Page 1







PÁG. 13


PÁG. 11

PÁG. 4


15 25 70 22


PÁG. 15

EDITORIAL Viernes 02 de diciembre de 2011



No escatiman en la proyecciรณn, sin importar el canal de televisiรณn, la frecuencia de radio o la pรกgina de internet (...)




X LAS CALLES Viernes 02 de diciembre de 2011





Los vecinos limpiaron el camellón de la Avenida Concepción, pero el ayuntamiento no recoge los desechos.

En el Clúster 13, al parecer el ayuntamiento ya “limpió” el lote baldío.

Por las noches, sigue el robo de tubería de cobre, por lo que algunos han optado por el plástico.




Trabajadores que arreglaban las banquetas cerraron la calle, pero no pusieron señalamientos.

;VKH]xHUVJVTLUaHIHUSHZÄLZ[HZWHtronales y el lunes ya se observaban los estragos del alcohol.

La imprudencia de los conductores ocasionó éste choque justo afuera de la gasolinera.










El que nos atendió ahora nos dijo que apenas nos conocía... esa no es la respuesta que queremos Manifestante de La Gigantera

GRILLA Viernes 02 de diciembre de 2011


Esperan que la Procuraduría actúe

El caso de Antonio Tatengo y el ex tesorero, sigue vigente Por Víctor Hugo Ornelas


e han cumplido casi dos años desde que el actual gobierno municipal presentó una serie de demandas en contra de ex funcionarios de la administración que les antecede, sin embargo, hasta ahora la

respuesta de la procuraduría ha dejado mucho que desear. Las únicas que lograron mayor avance fueron las que se interpusieron en contra del ex alcalde Antonio Tatengo Ureña y el ex tesorero, Carlos Romero Chávez, ya que ambas tuvieron como resolución una orden de embargo de bienes; en el caso de Romero Chávez, se sumó también una orden de aprehensión, misma que actualmente se encuentra vigente. Debido a un error del ConJUHVR HQ HO Q~PHUR GH R¿FLR J con el cual envió el comunicado, la parte acusada pudo interponer un amparo que les concedió la suspensión del embargo de bienes, situación que ha retrasado “El hecho de que Tlajomulco pueda comenzar a recuperar el desfalco del que fue objeto”, mencionó el secretario general del ayuntamiento.

Además declaró, “La situación está en manos de la procuraduría, en el caso del ex tesorero, se le había concedido una suspensión, pero ya no tiene protección de la justicia federal, nada impide que la procuraduría haga su trabajo”. El secretario señaló que confían en que antes de que la actual administración concluya, pueda darse alguna noticia importante al respecto, pero lamentó que sea tan complicado hacer que un funcionario corrupto pague, “Se dictó la orden de d aprensión, que todavía paso la posibilidad de defenderse, que q ya culminó el amparo y que no n esté detenido, evidentemente el resultado es que es muy complicado meter a un funcioc nario a la cárcel”. n Cabe recordar que el juicio que q se sigue obedece a las irregularidades encontradas en g la cuenta pública del 2008, a la TXHVHVXPDODQRWL¿FDFLyQGHO T Congreso de la cuenta pública C del d 2009, en la que el adeudo asciende a 347 mdp. a

Fueron 7 denuncias presentadas en 2010 170 millones en la deuda pública del 2008

Discriminación pública Las personas con capacidades diferentes batallan en los LKPÄJPVZW‚ISPJVZ Por Mario G. León Irónicamente en estos días se realiza el Teletón en nuestro País, donde se promueve la solidaridad y el apoyo a las personas con capacidades diferentes, sin embargo a muchos rincones de México pareciera que ese tema no llega; podemos observar en diferentes lugares y situaciones, que quienes conforman esta parte de la población, además de padecer alguna discapacidad, tienen que lidiar día con día con algo más difícil, la discriminación. Esto se puede observar claramente en cualquier lugar, también de nuestro Municipio, ya que a diario podemos ver ciudadanos con capacidades diferentes en busca de una oportunidad de trabajo, obviamente sin tener éxito. De igual forma, en las escueODV R HGL¿FLRV S~EOLFRV \ GH gobierno, se puede observar que no existen las condiciones adecuadas para que es-

tas personas puedan acudir a ellos en caso de que así lo requieran. Como ejemplo de ello, el 28 de noviembre el señor Solís DFXGLyDODVR¿FLQDVGHUHJLGRres del ayuntamiento de Tlajomulco, donde resulta de lo más complicado para él subir y bajar tantos escalones, porque no hay otra forma de acceder al lugar, aunque él sólo expresó “Ya estoy acostumbrado, vengo muy seguido”. Es necesario que tanto gobierno como sociedad tomemos conciencia de esta parte de la población, les ayudaríamos más al ser solidarios, creando espacios y oportunidades de trabajo que les permitan vivir mejor y sin discriminación.

frente al Lienzo Charro Sta. María, Tlajomulco de Zúñiga, Jalisco.

Tels. 13 80 01 24 ó 37 98 12 21 Fax: 13 80 01 27




También en Santa Anita:

Ramón Corona 645

ALAMBRE DE PÚAS Tel: 36 86 55 55 36 86 55 54

Viernes 02 de diciembre de 2011



Señalan descarga a cielo abierto en Arvento En la constructora dicen que no, los hechos demuestran otra cosa Por Víctor Hugo Ornelas Si bien en Tlajomulco no tenemos una Villa Panamericana, sí existe el fraccionamiento Arvento, no porque este albergue atletas y deportistas en sus viviendas, sino porque descarga aguas residuales a cielo abierto. Se trata de un un conjunto habitacional ubicado frente a la laguna de Cajititlán, que en su totalidad contará con una urbanización de 200 hectáreas y constará de trece etapas, de las cuales, algunas se encuentran habitadas. Arvento será sede del centro universitario politécnico, además de que presume ser el


“desarrollo más equipado” con iglesia, parques, clínica, mercado, ciclopistas, zona comercial y escuelas, sin embargo, con lo que el fraccionamiento no cuenta, es con una planta de tratamiento que permi-

metros separan a la planta de algunas viviendas

ta tratar sus aguas residuales antes de que sean vertidas en algún canal, colector o arroyo. Y es precisamente uno de los cauces que corre desde la laguna de Cajititlán, pasando por La Calera y Arvento, el que está recibiendo una descarga residual del este fraccionamiento. A un costado de donde se hace la descarga, se encuentra la construcción de lo que será la planta tratadora, que según lo explicaron trabajadores de la constructora, es capaz de recibir una cantidad que oscila en los cien litros por segundo, mientras tanto, argumentaron que el agua se está tratando con una planta provisional, de la FXDO QR HVSHFL¿FDURQ VX FDSDcidad, pero que evidentemente no trata la descarga de las cientos de viviendas que ya se encuentran habitadas. Esto afecta a otros lugares, uno de ellos es una escuela pri-

maria que se encuentra en la localidad de La Calera, ya que a espaldas de la misma corre el arroyo que ahora transporta las descargas de Arvento, aparte, algunos ganaderos de los


alrededores, aseguran que su ganado, se ha enfermado por el consumo de esta agua. Además, una compuerta que fue habilitada del lado del ingreso al fraccionamiento se encuentra cerrada, al parecer por algunas obras que se contemplan en el lugar, pero esto ocasiona que el agua que tampoco se está tratando en la planta de Cajititlán, se quede estancada del lado del arroyo que se conecta con la laguna. En la pasada sesión de Cabildo, el regidor Mario Morales denunció este hecho, por lo que se acordó que se llevaría a cabo una inspección por parte de la dirección de ecología, misma que daremos a conocer en nuestras próximas ediciones, para así determinar si el fraccionamiento incurre en alguna irregularidad y cuál será la intervención de las autoridades municipales.

etapas habitacionales dentro de Arvento

No pierdas tiempo, después será tarde.

Abogados: Lic. Salvador Padilla Alvarado Lic. Víctor Navarro Vázquez Legaliza tus asuntos:


CO DE 40 Diagnóstico y O T COS $1 asesoría nutricional, dieta, tratamiento y acupuntura.

Sucursal Tlajomulco de Zúñiga Ocampo Sur 37, Tel: 37 98 48 47 Horario: Lunes-Viernes: 9 - 3pm y 4 - 8 pm, Sábados: 10 a 2

Rama civil, mercantil, penal, agrario, deudas bancarias López Mateos Nte. #665, Guadalajara, Jal. Tel: 36-16-51-01

Particular: Abasolo Ote. #15, Tlajomulco de Zúñiga, Jal. Tel: 33-11-93-39-66 33-36-26-99-60

¡Nosotros vamos!

LA VENCEDORA III Te ofrece un extenso surtido en carne de res y puerco ◗ Chuleta ◗ Cortes finos ◗ Molida ◗ Bistec

Menudo $20 kilo Servicio a domilicio Juárez #72 Sur Tlajomulco de Z. 379 - 80670 - 80333


Viernes 02 de diciembre de 2011


Reglamento ladrillero a comisiones y estudio, pero serĂĄ lo mĂĄs que podrĂŠ hacer, aunque confĂ­o en el trabajo que realizan los ediles que integran las comisiones y sĂŠ que lo harĂĄn a la brevedad posible, de acuerdo a la carga de trabajo que cada uno de ellos ya tieneâ€?. ÂżAlgo mĂĄs que desee agregar? “SĂ­, me gustarĂ­a recordar que de manera independiente al avance que tenga el reglamento, el ayuntamiento seguirĂĄ apoyando econĂłmicamente a todos aquellos ladrilleros que deseen reubicar sus talleres a lugares fuera de los centros de las poblaciones, ademĂĄs del apo\RSDUDTXHPRGLÂżTXHQVXVPpWRGRVGH fabricaciĂłn. Con estas medidas que se han implementado en coordinaciĂłn con la DirecciĂłn de PromociĂłn EconĂłmica, esperamos que de manera gradual mejore el entorno ambiental sin afectar esta importante actividad para Tlajomulcoâ€?.

Se presentĂł para su estudio y en su caso aprobaciĂłn Por Mario G. LeĂłn En la sesiĂłn de cabildo celebrada el dĂ­a 29 de noviembre, fue presentado por el Director de EcologĂ­a y Medio Ambiente municipal, el Ingeniero Salvador =DPRUD=DPRUDXQRÂżFLRSDUDSRQHUD consideraciĂłn del pleno, el estudio de reglamento aplicable a la autorizaciĂłn y operaciĂłn de ladrilleras en el Municipio de Tlajomulco. Al respecto, se le preguntĂł al Ingeniero Zamora en quĂŠ consistĂ­a el documento propuesto; de lo cual respondiĂł “Transformar la realidad ecolĂłgica del Municipio no se lograrĂĄ de la noche a la maĂąana, por eso es necesario reglamentar una actividad tan importante para Tlajomulco como lo es la fabricaciĂłn de ladrillo y teja para dar seguridad, tanto a los productores como a los

habitantes, de que sĂ­ es posible tener XQD VDQD FRQYLYHQFLD WHQJR FRQÂżDQ]D en que sea revisado y ampliamente discutido en las comisiones edilicias para poder implementarlo a la brevedad posible, con todos aquellos elementos que aq los regidores puedan pued enriquecer lo propuesto por un serv servidorâ€?. ÂżDe quĂŠ trata el reglamento? “Son varios tem temas que se abordan, como saber en dĂłnde y cĂłmo podrĂĄn operar las ladrilleras, pero para mĂ­ resu resulta fundamental que desde el mismo reglamento se remis conozca a es esta actividad como un ĂĄrea primor primordial para Tlajomulco y establecerla establecer como prioritaria para el otorga otorgamiento tanto de estĂ­ estĂ­mulos ÂżVFDOHV FRPR SU SURJUDmas que ayuden a su WHFQLÂżFDFLyQ´ ÂżNos pudiera adelanad tar algo sobre dĂłnde y dĂł cĂłmo operaran? “Lo o que se plantea plantea en ell reglamento reglamentto son GDWRV GD DWRV PX\ HVSHFtÂżHVS SHFtÂżcos, pero an antes ntes de comentar algo de lo propuespro opuesto, recalco recalcco que sigue en n estudio y podrĂĄ ser PRGLÂżFDGR PRGLÂżFDGR DQWHV GH DSURbarlo, quitando q o agregando lo que los l regidores consideran conveniente, con nveniente, pero entre otras cosas, establece que c deberĂĄn deberĂĄ ĂĄn instalarse fuera de las zonas zon nas protegidas o de preservaciĂłn, preserrvaciĂłn, de acuerdo a los planes pllanes parcia-

les, fuera de los zonas urbanas –conservando las ya existentes- a mĂĄs de 3 kilĂłmetros del aeropuerto y 300 metros de cuerpos de agua, entre otras cosasâ€?. ÂżAdemĂĄs de la ubicaciĂłn, tendrĂĄn algĂşn otro requisito? “Claro, como cualquier otra empresa, deberĂĄn contar con su dictamen de uso de suelo, estudio de impacto ambiental y licencia municipal, para obtenerlos es necesario la supervisiĂłn de protecciĂłn civil y apegarse a los planes parciales y en lo general al Programa Municipal del Desarrollo Urbano. ÂżTambiĂŠn habla de alguna sanciones para quien incumpla? “Los reglamentos asĂ­ deben elaborarse, de otra manera las obligaciones establecidas podrĂ­an cumplirse o no segĂşn y se trata de que aplique para todos, y aunque ya se establecen algunas en el reglamento propuesto, aĂşn estĂĄn por GHÂżQLUVHSXHVFRQVLGHUR GHÂżQLUVHSXHVFRQVLGHUR que esta parte en particular pueda ser la que PiV PRGLÂżFDFLRQHV PRGLÂżFDFLRQHV sufraâ€?. ÂżPara cuĂĄndo se estima que podrĂĄ ser aprobado? “Los tiempos dependen de los regidores, yo estarĂŠ en contacto con cada uno de ellos para impulsar su revisiĂłn

“Transformar la realidad ecolĂłgica del Municipio no se lograrĂĄ de la noche a la maĂąana, por eso es necesario reglamentar una actividad...â€?

Viernes 02 de diciembre de 2011



Congreso Municipal del PT e Informe del Regidor

Ă“scar Ernesto Pacas

El pasado 19 de noviembre se llevĂł a cabo satisfactoriamente el Congreso Municipal del Partido del Trabajo, en esta Cabecera Municipal, donde se FRQWy FRQ XQD JUDQ DĂ€XHQFLD de asistentes militantes del partido, encabezada por el regidor Ă“scar Ernesto pacas PeĂąa dirigente municipal del PT, quien presentĂł un informe de actividades como Regidor de este H. Ayuntamiento AdministraciĂłn 2010-2011. AdemĂĄs de realizar la elecciĂłn de los nuevos miembros de la ComisiĂłn Ejecutiva y Coordinadora Municipal del PT de Tlajomulco entre ciudadanos de las diversas delegaciones del municipio, tales como: C.P. AdriĂĄn

Sandoval; C. Ivette Pacas; Lic. JosĂŠ Guadalupe Ruiz; Lic. Hay de Villalobos; C. Pablo Figueroa; C. Gabriela Guevara; C. Rigoberto VĂĄzquez; C. Brenda Esquivel; C. Enrique Toledo; C. Patricia Barrera; C. Juan Carlos GarcĂ­a; C. Mario mancillas; C. Manuel Moya; C. Antonio Barrera; C. Juan Gabriel GuzmĂĄn; JosĂŠ Manuel GĂłmez y Gonzalo GĂłmez AlarcĂłn, entre otros. “En estos 23 meses de gobierno, como Regidor del Municipio de Tlajomulco, considero plenamente haber cumplido con el gran compromiso que adquirĂ­ con la ciudadanĂ­a. Ese compromiso de trabajar por com el Municipio, sin pretextos, ni M distinciones de orden territodist rial o polĂ­tico. No ser un partido excluyente sino mĂĄs bien un e partido interesado en involupar crar cra tanto a mujeres y jĂłvenes, y ve ver por las necesidades de todas las localidades del Municipio, pio en el cual orgullosamente nacĂ­ nac y vivo. De igual forma, sin hacer hac distinciĂłn de colores, lo cual cua anteriormente era comĂşn en nuestro Municipio. Mi compromiso de trabajo, jo es sĂłlo el de las mejoras del d Municipio, por lo tanto, mĂĄs m allĂĄ de ser un representtante de partido adquiero mi ccompromiso como repressentante del pueblo. Por mi parte, las gestiones n han sido muchas y el trabajo ba ha sido arduo, pero esta carga me enorgullece y me ca rreconforta a seguir trabajando para aspirar a un Tlajomulco mejor. Dentro de las iniciativas presentadas en mi funciĂłn legislativa, algunas, como lo es la del centro de desarrrollo infantil en Lomas del Sur (CENDIS), son un logro S y motivo de orgullo. Y sigo

impulsando porque se vea reÀHMDGR HVWH SUR\HFWR TXH GDUi atención a 1,200 niùos aproximadamente, esto a travÊs de que como partido gestionamos una partida de $20 millones GHSHVRVHVWRSRUXQEHQH¿FLR educativo para la comunidad. Otro gran acierto por nuestra parte, que hemos compartido con este gobierno de coalición, es el bajarnos el sueldo en pro de la educación, generando como resultado el que se pu-

diera hacer la entrega de Ăştiles y uniformes en las escuelas del 0XQLFLSLREHQHÂżFLRSDUDWRGRV los bolsillos de los ciudadanos. Por mi parte, siempre existirĂĄ el apoyo incondicional hacia los comerciantes, en pro de la generaciĂłn de empleos y asĂ­ solventen sus necesidades familiares ante la presente crisis.

Como nuestros principios en el Partido del Trabajo, son las luchas sociales, dimos todo nuestro esfuerzo para darle el apoyo a las cooperativas, tales como la de mototaxis en Santa Fe, por mencionar una. Y dejarÊ en claro que siempre apoyarÊ el cooperativismo, para fortalecer la economía del municipio�.

Regidor Ă“scar Ernesto Pacas PeĂąa

El CapitĂĄn con un nuevo sabor.

Estamos solicitando cocinero en mariscos y meseros(as) Presentarse en el domicilio con solicitud elaborada SERVICIO A DOMICILIO

TEL: 37 98 03 54 En Avenida Pedro Parra Centeno No. 121 Tlajomulco de Zúùiga, Jalisco. A un costado de la clínica municipal

MUNICIPIO Viernes 02 de diciembre de 2011


AsĂ­ ve Enrique Alfaro su gestiĂłn

Entrevista exclusiva con el presidente municipal de Tlajomulco con motivo de su segundo informe de gobierno Por M Mario G. LeĂłn “Gracias al puebl pueblo de Tlajomulco por haberme dado esta oportunidadâ€?, con estas palabras culminĂł una llarga entrevista concedida a este medio de informaciĂłn, en la cual se abordaron abordaro temas de interĂŠs general, que g normalmente no normal son tocados en t los tradicionales informes de gobierno.

