Issuu on Google+

theRDstore.com

a division of Restaurant Depot

Order By PhOne

Order Online

Toll Free 866-761-3502 Fax 617-389-0033

www.theRDstore.com

24 24 77

Hours hours AaDay day Days days Week aAweek

1,000s

OF ITEMS AVAIL

at www.theRDs ABLE tore.com

866-761-3502

theRDstore .com

Foodservice Equipment & Supplies

2013-2014

BROWSE THROU GH

FOODSERVICE EQUIPMENT & SUPPLIES REFERENCE GUIDE 2013-2014

• Lay-Out Design Services Available • • Leasing Available • • Special Orders Accepted • • All Major Credit Cards Accepted •

Tabletop Catering Glassware Cookware Ovenware Food Safety Bar Supplies Kitchen Utensils Prep Equipment Beverage Equipment Cooking Equipment Storage & Transport Holding Equipment Refrigeration Furnishings Sanitation Textiles Janitorial Tabletop Catering Glassware Cookware Ovenware Food Safety Bar Supplies

a division of Restaurant Depot

“Revolutionizing the way you shop for Equipment & Supplies”

REFERENCE GUIDE

RDstore_Cover_v1_2013_Layout 1 4/2/13 10:55 AM Page 1


Welcome to the 2013/2014 Product Reference Guide! This guide is designed to be used as a quick comprehensive reference that showcases products from industry leading foodservice equipment and supplies manufacturers. We’ve included dozens of new and innovative foodservice products to keep you up to date with the latest technology in the industry, and we’ve also included some old favorites. Our commitment is to help you meet your goals. We use our strong partnerships with these leading manufacturers and our commitments to expertise in our field to enhance your business. By partnering with us, you can spend more of your time focusing on your customer.

How To Find What You Need Look in the Category Index on page 2. Look for products offered by a specific supplier in the Supplier Index on page 3. Look for the type of product in the Product Index on pages 4 and 5. Should you want something you cannot find in this catalog, please call us and we’ll be glad to help you.

Customer Service We value our customers highly and are dedicated to offering each and every one of you the best products and services available. Our business has been built on a foundation of service, knowledge, expertise, training and commitment. Our informed salespeople will share essential product information and help you as you make important buying decisions. As your “partner” in business, our objective is your long-term success. Our Membership in SEFA, the national foodservice marketing, buying and training group, is an honor awarded only to the very best in the industry. We meet stringent requirements in market leadership, education, finance and marketing. As SEFA Members, we can provide tools such as this Reference Guide to help you train your employees and to help you find the right equipment and supplies to meet your needs.

Food for Thought We’d like to express our thanks to the many fine chefs who submitted a favorite recipe or tip. Top Chefs are featured throughout the guide. Look for an index of Featured Chefs on pages 6 & 7. You’ll also find tips of the trade to keep you informed about rules and regulations, safety guidelines, tips for product selection and more. You’ll also find QR codes that link to videos on some of the products featured in the guide. Some of the information could even be incorporated into your own employee training. We’re sure this Reference Guide will prove to be a valuable resource tool in your day to day operations. We encourage you to take a look at what we have to offer. Call us and we’ll be happy to show you our complete line of products and discuss the variety of services we have available. Please retain this Reference Guide as a source for your equipment and supply needs throughout the year.


