indonesia akan dimiliki oleh PT Pela-



JAKARTA – Satuan Kerja Khusus Pelaksana Kegiatan Usaha HuluMinyakdanGasBumi(SKK Migas) terus berupaya meningkatkan pengawasan produksi migas, salah satunya melalui penerapan teknologi informasi. Deputi Pengendalian Operasi SKK Migas Muliawan mengatakan, pada akhir 2012 lalu tercatat 90% produksi migas telah diterima secara manual dari daerah operasi kontraktor kontrak kerja sama (KKKS) yang tersebar di seluruh Indonesia. ”Jumlah tersebut berasal dari mayoritas KKKS produksi migas di Indonesia,” kata dia di Jakarta kemarin. Dia menambahkan, SKK Migas memerlukan data lapangan real time dari kontraktor untuk meningkatkan fungsi pengawasan dan pengendalian. Saat ini SKK Migas memiliki sistem informasi operasi yang telah dimanfaatkan oleh seluruh


Menteri BUMN

buhan Indonesia (Persero) yang merupakan gabungan PT Pelindo I, PT Pelindo II, PT Pelindo III, dan PT Pelindo IV. ”Saat ini masih di notaris yang mengurus tentang NPWP (nomor pokok wajib pajak) dan izin perusahaan untuk pembukaan rekening bank, selain itu disiapkan neraca perdagangan. Dalam dua minggu ke depan harus sudah selesai,” kata Dahlan. PT Peti Kemas Indonesia akan menjadi induk usaha perusahaan terminal kontainer di Indonesia. Dengan adanya per-

usahaan ini, kata Dahlan, semua kegiatan peti kemas di seluruh pelabuhan Indonesia ditangani oleh PT Peti Kemas. Namun, dia mengakui bahwa rencana tersebut tidak mudah untuk diwujudkan lantaran terdapat sejumlah kendala. Di antaranya, masalah aturan maupun perundang-undangan. ”Memang agak sulit pembentukannya karena ada yang harus diselesaikan. Nanti jika terbentuk, direktur utamanya menjadi komisaris, direksinya menjadi dirut, dan diambil dari direksi yang paling baik,” tambahnya. Menurut Dahlan, Kementerian BUMN selaku pemegang saham Pelindo sangat mendorong Pelindo dalam membentuk perusahaan patungan, agar kegiatan di pelabuhan dapat efisien, baik dari waktu maupun biaya. ”Ini business to business, yang penting jalan, saya tidak akan intervensi terlalu jauh. Saya yakin ini akan memajukan perusahaan, seperti holding Semen Indonesia yang semakin maju,” ujar Dahlan. Sebelumnya PT Pelindo II atau Indonesia Port Corporation (IPC) bersama Pelindo I, III, dan IV terus mematangkan im-

plementasi konsep Pendulum Nusantara yang selanjutnya akan dilakukan uji coba melalui sistem penyatuan multiple port call (pelayanan pelabuhan yang terintegrasi). Direktur Utama Pelindo II RJ Lino mengatakan, perseroannya siap menerima berbagai masukan, terkait penerapan sistem Pendulum Nusantara. Saat ini IPC bersama Pelindo I, III, dan IV terus melakukan sosialisasi. Selain itu, masa uji coba juga pasti akan dilakukan terlebih dahulu sebelum penerapan penuh Pendulum Nusantara, sebagai bagian dari upaya penyempurnaan cara-cara untuk menurunkan biaya logistik nasional. ”IPC masih sangat terbuka apabila ada pihak-pihak yang ingin mengetahui lebih dalam, maksud dan konsep penerapan sistem Pendulum Nusantara,” kata RJ Lino beberapa waktu lalu. Menurutnya, keuntungan yang menjadi kelebihan Pendulum Nusantara dibandingkan pelabuhan individu, antara lain adalah sistem koridor yang dijalankan memungkinkan terbentuknya multiple port calldan ship size(ukuran kapal).  heru febrianto

bahwa atasan akan seirama dengan mereka, belum ada kepastian penghasilan untuk mereka yang mengambil kiblat berwirausaha dan banyak lagi hal ketidakpastian lainnya untuk berbagai macam alasan. Mereka perlu memastikan apakah yang mereka dapatkan setimpal dengan apa yang mereka tinggalkan. Berikut adalah beberapa kejadian nyata yang mungkin pernah Anda alami juga. Meski mendapat iming-iming gaji lebih tinggi dan fasilitas yang lebih baik, seseorang memutuskan untuk tidak mengambilnya lantaran tidak mendapatkan chemistryyang pas dengan calon atasan atau perusahaan. Namun di sisi lain ada juga yang meski mendapat tawaran posisi yang lebih baik di perusahaannya sekarang, seseorang tetap rela meninggalkan perusahaannya karena mendapat tantangan lebih besar di perusahaan yang baru atau lantaran ingin berdikari dan membangun usahanya sendiri. Bahkan pada beberapa kasus tertentu sangat menarik karena ada yang pindah ke perusahaan lainnya meski mendapat kompensasi

yang lebih rendah. Alasannya sederhana yakni karena merasa perusahaaannya sekarang tidak memiliki visi dan nilai. Bagi saya pribadi, selama Anda sudah melakukan yang terbaik dan dapat divalidasi oleh kinerja Anda dan orang-orang di sekitar Anda, maka Anda layak memberi apresiasi kepada diri Anda. Sebaliknya, saya sering protes kepada teman-teman profesional yang belum memberikan yang terbaik namun seringkali mengeluh mengenai perusahaannya. Saya selalu teringat pada ilustrasi singkat berikut: Sekaleng softdrink (minuman ringan) di warung pinggir jalan dapat Anda beli dengan harga Rp3.000-5.000, sedangkan di cafe bisa jadi harganya Rp10.000-15.000, sementara di hotel ternama bisa jadi harganya Rp30.000-50.000. Jadi sederhana saja, jika lingkungan/perusahaan di mana Anda bekerja saat ini tidak menjadikan Anda bernilai lebih tinggi (namun tetap dengan catatan Anda sudah melakukan yang terbaik, memiliki attitude yang baik dan kinerja baik), RESIGN! Dan temukanlah yang lebih baik! Salam transformasi! 


Resign: Siapa Takut? MEN JUNG, MM Author – Go To The Next Level! Founder – PT. Spirit Transformation International

ila Anda adalah seorang profesional di sebuah perusahaan, tentu kata resign bukan sesuatu yang baru bagi Anda. Kata resigndalam bahasa Indonesia memiliki pengertian mengundurkan diri dari perusahaan tempat kita bekerja. Meski ada banyak alasan bagi seseorang untuk mengambil keputusan mengundurkan diri, resignseringkali menjadi sesuatu hal yang tidak mengenakkan bahkan tidak jarang menjadi hal yang ditakutkan baik dipandang dari sisi karyawan maupun sisi perusahaan. Mari kita soroti satu per satu dan kita mulai dari bagian perusahaan. Pada banyak perusahaan yang masih bergumul dengan isu pengelolaan sumber daya manusia, pengunduran di-


ri dari orang-orang terbaik di perusahaan tersebut tentunya bukan sesuatu yang diinginkan. Adalah pukulan berat bagi setiap organisasi ketika orang terbaiknya harus meninggalkan organisasi apapun alasannya. Memulai kembali dari awal mencari orang yang pas untuk sebuah fungsi atau posisi memang bukan perkara yang mudah apalagi harus memastikan orang tersebut dapat menyatu dengan lingkungan yang ada dan cepat memahami proses bisnis yang ada di dalam perusahaan. Oleh karena itu, banyak perusahaan dewasa ini, ketika harus mempertahankan orangorang terbaiknya, mereka tidak tanggung-tanggung memberikan benefit lebih dalam bentuk kompensasi kenaikan gaji yang tinggi, fasilitas yang menarik baik itu kendaraan, kesehatan, bonus dan lain sebagainya. Namun pertanyaannya sederhana? Sanggupkah semua kelebihan yang diciptakan dan disediakan tersebut membuat orang tersebut bertahan? Aha, ternyata tidak semua tergiur dengan hal tersebut! Banyak perusahaan pada

skala menengah yang melihat reward & benefit sebagai faktor terpenting untuk mempertahankan orang-orang terbaik mereka. Anggapan bahwa ”the more you lure them with salary and benefits, the more they will be loyal” (semakin Anda menarik mereka dengan gaji dan banyak kelebihan, semakin mereka akan setia dengan perusahaan) adalah anggapan yang perlu ditinjau kembalin. Some will stay because of that, but probably they are not your best. Karena hal tersebut, beberapa mungkin akan tetap bertahan dalam perusahaan, tapi mungkin mereka bukan yang terbaik yang Anda miliki sebagai perusahaan. Yang gagal disikapi oleh kebanyakan perusahaan pada level ini adalah kenyataan bahwa pengelolaan sumber daya manusia sangatlah dinamis dan perusahaan dituntut untuk memahami bahwa setiap orang termotivasi secara berbeda. Karyawan Anda apabila dinilai sebagai aset yang terpenting, maka Anda akan melihat beberapa yang terbaik tetap bersama Anda karena alasan

yang lebih besar. Mereka memiliki motivasi yang jauh lebih besar tidak sekedar karena kompensasi dalam bentuk uang atau bonus. Apakah itu? Bisa jadi hal itu adalah visi perusahaan, nilai-nilai perusahaan, kultur


atau budaya perusahaan, atasan atau pimpinan yang inspiratif dan dikagumi, bahkan sampai kepada kebanggaan menjadi bagian dari sebuah organisasi yang memiliki jiwa, da-

ri organisasi yang memanusiakan manusia dan memberi nilai/makna. Kelihatannya alasan tersebut klise, namun ini adalah kenyataan yang ada. Bila Anda adalah pimpinan perusahaan/organisasi, coba renungkan kembali beberapa aspek tersebut di atas. Bisa jadi hal tersebut sudah mati di organisasi Anda, namun kabar baiknya Anda bisa menghidupkannya kembali. Maukah Anda menafasinya? Lalu bagaimana resign dari sudut pandang karyawan? Dari berbagai percakapan dan pengamatan saya, ternyata ini juga bukan sesuatu yang mudah bagi karyawan. Mereka harus mempertimbangkan segala sesuatunya dengan baik. Keluar dari keberadaan mereka saat ini membutuhkan pengorbanan di antaranya memulai di lingkungan yang baru sementara belum ada kepastian orang-orang baru yang ditemui akan bersahabat baik, belum ada jaminan



6:49 PM

Page 20







Harga Saham Sbl



PERTANIAN 1. Tanaman Pangan BISI Bisi International Tbk. 860 880 870 CKRA Citra Kebun Raya Agri Tbk. 235 240 235 2. Perkebunan AALI Astra Agro Lestari Tbk. 18,050 18,500 18,050 BWPT BW Plantation Tbk. 1,300 1,320 1,290 GZCO Gozco Plantations Tbk. 177 177 174 JAWA Jaya Agra Wattie Tbk. 370 380 375 LSIP PP London Sumatra Indonesia Tbk. 1,820 1,850 1,810 MAGP Multi Agro Gemilang Plantation TBk 130 130 128 PALM Provident Agro Tbk. 460 460 455 SGRO Sampoerna Agro Tbk. 2,175 2,175 2,125 SIMP Salim Ivomas Pratama Tbk. 1,000 1,030 1,000 SMAR SMART Tbk. 6,700 0 0 TBLA Tunas Baru Lampung Tbk. 480 480 475 UNSP Bakrie Sumatera Plantations Tbk. 95 98 95 3. Perikanan CPRO Central Proteinaprima Tbk. 53 0 0 DSFI Dharma Samudera Fishing Industries Tbk. 56 57 56 IIKP Inti Agri Resources Tbk. 1,600 1,650 1,650 4. Lainnya BTEK Bumi Teknokultura Unggul Tbk. 1,490 1,520 1,490 PERTAMBANGAN 1. Pertambangan Batubara ADRO Adaro Energy Tbk. 1,290 1,320 1,260 ARII Atlas Resources Tbk 1,190 1,170 1,080 ATPK ATPK Resources Tbk. 156 158 153 BORN Borneo Lumbung Energi & Metal Tbk. 465 475 460 BRAU Berau Coal Energy Tbk. 230 250 235 BSSR Baramulti Suksessarana Tbk. 1,950 0 0 BUMI Bumi Resources Tbk. 720 740 690 BYAN Bayan Resources Tbk. 7,800 8,200 6,900 CPDW Indo Setu Bara Resources Tbk. 229 0 0 DEWA Darma Henwa Tbk. 50 50 50 DOID Delta Dunia Makmur Tbk. 205 215 200 GEMS Golden Energy Mines Tbk. 2,450 0 0 GTBO Garda Tujuh Buana Tbk. 5,800 5,850 5,750 HRUM Harum Energy Tbk. 4,825 4,925 4,800 ITMG Indo Tambangraya Megah Tbk. 33,300 34,500 33,700 KKGI Resource Alam Indonesia Tbk. 2,350 2,375 2,350 MYOH Samindo Resources Tbk. 680 700 680 PKPK Perdana Karya Perkasa Tbk. 255 270 255 PTBA Tambang Batubara Bukit Asam (Persero) Tbk.13,500 14,350 13,700 PTRO Petrosea Tbk. 1,720 1,860 1,730 TOBA Toba Bara Sejahtra Tbk. 850 880 850 2. Pertambangan Minyak dan Gas Alam ARTI Ratu Prabu Energi Tbk. 355 0 0 BIPI Benakat Petroleum Energy Tbk. 184 190 176 ELSA Elnusa Tbk. 195 199 195 ENRG Energi Mega Persada Tbk. 97 100 97 ESSA Surya Esa Perkasa Tbk. 2,900 2,900 2,900 MEDC Medco Energi Internasional Tbk. 1,640 1,650 1,630 RUIS Radiant Utama Interinsco Tbk. 189 210 189 3. Pertambangan Logam dan Mineral ANTM Aneka Tambang (Persero) Tbk. 1,340 1,380 1,340 CITA Cita Mineral Investindo Tbk. 315 0 0 DKFT Central Omega Resources Tbk. 530 560 530 INCO Vale Indonesia Tbk. 2,500 2,575 2,400 PSAB J Resources Asia Pasifik Tbk. 4,575 4,550 4,325 SMRU SMR Utama Tbk. 400 480 415 TINS Timah (Persero) Tbk. 1,390 1,430 1,400 4. Pertambangan Batu-batuan CTTH Citatah Tbk. 53 53 52 MITI Mitra Investindo Tbk. 92 95 92 INDUSTRI DASAR DAN KIMIA 1. Semen INTP Indocement Tunggal Prakarsa Tbk. 22,150 22,600 22,150 SMCB Holcim Indonesia Tbk. 3,550 3,650 3,550 SMGR Semen Gresik (Persero) Tbk. 16,850 17,500 16,850 2. Keramik, Perselen dan Kaca AMFG Asahimas Flat Glass Tbk. 8,950 8,850 8,600 ARNA Arwana Citramulia Tbk. 2,450 2,550 2,450 IKAI Intikeramik Alamasri Industri Tbk. 164 0 0 KIAS Keramika Indonesia Assosiasi Tbk. 188 196 178 MLIA Mulia Industrindo Tbk. 220 225 220 TOTO Surya Toto Indonesia Tbk. 8,000 8,000 7,900 3. Logam dan Sejenisnya ALKA Alakasa Industrindo Tbk. 600 0 0 ALMI Alumindo Light Metal Industry Tbk. 610 610 600 BAJA Saranacentral Bajatama Tbk. 580 620 580 BTON Betonjaya Manunggal Tbk. 820 830 830 CTBN Citra Tubindo Tbk. 4,500 0 0 GDST Gunawan Dianjaya Steel Tbk. 106 108 107 INAI Indal Aluminium Industry Tbk. 500 500 500 ISSP Steel Pipe Industry of Indonesia Tbk 280 295 280 JKSW Jakarta Kyoei Steel Works Tbk. 120 0 0 JPRS Jaya Pari Steel Tbk. 345 355 350 KRAS Krakatau Steel (Persero) Tbk. 650 660 650 LION Lion Metal Works Tbk. 13,100 13,350 13,350 LMSH Lionmesh Prima Tbk. 16,000 0 0 NIKL Pelat Timah Nusantara Tbk. 225 225 220 PICO Pelangi Indah Canindo Tbk. 275 275 275 TBMS Tembaga Mulia Semanan Tbk. 6,750 0 0 4. Kimia BRPT Barito Pacific Tbk. 415 420 415 BUDI Budi Acid Jaya Tbk. 115 116 115 DPNS Duta Pertiwi Nusantara Tbk. 430 430 420 EKAD Ekadharma International Tbk. 440 445 440 ETWA Eterindo Wahanatama Tbk. 310 320 310 INCI Intanwijaya Internasional Tbk. 270 270 265 SOBI Sorini Agro Asia Corporindo Tbk. 1,790 0 0 SRSN Indo Acidatama Tbk. 50 50 50 TPIA Chandra Asri Petrochemical Tbk. 2,750 0 0 UNIC Unggul Indah Cahaya Tbk. 1,740 0 0 5. Plastik dan Kemasan AKKU Alam Karya Unggul Tbk. 97 130 105 AKPI Argha Karya Prima Industry Tbk. 850 880 750 APLI Asiaplast Industries Tbk. 90 91 89 BRNA Berlina Tbk. 700 710 690 FPNI Titan Kimia Nusantara Tbk. 127 0 0 IGAR Champion Pacific Indonesia Tbk. 405 410 405 IPOL Indopoly Swakarsa Industry Tbk. 118 125 119 SIAP Sekawan Intipratama Tbk. 124 0 0 SIMA Siwani Makmur Tbk. 128 0 0 TRST Trias Sentosa Tbk. 360 365 360 YPAS Yanaprima Hastapersada Tbk. 670 680 660 6. Pakan Ternak CPIN Charoen Pokphand Indonesia Tbk. 4,700 4,800 4,725 JPFA JAPFA Comfeed Indonesia Tbk. 8,800 8,950 8,600 MAIN Malindo Feedmill Tbk. 3,225 3,225 3,175 SIPD Sierad Produce Tbk. 65 68 65 7. Kayu dan Pengolahannya SULI Sumalindo Lestari Jaya Tbk. 99 100 97 TIRT Tirta Mahakam Resources Tbk. 70 71 69 8. Pulp dan Kertas ALDO Alkindo Naratama Tbk 690 740 690 FASW Fajar Surya Wisesa Tbk. 2,700 2,725 2,675 INKP Indah Kiat Pulp & Paper Tbk. 860 880 870 INRU Toba Pulp Lestari Tbk. 1,390 0 0 KBRI Kertas Basuki Rachmat Indonesia Tbk. 50 50 50 SAIP Surabaya Agung Industri Pulp & Kertas Tbk. 255 0 0 SPMA Suparma Tbk. 295 300 295 TKIM Pabrik Kertas Tjiwi Kimia Tbk. 2,025 2,025 2,000 ANEKA INDUSTRI 1. Otomotif dan Komponennya ASII Astra International Tbk. 7,500 7,800 7,600 AUTO Astra Otoparts Tbk. 3,825 4,025 3,825 BRAM Indo Kordsa Tbk. 3,000 0 0 GDYR Goodyear Indonesia Tbk. 13,800 0 0 GJTL Gajah Tunggal Tbk. 2,475 2,525 2,350 IMAS Indomobil Sukses Internasional Tbk. 5,400 5,550 5,450 INDS Indospring Tbk. 4,500 4,500 4,400 LPIN Multi Prima Sejahtera Tbk. 4,700 4,600 4,600 MASA Multistrada Arah Sarana Tbk. 380 390 380 NIPS Nipress Tbk. 5,950 5,950 5,350 PRAS Prima Alloy Steel Universal Tbk. 480 480 475 SMSM Selamat Sempurna Tbk. 2,525 2,525 2,450 2. Tekstil dan Garmen ADMG Polychem Indonesia Tbk. 365 365 360 ARGO Argo Pantes Tbk. 990 0 0 CNTB Century Textile Industry (Seri B) 5,000 0 0 CNTX Century Textile Industry (PS) Tbk. 6,100 0 0 ERTX Eratex Djaja Tbk. 390 350 335 ESTI Ever Shine Textile Industry Tbk. 180 0 0 HDTX Panasia Indo Resources Tbk. 750 0 0 INDR Indo-Rama Synthetics Tbk. 1,470 1,350 1,350 KARW ICTSI Jasa Prima Tbk. 560 630 490 MYTX Apac Citra Centertex Tbk. 210 0 0 PBRX Pan Brothers Tbk. 380 380 380 POLY Asia Pacific Fibers Tbk. 196 197 193 RICY Ricky Putra Globalindo Tbk. 188 191 188 SSTM Sunson Textile Manufacturer Tbk. 146 146 132 STAR Star Petrochem Tbk. 50 50 50 TFCO Tifico Fiber Indonesia Tbk. 620 0 0 TRIS Trisula International Tbk. 430 445 430 UNIT Nusantara Inti Corpora Tbk. 290 290 260 UNTX Unitex Tbk. 3,700 0 0 3. Alas Kaki BATA Sepatu Bata Tbk. 55,000 0 0 BIMA Primarindo Asia Infrastructure Tbk. 900 0 0 4. Kabel IKBI Sumi Indo Kabel 1,210 1,300 1,300 JECC Jembo Cable Company 1,800 1,800 1,790 KBLI KMI Wire and Cable 240 250 235 KBLM Kabelindo Murni 144 154 130 SCCO Supreme Cable Manufacturing & C Tbk. 4,900 4,800 4,800 VOKS Voksel Electric Tbk. 1,200 1,240 1,180 5. Elektronika dan Lainnya PTSN Sat Nusapersada Tbk. 105 115 98 INDUSTRI BARANG KONSUMSI 1. Makanan dan Minuman ADES Akasha Wira International Tbk. 3,700 3,850 3,700 AISA Tiga Pilar Sejahtera Food Tbk. 1,260 1,290 1,250 ALTO Tri Banyan Tirta Tbk. 500 550 510 CEKA Cahaya Kalbar Tbk. 1,490 1,500 1,500 DAVO Davomas Abadi Tbk. 50 0 0 DLTA Delta Djakarta Tbk. 308,000 308,000 308,000 ICBP Indofood CBP Sukses Makmur Tbk. 8,400 9,050 8,550 INDF Indofood Sukses Makmur Tbk. 7,200 7,400 7,250 MLBI Multi Bintang Indonesia Tbk. 940,000 940,000 940,000 MYOR Mayora Indah Tbk. 26,000 26,200 26,000 PSDN Prasidha Aneka Niaga Tbk. 235 240 235 ROTI Nippon Indosari Corpindo Tbk. 7,100 7,150 7,000 SKBM Sekar Bumi Tbk. 400 0 0 SKLT Sekar Laut Tbk. 180 0 0 STTP Siantar Top Tbk. 1,230 1,260 1,010 ULTJ Ultrajaya Milk Industry & Trading Co. Tbk. 1,860 1,890 1,830 2. Rokok GGRM Gudang Garam 46,100 46,950 46,000 HMSP HM Sampoerna 78,950 80,900 79,100 RMBA Bentoel Internasional Investama Tbk. 600 590 580 WIIM Wismilak Inti Makmur Tbk 910 930 910 3. Farmasi DVLA Darya-Varia Laboratoria Tbk. 2,175 2,225 2,200 INAF Indofarma (Persero) Tbk. 305 320 310 KAEF Kimia Farma (Persero) Tbk. 1,050 1,080 1,050 KLBF Kalbe Farma Tbk. 1,190 1,250 1,210 MERK Merck Tbk. 152,000 0 0 PYFA Pyridam Farma Tbk. 182 187 182 SCPI Schering Plough Indonesia 29,000 0 0 SQBB Taisho Pharmaceutical Indonesia Tbk. 10,500 0 0 SQBI Taisho Pharmaceutical Indonesia PS 238,000 0 0 TSPC Tempo Scan Pacific Tbk. 3,650 3,725 3,600 4. Kosmetik dan Barang Keperluan Rumah Tangga MBTO Martina Berto Tbk. 435 435 430 MRAT Mustika Ratu Tbk. 530 540 530 TCID Mandom Indonesia Tbk. 11,100 13,300 11,400 UNVR Unilever Indonesia Tbk. 22,100 22,750 22,300 5. Peralatan Rumah Tangga KDSI Kedawung Setia Industrial Tbk. 560 590 560 KICI Kedaung Indah Can Tbk. 300 290 290 LMPI Langgeng Makmur Industri Tbk. 265 265 260 PROPERTI DAN REAL ESTATE 1. Properti dan Real Estate APLN Agung Podomoro Land Tbk. 485 520 490 ASRI Alam Sutera Realty Tbk. 1,080 1,110 1,080 BAPA Bekasi Asri Pemula Tbk. 128 129 128 BCIP Bumi Citra Permai Tbk. 360 370 360 BEST Bekasi Fajar Industrial Estate Tbk. 930 990 940 BIPP Bhuwanatala Indah Permai Tbk. 99 101 98 BKDP Bukit Darmo Property Tbk. 100 0 0 BKSL Sentul City Tbk. 295 305 295 BSDE Bumi Serpong Damai Tbk. 1,690 1,740 1,700 COWL Cowell Development Tbk. 205 215 200 CTRA Ciputra Development Tbk. 1,100 1,140 1,070 CTRP Ciputra Property Tbk. 940 960 930 CTRS Ciputra Surya Tbk. 2,825 2,975 2,850 DART Duta Anggada Realty Tbk. 830 850 840 DILD Intiland Development Tbk. 560 590 570 DUTI Duta Pertiwi Tbk. 3,625 0 0 ELTY Bakrieland Development Tbk. 54 54 53 EMDE Megapolitan Developments Tbk. 125 124 123 FMII Fortune Mate Indonesia Tbk. 230 230 230 GAMA Gading Development Tbk. 335 340 330 GMTD Gowa Makassar Tourism Development Tbk. 660 0 0 GPRA Perdana Gapuraprima Tbk. 127 130 128 GWSA Greenwood Sejahtera Tbk. 295 300 290 JIHD Jakarta International Hotel & Dev. Tbk. 930 920 900 JRPT Jaya Real Property Tbk. 4,700 4,700 4,700 KIJA Kawasan Industri Jababeka Tbk. 295 305 290 KPIG MNC Land Tbk. 1,520 1,550 1,510 LAMI Lamicitra Nusantara Tbk. 315 0 0 LCGP Laguna Cipta Griya Tbk. 220 230 220 LPCK Lippo Cikarang Tbk. 6,100 6,750 6,150 LPKR Lippo Karawaci Tbk. 1,220 1,290 1,210 MDLN Modernland Realty Tbk. 920 970 930 MKPI Metropolitan Kentjana Tbk. 6,300 6,000 6,000 MTLA Metropolitan Land Tbk. 600 630 610 MTSM Metro Realty Tbk. 700 0 0 NIRO Nirvana Development Tbk. 225 230 225 OMRE Indonesia Prima Property Tbk. 335 0 0 PLIN Plaza Indonesia Realty Tbk. 1,460 1,510 1,510 PWON Pakuwon Jati Tbk. 360 375 355

Naik/Turun Ptp



Transaksi Volume

Minat Nilai





870 235

10 0

1.15 0.00

19.33 117.50

2,800,500 114,000

2,443,595,000 27,322,500

880 240

298,500 248,000

870 235

81,500 62,000

18,500 1,290 175 380 1,810 129 460 2,175 1,020 6,700 480 95

450 -10 -2 10 -10 -1 0 0 20 0 0 0

2.43 -0.78 -1.14 2.63 -0.55 -0.78 0.00 0.00 1.96 0.00 0.00 0.00

13.06 17.67 9.21 8.84 9.68 2.30 8.21 13.34 9.11 8.51 6.40 95.00

1,651,500 16,360,000 2,373,500 1,074,000 14,766,500 828,500 37,500 500,500 4,740,000 0 1,478,000 22,648,500

30,426,000,000 21,319,990,000 415,719,500 405,252,500 26,972,610,000 107,000,500 17,075,000 1,081,875,000 4,821,605,000 0 707,970,000 2,178,060,500

18,500 1,300 176 380 1,820 129 460 2,175 1,030 7,000 480 96

446,000 2,500 197,000 1,060,000 192,500 169,000 1,338,000 481,500 177,000 2,500 32,000 2,193,500

18,450 1,290 175 375 1,810 128 455 2,125 1,020 6,700 475 95

13,000 2,783,000 162,500 110,000 565,500 104,000 15,000 304,500 347,000 15,000 99,500 1,832,500

53 57 1,650

0 1 50

0.00 1.75 3.03

-3.31 11.40 -412.50

0 399,000 2,500

0 22,536,500 4,125,000

0 57 1,810

0 90,000 146,000

0 56 1,650

0 58,500 7,500











1,260 1,160 154 465 240 1,950 700 7,400 229 50 205 2,450 5,750 4,800 33,800 2,350 680 260 14,200 1,810 860

-30 -30 -2 0 10 0 -20 -400 0 0 0 0 -50 -25 500 0 0 5 700 90 10

-2.38 -2.59 -1.30 0.00 4.17 0.00 -2.86 -5.41 0.00 0.00 0.00 0.00 -0.87 -0.52 1.48 0.00 0.00 1.92 4.93 4.97 1.16

9.13 232.00 -9.06 11.07 -30.00 26.35 -2.34 23.42 5.20 -6.25 -25.63 61.25 8.96 7.21 8.14 8.08 34.00 -260.00 36.22 19.26 0.63

57,153,500 22,500 3,061,500 9,587,000 55,197,500 0 117,327,000 626,500 0 2,000 25,609,500 0 2,012,500 4,741,000 1,001,500 447,500 291,500 3,435,000 2,369,500 18,696,500 238,500

73,641,835,000 25,720,000 469,672,500 4,477,347,500 13,455,747,500 0 84,024,820,000 4,514,700,000 0 100,000 5,270,695,000 0 11,672,500,000 22,897,025,000 34,122,075,000 1,052,300,000 198,815,000 893,732,500 33,274,925,000 33,965,730,000 204,740,000

1,270 269,000 1,160 1,500 154 494,000 465 436,000 245 5,483,500 1,980 1,000 710 1,212,000 7,450 1,500 0 0 50 164,691,000 210 3,492,500 2,400 5,000 5,800 76,500 4,825 15,000 33,950 2,500 2,350 13,000 690 35,000 260 219,500 14,200 40,500 1,820 397,000 870 79,500

1,260 1,100 153 460 240 0 700 7,400 0 0 205 2,050 5,750 4,800 33,800 2,325 680 255 14,100 1,810 850

1,462,000 1,000 57,500 2,554,000 7,216,000 0 7,005,000 150,000 0 0 1,058,000 2,500 66,500 197,500 19,000 63,500 38,500 829,500 16,500 644,000 16,500

355 178 195 97 2,900 1,630 210

0 -6 0 0 0 -10 21

0.00 -3.37 0.00 0.00 0.00 -0.61 10.00

14.79 178.00 13.00 32.33 26.61 -74.09 4.77

0 175,481,000 6,217,000 171,185,500 9,000 386,500 56,837,000

0 31,928,517,500 1,218,273,500 16,818,696,500 26,100,000 632,765,000 11,439,265,500

0 178 196 98 2,900 1,640 210

0 3,221,000 110,500 4,060,500 174,000 47,500 319,500

0 177 195 97 2,825 1,630 205

0 5,732,000 189,500 4,921,000 500 350,000 1,440,000

1,370 315 550 2,450 4,350 450 1,410

30 0 20 -50 -225 50 20

2.19 0.00 3.64 -2.04 -5.17 11.11 1.42

15.57 7.50 12.50 0.93 117.57 -30.00 10.52

17,228,500 0 4,174,000 15,028,500 20,000 71,000 2,703,000

23,511,155,000 0 2,268,135,000 37,418,987,500 87,912,500 32,715,000 3,825,780,000

1,370 0 550 2,450 4,625 450 1,420

635,000 0 1,128,000 203,500 500 63,500 278,000

1,360 0 540 2,425 4,350 400 1,410

88,000 0 1,432,500 847,500 3,000 10,500 329,500

52 92

-1 0

-1.92 0.00

-10.40 10.22

2,500 9,591,000

130,500 886,267,000

53 92

6,000 1,678,000

51 91

84,500 310,000

22,200 3,625 17,500

50 75 650

0.23 2.07 3.71

18.86 27.05 24.58

2,450,000 3,862,500 9,171,500

54,785,000,000 13,948,012,500 158,215,275,000

22,650 3,625 17,550

23,500 77,000 10,500

22,200 3,600 17,500

220,000 632,500 158,000

8,600 2,500 164 192 225 8,000

-350 50 0 4 5 0

-4.07 2.00 0.00 2.08 2.22 0.00

10.62 29.76 -2.34 192.00 -1.67 15.78

58,500 4,272,000 0 2,967,000 53,000 2,000

507,950,000 10,628,025,000 0 564,487,500 11,922,500 15,900,000

8,650 2,500 168 194 225 8,000

23,000 211,500 100,500 234,000 963,000 36,000

8,550 2,475 164 192 220 7,900

60,500 12,000 150,000 38,000 2,529,500 4,000

600 610 610 830 4,500 107 500 280 120 350 660 13,350 16,000 225 275 6,750

0 0 30 10 0 1 0 0 0 5 10 250 0 0 0 0

0.00 0.00 4.92 1.20 0.00 0.93 0.00 0.00 0.00 1.43 1.52 1.87 0.00 0.00 0.00 0.00

10.17 -4.66 61.00 5.42 10.82 17.77 5.15

8.19 2.90 -9.78 8.33 2.82

0 10,000 4,815,500 77,000 0 150,000 10,000 30,177,500 0 569,500 6,048,000 1,000 0 1,231,500 5,000 0

0 6,050,000 2,906,615,000 63,910,000 0 16,110,000 5,000,000 8,699,555,000 0 200,252,500 3,932,015,000 13,350,000 0 270,995,000 1,375,000 0

0 640 610 840 0 107 500 285 118 355 660 13,400 17,800 225 280 0

0 49,000 812,000 20,000 0 26,500 32,500 4,207,500 100,000 417,500 17,640,500 9,500 1,000 6,387,000 3,000 0

0 600 600 830 0 106 480 280 80 350 650 12,600 13,600 220 275 0

0 1,500 529,500 36,500 0 91,000 32,500 5,474,500 100,000 1,126,000 10,625,000 2,500 2,500 4,601,500 20,000 0

420 116 425 440 315 270 1,790 50 2,750 1,740

5 1 -5 0 5 0 0 0 0 0

1.19 0.86 -1.18 0.00 1.59 0.00 0.00 0.00 0.00 0.00

-5.25 111.54 10.37 5.71 11.25 5.40 -37.29 16.67 -9.93 18.71

96,000 791,500 147,500 391,500 1,369,500 5,500 0 50,500 0 0

39,842,500 91,133,500 62,555,000 172,602,500 425,867,500 1,460,000 0 2,525,000 0 0

420 116 425 445 315 270 1,740 50 3,000 2,125

1,124,000 62,000 2,500 144,500 586,500 90,000 500 414,500 1,500 1,000

415 115 420 440 310 265 1,500 0 2,750 1,730

1,461,000 172,000 32,500 66,500 937,500 46,500 500 0 5,000 2,500

130 850 89 690 127 410 121 124 128 360 680

33 0 -1 -10 0 5 3 0 0 0 10

25.38 0.00 -1.12 -1.45 0.00 1.22 2.48 0.00 0.00 0.00 1.47

-14.44 14.17 22.25 7.19 -4.88 9.53 20.17 11.27 -3.88 13.85 25.19

157,000 106,500 66,500 421,500 0 59,500 48,901,500 0 0 56,000 27,000

17,285,000 84,810,000 5,935,500 294,095,000 0 24,157,500 5,988,622,000 0 0 20,165,000 18,210,000

0 850 90 700 129 410 122 129 0 365 680

0 4,000 2,500 56,500 500 61,000 1,554,000 1,500 0 54,000 86,500

108 750 89 690 117 405 121 102 0 355 670

10,000 4,000 220,000 324,000 5,000 96,000 216,000 5,000 0 75,000 9,000

4,725 8,900 3,225 66

25 100 0 1

0.53 1.12 0.00 1.52

23.51 14.47 15.36 13.20

7,572,000 330,500 9,090,500 41,966,000

35,983,225,000 2,911,900,000 29,145,525,000 2,792,650,500

4,775 8,900 3,225 67

14,000 131,000 538,500 2,816,500

4,725 8,750 3,200 66

606,500 3,500 182,000 9,090,500

97 70

-2 0

-2.06 0.00

-0.84 -6.36

1,953,500 69,000

191,392,000 4,770,500

99 70

105,500 11,500

97 69

190,500 158,500

700 2,725 870 1,390 50 255 295 2,000

10 25 10 0 0 0 0 -25

1.43 0.92 1.15 0.00 0.00 0.00 0.00 -1.25

28.00 -109.00 17.06 -19.58 7.14 -19.62 29.50 3.98

12,496,500 2,582,500 186,000 0 310,500 0 1,168,500 55,500

8,955,065,000 7,011,875,000 162,080,000 0 15,525,000 0 344,972,500 111,487,500

700 2,725 880 1,400 50 250 300 2,050

478,500 76,000 116,500 24,500 4,647,500 500 4,543,500 500

690 2,700 870 0 0 0 295 2,000

2,543,000 67,500 99,500 0 0 0 4,833,000 90,000

7,650 4,000 3,000 13,800 2,400 5,550 4,500 4,600 385 5,950 480 2,500

150 175 0 0 -75 150 0 -100 5 0 0 -25

1.96 4.38 0.00 0.00 -3.13 2.70 0.00 -2.17 1.30 0.00 0.00 -1.00

13.66 14.18 5.75 7.74 14.20 21.51 1.47 5.29 192.50 5.65 48.00 26.04

36,989,000 513,500 0 0 7,472,000 6,007,500 22,000 3,000 403,500 1,500 58,500 626,500

284,640,300,000 2,039,537,500 0 0 17,988,900,000 33,052,550,000 98,612,500 13,800,000 156,072,500 8,600,000 27,830,000 1,565,775,000

7,700 4,025 2,950 14,600 2,400 5,550 4,500 4,950 390 5,950 480 2,500

296,000 94,500 10,000 2,000 284,500 792,000 4,000 500 267,000 2,000 96,000 21,000

7,650 4,000 2,825 13,250 2,375 5,500 4,400 4,550 385 5,600 470 2,475

2,177,500 144,000 5,500 1,000 63,000 1,000 11,000 500 50,500 2,000 25,000 67,500

365 990 5,000 6,100 335 180 750 1,350 495 210 380 195 190 146 50 620 435 290 3,700

0 0 0 0 -55 0 0 -120 -65 0 0 -1 2 0 0 0 5 0 0

0.00 0.00 0.00 0.00 -16.42 0.00 0.00 -8.89 -13.13 0.00 0.00 -0.51 1.05 0.00 0.00 0.00 1.15 0.00 0.00

20.28 -1.87 -1.63 -0.46 -2.77 45.00 750.00 32.14 7.86 -2.31 25.33 -0.50 9.50 36.50 113.64 25.83 33.46 8.29 -0.93

1,572,000 0 0 0 8,500 0 0 10,500 4,354,000 0 47,500 629,000 1,153,500 182,500 27,000 0 10,547,000 22,500 0

567,570,000 0 0 0 2,967,500 0 0 14,175,000 2,337,057,500 0 18,050,000 121,795,000 218,928,500 25,478,500 1,350,000 0 4,602,070,000 5,925,000 0

365 0 0 7,300 400 0 930 1,460 495 235 385 195 191 145 50 750 435 290 0

6,299,000 0 0 1,000 3,000 0 2,500 5,000 441,000 2,000 175,000 227,000 381,000 13,000 17,174,000 2,500 353,000 500 0

360 0 0 5,400 335 0 0 1,350 490 210 380 194 190 139 0 0 430 265 0

4,822,000 0 0 500 7,000 0 0 8,000 42,000 47,500 132,500 66,000 2,149,000 1,000 0 0 165,000 10,000 0

55,000 900

0 0

0.00 0.00

9.78 18.75

0 0

0 0

0 0

0 0

50,000 0

1,000 0

1,300 1,790 235 154 4,800 1,240

90 -10 -5 10 -100 40

6.92 -0.56 -2.13 6.49 -2.08 3.23

17.11 6.11 7.58 9.06 4.15 9.39

1,000 6,500 6,671,500 17,000 500 42,000

1,300,000 11,695,000 1,602,545,000 2,602,500 2,400,000 50,720,000

1,350 1,800 245 154 4,950 1,280

500 1,000 1,155,000 5,000 1,000 500

1,100 1,790 235 132 4,800 1,180

5,000 5,000 1,242,000 6,000 500 500











3,725 1,260 520 1,500 50 308,000 9,050 7,350 940,000 26,200 240 7,150 400 180 1,010 1,860

25 0 20 10 0 0 650 150 0 200 5 50 0 0 -220 0

0.67 0.00 3.85 0.67 0.00 0.00 7.18 2.04 0.00 0.76 2.08 0.70 0.00 0.00 -21.78 0.00

25.51 14.48 52.00 6.64 -1.11 16.43 22.80 12.59 26.61 29.14 9.23 50.00 28.57 12.00 14.03 29.06

843,500 10,888,500 5,139,500 53,500 0 500 4,550,500 13,956,000 2,500 193,000 5,000 81,000 0 0 1,500 1,728,500

3,166,712,500 13,775,470,000 2,686,025,000 80,250,000 0 154,000,000 40,455,500,000 101,977,800,000 2,350,000,000 5,021,700,000 1,187,500 577,225,000 0 0 1,720,000 3,235,805,000

3,750 1,260 520 1,530 0 308,000 9,050 7,350 999,000 26,500 250 7,150 415 0 1,010 1,870

23,500 37,500 319,500 2,500 0 500 355,000 377,000 2,500 12,500 3,000 22,000 2,500 0 4,500 51,500

3,725 1,250 510 1,500 0 306,000 9,000 7,300 940,000 26,200 230 7,100 0 0 1,000 1,860

39,500 829,000 1,117,000 10,500 0 500 83,500 157,500 2,500 500 2,500 8,500 0 0 500 60,000

46,050 80,000 590 920

-50 1,050 -10 10

-0.11 1.31 -1.69 1.09

31.22 23.47 -13.72

1,047,500 7,000 123,000 5,179,000

48,374,500,000 559,700,000 72,055,000 4,735,585,000

46,100 80,000 590 930

121,500 5,000 1,000 359,500

46,050 79,550 580 920

20,500 500 219,000 20,500

2,200 310 1,050 1,240 152,000 183 29,000 10,500 238,000 3,700

25 5 0 50 0 1 0 0 0 50

1.14 1.61 0.00 4.03 0.00 0.55 0.00 0.00 0.00 1.35

16.92 35.96 29.17 37.58 98.00 14.08 -5.02 0.64 1.52 19.79

79,000 4,136,500 5,736,000 101,050,000 0 262,500 0 0 0 415,500

174,237,500 1,289,397,500 6,091,705,000 124,671,100,000 0 48,123,000 0 0 0 1,526,025,000