“Gracias al pueblo de Tlajomulco por haberme dado esta oportunidad�

Frente al antiguo retorno Amortiguadores Distribuidor



La actual administraciĂłn municipal llegĂł al poder con inusitadas expectativas, fruto de promesas de campaĂąa que, de cumplirse, cambiarĂ­an la historia de Tlajomulco. Dos aĂąos despuĂŠs, el alcalde nos comparte los retos que ha logrado superar, “El mĂĄs importante: reconstruir al gobierno de Tlajomulco (‌), ahora tenemos un gobierno que sĂ­ responde a la realidad de Tlajomulco, un gobierno a la altura de los retos que presenta nuestro Municipioâ€?. Sobre los logros obtenidos mĂĄs importantes agregĂł: “Para mĂ­, un logro trascendental es haber mantenido y acrecenWDGR OD FRQÂżDQ]D GH OD JHQWH caminar por la calle y recibir palabras de apoyo, aunque tambiĂŠn peticiones y quejas de cosas que aĂşn estĂĄn por arreglar. Y un logro muy importante es que he cumplido prĂĄcticamente todos los propĂłsitos que QRVWUD]DPRVFRPRDJHQGDGH gobierno, es decir, todo lo que dijimos que Ă­bamos a hacer, en dos aĂąos estĂĄ prĂĄcticamente concluidoâ€?.

MĂĄs allĂĄ de detallar la inversiĂłn en el Municipio, nos interesamos por conocer cuĂĄles considera que serĂĄn las obras que tendrĂĄn mayor impacto en la vida del municipio, seĂąalĂł que le resulta difĂ­cil saberlo, pues han sido de diferente naWXUDOH]D DOJXQDV GH HOODV LPpactarĂĄn la movilidad urbana, no sĂłlo de Tlajomulco sino de WRGDOD]RQDVXUGHOD=RQD0Htropolitana, “Pero viendo todo esto con mĂĄs calma, ya no sĂŠ bien si en tĂŠrminos de impacto, tengan mĂĄs impacto estas grandes obras o aquellas pequeĂąas que transforman radicalmente la vida de una comunidad, como el ingreso a Los Ranchitos, pues es una de las obras que mĂĄs orgullo me han dado entregar, que mayor satisfacciĂłn me han dejado, por lo que representa para quienes ahĂ­ vivenâ€?.

“Ahora tenemos un gobierno que sĂ­ responde a la realidad de Tlajomulcoâ€?

PARA EL TERCER AĂ‘O ReconociĂł que el resto de su administraciĂłn habrĂĄ muy poca inversiĂłn, enfocando todo HO HVIXHU]R D FRQVROLGDU ODV obras que ya se han concluido, como por ejemplo, la promociĂłn de CajititlĂĄn como punto turĂ­stico. AĂşn asĂ­, seĂąalĂł “Algunas ya estĂĄn en proceso o se tiene proyectada su construcciĂłn, como concluir las obras de abasto de agua, ProlongaciĂłn 8 de julio, unidades deportivas que quedan pendientes para Buenavista, Lomas del Sur, El =DSRWH &DMLWLWOiQ \ FRQWLQXDU Adolf B. Horn hasta Circuito Sur, ademĂĄs esperamos el arranque de la lĂ­nea 3 del tren ligero, esto se debe al proyecto TXH UHDOL]DPRV HQ HO TXH QRV propusimos concentrar la mayor obra pĂşblica posible para los dos primeros aĂąosâ€?.


La transformaciĂłn de la administraciĂłn pĂşblica, ha traĂ­do consigo un incremento signiÂżFDWLYR HQ OD QyPLQD OR TXH podrĂ­a comprometer el presupuesto de futuras administraciones, al respecto dijo: “No, cuando digo que tenemos un gobierno que responde a la realidad de Tlajomulco, tambiĂŠn PHUHÂżHURDHVRHOWDPDxRGHO gobierno se ha ido ajustando en base a la presiĂłn que tenemos para prestar los servicios que se le deben a la comunidad (‌), no tenemos un gobierno pesado o una burocracia excesiva, todavĂ­a nos falta personal operativo, no crecimos en directores y secretarias, crecimos en personal de mantenimiento, policĂ­as, agua potable, doctores, es decir, crecimos en los servicios S~EOLFRV KR\ ODV ÂżQDQ]DV GH Tlajomulco estĂĄn sanasâ€?.




Al tĂŠrmino de la entrevista, el mandatario enviĂł un mensaje a todos los tlajomulquenses, el cual podrĂĄ leer de manera Ă­ntegra en la prĂłxima ediciĂłn, asĂ­ como otros temas abordados en esta entrevista con el presidente municipal Enrique $OIDUR5DPtUH]FRPRODGHXGD pĂşblica adquirida durante su administraciĂłn, los fraccionamientos, su posible licencia y varios mĂĄs.


Viernes 02 de diciembre de 2011


Llantas por ĂĄrboles

DĂ­as de caos

Se busca evitar mĂĄs contaminaciĂłn y mejorar el medio ambiente


n promedio de cuatro mil llantas inservibles se recolectan mensualmente en todo Tlajomulco, que son intercambiadas por ĂĄrboles, con una productora de cemento, que las convierte en combustible para sus hornos, con lo que se busca convertir a este Municipio en el primero libre de neumĂĄticos inservibles.

“Se meterĂĄ en cintura a las que no estĂŠn registradasâ€? “Las llantas, por su contenido de hule, acero y pintura, son uno de los desechos mĂĄs contaminantes y peligrosos que generamos, ademĂĄs de que tardan mayor tiempo en degradarse,

por lo que es de vital importancia que no se tiren en las calles o “siembrenâ€? en lotes baldĂ­osâ€?, comentĂł el titular de la dependencia de aseo pĂşblico, quien coordina la recolecciĂłn del programa elaborado por la direcciĂłn de ecologĂ­a. De igual forma, hace un llamado a la poblaciĂłn y llanteras, p para que no las desechen eche en

cualquier lugar, sino que llaPHQDODRÂżFLQDGHDVHR PHQDODRÂżFLQDGHD pĂşblico del ayuntamiento ayuntamie para que pasen por ellas, ellas sobretodo en estas fechas fec porque, “Viene la ĂŠpoca decembrina decemb cuando los jĂłvej nes hacen fogatas fog con llantasâ€?.

CarnicerĂ­as Mary I y II JesĂşs MartĂ­n Pacas PĂŠrez

Los mejores cortes de carnes selectas

ConstituciĂłn No. 53 Tel: 37-98-04-99

estacionados de las demĂĄs callesâ€?, mencionĂł un agente de vialidad que la tarde del lunes se dedicĂł a organizar el trĂĄnsito en la calle Vallarta, la cual se habilitĂł como ingreso y salida de Tlajomulco cabecera hacia carretera a Santa Fe. Y es que fue necesaria la Por VĂ­ctor Hugo Ornelas intervenciĂłn de un agente vial durante los dĂ­as lunes y mar(O ÂżQ GH VHPDQD SDVDGR tes para tratar de disminuir fue completamente desastro- XQSRFRHOFRQĂ€LFWRYHKLFXODU so para los automovilistas que que ocasionĂł este cierre, al circularon en las calles de la parecer sin estrategia. cabecera municipal, la calle ConstituciĂłn fue cerrada para “Yo no sĂŠ cĂłmo un efecto de algunas obras, sin embargo, ante la falta de seMunicipio se pone a Ăąalamientos que indicaran el cerrar su calle mĂĄs uso de vĂ­as alternas, los automovilistas optaron por buscar importante y no pone una salida entre las calles aleseĂąalamientos...â€? daĂąas, circulando en sentido contrario y generando largas ÂżODV GH YHKtFXORV RFDVLRQDQdo que el trĂĄnsito vehicular se colapsara. El hecho generĂł molestia en los conductores y en los vecinos de estas calles, que ademĂĄs del ruido de los vehĂ­culos y sus claxon, tuvieron que tolerar que algunos camiones invadieran la banqueta y circularan sobre ellas algunos metros para poder pasar, “Yo no sĂŠ cĂłmo un Municipio se pone a cerrar su calle mĂĄs importante y no pone seĂąalamientos ni retira los vehĂ­culos

El desorden vehicular molestĂł a vecinos y visitantes de la cabecera

Por Jorge LĂłpez

Degollado No. 3 Tel: 37-98-52-43

en Tlajomulco de Zúùiga, Jal.

El funcionario, quien al parecer ya resolviĂł el problema de la basura en el Municipio, ahora se avocarĂĄ a otras funciones aunque no son de su competencia, ya que adelantĂł que iniciarĂĄn una revisiĂłn de WRGDVODVOODQWHUDVDÂżQGHFRrroborar que tengan su licencia municipal y el dictamen de la SEMADES (SecretarĂ­a de Medio Ambiente y Desarrollo Sustentable), que cumplan con los requisitos indispensables y deWHUPLQDUHOGHVWLQRÂżQDOGHORV neumĂĄticos que desechan, por lo que “Se meterĂĄ en cintura a las que no estĂŠn registradasâ€?. Es de seĂąalar que las llanteras cobran 40 pesos, por aceptar una llanta inservible, de las cuales muchas terminan en la vĂ­a pĂşblica.

Por una carga de llantas, el Municipio recibe 2000 ĂĄrboles.



Renta de Rockolas con Karaoke y videos para tus eventos y fiestas

Informes (Cel): 33-10-67-53-21


Viernes 02 de diciembre de 2011

Ya no mĂĄs

funcionarios en su colonia, a efecto de emitir un diagnĂłstico GHORVSUREOHPDVTXHHQHOODVH SUHVHQWDQ\GHWHUPLQDUODIRUPDVHOHVDSR\DUiSRUVXSDUWH los vecinos aseguraron que en el caso de que las autoridades PXQLFLSDOHV QR FXPSODQ FRQ HO DFXHUGR FHUUDUtDQ HO SDVR vehicular de la avenida Adolf %+RUQFRPRPHGLGDGHSURtesta. Cabe seĂąalar que de los once funcionarios que atendieron a los habitantes de dicha colonia en la sala de cabildo, ninguno FXHQWD FRQ OD DXWRULGDG VXÂżFLHQWHSDUDODWRPDGHGHFLVLRQHVHQHVWHWLSRGHVLWXDFLRQHV HVGHFLUQLQJXQRSXHGHRIUHFHU alguna soluciĂłn a los afectados.

Se manifestaron por sentirse ignorados Por VĂ­ctor Hugo Ornelas Habitantes de la colonia La Gigantera, ya se cansaron de HODERUDU RÂżFLRV FRQ SHWLFLRQHV de atenciĂłn al ayuntamiento FRQ UHVSHFWR DO SUREOHPD GH agua contaminada que enfrentan, lo cual hicieron de su coQRFLPLHQWR KDFH DSUR[LPDGDmente ocho meses.

“Mi hermana de cuatro aĂąos se estĂĄ muriendo porque vivimos en un hoyo que se estĂĄ pudriendo y ustedes no hacen nadaâ€?

Por ello, la maĂąana del miĂŠrcoles, se manifestaron en ODV LQVWDODFLRQHV GH OD SUHVLGHQFLDPXQLFLSDODOUHGHGRUGH 35 habitantes del lugar, quieQHV H[LJLHURQ DWHQFLyQ D HVWH SUREOHPDTXHFDGDGtDVHWRUQD mĂĄs serio. Entre ellos se encontraba la hermana mayor de Valeria 9HQHJDVXQDSHTXHxDGHFXD-



ran que quienes los han atendiGRQRFRPSUHQGHQODPDJQLWXG GHOSUREOHPDTXHSDGHFHQÂł(O que nos atendiĂł ahora nos dijo TXH DSHQDV QRV FRQRFtD OH GLjimos que en 18 aĂąos no han “Los afectados dicen hecho nada (ayuntamiento) y GLMR TXH DSHQDV QRV KDEtD sentirse ignorados...â€? pO conocido hoy, esa no es la resSXHVWDTXHTXHUHPRV´PHQFLRduales. “Mi hermana de cuatro Qy-RVp0LUDQGDUHSUHVHQWDQDxRV VH HVWi PXULHQGR SRUTXH te vecinal de la colonia. vivimos en un hoyo que se estĂĄ Los manifestantes se retiSXGULHQGR \ XVWHGHV QR KDFHQ UDURQ FRQ OD SURPHVD GH TXH nadaâ€?, les reclamĂł entre lĂĄgri- KR\ YLHUQHV SRU OD PDxDQD UHmas la joven. FLELUtDQ OD YLVLWD GH GLYHUVRV Pero Valeria y su familia no VRQ ODV ~QLFDV DIHFWDGDV SRU HVWH SUREOHPD SRUTXH HQ UHFLHQWHVVHPDQDVPiVSHUVRQDV que viven en la Gigantera han HPSH]DGRDSUHVHQWDULUULWDFLyQ\HUXSFLRQHVHQODSLHOHQWUHHOORVXQSHTXHxRGHDSHQDV seis meses de nacido. Los afectados dicen sentirse ignorados o al menos conside-

DELEGACIONES Viernes 02 de diciembre de 2011


Retiran sellos de clausura lizan dentro del polĂ­gono del litĂ­gio.

Algunas se habĂ­an colocado fuera del predio en litigio

La clausura se realizĂł por orden de un Juez que concediĂł suspensiĂłn de plano al ejido por el juicio donde piden el pago de 306 hectĂĄreas expropiadas

VĂ­ctor Hugo Ornelas DespuĂŠs de 16 dĂ­as desde que el ayuntamiento realizara la clausura de las obras que se realizaban en el Aeropuerto Internacional Miguel Hidalgo, el pasado 25 de noviembre fueron retirados algunos de los sellos colocados, debido a la ubicaciĂłn de las obras.

“Lo que tiene que ver con la expropiaciĂłn, tiene algunos vicios jurĂ­dicos pero sobre todo mĂ­nima atenciĂłn y respeto a la comunidad ejidalâ€? TrascendiĂł que la construcciĂłn del World Trade Center (WTC), que habĂ­a sido clausurada junto con la ampliaciĂłn de la aduana, se encuentra fuera del polĂ­gono de las 306 hectĂĄUHDVHQFRQĂ€LFWR AsĂ­ lo explicĂł el sĂ­ndico municipal p del ayuntamiento y Al-

berto Uribe Camacho, “En la informaciĂłn que tenĂ­amos originalmente del polĂ­gono o del terreno en litigio, que son 306 hectĂĄreas, no estaba claro que las obras del WTC estuvieran dentro del mismoâ€?. Ante dicha duda, “El ayuntamiento recurriĂł a una revisiĂłn del terreno donde se llevaban a cabo las obras del World Trade Centerâ€?, determinando que pertenece a un terreno que no estĂĄ en litigio, conocido este como Asturias. En torno al tema del adeudo, la expropiaciĂłn de tierras y la larga espera por parte de los ejidatarios del Zapote, para ver UHVXHOWR HVWH FRQĂ€LFWR HO VtQdico municipal p declarĂł que q el

levantamiento de los sellos de clausura es parte de un actuar responsable de la administraFLyQ\QRLQĂ€X\HQLREVWDFXOL]D una negociaciĂłn entre gobierno y ejido. “La parte importante para nosotros es que sabemos que ya hay una mesa de trabajo entre la SCT y el Ejido, lo que pedimos a la FederaciĂłn es que con toda seriedad analicen las peticiones del ejido del Zapote y arreglen un problema que es muy aĂąejoâ€?, comentĂł Uribe Camacho, ademĂĄs considerĂł que la FederaciĂłn debe tenerle todo el respeto al ejido “Porque lo que tiene que ver con la expropiaciĂłn, tiene algunos vicios jurĂ­dicos, j , pero p sobre todo

mĂ­nima atenciĂłn y respeto a la comunidad ejidalâ€?. Sin embargo el Ejido se pronunciĂł en desacuerdo con la acciĂłn tomado por el gobierno PXQLFLSDO\ODFDOLÂżFyFRPRXQ desacato a la orden del Juez, “Ellos Ellos El llo os no tenĂ­an tenĂ­a an que qu ue delimitar de delimi elimittar zonas, nas, n as, ellos ello os solamente so ola ameent nte te tenĂ­an tenĂ­ teenĂ­a an que ue ejecutar eje ej jeecu cut uta ta ar la clausuraâ€?, cla ausu uraâ€? ra aâ€?, coco omentĂł eentĂł ntĂł el el presidente preeside id deent nte te ejidal eji ej jid ida da al del deel Zapote apote a pote quien qu uieen asegurĂł aseegu urĂł que ue las la as obras obra as del deel WTC TC T C se rea re reaea-

En el último avalúo, el valor de la tierra por metro cuadrado se estableció en $13 ante el descontento del Ejido El adeudo corresponde al Gobierno Federal, el Grupo AerohgjlmYjag \]d HY[¹Ú[g$ ?9H! sólo recibió la concesión

“Lo que pedimos a la FederaciĂłn es que con toda seriedad analicen las peticiones del ejido del Zapoteâ€?

PIZZAS “EL CHINO� De lo bueno, lo mejor...

Contamos con dos nuevos nĂşmeros telefĂłnicos

Tel: 1649 5891 y Cel: 331 399 3648 Pizza familiar + refresco de 2 lt + alitas $184.00 Pizza grande + refresco de 2 lt + alitas $157.00 Pizza mediana + refresco de 2 lt + alitas $122.00 0

AdemĂĄs tenemos: Hamburguesas Papas a la francesa Lonches

Pruebe nuestro original LONCHE PIZZA

Promoción a domicilio sin límite de ingredientes. Visítenos en el Mercado Municipal de Tlajomulco de Zúùiga, local No. 18

Lonches y Hamburguesas

Servicio a domicilio

Viernes 02 de diciembre de 2011



Parece otro

Clausurada Por incumplimiento no permitieron la nueva estaciĂłn de servicio Por Jorge LĂłpez El ayuntamiento de Tlajomulco clausurĂł una gasolinera, ubicada en la colonia La Lagunita, en la delegaciĂłn de San AgustĂ­n, por presentar diversas irregularidades y la intranquilidad del entorno social, lo que habĂ­a provocado manifestaciones de los vecinos. El secretario general del ayuntamiento, informĂł que la instalaciĂłn de dicha estaciĂłn para cargar combustible, era investigada y al concluir que no cumplĂ­a con los requisitos legales, se procediĂł a su clausura. Al cuestionarle si esta decisiĂłn fue resultado de las protestas de los habitantes del lugar, asegurĂł, “Como gobierno siempre vamos a estar del lado de la gente y si un giro no es satisfactorio para la comunidad donde se va a instalar y no cumple con los requisitos legales, vamos actuar de inmediatoâ€?.

“Como gobierno siempre vamos a estar del lado de la gente (‌)â€? A la vez, que tambiĂŠn dejĂł claro, “Tenemos visiĂłn de apertura para la instalaciĂłn de comercios y ser generadores de condiciones para

fuentes de trabajo, pero deben cumplir con la regularidad jurídica y ofrecer tranquilidad al entorno social, en el caso de San Agustín, no se cumplió y por eso la clausura�.

“Cuidamos generar condiciones para que empresarios inviertan en el Municipio, (...) Una de las condicionantes de la paraestatal PEMEX, es que la ubicaciĂłn de las estaciones, no sea en un espacio de concentraciĂłn masiva y ese fue otro requisito indispensable que no se cumpliĂł, “Cuidamos generar condiciones para que empresarios inviertan en el Municipio, pero siempre y cuando no sea fuera de la norma, esa atracciĂłn de capitales siempre debe ser apegada a deUHFKR´VHxDOyÂżQDOPHQWH Es de mencionar que a pocas cuadras donde se ubicarĂ­a hay otra estaciĂłn de carga de combustible que sĂ­ cumple con la normatividad, por lo que no hay riesgo de desabasto en la zona.