Index by Category | 2 Sanitation

98-115

Dishwashers, Disposers, Sinks & Faucets, Trash Containers

Refrigeration

9-35

Reach-Ins, Merchandisers, Prep Tables, Blast Chillers, Ice Machines

Beverage Equipment

Storage & Transport

116-128

Shelving, Racks, Carts, Food Storage

36-42

Coffee Brewers, Blenders, Bar Coolers

Cooking Equipment

43-77

Ranges, Convection Ovens, Steam, Ventilation, Fryers, Microwaves

Dining

129-149

Dinnerware, Glassware, Flatware, Linens

Beverage Supplies

150-153

Barware, Servers, Pourers

Holding Equipment

78-88

Cabinets, Warmers, Serving Lines

Kitchen Prep

Kitchen Supplies

154-173

Cookware, Utensils, Prep, Safety, Apparel

89-97

Slicers, Mixers, Scales, Work Tables

Furnishings

174-175

Crowd Control, Changing Stations, Signage


Supplier Index | 3

Aarco Products, Inc. 174 ACP / Amana 71, 72 Admiral Craft 36, 39, 49, 51, 54, 57, 73, 83, 86, 157, 161 Advance Tabco 84, 88, 96, 97, 101, 103, 121, 160 American Metalcraft 135, 143, 145, 162, 164 American Panel 21, 32 Anchor Hocking 138 Apex Foodservice Matting 106, 113, 114, 166 Bakers Pride 44, 46, 47, 51 Bar Maid 38, 39, 150 Berkel 90 Blodgett 45, 46, 50, 51, 62, 65 Cactus Mat 114 Cadco 47, 49, 74, 76, 87 Cal-Mil Products, Inc. 145, 153 Cambro 42, 85, 87, 102, 117, 118, 121, 122, 124, 126, 127, 133, 138, 146, 152, 158, 165, 170 Captive-Aire 68, 69 Cardinal 132, 139, 140, 142 Carlisle 42, 102, 108, 109, 124, 127, 134, 137, 140, 146, 147, 157, 158, 160, 171 Carlisle/Dinex 134, 137, 147 Carter-Hoffmann 78, 80, 85,127 Champion 40, 98, 100, 103 Channel Mfg. 120 Chef Revival 173 Chef Specialties 136 Cleveland 62, 63, 64, 65 CMA Dishwashers 99, 100 Co-Rect Products 150 Continental 108, 111, 123, 124, 175 Cooper Atkins 167-169 Curtron 32, 120 Delfield 11, 19, 21, 23, 24, 80, 83, 86, 88, 89 Dexter Russell 154, 155 Dormont 60, 101, 104 Doyon 51, 92 Duke 84, 85, 87, 101 Edlund 93, 94, 156, 164, 165 Electrolux 89, 92 Elkay Sales 30, 96, 97, 104 Federal Industries 17 Fisher 105 Focus Foodservice 36, 118, 119, 151, 158, 163 Follett 26 FoodHandler 102, 149, 160, 166, 171 Franklin 50, 58, 167 Frymaster 56-58, 61 Garland 44, 74 G.E.T. 133, 137, 159 Gessner 135, 136 Globe 48, 54, 73, 74, 90, 91, 94 Groen 62, 63, 66 Hamilton Beach 37, 72, 76 Hatco 75, 78, 80-85 Hollowick 148, 149 Holman 52, 75

Ice-O-Matic 27, 28 InSinkErator 101, 102, 104 Inteplast - Pitt 109 InterMetro 78-80, 116-119, 122, 124, 127, 128 International Tableware 132 Jackson WWS 42, 98, 99 John Boos 96, 103 Kolpak 32, 33 Krowne 41, 106 Lakeside 40, 55, 124, 125, 128, 175 Lang 46 Lincoln Equipment 52, 53 MagiKitch’n 50, 55, 56 Manitowoc Ice 28, 29 Master-Bilt 9, 11, 14, 34 Maverick 88, 97 Menu Solutions 149 Mundial 155, 157 National Checking 149, 171 New Age 97, 121, 122 Nor-Lake 11, 12, 20, 24, 34, 39 Oneida 129, 131, 139, 141, 142 Paderno World Cuisine 161 Panasonic 70, 72 Perlick 13, 39 Piper 51, 81, 88, 128 Pitco Frialator 59-61 Randell 13, 19-21, 23, 85, 88 Robot Coupe 91, 92 Rubbermaid 95, 107, 109-111, 114, 121, 122, 125, 152, 175 San Jamar 110, 113, 146, 151-153, 156, 166, 172 Scotsman 9, 25, 26, 30 Scrubble 112 Southbend 43, 44, 46-49, 65 Spill-Stop 151 Star 49, 50, 52, 54, 73, 75, 81 Sterno Candle Lamp 54, 144, 145, 148 Structural Concepts 15 T&S Brass 61, 105, 106 Tablecraft 101, 135, 136, 151, 153 Taylor Precision Products 95, 169 Thermalrite/International Cold Storage 34, 35 Traulsen 12, 20, 21, 23, 79 True 9, 10, 13, 14, 16, 18, 23, 24, 40 Tuxton China 129, 131 Unified Brands 13, 19-21, 23, 62, 63, 66, 85, 88 Update International 111, 153, 158, 163, 165 Victorinox 154, 164 Victory Refrigeration 13, 18-21 Vollrath 47, 49, 72, 74, 83, 84, 86, 87, 92, 93, 102, 133, 143, 145, 146, 156-165 Vulcan FEG 43-45, 48, 50, 51, 58, 62, 64, 66, 68, 79, 90 Walco Stainless 140, 142, 143 Waring 38, 73, 76, 92 Wells/Bloomfield 37, 49, 55, 84 Winco 83, 121, 123, 132, 142, 144, 156, 163, 175 Wolf 43