2,200 315 1,060 1,240 152,000 184 0 0 239,000 3,725

14,000 1,132,500 636,500 3,443,000 3,500 5,000 0 0 1,000 47,000

2,125 310 1,050 1,230 0 182 0 0 236,000 3,700

13,000 42,500 880,500 711,500 0 96,000 0 0 500 15,000

435 540 13,300 22,750

0 10 2,200 650

0.00 1.85 16.54 2.86

9.26 9.15 17.43 37.23

1,254,500 263,000 10,500 2,506,500

544,437,500 141,895,000 120,650,000 56,762,625,000

435 550 13,150 22,750

527,000 124,500 2,500 95,500

430 540 11,500 22,600

435,500 199,500 10,000 100,000

570 290 265

10 -10 0

1.75 -3.45 0.00

5.14 12.08 66.25

482,000 3,500 249,500

275,615,000 1,015,000 65,350,000

570 315 265

8,000 10,000 1,545,500

560 290 260

16,500 121,500 1,523,500

510 1,090 129 370 970 100 100 305 1,740 200 1,080 930 2,950 850 590 3,625 54 123 230 335 660 129 295 900 4,700 305 1,520 315 225 6,750 1,290 960 6,000 610 700 230 335 1,510 370

25 10 1 10 40 1 0 10 50 -5 -20 -10 125 20 30 0 0 -2 0 0 0 2 0 -30 0 10 0 0 5 650 70 40 -300 10 0 5 0 50 10

4.90 0.92 0.78 2.70 4.12 1.00 0.00 3.28 2.87 -2.50 -1.85 -1.08 4.24 2.35 5.08 0.00 0.00 -1.63 0.00 0.00 0.00 1.55 0.00 -3.33 0.00 3.28 0.00 0.00 2.22 9.63 5.43 4.17 -5.00 1.64 0.00 2.17 0.00 3.31 2.70

10.85 21.37 32.25 41.11 21.56 -10.00 -33.33 38.13 25.97 2.60 22.98 27.35 17.46 70.83 19.03 11.69 -4.15 61.50 255.56 335.00 1.60 14.33 5.00 28.13 33.81 16.05 49.03 9.26 -225.00 12.30 15.54 27.43 15.79 26.52 41.18 115.00 27.92 68.64 23.13

111,999,000 94,526,000 1,668,500 1,163,000 50,457,000 1,151,500 0 141,702,500 29,940,000 74,087,000 35,919,000 11,759,000 21,642,000 118,000 35,454,500 0 72,243,500 66,500 540,000 5,245,000 0 1,007,500 2,156,000 723,000 7,232,000 69,201,000 4,594,500 0 67,769,500 9,708,000 132,775,000 110,807,000 500 3,683,500 0 5,482,500 0 1,000 98,503,000

56,323,112,500 103,416,075,000 215,217,500 422,565,000 48,421,870,000 113,165,500 0 42,583,762,500 51,577,045,000 15,586,150,000 39,336,870,000 11,041,260,000 63,131,037,500 99,645,000 20,608,825,000 0 3,887,924,000 8,193,500 124,200,000 1,774,340,000 0 129,611,500 634,905,000 661,715,000 33,990,400,000 20,781,947,500 7,033,205,000 0 15,236,642,500 62,963,750,000 166,832,685,000 105,641,320,000 3,000,000 2,267,970,000 0 1,247,575,000 0 1,510,000 35,703,877,500

510 1,090 129 370 980 100 100 305 1,750 205 1,090 940 2,950 860 600 3,625 54 126 230 335 0 130 300 920 4,750 310 1,520 385 230 6,800 1,300 960 7,500 620 700 230 0 1,780 370

3,538,500 1,778,500 60,500 2,500 4,447,500 128,500 57,500 25,542,500 1,995,500 9,080,500 139,000 120,500 1,077,500 19,000 4,738,500 10,000 37,458,000 3,000 10,000 376,000 0 143,500 919,500 12,500 1,000 29,489,500 77,500 500 2,454,500 193,000 981,500 7,150,500 500 127,000 174,500 1,024,000 0 500 1,665,500

500 1,080 128 365 970 99 93 300 1,740 200 1,080 930 2,875 850 590 3,200 53 123 215 330 0 129 295 900 4,700 305 1,510 270 225 6,750 1,290 950 0 610 0 225 335 1,510 365

5,798,000 20,240,000 253,000 40,000 1,601,000 70,000 30,000 16,195,000 682,000 6,819,500 357,000 3,087,500 386,000 125,500 3,656,000 6,000 84,332,000 79,500 20,000 2,117,500 0 10,500 651,000 117,000 268,000 6,541,500 1,056,000 5,000 7,000 312,000 466,000 11,302,000 0 502,500 0 4,514,000 150,000 4,000 2,895,000

-0.90 50.00





Harga Saham Sbl

PWSI Panca Wiratama Sakti Tbk. 61 RBMS Ristia Bintang Mahkotasejati Tbk. 151 RDTX Roda Vivatex Tbk. 4,750 SCBD Danayasa Arthatama Tbk. 830 SMDM Suryamas Dutamakmur Tbk. 200 SMRA Summarecon Agung Tbk. 2,325 2. Konstruksi Bangunan ADHI Adhi Karya (Persero) Tbk. 2,950 DGIK Nusa Konstruksi Enjiniring Tbk. 230 JKON Jaya Konstruksi Manggala Pratama Tbk. 1,450 PTPP PP (Persero) Tbk. 1,010 SSIA Surya Semesta Internusa Tbk. 1,560 TOTL Total Bangun Persada Tbk. 1,050 WIKA Wijaya Karya (Persero) Tbk. 1,860 WSKT Waskita Karya (Persero) Tbk. 660 INFRASTRUKTUR, UTILITAS, DAN TRANSPORTASI 1.Energi LAPD Leyand International Tbk. 170 PGAS Perusahaan Gas Negara (Persero) Tbk. 5,500 RAJA Rukun Raharja Tbk. 840 2. Jalan Tol, Pelabuhan dan Bandara CMNP Citra Marga Nusaphala Persada Tbk. 1,810 JSMR Jasa Marga (Persero) Tbk. 5,650 META Nusantara Infrastructure Tbk. 275 3. Telekomunikasi BTEL Bakrie Telecom Tbk. 50 EXCL XL Axiata Tbk. 5,200 FREN Smartfren Telecom Tbk. 93 INVS Inovisi Infracom Tbk. 6,800 ISAT Indosat Tbk. 5,850 TLKM Telekomunikasi Indonesia (Persero) Tbk. 10,550 4. Transportasi APOL Arpeni Pratama Ocean Line Tbk. 50 ASSA Adi Sarana Armada Tbk. 450 BBRM Pelayaran Nasional Bina Buana Tbk 200 BLTA Berlian Laju Tanker Tbk. 196 BULL Buana Listya Tama Tbk. 53 CASS Cardig Aero Services Tbk. 740 CMPP Centris Multipersada Pratama Tbk. 920 GIAA Garuda Indonesia (Persero) Tbk. 630 HITS Humpuss Intermoda Transportasi Tbk. 220 IATA Indonesia Air Transport Tbk. 197 INDX Tanah Laut Tbk. 137 MBSS Mitrabahtera Segara Sejati Tbk. 1,170 MIRA Mitra International Resources Tbk. 77 NELY Pelayaran Nelly Dwi Putri Tbk. 215 PTIS Indo Straits Tbk. 910 RIGS Rig Tenders Indonesia Tbk. 510 SAFE Steady Safe Tbk. 85 SDMU Sidomulyo Selaras Tbk. 310 SMDR Samudera Indonesia Tbk. 3,875 TAXI Express Transindo Utama Tbk. 960 TMAS Pelayaran Tempuran Emas Tbk. 415 TPMA Trans Power Marine Tbk 335 TRAM Trada Maritime Tbk. 1,350 WEHA Panorama Transportasi Tbk. 160 WINS Wintermar Offshore Marine Tbk. 415 ZBRA Zebra Nusantara Tbk. 96 5. Konstruksi Non Bangunan IBST Inti Bangun Sejahtera Tbk. 5,200 INDY Indika Energy Tbk. 1,210 SUPR Solusi Tunas Pratama Tbk. 5,000 TBIG Tower Bersama Infrastructure Tbk. 5,750 TOWR Sarana Menara Nusantara Tbk. 25,500 TRUB Truba Alam Manunggal Engineering Tbk. 50 KEUANGAN 1. Bank AGRO Bank Rakyat Indonesia Agroniaga Tbk. 145 BABP Bank ICB Bumiputera Tbk. 144 BACA Bank Capital Indonesia Tbk. 122 BAEK Bank Ekonomi Raharja Tbk. 1,350 BBCA Bank Central Asia Tbk. 10,600 BBKP Bank Bukopin Tbk. 840 BBNI Bank Negara Indonesia (Persero) Tbk. 4,525 BBNP Bank Nusantara Parahyangan Tbk. 1,300 BBRI Bank Rakyat Indonesia (Persero) Tbk. 8,500 BBTN Bank Tabungan Negara (Persero) Tbk. 1,610 BCIC Bank Mutiara Tbk. 50 BDMN Bank Danamon Indonesia Tbk. 6,350 BEKS Bank Pundi Indonesia Tbk. 122 BJBR BPD Jawa Barat dan Banten Tbk. 1,230 BJTM BPD Jawa Timur Tbk. 480 BKSW Bank QNB Kesawan Tbk. 710 BMRI Bank Mandiri (Persero) Tbk. 9,550 BNBA Bank Bumi Arta Tbk. 183 BNGA Bank CIMB Niaga Tbk. 1,380 BNII Bank Internasional Indonesia Tbk. 425 BNLI Bank Permata Tbk. 1,630 BSIM Bank Sinarmas Tbk. 255 BSWD Bank of India Indonesia Tbk. 1,560 BTPN Bank Tabungan Pensiunan Nasional Tbk. 5,150 BVIC Bank Victoria International Tbk. 132 INPC Bank Artha Graha Internasional Tbk. 110 MAYA Bank Mayapada Internasional Tbk. 1,700 MCOR Bank Windu Kentjana International Tbk. 240 MEGA Bank Mega Tbk. 3,900 NISP Bank OCBC NISP Tbk. 1,400 PNBN Bank Pan Indonesia Tbk. 820 SDRA Bank Himpunan Saudara 1906 Tbk. 800 2. Lembaga Pembiayaan ADMF Adira Dinamika Multi Finance Tbk. 9,500 BBLD Buana Finance Tbk. 730 BFIN BFI Finance Indonesia Tbk. 2,300 BPFI Batavia Prosperindo Finance Tbk. 205 CFIN Clipan Finance Indonesia Tbk. 425 DEFI Danasupra Erapacific Tbk. 1,070 HDFA HD Finance Tbk. 250 MFIN Mandala Multifinance Tbk. 620 TIFA Tifa Finance Tbk 265 TRUS Trust Finance Indonesia Tbk. 455 VRNA Verena Multi Finance Tbk. 124 WOMF Wahana Ottomitra Multiartha Tbk. 181 3. Perusahaan Efek AKSI Majapahit Securities Tbk. 90 HADE HD Capital Tbk. 50 KREN Kresna Graha Sekurindo Tbk. 335 OCAP Onix Capital Tbk. 325 PADI Minna Padi Investama Tbk. 1,290 PANS Panin Sekuritas Tbk. 3,850 PEGE Panca Global Securities Tbk. 240 RELI Reliance Securities Tbk. 490 TRIM Trimegah Securities Tbk. 111 YULE Yulie Sekurindo Tbk. 140 4. Asuransi ABDA Asuransi Bina Dana Arta Tbk. 2,700 AHAP Asuransi Harta Aman Pratama Tbk. 175 AMAG Asuransi Multi Artha Guna Tbk. 300 ASBI Asuransi Bintang Tbk. 490 ASDM Asuransi Dayin Mitra Tbk. 790 ASJT Asuransi Jasa Tania Tbk. 460 ASRM Asuransi Ramayana Tbk. 950 LPGI Lippo General Insurance Tbk. 3,400 MREI Maskapai Reasuransi Indonesia Tbk. 1,550 PNIN Panin Insurance Tbk. 770 PNLF Panin Financial Tbk. 245 5. Lainnya APIC Pacific Strategic Financial Tbk. 198 ARTA Arthavest Tbk. 285 BCAP MNC Kapital Indonesia Tbk. 1,560 GSMF Equity Development Investment Tbk. 177 LPPS Lippo Securities Tbk. 205 MTFN Capitalinc Investment Tbk. 235 RODA Royal Oak Development Asia Tbk. 405 SMMA Sinar Mas Multiartha Tbk. 4,575 PERDAGANGAN, JASA DAN INVESTASI 1. Perdagangan Besar Barang Produksi AIMS Akbar Indo Makmur Stimec Tbk. 220 AKRA AKR Corporindo Tbk. 5,300 ASIA Asia Natural Resources Tbk. 50 BMSR Bintang Mitra Semestaraya Tbk. 160 CLPI Colorpak Indonesia Tbk. 1,290 CNKO Exploitasi Energi Indonesia Tbk. 410 DSSA Dian Swastatika Sentosa Tbk. 13,600 EPMT Enseval Putra Megatrading Tbk. 2,450 FISH FKS Multi Agro Tbk. 2,350 GREN Evergreen Invesco Tbk. 61 HEXA Hexindo Adiperkasa Tbk. 5,600 INTA Intraco Penta Tbk. 430 INTD Inter Delta Tbk. 380 ITTG Leo Investments Tbk. 118 ITMA Sumber Energi Andalan Tbk. 1,870 KARK Dayaindo Resources International Tbk. 50 KOBX Kobexindo Tractors Tbk. 405 KONI Perdana Bangun Pusaka Tbk. 300 LTLS Lautan Luas Tbk. 770 MDRN Modern Internasional Tbk. 1,000 MICE Multi Indocitra Tbk. 590 OKAS Ancora Indonesia Resources Tbk. 165 SDPC Millennium Pharmacon International Tbk. 107 SQMI Renuka Coalindo Tbk. 650 TGKA Tigaraksa Satria Tbk. 3,300 TIRA Tira Austenite Tbk. 1,740 TMPI AGIS Tbk. 450 TRIL Triwira Insanlestari Tbk. 60 TURI Tunas Ridean Tbk. 940 UNTR United Tractors Tbk. 17,300 WAPO Wahana Pronatural Tbk. 60 WICO Wicaksana Overseas International Tbk. 53 2. Perdagangan Eceran ACES Ace Hardware Indonesia Tbk. 790 AMRT Sumber Alfaria Trijaya Tbk. 6,000 CENT Centrin Online Tbk. 230 CSAP Catur Sentosa Adiprana Tbk. 220 ERAA Erajaya Swasembada Tbk. 3,025 GLOB Global Teleshop Tbk. 1,140 GOLD Golden Retailindo Tbk. 400 HERO Hero Supermarket Tbk. 4,950 KOIN Kokoh Inti Arebama Tbk. 205 LPPF Matahari Department Store Tbk. 4,200 MAPI Mitra Adiperkasa Tbk. 7,850 MIDI Midi Utama Indonesia Tbk. 760 MPPA Matahari Putra Prima Tbk. 1,880 RALS Ramayana Lestari Sentosa Tbk. 1,290 RANC Supra Boga Lestari Tbk. 780 RIMO Rimo Catur Lestari Tbk. 260 SKYB Skybee Tbk. 495 SONA Sona Topas Tourism Industry Tbk. 2,300 TELE Tiphone Mobile Indonesia Tbk. 700 TKGA Toko Gunung Agung Tbk. 930 TRIO Trikomsel Oke Tbk. 1,500 3. Restoran, Hotel dan Pariwisata BAYU Bayu Buana Tbk. 385 BUVA Bukit Uluwatu Villa Tbk. 450 FAST Fast Food Indonesia Tbk. 11,100 GMCW Grahamas Citrawisata Tbk. 860 HOME Hotel Mandarine Regency Tbk. 199 HOTL Saraswati Griya Lestari Tbk 176 ICON Island Concepts Indonesia Tbk. 255 INPP Indonesian Paradise Property Tbk. 425 JSPT Jakarta Setiabudi Internasional Tbk. 750 MAMI Mas Murni Indonesia Tbk. 50 MAMIP Mas Murni Tbk. (Preferred Stock) 600 PANR Panorama Sentrawisata Tbk. 200 PDES Destinasi Tirta Nusantara Tbk. 160 PGLI Pembangunan Graha Lestari Indah Tbk. 122 PJAA Pembangunan Jaya Ancol Tbk. 1,020 PNSE Pudjiadi & Sons Tbk. 610 PSKT Pusako Tarinka Tbk. 700 PTSP Pioneerindo Gourmet International Tbk. 3,750 PUDP Pudjiadi Prestige Limited Tbk. 630 SHID Hotel Sahid Jaya International Tbk. 370 SMMT Golden Eagle Energy Tbk. 4,200 4. Advertising, Printing dan Media ABBA Mahaka Media Tbk. 106 DYAN Dyandra Media International Tbk 350 EMTK Elang Mahkota Teknologi Tbk. 6,100 FORU Fortune Indonesia Tbk. 137 IDKM Indosiar Karya Media Tbk. 1,240 JTPE Jasuindo Tiga Perkasa Tbk. 380 KBLV First Media Tbk. 570 LPLI Star Pacific Tbk. 570 MNCN Media Nusantara Citra Tbk. 2,975 MSKY MNC Sky Vision Tbk. 2,325 SCMA Surya Citra Media Tbk. 2,800 TMPO Tempo Inti Media Tbk. 152 VIVA Visi Media Asia Tbk. 475 5. Kesehatan SAME Sarana Meditama Metropolitan 1,600 SRAJ Sejahteraraya Anugrahjaya Tbk. 260 6. Jasa Komputer dan Perangkatnya ASGR Astra Graphia Tbk. 1,830 DNET Dyviacom Intrabumi Tbk. 240 LMAS Limas Centric Indonesia Tbk. 50 MTDL Metrodata Electronics Tbk. 265 7. Perusahaan Investasi ABMM ABM Investama Tbk. 3,200 BHIT Bhakti Investama Tbk. 520 BMTR Global Mediacom Tbk. 2,400 BNBR Bakrie & Brothers Tbk. 50 BRMS Bumi Resources Minerals Tbk. 310 MYRX Hanson International Tbk. 415 MYRXP Hanson International (Seri B) 95 MLPL Multipolar Tbk. 690 PLAS Polaris Investama Tbk. 1,190 POOL Pool Advista Indonesia Tbk. 1,680 8. Lainnya GEMA Gema Grahasarana Tbk. 435 MFMI Multifiling Mitra Indonesia Tbk. 215 SUGI Sugih Energy Tbk. 405



Transaksi Volume










0 158 0 0 205 2,350

0 151 0 0 200 2,275

61 156 4,750 830 200 2,275

0 5 0 0 0 -50

0.00 3.21 0.00 0.00 0.00 -2.20

-2.77 1.66 9.08 51.88 100.00 26.76

0 13,000 0 0 312,000 8,217,500

0 1,983,000 0 0 62,437,500 18,871,750,000

0 153 0 1,030 205 2,300

0 5,000 0 35,000 158,500 488,000

0 147 5,000 0 200 2,275

0 4,500 10,000 0 745,500 1,180,000

3,050 240 0 1,120 1,610 1,060 1,970 700

2,925 230 0 1,020 1,560 1,000 1,860 670

3,000 230 1,450 1,120 1,610 1,020 1,960 690

50 0 0 110 50 -30 100 30

1.67 0.00 0.00 9.82 3.11 -2.94 5.10 4.35

45.45 17.69 33.72 41.48 9.88 20.00 29.25

13,751,500 30,540,500 0 62,361,000 31,667,000 35,489,500 45,552,000 48,860,500

41,265,775,000 7,151,932,500 0 67,225,525,000 50,366,420,000 36,463,195,000 88,019,645,000 33,510,600,000

3,025 235 1,450 1,120 1,610 1,030 1,970 700

307,000 2,100,000 104,000 447,000 2,484,500 1,074,500 418,500 13,230,000

3,000 230 1,390 1,110 1,600 1,020 1,960 690

10,000 12,009,500 500 1,059,500 135,000 433,000 309,500 26,698,000

170 5,550 860

170 5,400 840

170 5,400 850

0 -100 10

0.00 -1.85 1.18

22.25 16.51 18.09

300,000 18,943,000 3,049,000

51,000,000 103,758,600,000 2,602,060,000

170 5,450 860

250,000 372,000 296,500

151 5,400 850

500 1,031,500 1,157,500

1,830 5,800 285

1,790 5,700 275

1,790 5,800 280

-20 150 5

-1.12 2.59 1.79

8.44 23.48 140.00

8,613,000 6,475,000 199,358,500

15,586,695,000 37,235,675,000 55,733,785,000

1,810 5,800 280

3,000 5,141,000 10,565,000

1,790 5,750 275

227,000 225,000 766,500

50 5,350 98 6,850 6,100 10,850

50 5,200 94 6,700 5,900 10,600

50 5,250 95 6,800 6,100 10,700

0 50 2 0 250 150

0.00 0.95 2.11 0.00 4.10 1.40

-1.02 15.31 -1.86 57.14 12.87 12.00

8,000 3,455,500 13,883,500 2,683,500 1,045,000 9,924,000

400,000 18,260,050,000 1,329,855,000 18,127,875,000 6,346,875,000 106,138,950,000

50 5,300 95 6,850 6,100 10,700

12,928,500 246,500 1,480,500 1,000 182,500 1,790,000

0 5,250 94 6,100 6,050 10,600

0 560,000 711,500 500 500 562,000

50 460 210 0 0 0 940 640 230 200 142 1,180 79 215 850 520 0 315 0 1,010 420 340 1,390 160 415 100

50 445 199 0 0 0 920 620 220 196 135 1,150 77 210 850 510 0 310 0 940 410 335 1,340 159 405 93

50 455 205 196 53 740 930 640 230 197 140 1,170 77 215 850 510 85 310 3,875 980 410 340 1,370 160 415 94

0 5 5 0 0 0 10 10 10 0 3 0 0 0 -60 0 0 0 0 20 -5 5 20 0 0 -2

0.00 1.10 2.44 0.00 0.00 0.00 1.08 1.56 4.35 0.00 2.14 0.00 0.00 0.00 -7.06 0.00 0.00 0.00 0.00 2.04 -1.22 1.47 1.46 0.00 0.00 -2.13

2.00 75.83

152.22 9.41 6.01 -8.55

100,000 11,633,500 1,207,000 0 0 0 42,500 87,035,000 4,000 31,621,500 58,500 238,000 1,748,500 580,500 500 375,000 0 43,500 0 44,127,500 180,000 225,000 171,692,000 2,585,500 411,500 21,500

5,000,000 5,248,117,500 244,925,500 0 0 0 39,445,000 55,379,865,000 890,000 6,257,232,500 7,993,500 277,015,000 136,699,500 123,192,500 425,000 191,255,000 0 13,487,500 0 42,780,990,000 74,695,000 75,870,000 233,861,115,000 413,677,500 168,247,500 2,022,500

50 455 205 0 0 760 940 640 230 197 140 1,170 78 215 910 520 0 310 4,000 980 415 340 1,380 160 415 98

29,882,500 4,413,000 350,000 0 0 1,000 3,000 8,858,500 1,500 953,000 51,000 178,000 17,500 812,000 500 220,500 0 450,000 2,000 552,500 18,000 6,000 4,149,000 6,500 102,500 2,000

0 450 200 0 0 740 920 630 172 196 137 1,160 77 210 870 510 0 305 3,875 970 410 335 1,370 159 410 94

0 875,000 49,500 0 0 500 500 4,799,000 6,000 1,260,000 500 127,000 110,000 1,541,000 2,000 64,000 0 18,000 25,500 500 59,500 158,500 277,000 48,000 312,500 3,500

5,200 1,250 0 6,150 26,500 0

5,200 1,220 0 5,750 25,500 0

5,200 1,220 5,000 5,900 26,500 50

0 10 0 150 1,000 0

0.00 0.82 0.00 2.54 3.77 0.00

4.98 3.80 36.23 45.38 101.15 -416.67

17,000 4,939,000 0 3,913,000 2,500 0

88,400,000 6,081,390,000 0 23,371,275,000 64,250,000 0

5,250 1,230 5,050 5,900 26,500 50

11,000 119,500 10,500 51,000 5,000 85,915,000

5,200 1,220 4,975 5,800 22,500 0

21,500 89,500 16,000 7,500 6,000 0

150 167 121 0 10,900 870 4,675 0 8,650 1,660 0 6,450 125 1,280 490 0 9,700 195 1,400 425 1,650 260 0 5,300 135 112 1,680 245 0 0 840 830

147 147 120 0 10,500 830 4,600 0 8,500 1,610 0 6,150 122 1,230 470 0 9,500 185 1,380 420 1,630 255 0 5,100 132 110 1,600 230 0 0 780 780

150 163 120 1,350 10,900 870 4,650 1,300 8,600 1,660 50 6,200 124 1,270 490 710 9,550 185 1,390 420 1,640 255 1,560 5,300 132 111 1,670 240 3,900 1,400 790 830

5 19 -2 0 300 30 125 0 100 50 0 -150 2 40 10 0 0 2 10 -5 10 0 0 150 0 1 -30 0 0 0 -30 30

3.33 11.66 -1.67 0.00 2.75 3.45 2.69 0.00 1.16 3.01 0.00 -2.42 1.61 3.15 2.04 0.00 0.00 1.08 0.72 -1.19 0.61 0.00 0.00 2.83 0.00 0.90 -1.80 0.00 0.00 0.00 -3.80 3.61

0.01 -81.50 17.14 13.37 24.55 8.45 13.03 6.13 11.85 10.92 7.14 14.69 41.33 9.77 10.89 -59.17 14.15 7.40 22.06 19.09 10.38 9.81 25.57 16.11 4.89 6.53 13.80 10.43 10.08 16.09 7.52 39.52

4,500 237,167,500 38,000 0 5,294,500 25,683,000 17,135,500 0 31,596,000 20,705,500 0 8,228,000 526,500 54,634,000 67,250,500 0 19,126,500 46,000 92,000 240,500 1,043,500 2,353,000 0 1,161,500 2,149,000 168,500 119,500 764,500 0 0 23,271,500 6,663,000

664,000 37,808,150,500 4,565,500 0 56,857,350,000 21,783,900,000 79,516,500,000 0 271,114,300,000 34,065,685,000 0 51,554,550,000 64,978,000 68,726,705,000 32,133,322,500 0 183,246,975,000 8,650,000 127,030,000 101,372,500 1,715,980,000 601,832,500 0 6,052,525,000 284,679,500 18,600,500 195,210,000 183,470,000 0 0 18,688,930,000 5,414,315,000

149 164 125 1,440 10,900 870 4,675 0 8,650 1,660 0 6,250 124 1,280 490 0 9,600 188 1,390 430 1,650 260 0 5,300 132 111 1,670 240 4,050 1,400 790 830

4,500 2,440,000 1,000 3,000 1,730,500 696,000 2,539,000 0 1,804,000 1,212,500 0 132,500 19,000 6,091,500 1,842,500 0 30,000 3,000 73,000 133,000 16,500 411,500 0 45,500 86,500 42,500 16,000 58,500 32,500 5,500 3,520,000 633,500

145 163 120 1,300 10,700 860 4,650 980 8,600 1,650 0 6,200 123 1,270 485 0 9,550 182 1,380 420 1,640 255 1,560 5,250 131 110 1,570 235 3,800 1,350 780 820

500 2,567,000 968,500 1,000 414,000 750,500 37,000 500 109,500 10,000 0 14,000 70,000 6,258,500 1,135,500 0 500,500 500 28,500 597,000 31,500 2,154,500 1,000 3,500 40,000 2,500 3,500 5,000 2,500 100,000 2,086,000 29,000

9,600 0 2,400 215 445 0 250 630 270 0 122 182

9,500 0 2,300 210 425 0 250 600 265 0 118 181

9,500 730 2,400 215 430 1,070 250 630 270 455 120 181

0 0 100 10 5 0 0 10 5 0 -4 0

0.00 0.00 4.17 4.65 1.16 0.00 0.00 1.59 1.85 0.00 -3.33 0.00

6.33 8.02 7.74 9.35 4.78 26.75 11.90 2.64 7.50 7.58 4.29 -3.93

6,500 0 56,500 199,500 4,115,500 0 5,453,000 216,000 234,000 0 212,500 62,000

62,000,000 0 130,200,000 42,292,500 1,772,420,000 0 1,363,250,000 130,505,000 62,520,000 0 25,711,000 11,224,000

9,600 700 2,400 220 430 1,080 250 630 270 0 120 184

1,000 50,000 67,500 158,500 199,000 500 250,000 42,000 539,500 0 56,500 500

9,500 660 2,300 215 425 0 245 600 265 0 119 180

1,000 3,000 197,000 420,500 376,000 0 612,500 111,500 1,432,000 0 500 25,000

0 0 340 0 1,290 3,850 240 0 111 0

0 0 340 0 1,290 3,850 240 0 110 0

90 50 340 325 1,290 3,850 240 490 110 140

0 0 5 0 0 0 0 0 -1 0

0.00 0.00 1.47 0.00 0.00 0.00 0.00 0.00 -0.91 0.00

45.00 50.00 56.67 -7.93 7.50 12.38 8.89 15.81 -36.67 46.67

0 0 1,372,500 0 27,000 1,000 25,000 0 436,500 0

0 0 466,650,000 0 34,830,000 3,850,000 6,000,000 0 48,246,000 0

0 50 340 325 1,300 3,825 245 500 113 145

0 8,434,500 24,000 500 195,000 57,500 175,000 25,000 2,000 50,000

0 0 335 0 1,290 3,800 240 485 110 120

0 0 119,000 0 155,500 50,000 150,000 18,000 500 5,000

2,700 0 305 500 840 0 0 0 0 770 255

2,700 0 295 495 750 0 0 0 0 760 240

2,700 175 300 500 750 460 950 3,400 1,550 770 250

0 0 0 10 -40 0 0 0 0 0 5

0.00 0.00 0.00 2.00 -5.33 0.00 0.00 0.00 0.00 0.00 2.00

6.21 8.75 4.69 4.39 5.60 -153.33 7.14 0.97 8.24 2.32 5.81

30,000 0 502,500 34,500 2,500 0 0 0 0 398,000 69,004,000

81,000,000 0 150,195,000 17,125,000 2,035,000 0 0 0 0 303,125,000 17,156,640,000

2,800 179 300 510 830 0 950 3,375 1,650 770 250

25,000 500 2,500 26,500 5,000 0 1,500 12,500 3,000 943,500 8,403,500

2,700 170 295 495 750 450 940 2,750 1,550 760 245

2,472,500 5,000 1,500 15,000 2,500 2,500 1,500 500 2,500,000 472,000 4,101,000

198 290 1,720 0 210 235 410 4,575

197 285 1,580 0 200 235 370 4,550

198 290 1,690 177 205 235 380 4,575

0 5 130 0 0 0 -25 0

0.00 1.72 7.69 0.00 0.00 0.00 -6.58 0.00

33.00 10.00 13.10 22.13 2.63 -117.50 76.00 18.98

1,391,500 260,500 16,966,000 0 3,020,500 500 984,500 2,092,500

275,328,500 74,607,500 28,348,605,000 0 619,247,500 117,500 370,547,500 9,555,000,000

198 290 1,690 178 205 240 380 4,575

291,500 30,000 261,500 19,000 78,500 14,000 21,500 350,000

197 285 1,680 0 200 235 370 4,500

1,174,500 394,500 64,000 0 2,876,500 2,000 90,500 9,000

0 5,300 50 0 1,320 420 0 2,500 0 64 5,850 440 0 129 0 0 425 0 780 1,000 600 168 105 620 0 0 460 61 950 17,700 66 55

0 4,925 50 0 1,290 405 0 2,450 0 61 5,600 430 0 118 0 0 405 0 760 990 570 160 103 580 0 0 450 59 940 17,350 56 53

220 5,200 50 160 1,300 410 13,600 2,500 2,350 62 5,650 435 380 128 1,870 50 420 300 780 990 600 162 105 620 3,300 1,740 455 60 940 17,350 66 54

0 -100 0 0 10 0 0 50 0 1 50 5 0 10 0 0 15 0 10 -10 10 -3 -2 -30 0 0 5 0 0 50 6 1

0.00 -1.92 0.00 0.00 0.77 0.00 0.00 2.00 0.00 1.61 0.88 1.15 0.00 7.81 0.00 0.00 3.57 0.00 1.28 -1.01 1.67 -1.85 -1.90 -4.84 0.00 0.00 1.10 0.00 0.00 0.29 9.09 1.85

220.00 25.37 -25.00 -6.15 9.29 17.83 1,511.11 20.00 9.33 885.71 6.43 21.75 6.67 -25.60 11.61 16.67 7.92 -27.27 4.02 76.15 8.11 -23.14 7.50 -17.22 25.98 58.00 227.50 -15.00 11.90 10.33 5.68 -7.71

0 13,392,500 17,000 0 696,500 28,213,000 0 4,000 0 2,207,000 2,804,000 4,872,000 0 28,611,000 0 0 10,521,000 0 379,000 640,000 13,467,000 20,000 187,500 2,500 0 0 123,860,500 274,500 969,500 3,433,000 533,500 63,000

0 68,065,562,500 850,000 0 911,850,000 11,604,782,500 0 9,862,500 0 137,019,000 15,926,000,000 2,120,390,000 0 3,552,908,500 0 0 4,422,905,000 0 294,045,000 635,085,000 7,838,245,000 3,296,500 19,381,000 1,475,000 0 0 56,311,857,500 16,417,000 911,335,000 60,054,050,000 34,068,000 3,363,500

215 5,200 50 190 1,300 415 15,000 2,475 2,400 62 5,700 435 0 129 0 0 425 300 780 1,010 610 168 106 620 3,100 0 455 60 950 17,450 66 54

4,000 436,000 2,847,000 50,000 9,500 3,531,000 1,000 2,500 35,000 834,500 52,000 619,500 0 1,767,000 0 0 432,500 4,000 65,000 6,500 294,000 50,000 29,500 2,500 4,500 0 4,314,500 45,500 1,066,000 35,000 6,500 109,500

0 5,150 0 147 1,290 410 13,600 2,450 2,025 61 5,600 430 0 128 0 0 420 0 770 990 600 162 105 590 0 0 450 59 940 17,350 65 53

0 5,000 0 5,000 46,000 132,500 20,000 1,000 1,000 624,500 287,500 944,000 0 407,000 0 0 719,500 0 158,000 23,000 494,000 11,000 3,000 500 0 0 3,428,000 88,500 373,000 239,000 110,500 1,000

820 5,950 240 230 3,125 1,130 395 4,975 0 0 8,400 0 1,920 1,330 800 265 0 0 740 0 1,490

780 5,950 225 220 3,000 1,100 395 4,950 0 0 7,950 0 1,800 1,290 770 230 0 0 700 0 1,400

810 5,950 225 230 3,075 1,100 395 4,950 205 4,200 8,400 760 1,910 1,330 770 240 495 2,300 730 930 1,490

20 -50 -5 10 50 -40 -5 0 0 0 550 0 30 40 -10 -20 0 0 30 0 -10

2.47 -0.84 -2.22 4.35 1.63 -3.64 -1.27 0.00 0.00 0.00 6.55 0.00 1.57 3.01 -1.30 -8.33 0.00 0.00 4.11 0.00 -0.67

40.50 37.90 1,607.14 9.20 20.23 16.42 98.75 55.00 9.32 38.89 36.52 47.50 46.59 53.20 30.80 -7.50 9.34 6.87 24.33 -10.33 23.28

13,863,500 6,000 3,175,000 788,000 6,639,500 32,000 10,000 1,200,500 0 0 4,389,500 0 5,759,000 10,637,500 2,655,500 2,183,000 0 0 33,344,500 0 57,500

11,146,190,000 35,700,000 725,065,000 176,662,500 20,379,837,500 35,255,000 3,950,000 5,942,500,000 0 0 35,895,925,000 0 10,752,815,000 14,006,960,000 2,056,300,000 541,932,500 0 0 24,017,545,000 0 83,430,000

810 5,950 225 230 3,100 1,100 400 4,950 250 0 8,400 760 1,910 1,330 780 240 500 2,800 730 0 1,490

199,000 69,500 85,000 958,500 36,500 20,000 27,000 210,000 2,500 0 84,500 26,500 208,000 245,500 51,000 42,000 54,500 105,500 312,500 0 17,500

800 5,100 220 225 3,075 1,080 395 4,925 205 0 8,350 740 1,900 1,320 770 235 450 2,300 720 0 1,480

1,029,000 10,500 115,000 26,500 50,000 25,500 17,500 3,500 7,500 0 2,000 10,000 262,500 303,000 581,500 32,500 10,000 500 6,120,500 0 5,000

390 510 0 0 200 177 230 0 0 0 0 200 0 134 1,020 650 0 0 650 370 4,200

380 445 0 0 198 176 215 0 0 0 0 200 0 134 1,010 600 0 0 630 360 3,975

390 450 11,100 860 198 176 215 425 750 50 600 200 160 134 1,010 650 700 3,750 650 370 4,200

5 0 0 0 -1 0 -40 0 0 0 0 0 0 12 -10 40 0 0 20 0 0

1.28 0.00 0.00 0.00 -0.51 0.00 -18.60 0.00 0.00 0.00 0.00 0.00 0.00 8.96 -0.99 6.15 0.00 0.00 3.08 0.00 0.00

2.27 90.00 27.41 14.10 -24.75

751,000 20,424,500 0 0 91,500 6,954,000 115,500 0 0 0 0 25,000 0 500 30,500 10,500 0 0 16,000 129,500 2,340,500

289,532,500 9,805,517,500 0 0 18,238,000 1,226,618,000 25,367,500 0 0 0 0 5,000,000 0 67,000 30,860,000 6,465,000 0 0 10,100,000 46,630,000 9,647,725,000

390 455 12,000 0 199 177 230 430 0 50 0 205 200 129 1,030 650 0 0 650 370 4,200

4,000 501,500 8,000 0 65,000 1,173,500 9,500 2,500 0 698,500 0 919,500 11,500 11,000 5,000 1,000 0 0 93,000 85,500 101,500

385 450 10,700 0 198 176 215 0 0 0 0 200 0 120 1,000 610 0 3,000 630 360 4,175

858,000 1,000 500 0 15,000 447,000 19,500 0 0 0 0 1,500,000 0 500 105,500 1,000 0 1,500 14,000 22,500 24,500

111 500 6,100 145 1,280 380 580 600 3,025 2,350 2,850 152 510

101 385 5,900 132 1,220 375 580 550 2,825 2,275 2,700 148 475

102 385 6,000 137 1,230 380 580 590 2,850 2,275 2,700 148 490

-4 35 -100 0 -10 0 10 20 -125 -50 -100 -4 15

-3.92 9.09 -1.67 0.00 -0.81 0.00 1.72 3.39 -4.39 -2.20 -3.70 -2.70 3.06

111.11 15.22 28.60 27.14 13.49 1.25 24.15 91.00 36.49 6.43 219.73

159,000 474,771,500 30,500 643,000 2,189,000 6,129,500 10,000 3,195,500 31,723,000 3,909,000 4,711,500 90,500 32,883,500

17,195,500 192,032,030,000 183,025,000 88,362,500 2,714,520,000 2,328,685,000 5,800,000 1,868,865,000 91,775,925,000 8,908,675,000 12,837,375,000 13,396,000 16,150,395,000

109 385 6,000 142 1,230 385 580 590 2,850 2,275 2,700 151 495

2,500 5,677,000 29,500 83,500 58,000 3,598,500 29,500 84,500 1,175,000 1,026,000 72,000 2,000 185,000

102 380 5,850 137 1,220 380 540 580 2,825 2,250 2,675 148 490

47,000 14,992,000 1,000 101,000 148,000 52,500 25,000 590,500 992,500 689,000 41,500 287,500 2,085,000

1,750 0

1,620 0

1,700 260

100 0

5.88 0.00


2,255,000 0

3,812,540,000 0

1,700 0

93,000 0

1,690 0

154,500 0

1,900 0 0 280

1,830 0 0 265

1,880 240 50 270

50 0 0 5

2.66 0.00 0.00 1.85

17.74 120.00 -2.22 6.59

1,433,500 0 0 6,805,500

2,674,650,000 0 0 1,849,632,500

1,880 0 50 275

10,500 0 3,301,000 1,563,500

1,870 0 0 270

204,000 0 0 525,000

3,300 530 2,450 0 320 430 99 720 0 0

3,200 510 2,350 0 300 415 96 660 0 0

3,300 510 2,350 50 310 425 97 670 1,190 1,680

100 -10 -50 0 0 10 2 -20 0 0

3.03 -1.96 -2.13 0.00 0.00 2.35 2.06 -2.99 0.00 0.00

54.10 9.62 18.22 12.50 -38.75 38.64 1.90 33.50 99.17 28.00

2,756,500 36,032,500 13,969,000 0 25,915,000 84,918,000 21,690,500 159,527,500 0 0

8,979,012,500 18,700,635,000 33,317,087,500 0 8,103,635,000 35,867,145,000 2,110,981,000 109,793,060,000 0 0

3,300 675,500 520 6,413,500 2,375 22,000 50 1,098,933,500 310 1,536,500 425 4,164,000 98 492,000 670 4,731,500 1,190 1,000 0 0

3,250 510 2,350 0 305 420 97 660 0 0

208,000 24,059,500 3,500 0 3,832,000 5,120,000 423,000 9,017,000 0 0

460 220 415

435 200 400

455 210 405

20 -5 0

4.40 -2.38 0.00

4.46 15.00 -405.00

698,000 189,500 101,715,500

313,840,000 38,177,500 41,547,657,500

450 205 400

500 500 5,698,000

1.05 2.04 8.60 18.82 -19.17 -9.38 70.00 5.91 -0.96 8.27 12.50 2.45 -4.47 103.33 -12.46 24.50 3.18

15.36 106.25 9.49 55.56 1.20 7.69 12.31 382.86 11.48 11.61 -175.00 16.82 7.39 30.83 -700.00 2,550.00


455 210 405

5,000 28,000 1,328,500




8:49 PM

Page 21

21 SELASA 26 MARET 2013







Trd 25-Mar





11.400 13.300




Alam Karya Unggul Tbk.


Mandom Indonesia Tbk.


Bank ICB Bumiputera Tbk.








SMR Utama Tbk.








Radiant Utama Interinsco Tbk.








PP (Persero) Tbk.








Lippo Cikarang Tbk.








Wahana Pronatural Tbk.








Dyandra Media International Tbk








Pembangunan Graha Lestari Indah Tbk.122






Leo Investments Tbk.







MNC Kapital Indonesia Tbk.







Indofood CBP Sukses Makmur Tbk. 8.400






Sumi Indo Kabel






Mitra Adiperkasa Tbk.





11.100 13.300





Mata Uang

Jual (Rp)

Beli (Rp)
































































































Trd 25-Mar





Mandom Indonesia Tbk.