Uno de los requisitos para el asentamiento de estos negocios, es que no se encuentre cerca de un centro de concentraciĂłn masiva.

El cambio de Los Ranchitos fue radical, ahora muestra otro panorama Por VĂ­ctor Hugo Ornelas


no de los dĂ­as mĂĄs importantes para la agencia municipal, AcatitlĂĄn, mejor conocida como Los Ranchitos, fue el 29 de noviembre, cuando se inauguraron una serie de obras que le cambiaron totalmente la cara a esta comunidad.

davía no me la creo, salir y ver así es algo que no pensÊ que fuera a pasar�, comentó una de las vecinas de Los Ranchitos, mientras arriaba unas

chivas en una postal llena de contrastes, pero que nos da una idea del cambio tan drĂĄstico y positivo que tuvo esta agencia municipal.

AcatitlĂĄn fue nombrada agencia municipal en


“TodavĂ­a no me la creo, salir y ver asĂ­ es algo que no pensĂŠ que fuera a pasarâ€? El cambio se puede apreciar desde el ingreso a la localidad, que se encuentra a pie de la carretera Tlajomulco – Buenavista, donde la carpeta asfĂĄltica ha sustituido la terrecerĂ­a de un tramo de casi dos kilĂłmetros y medio. AdemĂĄs de la renovaciĂłn del ingreso, se asfaltĂł tambiĂŠn la vialidad interna de los ranchitos, se habilitĂł una red de drenaje, se creĂł una fosa sĂŠptica, se construyeron banquetas y se interconectĂł una red de agua potable a un tanque elevado con el que se abastece a la comunidad. Para los vecinos del lugar, no pudo haber una intervenFLyQ PiV VLJQLÂżFDWLYD Âł7R-

Hacienda Agave te regala una T.V. plana de 32� en la compra de tu casa. FRENTE A LA UNIDAD DEPORTIVA Y A 5 CUADRAS DEL CENTRO

Bugambilia: $750,000 Girasol: $770,000 TulipĂĄn: $850,000 Aproximadamente Diciembre 2011 y Enero 2012 personas habitan VĂĄlido 98 36 83, 37 98 29 42 en esta comunidad Tels: 37Entrada por Vallarta, calle cerrada.


Constitución Oriente 302, Fracc. Hacienda Agave, Tlajomulco de Zúùiga

EL VALLE Viernes 02 de diciembre de 2011


AĂşn no estĂĄ completo

El tramo que corresponde a Tlaquepaque sigue inconcluso Por VĂ­ctor Hugo Ornelas


a inauguraciĂłn formal de la Avenida Adolf B. Horn estĂĄ cada vez mĂĄs lejana de realizarse este 2011, aunque las obras que corresponden al Municipio de TlaMRPXOFR \D VH HQWUHJDURQ \ OD DYHQLGD \D FXHQWD FRQ ORV WUHV carriles prometidos, el came-

llĂłn central se observa sin terminar en lo que corresponde a Tlaquepaque. Tlajomulco realizĂł su entrega de obras el 22 de septiembre en un evento en el que estuvo presente tambiĂŠn el mandatario de Tlaquepaque Miguel Castro, quien asegurĂł que en un plazo de tres semanas, a SDUWLUGHHVDIHFKDVHUHDOL]DUtD la inauguraciĂłn completa de la avenida. Las obras pendienWHV KDVWD HVH PRPHQWR HUDQ ODKDELOLWDFLyQGHOWHUFHUFDUULO \ HO FDPHOOyQ FHQWUDO \D TXH ORV FROHFWRUHV SOXYLDOHV KDEtDQ sido terminados; sin embargo,





,QVXÂżFLHQWHVHUYLFLR PD\RU GHQVLGDG SREODFLRQDO por lo que la oferta de estos servicios mĂŠdicos se ve fĂĄcilmente superada. “Para cualquier informaciĂłn, acuda usted a la SecretarĂ­a de Saludâ€?, respondieron al preguntar Por Jorge LĂłpez VREUHODFDUHQFLD\ODSRFDFDpacidad de atenciĂłn en esta Verdadero viacrucis sopor- unidad mĂŠdica, que pone en tan quienes acuden a consulta HQWUHGLFKR OD YHUVLyQ IHGHUDO al Centro de Salud, ubicado en el sentido de una cobertura en la Avenida ConcepciĂłn en XQLYHUVDO\DWHQFLyQDPpGLFD la zona valle de Tlajomulco, a todos los mexicanos. luego de que personal e inLos usuarios demandan fraestructura son rebasados a la SecretarĂ­a de Salud, que por la creciente demanda que incremente el nĂşmero de mĂŠse registran en esta unidad. GLFR \ DPSOLDU ODV LQVWDODFLREl nosocomio se satura de nes o establecer un Centro de personas, que esperan desde Salud mĂĄs, donde les puedan la 4 Ăł 5 madrugada a ver si EULQGDU DWHQFLyQ VXÂżFLHQWH \ son de los “privilegiadosâ€? en adecuada. Es de mencionar FRQVHJXLU XQD ÂżFKD SDUD SR- que en esta unidad mĂŠdica der recibir atenciĂłn mĂŠdica, WDPELpQ VH DÂżOLD DO 6HJXUR que no lo logran se pasan a los Popular, que igual se forman Servicios MĂŠdicos Municipa- desde la madrugada, por les, en espera de ser atendi- OR TXH VH REVHUYDQ GRV ÂżODV dos. enormes de gente, una para En el Centro de Salud se re- FRQVXOWDV \ RWUD SDUD DÂżOLDparten a diario un mĂĄximo de ciones, por lo es comĂşn que  ÂżFKDV D YHFHV PHQRV  \D alrededor de las 6 de la maĂąaque sĂłlo cuentan con cuatro na este lugar no tenga aspecPpGLFRV\HOKRUDULRGHDWHQ- to de unidad mĂŠdica, sino de ciĂłn es de 8 de la maĂąana a manifestaciĂłn. Y quizĂĄ esto 3 de la tarde, amĂŠn de que el QRWDUGDUiPXFKRHQKDFHUVH SDSHOHRHVPX\WDUGDGR realidad, si la gente no recibe En esta unidad mĂŠdica, que un mejor servicio. depende directamente de la SecretarĂ­a de Salud, tambiĂŠn se registra una carencia en la existencia de vacunas, como ODV GH 1HXPRFRFR H ,QĂ€XHQ]D Âł/OHJDQ KDVWD PHGLDGRV de diciembreâ€?, aseguran las encargadas de su aplicaciĂłn, que por cierto, su trato deja PXFKRTXHGHVHDU Es importante destacar que este Centro de Salud se ubica en una de las zonas con

Esperan para ser atendidos desde la madrugada

DXQTXHVHFXPSOLyHQODKDELOLtaciĂłn del tercer carril en la feFKDQRIXHDVtFRQHOFDPHOOyQ +R\ D GRV PHVHV GH OD SULmera entrega, la Avenida Adolf B. Horn sigue sin ser inaugurada, pero lo que realmente afecta a la ciudadanĂ­a, son las condiciones en la que todavĂ­a se encuentra el camellĂłn en el WUDPR TXH QR KD VLGR LQWHUYHQLGR\DTXHMXVWRHQHVHOXJDU VH UHJLVWUD JUDQ DĂ€XHQFLD GH peatones, debido a que en uno de los costados se encuentra el fraccionamiento Real del Valle, mientras que en otro, un centro FRPHUFLDO\XQFROHJLRFRQSULPDULD VHFXQGDULD \ EDFKLOOHrato, “Vivo aquĂ­ enfrente (Real GHO9DOOH \VHJXLGRYR\DODSOD]D\VtHVWiIHRSDUDFUX]DUPiV SDUD ODV VHxRUDV \ VXV QLxRV cuando los llevan a la escuelaâ€?, comentĂł CĂŠsar Rivera, vecino GHO \D PHQFLRQDGR FRQMXQWR KDELWDFLRQDO TXH DGHPiV FRQsiderĂł que el camellĂłn “Estaba mejor antes de que empezaran DKDFHUREUDV´ Cabe seĂąalar que en la Avenida se colocaron dos semĂĄforos en cruces que resultaban FRQĂ€LFWLYRV OR TXH WDPELpQ TXHKDJHQHUDGRRSLQLRQHVHQcontradas, mientras algunos aseguran que eran necesarios, otros estiman que solamente generan congestionamiento YHKLFXODUDSHVDUGHTXH\D cuenta con tres carriles.

MĂĄs de 60 personas esperan consulta desde las 4 de la maĂąana @Yq\]Ăš[a]f[aY]f vacunas y servicios

Estamos a sus Ăłrdenes con el servicio que usted se merece Paquete 1

Paquete 2

Paquete 3

Pizza familiar. Pizza grande 4 ing. Pizza grande 4 ing.

Con aro de queso. Spaguetti con jamón Nuguets de pollo Orden de pan de ajo. o champiùones 2 refrescos de 500 mL. Refresco de 2 L. 2 refrescos de 500 mL. $150.°°



Paquete 4

Pizza mediana

3 refrescos de 500 mL.


Cel: 33-34-52-67-95 Radio: 92*13*22436

Tel. NEXTEL: 16-60-22-62 Tel. oficina: 37-98-23-56

SAN AGUSTĂ?N 36-86-56-50 36-86-68-83

TLAJOMULCO 37-98-15-62 37-98-17-24

T$(( 2Â? & T Â? 

Visita nuestra pĂĄgina

Viernes 02 de diciembre de 2011



Siguen sin

maestros GHHVWRVHGHGLFDQDJUD¿WHDU\ hacer todo tipo de actos vandålicos, incluso han llegado a robarse las låmparas del plantel�, expreså la entrevistada.

El compromiso de que llegarĂ­an no se cumpliĂł


Por Jorge LĂłpez La tramitologĂ­a y falta de presupuesto ocasiona que alumnos de la Escuela Secundaria TĂŠcnica 170 “Luis Donaldo Colosio Murrietaâ€?, ubicada en la unidad habitacional Santa Fe, no tengan maestros, en detrimento de su educaciĂłn escolar. Para la directora del plantel, Grisela Ayala Cornejo, la situaciĂłn es realmente difĂ­cil, porque que en el presente ciclo escolar, dijo “Nos aumentaron un grupo y aunque algunos de los maestros, con plaza y horario, cubren horas extras, se UHJLVWUD XQ GpÂżFLW GH ´ HVWR para satisfacer la demanda sĂłlo de este plantel, donde se imparten clases a 19 grupos, en cada turno.

Faltan por cubrir: 30 en EspaĂąol 3 de InglĂŠs 10 en MatemĂĄticas 12 de ComputaciĂłn

La directora de la escuela, Grisela Ayala, seĂąala a ĂŠste respecto, “Semanalmente se pintan paredes, bardas y baĂąos, pero de inmediato vuelven DSDUHFHUORVJUDÂżWRV´ La secundaria 170 es la mĂĄs grande de la zona, asegura la directora y lamenta la falta de presupuesto, “Las paredes del HGLÂżFLRVRQGHSOiVWLFRORTXH ocasiona en esta temporada las aulas se conviertan en un refrigerador o en horno en el veranoâ€?.


Por su parte, la Licencia Graciela RuĂ­z, subdirectora del ĂĄrea administrativa de la direcciĂłn de secundarias tĂŠcnicas de la SEP Jalisco, asegurĂł, “Para el primero de diciembre en esta secundaria contarĂĄn con los maestros necesariosâ€?. RechazĂł enĂŠrgicamente que no haya presupuesto para tal efecto y asegurĂł “El departamento de recursos humanos contratarĂĄ a los maestros que aprobaron el examen de

oposición; tambiÊn se darå vista a las propuestas que lleve la directora de la secundaria�, por lo que reiteró que a partir de la próxima semana, ya estarån los maestros laborando.

CONTRATOS POR TRES MESES La directora de la secundaria en Santa Fe, explicĂł “Muchos de los profesores son contratados, pero sĂłlo por tres meses (en lo que llega el nuevo presupuesto), y algunos sĂłlo por tres horas, por lo que debido a la distancia y tiempo que implica trasladarse a Santa Fe, algunos optan por ir una o dos veces y ya no regresan, entonces hay que buscar otro sustitutoâ€?. Son siete los grupos afectados, “Los alumnos alumn que quedan sin clase y en ocasiones, como consecuencia

Son 14 maestros los que les faltan en la secundaria 170 7 grupos afectados y sin clases por falta de profesores 3 meses de contrato a maestros hasta que llegue presupuesto



Viernes 02 de diciembre de 2011

INFORME DE EN GOBIERNO A TLAJOMULCO, DOS AÑOS CAMBIANDO LA HISTORIA En Tlajomulco, desde hace más de dos años, construimos un proyecto sin colores partidistas, en el que entraron hombres y mujeres de –‘†‘•Ž‘•’ƒ”–‹†‘•›•‹’ƒ”–‹†‘ǡ‰‡‡”ƒ†‘…‘ϐ‹ƒœƒ‡‹–‡”‡•‡•…‘munes con la ciudadanía, logrando recuperar la esperanza de la gente y sacando de las ruinas al Municipio.

2011, AÑO DE LA CONSOLIDACIÓN El incremento en la recaudación durante 2011 tuvo un fuerte impulso, gracias a la consulta de Presupuesto Participativo que implementamos en enero y febrero. Les dimos la oportunidad a los …‘–”‹„—›‡–‡•†‡†‡ϐ‹‹”Žƒ•’”‹‘”‹†ƒ†‡•†‡‘„”ƒ’ï„Ž‹…ƒ‡†‹ƒ–‡ una votación y durante esos meses registramos un incremento en la recaudación del 37 por ciento. Mientras que en 2009 Tlajomulco gestionó recursos sólo por 9 millones de pesos, en 2010 aumentamos a más de 150 millones de pesos y en 2011 a 114 millones.

TRANSPA Hoy Tlajom de acuerdo co corruptos de transparente

INFRA MANEJO INTEGRAL DEL AGUA En primer lugar implementamos un programa de rehabilitación, sustitución y construcción de redes de agua en todo el Municipio. Por ello, pusimos en marcha cinco proyectos para crear subsistemas de abastecimiento de agua en la Zona Valle, con una inversión de casi 10 millones de pesos, en la Cabecera Municipal con más de 24 millones de pesos, en Tulipanes y Balcones de Santa Anita con 12 millones de pesos y en el corredor de la Carretera a Chapala con una inversión inicial de 25 millones. Para el saneamiento del agua también realizamos una inversión histórica, nuevamente sumando esfuerzos y buscando soluciones para la ciudad. Para el saneamiento de la Cuenca de El Ahogado se invirtieron 300 millones de pesos con la construcción de 20,000 metros de colectores. Para el saneamiento de la Laguna de Cajititlán invertimos más de 140 millones de pesos en 5 colectores y 3 plantas de tratamiento, enfrentando el problema fundamental de la Ribera de Cajititlán.

EQUIPAMIENTO URBANO Se invirtieron más de 113 millones de pesos en 11 nuevas unidades deportivas de primer nivel y cuatro más que están en proceso, pero no sólo se trató de construir canchas de fútbol, sino de desarrollar espacios públicos de calidad donde se pudiera reconstruir el tejido social, dándole alternativas de esparcimiento a los niños, jóvenes, madres de familia y adultos mayores. Sin contar las grandes obras viales, invertimos casi 240 millones de pesos en la construcción de vialidades en distintas localidades. En el Centro Histórico pusimos en marcha el primer proyecto de inversión público-privado que realiza un Municipio de México. Bajo este esquema y con recursos propios se invirtieron en la cabecera municipal casi 400 millones de pesos. En la Ribera de Cajtitlán se realizó una intervención no sólo para †‹‰‹ϐ‹…ƒ”ƒŽ‘•’—‡„Ž‘•“—‡Žƒ”‘†‡ƒ•‹‘’ƒ”ƒ…‘˜‡”–‹”Žƒ‡—†‡•tino turístico metropolitano de primer nivel. Se invirtieron alrededor de 350 millones de pesos, y el primer paso fue enfrentar de manera decidida el saneamiento de la Laguna.

Una de las es la movilida para construi problemas de Se concluyó dalajara que c Una soluci ciudad fue la c como la ruta a Tlajomulco co 171 millones Prolongac zona más pob de pesos, con ’ƒ”ƒ†‡•ƒŠ‘‰ gente del Mun Adolf B. H †‹…‹‘‡•ǡŠƒ• ˜Àƒ†‡…‘— Moderniza transitada de millones de p miento vial. En Tlajomu ello también c da construyen un solo espac

Viernes 02 de diciembre de 2011



NRIQUE ALFARO APROBADO ARENCIA Y COMBATE A LA CORRUPCIĂ“N omulco es el Municipio mĂĄs transparente de Jalisco, con CIMTRA, pasamos de ser uno de los Municipios mĂĄs e Jalisco en 2009 para convertirnos en el segundo mĂĄs e de MĂŠxico y en el primero a nivel estatal.

POLĂ?TICA SOCIAL El Programa de Uniformes y Ăštiles Escolares lo implementamos en los dos aĂąos de gobierno como nuestra contribuciĂłn para garantizar la gratuidad de la educaciĂłn pĂşblica, impulsamos este programa no como un mero ejercicio de regalar Ăştiles, sino como una polĂ­tica pĂşblica integral con planeaciĂłn y transparencia, Tlajomulco es todavĂ­a el primer y Ăşnico Municipio de Jalisco que lo realiza. Se construyeron 11 nuevos planteles educativos e iniciĂł la construcciĂłn del Centro Universitario de Tlajomulco de la Universidad PolitĂŠcnica, con el que demostramos que la voluntad polĂ­tica y la suma de esfuerzos son los principales factores para alcanzar soluciones.

Impulsamos el Programa de Apoyo a Adultos Mayores y el Programa de Apoyo a Jefas de Familia, ’‘”“—‡‡Â?–‡Â?†‹Â?‘•“—‡”‡…‘Â?‘…‡”›†‹‰Â?‹Ď?‹…ƒ”ƒ‡•–‘• grupos es una prioridad para reconstruir el tejido social. Nuevo modelo de seguridad ciudadana. Replanteamos la estrategia de seguridad ciudadana y pusimos en marcha el modelo de PolicĂ­a de Proximidad Social, para lo que pusimos en operaciĂłn 16 mĂłdulos de seguridad en todo el Municipio, destinamos personal exclusivo para esta ĂĄrea y planteamos un esquema de vigilancia por perĂ­metros a travĂŠs de policĂ­as en motocicleta, ciclopolicĂ­as y policĂ­as a pie.