Product Index | 4

Refrigeration Equipment

Cooking Equipment

Air Curtain Refrigeration . . . . . . . . . . . . . . . . . . . . . . . . . . .14, 21, 32 Blast Chillers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .21, 28 Countertop Refrigerators/Freezers . . . . . . . . . . . . . . . . . . . . . . . . .14 Ice Machines & Bins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9, 25-30 Milk Coolers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24 Reach-Ins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9-13, 18, 34 Refrigerated Display Cases . . . . . . . . . . . . . . . . . . . . . . . . .10, 15-17 Refrigerated Equipment Stands . . . . . . . . . . . . . . . . . . . . . . . .13, 23 Refrigerated Holding Cabinets . . . . . . . . . . . . . . . . . . . . . . . . . . . .79 Refrigerated Prep Tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . .17-20 Strip/Air Doors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 Undercounter Refrigerators/Freezers . . . . . . . . . . . . . .19, 21, 23, 24 Walk-Ins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9, 32, 35

Steam Kettles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 Steamers & Accessories . . . . . . . . . . . . . . . . . . . . . . . .63, 65, 66, 68 Toasters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75, 76 Utility Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .68 Ventilation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .68, 69

Beverage/Bar Equipment Back Bar Equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39, 41 Bar Coolers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39-41 Bar Sinks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 Beer Dispensers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39, 40 Beverage Bins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 Blenders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37, 38 Coffee & Tea Brewers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36, 37 Glass Frosters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 Glass Washers & Accessories . . . . . . . . . . . . . . . . . . . . . . . . .39, 42 Portable Bars . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42

Cooking Equipment Braising Pans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .62, 64 Broilers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47-50 Combination Ovens . . . . . . . . . . . . . . . . . . . . . . . . . . .45, 51, 62, 64 Convection Ovens & Accessories . . . . . . . . . . . . . . . . . . . .45-47, 51 Conveyor Ovens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52, 53 Countertop Cooking . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .48, 52, 74 Deck Ovens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47, 50, 51 Fryers & Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . .49, 55-61, 64 Gas Connectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .60, 61 Griddles & Grates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .48-50 Hot Dog Cookers & Grills . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .54 Induction & Buffet Ranges . . . . . . . . . . . . . . . . . . . . . . . . .54, 55, 74 Microwaves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .70-72 Outdoor Grills . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55 Pasta Cookers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61 Popcorn Poppers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .54 Restaurant Ranges . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .43, 44, 48 Rethermalizers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 Rice Cookers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 Rotisserie Ovens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .51 Sandwich Grills . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .73

Holding Equipment Buffet Units/Serving Lines . . . . . . . . . . . . . . . . . . . . . . . . . . . . .85-88 Countertop Warmers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82-85 Custom Fab Equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .84, 88 Display Cabinets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80, 81, 83 Drawer Warmers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .84 Drop-In Cold and/or Hot Pans . . . . . . . . . . . . . . . . . . . . . . . . . .83-85 Heat Lamps & Light Bulbs . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81-83 Heated Bases . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 Heater/Proofer/Holding Cabinets . . . . . . . . . . . . . . . . . . . . . . . .78-81 Hot Food Tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .85, 86 Sneeze Guards/Partitions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88

Kitchen Prep Can Openers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .93 Dough Sheeters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 Equipment Stands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .97 Food Processors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89, 91 Knife Racks & Sharpeners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .156 Mixers, Hand-Held . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92 Mixers, Stand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .91, 92 Scales . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .94, 95 Slicers & Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .90 Vegetable Prep . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89 Work Tables & Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . .96, 97

Sanitation Ashtrays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .114 Booster Heaters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101 Brooms & Dust Pans . . . . . . . . . . . . . . . . . . . . . . . . . .109, 110, 112 Cleaning Supplies, Scouring Pads & Sponges . . . . . . . . . . .110, 112 Deodorizers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .109 Dish Racks & Covers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102 Dishtables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .103 Dishwashers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40, 98-101 Disposable & Vinyl Aprons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102 Disposers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102, 104 Faucets, Spray Valves & Accessories . . . . . . . . . . . . . .101, 104-106 Floor Mats . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .113, 114 Floor Troughs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101