11.100 13.300

11.400 13.300









HM Sampoerna

78.950 80.900

79.100 80.000









Sarana Menara Nusantara Tbk.

25.500 26.500

25.500 26.500









Tambang Batubara Bukit Asam Tbk.13.500 14.350

13.700 14.200









Lippo Cikarang Tbk.













Indofood CBP Sukses Makmur Tbk. 8.400












Semen Gresik (Persero) Tbk.

16.850 17.500

16.850 17.500




Unilever Indonesia Tbk.

22.100 22.750

22.300 22.750


Mitra Adiperkasa Tbk.










Daftar nilai kurs sebagai dasar pelunasan Bea Masuk, PPN, PPnBM, Pajak Ekspor dan PPh,


Indo Tambangraya Megah Tbk.

33.300 34.500

33.700 33.800



berdasarkan Surat Keputusan Menteri Keuangan Nomor 15/KM.11/2013 tanggal 19-03-2013


Astra Agro Lestari Tbk.

18.050 18.500

18.050 18.500



Disusun urut nama negara, berlaku dari tanggal 20-03-2013 s/d 26-03-2013


Bank Central Asia Tbk.

10.600 10.900

10.500 10.900



Mata Uang



Indosat Tbk.





Amerika Serikat


Lion Metal Works Tbk.

13.100 13.350

13.350 13.350




Mayora Indah Tbk.

26.000 26.200

26.000 26.200









Siantar Top Tbk.







Trd 25-Mar




Island Concepts Indonesia Tbk.



Eratex Djaja Tbk.




ICTSI Jasa Prima Tbk.



Indo-Rama Synthetics Tbk.


Rimo Catur Lestari Tbk.


Bayan Resources Tbk.


Asuransi Dayin Mitra Tbk.


J Resources Asia Pasifik Tbk.


Sat Nusapersada Tbk.


Metropolitan Kentjana Tbk.


Renuka Coalindo Tbk.


Media Nusantara Citra Tbk.





Dev (Rp)

Dev (%)







Brunei Darussalam





































































100 JPY





Indo Straits Tbk.









Royal Oak Development Asia Tbk.





































































Saudi Arabia











Selandia Baru










Sri Lanka




















Bayan Resources Tbk.




Asahimas Flat Glass Tbk.





Metropolitan Kentjana Tbk.





J Resources Asia Pasifik Tbk.




Siantar Top Tbk.




Bank Danamon Indonesia Tbk.





Media Nusantara Citra Tbk.






Indo-Rama Synthetics Tbk.






Elang Mahkota Teknologi Tbk.






Perusahaan Gas Negara Tbk.






AKR Corporindo Tbk.






Supreme Cable Manufac & C Tbk.






Multi Prima Sejahtera Tbk.






Surya Citra Media Tbk.






Gajah Tunggal Tbk.





Trd 25-Mar

















1.010 -21,78




Tingkat suku bunga deposito berjangka Rp/US$ (% per tahun).



Nama Bank

1 Bulan

3 Bulan

6 Bulan

12 Bulan



Bank Artha Graha Int’l Tbk







Bank BNI Tbk







Bank UOB Buana







Bank Bukopin Tbk







Bank Bumi Arta Tbk







Bank ICB Bumiputera Tbk







Bank Central Asia Tbk







Bank Mutiara Tbk





Bank Danamon Tbk





Bank DKI





Bank Ekonomi Raharja





Bank International Indonesia Tbk





Bank Jabar Banten





Bank Kesawan Tbk





Bank Mandiri Tbk





Bank Mega Tbk







-1.573 -0.064




-0.14 -21.77




8.76 34,106.99




Frex (x)

Dyandra Media International Tbk




Bank ICB Bumiputera Tbk.





Nusantara Infrastructure Tbk.





Benakat Petroleum Energy Tbk.




TRAM Trada Maritime Tbk.





Energi Mega Persada Tbk.





Multipolar Tbk.




Bank CIMB Niaga Tbk


4,75/0,75 5,00/0,75.



Sentul City Tbk.










Lippo Karawaci Tbk.




Bank Panin Tbk










Bank Permata Tbk






Bumi Resources Tbk.




Bank Rakyat Indonesia Tbk






Agung Podomoro Land Tbk.




Bank Swadesi





MDLN Modernland Realty Tbk.




Bank Tabungan Negara






Sugih Energy Tbk.




Bank Mayora






Kalbe Farma Tbk.




Bank Bintang Manunggal














Frex (x)


Astra International Tbk.





Bank Rakyat Indonesia (Persero) Tbk. 31.596.000



TRAM Trada Maritime Tbk.





Dyandra Media International Tbk




Bank Mandiri (Persero) Tbk.





Lippo Karawaci Tbk.

SMGR Semen Gresik (Persero) Tbk.





2.338 3.291


Kalbe Farma Tbk.




Multipolar Tbk.





Telekomunikasi Indonesia Tbk.




MDLN Modernland Realty Tbk.








Perusahaan Gas Negara Tbk.


Alam Sutera Realty Tbk.





Indofood Sukses Makmur Tbk.







MNCN Media Nusantara Citra Tbk.


Yield 22 Mar

21 Mar

3.9488 3.9776 4.3985 4.5748 4.6957 4.8233 4.9688 5.1252 5.2854 5.4412 5.5874 5.7208 5.8899 5.9446 6.0854 6.1132

3.2451 4.0627 4.3879 4.5292 4.6422 4.7720 4.9229 5.0885 5.2590 5.4142 5.5646 5.7013 5.8228 5.9290 6.0208 6.0991

Tenor (tahun) 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30

Yield 22 Mar 21 Mar 6.1798 6.2351 6.2819 6.3209 6.3632 6.3800 6.4020 6.4201 6.4348 6.4489 6.4567 6.4647 6.4712 6.4764 6.4806

6.1885 6.2212 6.2678 6.3085 6.3384 6.3647 6.3863 6.4040 6.4184 6.4301 6.4995 6.4472 6.4534 6.4584 6.4625





Frex (x)


Garuda Indonesia (Persero) Tbk.





Dyandra Media International Tbk




Indopoly Swakarsa Industry Tbk.





BPD Jawa Barat dan Banten Tbk.


Bumi Resources Tbk.








Kalbe Farma Tbk.




Bank ICB Bumiputera Tbk.




COWL Cowell Development Tbk.




MNCN Media Nusantara Citra Tbk.





Kobexindo Tractors Tbk.





Benakat Petroleum Energy Tbk.





Astra International Tbk.





Lippo Karawaci Tbk.

SMGR Semen Gresik (Persero) Tbk. ADRO Adaro Energy Tbk.










Nama Broker














































































Nama Warant






Waran Seri I Tri Banyan Tirta






Waran Seri II Asuransi Mutli






Waran Seri I Bekasi Fajar Ind






Waran Seri III Bhuwanatala In






Waran Seri I Bintang Mitra Se






Waran Seri I Bank Sinarmas Tb





BSIM-W2 Waran Seri II Bank Sinarmas T






Waran Seri I Buana Listya Tam






Waran Seri V Bank Victoria






Waran Seri VI Bank Victoria






Waran Seri V Clipan Finance I






Waran Seri I Central Omega Re






Waran Seri II Smartfren Telec






Waran Seri I Gading Developme






Waran Seri I Evergreen Invesc






Waran Seri II Hotel Mandarine






Waran Seri I Saraswati Griya






Waran Seri I Inovisi Infracom






Waran Seri I Indopoly Swakars






Waran Seri II First Media Tbk






Waran Seri II Kertas Basuki R






Waran Seri II Kresna Graha Se






Waran Seri I Multi Agro Gemil




-2 -1


Waran Seri I Bank Windu Kentj





Waran Seri I Nusantara






Waran Seri II Multipolar Tbk.






Waran Seri I Nirvana Developm






Waran Seri I Minna Padi Inves






Waran Seri V Panin Financial






Waran Seri I Pool Advista Ind









SMMA-W4 Waran Seri IV Sinarmas Multia STAR-W

Waran Seri I Star Petrochem






Waran Seri II Sugih Energy Tb






Waran Seri I Solusi Tunas Pra






Waran Seri I Tiphone Mobile I






Waran Seri I Trisula Internat






Waran Seri I Visi Media Asia





BENCHMARK SUN Tenor 5.15 10.15 15.16 20.16


Fair price



FR0066 FR0063 FR0064 FR0065

101.2294 101.3650 99.9869 102.8240

4.9762 5.4484 6.1244 6.3732

5.2500 5.6250 6.1250 6.6250

TRANSAKSI HARIAN OBLIGASI 25 MARET 2013 Daftar seluruh transaksi obligasi yang dilaporkan melalui BEI Seri Jatuh Harga Harga Harga Obligasi Tempo Tertinggi Terendah Penutupan ADHI01ACN2 15-Mar-18 100.750 100.750 100.750 ADHI01BCN2 15-Mar-20 101.700 101.500 101.700 ADMF01ACN3 7-Oct-13 100.110 100.110 100.110 ADMF01BCN1 16-Dec-14 100.020 100.000 100.020 ADMF02DCN1 1-Mar-18 100.880 100.000 100.000 AKRA01A 21-Dec-17 101.700 101.650 101.650 ANTM01ACN1 14-Dec-18 100.000 100.000 100.000 ASDF01CCN1 21-Feb-17 99.750 99.750 99.750 ASDF11E 18-Sep-13 102.000 102.000 102.000 ASDF12C 25-Feb-14 102.650 102.650 102.650 BDMN02A 9-Dec-13 101.650 101.600 101.600 BNGA01SB 8-Jul-17 108.750 108.650 108.750 BNLI01SBCN2 19-Dec-19 101.170 101.100 101.150 BTPN02A 18-May-13 99.950 99.930 99.950 FIFA01BCN1 20-Apr-14 100.350 100.050 100.350 FIFA11C 26-Apr-14 102.700 102.500 102.700 FR0026 15-Oct-14 110.400 110.400 110.400 FR0027 15-Jun-15 111.250 111.250 111.250 FR0028 15-Jul-17 119.750 119.750 119.750 FR0030 15-May-16 117.250 117.250 117.250 FR0031 15-Nov-20 136.250 135.950 135.950 FR0032 15-Jul-18 146.000 146.000 146.000 FR0034 15-Jun-21 149.500 148.700 149.500 FR0035 15-Jun-22 152.990 152.990 152.990 FR0036 15-Sep-19 135.000 134.000 135.000 FR0038 15-Aug-18 131.000 131.000 131.000 FR0043 15-Jul-22 134.250 133.500 134.180 FR0044 15-Sep-24 135.000 134.400 134.900 FR0047 15-Feb-28 137.300 136.800 136.800 FR0050 15-Jul-38 150.500 149.750 149.750 FR0051 15-May-14 108.350 107.500 107.500 FR0052 15-Aug-30 145.000 144.500 144.500 FR0053 15-Jul-21 119.000 119.000 119.000 FR0054 15-Jul-31 136.250 134.300 134.300 FR0055 15-Sep-16 108.600 108.600 108.600 FR0056 15-Sep-26 121.600 120.000 120.950 FR0058 15-Jun-32 124.000 119.250 120.250 FR0059 15-May-27 108.680 108.000 108.520 FR0060 15-Apr-17 106.050 105.000 105.000 FR0061 15-May-22 112.000 111.250 111.250 FR0062 15-Apr-42 101.600 98.000 99.250 FR0063 15-May-23 101.600 101.350 101.500 FR0064 15-May-28 100.500 99.750 100.200 FR0065 15-May-33 106.850 101.250 102.650 FR0066 15-May-18 101.640 101.250 101.640 GBRB0020MyBV 25-Apr-15 98.650 98.450 98.450 GBRB0021NvBV 25-Nov-15 98.500 98.500 98.500 GBRB0023NvBV 25-Oct-16 98.990 98.990 98.990 IFR0003 15-Sep-15 109.370 109.370 109.370 ISAT05B 29-May-17 110.500 110.500 110.500 ISAT08A 27-Jun-19 103.550 103.500 103.500 ISAT08B 27-Jun-22 101.000 101.000 101.000 JPFA01CN1 12-Jan-17 103.850 103.150 103.850 MEDC01CN1 19-Dec-17 100.250 100.250 100.250 MEDC01CN2 15-Mar-18 103.000 100.220 102.500 MEDC02B 17-Jun-14 107.800 107.200 107.200 MEDC03 19-Jun-17 100.900 100.100 100.250 NISP03SB 30-Jun-17 107.750 107.500 107.500 ORI005 15-Sep-13 102.700 100.500 101.250 ORI007 15-Aug-13 101.000 100.400 100.800 ORI008 15-Oct-14 104.350 102.450 102.450 ORI009 15-Oct-15 102.300 101.000 102.250 PNBN01SBCN1 20-Dec-19 101.500 101.000 101.100 PNBN03 9-Apr-18 100.000 100.000 100.000 PPLN07 11-Nov-14 108.100 108.100 108.100 PTPP01CN1 19-Mar-18 100.950 100.500 100.950 SANF02B 20-Jan-14 100.760 100.760 100.760 SANF02C 20-Jan-15 102.000 102.000 102.000 SIKISAT03 9-Apr-13 100.130 100.130 100.130 SMAR01ACN1 3-Jul-17 101.900 101.570 101.900 SPN03130517 17-May-13 99.490 99.480 99.490 SPN12130404 4-Apr-13 99.950 99.900 99.900 SPN12130502 2-May-13 99.740 99.570 99.740 SPN12130606 6-Jun-13 99.120 99.120 99.120 SPN12131113 13-Nov-13 97.360 97.360 97.360 SR003 23-Feb-14 103.710 100.500 101.750 SR004 21-Sep-15 102.100 100.500 100.650 SR005 27-Feb-16 102.300 100.000 101.450 SSIA01A 6-Nov-15 100.500 100.400 100.500

Frek 25 4 1 3 3 2 1 1 1 1 2 2 7 2 5 3 1 2 1 1 2 1 9 1 3 4 4 4 3 4 2 4 1 2 1 5 29 7 5 10 18 30 21 38 6 2 1 1 1 1 2 1 4 1 12 4 6 3 6 7 6 29 4 2 1 3 1 1 1 5 2 2 2 1 1 13 11 119 2

Volume (Mil Rp) 9.80 20.00 2.00 20.00 29.00 22.00 2.00 0.15 1.00 1.00 44.00 10.00 182.00 28.00 25.00 13.50 150.00 40.00 3.00 50.00 4.70 10.00 631.70 20.00 11.00 15.50 14.30 24.50 7.95 29.50 31.15 8.20 4.00 0.43 3.00 83.70 127.14 35.25 55.40 346.60 67.06 913.61 461.57 278.63 105.15 400.00 200.00 100.00 109.00 4.00 30.10 0.10 8.00 5.00 4.88 6.00 12.00 12.00 0.63 2.87 1.09 62.57 10.10 10.00 0.50 3.00 2.00 0.24 5.00 13.00 56.90 10.00 5.50 98.50 0.50 15.55 4.18 752.18 2.00

Nilai (Mil Rp) 9.8735 20.3245 2.0022 20.0020 29.0346 22.3685 2.0000 0.1496 1.0200 1.0265 44.7150 10.8700 184.0585 27.9832 25.0475 13.8510 165.6000 44.5000 3.5925 58.6250 6.3987 14.6000 942.6579 30.5980 14.8000 20.3050 19.1606 33.0075 10.9004 44.2513 33.5113 11.8565 4.7600 0.5752 3.2580 101.5708 153.3517 38.2848 58.4545 387.2575 67.1110 927.8146 462.6895 286.7882 106.6320 394.0000 197.0000 98.9900 119.2133 4.4200 31.1685 0.1010 8.2918 5.0125 4.9681 6.4460 12.0465 12.9120 0.6457 2.8920 1.1264 63.9390 10.2171 10.0000 0.5405 3.0215 2.0153 0.2448 5.0066 13.2120 56.6045 9.9923 5.4772 97.6333 0.4868 16.0622 4.2489 766.8434 2.0090

Nama/jenis Reksadana

NilaiAktiva Bersih Rp

PENDAPATAN TETAP AXA MaestroObligasi Plus * 1,112.41 Batavia Dana Obligasi Plus 1,040.34 Batavia Dana Obligasi Ultima ( d/h Si DanaObligasi Ultima ) 1,722.86 Batavia Prima Obligasi 1,118.43 BNP PARIBAS DOLAR PLUS* 0.9999 BNP Paribas Maxi Obligasi 1,193.31 BNP Paribas Obligasi Plus * 1,592.73 BNP Paribas Prima Asia USD* 1.0410 BNP Paribas Prima II * 1,942.61 BNP Paribas Prima USD* 1.0831 BNP Paribas Rupiah Plus ( D/H Fortis Rupiah Plus) 1,651.60 BNP Paribas Rupiah Plus II * 1,037.23 Reksadana CIMB Principal Dollar Bond (Rp) 10,686.33 Reksadana CIMB Principal Dollar Bond (USD) 1.0985125 CIMB-Principal Income Fund A* 2,075.81 Dana Obligasi Stabil 2,540.05 Dana Pasti 2,847.88 Dana Premier 1,823.06 Danamas Dollar (Rp) * 13,909.89 Danamas Dollar (USD) * 1.427680 Danareksa Gebyar Indonesia II 1,683.70 Danareksa Melati Dollar (Rp)* 1,669.34 Danareksa Melati Dollar* 0.1713377851 Danareksa Melati Pendapatan Tetap II* 1,478.74 Danareksa Melati Pendapatan Tetap III* 1,087.31 Danareksa Melati Pendapatan Tetap IV * 1,017.77 Danareksa Melati Pendapatan Tetap V * 1,011.30 Danareksa Melati Pendapatan Tetap* 1,080.97 Danareksa Melati Pendapatan Utama 1,029.37 Danareksa Melati Platinum Dollar AS (Rp)* 10,513.96 Danareksa Melati Platinum Dollar AS* 1.0791293354 Danareksa Melati Platinum Rupiah* 1,441.68 Danareksa Melati Premium Dollar (Rp)* 11,861.17 Danareksa Melati Premium Dollar II* 1,009.92 Danareksa Melati Premium Dollar* 1.2174042178 EMCO Dana Prima 1,038.52 First State Ind. Bond Fund 2,603.69 Ganesha Abadi 2,633.16 GMT Dana Kencana 1,426.43 GMT Dana Obligasi Plus 2,486.97 GMT Dana Pasti 2 1,642.85 Insight_METI Renewable Energy Fund 1,135.95 Investa Dana Dolar Mandiri 1.300528 Investasi Reksa Premium * 2,380.52 ITB-Niaga 2,151.33 Kehati Lestari 1,691.84 Kresna Olympus 1,962.45 Maestrodollar 1.4767 Makara Prima * 1,900.99 Mandiri Investa Dana Obligasi Seri II 1,067.19 Mandiri Investa Dana Pendapatan Optimal 2,228.34 Mandiri Investa Dana Pendapatan Optimal 2* 1,090.98 Mandiri Investa Dana Syariah 2,549.96 Mandiri Investa Dana Utama 1,712.78 Mandiri Investa Keluarga 1,186.12 Manulife Dana Tetap Pemerintah 1,752.68 Manulife Dana Tetap Utama 1,436.98 Manulife Obligasi Negara Indonesia II 1,715.61 Manulife Obligasi Unggulan 2,014.54 Manulife Pendapatan Bulanan II 1,110.86 Medali Dua 1,545.51 Medali Syariah 1,528.25 MNC Dana Dollar (Rp) * 10,538.58 MNC Dana Dollar (USD) * 1.081657 MNC Dana Likuid ( BIG Dana Likuid Satu) 1,777.44 MNC Dana Syariah (Big Dana Muamalah) 1,967.77 MRS BOND KRESNA* 1,535.22 NET Dana Gemilang 1,342.92 Nikko Gebyar Indonesia Dua 1,645.99 Nikko Indah Nusantara Dua 1,708.43 Nikko Indonesia Bond Fund 1,014.22 Nikko Tron Dua 1,581.58 NISP Dana Idola US Dollar 1.186411 NISP Dana Pendapatan Stabil 1,120.56 NISP Dana Tetap II 1,476.42 NISP Dana Tetap Likuid 1,459.01 NISP Obligasi Negara Extra 1,384.56 Optima Pendapatan Abadi 2,309.23 Panin Dana Utama Plus 2 1,935.74 Panin Gebyar Indonesia II 1,848.01 Pendapatan Tetap Abadi 2 1,975.56 Pendapatan Tetap Utama 2,915.31 PNM Dana Sejahtera II 1,321.86 Premier Obligasi 1,079.03 RD Syailendra Fixed Income Fund 1,127.45 Reksa Dana Bahana Makara Abadi 2,589.92 Reksa Dana PAPI 2,519.96 Reksa Dana PNM Amanah Syariah 1,733.21 Reksadana CIMB - Principal Bond 17,304.11 Reksadana Eastspring Investments IDR High Grade 1,008.66 Schroder Dana Andalan II 1,027.94 Schroder Dana Mantap Plus II 2,001.89 Schroder Dana Obligasi Mantap * 1,155.87 Schroder IDR Bond Fund 1,501.05 Schroder IDR Bond Fund II 1,533.74 Schroder IDR Bond Fund III * 1,031.53 Schroder IDR Bond Fund IV 1,103.55 Schroder Prestasi Gebyar Indonesia II 1,983.24 Schroder USD Bond Fund (USD) 1.3628 Si DanaObligasi Maxima 2,418.06 Sucorinvest Government Bond Fund 1,047.09 TRAM Pendapatan Tetap USD 1.1153 TRAM Reguler Income 1,031.82 TRAM Strategic Plus 1,146.79 Trim Dana Stabil * 2,006.89 Tugu Mandiri Mantap 1,239.83 SAHAM Archipelago Equity Growth 1,411.53 Ashmore Dana Ekuitas Nusantara 1,058.15 Ashmore Dana Progresif Nusantara 1,090.93 Bahana Dana Prima 14,605.17 Batavia Dana Saham Agro 753.67 Batavia Dana Saham Optimal 2,306.51 Batavia Dana Saham Syariah 1,895.13 Batavia Dana Saham 45,742.13 BNP Paribas Ekuitas (D/H Fortis Ekuitas ) 16,899.47 BNP Paribas Infrastruktur Plus * 2,688.62 BNP Paribas Inspira 1,219.31 BNP Paribas Maxi Saham ( D/H Fortis Maxi Saham ) 1,620.92 BNP Paribas Pesona (d/h Fortis Pesona) 23,530.23 BNP Paribas Pesona Amanah (d/h Fortis Pesona Amanah) 2,365.61 BNP Paribas Solaris (d/h Fortis Solaris)* 2,170.47 BNP Paribas Star 1,406.37 Cipta Syariah Equity 1,887.22 Dana Ekuitas Prima* 4,313.97 Dana Pratama Ekuitas ( D/H Platinum Saham ) 6,685.77 Danareksa Mawar Agresif* 1,211.23 Danareksa Mawar Fokus 10* 1,564.76 Danareksa Mawar Komoditas 10* 703.55 Danareksa Mawar Konsumer 10* 1,549.08 Danareksa Mawar Rotasi Sektor Strategis 1,126.12 Danareksa Mawar* 7,907.93 First State Dividend Yield Fund 3,850.76 First State Indoequity High Conviction Fund 1,056.01 First State IndoEquity Peka Fund* 1,605.83 First State Indoequity Sectoral Fund 5,121.94 First State Indoequity Value Select Fund 1,554.08 GAP Equity Fund 1,223.35 GAP Value Fund 1,219.75 GMT Dana Ekuitas 3,287.42 HPAM Ultima Ekuitas 1 1,694.47 Indosurya Equity Fund 1,493.00 Mandiri Asa Sejahtera 1,130.93 Mandiri Dynamic Equity * 1,179.69 Mandiri Investa Atraktif Syariah 1,411.02 Mandiri Investa Atraktif 4,416.83 Mandiri Investa Equity Movement* 1,129.20 Mandiri Investa UGM 2,502.52 Mandiri Komoditas Syariah Plus* 803.20 Mandiri Saham Atraktif* 1,234.81 MANDIRI SAHAM PRIMA 1,010.79 Mandiri Saham Syariah Atraktif* 1,220.94 Manulife Dana Saham 11,096.67 Manulife Greater Indonesia Fund 1.3235 Manulife Institutional Equity Fund 1,172.19 Manulife Saham Andalan 1,861.60 Manulife Saham SMC Plus 1,006.39 Manulife Syariah Sektoral Amanah 3,514.82 MNC Dana Ekuitas (Big Bhakti Ekuitas) 3,551.67 MNC Dana Syariah Ekuitas 1,027.17 Nikko Indonesia Equity Fund 1,058.78 NISP Indeks Saham Progresif* 1,728.92 Panin Dana Maksima 68,667.76 Panin Dana Prima 3,181.77 Panin Dana Syariah Saham 1,154.77 Phinisi Dana Saham 20,530.92 PNM Ekuitas Syariah 1,599.25 PNM Saham Agresif 890.86 Pratama Saham 4,766.88 Prospera Bijak 703.64 RD Saham Eastspring Investments Alpha Navigator 1,235.15 RD Mandiri Investa Ekuitas Dinamis 1,498.68 RD OSKN Indonesia Dynamic Resources Plus 965.07 Reksa Dana AXA Citradinamis 4,331.31 Reksa Dana CIMB-Principal Equity Aggressive 3,194.55 Reksa Dana CIMB-Principal Islamic Equity Growth Sy 1,591.09 Reksa Dana Grow-2-Prosper 2,430.37 Reksa Dana OSK Nusadana Alpha Sector Rotation 1,221.42 Reksadana AAA Enhanced Strategy Fund 1,019.10 Rencana Cerdas 12,377.65 SAM Indonesian Equity Fund 1,806.48 Schroder 90 Plus Equity Fund* 1,612.20 Schroder Dana Istimewa 5,978.87 Schroder Dana Prestasi Dinamis* 1,236.79 Schroder Dana Prestasi Plus 24,005.36 Schroder Indo Equity Fund 1,824.17 Sucorinvest Equity Fund 1,122.44 Syailendra Equity Opportunity Fund 3,703.25 TRAM Consumption Plus 1,375.22 TRAM Infrastructure Plus 1,172.33 Trim Syariah Saham 1,604.79 CAMPURAN Archipelago Balance Fund 1,037.05 Bahana Dana Infrastruktur 7,509.28 Bahana Dana Selaras 6,709.68 Bahana Quant Strategy* 1,292.89 Batavia Dana Dinamis 5,953.20 Batavia USD Balanced Asia 1.0548 BNP Paribas Dana Investa (D/H Fortis Dana Investa) 2,985.94 BNP Paribas Equitra ( D/H Fortis Equitra ) 3,133.43 BNP Paribas Integra 1,074.71 Cipta Balance 1,465.24 Cipta Syariah Balance 1,731.56 Citragold 1,950.14 Danareksa Anggrek Fleksibel* 3,345.18 Danareksa Anggrek* 5,484.33 Danareksa Syariah Berimbang* 5,720.64 EMCO Dana Dinamis 1,159.53 First State Ind. Balanced Fund 2,382.51 First State Indonesian USD Balanced Plus Fund * 1.0288 First State MultiStrategy Fund 3,598.20 Garuda Satu 5,188.91 Harvestindo Istimewa * 1,020.17 HPAM Premiun-I 1,254.98 Indosurya Balance Fund 1,412.57 IPB Syariah 2,264.12 Reksa Dana Kresna Flexima 2,176.99 Reksa Dana Kresna Ultima Flexi 1,537.55 Mandiri Aktif * 1,100.98 Mandiri Berimbang Syariah Aktif* 1,181.43 Mandiri Investa Aktif 3,292.58 Mandiri Investa Syariah Berimbang 2,752.34 Manulife Dana Campuran II 2,441.49 Manulife Dana Stabil Berimbang 1,704.92 Manulife Dana Tumbuh Berimbang 1,896.87 MNC Dana Kombinasi (BIG BHAKTI KOMBINASI) 2,049.56 MNC Dana Kombinasi Icon 1,226.11 MNC Dana Kombinasi Konsumen 1,018.41 MNC Dana Syariah Kombinasi 1,021.89 MRS FLEX KRESNA * 1,660.32 NET Dana Flexi 953.03 Nikko BUMN Plus 2,055.74 Nikko Indonesia Balanced Fund 1,043.27 NISP Dana Handal* 2,151.39 NISP Flexigrowth 1,500.10 Panin Dana Bersama Plus 1,273.32 Panin Dana Syariah Berimbang 1,106.22 Panin Dana Unggulan 5,500.66 Panin Dana US Dollar 1.4454 Pratama Berimbang ( D/H Platinum Berimbang ) 3,211.99 RD BNP Paribas Spektra (D/H Fortis Spektra) 1,401.57 Reksa Dana Batavia Prima Ekspektasi 3,411.78 Reksa dana BNI - AM Dana Terencana 1,139.74 Reksa Dana CIMB-Principal Balanced Growth 2,883.50 Reksa Dana CIMB-Principal Balanced Strategic Plus 1,133.76 Reksa dana Cipta Dinamika 1,231.18 Reksa Dana Equator Alpha 1,036.44 Reksa Dana GMT Dana Fleksi 2,584.02 Reksa Dana GMT Dana Unggulan 1,062.06 Reksa Dana Maestroberimbang 4,277.45 Reksa Dana Panin Dana Bersama 5,759.27 Reksa Dana Panin Dana Prioritas 1,046.65 Reksa Dana PNM Syariah 3,218.12 Reksa Dana Prima 1,093.23 Reksa Dana UGM CIMB-Principal Balanced 1,123.36 Reksadana Keraton * 2,222.37 Reksa dana Kresna Optimus 2,601.27 Premier Campuran Fleksibel 2,658.65 Schroder Dana Campuran Progresif* 1,148.53 Schroder Dana Kombinasi 2,597.46 Schroder Dana Prestasi* 28,029.11 Schroder Dana Terpadu II 2,792.76 Schroder Providence Fund 3,052.29 Schroder Syariah Balanced Fund 1,941.85 Semesta Dana Maxima 6,337.28 Syailendra Balance Opportunity Fund 2,234.88 Trim Kombinasi 2 1,891.64 Trim Syariah Berimbang 2,192.48 PASAR UANG Reksa Dana Equator Dana Kas 1,010.83 Bahana Dana Likuid 1,006.40 Batavia Dana Kas Maxima (d/h Si DanaKas Maxima ) 1,011.37 Danareksa Gebyar Dana Likuid 1,010.65 DPLK BRI FIX 1,730.49 DPLK BRI PASAR UANG 2,000.74 DPLK BRI SAHAM 1,945.54 First State Indonesian Money Market Fund 1,010.76 Mandiri Investa Pasar Uang 1,011.72 Manulife Dana Kas II 1,008.36 Manulife Flexinvest Plus 1,010.98

Hasil investasi dalam % 30hari



0.01 -0.28 0.40 0.02 0.00 -0.08 0.10 -1.75 -0.19 -0.19 0.20 -0.16 -0.52 -0.52 0.12 1.23 0.65 0.23 0.41 0.41 -0.55 0.00 -0.58 -0.10 0.98 -0.66 -1.13 0.06 -0.55 0.00 -0.61 0.32 0.00 -0.41 -0.92 0.66 -0.27 0.21 0.76 1.73 0.66 0.42 -0.49 -0.06 0.07 -0.09 -0.01 0.48 0.86 -0.29 -0.17 0.18 0.12 0.12 0.39 -0.38 -0.05 -0.34 -0.22 -0.24 -0.30 -0.23 -0.15 -0.15 0.61 0.48 1.70 0.74 -0.06 0.70 0.06 -0.20 -0.72 0.18 0.51 0.82 -0.36 -0.08 -0.43 -1.16 -0.09 -0.24 0.87 -0.12 0.87 -0.11 0.40 0.49 0.02 -0.35 0.27 -0.26 0.03 -0.12 0.00 -0.03 -0.27 -0.37 0.13 0.57 0.46 -0.89 0.26 -0.08 0.64 0.51

6.40 0.00 6.77 0.00 0.00 8.81 10.12 1.11 7.21 3.01 4.44 6.41 2.29 2.29 5.89 7.31 8.12 7.43 3.60 3.60 6.36 0.00 2.61 9.51 8.93 0.00 0.00 4.69 0.00 0.00 2.87 4.54 0.00 3.18 0.49 0.00 6.49 10.44 7.84 6.52 8.67 6.08 3.71 4.22 3.66 6.83 5.10 4.84 11.03 7.06 9.49 5.78 7.65 10.04 6.96 6.94 0.00 6.89 7.42 3.42 6.56 5.49 3.81 3.81 7.34 7.04 9.93 9.15 3.90 9.15 0.00 6.78 2.30 0.00 7.92 5.85 4.77 9.21 7.78 5.43 8.18 6.91 5.10 5.20 9.42 8.05 8.40 4.45 8.85 0.00 4.17 7.34 8.34 8.41 9.65 4.27 8.46 7.49 3.24 8.58 0.00 4.73 5.84 7.97 7.61 5.57

5.08 0.00 4.65 0.00 0.00 4.54 -0.37 -2.86 5.11 -1.03 3.40 5.36 0.26 0.26 4.83 5.24 5.43 4.24 3.60 3.60 5.36 0.00 1.08 9.51 7.31 0.00 0.00 4.69 0.00 0.00 -0.16 2.47 0.00 1.14 -2.47 0.00 2.31 7.72 3.61 6.52 8.67 6.08 1.66 4.22 1.35 4.20 -2.91 1.76 11.03 7.06 9.49 3.69 5.25 7.87 4.84 -1.44 0.00 2.70 3.20 -0.64 4.45 2.36 3.81 3.81 7.34 7.04 5.62 8.15 2.61 8.10 0.00 6.24 -1.71 0.00 6.32 3.75 3.20 6.52 7.78 4.13 5.52 3.74 5.10 2.12 5.13 4.85 6.25 2.38 6.70 0.00 3.65 5.21 8.34 6.27 7.48 2.20 6.32 5.41 1.20 1.62 0.00 0.63 5.35 7.43 7.61 3.48

10.09 4.34 7.28 2.89 -1.39 3.98 5.56 2.85 3.44 2.40 3.55 2.90 3.43 5.45 4.34 3.44 5.30 4.24 7.20 2.58 4.81 -7.49 4.31 2.20 2.17 2.12 4.66 2.70 2.79 2.62 6.27 8.45 4.33 1.53 1.93 9.85 7.41 6.60 5.69 1.75 8.37 -7.79 3.66 0.00 5.01 2.61 3.04 3.95 3.64 0.00 3.52 5.04 2.27 0.07 0.56 6.86 4.87 5.50 0.18 4.57 7.34 9.91 -2.89 5.17 9.35 1.49 2.64 3.83 5.17 4.26 5.76 2.03 2.65 9.95 4.43 4.18 2.10 2.03 3.81 3.71 6.30 3.23 4.49 7.06

0.00 0.00 0.00 18.02 -17.98 23.76 19.94 15.36 13.84 19.20 15.71 14.53 15.96 21.81 19.13 17.18 17.05 19.15 17.31 13.91 18.67 -24.29 26.73 0.00 11.40 15.61 5.42 13.65 12.35 13.37 0.00 0.00 17.00 15.22 4.86 0.00 0.00 11.27 16.77 0.00 12.55 -23.95 15.58 0.00 10.79 15.55 8.56 18.98 16.16 0.00 15.04 24.79 0.00 0.00 6.96 23.40 22.51 0.00 18.32 4.30 3.49 27.49 -23.69 0.00 23.30 1.24 18.64 11.31 12.22 14.05 29.60 0.00 12.53 54.10 10.59 13.69 9.35 8.49 13.61 0.00 32.59 23.36 0.00 21.00

0.00 0.00 0.00 14.53 -21.58 18.89 17.56 13.09 9.42 15.41 11.17 11.15 12.26 18.21 14.46 11.49 17.05 11.52 15.56 10.04 15.11 -26.56 22.93 0.00 9.75 11.08 1.29 9.20 7.94 8.93 0.00 0.00 17.00 15.22 2.28 0.00 0.00 8.80 15.46 0.00 10.05 -25.46 13.29 0.00 8.60 11.02 4.31 14.31 14.72 0.00 13.32 24.79 0.00 0.00 4.84 20.96 19.28 0.00 16.85 4.30 -1.03 24.97 -26.68 0.00 20.86 -2.73 17.17 8.84 12.22 9.55 24.52 0.00 8.16 52.58 10.59 13.12 9.35 5.84 2.79 0.00 28.65 18.52 0.00 21.00

2.90 3.57 0.48 3.66 3.03 -1.55 2.29 0.97 0.76 1.55 3.96 0.57 1.02 0.82 2.39 5.72 0.73 2.03 1.56 0.32 -0.15 0.78 0.10 3.51 10.56 2.39 3.97 3.38 4.83 4.81 1.26 0.42 2.43 3.08 7.42 1.82 1.96 1.99 -4.69 4.50 0.09 -1.41 0.91 4.99 4.72 2.93 0.05 7.87 3.89 3.34 3.42 -0.06 2.75 0.90 0.95 3.74 0.67 1.07 5.66 1.25 2.54 0.44 1.21 1.63 2.34 5.96 2.93 1.10 4.89 1.71 3.14 3.35 4.65 5.57 3.53 3.30

0.00 10.78 10.81 15.10 15.92 0.18 12.68 4.61 0.00 7.22 10.65 4.34 8.22 7.63 10.49 0.00 6.61 0.00 11.87 8.72 -1.73 7.36 4.70 2.43 37.56 -3.27 0.00 8.31 13.68 9.25 11.38 7.41 12.73 18.98 0.00 0.00 0.00 2.50 -13.60 35.64 0.00 5.51 6.03 19.98 0.00 12.88 2.04 21.71 10.81 19.55 0.00 12.90 0.00 5.94 0.00 21.02 0.00 11.68 23.92 0.00 0.35 4.23 9.55 6.54 -10.64 10.47 8.90 10.09 15.53 7.20 12.19 15.13 9.96 24.64 25.58 13.82

0.00 7.51 7.53 11.71 15.34 -3.75 9.92 0.51 0.00 3.06 10.65 1.27 6.09 6.03 8.85 0.00 2.43 0.00 7.49 4.97 -1.73 5.50 2.12 2.43 27.08 -10.64 0.00 6.16 11.42 7.09 7.01 6.08 11.34 18.98 0.00 0.00 0.00 -1.52 -14.60 34.29 0.00 4.72 3.93 17.88 0.00 10.75 0.52 19.89 7.55 19.55 0.00 10.39 0.00 2.83 0.00 18.63 0.00 10.29 20.90 0.00 -2.57 3.20 6.85 6.54 -10.64 7.75 4.14 7.39 12.97 4.57 12.19 12.86 7.78 24.64 25.58 13.82

0.40 0.41 0.41 0.34 0.36 0.61 4.17 0.37 1.17 0.27 0.40

4.62 4.01 4.68 4.29 15.00 6.95 15.95 4.48 4.62 3.25 3.39

4.62 4.01 4.68 4.29 15.00 6.95 15.95 4.48 4.62 3.25 3.39

MNC Dana Lancar (Big Dana Lancar ) 1,011.34 Mrs Cash Kresna 1,001.94 Nikko Indonesia Money Market Fund 1,010.84 Nikko Kas Management 1,012.03 NISP Dana Siaga 1,010.40 OSK Nusadana Rupiah Liquid Fund 1,012.66 Panin Dana Likuid 1,014.06 Premier Pasar Uang 1,010.88 Reksa Dana CIMB-Principal Cash Fund 1,012.41 Reksa Dana GMT Dana Pasar Uang 1,015.17 Reksa Dana PNM Puas 1,008.55 Schroder Dana Likuid 1,009.00 Seruni Pasar Uang II 1,011.27 Seruni Pasar Uang III 1,010.11 INDEKS Reksa Dana Kresna Indeks 45 3,525.49 Danareksa Indeks Syariah 2,672.65 RD INDEKS OSK Nusadana LQ45 Tracker 1,144.91 REKSA DANA INDEKS CIMB-PRINCIPAL INDEX IDX30 1,100.15 PG Indeks Bisnis 27 1,117.85 EXCHANGE TRADE FUND (Reksa dana yang diperdagangankan di BEI) ABF IBI Fund 27,248.87 Premier ETF IDX30 403.1874999 Premier ETF LQ-45 798.1148999 DANA INVESTASI REAL ESTATE DIRE Ciptadana Properti Ritel Indonesia 109.96 PENYERTAAN TERBATAS Mandiri Optima Terbatas 2 5,000,000,000.00 Mandiri Optima Terbatas 4 5,000,000,000.00 Mandiri Optima Terbatas 5 5,000,000,000.00 RDPT Dhanawibawa Eksklusif Terbatas I (28/12/12) 7,965,579,666.99 PNM Pembiayaan Mikro BUMN 2012 (18/02/13) 5,020,196,448.51 PNM Pembiayaan Mikro BUMN 2012 Seri II (28/02/13)5,030,217,283.94 RDPT PNM Pembiayaan P PERUMNAS 2012 5,064,027,178.78 RDPT AAA Pembangunan Indonesia Fund 5,128,133,234.2795 Keterangan : *) NAB per tanggl 22 Maret 2013