AESTRUCTURA PARA EL DESARROLLO s principales exigencias de Tlajomulco y de la metrĂłpoli dad urbana, y por ello, diseĂąamos no sĂłlo un programa uir calles, sino un sistema vial que le diera soluciĂłn a los de movilidad del sur de la ciudad. yĂł el Circuito Metropolitano Sur, el libramiento de Guaconecta desde Tala hasta la carretera a Chapala. ciĂłn mĂĄs para los problemas de movilidad del sur de la a construcciĂłn de ProlongaciĂłn ColĂłn, que se constituye a alterna natural a LĂłpez Mateos y conecta directamente a con el centro de Guadalajara; en dicha obra se invirtieron s de pesos. aciĂłn 8 de Julio ‡•—Â?ƒ•‘Ž—…‹×Â?Â?ž•’ƒ”ƒ‡Ž–”žĎ?‹…‘‡Â?Žƒ oblada de Tlajomulco, con una inversiĂłn de 150 millones ntaremos con una vialidad mĂĄs en el sentido Norte-Sur ‘‰ƒ”‡Ž–”žĎ?‹…‘›„”‹Â?†ƒ”Ž‡ƒŽ–‡”Â?ƒ–‹˜ƒ•†‡Â?‘˜‹Ž‹†ƒ†ƒŽƒ unicipio. Horn, que se encontraba intransitable y en pĂŠsimas con•‹†‘†‹‰Â?‹Ď?‹…ƒ†ƒ›”‡Šƒ„‹Ž‹–ƒ†ƒ’ƒ”ƒ…‘Â?˜‡”–‹”•‡‡Â?‘–”ƒ Â?Â‹Â…ÂƒÂ…Â‹Ă—Â?‡Ď?‹…‹‡Â?–‡‡Â?‡Ž•‡Â?–‹†‘‘”–‡nj—”Ǥ zamos la Avenida ConcepciĂłn, que es la tercera mĂĄs e Tlajomulco y se encontraba destruida; invertimos 19 pesos en su repavimentaciĂłn y en obras para el ordenamulco nos tomamos en serio el tema de la movilidad y por n consolidamos un programa de movilidad no motorizaendo 14.65 kilĂłmetros de ciclovĂ­a siendo que no existĂ­a ni acio para la bicicleta antes de 2010.

CONCLUSIĂ“N “Revertir el rezago y el saqueo que sufriĂł Tlajomulco durante mĂĄs de una dĂŠcada no se logra en dos aĂąos, pero estoy convencido que logramos no sĂłlo sentar las EDVHVVLQRDYDQ]DUVLJQLÂżFDWLYDPHQWHHQODFRQVWUXFFLyQ de una nueva historia para Tlajomulco. Hoy Tlajomulco es un ejemplo a seguir para muchos Municipios que han intentando exportar nuestros programas y polĂ­ticas pĂşblicas, aunque no siempre con el mismo ĂŠxito; lo que ha hecho la diferencia es nuestra visiĂłn de gobierno, hemos GLJQLÂżFDGRODSROtWLFDGH7ODMRPXOFR\KHPRVUHFRQVWUXLdo la relaciĂłn entre sociedad y gobierno para generar FRQÂżDQ]D RUJXOOR H LQWHUHVHV FRPSDUWLGRV 0iV GHO  por ciento de nuestros compromisos ante notario se han cumplido o estĂĄn por concretarse, y una gran parte de lo que hemos logrado y que aquĂ­ se ha detallado no estaba incluido en esos compromisosâ€?, Presidente Municipal Enrique Alfaro RamĂ­rez.



Viernes 02 de diciembre de 2011

Ya tienen registro civil Santa Fe y Buenavista, ahora también tendrán este servicio Por Jorge López




“Tuve que realizar gestiones ante el archivo general y con el secretario general del ayuntamiento `ÄUHSTLU[LZLKPV la autorización del cabildo…” 7DPELpQ PDQLIHVWy ³7XYH TXH UHDOL]DU JHVWLRQHV DQWH HO DUFKLYR JHQHUDO \ FRQ HO VHFUHWDULR JHQHUDO GHO D\XQWDPLHQWR \ ¿QDOPHQWH VH GLR OD DXWRUL]DFLyQGHOFDELOGRDKRUD VH HYLWDUi TXH OD JHQWH VH



=pakl]f)+gÚ[afYk de Registro Civil en el Municipio Alrededor de 90 mil ciudadanos se atenderán en Santa Fe Se espera dar servicio a 20 mil personas al año en Buenavista


La mayoría de mujeres embarazadas no llevan control mensual. El embarazo complicado conlleva riesgo de muerte.



BUZĂ&#x201C;N Viernes 02 de diciembre de 2011


VIVE EN ARMONĂ?A Formar parte de la familia, grupo o equipo es parte de la vida. Descubre las claves para integrarte de manera armĂłnica. Trabaja en la uniĂłn: Un equipo â&#x20AC;&#x153;felizâ&#x20AC;? estĂĄ unido por el afecto y por un objetivo en comĂşn: el bienestar de todos. Y aunque el lema â&#x20AC;&#x153;Todos para uno y uno para todosâ&#x20AC;? les vaya bien, ten en cuenta que no todos tienen las mismas capacidades, y en consecuencia, no se les debe asignar las mismas funciones. El reparto de las tareas no debe ser equitativo sino operativo. AsĂ­ aquellos con mĂĄs experiencia tendrĂĄn mayor responsabilidad a la hora de buscar el bienestar de sus miembros. Evita la rigidez: Un grupo enfrenta constantemente situaciones adversas, tanto por lo que sucede a su alrededor como por los cambios internos, por ello los roles dentro del trabajo deben SRGHU PRGLÂżFDUVH 3RU HMHPSOR XQ equipo que trata igual a todos sus miembros sin considerar sus particularidades, no explotarĂĄ su mayor potencial. Favorece los roles y haz lo posible por evitar situaciones de frustraciĂłn. MantĂŠn la comunicaciĂłn: co omunicaciĂłn: Es bĂĄsica como herramienta para la soluciĂłn de

FRQĂ&#x20AC;LFWRV \ FUHD OD]RV HQWUH VXV LQWHJUDQWHV3UDFWLFDWDQWRODFRPXQLFDFLyQ verbal como la no verbal. La comunicaciĂłn del afecto mutuo es imprescindible al ser una expresiĂłn que va mĂĄs allĂĄ de las palabras: abrazos, miradas y sonrisas son las formas con las quĂŠ le hacemos saber al otro que estamos ahĂ­. Si no comunicamos se producirĂĄ un alejamiento. Respeta la individualidad: Ser XQ HTXLSR VLJQLÂżFD TXH WRGRV VRPRV uno, pero ademĂĄs somos seres individuales. Todos deben respetar los deseos de cada uno y alentarlos hacia la felicidad. Las necesidades individuales sĂłlo se convierten en un factor de tensiĂłn cuando se intenta anularlas, geneUDQGRXQFRQĂ&#x20AC;LFWR6LWRGRVDFHSWDQORV espacios personales de cada uno de sus integrantes tendremos como resultado el crecimiento grupal. &RQÂżDQ]D Es la convicciĂłn de que si el otro me dice algo, debo creerOR FRPR YHUGDG 3RU HMHPSOR DOJXQRV padres dicen â&#x20AC;&#x153;Yo desconfĂ­o porque mi hijo miente, entonces les digo que quizĂĄ el miente porque desconfĂ­a de ellosâ&#x20AC;?. Imaginemos a un niĂąo, ÂżCĂłmo se sentirĂ­a menos inclinado a mentir? Si le digo â&#x20AC;&#x153;siempre te creoâ&#x20AC;? o si le digo Âżseguro que no me mientes? Lo mismo pasa en los equipos de trabajo; es necesario, DSUHQGHUDFRQÂżDUHQHORWURGiQGROH libertad para trabajar. ConfĂ­a primero y espera a que eso genere sinceridad en OXJDUGHH[LJLUSDUDOXHJRFRQÂżDU Estar presente: Es necesario que el otro sepa que puede contar contigo tanto en un momento de alegrĂ­a como de tristeza. Es indispensable que los integrantes de un equipo, sobre todo en una familia, se vean y compartan sentimientos. Los vĂ­nculos fortalecen al grupo. Es asĂ­ que a nuestros hijos les podemos dejar dos cosas raĂ­ces y alas para avanzar en su vida, lo mismo podemos darles a los miembros de nuestro equipo.



EL MODELO Uno no puede ir por la vida, sin un modelo. El modelo es como el hilo negro, el hilo negro que la gran mayorĂ­a no puede encontrar, ni sabe dĂłnde buscar, supongo que por eso lo llaman asĂ­. La gran mayorĂ­a no lo encuentra, es mĂĄs, como sabe que no lo encontrarĂĄn; ni siquiera intenta buscarlo, pues imaginen lo que serĂ­a buscar un hilo en la inmensidad del ocĂŠano. ÂżQuiĂŠn realmente vive la vida sin un modelo? ÂżQuiĂŠn? Seguro, que nadie, pues cĂłmo es posible vivir, sin un modelo, sin saber cĂłmo es el hilo negro en realidad o si realmente es un hilo. ÂżSin un modelo al cual apegarnos a dĂłnde iremos a parar? Seguro que a ningĂşn lado. JamĂĄs llegaremos a ser lo que real y autĂŠnticamente queremos

ser, por lo tanto, no estaremos viviendo. Y para mi vivir es:3DVDUSRUHVWD vida caminando tu propio camino. Es ser quien tú quieres ser a cada momento. Sin un modelo ¿Cómo podremos decidir ante una situación? ¿Cómo podremos dirigir nuestras acciones? ¿Cómo podremos decidir entre decir no o decir sí? ¿Cómo podremos dirigir nuestra vida? Etc. Si nos encontråramos en una situación en la cual no sabemos quÊ hacer y pensåramos, ¿QuÊ le recomendaría a mi hijo hacer? No sabríamos ni quÊ decirle al hijo, pues no sabríamos hacía dónde queremos dirigirlo, es decir, nosotros mismos sin un modelo, sin un ideal del Yo, cómo demonios podremos dirigirnos a nosotros mismos. Si un modelo, somos como línea con altas, bajas, reveses, vueltas, sin rumbo, sin un camino que seguir. El modelo, es la búsqueda de un rompecabezas y el armado de ese rompecabezas. Y esa búsqueda, es la mås maravillosa de la vida y a la vez la mås GL¿FXOWRVD$UPDUORHVXQDPDJQL¿FHQcia y lo mås sublime a lo cual puedes dedicar tu tiempo. Apegarte a Êl es lo mås satisfactorio que se puede encontrar. ¥Y Vivir A travÊs de èl es Vivir! *Este escrito estå fundamentado por ODVSXEOLFDFLRQHVGHOD0LVLyQ3VLFROygica Actitudinal para la Calidad de Vida \OD6DOXG0HQWDO(VFULWDVSRUORV3VLcoterapeutas Margarito Alvaro y Araceli Mejía. Visita el video referente a este artículo en: / Carolina Metamorfosis Sígueme en Twitter: @carolinayomisma


Viernes 02 de diciembre de 2011 VĂ?CTOR HUGO ORNELAS

DE POLĂ?TICA Y OTRAS PERVERSIONES Esta columna suele ser ofensiva y grosera, el sarcasmo y la ironĂ­a de su contenido puede lastimar algunos susceptibles corazoncitos y si usted es intolerante a la crĂ­tica no la debe leer.

Los debates y la carabina de Ambrosio Ă&#x2030;rase una vez, en un PaĂ­s lleno de magia y fantasĂ­a, donde el sol no deja de brillar (salvo el del PRD que nomĂĄs nunca lo hace), que se comenzĂł a utilizar una tĂŠcnica, que aunque parece pleito de lavanderĂ­a, quienes lo llevan a cabo aseguran que consiste en la exposiciĂłn y discusiĂłn de opiniones antagĂłnicas entre dos personas mĂ­nimo. Ese es el debate, al que dentro de la polĂ­tica nadie pudo apadrinarlo mejor que Vicente Fox con su famoso berrinche del â&#x20AC;&#x153;Hoy, hoyâ&#x20AC;?, al lado de Cuahutemoc CĂĄrdenas y Francisco â&#x20AC;&#x153;La vestidaâ&#x20AC;? como le decĂ­a el buen Fox. Ese famoso debate se volviĂł algo sumamente popular entre la clase polĂ­tica, en especial la de los candidatos y suspirantes que recurren a â&#x20AC;&#x153;retarâ&#x20AC;? a sus contrincantes electorales para segĂşn ellos â&#x20AC;&#x153;debatir sus propuestasâ&#x20AC;?, pero que realmente sirve nada mĂĄs para sacarse mutuamente sus trapitos al sol o para que no se escuche tan sexual, para balconearse los unos a los otros. Pero resulta que ni eso saben hacer bien los ingratos, y poquito a poco se han encargado de que el debate pierda su atracciĂłn entre la ciudadanĂ­a, antes cuando menos generaba algo de morbo, pero ahora ya es una payasada, cĂłmo el mĂĄs reciente que hubo entre Santiago Creel, Ernesto Cordero y JoVHÂżQD 9i]TXH] 0RWD ORV WUHV D]XOLWRV panistas que buscan la candidatura del partido para las prĂłximas elecciones a presidente de la RepĂşblica. Y si usted es de los que no se enterĂł sobre este debate,, no se apure, ni rairai ting tuvo, lo han de haber visto como 6 Ăł 7 personas, incluyendo al

BUZĂ&#x201C;N camarĂłgrafo y al mediador de semejante y aburrido espectĂĄculo, que lejos de mostrar aspirantes ambiciosos y atrevidos, el supuesto debate terminĂł convirtiĂŠndose en una especie de aparador de promesas de precampaĂąa. A mi entender deberĂ­an de cambiar el debate por una especie de foro abierto, donde representantes ciudadanos, repito, CIUDADANOS, o sea, no acarreados, ni paleros, ni borregos, ni simpatizantes, cuestionen a sus candidatos, que hĂĄgame el favor, quieren gobernar al pueblo y ĂŠste, nomĂĄs nunca tiene la oportunidad de cuestionarlos. A poco no cree usted que los zapopanos no querrĂ­an hacerle sus preguntitas al ahora secretario de vialidad DieJR 0RQUD] TXH TXLHUH VHU FDQGLGDWR DODDOFDOGtDGHHVH0XQLFLSLRDTXLHQ de perdida podrĂ­an cuestionarle que si no fue capaz de atender un problema de transporte pĂşblico o simplemente meter en regla a los mototaxis en Tlajomulco, ÂżQuĂŠ le hace pensar al seĂąor TXHSXHGHGLULJLUXQ0XQLFLSLR" O que tal nuestros aspirantes a ocupar la silla presidencial en Tlajomulco, Ismael del Toro y Quirino VelĂĄzquez, y menciono a esos dos, porque los demĂĄs la verdad hasta me da risa que se anden apuntando, total, a estos dos bien se les podrĂ­a cuestionar quĂŠ otra cosa saben hacer ademĂĄs de pegar calcas y poner lonas con sus nombres, digo, alguna gracia deben de tener si es que quieren ser alcaldes. 'HÂżQLWLYDPHQWHHVRVHPHKDFHPXcho mĂĄs atractivo que el supuesto debate que para lo Ăşnico que sirve es para ocupar espacios televisivos y noticiosos, para decir que son bien chichos y que no tienen miedo de enfrentar a sus contrincantes, y para muestra la historia, quĂŠ paso cuando Enrique Alfaro convocĂł a debatir a JosĂŠ Ă ngel, candidato del PRI y Genaro Torres del PAN, pues todo acabo con Alfaro sentado solo en media plaza, porque los otros dos nunca fueron; Y cuando debatieron &DOGHUyQ0DGUD]R\HO3HMHQDGDQXHvo, las mismas cosas que presentaban en sus spots publicitarios son las que hablaron en el debate, por eso para mĂ­ el debate y la carabina de Ambrosio es lo mismo, porque si en verdad quieren que alguien los cuestione y si en verdad le quieren responder a alguien, ahĂ­ estĂĄ la ciudadanĂ­a. Eso es todo por hoy, mande sus opiniones y comentarios a victorzona10@ o sĂ­game en Hugo_Ornelas.

EL PASADO EN EL PRESENTE JosĂŠ Octavio Guevara Rubio

F.I.L. Era un martes primero de diciembre de 1987 cuando se abriĂł al pĂşblico la Feria Internacional del Libro (FIL), organizada por el Gobierno del Estado y la Universidad de Guadalajara, con mĂĄs de 60 mil tĂ­tulos en 350 stands, participando mĂĄs de 1000 editoriales de todo el mundo; principalmente de 0p[LFR \ $PpULFD /DWLQD (VWH DxR OD IHULD IXH RÂżFLDOPHQWH LQDXJXUDGD HO sĂĄbado anterior; pero, no se abriĂł al pĂşblico en general, ya que inicialmente se organizaron dentro del evento diversos seminarios y coloquios especializados y dirigidos a editores y bibliotecarios. Desde sus inicios, la FIL se ha preocupado por mantener atendidas 3 ĂĄreas de acciĂłn: la editorial,la acadĂŠmica y la cultural. Cada aĂąo recorren sus pasillos editores, agentes literarios, promotores de lectura, traductores, distribuidores y bibliotecarios que acuden a realizar intercambios comerciales y profesionales; de igual forma, es un punto de encuentro para la discusiĂłn en torno a la cultura contemporĂĄnea: escritores, acadĂŠmicos, artistas, intelectuales y muchas otras personas interesadas en el intercambio de ideas sobre el acontecer cultural acuden a este encuentro anual. En la FIL, tambiĂŠn se dan cita unas 400 mil personas, que a lo largo de 9 dĂ­as se sumergen en los libros y disfrutan de uno de los festivales culturales mĂĄs importantes de AmĂŠrica Latina. La FIL es, ademĂĄs una oportunidad Ăşnica para renovar los lazos que unen D 0p[LFR H +LVSDQRDPpULFD FRQ RWUDV culturas. Desde 1993, la Feria tiene un PaĂ­s o regiĂłn invitado de honor para que muestre en este foro internacional lo mejor de su producciĂłn editorial y artĂ­stica. Colombia (1993), Nuevo 0p[LFR   9HQH]XHOD   CanadĂĄ (1996), Argentina (1997), Puerto Rico (1998), Chile (1999),

EspaĂąa (2000), Brasil (2001), Cuba (2002), Quebec (2003), La Cultura Catalana (2004), PerĂş (2005), etc. han alimentado ya este espacio. Como parte del esfuerzo por mantener la calidad literaria y el desarrollo cultural, la FIL ha creado espacios para una serie de premios que se entregan cada aĂąo. El Premio de Literatura Latinoamericana y del Caribe Juan Rulfo, fundado en 1991 por la Universidad de Guadalajara estĂĄ dotado con 100 mil GyODUHV\VLJQLÂżFDHOUHFRQRFLPLHQWRD la trayectoria literaria de un autor. Este premio ha sido entregado a los mĂĄs importantes escritores de las letras latinoamericanas contemporĂĄneas: Nicanor Parra, Juan JosĂŠ Arreola, Eliseo Diego, Julio RamĂłn Ribeyro, NĂŠlida PixyQ$XJXVWR0RQWHUURVR-XDQ0DUVp Olga Orozco, Sergio Pitol, Juan Gelma, Juan GarcĂ­a Ponce, Cinthio Vitier, Rubem Fonseca, Juan Goytisolo, Tomas Segovia. El Premio Sor Juan InĂŠs de la Cruz es una distinciĂłn que desde 1993 se concede a una novela escrita por una mujer en idioma espaĂąol. De igual forma, se galardona, desde 1993, a los grandes editores con el Reconocimiento al 0HULWR (GLWRULDO 2WURV SUHPLRV TXH entrega la FIL son: el Premio Nacional de Periodismo Cultural Fernando BenĂ­tez, fundado en 1991, que se acompaĂąa de un homenaje a un periodista reconocido en el sector cultural; el Premio Arpa FIL para jĂłvenes arquitectos, que incluye tambiĂŠn un homenaje a un personaje relacionado con la arquitectura o el urbanismo; el Homenaje el Biblió¿ORFUHDGRHQ\HO+RPHQDMHDO Bibliotecario, creado en 2002. $OJXQRVQ~PHURVGHOD),/UHĂ&#x20AC;HMDQ su importancia: 22 mil metros cuadrados de ĂĄrea de exposiciĂłn, con un promedio anual 1300 casas editoriales de 35 paĂ­ses; el programa de actividades contempla mĂĄs de 600 horas-evento, que equivalen a una media de 50 actividades diferentes por dĂ­a; ademĂĄs, se realizan 200 presentaciones de libros y su organizaciĂłn deja en Guadalajara una derrama econĂłmica superior a los 10 millones de dĂłlares y mĂĄs de 100 mil jĂłvenes la visitan cada aĂąo. 0iV DOOi GH ODV FLIUDV OD ),/ HV XQ patrimonio vital y concreto de la cultura hispanoamericana. Un punto de encuentro para la discusiĂłn en torno al libro, reconocido como el mayor mundial mercado de publicaciones en espaĂąol.