Product Index | 5

Sanitation

Beverage Supplies

Floor/Wall Signs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101, 109 Hoses, Nozzles & Drain Accessories . . . . . . . . . . . . . . . . . . . . . .106 Mops/Wringers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111 Paper Dispensers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .113 Sinks & Drainboards . . . . . . . . . . . . . . . . . . . . . . . . . . .101, 103, 104 Trash Containers & Liners . . . . . . . . . . . . . . . . . . . . . . . . . .108, 109 Vacuums . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110

Barware . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .150, 151 Beverage Servers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .152 Condiment Trays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .153 Juicers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .151

Storage & Transport Banquet Carts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .125, 127 Can Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .121 Dish Dollies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .121, 127 Dunnage Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .122 Ice Transport Caddies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .152 Ingredient Bins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .122, 123 Meal Delivery Bags . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .125 Pan Carriers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .126, 127 Pan Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .120, 121 Pellet Bases/Dish & Tray Dispensers . . . . . . . . . . . . . . . . . . . . . .128 Rack Covers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .120 Security Trucks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .119 Shelving . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116-119 Utility/Bussing Carts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .124, 125

Dining Bibs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .149 Bowls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .146 Candles, Lamps & Lamp Fuel . . . . . . . . . . . . . . . . . . . . . . .148, 149 Chafers & Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . .143-145 Condiment Supplies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .135, 136 Dinnerware . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129-134 Flatware & Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . .141, 142 Food Display . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .145 Glassware & Tumblers . . . . . . . . . . . . . . . . . . . . . . . . . . . . .137-140 Guest Checks & Holders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .149 Holloware . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .142, 143 Menus & Menu Covers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .149 Napkin Dispensers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .146 Pepper/Salt Mills . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .135, 136 Plate Covers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .133 Ramekins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .135 Register Rolls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .149 Serving Utensils & Tongs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .146 Servingware . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .135, 145 Table Linens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .140 Trays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .140, 145-147

Kitchen Supplies Baking/Pizza Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .162 Chef Apparel & Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . .172 Choppers/Cutters/Corers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .164 Cutting & All Purpose Gloves . . . . . . . . . . . . . . . . . . . . . . . . . . . .164 Cutting Boards . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .166 Dishers & Ladles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .156 Disposable Gloves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .166 Film & Foil Dispensers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Food Pans & Lids . . . . . . . . . . . . . . . . . . . . . . . . . . . . .158, 170, 171 Food Storage Bags & Labels . . . . . . . . . . . . . . . . . . . . . . . .170, 171 Food Storage Containers . . . . . . . . . . . . . . . . . . . . . . . . . . .170, 171 Kitchen Utensils . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .156, 158, 165 Knives & Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .154-156 Measuring Cups and Spoons . . . . . . . . . . . . . . . . . . . . . . . . . . . .164 Mixing Bowls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Oven Mitts/Pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .172 Pan Liners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .160 Pastry Brushes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .157 Pots & Pans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .160-163 Scoops & Holders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Sheet/Bun Pans & Accessories . . . . . . . . . . . . . . . . . . . . . .160, 163 Spatulas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .157 Steamtable Pans & Accessories . . . . . . . . . . . . . . . . . . . . . .158, 159 Thermometers & Accessories . . . . . . . . . . . . . . . . . . . . . . . .168, 169 Timers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .167 Whips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .157

Furnishings Baby Changing Tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .175 Crowd Control Posts & Ropes . . . . . . . . . . . . . . . . . . . . . . . . . . .174 Signage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .174 Specialty Carts & Dollies . . . . . . . . . . . . . . . . . . . . . . . . . . . .40, 175 Youth Seating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .175


Featured Chefs | 6

Featured Chefs Clifford Crooks 12 ESquared Hospitality/BLT Restaurants New York, NY Will Metcalf Canyon Ranch Tucson, AZ

38

Jonathan Bennett Moxie, The Restaurant Cleveland, OH

42

Sholem Potash Culinary Depot Monsey, NY

53

Eric Williams Momocho mod mex Cleveland, OH

61

Nicholas Type & Seth Leifer Station Eats Stamford, CT

66

Mark Vannasdall The Restaurants at Chesapeake Oklahoma City, OK

67

Brian Robertson The San Luis Resort Galveston, TX

68

Carl DeLuce Cranwell Resort, Spa & Golf Club Lenox, MA

70

Robert Black A Good Egg Dining Group Oklahoma City, OK

75

Andy Urell Porterhouse Grill Athens, GA

76


Featured Chefs | 7

Guy Fieri The Food Network Guy’s Big Bite Guy Off The Hook Diners, Drive-Ins & Dives CEO Johnny Garlics’s Inc. Santa Rosa, CA Philippe Schmit Philippe Restaurant & Lounge Houston, TX