0.43 0.00 0.39 0.34 0.29 0.41 0.44 0.32 0.42 0.44 0.28 0.29 0.36 0.32

5.02 1.60 0.00 4.68 4.24 5.17 0.00 4.84 5.05 6.06 3.85 3.99 4.72 4.06

5.02 1.60 0.00 4.68 4.24 5.17 0.00 4.84 5.05 6.06 3.85 3.99 4.72 4.06

1.74 0.77 1.79 1.10 0.25

16.92 12.49 0.00 0.00 0.00

12.89 9.21 0.00 0.00 0.00

-1.49 0.86 1.01

8.22 0.00 15.46

8.22 0.00 15.46




0.00 0.00 0.00 4.41 -1.69 -1.64 -1.64 0.80

0.00 0.00 0.00 13.90 0.00 0.00 0.00 0.00

0.00 0.00 0.00 13.90 0.00 0.00 0.00 0.00

INSURANCE LINKED AJ Manulife Indonesia

Harga per unit 25-Mar-13 22-Mar-13 21-Mar-13 Pro-Invest Rupiah Fund 3,432.08 3,436.23 3,436.89 Pro-Invest US$ Fund 1.40775 1.40866 1.40834 PT Prudential Life Assurance 25-Mar-13 22-Mar-13 21-Mar-13 PRUlink Rupiah Managed Fund 7,559.15 7,577.52 7,583.16 PRUlink Rupiah Managed Fund plus 2,465.90 2,474.02 2,478.47 PRUlink US Dollar Fixed Income Fund 2.72202 2.72353 2.72120 PRUlink Rupiah Equity Fund 14,187.03 14,259.70 14,308.56 PRUlink Rupiah Fixed Income Fund 4,568.73 4,578.46 4,577.82 PRUlink Rupiah Cash Fund 2,580.80 2,579.91 2,879.61 PRUlink Syariah Rupiah Managed Fund 1,905.39 1,908.32 1,909.61 PRUlink Syariah Rupiah Equity Fund 2,026.10 2,031.73 2,034.57 PRUlink Syariah Rupiah Cash & Bond Fund 1,486.11 1,486.36 1,486.17 PRUlink US Dollar Indonesia Greater China Equity Fund 0.10744 0.10772 0.10787 PRUlink Rupiah Indonesia Greater China Equity Fund 1,045.13 1,049.47 1,049.18 PT MNC Life Assurance 22-Mar-13 21-Mar-13 20-Mar-13 MNC Life Assurance Dinamis IDR 1,424.2159 1,459.1252 1,472.3019 MNC Life Assurance Aman IDR 1,109.5410 1,109.4390 1,109.3396 MNC Life Assurance Berimbang IDR 1,352.5710 1,368.3133 1,373.4802 MNC Life Assurance Konservatif IDR 1,078.0259 1,077.9178 1,077.7743 Sun Life Financial Indonesia 22-Mar-13 21-Mar-13 20-Mar-13 Brilliance Aggressive 11,331.57 11,555.66 11,654.65 Brilliance Moderate 6,385.21 6,450.68 6,481.19 Brilliance Conservative 2,787.60 2,798.71 2,803.04 Brilliance Extra Aggressive 1,693.58 1,725.03 1,738.59 Brilliance Xtra Dynamic 1,528.42 1,535.84 1,538.96 Brilliance Xtra Prima 2,005.04 2,008.24 2,008.64 Brilliance Xtra Progressive 1,268.36 1,268.75 1,268.78 Brilliance USD Managed Fund 2.4849 2.4865 2.4838 Optima Principal Value 1,197.38 1,197.27 1,197.16 Brilliance Aggressive Multi Plus Fund 2,352.50 2,398.36 2,406.24 Brilliance Hasanah Equity Fund 1,739.29 1,774.50 1,782.92 Salam Equity Fund 1,354.12 1,381.75 1,388.44 Salam Balanced Fund 1,220.49 1,242.33 1,247.08 Maxi Fund I 1,184.15 1,195.18 1,199.68 Maxi Fund 3 1,110.19 1,122.13 1,126.26 Maxi Fund 4 1,160.13 1,172.24 1,176.53 Harga per unit Briliance ini juga berlaku untuk produk Optima One PT CIMB Sun Life 22-Mar-13 21-Mar-13 20-Mar-13 CSL Link Pasar Uang 1,125.28 1,124.81 1,125.27 CSL Link Berimbang 1,288.97 1,302.48 1,308.60 CSL Link Ekuitas 1,376.46 1,403.66 1,414.37 CSL Link Ekuitas Syariah 1,598.71 1,630.87 1,638.58 CSL Link Premier I 1,159.01 1,171.07 1,174.79 CSL Link Premier II 1,141.34 1,152.70 1,156.43 CSL Link Premier III 1,111.85 1,123.38 1,127.27 CSL Link Premier IV 1,096.73 1,108.33 1,111.80 CSL Link Premier V 1,095.71 1,108.07 1,111.27 CSL Link Premier VI 1,108.88 1,121.74 1,124.77 CSL Link Premier VII 1,121.07 1,134.97 1,137.70 CSL Link Premier VIII 1,064.40 1,077.24 1,080.38 JS LINK JIWASRAYA 22-Mar-13 21-Mar-13 20-Mar-13 JS Link Fixed 93 1,441.68 1,446.11 1,447.00 JS Link Fixed 95 1,441.68 1,446.11 1,447.00 PT AIA FINANCIAL (d/h AIG LIFE) 25-Mar-13 22-Mar-13 21-Mar-13 IDR CHINA INDIA INDONESIA EQUITY FUND 1,348.2470 1,327.3932 1,353.3936 AIA FINANCIAL IDR CASH SYARIAH FUND 1,134.2353 1,133.9119 1,133.7932 AIA FINANCIAL-DANA BERKAH FUND 1,348.8150 1,348.3625 1,348.2109 AIA FINANCIAL-IDR EQUITY FUND 13,216.0948 13,056.0493 13,307.8756 AIA FINANCIAL-MONEY MARKET FUND 1,403.1434 1,402.6589 1,402.4982 AIA FINANCIAL-IDR FIXED INCOME FUND 3,147.9824 3,150.4596 3,156.0339 AIA FINANCIAL-USD FIXED INCOME FUND 2.45539 2.45794 2.45766 AIA FINANCIAL IDR BALANCED SYARIAH FUND na 1,269.2431 1,290.6890 AIA FINANCIAL IDR EQUITY SYARIAH FUND na 1,205.6596 1,226.9567 AIA FINANCIAL - IDR BALANCED FUND na 1,576.2742 1,588.6807 PT Avrist Assurance (d/h PT AIA Indonesia) 22-Mar-13 21-Mar-13 20-Mar-13 AVRIST LINK ADVANTAGE PLUS USD FUND 0.95544 0.95683 0.95694 AVRIST LINK ADVANTAGE PLUS USD 10 FUND 0.96653 0.96653 0.96629 AVRIST LINK ADVANTAGE PLUS USD 11 FUND 0.98124 0.98123 0.98100 AVRIST LINK ADVANTAGE PLUS USD 2 FUND 0.94257 0.94328 0.94352 AVRIST LINK ADVANTAGE PLUS USD 3 FUND 1.01316 1.01476 1.01545 AVRIST LINK ADVANTAGE PLUS USD 4 FUND 0.95810 0.95930 0.95969 AVRIST LINK ADVANTAGE PLUS USD 5 FUND 0.96695 0.96802 0.96839 AVRIST LINK ADVANTAGE PLUS USD 6 FUND 0.95710 0.95804 0.95841 AVRIST LINK ADVANTAGE PLUS USD 7 FUND 0.94225 0.94293 0.94317 AVRIST LINK ADVANTAGE PLUS USD 8 FUND 0.94329 0.94328 0.94304 AVRIST LINK ADVANTAGE PLUS USD 9 FUND 0.95434 0.95434 0.9541 AVRIST LINK ACCESS IDR FUND 2,770.87 2,770.49 2,770.12 AVRIST LINK ADVISED IDR FUND 3,333.68 3,390.36 3,416.52 AVRIST LINK AGGRESSIVE IDR FUND 3,313.56 3,387.66 3,417.12 AVRIST LINK ASSURED IDR FUND 2,731.31 2,733.92 2,734.34 AVRIST LINK ASSURED USD FUND 1.43310 1.43594 1.43284 AVRIST LINK GROWTH FUND 5,448.65 5,561.20 5,612.48 AVRIST LINK MODERATE FUND 4,417.94 4,481.29 4,509.64 AVRIST LINK SECURED IDR FUND 2,612.10 2,612.10 2,612.10 AVRIST LINK TREASURE PLUS USD FUND 1.72152 1.72231 1.72309 AVRIST LINK ASIA FUND 0.95899 0.95990 0.96029 AVRIST ASSURANCE LINK ASIA 2 FD 0.98224 0.98294 0.98331 AVRIST LINK PRIME INVEST 001B FUND 2,831.37 2,852.64 2,859.52 AVRIST LINK PRIME INVEST 001B FUND (HWM) 2,807.91 2,807.91 2,807.91 AVRIST LINK PRIME INVEST 002A FUND 2,309.49 2,309.17 2,308.86 AVRIST LINK PRIME INVEST 002B FUND 2,561.79 2,577.12 2,583.81 AVRIST LINK PRIME INVEST 002B FUND (HWM) 2,534.63 2,534.63 2,534.63 AVRIST LINK PRIME INVEST 003A 2,267.16 2,266.85 2,266.55 AVRIST LINK PRIME INVEST 003B FUND 2,247.63 2,260.34 2,267.57 AVRIST LINK PRIME INVEST 003B FUND (HWM) 2,234.86 2,234.86 2,234.86 AVRIST PREMIUM INVESTA DOLLAR LINK 1.01754 1.01648 1.01594 AVRIST LINK ADVANTAGE PREMIER USD 1 FUND 1.09342 1.09640 1.09671 AVRIST LINK ADVANTAGE PREMIER USD 10 FUND 1.07807 1.08268 1.08316 AVRIST LINK ADVANTAGE PREMIER USD 11 FUND 1.02632 1.02918 1.0246 AVRIST LINK ADVANTAGE PREMIER USD 12 FUND 0.99225 0.99522 0.99104 AVRIST LINK ADVANTAGE PREMIER USD 2 FUND 1.06568 1.06906 1.06939 AVRIST LINK ADVANTAGE PREMIER USD 3 FUND 1.06140 1.06488 1.06519 AVRIST LINK ADVANTAGE PREMIER USD 4 FUND 1.05516 1.05884 1.05902 AVRIST LINK ADVANTAGE PREMIER USD 5 FUND 1.03300 1.03649 1.03667 AVRIST LINK ADVANTAGE PREMIER USD 6 FUND 1.01004 1.01322 1.01326 AVRIST LINK ADVANTAGE PREMIER USD 7 FUND 1.00443 1.00837 1.00845 AVRIST LINK ADVANTAGE PREMIER USD 8 FUND 0.98190 0.98514 0.98509 AVRIST LINK ADVANTAGE PREMIER USD 9 FUND 0.98812 0.99216 0.99234 AVRIST LINK ASYA EQUITY IDR FUND 3,561.79 3,630.76 3,648.27 AVRIST LINK ASYA CASH IDR FUND 2,589.79 2,589.44 2,589.10 AVRIST LINK ASYA BALANCED IDR FUND 2,712.99 2,752.02 2,758.74 AVRIST PRIME PROTECTION LINK USD 1.01735 1.01631 1.01578 PT BNI Life Insurance * 22-Mar-13 21-Mar-13 20-Mar-13 B-Life Link Dana Stabil 1.817,2946 1.819,8419 1.820,2574 B-Life Link Dana Slaras 1.767,0992 1.783,3519 1.791,9660 B-Life Link Dana Maksima 1.818,4370 1.855,8841 1.872,7898 B-Life Link Dana Cemerlang 1.388,5484 1.392,8980 1.393,8286 B-Life Link Dana Kombinasi 1.436,4744 1.458,2930 1.466,9457 B-Life Link Dana Aktif 1.523,2574 1.556,6720 1.569,2521 B-Life Link Dana Stabil Plus 1.648,3350 1.650,5440 1.650,9021 B-Life Link Dana Selaras Plus 1.743,9814 1.759,2507 1.767,6885 B-Life Link Dana Maksima Plus 2.105,7422 2.149,1656 2.168,9622 B-Life Link Dana Secure USD 1.1788 1.1810 1.1789 B-Life Syariah Stabil 2.246,0902 2.247,3054 2.247,3318 B-Life Syariah Berimbang 1.668,7608 1.688,8558 1.699,6869 B-Life Syariah Optimal 1.781,6122 1.825,1951 1.838,9939 B-Life Syariah Fixed Income 1.545,6751 1.545,4342 1.545,1933 B-Life Syariah Managed Fund 1.098,1973 1.104,7952 1.106,0845 B-Life Syariah Equity Fund 1.135,9349 1.158,4725 1.163,8066 PT Panin Life 22-Mar-13 21-Mar-13 20-Mar-13 Panin Rp Cash Fund 1,869.17 1,868.92 1,868.66 Panin USD Cash Fund 0.13650 0.13650 0.13649 Panin Rp Managed Fund 5,004.42 5,064.78 5,076.85 Panin USD Managed Fund 0.20372 0.20381 0.20362 Panin Rp Equity Fund 13,719.54 13,968.88 14,071.46 Panin Rp Fixed Income Fund 1,972.80 1,675.27 1,675.92 Panin Syariah Rp Cash Fund 1,556.25 1,556.05 1,555.85 Panin Syariah Rp Managed Fund 2,033.24 2,066.15 2,070.08 Panin Syariah USD Manage Fund 0.01059 0.01059 0.01059 Panin Syariah Rp Equity Fund 2,608.32 2,660.55 2,677.29 Panin MUL Rp Conservative Fund 1,983.12 1,993.94 1,998.66 Panin MUL Rp Moderate Fund 2,522.11 2,568.13 2,588.94 Panin MUL Rp Aggressive Fund 2,983.48 3,038.63 3,064.21 Panin MUL USD Aggressive Fund 9.87910 9.93320 9.92640 Panin MUL USD Moderate Fund 11.49420 11.50540 11.69060 PT Commonwealth Life 22-Mar-13 21-Mar-13 20-Mar-13 Investra Balanced Fund 2,302.9252 2,321.5005 2,330.0482 Investra Balanced Progressive Fund 3,437.3959 3,501.7753 3,529.7107 Investra Balanced Syariah 1,325.6708 1,349.5915 1,354.8225 Investra Balanced Target Fund 1,190.4487 1,196.1890 1,198.5863 Investra Bond Fund 2,537.8072 2,540.5695 2,542.5058 Investra Dynamic Strategic Fund 1,033.6445 1,037.4915 1,039.3005 Investra Equity Dynamic Fund 1,631.2626 1,664.8459 1,680.1797 Investra Equity Fund 4,846.8648 4,941.1010 4,984.6675 Investra Equity Income Fund 3,562.6897 3,633.1523 3,665.9260 Investra Equity Infrastructure Fund 1,676.8055 1,707.9232 1,720.3769 Investra Equity Syariah 1,972.3874 2,012.2141 2,021.6304 Investra Money Market Plus Fund 1,577.1776 1,576.7900 1,577.1224 Platinum Bond Fund 1,042.1541 1,043.3044 1,044.1145 Platinum Dynamic Strategic Fund 1,066.9318 1,070.9052 1,072.7718 Platinum Equity Dynamic Fund 1,101.3421 1,124.0700 1,134.4222 Platinum Equity Fund 1,101.3400 1,122.7756 1,132.6884 Platinum Equity Income Fund 1,150.9231 1,173.7139 1,184.3231 Platinum Money Market Fund 1,030.1680 1,029.9096 1,030.1409 PT Commonwealth Life 22-Mar-13 21-Mar-13 20-Mar-13 CommLink Dynamic Strategic Fund 1,087.4437 1,091.3715 1,093.5310 CommLink Aggressive Funds 2,194.0834 2,233.8177 2,252.0568 CommLink Aggressive Plus Fund 1,221.0077 1,238.7875 1,249.0549 CommLink Conservative Fund 1,451.7952 1,458.8350 1,462.0484 CommLink Moderate Fund 1,954.3873 1,982.1914 1,995.1583 PT Asuransi Jiwa Sinarmas 21-Mar-13 20-Mar-13 19-Mar-13 Ekalink Aggressive 1,964.59 1,982.70 1,979.76 Ekalink Dynamic 1,602.60 1,609.94 1,606.90 PT Zurich Topas Life 22-Mar-13 21-Mar-13 20-Mar-13 Zurichlink Rupiah Equity Fund 1,082.09 1,104.45 1,114.65 Zurichlink Rupiah Fixed Income Fund 1,080.37 1,081.91 1,082.17 Zurichlink Rupiah Flexible Fund 1,082.42 1,092.38 1,097.61 Zurichlink Rupiah Money Market Fund 1,032.22 1,031.79 1,032.25 AJB BUMIPUTERA 1912 22-Mar-13 21-Mar-13 20-Mar-13 BPLINK Dana Prestasi IDR 1,106.9657 1,111.0672 1,112.3169 BPLINK Dana Terpadu IDR 1,069.8846 1,086.6133 1,091.7323 BPLINK Dana Ekuitas IDR 1,155.1303 1,181.3698 1,189.7937 BPLINK Dana Likuid IDR 1,035.9299 1,035.3972 1,036.3450 AJ Manulife Indonesia 25 Maret 2013 Jual Beli Jual Manulife Dana Pasar Uang 1,458.89 1,429.71 1,458.68 Manulife Pendapatan Tetap Korporasi 1,881.10 1,843.48 1,882.98 Manulife Pendapatan Tetap Negara 2,169.00 2,125.62 2,172.56 Manulife Dana Ekuitas 7,786.43 7,630.70 7,944.00 Manulife Dana Berimbang 2,030.46 1,989.85 2,050.54 Manulife Dana Ekuitas Syariah 2,347.26 2,300.31 2,394.82 Manulife Dana Berimbang Syariah 1,392.59 1,364.74 1,414.86 Manulife Dana Pasar Uang Syariah 1,050.93 1,029.91 1,050.85 Manulife Dana Ekuitas Indonesia-China (Rp) 1,439.18 1,410.39 1,462.50 Manulife Dana Ekuitas Indonesia-India (Rp) 1,245.99 1,220.77 1,265.87 Manulife Dana Ekuitas Small-Mid Capital (Rp) 1,454.49 1,425.40 1,486.30 Manulife Pendapatan Tetap Dolar 1.23173 1.20710 1.23226 Manulife Dana Ekuitas Indonesia-China (USD) 0.14771 0.14476 0.15037 Manulife Dana Ekuitas Indonesia-India (USD) 0.12786 0.12530 0.13015 PT Asuransi Jiwa John Hancock 25 Maret 2013 Jual Beli Jual Signature Link - Adventurous 12,812.36 12,171.74 13,050.30 Signature Link - Balanced 7,372.19 7,003.58 7,446.39 Signature Link - Cautious 2,990.94 2,841.39 2,995.10 AXA Mandiri Financial Services 22 Maret 2013 Jual Beli Jual Active Money Rupiah 151.7245 159.3107 153.8206 Active Money Syariah Rupiah 148.2728 155.6864 150.5830 Commodity Syariah Rupiah 71.3972 74.9671 73.0060 Attractive Money Rupiah 162.8074 170.9478 165.9725 Attractive Money Syariah Rupiah 174.1227 182.8288 177.8070 Dynamic Money Rupiah 806.2542 846.5669 822.4800 Excellent Equity Rupiah 132.9445 139.5917 135.5071 Fixed Money Rupiah 201.2577 211.3206 201.5476 Mandiri Amanah Equity Syariah Rupiah 115.7162 121.5020 118.0537 Money Market Rupiah 128.4207 134.8417 128.3896 Progressive Money Rupiah 500.4496 525.4721 504.6520 Secure Money Rupiah 244.7363 256.9731 245.0131 Secure Money USD 12.8595 13.5025 12.8681 Ket : *) Sumber Data diambil dari Website Perusahaan, Untuk harga Unit Money Premi tunggal menggunakan harga beli

20-Mar-13 3,437.73 1.40815 20-Mar-13 7,594.24 2,486.48 2.72043 14,394.32 4,577.87 2,579.32 1,915.56 2,047.01 1,486.12 0.10857 1,055.59 19-Mar-13 1,463.1970 1,109.2350 1,370.8037 1,077.6319 19-Mar-13 11,638.44 6,466.12 2,803.65 1,736.98 1,538.04 2,009.48 1,268.72 2.4818 1,197.04 2,403.98 1,773.77 1,381.58 1,244.22 1,199.81 1,126.22 1,176.53 19-Mar-13 1,124.90 1,305.57 1,412.88 1,630.19 1,174.89 1,156.52 1,127.31 1,111.70 1,111.20 1,124.58 1,137.57 1,080.16 19-Mar-13 1,446.68 1,446.68 20-Mar-13 1,365.0398 1,133.6719 1,348.0570 13,387.1024 1,402.3341 3,156.9076 2.45706 1,295.0432 1,233.0277 1,593.9125 19-Mar-13 0.95430 0.96676 0.98147 0.94216 1.01115 0.95725 0.96573 0.95622 0.94206 0.94349 0.95456 2,769.74 3,412.40 3,407.69 2,733.74 1.43065 5,604.00 4,506.07 2,612.10 1.72404 0.95847 0.98227 2,857.78 2,807.91 2,308.55 2,582.51 2,534.63 2,266.24 2,267.41 2,234.86 1.01594 1.09715 1.08363 1.02964 0.99557 1.06983 1.06563 1.05948 1.03706 1.01371 1.00889 0.98554 0.99281 3,639.09 2,588.75 2,757.87 1.01578 19-Mar-13 1.821,3453 1.788,3863 1.869,9433 1.393,6130 1.463,5148 1.562,5509 1.651,8698 1.764,1419 2.165,8774 1.1773 2.246,5393 1.683,5018 1.835,7009 1.544,9255 1.103,2858 1.159,6812 19-Mar-13 1,868.41 0.13649 5,074.72 0.20305 14,041.58 1,676.75 1,555.65 2,056.98 0.01059 2,658.88 1,998.68 2,587.38 3,061.02 9.75580 11.58750 19-Mar-13 2,329.8508 3,526.9457 1,351.6998 1,197.8389 2,542.6792 1,038.4464 1,677.5747 4,973.6757 3,658.3743 1,714.2384 2,011.1208 1,576.6274 1,044.2012 1,071.8877 1,132.7007 1,130.2031 1,181.9198 1,029.8314 19-Mar-13 1,092.9068 2,247.3924 1,245.3165 1,462.1697 1,991.7526 18-Mar-13 1,970.08 1,597.70 19-Mar-13 1,112.98 1,082.83 1,095.41 1,031.96 19-Mar-13 1,111.7307 1,089.4971 1,185.4622 1,035.6888 22 Maret 2013 Beli 1,429.50 1,845.32 2,129.11 7,785.12 2,009.53 2,346.92 1,381.28 1,029.83 1,433.25 1,240.56 1,456.57 1.20761 0.14736 0.12755 22 Maret 2013 Beli 12,397.79 7,074.07 2,845.34 21 Maret 2013 Beli 161.5116 158.1122 76.6563 174.2711 186.6974 863.6040 142.2825 211.6250 123.9564 134.8091 529.8846 257.2638 13.5115



8:29 PM

Page 10























1.740,89 19/3




































BJB Bagi Dividen Rp663,8 Miliar

PENGHARGAAN ASIAN BANKER Direktur BRI Sulaiman Arif Arianto (tengah) menerima penghargaan Best Microfinance Business dalam ajang The Asian Banker Excellence In Retail Finance Services International Awards 2013 yang berlangsung di The Westin Hotel Seoul, Korea Selatan, Kamis (21/3) lalu. Kencangnya persaingan bisnis mikro di industri perbankan nasional maupun level Asia masih menempatkan BRI sebagai bank terbaik untuk layanan sektor usaha mikro, kecil, dan menengah (UMKM).


BI dan BOT Saling Tukar Informasi JAKARTA – Bank Indonesia (BI) dan Bank of Thailand (BOT) melakukan pertemuan bilateral guna saling bertukar informasi dan pengalaman kedua bank sentral di bidang moneter, perbankan, dan sistem pembayaran. Kepala Grup Departemen Perencanaan Strategis dan Hubungan Masyarakat BI Difi A Johansyah menjelaskan, pertemuan membahas perkembangan perekonomian kedua negara serta implementasi kebijakan moneter dan macro-prudential terutama dalam menghadapi risiko aliran modal. Pertemuan itu juga membahas perkembangan sektor perbankan di kedua negara serta pengalaman dalam membangun national payment gateway(NPG). BI juga memberikan penjelasan kepada BOT terkait rencana pengalihan fungsi pengawasan bank ke Otoritas Jasa Keuangan (OJK). “Di sisi lain, BI mendalami lebih jauh pengalaman BOT dalam menerapkan ketentuan Devisa Hasil Ekspor (DHE),” ujar Difi melalui keterangan tertulisnya kemarin. (erichson sihotang)

JAKARTA – Rapat Umum Pemegang Saham Tahunan (RUPST) PT Bank Jawa Barat dan Banten (BJB) Tbk (BJBR) menyetujui pembagian dividen sebesar Rp663,8 miliar. Vice President Corporate Secretary Division BJB Sofi Suryasnia mengatakan, berdasarkan Pernyataan Standar Akuntansi Keuangan (PSAK) 4, laba yang dijadikan basis perhitungan dividen adalah laba perseroan tanpa anak perusahaan sebesar Rp1,18 triliun. “Penggunaannyaadalah56% atau sebesar Rp663,8 miliar untuk dividen tunai dan 44% atau sebesar Rp521,6 miliar untuk cadangan umum (modal),” ujarnya dalam keterangan tertulisnya kemarin. Terkait laporan penggunaan dana hasil penawaran umum perdana saham (initial public offering/IPO) perseroan tahun 2010, sekitar 80% dana hasil penawaran umum yang dialokasikan untuk kredit usaha mikro, kecil, dan menengah (UMKM) telah habis digunakan. Sedang-

kan, 20% lainnya yang dialokasikan untuk pengembangan teknologi informasi (TI) sebesar 10% dan jaringan 10% belum habis. “Jadi, masih dapat digunakan untuk pengembangan dan perluasan jaringan,” kata Sofi. Dia mengungkapkan, pada tahun buku 2012 perseroan telah berhasil membukukan laba bersih sebesar Rp1,19 triliun atau meningkat sebesar 24% dibanding tahun sebelumnya. Total aset mencapai Rp70,8 triliun atau meningkat sebesar 30,1% serta dana pihak ketiga mencapai Rp50,6 triliun atau meningkat sebesar 29,6%. Dari sisi kredit, perseroan mencatat pertumbuhan kredit sebesar 31% atau mencapai Rp35,4 triliun. “Pertumbuhan tersebut mencerminkan meningkatnya aktivitas bisnis Bank BJB baik di bidang penyaluran kredit maupun penghimpunan dana yang mendorong naiknya tingkat profitabilitas Bank BJB,” tambah Sofi. ria martati

Indocement Gandeng GarapMigasLibya, Medco Siapkan USD220 Juta Kontraktor China :: EKSPANSI USAHA

Bangun Pabrik senilai Rp6,5 Triliun PERGERAKAN SAHAM INTP

JAKARTA – PT Indocement Tunggal Prakarsa Tbk (INTP) akan menambah kapasitas produksinya dengan dibangunnya pabrik ke-14 senilai Rp6,5 triliun di Citeureup, Jawa Barat. Indocement menggandeng kontraktor pabrik terkemuka asal China, Tianjin Industry Design and Research Institute Co Ltd (TCDRI) dalam pembangunan pabrik tersebut. Direktur Utama INTP Daniel Lavalle mengatakan, pabrik ini akan menjadi pabrik dengan kapasitas produksi terbesar di antara pabrik lain Indocement. Kapasitas produksinya akan mencapai 4,4 juta ton per tahun. “Setelah pabrik rampung dibangun akhir tahun 2015, kapasitas produksi semen seluruh pabrik milik perseroan ditaksir mencapai 25 juta ton per tahun,” ujarnya saat jumpa pers di Jakarta kemarin. Daniel menuturkan, proyek ini dimaksudkan untuk mengantisipasi permintaan dan mempertahankan keunggulan kompetitif melalui program

ekspansi kapasitas. Pabrik baru ini akan berdiri di atas brown fields, yang berarti seluruh infrastruktursepertitanah,listrik, dan jalan sudah siap, dengan luas lahan 15 hektare. Saat ini pabrik Indocement yang ada di Citeureup, Jawa Barat, secara keseluruhan mampu memproduksi semen 11,9 juta ton per tahun. Tahun depan ditargetkan ada peningkatan kapasitas produksi sebanyak 1,9 juta ton, sehingga pabrik di Citeureup akan menghasilkan semen sebanyak 13,8 juta ton per tahun. Direktur TCDRI Xu Peitao mengatakan, kerja sama dengan Indocement bukanlah proyek kerja sama pertama di Indonesia. “Kami merupakan kontraktor dan perusahaan riset di industri yang masuk dalam peringkat atas di China. Itu yang menjadi pertimbangan In-

25 Mar 22.200

26 Mar 18.200

docement gandeng kami. Saya yakin akan terjalin kerja sama yang baik,” paparnya. Direktur Keuangan INTP Tju Lie Sukanto sebelumnya mengungkapkan, untuk belanja modal (capital expenditure/ capex) pihaknya menargetkan kisaran USD260 juta hingga USD320 juta. “Itu tergantung dari pembangunan tiga pabrik kita,” ujarnya. Sedangkan, permintaan domestik tahun ini diperkirakan akan tumbuh sebesar 7–8%. “Namun, apabila pertumbuhannya melebihi 8%, perseroan akan mengatasinya dengan cara memaksimalkan produksi dan logistik seperti impor,” ucapnya. Pihaknya me-

yakini, pangsa pasar tetap di atas 30% karena permintaan semen selalu tumbuh. Perseroan juga sedang dalam tahap akhir studi kelayakan untuk membangun pabrik semen baru (greenfield) dengan kapasitas produksi masing-masing sekurang-kurangnya 2,5 juta ton per tahun, satu pabrik ada di Jawa Tengah dan dua lainnya di Luar Jawa. Tetapi, pembangunan pabrik di Pati, Jawa Tengah, masih mengalami hambatan berupa perizinan. “Pembangunan di Pati terancam ditunda terkait izin amdal,” ungkap Sukanto. Sukanto menambahkan, perseroan membukukan pendapatansebesarRp17,29triliunhingga akhir 2012, meningkat 24,5% dibanding tahun sebelumnya yang sebesar Rp13,88 triliun. Menurutnya, kenaikan pendapatan ini akibat dari peningkatan permintaan pasar disertai dengan peningkatan kapasitas produksi. “Faktor lain yang mengakibatkan naiknya pendapatan yaitu harga jual rata-rata semen domestik hingga 7% per ton mengalami kenaikan,” paparnya. kunthi fahmar sandy

JAKARTA – PT Medco Energi Internasional Tbk (MEDC) akan menginvestasikan USD220 juta untuk menggarap migas di Area 47, Libya. Anak usaha perseroan yaitu Medco International Ventures Limited akhirnya resmi membentuk joint operating company (JOC) bersama National Oil Corporation Libya (NOC) dan Libyan Investment Authority (LIA). Direktur Utama MEDC Lukman Mahfoedz mengatakan, total nilai proyek tersebut mencapai USD900 juta, terdiri dari USD280 juta untuk biaya pengeboran dan USD620 juta untuk fasilitas produksi minyak. Dalam kerja sama ini perseroan akan menjadi operator untuk pengembangan dan produksi migas di Libya. “Proyek tersebut bernama Nafusah Oil Operations BV. Perseroan akan mendapatkan hak sebesar 24,5%, sedangkan NOC dan LIA masing-masing dengan hak kepemilikan sebesar 51% dan 24,5%,” ujar Loekman dalam keterangan persnya kemarin. Dia mengatakan, perseroan mendapatkan izin komersialisasi untuk sejumlah lapangan migas dari 16 lapangan di Area 47 tersebut. Hal ini karena keberhasilan eksplorasi perseroan atas 18 dari 20 sumur dengan tingkat

keberhasilan mencapai 90%. Lebih lanjut Lukman mengungkapkan, perseroan akan mulai memproduksi minyak di area tersebut pada 2016 nanti. Ditargetkan, kapasitas produksi akan mencapai 50.000 barel minyak per hari (BOPD). Dia optimistis proyek pengembangan ini akan menguntungkan perseroan karena memiliki cadangan migas mencapai 300 juta barel (MMBOE). ”Cadangan tersebut dari enam lapangan. Sedangkan, totalnya sudah ada 16 lapangan yang ditemukan migasnya hingga saat ini,” ujarnya. Selain itu, dalam kerja sama tersebut empat pejabat telah ditunjuk dalam management committee(MC) pada tanggal 25 Februari 2013. Dua perwakilan berasal dari NOC, satu dari LIA, dan satu dari pihak perseroan. AnaliseTradingAndrewArgado menyatakan, pencapaian tersebut akan menjadi nilai positif bagi perseroan. Saat ini pasar masih menunggu perkembangan proyek di Libya tersebut. Namun, proyek tersebut masih belum berdampak bagi operasional perseroan dalam waktu dekat. Menurut Andrew, cadangan minyak di sana masih belum kelihatan dan perseroan masih butuh dana untuk eksplorasinya. hafid fuad

persyaratan untuk Anggota Kliring yang bisa memperoleh fasilitas PME, yakni Anggota Kliring harus sudah terdaftar sebagai anggotaPMEKPEI,danmemiliki subrekening PME di KSEI untuk melakukan penyelesaian transaksiPME.KeanggotaanPMEdibuat sebagai bentuk manajemen risiko. Selain ada persyaratan keanggotaan, diatur pula penempatan agunan dan trading limit. Jangka waktu peminjaman fasilitas PME ditetapkan minimal satu hari bursa dan maksimal 90 hari bursa. Fasilitas ini hanya tersedia untuk anggota kliring yang terdaftar sebagai anggota PME KPEI yang memiliki subrekening PME di KSEI. Adapun batasan fee yang harus dibayar Anggota Kliring peminjam sebesar sekitar 12%. Jika Anda menjadi lender, maka ber-

hak menerima imbal hasil sekitar 15%. Fasilitas PME tidak luput dari risiko, tetapi sejauh ini risiko tersebut hanya dialami oleh lender. Risiko penggunaan fasilitas PME muncul jika lawan transaksi gagal mengembalikan efek pinjaman. Namun risiko ini sudah mulai diminimalisir dengan penerapan manajemen risiko seperti persyaratan keanggotaan, penempatan agunan, maupun trading limit. Jika terjadi kegagalan pengembalian, maka borrower diwajibkan mengganti sejumlah dana yang besarnya 125% dikali volume efek, dan dikali harga tertinggi dalam tiga hari transaksi terakhir. *Kerja Sama Redaksi KORAN SINDO dan Bursa Efek Indonesia


Berinvestasi dengan Fasilitas Pinjam Meminjam Efek asar modal modern umumnya dilengkapi fasilitas penunjang transaksi yang memadai. Salah satu fasilitas untuk mendorong likuiditas di lingkungan Bursa Efek Indonesia dikenal dengan nama fasilitas Pinjam Meminjam Efek (PME). Di Indonesia, fasilitas ini dikelola oleh salah satu self regulatory organization (SRO) yaitu PT Kliring Penjaminan Efek Indonesia (KPEI). Sebagai lembaga kliring dan penjamin, KPEI mendapat mandat dari Undang-Undang Pasar Modal agar pelaku pasar bisa menikmati sarana securities landing and borrowing. Kehadiran fasilitas Pinjam Meminjam Efek (PME) memberikan peluang bagi tipe investor mana pun, baik yang berorientasi jangka panjang mau-


pun jangka pendek untuk mengoptimalkan keuntungan. Tentu saja ada mekanisme dan persyaratan untuk bisa menikmati fasilitas ini. Sesuai ketentuan otoritas, fasilitas ini tersedia melalui anggota kliring sebagai peminjam (borrower) maupun Anggota Kliring sebagai pemberi pinjaman (lender), serta bank kustodian. Para investor, baik individu maupun institusi, bisa menghubungi anggota kliring atau bank kustodian, untuk meminjam atau meminjamkan efek. Investor jangka panjang, yang selama ini hanya menyimpan efeknya, memiliki peluang untuk memperoleh keuntungan dengan meminjamkan efeknya melalui Anggota Kliring dengan imbalan persentase lending fee. Sementara para

trader bisa bertransaksi lebih saham menjadi uang. aktif dengan meminjam Sejauh ini, saham yang diperefek untuk transaksi kenankan untuk dishort selling, jika ditransak sik an perkirakan harga sebagai saham akan turun. Transaksi short selling dengan memanfaatkan fasilitas PME hanya bisa dilakukan melalui perjanjian. SemenKO tara itu, peminjaRA NS IND O/ T man efek juga dapat diIYU D pakai untuk menghindari kegagalan penyelesaian transaksi bursa. Demikian halnya dengan fasilitas PME hapengenaan alternate cash set- nya saham yang matlement(ACS) atau proses peng- suk kelompok LQ45 gantian kewajiban serah terima serta saham yang ma-

suk fasilitas margin dan short selling. Saham tersebut harus tercatat di C-BEST (sistem penyimpanan dan penyelesaian) yang selama ini dikelola PT Kustodian Sentral Efek Indonesia (KSEI). Saham yang masuk dalam fasilitas PME juga harus dimiliki minimal 300 pihak pemegang saham dan securities haircut minimal 50%. Saham yang layak terdaftar dalam fasilitas PME harus memenuhi tuntutan transaksi harian minimal 500.000 lembar dalam enam bulan terakhir, dengan rata-rata frekuensi transaksi harian minimal 20 kali dalam kurun waktu yang sama. KPEI juga menetapkan



8:33 PM

Page 23






SMGR Bangun Pabrik di Myanmar

CICIL EMAS BSM (Kiri-kanan) Direktur Bank Syariah Mandiri (BSM) Hanawijaya, Komisaris Utama BSM Ahmad Marzuki, Ketua Dewan Pengawas Syariah BSM Komaruddin Hidayat, dan Kepala Divisi Gadai BSM Jeffry Prayana menekan tombol saat peluncuran program BSM Cicil Emas di Jakarta, kemarin. Program ini memberikan kesempatan kepemilikan emas batangan minimal 10 gram kepada masyarakat dengan cara mencicil secara syariah.

JAKARTA – PT Semen Indonesia Tbk (SMGR) pada semester I/2014 siap melebarkan sayap usaha di wilayah Asia Tenggara, dengan menjadikan Myanmar sebagai basis produksi semen untuk pangsa pasar regional. Direktur Utama SMGR, Dwi Sutjipto, mengatakan saat ini emiten produsen semen nasional tersebut masih dalam tahap penjajakan untuk pembangunan satu produksi pabrik semen di wilayah Myanmar. Dia memperkirakan, kapasitas produksi pabrik semen tersebut mencapai satu juta ton semen per tahun. “Ada beberapa partner dari perusahaan lokal yang masih dalam tahap pembicaraan, semester II/2013 akan diberitahu mitra kerja sama dalam pembuatan pabrik ini,”

kata Dwi, usai mengikuti diskusi bertajuk Peran Industri Semen Indonesia dalam Pembangunan Ekonomi di Indonesia dan Asia di Jakartakemarin. Dia mengungkapkan, investasi yang dibutuhkan untuk pembangunan produksi pabrik semen tersebut mencapai USD200 juta. Sebesar USD140–160 juta akan dibiayai dari eksternal perusahaan dalam bentuk pinjaman perbankan. Sekitar USD40–50 juta akan diupayakan dari dana internal perseroan. Sedangkan, selebihnya atau sekitar 10% akan dibiayai dari mitra perusahaan. Meski menyanggupi pendanaan hingga sekitar USD50 juta, Dwi menuturkan, pihaknya kemungkinan mempertimbangkan pembiayaan dari pe-

nerbitan surat utang internasional dengan mata uang asing (global bond). Menurut Dwi, ekspansi bisnis ke Myanmar merupakan bagian dari rencana perseroan untuk lebih memperluas jaringan pabrik ke sejumlah negara setelah sebelumnya sudah masuk ke Vietnam.Sebelumnya perseroan sukses mengakuisisi saham mayoritas di perusahaan semen asal Vietnam, Thang Long Cement. “Untuk produksi semen yang di Myanmar ini, akan dijual untuk pangsa pasar di Myanmar. Kita juga membidik pasar regional ASEAN seperti Bangladesh, Kamboja dan Thailand, nanti akan dijadikan hub produksi semen,” tambahnya. ●heru febrianto

Sinar Mas Group Ekspansi ke Liberia Siapkan USD1,6 Miliar untuk Kembangkan Lahan Sawit JAKARTA – Sinar Mas Group melalui PT Sinar Mas Agro Resources and Technology Tbk (SMAR) dan Golden Agri Resources Ltd (GAR) siap mengembangkan usaha ke salah satu negara Afrika, yakni Liberia. Perseroan menyiapkan investasi sebesar USD1,6 miliar untuk ekspansi perkebunan kelapa sawit. Chairman Golden Agri Resources Ltd, Franky O Widjaja mengatakan, nilai tersebut akan mengakumulasi ekspansi pengembangan lahan yang telah dimulai sejak tiga tahun lalu. Tahun lalu investasi GAR pada The Verdant Fund LP–suatu pri-

vate equity fund yang memiliki Golden Veroleum Inc–mencapai USD70 juta. ”Pemerintah Liberia mencoba mengadopsi pengelolaan perkebunan berkelanjutan yang kita lakukan selama ini di negara mereka, salah satu caranya dengan membuka kesempatan bagi perusahaan sawit Indonesia untuk berinvestasi di sana,” kata Franky dalam

rilisnya kemarin. Hingga kini, ujarnya, perseroan dan perusahaan sawit di Liberia Golden Veroleum menguasai hak konsesi lahan seluas 220.000 hektare di beberapa provinsi bagian tenggara negara tersebut. Konsesi lahan ini membuka sebanyak 35.000 lapangan kerja langsung bagi warga setempat. Termasuk, mendukung pengembangan perkebunan plasma seluas 40.000 hektare milik petani. ”Penanaman yang dilakukan oleh Veroleum telah mencapai luasan 2.000 hektare. Veroleum sendiri kini mempekerjakan tidak kurang dari 1.200 karyawan,” imbuhnya.