Viernes 02 de diciembre de 2011



De viejos esquimales a adultos mayores tlajomulcas ÂżY usted, sĂ­ tiene abuela? ÂżQuĂŠ tal le fue con el inicio de la temporada â&#x20AC;&#x153;congelativaâ&#x20AC;?? ÂżYa sacĂł el abrigo o chamarra olorosos a humedad? ÂżSe encontrĂł en un bolsillo algĂşn billete de esos que sintiĂŠndonos ricos despuĂŠs de recibir el aguinaldo ni echamos de menos el aĂąo pasado, pero ahora que lo encontramos nos completan para tortillas? Hablando de frĂ­os muy â&#x20AC;&#x153;friososâ&#x20AC;?, he recordado una maravillosa novela etQRJUiÂżFD RVHDXQDQRYHODEDVDGDHQ investigaciĂłn antropolĂłgica real) de Hans Ruesch con tĂ­tulo original â&#x20AC;&#x153;Top of the worldâ&#x20AC;? y llamada en espaĂąol â&#x20AC;&#x153;El paĂ­s de las sombras largasâ&#x20AC;?. Esta amenĂ­sima historia tiene lugar en las congeladas tierras de los Inuits o Esquimales, como nosotros los conocemos; relata las costumbres de esa cultura en tiempos pasados y va desde el por demĂĄs conocido beso Inuit que se do la nariz con la de la da frotanpersona, los exĂłtiotra cos hĂĄbitos alimenticios, la confecciĂłn de ropa, herramien-

ta, viviendas, hasta la escases de mujeres y el prĂŠstamo de la esposa al amigo o al huĂŠsped, considerĂĄndose una humillaciĂłn que el receptor del â&#x20AC;&#x153;emprestamientoâ&#x20AC;? no lo aceptara. Pero, de todas las escenas que el autor nos regala, KD\XQDTXHOODPDDXQDUHĂ&#x20AC;H[LyQTXH traspasa las ĂŠpocas y las culturas: la vejez. La cultura Inuit antigua era, como casi todas las mĂĄs prĂ­stinas, prĂĄctica y de sobrevivencia. En ella los viejos eran una carga inĂştil en un ambiente tan lleno de peligros como escaso de alimentos. Los viejos eran abandonados, por propia peticiĂłn muchas veces, en la desolada nieve para morir congelados y/o ser devorados por algĂşn oso polar que algĂşn dĂ­a servirĂ­a de alimento a la familia del anciano. ¿¥QuĂŠ crueldad! piensa usted mi estimado tlajomulca? ÂĄQuĂŠ horribles modos de los esquimales esos! Y claro, es que ahora nosotros somos â&#x20AC;&#x153;civilizadosâ&#x20AC;?. Para empezar llamamos a las cosas con un nombre nice; nada de viejos o ancianos, nosotros decimos adultos mayores o personas de la edad de oro, aunque a veces lo Ăşnico TXHWLHQHQGHGRUDGR WDWHPDGR HVOD piel, por andar pidiendo limosna o juntando botes por la calle para medio comer o porque, a los que bien les va, los nietos olvidaron â&#x20AC;&#x153;guardarlosâ&#x20AC;? a tiempo cuando los sacaron al solecito. Nosotros no le damos esa terrible muerte ritual al viejo por no haber reFXUVRVVXÂżFLHQWHV$KRUDKDVWDOHVD\Xdamos a administrar los tres centavos que las maravillosas instituciones de JRELHUQROHVGDQFDGDPHV$OFDERTXH el abuelo pa paâ&#x20AC;&#x2122; que quiere el dinero a ver dĂ­game usted. Comida ahĂ­ hay, que le ust haga la lucha luch y la remuela con las encĂ­as como pueda pueda. ÂżRopa? Pues que Yonatan Estiven le deje d su chamarra al abuelo y con lo de la pensiĂłn le compramos una QXHYDDOPXFKDFKRÂŁ$pOVtOHOXFHWDÂś QXHYDDOP re guapo!... De eso del respeto pues ni cĂłmo hacerle. hacer Si la verdad, ya no saben ni lo que dicen. La abuela con que en d sus tiempos si eran â&#x20AC;&#x153;mujeresâ&#x20AC;?, pero no sabe ni cĂłmo cĂłm hacerse su â&#x20AC;&#x153;maruchanâ&#x20AC;? en el micro y el abuelo a muele y muele con las mismas mism historias una y otra vez. QuĂŠ si se le apareciĂł el diablo, que lo de antes era mejor, que si las cosas costam ban diez centavos. cen Hoy en dĂ­a d no somos pueblos bĂĄrbaros ÂżVerdad ÂżVerdad? Ya no es bien visto que el viejo muera en la blancura de la nieve, ahora muere muer en la calle, en el hospital pĂşblico o en el cuartito mugroso al TXH HVWi HVWi FRQÂżQDGR (O DQFLDQR \D QRVHDOHMDXQGtDGHÂżQLWLYDPHQWH QRVHDO ahora se va desvaneciendo poco a poco poc a la misma velocidad con que deja de ser nece$ario. Para muchas familias el hombre o la mu mujer mayor pasa a ser un ser m desactualizado, no producd tivo, que no llena las expectativas de un mundo materialista. Hoy en dĂ­a es mĂĄs importante la forma en que nombramos a los viejos que la forma en que los tratamosâ&#x20AC;Ś Los dejo con las palabras de mi tĂ­a MarĂ­a ExpectaciĂłn del niĂąo JesĂşs â&#x20AC;&#x153;Como te ves me vi y como me ves te verĂĄsâ&#x20AC;? ÂżO usted quĂŠ opina? $QWURSRIDJLDEUDYR#


ÂĄEl DĂ­a despuĂŠs de MaĂąanaâ&#x20AC;Ś! De acuerdo al BiĂłlogo Nasif Nahle Sabag, en su artĂ­culo â&#x20AC;&#x153;Una posible glaciaciĂłnâ&#x20AC;?, publicado el 13 de abril del 2007, comenta que con base a los datos de satĂŠlites y globos climatolĂłgicos, la tendencia de la temperatura atmosfĂŠrica desde 1998 a la fecha indica un enfriamiento global en vez de un calentamiento, propensiĂłn que disminuyĂł de 0.52 °C en 1998 a 0.144 °C en los ocho aĂąos siguientes. La pequeĂąa variaciĂłn de 0.144 °C en la temperatura troposfĂŠrica es el promedio de las temperaturas anuales registradas durante la presente dĂŠcada, la cual comprende de 1997 a 2007. $ UDt] GHO SURORQJDGR LQYLHUQR 2006-2007 y las frecuentes nevadas y frentes frĂ­os ocurridos en el Hemisferio Norte, algunos grupos ambientalistas comienzan a abandonar su alarmismo inicial sobre catĂĄstrofes ecolĂłgicas por el calentaprovocadas calenta miento global â&#x20AC;&#x201C;que falazmente se


atribuye a las actividades humanas-; ahora, cambiaron el calentamiento global por una glaciaciĂłn inminente, por supuesto, segĂşn ellos, tambiĂŠn serĂ­a provocada por los seres humanos. De acuerdo al registro geolĂłgico actualmente estamos pasando por un perĂ­odo interglacial con oscilaciones que pueden abarcar de 3 a -3 °C; tambiĂŠn demostramos que el sistema solar estĂĄ cruzando una nube de radiaciĂłn cĂłsmica interestelar que estĂĄ causando alteraciones en el clima Solar y, por consecuencia, de todos los planetas del sistema. Hemos visto cĂłmo la temperatura de la tierra responde a las variaciones en la irradiaciĂłn solar durante los Ăşltimos 400 aĂąos y se encontrĂł una correlaciĂłn matemĂĄtica. $FWXDOPHQWH VH REVHUYD XQD WHQGHQFLDQHJDWLYDHQODĂ&#x20AC;XFWXDFLyQGHOD temperatura, lo cual aumenta las probabilidades de que estemos entrando a una era glacial similar a la PequeĂąa GlaciaciĂłn de la Edad Media. No hay motivo alguno para deducir FLHQWtÂżFDPHQWHTXHORVVHUHVKXPDQRV somos la causa del calentamiento global, y mucho menos que estemos produciendo una glaciaciĂłn como la de la pelĂ­cula â&#x20AC;&#x153;El DĂ­a DespuĂŠs de MaĂąanaâ&#x20AC;?. Todo lo que estamos observando son ciclos naturales que obedecen a cambios en la intensidad de la radiaciĂłn solar; tanto los calentamientos como los enfriamientos de la tierra han sido si causados en el pasado y estĂĄn siendo provocados actualmente por la cantidad cantid de radiaciĂłn cĂłsmica que recibimos, cibimo tanto desde nuestro sol, como desde desd otras fuentes fuera de nuestro sistema solar. siste En vez de asustar a la gente, debemos tomar medidas para prepabe rar a la humanidad ante cualquier cambio posible de la naturaleza; c debemos enseĂąarnos a cuidar y ahorrar el agua, a no destruir los biomas, a cuidar nuestro entorno n y ahorrar combustibles. Instituto TecnolĂłgico de TlajomulIn co, Jalisco Km. K 10 Carr. Tlajomulco-San Miguel CuyutlĂĄn Tels: Tel 3772 â&#x20AC;&#x201C; 4426 y terminaciĂłn 27 BiĂłl. Jaime Reyes Rueda FRODSVLV#\DKRRFRPP[

EN LA RED Viernes 02 de diciembre de 2011


Fue aprobado en cabildo... ÂżEstĂĄs de acuerdo en que se utilicen recursos del HUDULRS~EOLFRSDUDODDGTXLVLFLyQGHXQYHKtFXORDÂżQGHTXHHVWHVHULIHHQWUH trabajadores sindicalizados del ayuntamiento en esta navidad? Willaldo Castro Rosales:

Blanca Bravo:

No estoy de acuerdo, ese dinero es para el mejoramiento de Tlajomulco no para unos cuantos, ya que si quiere rifar un coche, Alfaro de su bolsa puede pagarlÂżo no?

Que lo compren con el cambio (moneditas) que tienen en el cajĂłn de su escritorio Enrique, SĂ­ndico, Secretario y Regidores. 28 de Noviembre Me gusta - Comentar

28 de Noviembre Me gusta - Comentar David Meza Ruiz:

Â&#x2018;Â?Â&#x17D;Â&#x192;Â&#x2026;Â&#x2018;Â?Â&#x2019;Â&#x201D;Â&#x192;Â&#x2020;Â&#x2021;Â&#x2014;Â?Â&#x2026;Â&#x192;Â&#x201D;Â&#x201D;Â&#x2039;Â&#x2013;Â&#x2018;Â&#x2019;Â&#x2018;Â&#x2022;Â?Â&#x2018;Â?Â&#x192;Â&#x2022;Â&#x2DC;Â&#x192;Â?Â&#x192;Â&#x201E;Â&#x2021;Â?Â&#x2021;Ď?Â&#x2039;Â&#x2026;Â&#x2039;Â&#x192;Â&#x201D;Â&#x192;Â&#x2014;Â?Â&#x2018;Â?Â&#x2021;Â&#x152;Â&#x2018;Â&#x201D; por quĂŠ no voltean un poquito y ven las necesidades de implementos que Â?Â&#x2021;Â&#x2026;Â&#x2021;Â&#x2022;Â&#x2039;Â&#x2013;Â&#x192;Â&#x17D;Â&#x192;Â&#x2030;Â&#x2021;Â?Â&#x2013;Â&#x2021;Â&#x2019;Â&#x192;Â&#x201D;Â&#x192;Â&#x2013;Â&#x201D;Â&#x192;Â&#x201E;Â&#x192;Â&#x152;Â&#x192;Â&#x201D;ÇĄÂ&#x192;Â&#x2022;Ă&#x20AC;Â?Â&#x2018;Â&#x201E;Â&#x2021;Â?Â&#x2021;Ď?Â&#x2039;Â&#x2026;Â&#x2039;Â&#x192;Â&#x201D;Ă&#x20AC;Â&#x192;Â?Â&#x192;Â&#x17D;Â&#x2018;Â&#x2022;Â&#x2013;Â&#x201D;Â&#x192;Â&#x201E;Â&#x192;Â&#x152;Â&#x192;Â&#x2020;Â&#x2018;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2022;Â&#x2039;Â?Â&#x2018; a la misma gente que le llega el servicio del H. Ayuntamiento y paga sus impuestos. 28 de Noviembre Me gusta - Comentar Paola Topete Flores:

Pues que si estoy de acuerdo, NO, pero es lo Ăşltimo que les va a imporÂ&#x2013;Â&#x192;Â&#x201D;ÇĄÂ&#x192;Â&#x17D;Ď?Â&#x2039;Â?Â&#x2021;Â&#x17D;Â&#x17D;Â&#x2018;Â&#x2022;Â&#x2022;Â&#x2018;Â?Â&#x17D;Â&#x2018;Â&#x2022;Â&#x201C;Â&#x2014;Â&#x2021;Â?Â&#x2014;Â&#x2021;Â&#x2DC;Â&#x2021;Â?Â&#x2021;Â&#x17D;Â&#x2020;Â&#x2039;Â?Â&#x2021;Â&#x201D;Â&#x2018;Â&#x2020;Â&#x2021;Â?Â&#x2014;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x201D;Â&#x2018;Â&#x2022;Â&#x2039;Â?Â&#x2019;Â&#x2014;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x2018;Â&#x2022;Â&#x203A;Â&#x2022;Â&#x2039; estamos o no de acuerdo a ellos les vale ma... 28 de Noviembre Me gusta - Comentar AdĂĄn Nava:

SĂ­ estoy de acuerdo, es para un trabajador de bajo sueldo, y si el 0XQLFLSLRHVWiÂżQDQFLDQGRODVFDPSDxDVGHPXFKDVSHUVRQDVSRUTXp QRXQFRFKH 28 de Noviembre Me gusta - Comentar Quirino VelĂĄzquez:

Estoy de acuerdo que se incentive a los trabajadores sindicalizados del ayuntamiento. Pero bueno fuera que el vehĂ­culo lo paguen, con sus recursos personales, el presidente, regidores, sĂ­ndico y funcionarios, hasta nivel de direcciĂłn, y asĂ­ se evitarĂ­a que alguien se pase de listo y se pare el cuello con recursos del pueblo, es decir, salude (regale) con sombrero ajeno. Yo le entro con mi parte. 28 de Noviembre Me gusta - Comentar Teree riiaaâ&#x20AC;şn:

A ver, o sea, aparte de sus sueldos, y buenos sueldos, y sus buenos aguinaldos y sin casi sin hacer nada, todavĂ­a se les darĂĄn un auto... jajaja quĂŠ burla para el pueblo que somos nosotros, mejor utilicen ese dinero en darlo para otra prepa, que mucha falta hace y no ese regalito, yo no estoy d acuerdo. 28 de Noviembre Me gusta - Comentar Eva CĂĄrdenas:

ÂżEn serio creen que alguien puede estar de acuerdo en eso? 28 de Noviembre Me gusta - Comentar Regino BurrĂłn Tacuche:

Claro que hay quien estĂŠ de acuerdo, no sean cerrados, al menos hay dos mil trabajadores del ayuntamiento que lo van a ver bien. Para mi gusto es un gasto inĂştil y absurdo, pero hay opiniones de todo tipo. 28 de Noviembre Me gusta - Comentar

Carlos Iglesias Luna:

Jajajajajajajaj... La respuesta es tan clara, los del ayuntamiento y familiares SĂ?, el resto de la gente NO. ÂżEn serio propusieron eso, o ya lo aprobaron? 28 de Noviembre Me gusta - Comentar

Mariana Alejo:

Â&#x2022;Â&#x160;ÇĄ ÇŠÂ&#x2018;Â&#x201D; Â&#x2020;Â&#x2039;Â&#x2018;Â&#x2022;Ǩ Â? Â&#x2013;Â&#x2018;Â&#x2020;Â&#x192;Â&#x2022; Â&#x2019;Â&#x192;Â&#x201D;Â&#x2013;Â&#x2021;Â&#x2022; Â&#x2022;Â&#x2021; Â&#x201D;Â&#x2039;Â&#x2C6;Â&#x192;Â? Â&#x2026;Â&#x2018;Â&#x2022;Â&#x2039;Â&#x2013;Â&#x192;Â&#x2022; Â&#x2021;Â? Â&#x2021;Â&#x2022;Â&#x192;Â&#x2022; Â&#x2C6;Â&#x2021;Â&#x2026;Â&#x160;Â&#x192;Â&#x2022; Â&#x203A; Â&#x2022;Â&#x2018;Â? como incentivos, los trabajadores son trabajadores como de cualquier empresa y si no reciben reparto de utilidades, que es obvio porque en el ayuntamiento no existe eso, por lo menos algo que los motive a trabajar, Â&#x201E;Â&#x2014;Â&#x2021;Â?Â&#x2018;Â&#x203A;Â&#x2018;Â&#x2026;Â&#x201D;Â&#x2021;Â&#x2018;ǤÂ&#x2021;Â&#x2022;Â&#x2019;Â&#x2021;Â&#x2026;Â&#x2039;Ď?Â&#x2039;Â&#x2026;Â&#x2018;Â&#x201C;Â&#x2014;Â&#x2021;Â&#x203A;Â&#x2018;Â?Â&#x2018;Â&#x2022;Â&#x2018;Â&#x203A;Â&#x2021;Â?Â&#x2019;Â&#x17D;Â&#x2021;Â&#x192;Â&#x2020;Â&#x2018;Â&#x2022;Â&#x2039;Â?Â&#x2020;Â&#x2039;Â&#x2026;Â&#x192;Â&#x17D;Â&#x2039;Â&#x153;Â&#x192;Â&#x2020;Â&#x2018;Â&#x2019;Â&#x192;Â&#x201D;Â&#x192; que no me tiren caca ehhhh! 28 de Noviembre Me gusta - Comentar Juanis CĂłrdoba Ă valos:

ÇŠ Â&#x192;Â&#x203A;ǼDzÂ&#x2014;Âą Â&#x201E;Â&#x2014;Â&#x2021;Â?Â&#x2018;Â&#x2022; Â&#x2022;Â&#x2021;Â?Â&#x2013;Â&#x2039;Â?Â&#x2039;Â&#x2021;Â?Â&#x2013;Â&#x2018;Â&#x2022;Çł Â&#x2019;Â&#x2018;Â&#x201D; Â&#x2019;Â&#x192;Â&#x201D;Â&#x2013;Â&#x2021; Â&#x2020;Â&#x2021;Â&#x17D; Dz Ǥ Â&#x203A;Â&#x2014;Â?Â&#x2013;Â&#x192;Â?Â&#x2039;Â&#x2021;Â?Â&#x2013;Â&#x2018;Çł Â&#x192;Â&#x17D; Â&#x2026;Â&#x2018;Â?Â&#x2019;Â&#x201D;Â&#x192;Â&#x201D;Â&#x2014;Â?Â&#x192;Â&#x2014;Â&#x2013;Â&#x2018;Â&#x2020;Â&#x2021;DzͳͲͲÂ?Â&#x2039;Â&#x17D;Â&#x2018;Â?Â&#x17E;Â&#x2022;ÇłÂ&#x2019;Â&#x192;Â&#x201D;Â&#x192;Â&#x17D;Â&#x2018;Â&#x2022;Â&#x2022;Â&#x2039;Â?Â&#x2020;Â&#x2039;Â&#x2026;Â&#x192;Â&#x17D;Â&#x2039;Â&#x153;Â&#x192;Â&#x2020;Â&#x2018;Â&#x2022;Â&#x2021;Â?Â&#x2021;Â&#x2022;Â&#x2013;Â&#x192;Â?Â&#x192;vidad del recurso de la gente necesitada, que con trabajo completa para Â&#x2019;Â&#x192;Â&#x2030;Â&#x192;Â&#x201D;Â&#x2039;Â?Â&#x2019;Â&#x2014;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x2018;Â&#x2022;ǨÂ&#x160;Â&#x2018;Â&#x201D;Â&#x192;Â&#x2022;Ă&#x20AC;Â&#x2014;Â?Dz Â&#x2018;Â&#x201E;Â&#x2039;Â&#x2021;Â&#x201D;Â?Â&#x2018;Â&#x2019;Â&#x201D;Â&#x2018;Â&#x201E;Â&#x192;Â&#x2020;Â&#x2018;ÇłÂ&#x152;Â&#x192;ÇĄÂ&#x152;Â&#x192;ÇĄÂ&#x152;Â&#x192;ÇĄÂ&#x2020;Â&#x2039;Â&#x2022;Â&#x2026;Â&#x2014;Â&#x17D;Â&#x2019;Â&#x2021;Â?Â?Â&#x2039; sarcasmo. 28 de Noviembre Me gusta - Comentar Anni Cortes:


Maguy Margarita Chitala GuzmĂĄn:




Alejandra Adame Bucio:

Que no inventen tanta gente que ni siquiera va a tener que llevarse algo a la boca o que pasa frĂ­o y ellos quieren utilizar el dinero en cosas que a mi Â&#x2019;Â&#x2014;Â?Â&#x2013;Â&#x2018;Â&#x2020;Â&#x2021;Â&#x2DC;Â&#x2039;Â&#x2022;Â&#x2013;Â&#x192;Â?Â&#x2018;Â&#x201E;Â&#x2021;Â?Â&#x2021;Ď?Â&#x2039;Â&#x2026;Â&#x2039;Â&#x192;Â&#x192;Â&#x17D;Â&#x192;Â&#x2026;Â&#x2039;Â&#x2014;Â&#x2020;Â&#x192;Â&#x2020;Â&#x192;Â?Ă&#x20AC;Â&#x192;ǤÇŠÂ&#x2014;Â&#x2021;Â&#x2019;Â&#x2039;Â&#x2021;Â?Â&#x2022;Â&#x2021;Â?Â&#x2021;Â?Â&#x17D;Â&#x192;Â&#x2022;Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2022;Â&#x2018;Â?Â&#x192;Â&#x2022; necesitadas y no en lujos! 28 de Noviembre Me gusta - Comentar Leticia GonzĂĄlez LĂłpez:

Yo trabajo en el ayuntamiento y claro que no estoy de acuerdo, mejor que lo inviertan en computadoras, en arreglos de escuelas, que buena falta hace, ya que el 90% de los planteles estĂĄn en mal estado, en vez de ponernos de pretexto para malgastar el dinero. 28 de Noviembre Me gusta - Comentar

JesĂşs VelĂĄzquez Aguilar:


Jorge Machado:

4XHORSDJXHHOFDELOGRHQWHUR 28 de Noviembre Me gusta - Comentar

MUJER Viernes 02 de diciembre de 2011


ÂĄBasta ya!

La violencia contra mujeres D~QQRKD¿QDOL]DGR(QSOHQR VLJOR ;;, OHMRV GH HUUDGLFDUVH ODV PXMHUHV D~Q VLJXHQ VXIULHQGRDJUHVLRQHVHQPDQRV GHKRPEUHV£%DVWD\D Actualmente, una de cada tres mujeres es maltratada alJXQDYH]HQVXYLGD¢&yPRHV esto posible?

ÂĄNO AL MALTRATO DE GĂ&#x2030;NERO! El maltrato estĂĄ latente en PXFKRV KRJDUHV GHO PXQGR D SHVDU GH ODV FDPSDxDV FRQWUD la violencia a la mujer, a nivel PXQGLDOODVHVWDGtVWLFDVVLJXHQ siendo alarmantes y cuando una mujer muere en manos de XQPDOWUDWDGRUWRGRVJULWDPRV DXQDVRODYR]ÂŁ%$67$<$ Cuando hablamos con una mujer maltratada, la escuchamos, sentimos pena por ella, pero en la mente nos queda XQD LQWHUURJDQWH ¢3RU TXp QR VH VHSDUD GH VX DJUHVRU" 3HUR VHUtD EXHQR WDPELpQ SUHJXQWDUQRV¢3RUTXppOODPDOWUDWD" Como sociedad o como personas, buscamos excusas y ra]RQHV MXVWLÂżFDU HO PDOWUDWR GH manera muy sutil, en ocasiones se culpa a la mujer, hasta se dan razones por las que la merece o se deja

maltratar. Consciente o inFRQVFLHQWHPHQWHVHMXVWL¿FDDO DJUHVRU FRPR ³XQ ERUUDFKR R XQHQIHUPR´³HVTXHDVtFUHFLy HQVXIDPLOLD´ +R\ HQ GtD VH KDQ SHUGLGR muchos de los valores morales que aprendimos en nuestros KRJDUHV SRU HMHPSOR VH KDEOD FRQVWDQWHPHQWH GH OD ³OLEHUDFLyQIHPHQLQD´HVXQWpUPLQR que se utiliza especialmente HQ ODV QXHYDV JHQHUDFLRQHV 0XFKDV PXMHUHV SUHJRQDQ D los cuatro vientos que la mujer SXHGH GHVHPSHxDU  PXFKRV roles, que en otra Êpoca eran DVLJQDGRVDOKRPEUHVHYDQDJORULDQ\SHOHDQSRUTXHSXHGHQ ocupar puestos importantes en HO VHFWRU S~EOLFR FRQWULEXLU tanto o mås que su pareja en ORVLQJUHVRVGHOKRJDU\DVSLUDU a mejorar su educación acadÊmica. A todo esto podemos DJUHJDUOH HO ³GHUHFKR´ GH OD PXMHUSDUDHVFRJHUVXYLGDtQtima con quien quiera y cuando quiera. 3HURD~QFRQWRGRHVRPXchas viven bajo un patrón de DEXVRV ItVLFRV \ SVLFROyJLFRV GHORVTXHD~QQRVHKDQSRGLGROLEHUDU6HGLFHPX\FRP~Qmente que la mujer ha sido insWUXLGDHQVXVKRJDUHVTXHVHOH ha inculcado a no rebelarse en contra el hombre. cont Los hombres por su parte, hacen vaOHU ³VXV GHUHFKRV´ OH EDVDGRV \ VHJXURV ED GH VX IXHU]D ItVLFD GH la mujer muchas veces calla y oculta vec el maltrato, porque muy a pesar de lo que ser discreta, siente debe d SRUTXH³ORVWUDSLWRVVXFLRV SRUTXH³ VH ODYDQ HQ FDVD´ \ QR VH denuncian, convirtiÊndose denuncia

HQ ³FyPSOLFHV´ GH OD YLROHQFLD LQWUDIDPLOLDU GH XQD VRFLHGDG PDFKLVWDVRSRUWDQGR\IRPHQtando con su silencio, el maltrato. Si nos detuviÊramos un momento a pensar las razones por las cuales la mujer que estå siendo maltratada y se queda HQXQDUHODFLyQGRQGHORVJROSHV ItVLFRV VRQ FDVL QRUPDOHV HQFRQWUDUtDPRV TXH ODV UD]Rnes pueden ser muchas, hay VHxDOHVTXHQRQHFHVLWDQVHUGLFKDVFRQSDODEUDVDVtTXHSRQJDPRVDWHQFLyQ El hombre encuentra motivos y excusas para continuar con el maltrato y el dominio soEUHODPXMHUHVWRHOHYDVXHJR al darse cuenta que atemori]DQGR\PDOWUDWDQGRFRQVLJXH sobajarla y someterla, haciÊndola sentir culpable.

â&#x20AC;&#x153;Noâ&#x20AC;? a la violencia SĂłlo nosotras mismas podemos y debemos detener la violencia, es nuestra responsabiliGDG FXLGDU QXHVWUD LQWHJULGDG ItVLFD \ PHQWDO 6yOR QRVRWUDV SRGHPRV SURWHJHU D QXHVWURV KLMRV VyOR W~ PXMHU TXH HVWiV siendo maltratada, puedes rescatar tu valor, tus derechos de mujer como un miembro importante de la sociedad. 'LJDPRVÂł1R´DODYLROHQFLD QR DO PDOWUDWR GH JpQHUR QR D ODV DJUHVLRQHV DEXVLYDV GHO KRPEUH´TXHVLQWHQHUQLQJ~Q GHUHFKR SURIDQD OD SHUVRQDOLGDGGHODPXMHUVXGLJQLGDG\ su esencia. Denuncia, hazte escuchar, no calles lo que sin palabras llora por justicia. ÂŁ12 $/ 0$/75$72 '( *e1(52

â&#x20AC;&#x153;...una de cada tres mujeres es maltratada â&#x20AC;&#x153;...u alguna vez en su vida.â&#x20AC;? Mascarilla para cutis graso: WD]DGH\RJXUW QDWXUDO

2 ½ cucharadas de miel de abeja


HORĂ&#x201C;SCOPOS Aries 21/Mar-20/Abr Escucha lo que un homA E EUHH[LWRVRWLHQHSRUGHFLUWHVREUHVXÂżORVRItD GHYLGD\ODPDQHUDHQODTXHSLHQVDSRGUtDV G ssacar mejor provecho a tus actividades, sus intenciones son buenas. te TTauro 21/Abr-21/May Ta 21/Ab 21/M Por mĂĄs que paP ĂĄ exitosa i rezca la trayectoria de ese hombre, encierra re PiVIUDFDVRVGHORVTXHWHLPDJLQDVSXHGHVHU P que intente proyectarse sobre ti haciĂŠndote q sentir que no vales. se GĂŠminis 22/May-21/Jun El dinero no serĂĄ SUREOHPDHQWXYLGDODHFRQRPtDHVWDUiGHWX S parte y es un buen momento para planear una p ÂżHVWD R XQD VDOLGD GLYHUWLGD HQ FRPSDxtD GH Âż quien amas. q CĂĄncer 22/Jun-23/Jul  $OJXLHQ D WX DOUHGHGRU eestĂĄ dispuesto a ayudarte para que no pierdas eel camino y encuentres la mejor manera de loJUDUWXVREMHWLYRVDVtTXHHVFXFKDORTXHWLHQH J que decir. q Leo 24/Jul-23/Ago &XLGDGR FRQ OD JHQWH TXH WHQJDVFHUFDSRGUtDVHVWDUDSUR[LPiQGRWHGHWH PDVLDGRDDOJXLHQTXHQRHVSUHFLVDPHQWHpWLP FFR\DTXLHQQROHLPSRUWDMXJDUVXFLRFXDQGR eestĂĄ aburrido. Virgo 24/Ago-23/Sep No estĂĄs soltando aquĂŠllas cosas del pasado que eran importantes ll para ti, pero que ya han terminado su ciclo en p WXYLGD(VLPSRUWDQWHTXHSRQJDVSXQWRÂżQDO WX $VtWXYLGDPHMRUDUi $ Libra 24/Sep-23/Oct 4XL]iWHVXUMDQSUHJXQWDVVREUHDOJXQRVDVSHFWRVGHWXYLGDTXHSXHWD GHQ G WUDHUWH DOJXQRV GRORUHV GH FDEH]D SHUR VHJXLUHVHFDPLQRVHUiXQDSpUGLGDGHWLHPSR VH \HQHUJtD \ Escorpion 24/Oct-22/Nov EstĂĄs esperando recibir ayuda de la persona equivocada. Probaci blemente estĂŠs poniendo tus huevos en la cab nasta incorrecta, hay quienes desean ayudar, n VyORKDFHIDOWDTXHYROWHHV Vy Sagitario 23/Nov-21/Dic Es posible que estĂŠs viendo la vida con pesimismo y por pensar que v todo to estarĂĄ mal no te estĂŠs dando permiso de GLVIUXWDUGHOREXHQRTXHWUDHFRQVLJRGLVIUXWD G mĂĄs m tu diario vivir. Capricornio 22/Dic-20/Ene Cuidado con los KDODJRVSRUTXHSRGUtDKDEHUDOJXQRVDGXODK dores intentando distraerte con sus palabras. d Trata de ser muy realista, no te dejes llevar T SRUORTXHGLJDQORVGHPiV S Acuario 21/Ene-19/Feb Es posible que la auVHQFLDGHDOJXLHQHVWpSHVDQGRPiVGHORTXH VH GHVHDUtDVDKRUDTXHQRWHDFRPSDxDHQHOFDG PLQRSXHGHSDUHFHUGLItFLO3HURW~SXHGHVVDP OLUDGHODQWH\VHUIHOL] OL Piscis 20/Feb-20/Mar $OJXQDVFRVDV\SHUVRnas n han cumplido su ciclo en tu vida, pero no estĂĄs dejando que se marchen, lo cual puede e traer problemas mĂĄs adelante. SĂłlo dĂŠjalos ir, tr que q ya lo han hecho.

SOCIALES Viernes 02 de diciembre de 2011

Comienzan los Festejos




DEPORTES Viernes 02 de diciembre de 2011


Gran Final

“Reencuentro Campeón” Reencuentro R e – Revolturas Estos dos equipos se enfrentaron para jugarse el título de “Campeón”. Arrancó el encuentro, los del “guaya” desde los primero minutos intentaron abrir el marcador, por su parte, los comandados por Erick Díaz también traían lo suyo. En la primer jugada, Erick la tuvo solo contra el portero, pero como si fuera de la selección mexicana la echó pa’ fuera y en una jugada a balón parado, el “ubre” puso el primer tanto a favor de los de Erick, así culminó el primer tiempo. En e En arrranq an a n ue ue de de del ell segundo, segu seg se un nd do do, o o,, tómala, tóm tó mal ma ala, a a, ell arranque

el Erick puso el 2 X 0 a su favor, pero en una reacción, el “palomita” descontó los cartones poniendo el marcador 2 X 1 y en otra buena jugada, de este mismo jugador, se empataron los cartones. Luego vinieron los de Erick para darse la ventaja del marcador de 3 X 2, pero los experimentados del “guaya” lograron empatar, incluso tuvieron que llegar hasta la vía de la pena máxima para definir al Campeón. El primero en tirar uno de los penales Cristian, quien estrelló en ell m marco fue fu fue e Cr rist stia st ia an n, q uie i n lla ae ssttrel e ló e ell ne a portería, finalmente coronaron de d e la la p por po orrtter o ería, ía fin ía nalm allme almen en ent nte sse nt e ccoro oro or o ron ro na a Campeones del Deportivo ReencuenCam C am a peo pe eo e one nes ess lo e loss d ell Dep Deport orttivo iv vo o Re R een enc e n nccu tro. ttr tro ro. ro esta estuvo presente En es En e est stta ccanchita anc an anc nchi nchit hit h itta estu e stuv uvo vo pre p rre esen se entte e el Secretario General Ismael del Toro, Sec S Se e eccre r ari ret rio G ri ene e en eneral nera n ral al Is smae mael ma el d el T el To o quien estuvo apoyando este qu q qui u uiien n est e ssttuvo vo o ap a poyando oya o yando ndo d a est e es st ste te deporte, manera por orte or te te, e, de de igual igua ig ual u a al m ma anera nerra ttuvo ner u o el uvo el honor no o de e hacer ha ace cer er entrega e tre en ega ga de e los lo trot feos felicitar all Camp Campeón. fe feo eoss y fe ellic icita ittarr a C am amp mpeón eó ón. ón.


Viernes 02 de diciembre de 2011


Liga infantil categoría 2000

Liga Independiente

La Roma - Diablitos

Oriente - Potros

En el empastado del Rápido, estos dos equipos jugaron el primer encuentro de la gran ¿QDO GH OD OLJD GHO ,QVWLWXWR GH Cultura, Recreación, Deporte, Billar, Carambola, Corte y Confección, donde curiosamente al Deportivo La Roma no le cayó la mala suerte del primer lugar y en este primer encuentro lograron propinarle una goleada a los enrojecidos Diablos de

San Miguel Cuyutlán con un marcador de 4 X 0. Próximo encuentro pregúntenle al instituto de Cultura. Por otro lado, en el empastado de los Esquíveles tampoco les fue bien a los Diablos de San Miguel, porque los Frijoleros también los recibieron con una goleada de 3 X 0, todo en el primer encuentro.

Este enfrentamiento se llevó a cabo en la unidad deportiva de Tlajomulco, después de que en el primer encuentro los del Oriente les propinaran 3 X 1, aunque todo parecía que sería diferente. Los potros venían con sus mejores equinos, pero en los

primeros minutos apareció el abuelo poniendo el 1 X 0 a favor del sol naciente y luego vino “Beckham” para poner el 2 X 0 y así culminó la primera parte donde el marcador global quedó 5 X 2. En la parte complementaria los humos empezaron a subir, se armó la tracalera y

pegándole unas guajoloteras al abanderado “pacquiao”, el 2ULHQWHSDVyDODJUDQ¿QDO Por otro lado, se midieron los Vaqueros contra el Aceites llevándose el triunfo los caballerangos de Lomas, quienes se jugarán la gran ¿QDO GH HVWD OLJD FRQWUD HO Deportivo Oriente.