:: KINERJA 2012

Eximbank Catat Pertumbuhan Pembiayaan Sebesar 31,71% JAKARTA – Lembaga Pembiayaan Ekspor Indonesia (Indonesia Eximbank) membukukan pembiayaan tahun 2012 sebesar Rp27,05 triliun atau meningkat 31,71% dibanding tahun sebelumnya yang sebesar Rp20,54 triliun. Pembiayaan itu didapat dari pembiayaan rupiah sebesar Rp13,88 triliun dan pembiayaan valas sebesar Rp13,17 triliun. Direktur Eksekutif Indonesia Eximbank I Made Gde Erata mengatakan, kinerja yang positif itu mendorong perolehan laba perusahaan tumbuh hingga 27,13% dari Rp460,64 miliar di 2011 menjadi Rp585,62 miliar pada 2012. “Posisi aset perusahaan pada 2012 juga mengalami kenaikan sebesar 26,64%, menjadi Rp33,33 tri-

liun dari tahun sebelumnya yang senilai Rp26,32 triliun,” ujarnya saat paparan kinerja perseroan di Jakarta kemarin. Dia menargetkan, pembiayaan tahun ini mencapai Rp36,1 triliun atau meningkat sekitar 37% dibanding pencapaian 2012. ”Kondisi eksportir saat ini memang kurang baik, namun akan kembali positif. Sementara untuk laba bersih, kami menargetkan sekitar Rp620 miliar,” paparnya. Made menambahkan, pihaknya akan terus mendorong pembiayaan ekspor ke negaranegara pasar nontradisional, sehingga membantu meningkatkan kinerja ekspor Indonesia. Menurutnya, potensi pembiayaan di pasar-pasar ekspor nontradisional cukup besar, apalagi di

tengah kondisi pelemahan ekonomi global. Hal itu sejalan dengan program pemerintah, khususnya Kementerian Perdagangan (Kemendag), untuk mendorong ekspor ke negaranegara pasar nontradisional. Direktur Pelaksana Senior Indonesia Eximbank Arifin Indra S menjelaskan, sasaran perseroan pada 2013 juga untuk mendukung program pemerintah dalam meningkatkan kinerja ekspor melalui penyediaan pembiayaan, juga penjaminan asuransi dan reasuransi. Kemudian kegiatan jasa konsultasi antara lain pembiayaan pada 10 komoditas ekspor unggulan pemerintah, peningkatan pembiayaan UKM dan pembiayaan infrastruktur pendukung ekspor. ●kunthi fahmar sandy

JAKARTA – Bank Indonesia (BI) tengah melakukan penyelidikan terkait kasus pencurian data pada nasabah PT Bank Mandiri Tbk (BMRI). Dugaan sementara, pencuri data memanfaatkan kelemahan dari kartu jenis magnetic stripe di sejumlah gerai Body Shop. Kepala Grup Departemen Perencanaan Strategis dan Hubungan Masyarakat BI Difi A Johansyah mengatakan, penelitian ini dilakukan bersamasama dan berdasarkan laporan Asosiasi Kartu Kredit Indonesia, VISA, dan Penerbit/ Acquirer Kartu Kredit (penerbit kartu kredit yang sekaligus juga melakukan pemrosesan data). Penelitian tersebut menemukan, permasalahan pencurian data hanya terjadi pada kartu dengan swipe di mana kartu konsumen digesek dua kali (double swipe) saat melakukan transaksi. Pada sistem chip,


Kelemahan Kartu Magnetic Jadi Celah Penipuan

DIFI A JOHANSYAH Kepala Grup Departemen Perencanaan Strategis dan Hubungan Masyarakat BI

pencurian data tidak terjadi karena data pada kartu kredit yang menggunakan chip sudah terenkripsi. Berdasarkan kronologis peristiwa yang disampaikan, pencurian data ini terdeteksi pada tanggal 5 Maret 2013 dengan deteksi fraud counterfeit kartu debet di Amerika Serikat dan Meksiko. Setelah melalui sejumlah analisa dan koordinasi antar-penerbit, pada tanggal 6

Maret 2013 diketahui dugaan awal tempat pencurian data adalah merchant Body Shop di dua buah mal di Jakarta. Di hari berikutnya, yaitu pada 7 Maret 2013, lokasi fraud bertambah tidak hanya di Amerika Serikat dan Meksiko, melainkan juga di Filipina, Turki, Malaysia, Thailand, dan India dan dugaan adanya tempat pencurian data mulai berkembang ke cabang Body Shop yang lain. BI pun segera menyusun aturan larangan kegiatan double swipe atau penggandaan data pada merchant dalam rangka merekam data kartu. ”BI segera menyiapkan surat imbauan kepada seluruh bank acquirer untuk lebih berhati-hati dalam menjalankan kerja sama dengan merchant, termasuk melarang kegiatan double swipe pada merchant dalam rangka merekam data kartu,” ujar dia. ●erichson sihotang

Franky mengungkapkan, ekspansi ke Liberia merupakan langkah strategis yang ditempuh untuk mengoptimalkan luasan lahan konsesi. Apalagi, kondisi iklim dan lahan di Liberia cocok sebagai budi daya kelapa sawit. “Investasi ini merupakan sinergi yang saling menguntungkan. Liberia coba mengadopsi pengelolaan perkebunan berkelanjutan yang selama ini kami lakukan di Indonesia,” ucapnya. Luas lahan tertanam di perkebunan sawit Liberia saat ini baru sekitar 2.000 hektare. Penanaman pada lahan baru terus dikebut. Usia produktif hingga masa panen akan diper-

oleh 3-5 tahun ke depan. Selain menggelar ekspansi ke Afrika, Managing Director Sinar Mas G Sulistyanto mengatakan, pihaknya juga berkonsentrasi memantapkan posisi sebagai salah satu raksasa pengelola perkebunan sawit terbesar di Indonesia. Hingga kini area perkebunan tertanam telah mencapai 463.400 hektare. ”Kami melihat, kedua negara yaitu Indonesia dan Liberia memiliki beberapa persamaan, antara lain sama-sama mengandalkan industri perkebunan, dalam hal ini kelapa sawit, sebagai pendorong pertumbuhan ekonomi dan peningkatan tarif kehidupan sosial warga

masyarakatnya,” paparnya. Analis Investa Saran Mandiri Kiswoyo Adi Joe menilai, rencana perseroan ekspansi ke luar negeri dikarenakan semakin sempitnya lahan sawit baru di Indonesia. Hal ini juga diperparah dengan aturan pemerintah yang memperketat ekspansi produsen sawit. Bahkan, lahan kosong saat ini juga tidak bisa didapatkan dengan harga murah. Menurutnya, dengan ekspansi di Liberia, maka akses ekspor ke Amerika Serikat (AS) akan bisa lebih mudah. “Hal ini karena negara tersebut merupakan bekas jajahan AS,” ujar Kiswoyo. Menurut dia, investasi yang

dilakukan masih dalam level menengah karena perseroan harus membangun infrastruktur dari nol. Dia pun menyayangkan saham perseroan sangat tidak likuid di pasar, walaupun kinerjanya bagus. Hal ini membuat saham tersebut jatuhnya tidak signifikan di pasaran. Dia juga menilai prospek komoditas minyak sawit mentah (crude palm oil/CPO) masih akan tumbuh di tahun ini. ”Hingga akhir tahun diperkirakan harga CPO bisa mencapai 2.700–3.000Ringgit Malaysia (RM) per ton,” ujarnya. ●heru febrianto/ hafid fuad



7:09 PM

Page 1




TNT Express Akan PHK 4.000 Pegawai Restrukturisasi itu dilakukan setelah perusahaan itu gagal diambil alih oleh United Parcel Service (UPS), perusahaan pesaing asal Amerika Serikat (AS). TNT juga akan menerapkan struktur manajemen baru, menjual operasinya di China dan Brasil, serta mengurangi kapasitas pengiriman udara. Langkahlangkah itu dapat memangkas biaya 150 juta euro dan menambah tabungan tahunan 220 juta euro hingga akhir 2015. Pengumuman rencana pemecatan itu muncul setelah UPS pada Januari membatalkan tawarannya untuk membeli TNT Express. “Bisnis kami menghadapi kondisi pasar dan tantangan strategis yang sulit. Kami melakukan langkah cepat untuk

membentuk kembali portofolio kami, membuat perusahaan ramping dan efisien dalam proses operasional dan pendukung,” papar CEO TNT Express Bernard Bot, dikutip AFP. TNT menyatakan bahwa perusahaan itu menelaah berbagai cara untuk mengurangi beban kapasitas antarbenua. “Opsiopsi itu termasuk kesepakatan pembagian kapasitas, penyewaanlagidanpenghentiankontrak. Proses penjualan untuk domestik China berjalan baik dan hasilnya akan diketahui segera,” ungkap perusahaan tersebut. Operasi TNT di Brasil mengalami kerugian selama bertahun-tahun. Karena itu pula, TNT akan melakukan restrukturisasi manajemen dan ber-


DEN HAAG – Perusahaan pos dan kurir Belanda, TNT Express kemarin mengumumkan akan memecat sekitar 4.000 pegawainya dalam tiga tahun mendatang.

Sebuah truk UPS diparkir di depan kantor pusat TNT di Hoofddorp, Belanda, pada 19 Maret. Kesulitan bisnis yang dihadapi TNT memaksa perusahaan itu melakukan restrukturisasi manajemen.

konsultasi dengan para pegawai dan serikat buruh terkait konsekuensi dan solusi terbaik. “Dua pertiga pemutusan hubungan kerja (PHK) akan dila-

kukan di Eropa. Kami terlambat dalam restrukturisasi, karena itu kami bertindak sekarang,” kata juru bicara TNT Express Cyrille Gibot pada AFP.

Bank Mandiri Fasilitasi Lima Perupa Ikut Pameran Internasional

Bank Mandiri memberikan Rp 100 juta untuk mendukung lima perupa Indonesia yang akan berpartisipasi pada pameran seni rupa internasional Bienal Venesia di Italia. Kehadiran perdana perupa Indonesia dalam Paviliun Indonesia Venice Biennale yang ke-55 di Venesia Italia pada Juni hingga November 2013 mendatang menjadi salah satu tonggak penting seni rupa Indonesia. Hal itu akan mengangkat pamor Indonesia selain juga merupakan kontribusi signifikan dalam memperkuat eksistensi Indonesia sebagai subjek penting dunia. Karenanya Bank Mandiri dengan antusias menghadirkan exclusive preview Paviliun Indonesia di Plaza Mandiri, Jakarta, Sabtu (23/3). Zulkifli Zaini, Direktur Utama-CEO PT Bank

Mandiri (Persero) Tbk dalam sambutan sekapur sirih mengatakan dunia seni rupa kontemporer bakal mendapat banyak kesempatan di Venice Biennale ke-55 itu. Ajang ini tentu sangat bagus untuk promosi perkembangan seni rupa dan Indonesia secara keseluruhan. Dengan demikian peluang seniman Indonesia mengembangkan karyanya di dunia internasional semakin terbuka dan sekalipun mungkin tidak seketika akan ada manfaat besar yang mengikuti. Zulkifli Zaini juga menyebutkan dukungan Bank Mandiri adalah bentuk kecintaan dan tanggungjawab kepada seni budaya nasional dan masyarakat. Sementara Wakil Direktur Utama Bank Mandiri Riswinandi yang hadir pada exclusive priview Paviliun Indonesia di Plaza Mandiri mengatakan Bank Mandiri bangga menjadi bagian pengembangan seni Indonesia. “Karena hal itu sejalan dengan upaya Bank Mandiri dalam mengapresiasi dan memberikan penghargaan kepada nasabahnya sehingga Bank Mandiri telah menghasilkan budaya dengan kinerja baik. Selama lima tahun ini Bank Mandiri menjadi bank dengan kualitas layanan terbaik,” tuturnya. Menurut Kurator Carla Bianpoen, seniman yang terpilih adalah mereka yang menawarkan kehadiran budaya baru di peta seni rupa global. Lima seniman terpilih mewakili kelompok perupa Indonesia saat ini yaitu Sri Astari, Albert Yonathan Setyawan, Eko Nugroho, Entang Wiharso, Titarubi. [aliefien/Info]

Standard Charterd Trophy Indonesia 2013 Usai Digelar

Standard Chartered Bank Indonesia merampungkan turnamen futsal tahunan bertajuk ‘Standard Chartered Trophy Indonesia 2013’. Pemenang akan dikirim untuk mengikuti Standard Chartered Trophy Road to Anfield 2013, di London, Inggris. Untuk kualifikasi Indonesia tahun ini digelar dalam dua kategori yakni tim futsal media cetak dan tim futsal karyawan Standard Chartered Bank. Turnamen futsal ini merupakan agenda tahunan yang diadakan di 12 negara tempat Standard Chartered Bank beroperasi. Turnamen futsal kualifikasi media yang berlangsug pada 9 Maret 2013 lalu diikuti oleh tim futsal putra dari sembilan media cetak yaitu: Info Bank, Bisnis Indonesia, Jawa Pos, Kompas, Seputar Indonesia, Warta Kota, Bola, Soccer, dan Top Skor. Dalam turnamen futsal kualifikasi media tersebut, tim futsal putra dari harian Top Skor berhasil keluar sebagai juara pertama. Adapun tempat kedua

untuk tim futsal putra terbaik diraih oleh tim futsal putra dari harian Kompas, disusul oleh tim futsal putra dari harian Warta Kota. Pemenang Pemain Terbaik (Best Player) diraih oleh Novi Kurniawan dari harian Kompas, Pencetak Gol Terbaik (Top Scorer) dimenangkan oleh Heru Sri Kumoro dari harian Kompas, dan Penjaga Gawang Terbaik (Best Goalkeeper) dimenangkan oleh Yosua Eka Putra dari harian Soccer. Pemenang pertama selain mendapat kesempatan bermain di Stadion Alfield pada 21 Mei, juga berhak atas hadiah uang sebesar Rp5 juta. Sedangkan pemenang kedua dan ketiga mendapat sebesar masing-masing Rp3 juta dan Rp2 juta. Sedangkan untuk tim kualifikasi karyawan diikuti oleh 20 tim futsal putra dana dua tim futsal putri karyawan Standard Chartered Bank Indonesia, tim futsal putra dari divisi unit Information & Technology (IT) Mix 2 keluar sebagai pemenang tim futsal putra terbaik. Adapun pemenang kedua diraih oleh tim futsal putra dari divisi unit Collection, disusul oleh tim futsal putra dari divisi unit SME Banking. Penghargaan untuk Pemain Terbaik (Best Player) diraih oleh Andreas Oloan dari divisi unit SME Banking, sementara itu penghargaan khusus Pencetak Gol Terbaik (Top Scorer) dimenangkan oleh Desron Andika dari divisi unit IT Mix 2, dan Penjaga Gawang Terbaik (Best Goalkeeper) dimenangkan oleh Andreas Julius dari divisi unit IT Mix 2. Country Head Corporate Affairs Standard Chartered Bank Indonesia Aminarmo Kermaputra mengatakan, kegiatan ini telah berlangsung dengan sangat baik. “Terima kasih kepada semua pihak yang mendukung turnamen ini.” [aris kurniawan/Info]

Saat upaya UPS mengambilalihTNTExpressgagal,TNTsegera mengalami kerugian hampir 2 miliar euro. Meski demikian, UPS membayar biaya pembatalan

pada TNT sebesar 200 juta euro. UPS dan TNT berupaya keras agar proses pengambilalihan itu disetujui otoritas kompetisi bisnis Uni Eropa (UE). Namun, UPS segera membatalkan rencana pengambilalihan TNT setelah para pejabat UE menghalangi kesepakatan itu. UE khawatir usulan merger itu akan mengurangi jumlah kompetitor dari empat menjadi tiga perusahaan dan memicu konsentrasi pasar untuk layanan pengiriman ekspres domestik dan internasional di benua Eropa.Kesepakatanitudiperkirakan menjadikan UPS lebih unggul dibandingkan dua kompetitornya,sertadapatmemperkuatposisinya di Eropa dan global. “Malangnya, semua bisnis dengan UPS hanya membuang waktu bagi TNT Express. Pengumuman hari ini tidak mengejutkan saya, mereka telah melakukan sesuatu karena pasar tidak terlalu baik. Pasar Eropa sangat kompetitif dibanding-

kan pasar AS,” tutur Jos Versteeg, analis dari bank Belanda, Theodoor Gilissen, pada AFP. UPS dan TNT Express merupakan pemain utama dalam bidang pengiriman paket. Mereka termasuk empat perusahaan dengan jaringan pengiriman udara dan darat yang komprehensif di benua Eropa. Pemain lain di Eropa adalah DHL milik Deutsche Post dan FedEx asal AS. Analis Versteeg mengatakan bahwa TNT Express harus menjual operasinya di Brasil yang mengakibatkankerugian.“Anda tidak dapat membiarkan diri Anda sendiri mengalami kerugian selama beberapa tahun tanpa melakukan apa pun,” ujarnya. TNT Express beroperasi di lebih dari 200 negara dan tetap menjadi pemain utama dalam jaringanpengirimandaratdiEropa. Saat ini karyawannya mencapai 77.000 orang. Perusahaan itu mencapai rekor penjualan lebih dari 7,1 miliar euro pada 2012.  syarifudin

Carrefour Salurkan Donasi Program Dare to Share PT Trans Retail Indonesia (dahulu PT Carrefour Indonesia), kembali menyalurkan donasi sebesar Rp27.590.750. Donasi tersebut diserahkan secara simbolis kepada Panti Sosial Asuhan Anak, Bala Keselamatan Catherine Booth, Pondok Cabe, Tanggerang Selatan, beberapa waktu lalu. Donasi tersebut diambil dari program Dare to Share. Program Dare to Share adalah suatu program sosial untuk berbagi dari pelanggan kepada anakanak yang membutuhkan. Pada progam kali ini, Carrefour bekerja sama dengan salah satu pemasok aneka produk mainan anak, yaitu PT Multi Daya Rencana. Hendrik Adrianto, Head of Ex ternal Communications and Corporate Social Responsibility, PT Trans Retail Indonesia mengungkapkan pada setiap pembelian aneka produk mainan anak tertentu yang bertanda “Dare to Share”, sebagian hasilnya disumbangkan kepada Panti Sosial Asuhan Anak, Bala Keselamatan Catherine Booth, Pondok Cabe Tanggerang Selatan. Program ini berlangsung sejak tanggal 26 November 2012 sampai dengan 31 Desember 2012”. Panti Sosial Asuhan Anak, Bala Keselamatan Catherine Booth, Pondok Cabe Tanggerang Selatan berdiri sejak tahun 2006 di bawah naungan Bala Keselamatan. Panti Asuhan yang beralamat di Jl Kemiri VII No 78, Pondok Cabe Tanggerang Selatan ini menampung anak-anak dari keluarga yang kurang mampu dan anak yatim piatu. Dalentang, Pimpinan Panti Sosial Asuhan Anak,

Bala Keselamatan Catherine Booth, Pondok Cabe Tanggerang Selatan mengatakan, “Kami sangat bersyukur dan memberikan apresiasi yang sangat tinggi kepada Carrefour dan seluruh pelanggannya atas donasi yang diberikan. Dana tersebut akan digunakan untuk peningkatan pendidikan bagi anak-anak di panti asuhan kami”. Adji Srihandoyo, Corporate Affairs Director, PT Trans Retail Indonesia menambahkan, “Kami berharap donasi ini dapat bermanfaat dan membantu pendidikan anak-anak yang membutuhkan. Tidak lupa kami mengucapkan terima kasih atas partisipasi pelanggan setia Carrefour untuk membantu saudara kita yang kurang beruntung”. [syarif wibowo/Info]

Pinocchio a Musical, Ajang Asah Kemampuan Anak SD Santa Laurensia, Jakarta menyelenggarakan pementasan drama musikal menarik bertema “Pinocchio a Musical” di Graha Bakti Budaya, Taman Ismail Marzuki, Jakarta pada Jumat (22/3) pekan lalu. Pinokio merupakan dongeng klasik, sederhana dan penuh makna yang bagus untuk perkembangan karakter anak-anak secara menyeluruh. “Tema ini sengaja dipilih karena memiliki banyak pesan yang sangat berpengaruh untuk perkembangan anak. Dalam cerita ini dipaparkan arti sesungguhnya suatu kejujuran, kasih sayang, cinta, persahabatan, percaya diri, kecerdikan, dan tanggung jawab,” jelas Daniel Terry Dippo sebagai produser Pinocchio a Musical. Acara pentas musikal yang diadakan secara rutin selama dua tahun sekali ini menghadirkan 43 pemain yang terdiri dari siswa-siswi kelas 3 sampai 5 SD Santa Laurensia. Namun, tidak semua murid dapat mengikuti drama musikal. Mereka harus mengikuti proses audisi terlebih dulu hingga akhirnya terpilih pemeran Pinokio dan kawan-kawan. Dalam tahap audisi, para siswa yang mendaftar mencapai 100 orang. Mereka harus menunjukkan kemampuan berakting serta bernyanyi. Lantas peserta mengikuti kelas khusus, yaitu akting dengan pengajar sutradara Santiago Gonzalez, kelas nyanyi dengan guru vokal

Ignatius Aribowo, dan kelas menari dalam bimbingan Falentina Mardiyatun. Drama musikal yang disajikan dalam bahasa Inggris ini berhasil mendatangkan lebih dari 400 orang penonton yang terdiri dari orang tua dan anak-anak. “Drama musikal ini adalah salah satu cara untuk mendukung kemampuan atau talenta siswa yang unik dan beragam. Pengembangan kegiatan ini diarahkan untuk mendukung kemampuan siswa yang multi talenta, sehingga kegiatan yang dilakukan di sekolah cukup beragam, baik itu yang bersifat akademis maupun non akademis. Karena kegiatan non akademis akan melatih kemampuan siswa untuk percaya diri, mandiri, bertanggung jawab, kreatif, dan kompeten sesuai kebutuhan zaman,” imbuh Daniel yang juga menjabat Kepala Pre-School TK dan SD Santa Laurensia. [balqis eghnia/Info]

Hattrick_new–cov tanpa lidah


6:02 PM

Page 1



27 Italia mengusung formasi 4-3-3 melawan Malta di Ta’qali National Stadium.

Prancis tak kecil hati menjamu juara dunia dan Eropa Spanyol pada Kualifikasi Piala Dunia 2014.




RABU (27/3) PUKUL 02.30 WIB



PARIS – Spanyol siap mengubah strategi saat menghadapi Prancis pada Kualifikasi Piala Dunia 2014 Zona Eropa di Stade de France, dini hari nanti. Perubahan wajib dilakukan La Furia Roja demikemenangan, agar takhta Grup I kembali d iraih dan jalan menuju Brasil tidak terhambat. Spanyol mendapat tamparan ketika ditahan imbang Finlandia 1-1, Jumat (22/3). Hasil itu membuat La Furia Rojakehilangan statusnya sebagai pemimpin Grup I. Pasukan Vicente del Bosque itu tertinggal dua angka dari Prancis yang sukses memukul Georgia 3-1. Itu tidak hanya mencoreng reputasi Spanyol sebagai juara Piala Dunia 2010, juga menyulitkan langkah Cesc Fabregas dkk menuju Brasil. Mereka akan menempuh jalan lebih panjang jika tidak kembali memuncaki klasemen, karenarunner-up grup

masih harus mengikuti kualifikasi fase kedua atau play-off.Negeri Matador tidak punya pilihan kecuali mengalahkan Prancis. “Kami akan berkunjung ke Prancis untuk menang. Kami masih melewati empat laga lagi. Karena itu, harus optimistis,” ucap Del Bosque, dilansir Reuters. Del Bosque menyiapkan strategi khusus menghadapi Prancis. Dia akan melakukan perombakan dalam susunan pemain. Kehilangan Jordi Alba (cedera) dan David Silva (kartu kuning), tak jadi masalah buat Del Bosque. Dia akan memplot Nacho Monreal, Xabi Alonso, Xavi Hernandez, dan Pedro Rodriguez sebagai starter. Pemain tersebut absen melawan Finlandia. Monreal

favorit menggantikan Alba untuk mengisi bek kiri . Del Bosque juga akan memakai strategi saat Piala Eropa 2012, yakni false ninealias kuasi penyerang. Xavi, Alonso, dan Santi Cazorla berperan sebagai gelandang. Sementara Andres Iniesta, Pedro, serta Fabregas menjadi goal getter. Taktik itu akan kembali diterapkan karena pernah berfungsi saat melawan Prancis di perempat Piala Eropa 2012. Saat itu, tanpa menurunkan penyerang murni, Spanyol memukul Les Bleus 2-0. Selain itu, formasi Pelatih: biasa tidak akan Didier mempan kepada Deschamps Prancis. Itu terlihat ketika berbagi hasil 1-1 pada pertemuan PRANCIS terbaru. 4-4-2 Namun, Armada Didier Deschamps tidak gentar dengan rencana Spanyol. “Kuncinya,

kami harus bermain lepas. Tapi, kami tidak hanya akan bertahan. Sebab, kami juga mengincar kemenangan,” ujar playmakerPrancis Franck Ribery.  m mirza

LIMA PERTEMUAN TERAKHIR 16-10-2012 23-06-2012 03-03-2010 06-02-2008 27-06-2006

Piala Dunia Piala Eropa Persahabatan Persahabatan Piala Dunia

Spanyol vs Prancis Spanyol vs Prancis Prancis vs Spanyol Spanyol vs Prancis Spanyol vs Prancis

SPANYOL Lloris Sakho Varane Debuchy Valbuena


Evra Ribery

Matuidi M Gi Giroud


Pelatih: Vicente del Bosque


Benzema B Fabregas

Xavi X Arbeloa b Alonso


Pique Cazorla C

R Ramos Valdes

M Monreal



1-1 2-0 0-2 1-0 1-3

Hattrick_new–cov tanpa lidah


6:02 PM

Page 2








Melakoni laga tandang biasanya menjadi kesulitan tersendiri bagi tim tamu. Tapi, itu tidak berlaku bagi Spanyol saat menyambangi Prancis. Pasalnya, Negeri Anggur ibarat rumah kedua bagi olahragawan Spanyol. Cukup banyak atlet atau klub asal Negeri Matador merengkuh sukses di sana. SEPAK BOLA Sejumlah pemain Spanyol punya motivasi tinggi saat nanti meladeni Prancis di Stade de France. Barcelona pernah memenangkan Liga Champions pada edisi 2008/2009 setelah mengalahkan Manchester United (MU) 2-0. Setidaknya ada sembilan pemain El Azulgrana, julukan Barcelona, yang ikut dibawa Pelatih Vicente del Bosque.

PARIS – Prancis tak kecil hati kendati menjamu juara dunia dan Eropa Spanyol pada Kualifikasi Grup I Piala Dunia 2014 Zona Eropa di Stade de France, dini hari nanti. Meski secara usia dan pengalaman Les Bleuslebih muda ketimbang timnas Spanyol, pasukan Didier Deschamps yakin bisa mengalahkan tamunya itu. Skuad Prancis saat ini dibanjiri darah muda. Deschamps lebih memilih pemain belia bertalenta dalam skuadnya saat ini. Hanya tiga orang yang berusia 30 tahun ke atas, selebihnya rata-rata berusia 26 tahun, 5 bulan. Pemain yang dianggap sesepuh di tubuh Les Bleushanyalah duo bek Patrice Evra, 31, dan Rod Fanni, 31, serta kiper Mickael Landreau, 33. Di antara pemain muda itu ada lima yang masih berusia 23 tahun ke bawah, sebut saja Mamadou Sakho, 23; Moussa Sissoko, 23; Mapou Yanga-Mbiwa, 23; Paul Pogba, 20;dan Raphael Varane, 19. Fakta ini menunjukkan, Deschamps tengah mencoba meremajakan Prancis. Ini sesuai permintaan publik. Sebelumnya, disinyalir terpuruknya prestasi Negeri Ayam Jantan di pentas internasional karena banyaknya pemain tua. Terbukti, mungkin hanya Franck Ribery dan Evra yang dinilai sebagai angkatan senior pada pertandingan nanti. Situasi ini sedikit bertolak belakang dengan Spanyol. La Furia Roja, julukan Spanyol, masih memprioritaskan generasi emas. Skuad yang telah menghasilkan dua Trofi Piala Eropa dan satu Piala Dunia. Pelatih Vicente del Bosque kali ini membawa enam pemain yang sudah berusia kepala tiga. La Furia Roja masih ditemani Xavi Hernandez, Pepe Reina, Xabi Alonso, David Villa, Victor Valdes, dan Alvaro Arbeloa.


Lebih lanjut, mayoritas usai pemain lainnya berkisar 28 tahun 2 bulan. Meski menghadapi tim senior nan berpengalaman, Deschamps justru tidak terlihat melakukan persiapan khusus untuk menghadapi Negeri Matador. Mereka tetap memakai strategi standar yang digunakan selama Kualifikasi Piala Dunia 2014. “Pada laga nanti, Spanyol pasti akan menekankan pada penguasaan bola dan berusaha memetik kemenangan. Tapi, saya tidak bisa begitu saja meminta para pemain untuk bertahan sekalipun Spanyol terus menekan’,” ucap Deschamps, dilansir Reuters. Karena itu, Deschamps meminta armadanya untuk bermain seperti biasa. Sebab, mengubah gaya permainan belum tentu membuahkan hal positif. Faktanya, pola permainan yang diterapkan berfungsi baik. Prancis tidak pernah kalah selama menjalani empat pertandingan, dengan rincian tiga kali menang dan sekali imbang. Deschamps tetap optimistis pasukannya bisa mengimbangi Spanyol sekalipun tanpa persiapan khusus. Keyakinan itu muncul lantaran Prancis terus berkembang setelah dipermalukan armada Del Bosque saat Piala Eropa 2012. Terbukti, mereka bisa menahan imbang 1-1 pada pertemuan berikutnya. “Prancis termasuk salah satu tim kuat di dunia. Tapi, kami pasti bisa mengalahkan mereka. Sebab, kami datang dengan motivasi lebih tinggi. Anda akan melihat kekuatan kami yang sebenarnya di sana,” tutur Alonso, playmakerSpanyol.  m mirza

Ada satu tempat yang mungkin paling populer bagi warga Spanyol, yakni Roland Garros. Arena tanah liat tempat digelarnya Grand Slam Prancis Terbuka itu merupakan jajahan Negeri Matador. Di sana, Rafael Nadal sudah tujuh kali merebut gelar juara, yakni 2005, 2006, 2007, 2008, 2010, 2011, 2012. BALAP SEPEDA Prancis terkenal dengan turnamen balap sepeda Tour de France. Meski demikian, Spanyol cukup mendominasi. Terbukti, bendera Spanyol sudah 12 kali berkibar sejak event itu dimulai pada 1903. Miguel Indurain pernah lima kali beruntun menjadi juara umum (1991–1995). Lalu masih ada Alberto Contador. MOTOGP Prancis sebenarnya diwakili Randy de Puniet di ajang itu. Namun, Puniet tidak bisa berbuat banyak. Bahkan, saat menjadi tuan rumah di GP Prancis musim lalu, dia kalah bersaing. Balapan yang digelar di Sirkuit Le Mans itu dikuasai utusan Spanyol Jorge Lorenzo. Bahkan, Lorenzo pernah tiga kali berjaya. Belum lagi Sete Gibernau dan Alex Criville. FORMULA 1 AFP/FRANCK FIFE

Walau bernama GP Monaco, adu cepat di Circuit de Monaco itu dianggap GP Prancis. Menariknya, pembalap asal Spanyol pernah mencatat prestasi bagus di sana. Itu ditorehkan Fernando Alonso bersama Renault dan McLaren-Mercedes. Dia menguasai podium pertama pada perhelatan 2006 dan 2007.

Duo penyerang Prancis Jeremy Menez (kiri) dan Karim Benzema bergurau jelang latihan di Clairefontaine-en-Yvelines, Paris, Sabtu (23/3). Prancis akan menghadapi Spanyol pada Kualifikasi Piala Dunia 2014, dini hari nanti.

:: DATA & KLASMEN KLASEMEN 1. Italia 2. Bulgaria 3. Denmark 4. Republik Ceko 5. Armenia 6. Malta


KUALIFIKASI PIALA DUNIA 2014 Prancis vs Spanyol Rabu (27/3) pukul 02.30 WIB

4 5 4 4 3 4

3 2 1 1 1 0

1 3 2 2 0 0

0 0 1 1 2 4

10-4 10 10-3 9 5-4 5 3-4 5 2-4 3 1-12 0

Grup C ● Jerman vs Kazakhstan ● Rep Irlandia vs Austria KUALIFIKASI PIALA DUNIA 2014 Malta vs Italia Rabu (27/3) pukul 02.30 WIB

KLASEMEN 1. Jerman 2. Swedia 3. Austria 4. Republik Irlandia 5. Kazakhstan 6. Kepulauan Faroe

KUALIFIKASI PIALA DUNIA 2014 Azerbaijan vs Portugal Rabu (27/3) pukul 23.45 WIB ISL Persepam vs Sriwijaya FC Selasa (26/3) pukul 15.30 WIB

5 4 4 4 5 4

4 2 2 2 0 0

1 2 1 1 1 0

0 0 1 1 4 4

KUALIFIKASI PIALA DUNIA 2014 Montenegro vs Inggris Rabu (27/3) pukul 03.00 WIB

18-6 13 8-5 8 11-2 7 7-8 7 1-11 1 2-15 0

5 5 5 5 5 5

5 3 3 2 1 0

0 1 1 0 0 0

0 1 1 3 4 5

16-2 15 12-7 10 10-6 10 6-6 6 1-9 3 0-15 0

Grup F ● Azerbaijan vs Portugal ● Irlandia Utara vs Israel PIALA DUNIA 2014 KLASEMEN

Zona Eropa (UEFA) Grup A ● Serbia vs Skotlandia ● Belgia vs Makedonia ● Wales vs Kroasia

1. Rusia


4 0


2. Israel


2 2




8-0 12

3. Portugal


2 2




4. Irlandia Utara


0 3




5. Azerbaijan


0 3




6. Luksemburg


0 2




Ukraina vs Moldova ● Polandia vs San Marino


4 1


10-1 13

2. Kroasia


4 1


8-2 13

Montenegro vs Inggris

KLASEMEN 1. Montenegro


4 1


13-2 13 20-2 11

3. Wales


2 0




2. Inggris


3 2


4. Serbia


1 1




3. Ukraina


1 2




5. Makedonia


1 1




4. Polandia


1 2




6. Skotlandia


0 2




5. Moldova


1 1




6. San Marino


0 0




Grup B ●

Armenia vs Rep Ceko ● Denmark vs Bulgaria

Malta vs Italia

Grup I ● Prancis vs Spanyol

0 0 3 3 1

8-3 10 7-2 8 3-7 4 3-8 3 2-3 2

Ket: 1 lolos ke Piala Dunia, 2 play-off

KLASEMEN 1. Argentina 2. Kolombia 3. Ekuador 4. Uruguay 5. Venezuela 6. Cile 7. Peru 8. Bolivia 9. Paraguay

Zona Concacaf ● Kosta Rika vs Jamaika ● ● Panama vs Honduras KLASEMEN 1. Honduras 2. AS 3. Panama 4. Meksiko 5. Jamaika 6. Kosta Rika

3. Mozambik 4. Zimbabwe

3 2

0 2 0 1

1 1

0-2 0-1

2 1

Grup H Aljazair vs Benin Klasemen 1. Mali 2. Benin 3. Aljazair 4. Rwanda

3 2 2 3

2 1 1 0

1 0 1 2

4-3 2-1 5-2 2-7

6 4 3 1

0 1 0 1

Ket: peringkat 1 ke babak ketiga (play-off)

Zona Asia (AFC) 10 9 9 10 10 10 10 10 10

7 6 5 3 3 4 3 2 2

2 1 2 4 3 0 2 2 2

1 2 2 3 4 6 5 6 6

23-7 19-6 12-9 17-19 8-12 14-19 11-15 12-19 7-17

23 19 17 13 12 12 11 8 8

Meksiko vs AS

2 2 2 2 2 2

1 1 0 0 0 0

1 0 2 2 2 1

0 1 0 0 0 1

4-3 2-2 3-3 2-2 1-1 2-3

4 3 2 2 2 1

Ket: 1-3 lolos ke Piala Dunia, 4 play-off melawan juara Oceania

Grup A ● Korea Selatan vs Qatar ● Uzbekistan vs Lebanon KLASEMEN 1. Uzbekistan 2. Korea Selatan 3. Iran 4. Qatar 5. Lebanon

5 4 5 5 5

2 2 2 2 1

2 1 1 1 1

1 1 2 2 3

5-4 9-4 2-2 3-5 2-6

8 7 7 7 4

Grup B ● Australia vs Oman ● Yordania vs Jepang KLASEMEN 1. Jepang 2. Australia 3. Irak 4. Oman 5. Yordania

5 4 5 5 5

4 1 1 1 1

1 2 2 2 1

0 1 2 2 3

13-2 13 4-4 5 4-5 5 4-7 5 4-11 4

Ket: 1-2 lolos ke Piala Dunia, 3 play-off

Tunggal Putra Albert Ramos (Spanyol) vs James Blake (AS) 6-4, 2-6, 7-5 ● Jurgen Melzer (Austria) vs Tobias Kamke (Jerman) 6-7(3), 6-3, 6-4 ● 1-Novak Djokovic (Serbia) vs Somdev Devvarman (India) 6-2 ,6-4 ● 11-Gilles Simon (Prancis) vs Grega Zemlja (Slovenia) 6-4, 6-4 ● 7-Janko Tipsarevic (Serbia) vs 26-Kevin Anderson (Afsel) 4-6, 7-6(5), 6-0 ● 15-Tommy Haas (Jerman) vs 19-Alexandr Dolgopolov (Ukraina) 6-3, 6-2 ● 13-Kei Nishikori (Jepang) vs Xavier Malisse (Belgia) 6-2, 7-5 ● 3-David Ferrer (Spanyol) vs 32-Fabio Fognini (Italia) 6-1, 7-5 ●

Tunggal Putri ● 8-Sara Errani (Italia) vs Simona Halep (Rumania) 6-1, 6-0 ● 12-Ana Ivanovic (Serbia) vs Svetlana Kuznetsova (Rusia) 6-3, 6-3 ● 15-Roberta Vinci (Italia) vs 20-Carla Suarez Navarro (Spanyol) 5-7, 6-4, 6-4 ● 3-Maria Sharapova (Rusia) vs 29-Elena Vesnina (Rusia) 6-4, 6-2 ● 21-Klara Zakopalova (Rp Ceko) vs 14-Maria Kirilenko (Rusia) 6-2, 7-6(4) ● 28-Sorana Cirstea (Rumania) vs 6-Angelique Kerber (Jerman) 6-4, 6-0 ● 32-Alize Cornet (Prancis) vs Lauren Davis (AS) 2-6, 6-3, 6-2 ● 22-Jelena Jankovic (Serbia) vs 11-Nadia Petrova (Rusia) 7-6(7), 6-4

Zona Oceania Jadwal Babak Ketiga, selasa (26/3) ● Kep Solomon vs Selandia Baru Kaledonia Baru vs Tahiti

Zona Afrika Hasil Pertandingan Penyisihan Grup, Minggu (24/3)

KLASEMEN 1. Selandia Baru 2. Kaledonia Baru 3. Tahiti 4. Kep Solomon


KLASEMEN 1. Belgia

1 2 1 0 2

Grup A ● Ethiopia 1 (Kebede 88) vs Botswana 0

Grup H ●

3 2 1 1 0

Ket: 1-4 lolos ke Piala Dunia, 5 play-off melawan peringkat 5 zona Asia

Ket: acara bisa berubah sewaktu-waktu.

Jadwal Kualifikasi, Selasa (26/3)

4 4 5 4 3

Zona Amerika Selatan (Cobmebol) ● Ekuador vs Paraguay ● Bolivia vs Argentina ● Venezuela vs Kolombia ● Cile vs Uruguay

Grup D ● Estonia vs Andorra ● Turki vs Hungaria ● Belanda vs Rumania KLASEMEN 1. Belanda 2. Hungaria 3. Rumania 4. Turki 5. Estonia 6. Andorra

KLASEMEN 1. Prancis 2. Spanyol 3. Georgia 4. Belarus 5. Finlandia

5 5 5 5

5 3 1 1

0 0 0 0

0 2 4 4

15-2 15 16-6 9 21-1 3 5-19 3

Ket: Peringkat 1 play-off melawan peringkat 4 Concacaf

1. Ethiopia


2 1




2. Afrika Selatan


1 2





Hasil Pertandingan Minggu (24/3) Huruf kapital tuan rumah










San Antonio






3. Afrika Tengah


1 0







4. Botswana


0 1







Jadwal Pertandingan, Selasa (26/3) Grup G ● Mesir vs Zimbabwe

Jadwal Persahabatan, Selasa (26/3) Albania vs Lithuania ● Luksemburg vs Finlandia ● Slovakia vs Swedia ● Peru vs Trinidad & Tobago ●

97 108









Ket: • Belum termasuk hasil pertandingan tadi

KLASEMEN 1. Mesir 2. Guinea


2 0 1 1

0 1

5-2 3-3

6 4

malam dan dini hari. • Jadwal dan hasil pertandingan disesuaikan

Hasil Pertandingan Babak III, Minggu (24/3)

dengan waktu setempat.



5:57 PM

Page 1






TA’QALI – Tim nasional Italia bakal menggelar formasi 4-3-3 pada lanjutan Kualifikasi Piala Dunia 2014 melawan Malta di Ta’qali National Stadium, dini hari nanti. Alessio Cerci, Mario Balotelli, dan Stephan El Shaarawy didaulat menjadi trisula di lini depan. Sinyal bakal dipakainya sistem 4-33 saat melawan Malta terbaca dari sesi latihan. Sistem yang digunakan pada babak kedua saat melawan Brasil di laga persahabatan, Kamis (21/2), dinilai efektif dan membuat penyerangan Gli Azzurri lebih tajam. Terbukti, dengan formasi ini asuhan Cesare Prandelli itu sukses menyamakan keadaan setelah di babak pertama tertinggal 0-2 dari Brasil, pekan lalu. El Shaarawy kemungkinan kembali berduet dengan rekannya di AC Milan, Balotelli, di lini depan. Satu slot penyerangan kemungkinan dipercayakan kepada Cerci. Winger Torino ini tampil trengginas sebagai pemain pengganti ketika melawan Brasil. “Sistem ini memberikan kami opsi penyerangan yang lebih dibandingkan sistem lain. Kami kemungkinan akan menggunakannya pada laga melawan Malta,” ungkap Prandelli, dilansir Football Italia. Dengan formasi ofensif, besar kemungkinan Gli Azzurri akan mencuri tiga angka bahkan dengan skor telak. Kemenangan dengan skor besar bukan hal yang tabu bagi Italia pada laga ini. Meski bermain di kandang, Malta adalah tim terlemah di Grup B. Mereka berada di posisi buncit klasemen dengan rekor 12 kemasukan atau jumlah kebobolan

Pemain timnas Jerman (kiri-kanan) Marcel Schmelzer, Ilkay Guendogan, Sami Khedira, dan Mario Goetze berlatih jelang laga melawan Kazakhstan, dini hari nanti.

Jerman Sulit Juara di Piala Dunia 2014 NURNBERG –Tim nasional Jerman saat ini bertengger di puncak klasemen Grup C Kualifikasi Piala Dunia 2014. Mereka pun menjadi salah satu tim dari Benua Biru yang diprediksi akan melangkah mulus ke Brasil. Tak hanya itu, dengan segala potensi yang dimiliki sekarang, salah satunya adalah banyaknya talenta muda yang siap mengisi timnas, Jerman pun difavoritkan sebagai kandidat juara pada 2014 mendatang. Tapi, pendapat itu ternyata dibantah Manajer Timnas Jerman Oliver Bierhoff. Bierhoff menyatakan akan menjadi hal yang sulit bagi sepak bola negaranya memenangkan gelar di Brasil. Hal tersebut tak lepas fakta bahwa Amerika Selatan kerap tak bersahabat dengan tim-tim Eropa. Turnamen sepak bola terakbar sejagat tersebut sudah empat kali digelar di Amerika Selatan, yakni 1930, 1950, 1962, dan 1978. Dari empat penyelenggaraan tersebut, Uruguay, Brasil, atau Argentina tampil sebagai juara. Setelah 36 berlalu, turnamen ini kembali ke sana dan Bierhoff menyatakan pesimismenya. “Bagi kami, sangat mustahil memenangkan turnamen tahun depan,” ujarnya, dalam sesi konferensi pers jelang laga lanjutan kualifikasi melawan Kazakhstan di Nurnberg, dini hari nanti. “Itu seperti menaiki gunung tinggi. Amerika Selatan biasanya lebih menguntungkan negara-negara yang ada di kawasan mereka sendiri.”

terbanyak di antara kontestan lain dari grup ini. Tiga poin juga bakal memantapkan posisi Italia sebagai pemuncak grup. Hingga saat ini finalis Piala Eropa 2012 itu bertengger di posisi teratas dengan 10 poin. Hasil maksimal juga membuat Italia bisa menghindari kejaran Bulgaria yang hanya satu poin di bawah mereka. “Saya gagal memanfaatkan sejumlah peluang saat melawan Brasil. Sekarang, partai penting melawan Malta menanti. Kami ingin tampil bagus karena pertandingan tersebut memiliki banyak arti dalam perjalanan kami di ajang Kualifikasi Piala Dunia,” ungkap Balotelli, yang amat termotivasi menghadapi laga ini. Sementara itu, Malta pun seolah hanya bisa pasrah. Kekalahan 0-6 dari Bulgaria saat melawat ke Sofia membuat beban mereka semakin berat. Pelatih Malta Pietro Ghedin pun menyatakan tugas berat pasukannya. “Italia adalah satu dari lima tim teratas di dunia. Italia tim yang kuat dan kami tahu itu,” ujar pelatih yang sedikit banyak mengenal karakter sepak bola Italia karena pernah menjadi asisten Cesare Maldini, Dino Zoff, dan Giovanni Trapattoni ini. Ghedin pun hanya bisa berharap timnya tampil solid dan disiplin. ● sugeng wahyudi

Meski demikian, Bierhoff menandaskan bahwa Jerman di bawah asuhan Joachim Loew memiliki kans melangkah lebih jauh di Brasil mendatang. Pihaknya akan mendukung partisipasi Jerman sepenuhnya, terutama persiapan logistik, meski itu baru akan dikerjakan mulai musim panas mendatang.

”Kami belum memiliki rencana di mana kami akan tinggal di Brasil. Karena, kami belum tahu di mana kami akan bermain dan tergabung di grup mana.” OLIVER BIERHOFF

“Kami belum memiliki rencana di mana kami akan tinggal di Brasil. Karena, kami belum tahu di mana kami akan bermain dan tergabung di grup mana,” ungkap Bierhoff. “Tapi, tak ada masalah sepertinya bagi kami untuk berada di selatan atau utara Brasil.” Di sisi lain, agenda melawan Kazakhstan menjadi laga yang wajib dimenangkan. Memimpin Grup C dengan 13 angka atau unggul lima poin atas tim peringkat 2 Swedia bukanlah posisi yang aman bagi juara Piala Eropa 1996 itu. ● sugeng wahyudi


ITALIA (4-3-3) : Buffon; Abate, Barzagli, Bonucci, De Sciglio; Pirlo, Montolivo, Marchisio; Cerci, Balotelli, El Shaarawy Pelatih : Cesare Prandelli



AMSTERDAM – Belanda dalam kepercayaan diri tinggi setelah memetik kemenangan 3-0 atas Estonia pada lanjutan Kualifikasi Piala Dunia 2014, Kamis (22/3). Oranjepun semakin mantap sebagai pemimpin sementara Grup D. Kemenangan atas Estonia menjadi streak kelima mereka sejauh ini. Pasukan Louis van Gaal itu pun dalam posisi siap tempur kala harus menjamu Rumania pada laga lanjutan kualifikasi di Amsterdam Arena, dini hari nanti. Kemenangan sudah barang tentu memantapkan posisi The Flying Dutchmandi singgasana. Sikap positif tuan rumah semakin tinggi lantaran di pertemuan terakhir kedua tim, mereka meraih kemenangan 4-1 pada laga di Bucharest, September lalu.“Kami dalam momentum positif saat ini. Permainan kami terus berkembang dan ini menjadi modal penting kami

menghadapi Rumania,” ungkap Van Gaal, tentang kondisi timnya jelang laga seperti dikutip Reuters. Meski masih tak bisa diperkuat Wesley Sneijder karena cedera, Van Gaal masih bisa menggelar komposisi terbaik. Rafael van der Vaart bisa dijadikan sumber kreativitas di lini tengah. Playmaker Hamburg tersebut membuka skor melawan Estonia setelah Belanda dibuat frustrasi sepanjang babak pertama, pekan lalu. Kontribusi Van der Vaart sangat diharapkan untuk kembali memberikan energi positif di lini tengah. Tugasnya mengalirkan bola membuat kinerja Arjen Robben yang akan menopang Robin van Persie semakin ringan. Dia juga diharapkan mampu memecah kebuntuan lagi jika lini depan mengalami masalah. Hanya, Belanda kali ini mewaspadai sepak terjang Rumania. Faktanya, Tricoloriiyang saat ini


Pasukan Oranje Waspadai Tricolorii

Robin van Persie (atas) akan menghadapi perlawanan berbeda dari Rumania pada lanjutan Kualifikasi Piala Dunia 2014, dini hari nanti. Belanda kembali membidik poin sempurna pada laga ini.

berada di peringkat 3 memiliki kans besar merangsek ke peringkat 2 klasemen. Inilah yang akan menjadi senjata pasukan Victor Piturca. Kemampuan menahan imbang

kandidat tim yang akan lolos ke Brasil 2014 lainnya dari Grup D, yakni Hungaria dengan skor 2-2 pekan lalu menjadi modal berharga menghadapi Belanda. Penyerang

senior Adrian Mutu dan Alexandru Chipciu yang masing-masing mencetak gol saat melawan Hungaria bisa kembali diandalkan. ● sugeng wahyudi




MALTA (4-4-2) : Hogg; Agius, Dimech, Herrera, Caruana; P Fenech, R Fenech, Briffa, Failla; Mifsud, Schembri Pelatih : Pietro Ghedin


6:36 PM

Page 1






Pertemuan Montenegro menjamu Inggris di Stadion Pod Goricom, dini hari ini, menjadi ajang penentuan siapa paling berhak menguasai Grup H Kualifikasi Piala Dunia 2014 Zona Eropa. Di atas kertas, saat ini Montenegro masih menjadi tim terbaik, karena menjadi pemimpin klasemen. Peluang Montenegro menjaga posisi pun semakin terbuka, apalagi mereka akan mendapat dukungan fans tuan rumah.


Km akan ditempuh Cristiano Ronaldo ke Baku, Azerbaijan. Dia memilih menempuh jarak itu, meski tak akan main karena akumulasi kartu.


Namun, Inggris selaku tim tamu tak ingin dipermalukan. Mereka berambisi membawa pulang tiga poin untuk memuluskan langkah ke Brasil, tuan rumah Piala Dunia 2014. The Three Lions memang wajib meraih tiga angka jika tak ingin tertinggal dari Montenegro terlalu jauh. Inggris masih berada di peringkat 2 dengan torehan 11 angka atau tertinggal dua poin dari Montenegro.

Gol telah dikemas striker Belize Deon McCaulay selama babak Kualifikasi Piala Dunia 2014. Pencapaian itu mengalahkan Lionel Messi (8 gol).




Jepang menjadi negara pertama yang lolos ke putaran final Piala Dunia 2014. Di babak kelima penyisihan Grup Zona Asia, Jepang memimpin dengan torehan 15 poin.


BRANISLAV BRNOVIC Nama : Branislav Brnovic Kelahiran : Titograd, Yugoslavia, 8 Agustus 1967 Posisi : Pelatih Karier Timnas Tahun Negara Penampilan 1989-1998 Yugoslavia 27 Karier Kepelatihan 2007-2011 Montenegro (asisten) 2011-... Montenegro

Pertandingan menghadapi Bulgaria menjadi penting bagi kami jika ingin merasakan udara Brasil.

Gol 3

LONDON – Wayne Rooney bertekad mengubur mimpi buruk saat dijamu Montenegro pada Grup H Kualifikasi Piala Dunia 2014 di Stadion Pod Goricom, dini hari nanti. Rooney berjanji tak akan mengulang sikap emosional seperti saat menjalani Kualifikasi Piala Eropa 2012.

ROY HODGSON Nama : Roy Hodgson Kelahiran : Croydon, Inggris, 9 Agustus 1947 Posisi : Pelatih Karier Kepelatihan 2006-2007 Timnas Finlandia 2007-2010 Fulham 2010-2011 Liverpool 2011-2012 West Bromwich Albion 2012-... Timnas Inggris

Tahun lalu, Rooney harus keluar lapangan karena mendapat kartu merah saat menghadapi Montenegro. Imbasnya, The Three Lions,julukan Inggris, gagal memenangkan pertandingan tersebut. Rooney mengaku masih sulit melupakan memori kelam itu. Namun, striker milik Manchester United ini akan berusaha sekuat tenaga memberikan yang terbaik bagi TheThreeLions. Sebab, tiga angka dari Pod Goricom dianggap lebih penting ketimbang membahas masalah yang telah berlalu. Pernyataan Rooney cukup beralasan. Pasalnya, Inggris saat ini masih tercecer di peringkat 2 klasemen sementara Grup H. Dengan torehan 11 poin, Inggris harus rela sementara waktu mengalah dari Montenegro yang mendominasi grup itu dengan 13 angka. Karena itu, tiga angka dianggap Rooney lebih penting dari segalanya. Optimisme Rooney bakal memberikan yang terbaik di laga itu dibenarkan Joleon Lescott. Bek Inggris ini yakin rekannya di timnas itu akan melupakan insiden tendangan yang berujung kartu merah Rooney. Lescott mengatakan, Rooney tidak akan membiarkan emosinya meluap saat ini. Lescott tak menepis bila Wazza, sapaan Rooney, sangat emosional tahun lalu. Perilaku brutalnya kemungkinan karena emosinya belum terkendali dengan baik. Namun, kali


Pelatih Denmark

MLADEN BOZOVIC Nama : Mladen Bozovic Kelahiran : Titograd, Yugoslavia, 1 Agustus 1984 Posisi : Kiper


Pelatih Bulgaria Karier Timnas Tahun Negara 2007-... Montenegro

Demi Negara, CR7 Rela Tempuh Jarak 4.693 Km BAKU – Cristiano Ronaldo memang tak bisa tampil membela negaranya, Portugal, saat dijamu Azerbaijan dalam lanjutan Grup F Kualifikasi Piala Dunia 2014. Namun, striker Real Madrid ini ngotot ikut rombongan untuk menempuh perjalanan sejauh 4.693 km. Ronaldo tak bisa memperkuat Seleccao das Quinas, julukan timnas Portugal, lantaran mendapat kartu kuning saat Portugal bermain imbang ketika dijamu Israel 3-3, Jumat (22/3). Namun, bukannya balik ke Spanyol untuk memulihkan kebugarannya sebelum membela Los Blancos, julukan Real Madrid. Dia malah ikut rombongan tim untuk menyemangati rekan-rekannya. “Itu (tidak bisa bermain) membuat saya sedih, semua orang tahu berada di dalam skuad sangat penting buat saya. Akan lebih mudah jika saya terbang dengan pesawat dan kembali ke klub, tapi saya suka berada di sini dan saya pikir saya bisa berkontribusi meski tanpa harus bermain,” kata Ronaldo, dilansir Marca. Keinginan CR7, julukan Ronaldo, cukup beralasan. Sebab, posisi Seleccao das Quinassaat ini sangat terjepit di klasemen Grup F. Mereka bahkan bisa saja gagal ambil bagian di putaran final Piala Dunia 2014 di Brasil, karena masih tercecer di posisi 3 dengan 8 poin. Portugal kalah dari Israel (8) dan Rusia yang menjadi pemuncak klasemen dengan nilai 11. “Apa yang terpenting adalah tetap berada di sana. Saya ingin mereka tahu kalau saya bersama tim ini,” pungkasnya. “Pada hari Selasa (saat pertandingan) nanti, saya akan menyemangati rekanrekan saya untuk

bisa menjalani pertandingan yang bagus. Semoga kami bisa menang. Ini saatnya (saya) membantu dari luar,” tegas pemain termahal di dunia itu. Sementara Pelatih Portugal Paulo Bento sangat berterima kasih kepada CR7yang masih menganggap kepentingan negara di atas segalanya. Fakta itu menggambarkan bahwa sosok Ronaldo tak hanya mementingkan masalah pribadi semata. “Keputusannya untuk tetap bersama tim ini menggambarkan bahwa dia memiliki peran besar bersama Portugal. Saya yakin seluruh rekannya akan memberikan yang terbaik, meski tanpa kehadirannya,” pungkas Bento, dilansir Reuters. Setengah kekuatan Portugal memang menghilang tanpa diperkuat Ronaldo di lapangan. Tapi, dengan keberadaannya di sisi lapangan, permainan Seleccao das Quinastetap saja akan trengginas untuk melumat Azerbaijan yang masih bercokol di peringkat 5 dengan tiga angka.  rini agustina

Penampilan 30

Gol 0

MARKO BASA Nama : Marko Basa Kelahiran : Trstenik, Yugoslavia, 29 Desember 1982 Posisi : Bek

Karier Timnas Tahun Negara 2005 Serbia & Montenegro 2009-... Montenegro

Penampilan 3 23

Gol 0 1

ELSAD ZVEROTIC Nama : Elsad Zverotic Kelahiran : Berane, Yugoslavia, 31 Oktober 1986 Posisi : Bek Kanan/Gelandang Karier Timnas Tahun Negara Swiss U-18 2007-2008 Montenegro U-21 2008-... Montenegro

Penampilan 1 6 34

Gol 0 1 3

JOE HART Nama : Charles Joseph John Hart Kelahiran : Shrewsbury, Inggris, 19 April 1987 Posisi : Kiper Karier Timnas Tahun Negara 2005-2007 Inggris U-19 2007-2009 Inggris U-21 2008-... Inggris

Gol 0 0 0

CHRIS SMALLING Nama : Christopher Lloyd Smalling Kelahiran : Greenwich, Inggris, 22 November 1989 Posisi : Bek

Karier Timnas Tahun Negara 2008 Inggris U-18 Inggris U-20 2009 2009-2011 Inggris U-21 2011-... Inggris

Penampilan 5 1 14 5

FRANK LAMPARD Nama : Frank James Lampard Kelahiran : Romford, Inggris, 20 Juni 1978 Posisi : Gelandang Karier Timnas Tahun Negara 1997-2000 Inggris U-21 1999-... Inggris

Pemandangan Pantai Copacabana, Brasil, akan menjadi view para pemain timnas Inggris. Catatannya, pemain The Three Lions harus bisa menembus putaran final Piala Dunia 2014.

Penampilan 16 95

Bila Lolos ke Brasil

Gol 9 28

Pemain Akan Dilayani ala Raja nggris belum dipastikan lolos ke putaran final Piala Dunia 2014 di Brasil. Tim berjuluk The Three Lionsini masih berjuang keras di babak Kualifikasi Grup H. Namun, Federasi Sepak Bola Inggris (FA) telah membuat rencana yang ditengarai bakal memanjakan para pemain timnas di Brasil nanti. Kabar itu memang baru sebatas wacana dari FA, yakni akan memanjakan Steven Gerrard dkk bila lolos ke Piala Dunia nanti. Tapi, bila keinginan itu terwujud, para pemain Inggris dipastikan mendapat pelayanan seperti raja. Apalagi, FA telah melakukan negosiasi dengan manajemen Hotel Windsor Atlantica. Bila The Three Lions, julukan Inggris, lolos ke Brasil, tempat penginapan itu akan menjadi markas Gerrard dkk di Negeri Samba. Di tempat itu, mereka akan mendapat jamuan mewah ala raja-raja. Pemandian air panas, tempat perbelanjaan mewah, rekreasi indah, dan sajian sampanye di pagi hari akan menjadi menu utama para pemain Inggris. Tak hanya itu, Pantai Copacabana yang terkenal sebagai destinasi dunia akan menjadi pemandangan rutin mereka. Sementara di sebelah barat dan


Karier Timnas Tahun Negara 2005-2006 Serbia & Montenegro Montenegro 2007-...

Penampilan 3 30

Gol 0 14

WAYNE ROONEY Nama : Wayne Mark Rooney Kelahiran : Croxteth, Inggris, 24 Oktober 1985 Posisi : Striker Karier Timnas Tahun Negara 2000-2001 Inggris U-15 2001-2002 Inggris U-17 2002-2003 Inggris U-19 2003-... Inggris



Moldova menang (tandang)

San Marino (kandang) menang




Zverotic Kasalica

Kasalica Novakovic




Bozovic 22 Maret 2013



Drincic Vukcevic


Bozovic 14 November 2012

Gol 2 7 0 34

San Marino (tandang) menang




Scott Asante Pavicevic

Houghton Stoney Bradley





Pekovic Vukcevic

Kanada U-21 menang (kandang)



Jovetic Vucinic

Penampilan 4 12 1 80



timnya saat ini mengalami perubahan. “Mereka jelas tim yang paling diunggulkan untuk lolos ke putaran final Piala Dunia. Namun, kami tak ingin menyerah begitu saja,” tandasnya.  rini agustina

Gol 1 0 1 0


MIRKO VUCINIC Nama : Mirko Vucinic Kelahiran : Niksic, Yugoslavia, 1 Oktober 1983 Posisi : Striker


Penampilan 5 21 29

ini, Rooney telah berubah. Dia telah berkembang menjadi pemain yang lebih matang dengan emosi stabil. Bek milik Manchester City ini yakin Rooney tidak akan mudah terpancing provokasi apa pun. “Mereka (Montenegro) mungkin akan bermain dengan temperamen tinggi. Namun, saya tahu Rooney adalah pemain profesional. Dia pasti punya cara untuk menghadapi itu,” ujar Lescott, dilansir Daily Mail. LescottyakinWazzatidakakan bertindakgiladanmembuatkecewa negaranya.Pengalamanburuknya tahunlalumembuatnyamenjadisosok yanglebihprofesional.Lescottpercaya, sebagaiujungtombakharapantim, Rooneyakanberjuangkerasmembawa prestasiterbaikuntukInggris. Yang jelas, Lescott berjanji akan memberikan dukungan penuh kepada Rooney untuk melupakan dilema tersebut. Apalagi, keinginan Lescott mendapat apresiasi dari pemain Inggris lainnya agar Rooney terhindar dari provokasi lawan. Intinya, mantan bek Everton ini balik mengancam tim Negeri Balkan itu. “Rooney akan membayar apa yang sudah Montenegro lakukan tahun lalu. Dia akan mengembalikan harga dirinya dengan bermain lebih impresif dan mencetak banyak gol,” tandas bek berusia 30 tahun tersebut. Pelatih Inggris Roy Hodgson pun menyatakan hal serupa. Hodgson

yakin Rooney akan membalas insiden kartu merahnya dengan penampilan yang memukau. Namun, mantan pelatih Liverpool ini tidak menampik jika kemungkinan besar Rooney akan bermain dengan emosi labil, mengingat atmosfer pertandingan nanti berpotensi membuatnya mengenang kembali mimpi buruk tahun lalu. “Tapi, dia pemain profesional yang sudah banyak menjalani pertandingan. Saya yakin dia sudah melupakan kejadian itu,” tandas Hodgson. Mengenai strategi menghadapi Montenegro, Hodgson tidak banyak melakukan perubahan. Pola 4-4-1-1 masih tetap digunakan. Faktanya, skema inilah yang berhasil membantai San Marino 8-0. Kala itu, The Three Lions hanya mengandalkan Jermain Defoe dan Rooney sebagai kunci serangan. “Ada batas-batas tertentu saat kami menentukan sebuah formasi yang tepat. Bukan hanya tepat, tapi juga tidak berlebihan,” ujar Hodgson, dikutip The Guardian. Sementara striker Montenegro Marko Vucinic mengakui Inggris lebih difavoritkan untuk memenangkan pertandingan nanti. Kendati timnya sempat menahan imbang Inggris 2-2 di Kualifikasi Piala Eropa 2012, kondisi


Kami sadar masih banyak kekurangan, tapi kami yakin bisa mengatasi mereka (Denmark).



Bardsley 13 Maret 2013

Rooney Young Chamberlain Lampard Cleverley Baines

Lescott Smalling Hart

22 Maret 2013


timur hotel terdapat view pegunungan. Yang jelas, pelayanan seperti itu akan mengulang kejadian serupa kala Inggris lolos ke Piala Dunia 2006 di Jerman. Di bawah asuhan SvenGoran Eriksson saat itu, The Three Lionsdimanjakan dengan kebebasan penuh. Para Wags(Wives and girl friends)diperkenankan ikut dalam rombongan. Sayang, hal itu justru berdampak buruk terhadap performa Inggris. Kemudian, Fabio Capello datang sebagai pelatih dan mengubah kebijakan tersebut. Pelatih asal Italia itu menyatakan tidak seorang pun pemain boleh bersama istri atau kekasihnya hingga Piala Dunia 2010 usai. Namun, strategi Capello itu pun tidak mengubah performa Inggris. Kini, Roy Hodgson datang dengan ide baru. Bukan hanya boleh membawa Wags, para pemain juga akan mendapat pelayanan bak Pangeran Charles. Namun, di balik semua kemewahan itu, lokasi Copacabana yang terletak di Kota Rio de Janerio itu masuk kawasan berbahaya. Barbar yang berderet di sepanjang kota menggambarkan kehidupan malam yang penuh warna. Saking berwarnanya, ada 30 kasus pembunuhan yang terjadi setiap pekan. Enggan dikatakan sebagai negara

berbahaya, Kementerian Luar Negeri Brasil pun menyatakan negaranya cukup aman untuk dikunjungi siapa pun. Menurut juru bicara kementerian, kejahatan bisa terjadi di mana saja ketika ada peluang untuk melakukannya. Negara penghasil kopi itu pun mengimbau kepada Inggris untuk menanggalkan benda-benda mewah selama mengunjungi Brasil. “Pada Piala Dunia 2010 lalu di Afrika Selatan, banyak pihak khawatir terhadap angka kejahatan Afrika yang tinggi. Namun, faktanya, setelah ada sosialisasi kepada para pemain, hal-hal buruk dapat dihindari,” ujar juru bicara Football Supporters Federation Miles Kevin. Fakta itu setidaknya bisa membuat FA bernapas lega, apalagi kepolisian setempat dan pihak hotel berjanji merahasiakan keberadaan mereka di Brasil. Terlalu fokus pada hotel, Inggris justru melupakan tempat terpenting, yaitu tempat latihan (sports club). Kabar terbaru mengatakan bahwa Flamengo Sports Club menjadi target utama mereka. Tempat itu merupakan tempat latihan paling populer di Brasil. Tampaknya, FA ingin sekali memberikan segala keistimewaan bagi pemain Inggris agar dapat mengecap hasil positif di Piala Dunia nanti. 






7:06 PM

Page 8







Fans Siprus membentangkan spanduk menentang dana talangan Uni Eropa terkait krisis ekonomi yang sedang melanda pada laga melawan Swiss, beberapa hari lalu.

GELANDANG veteran Belanda yang kini membela Botafogo di Liga Brasil, Clarence Seedorf, mengalami hari sial pada pertandingan melawan Madureira. Mantan pemain Ajax Amsterdam, Sampdoria, Real Madrid, dan AC Milan itu harus menerima dua kartu kuning gara-gara memprotes keputusan wasit yang mengubah hukuman penalti menjadi tendangan bebas. Kejadian bermula ketika wasit menunjuk titik putih atas pelanggaran terhadap pemain Botafogo. Namun, asisten wasit kemudian memberi tahu bahwa sebelum pelanggaran terjadi, pemain Botafogo telah lebih dulu offside. Akibatnya, protes muncul dan Seedorf menjadi salah satu pemain yang berdebat dengan keras. Meski mendapat kartu merah, Botafogo tetap menang 2-1. ●

KEPUTUSAN merumput di Liga Rusia bersama Zenit Saint Petersburg ternyata tidak membuat Hulk menyesal. Meski sering mendapatkan perlakukan rasial dari fans Zenit maupun klub-klub lain di Liga Rusia, pemilik nama lengkap Givanildo Vieira de Souza itu mengaku bahagia. Dia berjanji tidak akan meninggalkan klub arahan Luciano Spalletti itu hingga kontrak selama lima tahun berakhir. Di sela-sela persiapan membela Brasil menjalani pertandingan uji coba, Hulk mengaku menolak tawaran sejumlah klub Liga Primer sebelum mengambil keputusan membela Zenit. Menurut mantan mesin gol FC Porto itu, alasan utama bermain di Negeri Beruang Merah adalah untuk mencari tantangan baru. Dia beranggapan sepak bola Rusia sedang berkembang. ●

PENYERANGReal Betis yang sedang menjadi buah bibir di Primera Liga, Benat Etxebarria Urkiaga, membantah kabar tercapainya kesepakatan dengan Bayern Muenchen di transfer windowmusim panas. Pemain kelahiran Igorre, 19 Februari 1987, itu mengatakan kabar mengenai ketertarikan Bayern atau Manchester City itu hanya merupakan produk kreativitas para jurnalis Spanyol. Kabar kesepakatan antara Bayern dan Betis muncul akhir pekan lalu dari pemberitaan sebuah stasiun televisi Spanyol. Kabarnya, Josep Guardiola sendirilah yang meminta Benat bergabung dengan Bayern. Uniknya, pada media lain disebutkan bahwa penyerang berpostur 175 cm itu menjadi salah satu incaran Man City. Tapi, kemudian sang agen Jose Vicente Biurrun membantahnya. ●



BAHAYA KETINGGIAN Meski Lionel Messi dalam kondisi terbaik, La Verdediyakini akan membuat tim Tango berjuang keras di stadion yang berada pada ketinggian 3.600 meter di atas permukaan laut itu. Apalagi, Argentina pernah memiliki memori kurang menggembirakan di La Paz. Pada 1 April 2009 saat masih ditangani Diego Maradona, Bolivia berhasil mengecundangi Albiceleste6-1 pada Kualifikasi Piala Dunia 2010. Itu adalah hasil terburuk Argentina dalam kurun waktu 60 tahun. “Ketinggian adalah faktor tidak normal yang akan menyulitkan. Anda harus berusaha keras fokus untuk bisa selamat. Kami wajib bermain efektif. Memperlakukan pertandingan ini dengan cara dan gaya berbeda dari laga-laga lainnya,” ujar gelandang asal River Plate Leonardo Ponzio kepada kantor berita nasional Argentina Telam. Fakta menunjukkan, Argentina bukan satu-satunya raksasa Amerika

Selatan yang tumbang di Hernando Siles. Pada 16 Oktober 2012, Uruguay yang datang ke La Paz dengan status tim peringkat 4 Piala Dunia 2010 dan juara Copa America 2011 harus mengakui keunggulan Bolivia 1-4. Bahkan, pada 1993 saat Kualifikasi Piala Dunia 1994 digelar, Bolivia berhasil mengecundangi Brasil 2-0. Padahal, sejarah mencatat Selecao adalah tim yang berjaya di Piala Dunia 1994. “Bukan rahasia bila La Paz akan menjadi tempat yang sulit bagi semua tim karena ketinggiannya yang ekstrem. Saya memiliki kenangan buruk dari lawatan terakhir Argentina ke tempat itu. Sangat sulit memantulkan bola. Saat itu saya mengalami kesulitan bernapas,” ungkap Messi, dikutip Ole. Statistik memang menunjukkan La Paz adalah neraka bagi para pesepak bola Amerika Selatan. Namun, bukan berarti potensi Argentina memenangkan

pertandingan otomatis tertutup. Selama Kualifikasi Piala Dunia 2014, Bolivia tercatat sudah menelan dua kekalahan dan satu imbang di La Paz. Dua tim yang mengalahkan tim arahan Xabier Azkargorta itu adalah Kolombia dan Cile. Kolombia menang 2-1 dan Cile unggul 2-0. Sementara Peru imbang 1-1. Potensi Argentina semakin besar mengingat pada pertandingan sebelumnya sukses menghajar Venezuela tiga gol tanpa balas. Pada duel di Estadio Monumental Antonio Vespucio Liberti Buenos Aires, Jumat (22/3), Gonzalo Higuain mencetak dua gol dan Messi (satu gol). Sementara pada saat yang hampir bersamaan, Bolivia dihajar Kolombia lima gol tanpa balas di Estadio Metropolitano Roberto Melendez Barranquilla. Hasilnya, Argentina kokoh di puncak, sedangkan Bolivia ada di

peringkat 8 dari sembilan peserta. “Mengalahkan Bolivia di La Paz tetap menjadi target kami. Memang ada faktor nonteknis yang akan menghambat kami. Namun, saya tidak terlalu mencemaskannya,” kata Pelatih Alejandro Sabella. ● andri ananto


LA PAZ – Estadio Hernando Siles La Paz selalu menjadi tempat yang menakutkan bagi tamutamu Bolivia, tak terkecuali Argentina, pada Kualifikasi Piala Dunia 2014 Zona Amerika Selatan besok pagi WIB.

Foto Estadio Hernando Siles La Paz yang akan menjadi tempat pertandingan Bolivia melawan Argentina pada Kualifikasi Piala Dunia 2014 Zona Amerika Selatan, besok pagi WIB (foto kiri). Lionel Messi, Ezequiel Lavezzi, dan Fernando Gago akan menjadi pemain andalan Alejandro Sabella saat bertemu Bolivia (foto kanan).

El Clasico ala Amerika Utara


uergen Klinsmann punya misi khusus saat Amerika Serikat (AS) melawan Meksiko pada pertandingan bertajuk el clasicoala Amerika Utara, besok pagi WIB. Pelatih asal Jerman itu ingin melanjutkan rekor pribadinya, yaitu tidak terkalahkan atas tim dari Negeri Sombrero tersebut.


“Pertemuan dengan Meksiko selalu spesial bagi saya. Semoga saya bisa meraih hasil yang terbaik.” JUERGEN KLINSMANN

Tugas utama Klinsmann tentu saja membantu AS memenangkan lanjutan Kualifikasi Piala Dunia 2014 Zona Concacaf. Tim Negeri Paman Sam tinggal sedikit lagi menuju Brasil lantaran sudah sampai kualifikasi putaran keempat. Mereka bahkan menjadi runner-upsementara dengan hasil satu

kali menang dan satu kali kalah atau terpaut satu angka dari Honduras. Pada laga pertama, AS dipermalukan Honduras 1-2 yang ditebus dengan menundukkan Kosta Rika 1-0. Artinya, bila pulang dari Estadio Azteca dengan hasil positif, Clint Dempsey dkk berpotensi memuncaki klasemen. “Kami menghormati Meksiko. Tapi, kami tidak takut kepada mereka,” ungkap Klinsmann, disitir MLS Soccer. Meski demi kepentingan seluruh tim, ternyata tersemat misi pribadi dalam benak mantan bomber Tottenham Hotspur itu. Seandainya AS tampil sebagai pemenang atau minimal berbagi hasil, catatan pribadinya yang tidak pernah kalah ketika bersua El Tricolorselama berkarier di sepak bola akan terus terjaga. Baik sebagai pemain atau pelatih, Klinsmann tidak pernah kalah dari Meksiko, yakni tiga kali menang dan tiga kali imbang. Catatan itu dimulai pada 1992 ketika membela Der Panzerpada laga persahabatan. Duel itu berakhir imbang 1-1. Dia kembali berjumpa Meksiko satu tahun kemudian, juga di laga ekshibisi yang berkesudahan tanpa gol. Klinsmann baru bisa mengalahkan Meksiko ketika babak 16 besar Piala Dunia 1998 ber-

langsung. Sempat tertinggal 0-1, dia membantu Der Panzermenang 2-1. Saat itu, dia menciptakan gol penyama kedudukan. Pertemuan Klinsmann dengan Meksiko berikutnya baru terjadi lagi pada 2005. Waktu itu, dia membimbing Jerman di Piala Konfederasi, tepatnya dalam perebutan posisi ketiga. Dia memaksa Meksiko menyerah 3-4. Hegemoni itu berlanjut ketika arsitek berusia 48 tahun itu membesut AS. Nasib kembali mempertemukannya dengan Meksiko dalam laga persahabatan, Agustus 2011. Sayang, partai itu berujung skor 1-1. Terakhir kala AS unggul 1-0, Agustus lalu, juga di partai pemanasan. “Pertemuan dengan Meksiko selalu spesial bagi saya. Semoga saya bisa meraih hasil yang terbaik,” kata Klinsmann. Namun, ambisi Klinsmann tampaknya akan sulit terpenuhi. Soalnya, tuan rumah diperkuat Javier ‘Chicharito’ Hernandez yang belakangan tengah ganas. Terbukti, penyerang Manchester United (MU) itu memborong dua gol waktu Meksiko ditahan imbang Honduras 2-2. Pada laga nanti, Hernandez berpotensi menjadi hantu lini belakang AS. ●


Antara Gengsi, Tiket Piala Dunia, dan Misi Pribadi

Kiper AS Brad Guzan mengamankan bola dari ancaman pemain Kosta Rika pada lada di Colorado, akhir pekan lalu. Besok pagi WIB, AS akan tampil di laga sarat gengsi versus Meskiko di Mexico City.



6:02 PM

Page 1







Para pemain timnas Indonesia saat latihan di Komplek Lanud Halim Perdanakusuma, Jakarta, beberapa waktu lalu. Konflik saat pembentukan timnas oleh Badan Tim Nasional ternyata masih berlanjut setelah laga Indonesia dengan Arab Saudi.

JAKARTA – PSSI akan menggelar rapat Komite Eksekutif (Exco) terkait penyelesaian masalah di Badan Tim Nasional (BTN). BTN kembali menjadi sorotan setelah adanya pernyataan Ketua BTN Isran Noor terkait konflik di tubuh tim nasional Indonesia. Konflik seakan belum mau meninggalkan persepakbolaan Indonesia. Setelah problem organisasi, yakni kompetisi telah teratasi lewat Kongres Luar Biasa (KLB) 17 Maret lalu, kali ini masalah baru datang. BTN yang dibentuk PSSI mengurusi tim Garuda, malah terpecah belah. Jika dirunut, konflik BTN dimulai dari pencoretan 14 pemain dalam pelatihan nasional (pelatnas) jelang laga Indonesia kontra Arab Saudi, Sabtu (23/3). Kemudian, imbas dari itu, Pelatih Luis Manuel Blanco didepak dan digantikan Rahmad Darmawan. Namun, yang mengerikan, ternyata ada skenario lain di balik itu

semua. Blanco konon sudah mendapat campur tangan dari pihak tertentu bahwa pemain yang akan berlaga kontra Arab Saudi sudah ditetapkan 50% pemain Indonesia Super League (ISL) dan 50% lagi dari Indonesian Premier League (IPL). Dan, satu kejadian yang cukup mencengangkan, pemain yang sudah kecewa terhadap Blanco diminta membubuhkan tanda tangan. Pemain itu merasa tanda tangan tersebut untuk pengambilan uang saku sebesar USD300. Nyatanya, tanda tangan tersebut disalahgunakan dan dijadikan sebagai bentuk dukungan kepada Blanco. Dengan kondisi itu, PSSI berniat

mencari solusi penyelesaian masalah ini dalam rapat Exco PSSI. Rapat itu akan digelar setelah Ketua Umum (Ketum) PSSI Djohar Arifin Husin pulang dari Malaysia dan Wakil Ketua Umum (Waketum) La Nyalla M Mattalitti kembali dari umrah sekaligus dijadikan sebagai ajang evaluasi timnas. “Kami akan menggelar rapat Exco secepatnya untuk mengevaluasi kembali hal-hal yang harus diperbaiki ke depannya. Kami akan melihat kontrak Blanco seperti apa, CV-nya bagaimana? Tentu, masyarakat harus tahu soal ini. Kami harus merasa yakin dulu, timnas dipegang pelatih seperti apa,” ungkap anggota Exco PSSI Roberto Rouw, saat dihubungi KORAN SINDO, kemarin. Berto, sapaan akrab Roberto, menyatakan, dalam rapat Exco nanti PSSI akan memanggil Isran. Pria yang menjabat Bupati Kutai Timur tersebut akan dimintai keterangannya tentang alasan pengangkatan Blanco dan format kontraknya. “Dalam rapat nanti, kami akan

Persebaya IPL-Persema Bisa Bubar Memang, pekan lalu terjadi pertemuan antara pihak LPIS dan CEO sejumlah klub IPL. Hasilnya, mereka akan mengadu ke Menpora terkait hasil KLB PSSI yang dianggap bukan cerminan penyatuan kompetisi. Sebelum Persebaya mengambil sikap resmi, klub Jawa Timur lainnya, Persema Malang, juga sudah mengancam akan mundur dari IPL. Sebab, tim berjuluk Bledeg Biru itu juga tidak punya hak ikut kompetisi musim depan karena masih dalam status terhukum bersama Persibo Bojonegoro. Sinyal Persebaya akan membubarkan diri dari IPL tampaknya juga sudah tercium pemain. Beberapa pemain sudah pasrah dengan keputusan manajemen. “Kami menghormati keputusan Pak Gede. Selama ini biaya tim juga uang beliau. Saya juga dengar tim yang dualisme tidak bisa ikut,” ujar kapten tim Persebaya Erol Iba. Sebenarnya ada kemungkinan Persebaya masih selamat. Salah satu jalan melakukan merger dengan Persebaya Divisi Utama. Namun, Gede belum memberikan jawaban apa pun terkait wacana merger. Sementara itu, rencananya tim akan tetap berlatih kembali Selasa (26/3) pagi ini setelah libur sejak Jumat (22/3).  rachmad tomy

Hotel Century, Jakarta, Minggu (24/3) malam, Isran menyatakan kekecewaannya dengan hasil tim Indonesia. Kekecewaan itu pun dilampiaskannya kepada wakil BTN Harbiansyah Hanafiah. Dia menilai Harbiansyah telah melangkahi dirinya sebagai orang nomor satu di BTN. Isran juga menegaskan jika Blanco akan tetap menjadi pelatih timnas Indonesia. Menurut dia, Blanco akan tetap menjadi pelatih kepala tim Garudadalam masa persiapan pada laga ketiga Pra-Piala Asia (PPA) 2015 Grup C kontra China, 15 Oktober mendatang. “Kami sudah menyepakati pelatih adalah Luis Manuel Blanco dan diganti dengan orang yang menganggap dirinya sebagai wakil BTN (Harbiansyah). Saya jelaskan, wakil BTN itu belum ada. Yang ada baru ketua BTN. Saya sungguh kecewa dengan orang-orang tidak bertanggung jawab. Timnas kita melepas target mencuri angka,” tandas Isran.  decky irawan jasri


Jelang Tur Papua, Bendol Masih Belum Puas


SURABAYA – Nasib Persebaya Surabaya di ajang Indonesia Primer League (IPL) tinggal menghitung hari. Rencananya, jajaran manajemen Bledug Ijo akan memutuskan sikap resmi pada awal April mendatang. CEO Persebaya Gede Widiade mengatakan akan datang ke Surabaya untuk menemui pemain, pekan depan. Tujuannya memberikan kepastian nasib Persebaya terkait hasil Kongres Luar Biasa (KLB) PSSI. “Awal April, saya akan ke Surabaya untuk menentukan sikap Persebaya, “ ucap Gede. Meski belum buka suara, salah satu kemungkinan Persebaya akan mundur dari IPL. Ini jika melihat kenyataan hasil KLB PSSI yang tidak berpihak ke Persebaya. Musim mendatang, tim yang diperkuat Andik Vemansyah itu tidak punya jatah masuk penyatuan Kompetisi IPL-ISL karena dinilai ilegal. PSSI justru memberikan legalitas kepada Persebaya yang kini ikut Kompetisi Divisi Utama di bawah Pelatih Tonny Ho. Artinya, jika Persebaya IPL tetak melanjutkan kompetisi, tidak akan berdampak apa-apa. Apalagi, selama ini, biaya pengeluaran tim masih bersumber dari uang pribadi Gede. Sementara pihak konsorsium IPL maupun PT Liga Prima Indonesia Sportindo (LPIS) juga belum menunjukkan sikap.

meminta Pak Isran datang dan memberikan penjelasan tentang semua permasalahan yang ada. Hasilnya akan segera kami pelajari. Yang pasti, kami akan mencoba menyelesaikan masalah ini secara baik-baik agar tidak ada lagi ributribut di luar sana,” papar Berto. “Bagaimana kontrak Blanco? Dengan siapa kontrak itu dijalin? Semuanya harus jelas supaya tidak timbul persoalan baru. Kami juga harus lihat latar belakang pelatih ini seperti apa, apakah kami mau memberikan timnas kepada pelatih yang tidak tahu asal muasalnya?” sambungnya. Terkait kekalahan 1-2 tim Garuda dari Arab Saudi, Berto tidak ingin semua pihak menyalahkan pelatih dan pemain. Menurut dia, dengan masa persiapan sangat singkat, apa yang sudah dilakukan para punggawa timnas Indonesia sudah cukup bagus. Apalagi, tim yang dihadapi memiliki level yang jauh lebih baik. Sementara dalam jumpa pers di


JAKARTA – Misi Persija Jakarta bangkit dari dasar klasemen Indonesia Super League (ISL) sepertinya tidak akan berjalan mudah. Apalagi, Benny Dollo menilai performa Macan Kemayoran, julukan Persija, masih mengecewakan. Bendol, sapaan akrab Benny Dollo, yang ditunjuk sebagai suksesor Iwan Setiawan sebagai juru taktik Persija, memang memikul beban berat. Mengangkat performa buruk Persija menjadi misi pelatih yang juga sempat menukangi Ismed Sofyan dkk pada periode 2009 sampai 2010 tersebut. Bendol akan memulai debut dengan menjalani tur Papua menghadapi Persiwa Wamena, Sabtu (30/3), dan dijamu Persipura Jayapura, Selasa (2/4). Namun, jelang dua laga berat tersebut, Bendol sepertinya masih kecewa dengan penampilan anak-anak asuhnya itu. Apalagi, Persija sempat ditahan dengan skor kacamata oleh Persipasi Bekasi dalam laga uji coba di Lapangan POR Pelita Jaya, Sawangan, Depok, Minggu (23/3). Mantan pelatih tim nasional Indonesia ini menilai masih banyak pembenahan yang harus dilakukannya untuk meningkatkan performa tim. “Secara umum masih banyak yang perlu diperbaiki dari tim ini.