Liga Dominical La Mejor

Duelo ejecutado en una fría mañana en la cancha del piratas, donde a pesar del fresco, estos jugadores no paraban y los enojados Chivas que venían de haber perdido ante el Querétaro se querían desquitar contra La

20. En el primer minuto de juego ya les habían puesto el 1 X 0 y antes de transcurrieran 20 minutos ya estaba el marcador 2 X 0 a favor de Las Chivas. En una última reacción de los de La 20 lograron descontar los cartones

terminando el encuentro con un marcador de 2 X 1. Por otro lado en la cancha de los Zalates se midieron el Copa Cabana y el Deportivo Tlajomulco, todo parecía fácil para el campeón, pero no contaban con

la astucia de los muchachitos de Tlajo, que les propinaron 2 X 0 en su propia cancha. ¿Qué paso chucky? ¿No te ayudó el cholo? Y de seguro el pecas no pudo meter el gol, suerte para la próxima.


Viernes 02 de diciembre de 2011

Liga Sabatina La Mejor Gran Final

Deportivo La Raza contra Deportivo San Isidro Mazatepec


LIGA INDEPENDIENTE ORIENTE A 4 â&#x20AC;&#x201C; â&#x20AC;&#x153;3 ESTRELLASâ&#x20AC;? 2 6H SHUÂżOD SDUD OD ÂżQDO GH OD FDWHJRUtD MXYHQLO ORV vochitos, que llevan la delantera. Los del fraccionamiento de la bloquera no pudieron con la artillerĂ­a de ORVMyYHQHVGHOHVSOHQGRU\TXLHUHQOOHJDUDODÂżQDO\DO parecer lo lograrĂĄn. Vochigoles de Alan Omar Carrillo, )UDQFLVFR-DYLHU5DPRV\Ă&#x2C6;QJHO*DUFtD<GHORVEORqueros Leonardo Daniel Goche.

FRIJOLEROS 3 â&#x20AC;&#x201C; GUADALAJARA 1 NomĂĄs tres tiros les dieron a las inofensivas cabras, que de paso les pararon su rachita de triunfos, los de los frijoleros querĂ­an hacer puntos porque llevaban varias derrotas y lo lograron con anotaciones de TriQLGDG*DUFtDÂł&KLOD´-DYLHU*DUFtD1DYDUUR\(XJHQLR GonzĂĄlez. Cabragol de William LomelĂ­.

Este partido se realizĂł en el empastado campo de San Isidro Mazatepec, entre el Deportivo La Raza y los de San Isidro, despuĂŠs de que en el primer encuentro, estos Ăşltimos perdieron con 1 X 0, pero el pasado sĂĄbado los de La Raza visitaron la cancha del San Isidro y lograron traerse el triunfo con un marcador de 2 X 0 y se coronaron Campeones de la liga sabatina la mejor.


ARSENAL 8 â&#x20AC;&#x201C; LOS TOROS 1 Sacaron la casta los del Eucaliptos al vencer cĂłmodamente a los jĂłvenes de los Nogales, que los bailaron, trapearon y de paso les dieron cĂĄtedra de futbol. Pero cĂłmo no, si jugaron con dos menos y sin cambios, mientras los otros se dieron el lujo de dejar en la EDQFDVLQMXJDUDYDULRV(PLOLR5DPRV-DYLHU&KiYH] y Miguel Ă ngel Torres. Cuernazo por los botines de Armando Cervantes.

EQUIPO DEL PUEBLO 2 â&#x20AC;&#x201C; BARCELONA 0 Lograron tres buenos puntos los del pueblo al vencer a los del barrio de la prepa, que de dos golazos los GHMDURQVLQSXQWRV\VLQRSFLyQGHOOHJDUDODÂżQDOGH &RSD*ROHVGH-XDQ'LHJR'HOJDGR

EGGMAN GYM 1 â&#x20AC;&#x201C; FLECHA ROJA 1 Igualaron los de la categorĂ­a sabatina libre, encuentro llevado a cabo en la PolitĂŠcnica, en un encuentro muy parejo, donde ambos equipos sudaron la camiseta y fue justo el resultado, ya que ambos merecĂ­an el WULXQIR*ROGH1Rp3DFDV&DOGHUyQ\Ă&#x20AC;HFKD]RGH(IUpQ RodrĂ­guez.

CHELSEA 2 â&#x20AC;&#x201C; ARSENAL 1 3RUÂżQJDQDURQORVFD\HWDQRVDOYHQFHUDORVGHOD sabatina de los Eucaliptos en un encuentro muy cerraGRSHURDOÂżQDOORJUDURQHOWULQIRORVORFDOHVKDFLHQGR valer su condiciĂłn. Goles de Cayetano Mercado y Alfredo GarcĂ­a. De los del fraccionamiento Carlos HernĂĄndez.

ROMA 3 â&#x20AC;&#x201C; ORIENTE 1 Segundo encuentro de cuarWRVGHÂżQDO'HVSXpVGHXQ;  TXH VH YLYLy HQ 6DQ -XDQ HO Ă guilas venĂ­a con todo para llevarse el triunfo y en una buena reacciĂłn, uno de los mejores jugadores de este pueblo, el â&#x20AC;&#x153;caĂąasâ&#x20AC;?, logrĂł poner el 1 X 0. TranscurrĂ­a el encuentro y se veĂ­a complicado para la dulcera, pero tenĂ­a que aparecer el â&#x20AC;&#x153;chavo del ochoâ&#x20AC;? y tĂłmala, les empataron los cartones. Otra vez se puso la dulcera

en ventaja, en la segunda parte que aparece otra vez el chavo y les puso el 2 X 1, pero en los Ăşltimos minutos, curiosamente el nazareno central marcĂł la pena Pi[LPDDIDYRUGHO6DQ-XDQ\ asĂ­ terminĂł el encuentro, con un empate. Gracias a la tabla de posiciones los dulceros salieron favorecidos y desde esta narraciĂłn les digo que pasaron como yo en la escuela. En San Miguel CuyutlĂĄn los

del RĂĄpido comandados por la Yoya, lograron pasar a la siguiente ronda, dejando atrĂĄs a los Tigres de la ribera. De igual forma, en el pueblo de La Calera, los Argentinos lograron derrotar a los Cachorritos y no podĂ­a faltar el triunfo del Piratas en la cancha del Santa Rosa. (VWRVVRQORVÂżQDOLVWDV MazapĂĄn VS RĂĄpido Piratas VS Argentinos

Cayeron los líderes de nueva cuenta con los juveniles del barrio de abajo en un encuentro llevado en la majestuosa unidad deportiva entre estos dos equipos y aprovecharon los visitantes que la vochada no se ajustó y claro, se los suenan dejåndolos casi fuera de la liguilla vochigoles de Gabriel Zúùiga.


POLICIACAS Viernes 02 de diciembre de 2011

Atentaron contra jefe policiaco

cometidos contra representantes de la autoridad. Los tres presuntos responsables fueron consignados por la Procuraduría de Justicia Estatal, luego que el pasado 18 de noviembre, en el cruce de Por Jorge López /DJR &XLW]HR \ DYHQLGD 3DWULD FRORQLD -DUGLQHV GHO &RXQWU\ Francisco Javier Araiza Sa- intentaron matar al supervisor lazar, con domicilio en Santa general de la Policía Municipal Clemencia, colonia Talpita, Fi- de Guadalajara. En el atentado, tres policías del García Alonso, vecino de la calle San Vicente en la colonia municipales resultaron lesio3DFt¿FR GHO 6DOWR \ %HQMDPtQ QDGRV \ XQR GH ORV SUHVXQWRV Sandoval Suårez de 29, ave- delincuentes murió, posteriorcindado en la calle Capulín, de PHQWH IXH LGHQWL¿FDGR FRPR la colonia Tulipanes, en Tlajo- Alejandro Segoviano Carrillo mulco de Zúùiga, recibieron GH  DxRV \ UHVLGHQWH GH 7ODDXWR GH IRUPDO SULVLyQ \ TXH- quepaque, Los dos primeros sujetos daron sujetos a proceso por los GHOLWRV GH KRPLFLGLR FDOL¿FDGR fueron detenidos a bordo de HQ JUDGR GH WHQWDWLYD \ GHOLWRV XQD FDPLRQHWD 'XUDQJR \ GH-

Ya duermen en prisiĂłn los tres responsables

clararon haber participado FRPR ÂłKDOFRQHV´ \ TXH LEDQ D SUHVWDU DSR\R D VXV FyPSOLces para sacarlos del lugar. El tercero confesĂł que su participaciĂłn consistiĂł en llevar un DXWR-HWWDFRQDUPDVGHIXHJR\ â&#x20AC;&#x153;halconearâ&#x20AC;?. A los delincuentes se les aseguraron seis camionetas tres GH HOODV EOLQGDGDV \ XQD UREDda minutos antes del atentado, ademas todo un arsenal, inteJUDGRSRUULĂ&#x20AC;HVGHDVDOWRSLVWRODVFXHUQRVGHFKLYR\FKDOHFRV antibalas. Luego del fallido atentado la SROLFtD DVHJXUy XQD ÂżQFD HQ OD calle CapulĂ­n, en la colonia Tulipanes en Tlajomulco de Zúùiga GRPLFLOLRGH%HQMDPtQ6DQGRval SuĂĄrez), donde se encontraron tres de los fusiles AR-15.


Acuchillado en riĂąa Por Jorge LĂłpez Marco Antonio Ă lvarez SĂĄnchez de 23 aĂąos fue detenido en Chulavista, luego de haber agredido con un cuchillo a Jaime Ricardo Gaeta GarcĂ­a, el pasado lunes. Los elementos de la policĂ­a municipal recibieron el reporte de una riĂąa en la calle de la Culebra, por lo que de inmediato se trasladaron al lugar, al llegar, encontraron a Ricardo en el suelo, herido con arma blanca. Los mirones de la disputa, informaron a la policĂ­a el rumbo por donde huĂ­a el agresor, por lo que procedieron a su bĂşsqueda, una vez que localizaron al agresor, lo revisaron, asegurĂĄndole dos cuchillos. Ă lvarez SĂĄnchez, junto con sus armas, fueron puestos a disposiciĂłn del Juez municipal, mientras que Jaime fue trasladado al Hospital Civil.

PerdiĂł el vuelo por escandalizar

Incendio provocado El combustible fue un montĂłn de llantas viejas Por VĂ­ctor Maldonado El dĂ­a 29 de noviembre en plena zona centro de Tlajomulco cabecera, se pudo observar una columna de humo negro provocada por un incendio, esto en la calle ConstituciĂłn, en el predio con nĂşmero 36, casi en esquina con Flaviano Ramos. Se trataba de un montĂłn de llantas viejas que se encontraban en llamas, dado el temor de los vecinos de que el siniesWURDIHFWDUDVXVKRJDUHV\QHJRcios, fue que algunos intentaron sofocar el fuego, mientras que otros dieron aviso a protecFLyQFLYLO\ERPEHURV

En poco mĂĄs de 10 minutos, ORV HOHPHQWRV GH ERPEHURV \D VHHQFRQWUDEDQHQHOOXJDU\KDbĂ­an controlado el asunto, aunque la causa de dicho incidente QRSXGRVHUHVSHFLÂżFDGD

Por Jorge LĂłpez %HW]DLGD$ELVDQJGHOD7Rrre de 29 aĂąos de edad, originaria de la ciudad de CoahuiODEHELyVHHPEULDJy\DUPy tremendo escĂĄndalo en el Aeropuerto Internacional Miguel Hidalgo, por lo que perGLy VX YXHOR \  IXH GHWHQLGD por la policĂ­a de Tlajomulco. Los hechos se registraron el domingo 27 por la noche, cuando la policĂ­a recibiĂł un llamado porque al interior de la terminal aĂŠrea, una mujer ebria escandalizaba. Al llegar a la sala 9 del aeropuerto, donde pasajeros abordaban un vuelo, los uniformados fueron recibidos con insultos \DPHQD]DVSRUSDUWHGH%HW-

zaida, quiĂŠn se ostentĂł como Licenciada en Derecho. No obstante las â&#x20AC;&#x153;advertenciasâ&#x20AC;? de la mujer, fue detenida \UHPLWLGDDQWHHO-XH]PXQLcipal.

Se suicidĂł Por Jorge LĂłpez

entrada del patio de su casa, el lunes 28 por la maĂąana. *XDGDOXSH %HFHUUD 5XHODV $O UHDOL]DU OD LGHQWLÂżFDFLyQ de 58 aĂąos, se quitĂł la vida, RÂżFLDO VX KLMD LQGLFy TXH ahorcĂĄndose en su domicilio, la casa donde fue hallado ubicado en la calle Los Setos su padre era propiedad de en Jardines de San SebastiĂĄn, pO \ TXH KDEtD LGR HO  GH Municipio de Tlajomulco, noviembre a revisarla, pordonde fue encontrado por su que le dijeron que se habĂ­an compaĂąera de trabajo que metido a robar, sin embargo dijo desconocer el motivo pasĂł a recogerlo. Su cuerpo fue encontra- por el que su padre decidiĂł do colgado de un lazo en la suicidarse.

Viernes 09 de diciembre de 2011


ÂżQue traĂ­a quĂŠ?

Por Víctor Hugo Ornelas Edgar López Tinoco de 30 aùos, quien se desempeùaba como funcionario público, a cargo de la entrega de cartillas militares en el municipio de Tlajomulco de Zúùiga, fue detenido el primero de diciembre, justo en el marco del segundo informe de gobierno. Y es que por increíble que parezca, este sujeto, junto con Filiberto à valos Arellano y Verónica Yazmín à valos Arellano, esta última, presuntamente su pareja sentimental, intentaron ingresar a las instalaciones de la nueva unidad administrativa ubicada en la cabecera municipal con 261 pastillas psicotrópicas.

Los vecinos lo atraparon Por Jorge LĂłpez Cuando hay uniĂłn y solidaridad, el hampa se topa con paUHGHVWRVHSXVRGHPDQLÂżHVWR el dĂ­a 7 de diciembre, cuando

vecinos del fraccionamiento Cima del Sol, detuvieron a Luis Alberto Cruz HernĂĄndez de 31 aĂąos, luego de que se metiĂł a robar en una casa, posteriormente fue entregado a la policĂ­a municipal. Al llegar la policĂ­a a circuito Ayax, se encontraron que vecinos de ese lugar tenĂ­an retenido a Luis Alberto. El hampĂłn tiene su domicilio en la calle de encino, en el mismo fraccionamiento. El presunto delincuente fue puesto ante el Juez Municipal. Los vecinos esperan que de ahora en adelante los delincuentes se la piensen dos veces antes cometer sus fechorĂ­as en Cima del Sol.

Por ladrĂłn lo arrestaron Por Jorge LĂłpez Francisco Javier Alvarado Lozano de 33 aĂąos fue detenido por la policĂ­a, el pasado sĂĄbado 3 por la maĂąana, luego de que junto con su cĂłmplice robaron objetos varios de una casa-habitaciĂłn en Balcones de la Calera. Ese dĂ­a, alrededor de las ocho de la maĂąana, los elementos policĂ­acos recibieron una llamada de auxilio informando de robo a un domicilio. Al llegar al lugar, los vecinos les indicaron que dos sujetos sa-

lieron de una casa ubicada en Avenida Panamericana, llevando consigo el botĂ­n. De inmediato, los policĂ­as se avocaron a la bĂşsqueda, ubicaron a los presuntos ladrones en la carretera a CajititlĂĄn, a la altura del kilĂłmetro 1.5, donde le marcaron el alto a Francisco Javier, que llevaba una tarja de cocina, tubo para gas LP, pinzas, desarmador y llaves de agua. Su cĂłmplice se dio a la fuga. Detenido y objetos robados fueron puestos a disposiciĂłn del juez municipal.

SegĂşn el reporte de la policĂ­a, los antes mencionados pretendĂ­an entrar al lugar donde el presidente municipal rendirĂ­a su informe, sin embargo, tras hacerles una revisiĂłn, los elementos notaron un paquete envuelto en un papel de color cafĂŠ, el cual Edgar LĂłpez argumentĂł que se trataba de un â&#x20AC;&#x153;loncheâ&#x20AC;?, pero cuando los policĂ­as pidieron que lo mostrara, el antes funcionario pĂşblico se mostrĂł agresivo y prepotente, incluso intentĂł arrebatar el paquete y huir. Esto Ăşltimo no le fue posible lograrlo, debido a que los uniformados notaron que en el interior del papel se encontraba una bolsa con pastillas, al parecer metanfetaminas, por lo que procedieron


con la detenciĂłn de los tres sujetos que juntos querĂ­an ingresar al lugar donde se realizĂł el informe presidencial. Tras el arresto, tanto Edgar LĂłpez como VerĂłnica JazmĂ­n Ă valos seĂąalaron que el envoltorio era propiedad del seĂąor Filiberto, mismo que aceptĂł dicha declaraciĂłn. Los tres involucrados fueron trasladados a las instalaciones de la cĂĄrcel municipal y mĂĄs tarde fueron presentados ante instancias federales, donde enfrentan cargos por aportaciĂłn de sustancias prohibidas. En cuanto a su cargo como servidor pĂşblico, Edgar LĂłpez Tinoco, fue dado de baja y ya hay otra persona cubriendo sus funciones.

Pleito entre camioneros La cabecera municipal fue escenario de una riĂąa entre choferes Por VĂ­ctor Hugo Ornelas JosĂŠ Federico Ă lvarez MacĂ­as y Juan Ricardo Ruvalcaba BarrĂłn, fueron detenidos la maĂąana del martes 7 de diciembre luego de ser seĂąalados y reconocidos como los agresores de Gustavo RodrĂ­guez Ruiz.

La vĂ­ctima, segĂşn se le reportĂł a la policĂ­a municipal, fue abordada en el nĂşmero 11 de la calle Independencia en Tlajomulco cabecera por los sujetos detenidos, quienes comenzaron a golpearlo con un tubo, causĂĄndole diversas lesiones, por lo que tuvo que ser transferido a la clĂ­nica de urgencias de la zona del valle. Tras el reporte de la agresiĂłn, los uniformados comenzaron la bĂşsqueda de los presuntos agresores, quienes se habĂ­an retirado del lugar, al parecer, a bordo de un camiĂłn de pasajeros del Servicios Vi-

llegas de Tlajomulco, mismo que fue ubicado alrededor de 20 minutos despuĂŠs del reporte sobre la calle ProlongaciĂłn Escobedo. Los uniformados les marcaron el alto y al revisar la unidad localizaron un tubo con el que se presume pudieron haber golpeado a la vĂ­ctima, ademĂĄs, fueron presentados ante los reportantes, quienes ORV LGHQWLÂżFDURQ SOHQDPHQWH como los agresores. Los chĂłferes fueron detenidos y enviados a la cĂĄrcel municipal, mientras que la unidad de transporte fue asegurada.

PASATIEMPOS Viernes 02 de diciembre de 2011


1. Resistirse a acceder a las pretensiones de otro, en tres palabras. 2. Representación de una persona real y verdadera. Pueblo de Málaga. 3. Filólogo francés, el creador de la semántica. Ablandar. 4. Poeta considerado como el padre de la poesía lírica francesa. Título croata a los que gobernaban un territorio. 5. Acción considerada e impensada. Sitios donde abundan unos árboles que pueden ser llorones. 6. Se suele pronunciar al descolgar el teléfono. Río de Perú que se une al Marañón para formar el Amazonas. &LHUWRVDUUHRVGHODVFDEDOOHUtDV9R]LQJOHVDTXHVLJQL¿FDUHG 8. Dinastía de reyes persas derrocada por lo árabes. Quieto caballo.