Pekerjaan ini memang berat. Tapi, saya akan terus berjuang melakukan pembenahan. Semoga saja kinerja tim bisa lebih baik ke depannya,” ungkap Bendol. Pelatih kelahiran Manado 62 tahun silam ini mengatakan, faktor mental pemain Persija masih sangat mengkhawatirkan. Tampaknya, tujuh kekalahan dari 11 pertandingan yang telah dilalui sangat memengaruhi para pemain Macan Kemayoran. “Saya pikir mental pemain masih belum baik. Mental ini sangat penting, apalagi tim ini sudah terlalu sering mengalami kekalahan. Mental buruk ini harus segera diubah,” papar Bendol, yang berencana membawa timnya bertolak ke Papua, Kamis (28/3). Sementara itu, Pelatih Fisik Persija Ega Raka Galih menjelaskan, para pemain Persija masih memiliki kendala di sektor stamina. Tercatat, fisik pemain masih hitungan 75%. Namun, Ega yakin dalam beberapa hari ke depan semuanya akan kembali seperti semula. “Meski fisik pemain hanya mencapai 75%, kondisi tim ini semakin baik dengan adanya pelatih baru. Kedatangan pelatih baru secara tidak langsung membuat pemain semakin bersemangat,” tutur Ega.  decky irawan jasri



7:08 PM

Page 8







JAKARTA – Pembalap tim Scuderia Ferrari Felipe Massa berhasil memulai balapan Formula One (F1) musim ini dengan memuaskan. Pada dua balapan yang sudah dijalani, pembalap asal Brasil itu masuk 5 besar. Pada seri pembuka di Sirkuit Albert Park, Melbourne, Australia, Massa berhasil menempati peringkat 4 di bawah Kimi Raikkonen (Lotus), Fernando Alonso (Ferrari), dan Sebastian Vettel (Red Bull Racing). Selanjutnya, dia kembali membuktikan kualitasnya dengan mengakhiri lomba di posisi kelima pada GP Malaysia di Sirkuit Sepang, akhir pekan kemarin. Jelas, dua balapan itu sudah membuktikan bahwa Ferrari sudah semakin kompetitif “Saya pikir ini awal yang cukup bagus mengawali lomba di musim ini,” kata Massa. “Pada balapan selanjutnya, saya yakin bisa memberikan hasil lebih baik lagi, terutama pada dua seri Asia di GP China dan GP Bahrain,” tambah Massa, saat peluncuran Shell V-Power di Hotel Dharmawangsa, Jakarta, kemarin. Pembalap berusia 31 tahun ini yakin bisa mengakhiri musim dengan hasil yang bagus. Apalagi, dia menilai performa Ferrari terus menunjukkan peningkatan signifikan. Karena itu, dia mematok target meraih gelar juara dan naik podium di setiap lomba yang akan dijalaninya. Sebelum bergabung bersama Ferrari pada 2006, Massa memulai debut di ajang F1 bersama tim Sauber pada 2002. Sejak saat itu, dia belum sekali pun merasakan menjadi juara dunia. Prestasi terbaiknya hanya menjadi runner-uppada 2008. Ketika itu, pembalap kelahiran Sao Paulo, Brasil, 25 April 1981 ini, mampu menunjukkan persaingan yang luar biasa, terutama terhadap pembalap asal Inggris Lewis Hamilton (saat itu memperkuat Mclaren) yang menjadi juara dunia. Bahkan, pada seri penutup musim, dia sukses meraih juara di GP Brasil.


Namun, pencapaiannya itu masih belum cukup membantunya menjadi juara. Sebab, perolehan poinnya masih kalah dari pembalap asal Inggris tersebut. Kegagalan itu membuat impiannya pupus. Jelas, bisa kompetitif merupakan salah satu syarat untuk meraih gelar juara dunia. “Setiap balapan, saya selalu melakukan dengan maksimal. Seperti halnya saya meraih posisi kedua saat lomba di Sepang, kemarin. Tapi, hasilnya tidak sebagus harapan,” ujar Massa. “Padahal, saya bisa melakukan kualifikasi dengan bagus karena dibantu dengan hujan. Namun, saat lomba, semua akan berbeda,” lanjut partner Fernando Alonso itu. Jelas, musim ini merupakan kesempatan Massa membuktikan kualitasnya bersama Ferrari di tahun ke delapannya. Apalagi, para pembalap dari tim asal Italia itu sudah lama tidak

:: BIODATA MASSA Nama lengkap Kelahiran Kebangsaan

: Felipe Massa : Sao Paulo, Brasil, 25 April 1981 : Brasil

■ KARIER DI F1 Tim 2013 Nomor mobil Jumlah balapan Juara dunia Menang Jumlah podium Total poin Pole position Lap tercepat Debut Sukses pertama Sukses terakhir Balapan terakhir Posisi 2012 Posisi 2013

: : : : : : : : : : : : : : :

Ferrari 4 176 (174 start) 0 11 kali 35 kali 726 15 14 GP Australia 2002 GP Turki 2006 GP Brasil 2008 GP Malaysia 2013 Ketujuh (122 poin) Kelima (22 poin)

meraih gelar juara dunia sejak Kimi melakukannya pada 2007. Apalagi, Ferrari sudah berhasil menghasilkan 12 gelar juara dunia dan 10 gelar konstruktor. Dari 490 balapan yang telah diikuti, sebanyak 160 balapan berhasil dimenangkan. Itulah yang membuat Massa optimistis bisa mendapatkan hasil terbaik tahun ini. ● raikhul amar


Karateka Maya Sheva dan Dhuhril Ramadhan tampil sebagai peraih Best of The Best pada Kejurnas Karate Mahasiswa UNS Cup VIII.


Sheva-Dhuhril Raih Best of The Best JAKARTA– Para karateka nasional menguasai Kejurnas Karate antarMahasiswa UNS Cup VIII 2013 di GOR Sritex Arena, Solo, 22–24 Maret. Sebut saja karateka Maya Sheva asal Universitas Nasional (Unas) Jakarta mampu meraih Piala Best of the Best setelah menundukkan karateka Universitas Negeri Jakarta (UNJ) Risca Anisa Miolo pada final Minggu (24/3).

“Karate telah berhasil membina generasi muda dalam membentuk karakter bangsa.” HENDARDJI SOEPANDJI

Sementara Best of The Best putra menjadi milik karateka Universitas Hasanudin (Unhas) Makassar Dhuhril Ramadhan yang menaklukkan Alin Sukma (UN Yogyakarta). Meski begitu, secara keseluruhan kompetisi bergengsi di level

mahasiswa tersebut jatuh ke tangan kontingen Universitas Negeri Sebelas Maret Solo dengan 6 emas, 5 perak, dan 45 perunggu. Disusul Unas Jakarta dengan 2 emas, 2 perak, dan 3 perunggu, serta Unhas Makassar dengan 2 emas, dan 2 perunggu. Ketua Umum PB Forki Hendardji menyambut baik hasil kejurnas antarmahasiswa yang diikuti 80 perguruan tinggi di Indonesia itu. Dia menilai para juara kejurnas tersebut akan menjadi aset besar Forki di masa depan. Sebab, kemungkinan mereka akan mampu membela Indonesia di ajang-ajang internasional. ”Karate telah berhasil membina generasi muda dalam membentuk karakter bangsa. Banyak karate Indonesia yang berhasil meraih prestasi, baik sebagai olahragawan, pegawai negeri, ilmuwan, pengusaha, birokrat, seniman, maupun militer. Jadi, jelas mereka adalah aset bangsa,” kata Hendardji, saat penutupan event.“Mahasiswa yang mengikuti Kejurnas UNS CUP ini juga komit dengan sumpah karate dan nilai bushido yang ada dalam kejuaraan ini,” tambahnya. ● raikhul amar

MIAMI– Miami Heat tampil konsisten dengan terus meraih kemenangan saat bertemu Charlotte Bobcats. Tak tanggungtanggung, mereka unggul 32 poin (109-77) atas Bobcats pada laga di American Airlines Arena, Miami, Florida, AS, kemarin. Ini merupakan kemenangan ke-26 beruntun mereka selama kompetisi reguler musim ini. Pada pertandingan tersebut, LeBron James lagi-lagi menjadi bintang. ForwardHeat ini sukses meraih double-doubledengan menciptakan 32 poin dan 10 assist. Hasil ini cukup luar biasa, apalagi laga ini disaksikan beberapa atlet terbaik dunia seperti Novak Djokovic (tenis), Wladimir Klitschko (tinju), dan Rory McIlroy (golf). ”Saya pikir ini sangat istimewa karena penampilan tim kami disaksikan para atlet terbaik dunia,” kata James, dilansir Sports Yahoo. ”Sebagai tim dan individu, saya benar-benar senang melakukannya. Jadi, ini sangat bagus menyambut kedatangan mereka,” sambungnya. James wajar bangga dengan hasil tersebut. Apalagi, tim tersebut tidak diperkuat salah satu andalan Heat, Dwyane Wade, yang absen karena cedera lutut. Selain James, keberhasilan ini juga berkat Chris Bosh dan Norris Cole. Keduanya tampil gemilang setelah masing-masing mempersembahkan 15 poin untuk kemenangan timnya. Yang jelas, Heat butuh tujuh kemenangan beruntun lagi untuk menyamakan rekor Los Angeles Lakers pada musim 1971–1972. Saat itu, Lakers sukses meraih 33 kemenangan beruntun dan tercatat sebagai rekor kemenangan beruntun terlama sepanjang sejarah NBA. Posisi Heat sendiri memang masih terbaik di klasemen Wilayah Timur saat ini, Mereka bahkan menjadi tim terbaik NBA musim ini

dengan rekor 55-14. Mereka unggul 2,5 gameatas pemimpin klasemen Wilayah Barat San Antonio Spurs. Yang pasti, kemenangan ini membuat Pelatih Heat Erik Spoelstra senang. Bahkan, dia merasa timnya ini merupakan yang terbaik sejak menangani juara bertahan itu pada 2008. ”Ini kemenangan yang sangat bagus. Jelas, kami telah melakukannya dengan sempurna karena para pemain tampil sangat baik,” ujar Spoelstra. ”Ini bagus untuk melihat ke depannya. Karena, kami sangat membutuhkan kemenangan ini,” lanjut Spoelstra. Di kubu

tim tamu, Kemba Walker menjadi peraih poin tertinggi Bobcats dengan 20 poin. Disusul Gerald Henderson dengan 18 angka. Pelatih Bobcats Mike Dunlap mengatakan, para pemainnya tampil kurang bagus, terutama saat melakukan lemparan tiga angka. Terbukti, dari 25 kesempatan, mereka hanya berhasil memasukkan lima bola. Jelas, itu yang membuat sang pelatih kecewa.”Kami mencoba terus melakukan perlawanan. Salah satunya dengan melakukan tembakan tiga angka. Tapi, kami gagal memanfaatkan itu,” ucap Dunlap. ● raikhul amar




Heat Belum Terbendung



5:20 PM

Page 1


Makanan Jepang selama ini selalu 34 identik dengan kata mahal. Pandangan inilah yang ingin diubah D’Cost Group

36 Erwin Gutawa bersama-sama dengan putrinya, Gita Gutawa, menggarap album “Di Atas Rata-Rata”.



Desain perhiasan mutiara kini tampil dalam bentuk yang lebih modern, menarik, dan futuristik. Profesional perhiasan Kathryn Bishop mengungkapkan, desain perhiasan mutiara menjadi tren yang klasik.


berbagai logam sudah ditinggalkan dengan pendekatan desain modern,” ujarnya. Dengan pengemasan mutakhir ini, tambah Clarke, mutiara terlihat lebih segar dan penggemarnya pun meluas karena dapat dikenakan dengan berbagai cara. Penggunaan mutiara berwarna atau menggabungkan mutiara dengan kejutan warna juga menambah kesan

esain perhiasan mutiara tidak lagi mempertahankan kesan sederhana dan ringan seperti yang terjadi sejak 1920-an. Namun, mutiara bergeser menjadi perhiasan yang setara dengan batu permata lainnya yang dikemas lebih futuristik, tidak biasa, dan menarik. Desainer perhiasan Sophie Breitmeyer mengungkapkan, saat ini perhiasan dari mutiara memang perlu didesain lebih segar. “Para desainer bisa menggunakan mutiara dengan cara yang modern, tetapi tetap relevan,” ungkapnya. Koleksi dari desainer perhiasan Shaun Leane dalam mengemas mutiara sebagai perhiasan yang modern dengan potongan tribal decobisa menjadi contoh yang bagus. Hal ini yang membuat perhiasan mutiara memiliki penggemar baru untuk jenis perhiasan. Seperti cincin azagury partridge’s ballcrusher yang menggunakan mutiara laut secara inovatif. Menurut Bec Astley Clarke dari pemasar perhiasan Astley Clarke, banyak konsumen yang memang menginginkan desain perhiasan dari mutiara yang lebih berbeda. “Sekarang semuanya tentang bermain kombinasi warna. Sementara, untuk mutiara dengan

Memilih Desain Lebih Modern Label perhiasan Nigel Milne mencatat penggemar perhiasan mutiara memilih desain yang lebih populer dan dikenakan dengan cara baru. Hal ini ditunjukkan dengan para pelanggan yang meminta merangkai perhiasan mutiara menjadi lebih baru, salah satunya untuk jenis multi-row choker necklaces, yang belum pernah ada selama jeda 10 tahun terakhir. Jelas ini mengungkapkan bahwa perhiasan mutiara sekarang jauh lebih modis. (dyah ayu)



Desain perhiasan mutiara kini dikemas modern, dan lebih segar. Direktur London Pearl, Daniel Vecht mengungkapkan, beberapa perusahaan menciptakan mutiara dengan warna cerah.

modernitas untuk jenis permata bulat kecil ini. Selanjutnya, mutiara merah muda sedang naik daun. Direktur London Pearl, Daniel Vecht mengungkapkan, akhirnya perusahaannya menciptakan beberapa mutiara warna-warni. Seperti dalam koleksi yang diberi nama Catherine untuk penghormatan kepada Duchess of Cambridge yang menciptakan cipratan warna dari batu permata dan kulit merah muda untuk melengkapi kilau putih mutiara dari south seadan Tahiti. First Lady Michelle Obama memakai mutiara ganda berwarna Adapun label Jersey Pearl putih yang universal. menambahkan warna pop sebagai daya tarik baru. Label ini telah menikmati kesuksesan besar dengan berbagai desain gelang kulit berwarna cerah dan logam yang diikat dengan mutiara air tawar putih di atasnya. “Kontemporer, desainnya menarik, ini membuat semakin banyak penggemar perhiasan jenis mutiara di semua kalangan, baik pencinta fashion, perhiasan, maupun selebriti,” ungkap Martin Beesley, pemilik Jersey Pearl. Memang, mutiara telah menghiasi beberapa kelengkapan untuk fashion, film, dan para bintang musik papan atas. Ikon mode Inggris, Kate Middleton, menggunakan kalung pendek dengan mutiara multiKate Middleton adalah penggemar rowdan beberapa sapuan queen’s diamond jubilee anting mutiara untuk penampilan dalam suatu acara. Bintang musik pop Rihanna, Lady elegan dan glamor. Gaga, aktris Sarah Jessica Parker, dan Zooey Deschanel memberikan efek mutiara yang edgier. Rihanna tampil di runwayVictoria Secret pada akhir tahun lalu memakai barisan kalung mutiara dan kacamata berbingkai. Sementara, Lady Gaga memakai gobstopper-sizeanting putih mutiara berikut gelang mutiara yang dipadankan dengan gaun mini orangeneon, kerah mutiara berani. Michelle Obama menjadi pesohor yang tercatat banyak menggunakan perhiasan mutiara. Harry Brown, Co-Director dari label Chrisholm Hunter mengungkapkan, Michelle Obama memang telah menjadi ikon untuk gaya perhiasan mutiara yang membuat para penggemar perhiasan mutiara Sandra Bullock terlihat kasual dalam mencari tren saat ini. “Anting mutiara dan untaian mutiara indah yang berlapis dekalung multi-stranded layeredmenjadi ngan gaun asimetris berwarna hitam. tampilan dramatis yang populer, bersama dengan koleksi dari label lainnya yang sangat terpengaruh dengan tren fashion terkini,” kata Brown. Sementara itu, artis Sarah Jessica Parker menggunakan kalung mutiara dalam bentuk menjuntai panjang yang dipadankan dengan t-shirt abu-abu dan jins saat menghadiri Festival Film Sundance. ● dyah ayu Mandy Moore mengenakan kalung pamela mutiara hitam putih di red carpet Golden Globe Awards.


Kenzo membawa koleksi terbarunya yang dipamerkan di ajang Paris Fashion Weeklalu ke panggung Plaza Indonesia Fashion Weekpada Rabu (20/3). Koleksi yang terinspirasi dari kekayaan hutan ini diterjemahkan dalam busana pria dan wanita yang tampil dalam warna dan motif khas bergaya jungle. Pergelaran ini terbagi menjadi dua sequence,yakni busana pria dan wanita. Koleksi dalam balutan motif, seperti tigers, leopard, dan crocodiles, untuk koleksi busana pria pada sequencepertama. Menggunakan bahan seperti katun

dan nilon, busana ini tampil dengan koleksi kemeja, safari jaket, kaus, serta celana panjang dan pendek. Lewat permainan tekstur kain pilihan, detail manik, warna yang berani, serta elemen motif yang disamarkan terkesan abstrak seolah menjadi daya tarik busana ini. Sementara, pada sequence kedua yang menampilkan koleksi busana wanita tampil lebih mengeksplor kekayaan jungle. Koleksi busana seperti tops, jumpsuit, dan dress dengan warna hijau, oranye, kuning mustard, dan turquoisebermaterial kulit dan bermotif leopardserta tigersini

menegaskan tampilan siluet ramping. Motif tigerjuga menyentuh potongan koleksi denim yang ditambahkan dengan bordiran dan ditambah gesper emas sebagai pemikat. Selain itu, koleksi spring-summer2013 ini juga diterjemahkan senatural mungkin untuk gaya urban lewat motif geometricdan organik dengan warna navy bluedan pinkpucat. ● rehdian khartika Model di pergelaran Kenzo di gelaran Plaza Indonesia Fashion Week. Kenzo menawarkan koleksi yang terinspirasi kekayaan alam di hutan.



Eksplorasi Tanpa Batas



4:59 PM

Page 1






Murah Meriah Makanan Jepang selama ini selalu identik dengan kata mahal. Pandangan inilah yang ingin diubah D’Cost Group. Lewat D’Sushi Bodo, pengunjung dapat mencicipi kelezatan beragam hidangan Jepang dengan harga yang bersahabat. Pembukaan outletperdana Sushi Bodo yang berlangsung pada Rabu (13/3) amat meriah. Antrean pengunjung tampak membludak, pihak restoran sengaja mendirikan tenda di pela-


taran parkir dan menempatkan beberapa kursi yang didominasi para wanita. Rupanya, pada hari itu diberlakukan makan gratis khusus wanita dan anak-anak. ”Setiap Rabu, wanita dan anak-anak bisa makan gratis di sini selama masa promosi,” urai Eka Agus Rachman selaku General Manager Marketing D’Cost Group. Kontan saja, pengunjung tak pernah surut datang pada hari itu. Namun, bukan hanya pada hari itu, menurut Eka, setiap harinya Sushi Bodo melayani tak kurang dari 600 pengunjung, bahkan mencapai 1.000 pada hari libur. Menakjubkan bukan! Agaknya harga murah memang menjadi daya tarik tempat ini. Bayangkan saja, sekotak sushiisi 10 potong dihargai hanya Rp10.000. Sushi rolldisajikan dalam kemasan boks plastik transparan berisi 10 potong dengan isian berbeda. Sushiberbalut nori atau rumput laut itu diberi isian berupa potongan mentimun, alpukat, telur dadar, daging iris, selada, dan abon. Ukuran per potongnya cukup besar. Tak ketinggalan, shoyudan wasabisebagai pelengkapnya. Sushidiletakkan di chiller,pengunjung bisa menyantap langsung atau bawa pulang. Meski harganya miring, namun kualitas tetap jadi prioritas. ”Sushi ini diletakkan dalam chillersehingga kualitasnya terjaga. Sushi-nya juga



Beragam hidangan Jepang disajikan restoran D’sushi Bodo di Sunter, Jakarta Utara.

segar. Kalau enggak laku terjual, sushi kami buang karena daya tahannya hanya satu hari,” kata Andy Rozano, Direktur D’sushi Bodo. Sushibukan satu-satunya hidangan yang terjangkau di sini. Beberapa menu lain juga ditawarkan dengan harga yang bersahabat. Ada tempura moriawase, chicken katsu, salmon katsu, tempura bodo, ebi furai, kakiage, yaki udon, yaki soba, sanma shioyaki, saba teriyaki, salmon shioyaki, koroke, yaki tori, saba shioyaki, ramen bodo, oyako donburi, chicken teriyaki ramen,dan doburi bodo. Anda bisa memilih menu paket untuk 2–4 orang dengan harga mulai dari Rp60.000 hingga Rp90.000. SINDOsempat mencicipi tempura udon, semangkuk udonhangat diberi toppingtempurayang garing. Udon atau mi berukuran besar dan bulat ala Jepang tersebut kenyal, namun empuk ketika digigit. Kuahnya yang bikin acara bersantap makin mantap. Porsinya pun cukup banyak dan pasti mengenyangkan. Untuk menikmati tempurabisa menambahkan saus berwarna hitam yang encer dengan aroma jahe yang tajam. Sementara itu, untuk minuman, silakan ambil sendiri sepuasnya. Ada pilihan ochapanas dan dingin. Keunikan restoran yang bertempat di Jalan Danau Sunter Barat Blok A 2 No 5, Sunter, Jakarta Utara, itu masih berlanjut. Cara pemesanan dan


SUSHI pelayanan juga tak kalah menunggu pagerberbunyi, uniknya. Begitu masuk, kira-kira 10 hingga 15 meCHICKEN pengunjung akan melinit. Jadi, jangan heran jika KATSU DON hat papan besar yang tidak ada pelayan yang men-display aneka makandatang ke meja dan menaan. Ada 2 kertas yang disenyakan pesanan Anda. diakan di masing-masing gamRestoran ini buka setiap hari mulai bar menu, untuk dimakan di tempat jam 11.00 hingga 21.00 WIB. dan dibawa pulang. Tinggal ambil kertas Demi menyelaraskan konsep restoran menu itu yang sekaligus tertera harga Jepang, seluruh pelayan mengenakan bamenunya, mulai dari Rp12.000 hingga ju kimono. ”Cara praktis memesan maRp39.000. Berikan kertas ke meja kasir kanan ini baru ada di D’sushi Bodo. Bisa dan selanjutnya pesanan akan ditotal. jadi, ini yang pertama di Indonesia dan Pengunjung akan mendapatkan sedunia karena kami ingin lebih memberibuah alat berbentuk bulat semacam pager kan kepuasan kepada konsumen. Mereka yang ada nomor meja si pengunjung. Jika tidak menunggu terlalu lama, sisi kemanpesanan sudah siap, benda bulat itu akan dirian juga terlihat untuk konsumen,” bergetar dengan sendirinya dan tutup Andy. Penasaran ingin merasakan pengunjung tinggal mengambil pengalaman bersantap di tempat ini?  sri noviarni pesanannya. Tak butuh waktu lama untuk



4:40 PM

Page 1




Memilih metode kontrasepsi bagi pasangan suami-istri (pasutri) mesti dilakukan dengan tepat dan hatihati. Penggunaan alat kontrasepsi harus disesuaikan dengan tujuan, usia, gaya hidup, dan rasa nyaman. erencanakan keluarga, termasuk memikirkan kelahiran anak adalah hal yang penting bagi sebuah rumah tangga. Sebab, bukan hanya menyangkut masalah kesejahteraan, tapi juga masa depan anak itu sendiri. Lebih jauh lagi, mencegah kehamilan adalah cara menekan laju pertumbuhan manusia, terutama menghindari ledakan penduduk. Karena itu, banyak pasangan yang memilih menunda memiliki anak bagi yang masih muda atau pasangan yang baru dikaruniai anak. Bagi mereka yang berusia menjelang 40-an, pun bisa memutuskan untuk tidak memiliki anak lagi. Untuk itu, agar sesuai harapan, mereka membutuhkan alat kontrasepsi yang tepat. Namun, banyak pasangan yang dirundung kebingungan dalam memilih metode kontrasepsi yang tepat di tengah jenisnya yang beragam. Ini ditengarai akibat pengetahuan mereka yang belum memadai. Dokter spesialis kandungan dan kebidanan dari FKUI/RSCM, DR Dr


I Putu Gede Kayika SpOG (K) memaparkan, pemilihan alat kontrasepsi mesti disesuaikan dengan tujuan pengaturan kelahiran. Apakah menunda kehamilan, menjarangkan kehamilan, atau mencegah kehamilan selama-lamanya, juga ditentukan dari kebiasaan atau gaya hidup penggunanya. Misalnya, bagi Anda yang pelupa, pemakaian pil KB tidak tepat karena harus diminum setiap hari dan mesti tepat waktu. Sementara, penggunaan spiral kurang sesuai bagi yang sering bertugas keluar kota karena meningkatkan risiko infeksi yang besar. ”Mesti dipilih yang benar-benar tepat dan cocok untuk masing-masing individu. Ini harus dibicarakan bersama pasangan saat berkonsultasi dengan bidan atau dokter,” ujarnya saat menjadi pembicara dalam acara Women’s Health Expo (WHE) 2013di Hotel Grand Sahid Jaya, Sudirman, Jakarta. Menurut Kayika, alat-alat kontrasepsi yang tersedia di pasaran memang memiliki kelebihan dan kekurangan masing-masing. Salah satunya pil KB. Kontrasepsi jenis oral ini sangat bisa diandalkan karena amat efektif. Kekurangannya, tidak praktis karena harus diminum setiap hari sesuai jadwal serta menimbulkan vlek dan jerawat di wajah. Selain itu, juga karena pil ini berguna untuk menambah hormon sehingga berisiko menimbulkan kegemukan. Namun, jangan takut, penambahan berat badan juga disebabkan oleh sejumlah


Tepat Pilih Alat Kontrasepsi Sebelum memutuskan untuk menggunakan alat kontrasepsi sebaiknya konsultasikan dengan dokter terlebih dulu.

faktor, di antaranya usia, kebiasaan berolahraga, dan lainnya. ”Lagi pula, sekarang sudah ada jenis pil yang tidak membuat gemuk. Apalagi, wanita memang otomatis akan gemuk usai menikah,” terangnya. Sementara untuk metode suntik, lanjut dia, keunggulannya di antaranya andal mencegah kehamilan dan tidak repot karena hanya perlu melakukannya setiap tiga bulan sekali. Kelemahannya, mengganggu siklus menstruasi dan menyebabkan berkurangnya kepadatan mineral tulang sehingga meningkatkan risiko osteoporosis atau pengeroposan tulang. “Namun, hal itu masih belum valid dan harus dibuktikan secara ilmiah,” sebut Kayika. Ada lagi IUD (intrauterine device) atau biasa disebut spiral yang bentuknya lebih kecil, lentur, dan dapat bertahan hingga bertahun-tahun lamanya. Kerugiannya, menyebabkan menstruasi tidak teratur, vagina kering, sakit

kepala, dan timbulnya jerawat. Saat pemasangan, IUD juga dapat menimbulkan rasa nyeri dan perdarahan. Menurut Kayika, rasa sakit ini belum tentu disebabkan oleh IUD. Bisa jadi karena terdapat tumor atau benjolan, infeksi, perlekatan, ataupun keputihan. Hal ini dipastikan dengan mengecek ke dokter kandungan. Bagi yang ingin selamanya tidak hamil, dapat memilih kontrasepsi mantap atau sterilisasi. Pada sterilisasi pria atau disebut dengan vasektomi, vasdeferens ditutup sehingga tidak ada sperma yang keluar, meskipun tetap ejakulasi. Sementara, sterilisasi wanita atau tubektomi, saluran tuba falopi ditutup sehingga sel telur tidak keluar. ”Sterilisasi aman dilakukan serta tidak ada efek terhadap kesehatan dan fungsi seksual karena tidak ada bagian tubuh yang dibuang,” katanya. Lalu, mengapa masih ada kejadian

seorang ibu tetap hamil meskipun sudah menggunakan alat kontrasepsi? Kayika mengungkapkan, hal itu bisa terjadi karena beberapa faktor. Misalnya, pil KB yang dikonsumsi bersamaan dengan obat-obatan lain. Jenis obat yang dapat mengganggu kinerja pil KB, antara lain obat jamur, TBC, dan diare. Ada juga makanan tertentu yang membuat penyerapan pil menjadi tidak baik, seperti susu. Selain itu, pil KB akan kehilangan manfaatnya jika penyimpanannya tidak baik, keasliannya diragukan, atau sekali saja terlupa untuk diminum. Untuk spiral, pemasangan yang kurang tepat atau bergeser juga dapat memperbesar timbulnya kehamilan. ”Makanya, saat memasang atau berkonsultasi soal alat kontrasepsi mesti dilakukan pada tenaga medis yang tepat dan terlatih. Selalu taati ketentuan penggunaannya,” ujarnya.  rendra hanggara



5:17 PM

Page 1




:: E R W I N G U T A W A


Tetapkan Standar Baru Penyanyi Anak-Anak

Erwin Gutawa bersama-sama dengan putrinya, Gita Gutawa, menggarap album ”Di Atas Rata-Rata” sebagai wadah penyaluran bakat dan kreativitas penyanyi anak-anak Indonesia yang belum tergarap maksimal. lbum ”Di Atas Rata-Rata” itu juga bisa dikatakan sebagai proyek idealis Erwin dan Gita. Keduanya mengumpulkan talenta muda berbakat di bidang menyanyi dengan rentang usia 9–14 tahun. Sesuai dengan judulnya, penyanyi anak-anak yang terlibat dalam album tersebut merupakan kumpulan anak berbakat


yang memiliki kemampuan bernyanyi di atas rata-rata atau bahkan lebih baik dari penyanyi yang dikenal saat ini. Ide proyek idealis bapak dan anak ini terlahir pada akhir 2011, di mana proyek tersebut bermula dari keprihatinan keduanya terhadap kurangnya wadah penyaluran kreativitas bagi anak-anak berbakat dalam bidang seni budaya, terutama di dunia tarik suara. Berangkat dari situ, keduanya kemudian melakukan audisi tertutup dengan menggandeng guru musik dan musisi di sekolah musik di Jakarta dan Bandung sehingga terkumpul sekitar 150 anak. ”Saat ini banyak talenta-talenta muda dalam bernyanyi di berbagai kota di Indonesia, namun tidak ada wadah buat menyalurkan bakat mereka. Kami berharap album ini bisa menjadi wadah yang baik bagi mereka,” ujar Erwin yang diamini Gita dalam jumpa pers peluncuran album ”Di

Atas Rata-Rata” di Blitz Megaplex, Grand Indonesia, baru-baru ini. Dari audisi tertutup tersebut, terpilih 13 anak dari berbagai genre musik, seperti Rafi, 12, yang memiliki karakter suara jazz. Juga, grup vokal Boy Sopranos yang terdiri atas 3 anak lelaki, yakni Moses, Christo, dan Sabian, yang piawai menyanyikan lagu-lagu klasik. Selanjutnya ada grup vokal wanita bernama Trio Aorea yang terdiri atas Naomi, Rara, dan Dea, yang mengingatkan akan trio Destiny’s Child. Ada juga Dian, 9, yang memiliki suara mesosopran layaknya Katherine Jenkins dan amat fasih melantunkan aria Nessun Dormamilik Puccini. Tidak hanya menampilkan musik maupun seni berlatar budaya Barat, Erwin juga memasukkan lagu bernapaskan tradisi budaya lokal, melalui anak didik penyanyi sekaligus penyinden terkenal asal Solo Sruti Respati bernama Woro.

Penyanyi yang juga seorang dalang cilik tersebut fasih menembang dan menyanyikan lagu bergenre keroncong. Ada juga anak asal Surabaya, Sensen, yang memiliki tipikal penyanyi gaya soul. Penggemar berat Sandhy Sandoro ini ditantang Erwin untuk menyanyikan lagu milik penyanyi senior Euis Darliah, Apanya Dong,yang aransemennya disesuaikan dengan dunia anak-anak masa kini. Erwin menyatakan, jika proyek perdananya tersebut sukses dan mendapatkan sambutan positif, dia dan Gita berencana melakukan kembali pencarian bakat serupa dengan jangkauan wilayah lebih luas, seperti wilayah Indonesia bagian tengah dan timur. ”Kami berencana membuat konser dari album ini pada Juni nanti. Tidak hanya itu, bila mendapatkan sambutan positif, kami akan kembali mencari bakat dengan scoop lebih luas dari saat ini, di mana Indonesia

bagian tengah seperti Makassar dan daerah lain di Sulawesi dan Kalimantan serta bagian timur Indonesia,” kata suami dari Lulu Gutawa ini. Erwin mengatakan, proyek album ”Di Atas Rata-Rata” tersebut juga sekaligus sebagai penetapan standar baru kualitas penyanyi, terutama penyanyi anak-anak. ”Album ini semoga bisa membuka mata dunia bahwa standar anak-anak Indonesia enggak kalah kemampuan dan bakat menyanyinya dibandingkan penyanyi anak dari negara lain,” tutur Erwin. Gita menambahkan, proyek yang digarap bersama ayahnya ini bukan merupakan proyek album biasa. ”Ada pesan dan sebuah gerakan bahwa anakanak Indonesia memiliki kemampuan di atas rata-rata anak-anak negara lain,” pungkas perempuan yang kini sedang sibuk berkuliah di Inggris ini.  thomas manggalla


@evansanders_id ”Kita lebih baik hidup dari sampah, daripada jadi sampah masyarakat” -quote ibu di METRO TV – speechless

@SahrulGunawan23 Ditinggal anak istri ke bali, nyusul bsk krn hr ini hrs shooting.. :( @RockNal Sedang anter mama ke Pasar Kosambi, Bandung. Udah lama banget gak masuk pasar ini, inget masa kecil. Klasik! :)

@astreedtiar1207 Klo ntn bola jadi ke inget Bang Ricky jo.. :( Selamat Jalan Bang.. @addiems Indonesia ini spt satu keluarga yg anaknya nakal2. Butuh ketegasan & kebijaksanaan orang tuanya.

Gallerypun bukan sembarangan. Sebut saja The Adams, Payung Teduh, Efek Rumah Kaca, dan The Experience Brothers, yang menghibur lebih dari 2.000 penonton yang kebanyakan datang dari kalangan mahasiswa dan siswa SMA se-Jabodetabek.

Irfan menambahkan, Music Gallery bukan hanya bentuk kepedulian BSO Band terhadap band-band indie, tapi juga menjadi bentuk rasa cinta mereka terhadap perkembangan musik di Indonesia bahkan dunia. Karenanya, tema yang

diusung pada Music Gallerytahun ini pun berkaitan dengan perkembangan musik dunia. Mengambil tema Time Machine, BSO Band ingin mengangkat perubahan musik dari era ke era, evolusi musik dari segi genre, penyanyi yang menjadi idola, sampai alat yang terus mengalami perubahan dan semakin canggih. ”Kami ingin para penonton tahu perkembangan musik di Indonesia dan dunia pada era 80-an dan 90-an mulai kaset sampai CD, biar anak muda juga suka musik-musik zaman dulu,” tambah Wakil Ketua Music Gallery Riri Ghaisani. Band Indie Rumah Sakit, salah satu bintang tamu yang hadir mengatakan, Music Gallerymerupakan wadah yang bagus untuk mengembangkan musik indie di kalangan muda. ”Senang sekali ada eventyang bisa mengenalkan musik indie pada kaum muda, terutama mahasiswa,” ungkap vokalis Rumah Sakit Andri Ashari.  ananda nararya

Pacar Baru Britney Spears

Band My Chemical Romance Bubar

KEHIDUPAN Britney Spears memang tidak pernah lepas dari gosip. Apalagi bila berkaitan dengan pasangan hidupnya yang terus berganti-ganti. Baru-baru ini, kamera paparazi sukses menangkap sosok baru kekasih pelantun Hold It Against Metersebut. Diva pop berusia 31 tahun tersebut tertangkap kamera tengah berpegangan tangan dengan David Lucado, kekasihnya selama dua bulan terakhir. Keduanya kerap dipergoki bersama-sama sejak Februari lalu, tepatnya pada Valentine, di mana mereka berdua terlihat begitu mesra dan menikmati kehadiran BRITNEY SPEARS DAN DAVID LUCADO satu sama lain. Lalu, siapakah Lucado? Belum ada yang berhasil mengorek siapa membuat Spears bahagia sejak dia sebenarnya pria yang memenangkan berpisah dari tunangannya, Jason hati Spears. Namun, satu hal yang pasti, Trawick, Januari lalu. Lucado adalah pria pertama yang sukses  lesthia

BAND ROCK asal New Jersey, My Chemical Romance (MCR), menyatakan diri bubar. Band yang digawangi Gerard Way, Ray Toro, Frank Iero, dan Mickey Way, itu secara resmi mengumumkan pembubaran diri mereka pada Jumat (22/3). Meski demikian, sang vokalis Gerard Way menyatakan, tidak ada lagi My Chemical Romance bukan berarti semangat yang diusung MCR selama ini harus mati. “My Chemical Romance memang sudah selesai, tapi tidak akan pernah mati. MCR hidup dalam hati kami dan


@didipetet1 Teater koma dengan sampek engtay selalu memikat..


@joannaalexandra I have adapted with jakarta's traffic. Mau macet gimana juga udah ngerti dan biasa...tapi kalo jalan gw diputer2 sm polisi MATADUITAN...

GELIAT subkultur musik indie di Indonesia memang mengendur beberapa tahun terakhir, namun bukan berarti mati. Malah, kini semakin menggelora lewat berbagai event, salah satunya Music Gallerypersembahan Badan Semi Otonom (BSO) Band dari Fakultas Ekonomi, Universitas Indonesia. Bertempat di Gedung Annex, Wisma Nusantara, Jakarta, Music Galleryyang digelar untuk ketiga kalinya itu bertujuan melebarkan sayap musik indie di Tanah Air. Ketua Panitia Music Gallery Irfan Raja mengatakan, eventtersebut merupakan festival musik indie terbesar di Jakarta yang diadakan mahasiswa. ”Music Gallerymerupakan festival band indie terbesar di Jakarta yang dibuat anak kampus. Karena kami lihat masih jarang ada yang mau bikin festival band indie. Padahal, dari segi kualitas bermusik, mereka sangat bagus,” kata Irfan. Deretan band yang hadir di ajang Music


Dukung Perkembangan Band Indie

seluruh fansselamanya karena MCR adalah sebuah ide, sebuah semangat, bukan sekadar band,” tulis Gerard dalam blognya. MCR yang merupakan band beraliran kombinasi alternatif, punk rock dan pop itu merilis album debut mereka pada 2002. Namun, nama mereka memuncak pada 2004 lewat album “Three Cheers for Sweet Revenge” dan “The Black Parade” pada 2006. MCR mengeluarkan album terakhir mereka pada 2010 dengan judul ”Danger Days: The True Lives of the Fabulous Killjoys”.  lesthia



3:53 PM

Page 1


Email Alamat Gedung SINDO Jalan KH. Wahid Hasyim No. 38 Jakarta 10340


Telepon (021) 392 69 55 ext 632, 628, 642

37 Informasia | KESEHATAN

Perhatikan Makanan Ini Jika Ingin Tambah Keturunan Ini

yang wajib diketahui oleh kaum adam terkait organ tubuhnya khususnya organ reproduksi. Seorang pria disebut nornal jika jumlah spermanya berkisar di atas 20 juta dalam setiap satu milliliter. Kurang dari itu, kecil kemungkinannya bagi pria bisa menghamili wanita. Banyak hal yang menyebabkan jumlah sperma menjadi sangat sedikit di antaranya faktor gaya hidup. Selain itu banyak penelitian menyebutkan jumlah dan kualitas sperma sangat dipengaruhi oleh jenis makanan yang dikonsumsi. Beberapa jenis makanan tertentu disebut-sebut dapat meningkatkan jumlah dan kualitas sperma. Makanan-makanan ajaib tersebut dapat meningkatkan produksi testosteron tubuh sehingga meningkatkan produksi sperma. Berikut ini makanan yang berguna untuk meningkatkan jumlah atau volume, kualitas, produksi dan motilitas sperma. 1. Cabai merah, wortel, gandum, aprikot kering Vitamin A dalam makanan ini membantu pertumbuhan sperma yang sehat. Heidi Murkoff, peneliti infertilitas mengatakan kekurangan vitamin A pada pria adalah salah satu penyebab kemandulan karena gerak sperma yang menjadi lambat. Untuk meningkatkan jumlah sperma dan motilitasnya, makanlah daun selada hijau tua, brokoli, bayam, kentang manis, dan susu yang diperkaya dengan vitamin A. 2. Asparagus, kacang polong, tomat yang dimasak, stroberi Vitamin C dalam jenis makanan ini mempengaruhi motilitas dan viabilitas sperma. Vitamin C dan vitamin A yang ditemukan dalam

AGEN DUCK KING/Bebek Peking Kuliner Plng Top Masa Kini, Dagingnya Lezat & Gurih Disukai Bnyk Org Sdh Saatnya Restoran, Catring, Kantin & Wrung Nasi Memakai Menu Tsb. Utk Dpt Bhn bku Bebek Dtg Lsg Ke Jl. Tanjung No. 2 Cijantung Jaktim HP: 0811882485 P06046-01-30(30/03)

AIR CONDITIONER AC-KULKAS Menerima Service AC Rumah-Kntr & Kulkas Perbaikan brgaransi, Bongkar-Pasang AC. Jual AC Second. Hub: 021-33029912/ 98531495/ 0817729959 B17290-21-30(19/04)

ANTENA / PARABOLA DUNIA ELEKTRO Agen & Ahli Antena TV 125Rb, Parabola 1,6Jt, CCTV 4,5Jt, Indvsn & TopTv Jkt: 44304294 = Bks: 83323560 = Tgrg: 50395601 = Dpk: 70508005 AM5476-19-30(17/04)

DEALER RESMI 6323752 83251519. Promo Indovision - TOPTV - Okevision. Sedia : Antena - Parabola - CCTV. LIBUR BUKA. GARANSI AM5439-06-30(04/04)

“ANTENA SOLUTION” 4675 3000 – 5618 1977 - 8601188 Antena 125rb, Parabola +-300ch 1.6jt oke/ Telkom/ indovision, yes/top TV Skyindo Bs prll 210Tv Lbr Bk Se Jabodetabek AM5432-01-30(30/03)

HD ELEKTRO Agen & Ahli Antena TV 125rb, Parabola 1,6Jt, Camera CCTV 4,5jt, Indovision 149rb, dll. JKT: 56944411 = BKS: 83304744 = TGRG: 50219995 = DPK: 71054446 AM5423-26-30(27/03)

ARLOJI / BERLIAN AHLI ARLOJI &BERLIAN &BALLPOINT dbeli dgn hrg tg; ROLEX, CARTIER, CHOPARD, BREITLING, PATEK P, TAG HEUER DLL. Hub; 021-3929079, 08129455198, Apt Menteng Prada lt.Dsr,No2J.DpnStasiunCikini.Dtgktmpt (Trm beli smntra) B17479-26-30(27/03)

AUTOMOTIF MOBIL DIJUAL DAIHATSU DAIHATSU 100% Baru KRDT DP Hemat PU 2.2jt, MB 2.4jt, Xenia 2.7jt, Luxio 2.9jt, Terios 3.4jt. Hub: (021) 99212120, HP: 0818988538 DKI-DPKTGR-BGR B16501-21-30(19/04)

FORD ALL NEW FORD Fiesta, Everest, Focus, Ranger, Escape dapatkan promo & diskon khusus hanya dibulan Maret 0821227 66601/ 91166983 Pin 2878476E AM5455-10-30(08/04)

HONDA HONDA CIVIC 1.8 matic hitam, 09’, KM rendah, pajak panjang. Wisma Laena, Jl.KH.Abd.Syafei No.7, Tebet - Jaksel. 0811 811 8370. B17500-24-07(30/03)

NISSAN Nissan All 100% Baru, Evalia, Livina, Serena, Juke, X-Trail, Dp Mrh/Bng 0%, Disc OK Hub Nissan BEKASI 82600729/33000902 B17464-23-30(24/03)


banyak makanan seperti: kangkung, paprika merah, ubi jalar, sayuran kuning dan buah-buahan memiliki zat antioksidan yang dapat meningkatkan jumlah sperma dan mengurangi radikal bebas berbahaya. 3. Ayam kalkun, telur, makanan laut, tiram, biji labu Zat seng yang kurang di dalam tubuh menyebabkan kadar testosteron rendah membuat jumlah sperma berkurang. Zat seng banyak ditemukan pada daging sapi, yoghurt, gandum dan jagung. 4. Sayuran berdaun hijau, alpukat, kacang-kacangan, biji-bijian Pastikan Anda mendapatkan cukup folic acid. Tidak memiliki folic acid yang cukup menyebabkan bayi cacat lahir. Pria dengan kadar folat rendah memiliki sperma dengan kelainan kromosom. Untuk meningkatkan jumlah sperma Anda, produksi, dan motilitasnya, pastikan Anda mengonsumsi banyak sayuran hijau gelap dan buah-buahan. Lebih baik lagi jika anda mengkonsumsi suplemen asam folat. Jika Anda khawatir tentang jumlah, produksi dan motilitas sperma Anda, cobalah melakukan tes sendiri dengan alat tes kesuburan laki-laki – seperti alat Sperm Check for Fertility. 5. Salmon, sarden, teri, kacang kenari DHA dan omega-3 asam le.mak esensial membantu meningkatkan aliran darah ke alat kelamin dan meningkatkan fungsi seksual. Dari




Yyasan YESNITA mnyalurkan, Prt/ B.sitter/ Suster Lansia, Hub ibu Vero: 02168215000-085287616969081617176990-087781281280

KEMENANGAN MOTOR Berani Beli Mobil Second hand Anda Dgn Harga Pantas SEJABODETABEK (Mbl Jepang) Hub: 0816932247/ 021 68336806 PIN BB 228B2394 P06047-08-30(06/04)

“ADA TANGERANG” BERANI BELI MOBIL Dg Hrg Tggi Sgl Jns Mbl Th.90 s/d 2013 BPKB ASLI/ DUPLIKAT. hub: MAS TIO 021.7028.3933 / 0812.890.7676. CIMONE TANGERANG B17494-08-30(06/04)

MOBIL DISEWAKAN MOBIL DISEWAKAN/RENT CARS Berta Rent: Avz, Inv, Jazz dll. Berpengalaman, start 250rb + supir available visa/master payment : (021) 4280-3757/4280-3767, 7121-9402 B17275-19-15(02/04)

GEMA RC & Biro Jasa 02183921017, 081314080977 Diswkn: Avnza, Xnia, Inova, APV, dll. Hrn, mgguan & blnn. trm ttpn, prpjg STNK, SIM, Blk Nma mutasi


PERLENGKAPAN MOBIL / MOTOR Cari Box Untuk Antar Makanan Resto/ Catering/ Canvas Perusahaan ? Pemesanan di 0818846107 add PIN BB 28cbfe7e Bisa Kirim Ke Sel Indonesia AM5458-14-30(12/04)

BABY SITTER Yysn Buah Hati B.Sitter 73447540/ 70638812, Sedia B.Sitter Inval Lbrn u/ Bayi, Blt, Jompo, Org skt. Identitas jls ADM&gj ringan. Bu Yati AM5492-26-30(24/04)

***LPK KEYSHA AMANDA*** Sdia bnyk B.sitter, PRT snior/jnior utk rwt by & blt, lsia. Idnts jls, gj stdr, grsi. Siap antr. Hub: Ibu widia 021-88854767087880895522~082123723311 B17498-20-30(18/04)

LPK BU MIMIEN Rsmi Disnaker sdia b.sitter by, blt, lnsia. Dlm & l.kota. Grnsi 1th, adm ringan, gj stdr, bs antar. Hub 082261832745/ 087780540356 AM5464-16-30(14/04)

84975478-98298964-081315206031 JIHAN Ada banyak Baby Sitter Untuk Bayi, Balita, Manula, Orng Sakit dan PRT, Gaji MURAH, Adm Murah Bisa Antar. AM5472-16-30(14/04)

LPK Pancaran Kasih Rsmi Disnaker sdia b.sitter/ PRT dlm/ l.kota. GARANSI 1th. Adm ringan, gj stdr, bs antar. HUB 82401313/ 92410697 AM5446-08-30(06/04)

LPK AMANDA sdia bnyk b.Sitter/PRT untuk Dlm / Luar kota, Jnior/snior u/bayi, Blita, JO, OS,Adm MURAH, Gj nego, bgransi, Idts Jls Asli, siap Antar Hub.B.Imah: 021-3204 3353, 0852 1208 1909 B17471-26-30(27/03)

LPK PUTRI PERTIWI Menyediakn: B Sitter/ PRT u/ Bayi, Balita, Jompo Dll. Adm Mudah Bgransi, Idntts Jelas & Asli, Gaji bs Nego, Sdia Infal Lebarn Hub Ibu Cici: 021-7072 1107, 7072 1109 B17473-26-30(27/03)

ADA ”DANA MITRA USAHA” TNP JMNAN. Bth dana, mdl usaha, byr hutang. Prss 2jam. KH. Bagoes Aryo Diningrat 081320991799 aman & nyata



Bth “DANA” hr ini u/ Byr HUTANG & MODAL USAHA, dibntu dg “DANA AMANAH”. Prss 2jam cair. Ustadz ARIPIN 081223344700 bkn penipuan AM5468-16-30(14/04)


Konsultasi hutang, modal usaha. Dana Amanah Prss 2jam cair. Bpk. Suryo Kusumo 0821 1895 1895 bkn penipuan

BARANG ANTIK ACING ART GALERY BELI: lukisan, furnitur eropa/cina, gading, perak, kain batik, jam. guci2, kristal. 081387555122/ 087876807818


KIJAGADHITA SPESIALIS Konsultasi membantu masalah keluarga, pasangan, dll. Jl. Ry Hankam 52A Pnt Bulog 2 Pd gede 84591683-0818788859 BYR SUKARELA






TERIMA GBR Rmh/ Ruko/ Ktr Dgn Autocad. Renov/ Bgn Br. Pengurusan IMB Harga Bersaing. Hub: 021 9348 0635 - 0813 8331 1789

PT.LAKSANA 5-350JT PNJMN DANA TUNAI TNP JMNN BNG 0,5% Fleat Prs 1hr Lsg Acc Trm LKota Krywn Non Krywn. 02199666880-085811699778


BAHAN BANGUNAN Glasswool, Rockwool, Aluminium Foil, Lantai kayu, Lantai vinyl, Acoustic Board, MDF Board, HPL, Wallpaper, Peredam Suara & Panas. Hub : 021-88880048, 88882255. B17264-13-30(11/04)

BIRO IKLAN MAU MURAH? AGEN IKLAN Menerima Hingga 100 KORAN SLrh INDO. BARIS, DISPLAY, DKCITA, RUPS, Dll. 02199733071/ 08128804884/ 0813 19471776 Jtwaringin No2A JAKTIM AM5483-23-30(21/04)

BIRO JASA PT ASP, urus SIUP, PT, CV, UD, paspor, kitas, UUG, API, GAPENSI, AKTE lahir, cerai, IMB, STNK, BPKB, NO PIL, Dll: 082122841936-08595997807002170521746 AM5479-21-30(19/04)

BIRO JODOH Pria Ljng 37Th Katholik S1 Pek Ttp TB&BB I70/63 Mpn& Mndiri TggJwb,Srius&Siap BrmhTgg Dmb Istri Gds/Jnd Nasrani/Budha Mandiri,Siap Nkh:Bram 082310172812 AM5482-23-30(21/04)

Janda 40, Ctk, Jawa, 163, 62, S2, Peg. Neg, Mns, Mnrk. Mncri Pira Duda/Bujg, Peg. Ttp dan punya tgg jwb, umur 4050an. Niat serius. Bila minat hub madesa b.jdh. 081213928198, 021-8015832 B17286-20-30(18/04)

Duda 45th S2, Katholik, Sawo mtng, Kontraktor, Mapan. Cr Gds/ Janda 3545th D3/S1 Jawa, Chns, Menado, Krj, Manis. Hub 087809873731 AM5444-06-30(04/04)



Tutup cc/kta dengan cara tidak bayar sm sekali (PEMUTIHAN) LEGAL STC SENAYAN EKA 02197231605, 087775002982, 081314951324 B17492-07-30(05/04)

AA-Dana Pasti cair, solusi kredit mct, kebthan mendesak ,no BI checking, jmnan SHM/ HGB hub: 95747011/ 60300404/ 98537110

Bisa Tarik Tunai Dari Kartu Kredit Visa & Master, Kemanggisan Kbn Jeruk Dekat Binus.Tlp 53670003



LPK BAKTI ABADI Sedia Baby Sitter ynior, Snior, Balita, Jompo, O Sakit, Adm. Murah, Garansi, Gaji 500-700, Idntitas Jls Asli. Hub. B. Sigit : 33577796, 0812 80779596, 0877 70000 045

Ada Mslh dgn Kartu Kredit/KTA Anda? Kami bantu PEMUTIHAN legal, Cepat, Tuntas Dewi 02194986428, 087880523323, 081286179648





Menabung dengan hasil 5% - 30% per bulan (50Jt. - 5M ) Hub. Rahel : 0813 1628 9282 B17254-06-30(04/04)

Dibuka kerja sama usaha transportasi sdh spk dan mou sistem profit share 12 % dijamin dana aman. 021 7459493, 7459593, 0812 812 52 127 AM5433-03-30(01/04)



DEPOT AIR PEMBUAT DEPO AIR MINUM Terbaik Di Indonesia Harga paling Murah Dari Yang Lain. Tlp 081284113434/085881341234 P06049-26-30(24/04)

ELEKTRONIK Hot Promo-Lampu LED Innlux bulb 5W (60rb), 8W (70rb) & 10W (110rb), min 25 pcs, stok terbatas. Bs dikirim ke slrh Indonesia. Hub: 021-36666262; 71006262 Free Ongkir JABODETABEK AM5477-20-30(18/04)

HOTEL WISATA Ciwidey & Kawah Putih Ada Penginapan Full AC & Air Panas. Kmr Dpn 250Rb, Kmr Blkng 250Rb. Jl Raya Soreang 147 Kluar Tol Kopo Arah Alun2 Soreang 022 5891832/ 0811882485, 24 Jam + Sarapan Roti P06048-15-30(13/04)

Hotel mulai Rp 99rb, AC, TV, Hot water, meeting : 0251 8338899, 8378658, 8901088, 8315769 B17283-20-30(18/04)

Kartu Krdit/KTA Anda Brmasalah? Bntu PEMUTIHAN Bbs Byr. Legal. Blok M Square lt. 3A Blk B95 Nadyne 98656178085719258210-081210659595



LPK SUGESTI 70621352/ 70726768/ 081286161523/ 087774096768 PIN BB 2A82C8C3 B.Sitter By, Blt, Perawat Os/Lansia Adm & Gj Nego Idtts Jls

***LPK DUTA BABY SITTER*** Sdia Baby Sitter byi, blta, lnsia & Or skit. u/ Dlm/ L. Kota. Adm mrh, grnsi 1th, idntts jls, gj stndr, siap antr. Hub: Sofie 021322 96992/ 02195320336/ 085283828342

CENTRAL RC 91918081-99412201 menyewakan mobil Xenia, Apv Arena, Inva, Dll D.Kota mulai 250rb, L.Kota 350 rb, Supir Brpnglmn





ABADIKAN Perjalanan Anda VMM Rent Car Alph, Avanza, Innova, Ford Everest. Hub: 021-70111137 / 0215383191 / 0812 1011 1137

Pria juga harus mengetahui jika volume sperma dibawah 20 juta dikategorikan infertil dan disarankan mengkonsumsi makanan yang kaya nutrisi seperti Vitamin B-12, asam askorbat (vitamin C) dan vitamin E. Selain asupan makanan tersebut, gaya hidup seperti berikut ini berpengaruh pada kualitas sperma. 1. Berhentilah merokok Jika Anda seorang perokok saat ini, berhentilah. Selain menyebabkan napas tak sedap, merokok juga mempengaruhi jumlah sperma. Penelitian

menujukan perokok memiliki jumlah sperma lebih kecil dibanding pria yang tidak merokok, karena rokok mengandung nikotin, nikotin lah yang menyebabkan sperma anda menjadi buruk. 2. Hindari memakai celana ketat dan panas Inilah alasannya mengapa letak testis itu tergantung di tubuh. Testis perlu memiliki suhu lebih sejuk dibanding bagian tubuh lain karena itu memakai celana dalam atau celana panjang ketat akan mengakibatkan suhu di sekitarnya panas. Sedapat mungkin usahakan tidak mengenakan celana dalam sewaktu tidur untuk menjamin tetap sejuk. 3. Mulailah makanan-makanan yang tepat Diyakini atau tidak, pola makan mempengaruhi produksi sperma. Cobalah makan makanan rendah lemak, berprotein tinggi, sayuran dan seluruh jenis padi-padian yang baik bagi kesehatan. 4. Kurangi hubungan intim dan masturbasi Banyak pria mengeluhkan air mani mereka sedikit dan encer. Semakin banyak ejakulasi, semakin berkurang kepadatan air mani tersebut. Jika anda melakukan hubungan intim tiap hari atau lebih buruk lagi masturbasi akan berpengaruh pada jumlah sperma dan kepadatan air mani itu sendiri. 5. Kurangi alkohol Alkohol dapat mempengaruhi fungsi liver yang pada gilirannya menyebabkan peningkatan tingkat estrogen. Jumlah estrogen yang tinggi dalam tubuh akan mempengaruhi produksi sperma. Sebaiknya hentikan minum alkhol mulai saat ini apabila Anda tidak ingin kehilangan jumlah produksi sperma. 6. Olahraga otot Meskipun ini tidak dapat langsung meningkatkan produksi sperma dan air mani, olahraga otot PC dapat membantu Anda menembak lebih jauh dari sebelumnya. Lakukan latihan Keegel misalnya. [berbagai sumber/CW1]

Kulit Asli, Furniture, Bag, Shoes, Fashion, Car, Promotion,Wallet, etc. Harco Elektronik Mangga Dua Ruko Blok. B No.2 Jakarta Telp:612 8888

CV RESTU BUNDA 91265122/ 99227782/ 087887011701 SDIA B.Sitter U/ By, Blt, Lansia, Org Skt, Snr/Jnr, Idnt Jls & Asli, Adm Mrh, Gj Standr, Grs 1th, Antr Grts. Sdia Dlm & L Kota Hbg Yanti. Mnrm Sttr Pndhn

ERTIGA GL DB angsuran 2jtan..NEW SWIFT angsuran 2jtan.. PIC UP TDP 10jtan info beny 081319148420 alvin 087820000799



penelitian diketahui bahwa pria subur memiliki asam lemak dalam spermanya lebih banyak ketimbang pria yang tidak subur. Konsumsilah makanan-makanan yang mengandung banyak asam lemak Omega-3 seperti arugula, kepiting, udang, rami, dan ayam. Untuk meningkatkan jumlah sperma, perbanyak makan makanan yang mengandung omega-3. 6. Toge Toge alias kecambah, Bisa dimakan mentah maupun dimasak tapi jangan terlalu matang. Toge ini solusi baik untuk kualitas maupun volume sperma. Makan saja sebanyak-banyaknya, tidak ada efek samping 7. Air kelapa hijau Untuk meningkatkan volume sperma, silahkan konsumsi air kelapa, disarankan air kelapa hijau. Air kelapa hijau diketahui mampu menetralisir racun.Bagi seorang perokok racun nikotin mampu menurunkan kualitas sperma dan daya ereksi, maka air kelapa hijau selain berfungsi mengatasi hal ini. Juga mampu meningkatkan volume sperma dan mengandung bahan alkohol yang memberikan pengaruh lebih hot dan berstamina bagi laki- laki.

INDEKOST Kost 1 Kmr Bisa 2 org,AC Split, Exhaust Fan,Lemari,S.Bed, Rak TV,650rb/bln. Jelambar Jaya 2 No 7 Rt 3/3. Hub: 33377740,70009996 AM5484-23-30(21/04)

ACCOUNTING - ADMINISTRASI Dibutuhkan Segera Sekretaris, Adm U/Ktr Di Gd. Tempo Lt.32 Kuningan. Syarat Bisa Berbahasa Inggris/Fasih, Komputer, Usia 25-30 Th. Hub Pak SEM 021-36822464 – 087777129871 B16551-26-30(24/04)

Info Loker di Grogol. Bth Cpt Adm, Keu, Gdng, Rcpt, Spv, BM, Oprtor, Scrty. P/W min smp, Smu/ 27jt/bl+50rb/hr. Pnmptn Ssuai Dmsli. Non Kontrak.Sms nm, usia, pddkn, alamt ke 08561336996 UP.IBU HALIMAH (Pasti dtrima &Lsg Krja) AM5466-16-30(14/04)

ADA LOW BTH CEPAT P/W, U/ PRSHN EXIMP TNP TEST LSG KRJA MINGGU INI Pss staff kntor ADM, HRD, KEU, RCP, GDNG, 17-47th inc.2-8jt/bl +60rb/hr.Serius Hub/Sms (Nama,Usia, Pndkn) 087883917296 IBU AMELIA (MGR HRD). KRYWAN TETAP, BKN SLS/YYSN PSTI DTRIMA AM5465-16-30(14/04)

Staff ADM(5), Gdg(5), Scurity(20), OB(8), Spv(3). Lsg Krja. Min SMP, Max 57th. Bkn Yysn/Outsrs/Pnylr (Inc. 3-8jt + 90rb/Hr) SMS (Nama #Almt #Usia #Pdkn) Ke IBU SYAKIRA - HRD MGR 085691159993 (Wwncra Lsg DtrimaSsui Domisli) (20 Kntr Cbg)



Ada Bth Kasir & Admin syrt: Pria/Wanita, SLTA sdrjt, max. 30th, Jkt. Hubungi Telp. 0812.8090.9073/ 0819.0367.8553

KERJA DIRUMAH Ngelem Benang Teh Celup,1Box200Benang=70Rb,50Box= 3,5 Jt+DPT UANG Bulanan Hub/SMS ANA 08567387138/ 02197616285


Info Low Lsg Krja U/Cbng Baru! Pos: Hrd, Adm, Scrty, OB, Keu, Spv, Smp- S1, 1755th, Gen. Trading, Importir, Inc. 2-8jt/Bl + 60rb/Hr + Jmstk, Non/Pglmn, Sms Dta Diri 085777228010 Ibu Elsa,Se (HRD) Pst Dtrma, Bkn Yys/Sls

AL-AMIEN AQIQAH Sedia Kambing Mulai 700 Ribu,Masak Aneka Menu, Gratis Potong Antar, Buku, Kalender. 0217509991-68434577-97734850 AM5448-08-30(06/04)







BTH KRYWN CPT DPRSHN PT GLOBAL COMPANY GROUP U/ GDG, OB, ADM, KEU, HRD. INC.4,5jt-6,6jt Bl 60/hr U1749th bkn sls, lnsg krj tnp test minat sms 087883917267 IBU VEGA SE (HRD) SESUAI DOMSLI “PSTI DTRMA”

DICARI staff Adm wnt max 21thn SMA/D3 jujur kreatif, Satpam/Sopir max 35thn SIM A jujur rajin domisili diJaksel kirim lamaran ke Amanah tour Rukan Royal Palace b 24 jl Supomo Jaksel LSG KERJA Tnp tes u/kntr u/pss (BM, HRD, KEU, SPV, ADM, GDNG, RCP, OB) Non yysn/sls. P/W SMP, SMA,D3-S1,umur 1765th incm 2-8 JT/bln, fslt, Jmstk, jjkrf, trnf, U.harian 50rb+U.mkn, krm dt diri (nama, almt, umur, pddkn akhir) via sms ke INDAH SE 087880199841




Acc. Wnt maks 35 thn.Min D3, pnglmn min 2 thn. Mampu mengoperasikan MS.Office.Diutamakanpasif berbahasa mandarin.lokasi Dadap,T angerang.Telp 0821-10710251 B17496-08-30(06/04)


Dicari Therapist wanita & kurir pria usia 16-45th bersedia tinggal di mess, Hub: 021-90250339, 082120868837 AM5489-24-07(30/03)

BTH 10 STAF Mrktg, Guru B.Ing & komp. P/w, min SMA, Pny Kendr.Lmr: Jaktim: 85914981 Jaksel:78837219 AM5480-21-07(27/03)

Bagian Lipat Kertas Teh,Bisa Dibawa Pulang. Stor 1 Pac. Upah >70Rb (100Pac=7Jt) + DPT UANG BULANAN. PT HDN. SMS. IBU POPPY 089602577360 AM5475-18-30(16/04)


Kesmptan krj u/Pnsiunn, Ex. PHK, PNS, Ibu RT dll. Ktr Hji + Umroh, 5jt/bl. Bth P/W, 35-69th Hj. ROSMAYANTI 94330560/ 081314679643/ 087884151989 AM5461-15-30(13/04)

Dbth Financial Consultant Gaji Ttp + kms, Walk in interview Sequis Plaza lt.7 suite 703 (sblh Tamara Center) Jl. Jen. Sudirman Kav.25 B17262-09-30(07/04)

Bth P/W Usia 30-69Th Krj dikantor Haji & Umroh Income 5Jt/bln Cocok untk Pensiunan, Ex PHK, PNS dll. Bpk Ibrahim 085223186107 AM5436-05-30(03/04)



4:35 PM

Page 1






INDONESIAmengalami peningkatan angka kasus alergi pada bayi setiap tahunnya. Menurut hasil penelitian dari Dr Zakiudin Munasir SpA(K) selaku Kepala Divisi & Konsultasi AllergyImmunology, Departemen Anak RSCM, tingkat risiko alergi pada bayi bisa timbul 5–15% walaupun kedua orang tua tidak memiliki riwayat alergi. Angka akan bertambah menjadi 25–30% jika satu saudara kandung memiliki riwayat alergi, 40% jika salah satu orang tua memiliki riwayat alergi, dan 40–80% jika kedua orang tua memiliki riwayat alergi. “Agar tidak terjadi peningkatan kasus alergi pada bayi, pencegahan alergi primer harus dilakukan oleh para orang tua,” tambahnya pada acara yang diselenggarakan oleh Nestle Nutrition Institute di Sanur Room Gran Melia Hotel-Jakarta, beberapa waktu lalu. Alergi yang terjadi pada bayi biasanya disebabkan oleh makanan dan bisa menyebabkan dermatitis atopik, asma, dan rhinitis. Dokter yang juga menjabat sebagai Ketua Perhimpunan Alergi-Imunologi Jakarta ini menyatakan, yang sering terjadi pada bayi adalah alergi susu sapi dan alergi susu formula. Alergi susu sapi me-


ASI, Lindungi Bayi dari Alergi

nyebabkan bayi mengalami dermatitis atopik dengan reaksi kulit bayi dan sekitar pipi timbul bercak merah, rasa gatal, dan diare. Cara terbaik agar bayi terhindar dari alergi adalah pemberian ASI eksklusif minimal 6 bulan. “ASI eksklusif merupakan cara ampuh agar bayi terhindar dari alergi,” ungkap dokter yang mengejar ilmu pediatric allergy immunology di Groningen, Belanda, pada 1990. Sang ibu juga perlu memperhatikan asupan makanannya agar kualitas dan kuantitas ASI tetap terjaga. Pola hidup sehat dengan makan sayur (daun katuk), buah-buahan, hingga

makanan yang mengandung protein tinggi. “Pola hidup sehat si ibu, seperti tidak merokok dan tidak berada di sekitar orang merokok,” tambahnya. Cara lain pencegahan alergi pada bayi adalah dengan memilih susu pendamping ASI yang tepat. Susu formula dengan asupan 100% wheyprotein yang terhidrolisis parsial dapat mencegah kasus alergi bayi. Prof Ulrich Whan, ahli dan konsultan anak bidang pneumonology dan allergology Jerman menambahkan, pencegahan menggunakan asupan 100% protein wheyterhidrolisis parsial terbukti paling efektif dan aman secara klinis untuk mengurangi risiko alergi. German Infant Nutritional Intervention Study (GINI) 2008 melakukan riset hampir 6 tahun di negara berkembang, melihat adanya penurunan risiko dermatitis atopik dengan penggunaan 100% protein wheyterhidrolisis parsial.  witantri nurfadilah


SABTU, 23 Maret 2013, SD Santa Maria Fatima yang berlokasi di Jalan Raya Jatinegara Barat ini mengadakan kegiatan pentas seni dan bazar. Acara ini menjadi awal kegiatan Peringatan 60 Tahun SD Santa Maria Fatima, sekaligus bertepatan dengan pembagian rapor midsemester siswa di sekolah. Kegiatan yang berlangsung sejak pukul 07.00 WIB ini langsung diisi aksi pentas seni dari murid TK, SD, hingga SMP Santa Maria Fatima. “Sebenarnya ini lebih ke acara reunian kita-kita” papar Lusia Meliani Suciadi SPd, Kepala SD Santa Maria Fatima. Kebanyakan mereka yang hadir adalah para orang tua dan wali murid yang dulunya lulusan dari sekolah ini. Selain acara pentas seni dari siswa sekolah, kegiatan ini diisi juga dengan sejumlah stan bazar. Bazarnya juga beraneka ragam, mulai makanan khas daerah seperti


Rayakan Ultah ke-60 menyediakan makan dan minum, bazar juga diisi penjualan tas, baju, pakaian, aksesori, hingga sejumlah penawaran les pelajaran dan musik. “Kami sangat senang dengan antusiasme para wali dan murid menyambut acara dan bazar di sini” kata Lucy selaku ketua panitia acara ini. Selain panggung hiburan dan bazar, juga digelar lomba gambar nasional yang bertajuk “Menggambar Negeri Impianku”. Lomba ini dikhususkan untuk murid di kelas Suasana bazar di SD Santa Maria Fatimah di Jatinegara, 1, 2, 3 SD. Mereka yang mepada peringatan Ultah yang ke-10. nang berhak mendapatkan hadiah utama berupa liburan gudeg, pempek, ada juga makanan jadi ke Hong Kong Disneyland.  witantri nurfadilah seperti pizza dan hamburger. Tak hanya

04.30 06.00 07.00 09.00 11.00 12.00 12.30 14.30 15.00 15.30 16.30 17.00 18.30 19.30 21.00 22.30 00.30 01.00 01.30

: Seputar Indonesia Pagi : Go Spot : Dahsyat : Sinema Pagi : Intens : Seputar Indonesia Siang : Sinema Siang : Cek & Ricek : Silet : Putri Bidadari : Seputar Indonesia : Yang Muda Yang Bercinta : Cinta 7 Susun : Tukang Bubur Naik Haji : Layar Drama Indonesia : Berkah : Mega Sinema : America's Funniest Home Video : Seputar Indonesia malam : World Cup 2014 Qualification Perancis VS Spanyol 04.00 : Assalamualaikum Ustadz

04:30 05:00 05:30 06:00 06:30 07:00 07:30 08:30 09:00 11:00 11:30 12:00 13:30 15:30 16:00 16:30 18:00 19:00 20:30 22:00 23:00 00:00 00:30 01:00

04.00 06.00 08.30 09.30 10.00 11.00 12.00 14.00 15.30 16.00 16.30 17.00 18.00 20.00 23.00 01.00 01.30

: Majelis Sakinah : Lintas Pagi : Disney Club : Little Einstein : Disney Club : Jungle Junction : Disney Club : Donald Duck Present : Upin & Ipin Dkk : Serial Pilihan : Pose : Kisah Unggulan : Diantara Kita : Lintas Siang : Layar Kemilau : I Drama : Tuntas : Lintas Petang : Animasi Spesial : Sepatu Super : Tendangan Si Madun Season 3 : Raden Kian Santang : Lara : Sinema Pilihan : Lintas Malam : Sport Mania : Sidik

: Buletin Indonesia Pagi : Spongebob Squarepants : Sketsa Tawa : Hot Spot : Obsesi : Buletin Indonesia Siang : Namaku Mentari : 100% Ampuh : Top Banget : Fokus Selebriti : Arjuna : Si Kriwil : Big Movie : Big Movie : Big Movie : 100% Sport : Buletin Indonesia Malam

02:00 : SL Super Soccer 02:33 : SL UEFA Champions League Round of 16 04:30 : Closing SL UEFA Champions League - Round of 16

04:33 06:00 07:00 09:00 10:00 11:00 11:03 12:00 12:30 14:30 16:30 17:00 18:45 20:30 21:15 23:00

: SL Liputan 6 Pagi : Was Was : SL Inbox : Halo Selebriti : Pembantu Cantik Itu Pacarku : SL Liputan 6 : Pembantu Cantik Itu Pacarku : SL Liputan 6 Siang : Cantik-Cantik Master Kungfu : SL Eat Bulaga Indonesia : SL Liputan 6 Petang : Heart Series 2 : Si Biang Kerok Cilik : Para Pencari Tuhan Jilid 6 : Ustad Fotocopy : FTV Utama

02:30 05:00 06:00 07:00 08:00 10:30 11:30 12:30 14:30 16:00

20:00 22:00 22:00

: Hembusan Cinta Dari Surga : Mamah dan AA : Fokus Pagi : Sensasi Selebritis : Pagi Pagi Bagi Bagi : Sinema TV Spesial : Patroli : Sinema Siang : KISS Sore : Drama Korea : Rooftop Prince : Jessy dan Super 7 : Drama Seri Indonesia : Bukan Mawar Tapi Melati : Brahma Kumbara : Sinema Unggulan : Mega Asia : A Better Tomorrow

02:30 04:30 06:30 07:00 09:00 09:30 10:00 11:30 13:30 14:30 15:00 17:30 19:30 20:30 21:30 22:30 23:00 23:30

: Damai Indonesiaku : Kabar Pagi : Kabar Arena Pagi : Apa Kabar Indonesia Pagi : EnsikloTIVI : Kabar Pasar Pagi : Coffee Break : Kabar Siang : Ruang Kita : Kabar Pasar : Divisi Utama Liga Indonesia : Kabar Petang : Debat : Apa Kabar Indonesia Malam : Kabar Malam : Menyingkap Tabir : Kabar Arena : Kabar Hari Ini

04:05 04:29 04:30 07:05 07:30 08:05 11:30 13:05 17:05 19:05 20:30 21:05 21:30 22:30 23:05

: Genta Demokrasi : Opening New Day : Metro Pagi : Bedah Editorial : Media Indonesia : 8 Eleven Show : Metro Siang : Wideshot : Metro Hari Ini : Suara Anda : Otoblitz : Top Nine News : Mata Najwa : Stand Up Comedy : Metro Realitas

17:00 18:00

04:30 05:30 06:00 06:30 08:30 09:30 10:30 11:00 12:00 14:30 16:00 16:30 17:00 18:00 22:00

: Reportase Pagi : Islam Itu Indah : Makna Kehidupan : Insert Pagi : Buah Hati : Ala Chef : Ngulik : Insert : Bioskop Indonesia : Sketsa : Insert Investigasi : Reportase Sore : Lolly Love : Indonesia Mencari Bakat : Bioskop Trans Tv : Four Brothers 01:30 : Bioskop Trans Tv : Wasabi

06:30 07:30 08:00 08:30 09:30 10:30 11:30 12:00 12:30 13:30 14:30 15:00 15:30 16:00 16:30 17:00 17:30 18:00 19:30 20:00 22:00

: Redaksi Pagi : Selebrita Pagi : RAN : Gak Nyangka : Spotlite : Warna : Redaksi Siang : Selebrita Siang : Si Bolang : Dunia Binatang : Brownies : Tau Gak Sih : Jejak Petualang : Orang Pinggiran : Redaksi Sore : Bukber : Orang Pinggiran : Hitam Putih : On The Spot : PAS MANTAB : Bukan Empat Mata

07.30 08.00 08.30 09.00 10.00 11.00 11.30 12.00 13.00 13.30 14.00 14.30 15.00 15.30 16.00 16.30 17.00 18.00 19.30 20.30 21.30 23.30 00.00 00.30 01.00

: Perempuan Hebat : Selebriti Punya Story : Seleb @ Seleb : KLIK! : Guyonan : New Friends : Topik Siang : Wooow : Seleb Tolong Dong : Lulu Vroumette aka Lulu Zipadoo : Panda Fanfare aka Kung Fu Panda : Mr Bean : Tom & Jerry : Curious George : Mr. Bean : Topik Petang : Suka-Suka Nizam : Pesbukers : Catatan Si Olga : Mel’s Update : Sinema Spesial Basahhh : Cakrawala : Topik Malam : Lensa Olahraga Malam : Fenomania

Acara TV bisa berubah sewaktu-waktu tanpa pemberitahuan.



3:55 PM

Page 1










Anda mau blajar stategi aman trading forek profit 10%/mgu s/d 50%/bln? Training Gratis. Sms “ fx, nama, kota,email” Ke 0818-911900

Penerbit buku cuci gudang. Ratusan judul fiksi, agama, dll. hanya 5rb/eks. kondisi 100% bgs. msh diplastik. Melayani partai bsr & proyek. Hub: 021-32373737





Prgrm PlatIhn U/Cpt krj di Hotel & Kpl Pesiar Eropa-USA, Inc ±2500 US$/bln P/W min. SMU/ Sdrjt-S1, min19-35th, Ing Pasif, PT.CIN, Tarumanegara No.37-39 Ciputat T: 021-74701515/ 71234190/ 71488393/ bb: 293E207E

PJTKI terp’caya bth bbrp tkw ut ngr Malay, S’pur,H’kong, Taiwan & Timur Tngh. Prs cpt & mdh. 081389799515 – 085779795561 (Ibu Ria)

BUTUH CEPAT 30 SPG/ SPB, 20Staff Promo, 10TL, pnmpln mnrk, kmnktf, Max 28thn, Min SMA. salary Gapok+Bonus. Domisili bekasi/ jaktim Hub: Rafi 02191821022 / PIN 225D8BEC.


Buka lowongan u/Big event: SPG/B.Team Leader, Min: SMA, Max 28th,100–300rb/hr Up: Rachel (081393256071/ pin:23725137) B17484-03-30(01/04)

Kerja paling enak di rumah!Pasang benang teh upah 350 rb/hri/5 box,50 box 3,5jt,+uang bulanan pak WARMAN 082116334684-085716770265 B17248-27-30(28/03)

ADA BAGIAN Ngelem Benang Teh Dirmh. 1 Box Upah 70Rb, 50Box 3,5Jt + Dpt Uang Bulanan. 50Rb s/d 600Rb. Hub. Bu HIKMA. 087886620358-91941381 AM5429-27-30(28/03)

COZY SPA KELUARGA, mencari Terapist & Reception. Wnt/pria min SMA-D3. max 30 Thn. Gaji ( 2,5 jt - 3 jt) Kir CV ke Ruko Tol boulevard F-26. Jln Pahlawan seribu BSD./ 021-70081185


PJTKI RESMI & BENAR mbthkan TKW Taiwan, Singapur, Malaysia, Hkong, A Dabi, Qatar. Prss Kami Lbh Cpt Aman Hub. Harry Jl. Psr Mnggu 42 T 0818750994 & 081210578877 AM5430-28-30(29/03)


PAKAIAN Ahli Kaos Promosi, Pilkada & Parpol mUlai 5000 Hyget, PE, TC, Cattun, Polo shirt, Kemeja, Topi, Rompi, Jaket, Training, Bendera, 021.7075 700008568897000- 081288699250

Mengundang 1000 Mitra Bisnis u/ Simpanan Haji Plus prtama di indonesia, peluang umroh grtis tahunan, peluang haji plus dlm 3th penghasilan puluhan smp ratusan jt. Presentasi Prdana Kamis 28 Maret Pkl : 14.00-16.00wib registrasi hub : 33394172,33394173,33394174” AM5487-23-07(29/03)

PAHAMI Dulu RESIKOnya.HIGH GAIN HIGH RISK.Itu Prinsip Dasar Trading Di FOREX & GOLD.Report Dikirim.Info Hub. 021-99653673

“Butuh 1000 mitra pmasaran mandiri u/ simpanan haji plus, bnefit peluang umroh & haji Plus grtis dlm 3th, pnghsln rtusan juta/bln. Syrt :1. brjiwa wirausaha, 2. orientasi pd pnghsln, 3.trbuka u/ umum. Ikuti program haji plus pintar dng kami ! dftr skrg jg ! Legal & bkn MLM Hub: 08138185700/ 081288627000“



Ada Sewa kantor Murah dgn Gratis Domisli, forwading, bbs 3in1, fslts lgkp, fully furnshed & bantu pengurusan legalitas PT/CV. Hubungi 0812 8002 1918

"Dapatkan bantuan dana dr Program CV. Bintang Kelapa. Kirim nama dan alamat lengkap ke 087838431550"



Need: Sales bidang CCTV pengalaman & punya motor pribadi. Intrvw: Rasuna Said, Gd.Palma One Lt.9,910 Kuningan. Ph: 5278333 B17260-09-30(07/04)

CV MILEINDO C.P-Bth Arsitek, Interior Designer D3/S1. Pglm 1-3th, Tlp: 021-29070087. Krm CV & por

Bth cpt mrktg property Pria/Wnt Wilyh Sarua Pamulang, Pny Motor Sndri Min SMA/Pglmn,Ada Gaji Komisi& Bonus, dtg lgsg bw Lmrn cv Ke Ruko Tmn Jeruk Intercon Jl.Meruya Ilir Ry Blok AIX/16 Jakbar (jam kerja) Hub Dirka:99829061 /0819329602 86







Extra Income 3-5jt/bln utk IRT yg paham internet. Daftar di B17292-21-15(04/04)

Belajar Menjadi Traders SUKSES. Workshop GRATIS Stiap Hri. Manajemen Resiko Dan Keuntungan Yg Baik Dlm Brtransaksi Di Forex Dan Emas. Daftar Nama Anda dan Sms Ke: 0812882 82012-081510191842 AM5460-15-30(13/04)



PENDIDIKAN UJIAN PERSAMAAN/Konversi. Pkt B/C Akta-4, D3, S1, S2, S3 smua fakultas. Resmi, cpt wisuda, biaya diangsur T: 021.9602.0009/ 0852.5556.4971 AM5438-06-30(04/04)

PENGOBATAN SPESIALIS VITILIGO Obat Kulit Belang Bintik Putih Normal Kembali Rp. 350Rb Per Paket Hub: 021 95175685, 085216077601 P06045-23-30(24/03)


PROPERTI JAKARTA PUSAT APARTEMEN DIJUAL Dijual Apartemen Boulevard Tanah Abang Lt 18, furnish, unit bersih, 1 KT, 1 KM. Hub. 081314340249 AM5478-20-30(18/04)




BOGOR TANAH DIJUAL Di jual tanah SHM 5000m Kav.Kejaksaan, Tonjong. Bogor. Hub : 08179851170/ 081280237823 AM5493-26-30(24/04)




Dijual RmhKomp.Pertamina P.Gebang Lt.338/Lb.160,Huk,hadap timur,SHM, Siap huni,Tanpa perantara Hub. 021745 7972 / 0817 8189 32

Dijual/sewa Rmh kos 10kmr+2Pav, Lt.250m (Pggr jln). Jl.Pembangunan /+150Mtr ke RS.U Dr.Slamet Grt. 081945360247-085286886027


BEKASI RUMAH DIKONTRAKAN Rmh LT 135m2 LB 90m2 KT 3 KM 2. Keamanan 24jam, Rmh Baru, Air Jernih, CCTV. Perum De Sanctuary Blok A_8, Jl. Kemangsari Ry, Kel. Jt Makmur, Kec. Pdk Gede Dekat Pintu Tol Jati Bening. Tel. 085312939600/ 081310798935/ 0218478138. Hrg Nego AM5463-15-30(13/04)

Referensi Iklan Baris & Kolom

DIJUAL rumah baru luas 123,19M2 ukr 12,7m x 9,7m., jl raya lenteng agung Gg h.harun no1 Rt 16 rw 5 jaksel.telp 83705285


TOUR & TRAVEL BALI FREE EASY 3D2N 478rb, Hotel bintang 3 / setara. Tersedia berbagai hotel seluruh Indonesia. Buka 24Jam. Hubungi: Laena Tour 021 - 8356660

Informasi Pemasangan Iklan


UCAPAN TERIMAKASIH ATAS TERKABULNYA DOA “Novena 3 X Salam Maria” B17279-20-07(26/03)

0819 9090 0919 0815 8469 6014

021 9898 7386 021 7112 3449



3:58 PM

Page 1




Informasia | RAGAM

Sejak Kapan Tusuk Gigi Dipergunakan?


usuk gigi meski remeh tapi sangat penting bagi seseorang. Apalagi dengan keadaan gigi yang berlobang, tusuk gigi sangat diperlukan. Tusuk gigi berupa sebatang kayu atau plastik yang digunakan untuk menyingkirkan sisa-sisa makanan dari gigi, biasanya setelah makan. Biasanya tusuk gigi biasanya mempunyai satu atau dua ujung yang tajam untuk disisipkan di antara gigi. Dan, alat ini ternyata juga dijadikan komponen dari pisau Swiss Army. Lalu, sejak kapan alat ini dipakai manusia? Tusuk gigi telah ada selama ribuan tahun, mungkin sebagai alat tertua untuk membersihkan gigi. Tusuk gigi dikenal di semua budaya. Sebelum sikat gigi diciptakan, orang membersihkan giginya dengan kayu pembersih gigi yang keras maupun lembut. Tusuk gigi yang terbuat dari perunggu telah ditemukan di antara barang-barang yang dikuburkan dalam makam-makam pra-sejarah di Italia Utara dan di Alpen Timur. Tusuk gigi juga dikenal luas di Mesopotamia. Konon sang tiran Agatokles dibunuh pada 289 SM melalui racun yang bekerja lambat, yang ditaruh oleh seorang budak kesayangannya pada sebatang tusuk gigi. Ada contoh-contoh tusuk gigi yang artistik dan halus dari bahan perak di zaman kuno, atau dari kayu mastis di kalangan bangsa Romawi.

Pada abad ke-17 tusuk gigi dianggap barang mewah yang setara dengan perhiasan permata. Mereka dibuat dari logam mulia dan dihiasi dengan batu-batu berharga. Seringkali mereka dibuat secara artistik dan dilapisi email. Kini, dengan kemajuan ilmu kedokteran gigi modern, penggunaan tusuk gigi agak ditolak, dan alat-alat bantu lainnya seperti benang gigi dan sikat gigi lebih disukai. Namun karena terobosan mutakhir dalam teknologi rasa, tusuk gigi tetap populer di kalangan banyak orang. Negara bagian Maine di Amerika Serikat adalah produsen utama tusuk gigi. Di Korea Selatan, untuk mendorong orang agar lebih ramah lingkungan, beberapa perusahaan menciptakan tusuk gigi yang dapat dimakan. Tusuk gigi ini dibuat dari ubi jalar, tampak jernih dan melunak perlahan-lahan apabila terkena air panas. [CW3/dari berbagai sumber]

Si Digital - 26032013  

Si Digital - 26032013

Read more
Read more
Similar to
Popular now
Just for you