VERTICALES 1. Grupo de islas situadas al noroeste de Escocia. 2. Que se reproduce sin necesidad de otro sexo. 3. Parajes pantanosos. 4. Neurólogo portugués, Premio Nobel de Medicina en 1949. 7LULWDVGHIUtR6X¿MRItVLFR 6. Matrícula andaluza. Arbol chileno empleado en la fabricación de muebles. 7. Enseñad los buenos usos de urbanidad. 8. Médico danés,Premio Nobel de Medicina en 1926. 9. En esta vida temporal. 10. Dieran vueltas en círculo. 11. Son para mearse. 12. Continuación del 1 horizontal. Alfonso Pons Esquerdo, llamado ---. (GL¿FLRSDUDKDELWDU1RPEUHGHGRVLVORWHVGH*XLQHD(FXDtorial.







Respuesta semana anterior



Instrucciones: Coloque los números del uno al nueve, sin que ZLYLWP[HULUJHKH\UHKLSHZÄSHZJVS\TUHZ y cuadros.



Viernes 02 de diciembre de 2011







ÂĄOportunidad! Se venden en Lomas de Santa Anita Residencial, frente al crucero de Tlajomulco 713 metros con 25 metros de frente, esquina, aproveche a valor predial $955,000.00. Se acepta auto. Informes al: 37 19 32 21, 33 11 32 72 67 Ăł ID: 52*11*21508.

Los Fresnos, Chulavista, Santa Fe y alrededores de Tlajomulco. Informes al: 33 31 72 58 83 Ăł 38 12 26 99, de 9 am a 7 pm.

consultas y comisiĂłn por venta de medicamentos. Informes al: 32 83 44 25.

a 45 aĂąos, sexo masculino, sueldo $4,500 al mes. Informes al: 32 83 44 25.

Parra y Santa Cruz de las Flores, de 25 aĂąos en adelante, sexo indistinto, sueldo $10,000 a $13,000 aproximadamente. Informes al: 32 83 44 25.

Se vende terreno en Tierra de Esperanza de 7 X 17 a tratar. Informes al: 33 14 03 81 94 y 33 31 11 68. Se vende terreno en fraccionamiento Tierra de Esperanza en Tlajomulco, de 7 X 16. Informes al: 33 15 73 77 00 Ăł 55 49 87 89 06. Se venden lotes a un lado de la cruz verde en Tlajomulco de 10 x 20 y 7 x 20, tambiĂŠn en San Juan Evangelista. Con facilidades. Y rento casa en Tlajomulco. Informes al: 33 14 86 81 61 con RamĂłn Olivares Pulido.

Varios Vendo perro labrador de 10 meses. Informes al: 33 11 73 73 22. Vendo paquete de muebles para estĂŠtica, tocador doble, 3 sillas de corte, mesa auxiliar, 2 sillas de espera y labacabezas. Informes al: 33 11 74 76 32. Se vende mesa profesional para uĂąas, seminueva, en excelente estado. Informes al : (044) 33 13 42 49 94.

Casas Se vende casa con todos los servicios en Ocampo #89-A. Informes al: 33 13 48 99 99. Vendo casa en Lomas de Zapopan, calle Antequera #1316 frente al parque, extensiones 7 X 17.50 metros, cochera para 2 autos, 2 patios, 2 recĂĄmaras, cocina, baĂąo completo, amplia estancia. Informes al: 38 34 41 84 Ăł 33 38 14 94 71. ÂĄBuen precio!

Autos Se vende Platina standard mod. 2003, 75.000 Km, color Oro $42,000 a tratar. Informes al tel: 33 15 18 44 45 Ăł 33 34 07 07 30 Platina automĂĄtico mod. 2005, color plata $50,000 a tratar. Informes al tel: 33 15 18 44 45 Ăł 33 34 07 07 30

Empleos Se hacen todo tipo de trabajos en pintura, casas, escuelas, llĂĄmame: 33-17-09-58-48. Solicito Ingeniero en Sistemas Ăł Licenciado en informĂĄtica, experiencia en programaciĂłn C++ (de preferencia con conocimientos en manejo GH ,QWHUID] JUiÂżFD \ ;0/  LQJOpV intermedio, trabajo desde casa, sueldo $1,000 semanales. Oportunidad de crecimiento. Interesados enviar curriculum a Gana! Medio tiempo $10,000 mensuales, tiempo completo $20,000 mensuales, para personas dinĂĄmicas de alto rendimiento $35,000 mensuales como empresario independiente de Omnilife. Informes al: 33 14 60 08 27. Empresa en expansiĂłn solicita personal de ambos sexos, sueldo atractivo, de preferencia que vivan en

Se solicita auxiliar administrativo, escolaridad preparatoria, en Plaza del Sol, de 23 a 35 aĂąos, sexo femenino, sueldo en entrevista. Informes al: 32 83 44 25. Se solicita personal de inspecciĂłn, escolaridad preparatoria, en Tlajomulco y Tlaquepaque, de 20 a 45 aĂąos, sexo masculino, sueldo $7,500 al mes. Informes al: 32 83 44 25. 6HVROLFLWDGLVHxDGRUJUiÂżFRHVFRODULGDG WpFQLFR HQ GLVHxR JUiÂżFR HQ Paseos del Sol (a espaldas tianguis del Sol), sexo femenino, sueldo $3,000 inicial al mes. Informes al: 32 83 44 25. Se solicita encargado de tienda, escolaridad preparatoria, en LĂłpez 0DWHRV GH  D  DxRV VH[R LQGLVtinto, sueldo base mĂĄs comisiĂłn. Informes al: 32 83 44 25. Se solicita personal para atenciĂłn a clientes, escolaridad preparatoria o licenciatura trunca, en PerifĂŠrico Sur y ColĂłn, de 18 a 34 aĂąos, sexo indistinto, sueldo $9,000. Informes al: 32 83 44 25. Se solicita cantinero con inglĂŠs bĂĄsico, escolaridad preparatoria, en Aeropuerto, de 20 a 35 aĂąos, sexo masculino, sueldo $8,000 mensuales. Informes al: 32 83 44 25. Se solicita personal para atenciĂłn a clientes, escolaridad preparatoria, en Agua Blanca, de 18 a 28 aĂąos, sexo femenino, sueldo atractivo. Informes al: 32 83 44 25. Se solicita auxiliar administrativo, escolaridad preparatoria trunca o terminada, en San AgustĂ­n, de 18 a 25 aĂąos, sexo masculino, sueldo $4,000 mensuales. Informes al: 32 83 44 25. Se solicita mĂŠdico general, escolaridad licenciatura en medicina, en Tlajomulco, sexo indistinto, sueldo $800 mĂĄs cobro de consulta. Informes al: 32 83 44 25. Se solicita personal de soporte tĂŠcnico, escolaridad ingenierĂ­a o tĂŠcnico en informĂĄtica o sistemas, en Santa Cruz de las Flores, de 22 a 35 aĂąos, sexo masculino, sueldo de entrevista. Informes al: 32 83 44 25. Se solicita supervisor de contabilidad, escolaridad licenciatura en contadurĂ­a pĂşblica, en las cuatas, de 20 a 30 aĂąos, sexo indistinto, sueldo $9,000 mensuales. Informes al: 32 83 44 25. Se solicita enfermera, escolaridad licenciatura, con cĂŠdula, en LĂĄzaro CĂĄrdenas, de 27 a 35 aĂąos, sexo indistinto, sueldo $7,900 mensuales. Informes al: 32 83 44 25. Se solicita contador, escolaridad licenciatura, en San AgustĂ­n, de 28 a 35 aĂąos, sexo indistinto, sueldo segĂşn aptitudes. Informes al: 32 83 44 25. Se solicita contador, escolaridad licenciatura, en El Salto, de 25 a 30 aĂąos, sexo femenino de preferencia soltera, sueldo $8,000 mensuales. Informes al: 32 83 44 25. Se solicita ejecutiva de cuenta, escolaridad licenciatura en negocios internacionales, en El Salto, de 21 a 25 aĂąos, sexo femenino, sueldo $2,500 mensuales. Informes al: 32 83 44 25. Se solicita contador pĂşblico, escolaridad licenciatura, en Tlajomulco, de 28 a 35 aĂąos, sexo indistinto, sueldo $10,000 mensuales. Informes al: 32 83 44 25. Se solicita mĂŠdico general, escolaridad licenciatura, con cĂŠdula profesional, en Toluquilla, sexo indistinto, sueldo $2,775 mensuales mĂĄs cobro de

Se solicita inspector de procesos, escolaridad ingeniero quĂ­micofĂĄrmaco-biĂłlogo titulado o carrera WUXQFD HQ /ySH] 0DWHRV GH  D  aĂąos, sexo indistinto, sueldo $5,000 mensuales. Informes al: 32 83 44 25.

Se solicitan encuestadoras, escolaridad primaria o secundaria, en Tlajomulco, de 18 a 25 aĂąos, sexo femenino, sueldo mĂ­nimo. Informes al: 32 83 44 25.

Se solicita gerente de planta, escolaridad ingeniero industrial, en Santa Cruz de las Flores, de 23 aĂąos en adelante, sexo masculino, sueldo de entrevista. Informes al: 32 83 44 25.

Se solicita costurera, escolaridad primaria o secundaria, en el Ă lamo Industrial, de 22 a 40 aĂąos, sexo femenino, sueldo $750 semanales. Informes al: 32 83 44 25.

Se solicita ingeniero en proceso, escolaridad ingeniero quĂ­mico, en Tulipanes, de 20 a 35 aĂąos, sexo masculino, sueldo $8,000 mensuales. Informes al: 32 83 44 25.

Se solicita cantinero, escolaridad secundaria, en Plazas Outlet, de 18 a 30 aĂąos, sexo indistinto, sueldo $3,180 mĂĄs propinas. Informes al: 32 83 44 25.

Se solicita jefe de piso, escolaridad preparatoria o licenciatura, en Plaza del Sol 3, Arboledas 2, Centro Sur 1 \ 0DULDQR 2WHUR  GH  D  DxRV sexo indistinto, sueldo $4,500. Informes al: 32 83 44 25.

Se solicitan meseros, escolaridad primaria o secundaria, en Plazas Outlet, de 18 a 33 aĂąos, sexo indistinto, sueldo $2,400 mensuales mĂĄs propinas. Informes al: 32 83 44 25.

Se solicita gerente de tienda, escolaridad licenciatura trunca o terminada, en Tlajomulco, de 23 a 50 aĂąos, sexo indistinto, sueldo $10,000. Informes al: 32 83 44 25. Se solicita reclutadora, escolaridad licenciatura en administraciĂłn, psicologĂ­a o recursos humanos, en Guadalajara, de 23 a 35 aĂąos, sexo indistinto, sueldo $3,500 base mĂĄs bonos al mes. Informes al: 32 83 44 25. Se solicita enfermera, escolaridad licenciatura, en Tlajomulco, de 20 a 40 aĂąos, sexo femenino, sueldo $2,500 quincenales. Informes al: 32 83 44 25. Se solicita chofer de camioneta, escolaridad primaria, en Tlajomulco, de 20 a 45 aĂąos, sexo masculino, sueldo $1,300 semanales. Informes al: 32 83 44 25. Se solicita ayudante de chofer forĂĄneo, escolaridad secundaria, en 6DQ ,VLGUR 0D]DWHSHF GH  D  aĂąos, sexo masculino, sueldo $3,200 de inicio, a los 3 meses $4,000 y a los 6 meses $4,500. Informes al: 32 83 44 25. Se solicita chofer, escolaridad primaria, en Buenavista, de 18 aĂąos en adelante, sexo masculino, sueldo $1,000 semanales. Informes al: 32 83 44 25. Se solicita repartidor motociclista, escolaridad secundaria, en San AgustĂ­n, de 18 a 25 aĂąos, sexo masculino, sueldo $800 semanales mĂĄs bono dominical. Informes al: 32 83 44 25. Se solicita chofer vendedor, escolaridad secundaria, en Avenida 0RFWH]XPD GH  D  DxRV VH[R masculino, sueldo $4,800 al mes aproximadamente. Informes al: 32 83 44 25.

Se solicita descargador, escolaridad secundaria, en Agua Blanca, de 20 a 39 aĂąos, sexo masculino, sueldo base mĂ­nimo mĂĄs bonos. Informes al: 32 83 44 25. Se solicita ayudante de cocina con experiencia, escolaridad primaria, en Plazas Outlet, de 18 a 35 aĂąos, sexo indistinto, sueldo de entrevista. Informes al: 32 83 44 25. Se solicitan costureras, escolaridad primaria, en San AgustĂ­n, de 18 a 50 aĂąos, sexo indistinto, sueldo $600 a $800 semanales, segĂşn aptitudes mĂĄs bonos. Informes al: 32 83 44 25. Se solicita auxiliar de cocina, escolaridad secundaria, en CopĂŠrnico y /ySH] 0DWHRV GH  D  DxRV VH[R femenino, sueldo $850 mĂĄs propinas. Informes al: 32 83 44 25. Se solicitan costureras con experiencia, escolaridad primaria, en 6DQ0LJXHO&X\XWOiQVH[RLQGLVWLQWR sueldo $800 semanales. Informes al: 32 83 44 25. Se solicita empleado general, escolaridad secundaria, en Plazas Outlet, de 16 a 22 aĂąos, sexo indistinto, sueldo $600 semanales. Informes al: 32 83 44 25. Se solicitan tapiceros, escolaridad primaria, en Santa Cruz de las Flores, de 18 aĂąos en adelante, sexo masculino, sueldo $1,000 semanales. Informes al: 32 83 44 25. Se solicita costurera, escolaridad primaria, en Santa Cruz de las Flores, sexo indistinto, sueldo $1,000 semanales. Informes al: 32 83 44 25. Se solicita mesero vendedor, escolaridad secundaria o preparatoria en Plazas Outlet, de 18 a 30 aĂąos, sexo indistinto, sueldo de entrevista. Informes al: 32 83 44 25.

Se solicitan repartidores, escolaULGDG VHFXQGDULD HQ HO 0DQDQWLDO mayor de 18 aĂąos, sexo masculino, sueldo $600 semanales mĂĄs propinas. Informes al: 32 83 44 25.

Se solicita encargado de tienda, escolaridad preparatoria, de 25 a 55 aĂąos, sexo indistinto, sueldo por comisiones de $10,000 a $13,000. Informes al: 32 83 44 25.

Se solicita chofer de reparto, escolaridad primaria, en Santa Cruz de las Flores, zona industrial, de 19 a 45 aĂąos, sexo masculino, sueldo de $4,000 a $5,000 ya con comisiones. Informes al: 32 83 44 25.

Se solicita lĂ­der de tienda, escolaridad preparatoria o tĂŠcnico, en Pedro

Se solicitan cocineros, escolaridad secundaria, en Plaza del Sol 3, ArboleGDV&HQWUR6XU\0DULDQR2WHUR de 20 a 35 aĂąos, sexo indistinto, sueldo $4,300. Informes al: 32 83 44 25. Se solicitan auxiliares de cocina, escolaridad primaria, en Plaza del 6RO$UEROHGDV&HQWUR6XU\0Driano Otero 2, de 18 a 45 aĂąos, sexo indistinto, sueldo $2,773 al mes. Informes al: 32 83 44 25. Se solicitan jefes de cocina, escolaridad secundaria, en Plaza del Sol 3, $UEROHGDV  &HQWUR 6XU  \ 0DULDQR Otero 2, de 22 a 35 aĂąos, sexo indistinto, sueldo $5,700 al mes. Informes al: 32 83 44 25. Se solicita costurera, escolaridad primaria o secundaria, en El Palomar, de 18 a 35 aĂąos, sexo indistinto, sueldo por destajo. Informes al: 32 83 44 25. Se solicita gestor de cobranza especial y difĂ­cil, con moto o carro, escolaridad licenciatura terminada ĂĄreas econĂłmico administrativas, de 25 a 55 aĂąos, sexo masculino, sueldo $18,000 primer mes, despuĂŠs base mĂĄs comisiĂłn. Informes al: 32 83 44 25. Se solicita localizador, escolaridad preparatoria terminada, en varios lugares, de 20 a 50 aĂąos, sexo indistinto, sueldo $5,000 el primer mes. Informes al: 32 83 44 25. Se solicita gestor de cobranza intermedia o preintermedia, escolaridad preparatoria o licenciatura trunca, ĂĄrea administrativa o legal, en varios lugares, de 23 a 50 aĂąos, sexo indistinto, sueldo $9,000 el primer mes. Informes al: 32 83 44 25. Se solicita empleado general, escolaridad secundaria, en Santa Anita, San AgustĂ­n, Santa Fe y San SebastiĂĄn, de 18 aĂąos en adelante, sexo indistinto, sueldo $800 mĂĄs incentivos. Informes al: 32 83 44 25. Se solicitan cajeros promotores, escolaridad preparatoria, en Provenza, de 18 a 25 aĂąos, sexo indistinto, sueldo $3,900 mĂĄs comisiones. Informes al: 32 83 44 25. Se solicita cajera, escolaridad secundaria, en varios lugares, de 20 a 40 aĂąos, sexo femenino, sueldo $3,800 mensuales. Informes al: 32 83 44 25. Se solicita cajero, escolaridad preparatoria, en La Tijera, de 18 aĂąos en adelante, sexo indistinto, sueldo $3,000 mensuales. Informes al: 32 83 44 25. Se solicita cajero (a), escolaridad secundaria, de 18 a 51 aĂąos, sexo indistinto, sueldo de $2,800 a $3,500 segĂşn aptitudes. Informes al: 32 83 44 25. Se solicita cajero (a), escolaridad preparatoria, en Centro Sur y en el centro de Guadalajara, de 23 a 43 aĂąos, sexo indistinto, sueldo $5,500 al mes. Informes al: 32 83 44 25.

Se solicitan encuestadores, escolaridad preparatoria, en Tlajomulco, de 18 aĂąos en adelante, sexo indistinto, sueldo $3,000 al mes. Informes al: 32 83 44 25. Se solicita cargador y ayudante, escolaridad primaria, en Tlajomulco, de 18 a 45 aĂąos, sexo masculino, sueldo $1,000 semanales. Informes al: 32 83 44 25. Se solicita jardinero, escolaridad secundaria, en Los Gavilanes, de 25

TELĂ&#x2030;FONOS T E DE EMERGENCIA DE TLAJOMULCO ProtecciĂłn Civil y Bomberos 37 98 15 98 Emergencias 066 Seguridad PĂşblica 32 83 45 45

Servicios MĂŠdicos Municipales 37 98 14 80 Agua Potable 32 83 44 56 Alumbrado PĂşblico 37 98 00 32 ext 3740

Denuncia Ciudadana 32 83 44 48 Denuncia AnĂłnima al EjĂŠrcito 01 800 83 24 771 Perrera Municipal 37 98 45 03

Edicion 582 02-dic-2011  

Edicion impresa 582 Semanario La Verdad de Tlajomulco del 02 de diciembre de 2011

Read more
Read more
Similar to
Popular now
Just for you