93, 168

94

Brad Johnson Hal Smith Restaurant Group Oklahoma City, OK

123

Phil Young The Stone Hearth New Haven, CT

128

Alex Eaton The Manship Wood Fired Kitchen Jackson, MS

136

Chris McKenna Stella Modern Italian Cuisine Oklahoma City, OK

144

Andreas Singer Hyatt Regency Coconut Point Bonita Springs, FL

158

John des Rosiers Inovasi Lake Bluff, IL

163

Adam Trachtenberg E&A Hotel Restaurant Supply Plainfield, NJ

165

Jamie Gorey & Jill Means Two Chicks from the Sticks Atlanta, GA

167



Refrigeration Equipment | 9

Refrigeration Reach-Ins Merchandisers Prep Tables Blast Chillers Ice Machines Walk-Ins Care Of Your Refrigeration Dirty condensers are the greatest contributors to compressor failure. Location will vary the frequency of cleaning, but it is recommended that the condenser on all your refrigeration equipment be cleaned once a month. How To Clean The Condenser Disconnect the electrical power to the unit. Remove the louvered grill.

A. Traditional Reach-Ins. Highest quality materials and oversized refrigeration system provides you with colder product temperatures, lower utility costs, exceptional food safety and the best value in today’s foodservice marketplace. Refrigerator features: Bottom mount compressor, stainless front, self-contained system, anodized aluminum end, 4" swivel casters, high density insulation (CFC free). Holds 33°F to 38°F. Freezer features: -10°F temperature (T19FZ maintains 0°F), large evaporator and coil heater permit short defrost cycle, defrost system time initiated and temperature terminated. Height does not include 5" for casters or 6" for optional legs. Model T49 shown. Model Description T-23 291/2"x783/8"x27"L, 1 Door-3 Shlvs T-23F 291/2"x783/8"x27"L, 1 Door-3 Shlvs T-49 291/2"x783/8"x541/8"L, 2 Door-6 Shlvs T-49F 291/2"x783/8"x541/8"L, 2 Door-6 Shlvs T-72 291/2"x791/8"x781/8"L, 3 Door-9 Shlvs T-72F 291/2"x791/8"x781/8"L, 3 Door-9 Shlvs T-12F 231/8"x631/8"x247/8"L, 1 Door-3 Shlvs Additional models available.

A

Traditional Reach-Ins T-Series

Vacuum or brush the dirt, lint and paper from the finned condenser coil. If you have significant dirt build up you can blow out the condenser with compressed air. (Caution must be used to avoid eye injury. Eye protection is recommended.)

B. Ice Valet™ Hotel Dispensers. Reliable, simple push chute dispense mechanism for sanitary and easy ice dispensing. Available in 22" or 30" widths, storing from 120-180 lbs. of ice. Stainless steel exterior looks attractive in any decor. Rounded corners and rust-free plastic top panels are designed to match the Prodigy® cuber to the dispenser. Deep sink depth accommodates virtually every sized hotel ice bucket. 30"W model available with optional coin/token mechanism or water filter. Shown with ice machine (sold separately). Model Description HD30B-1H 180 lb. Storage HD22B-1H 120 lb. Storage

When finished be sure to replace the louvered grill. The grill protects the condenser. Reconnect the electrical power to the unit. Clean Fridge All refrigeration requires constant cleaning. Wipe interiors as often as possible and wipe the exteriors daily. Be sure to also wipe down the gaskets daily by using a mild detergent and soft cloth or sponge. Dirty gaskets lead to loss of refrigerated air, increased electricity cost, and premature failure of the gaskets.

B

C. Quick Ship Walk-Ins. In a hurry for a walk-in structure? Master-Bilt’s Quick Ship Program is the answer for you. These stock walk-ins ship within 5 working days! Three basic options are available: the standard four wall cooler or freezer, walk-ins with openings for glass doors and two-compartment combos. Over 1500 configurations arepossible with these options. A matching M-seriesrefrigeration system is standard with each Quick Ship Walk-In. Choice of 26", 30" or 36" door width at no extra charge.

C


5HIULJHUDWLRQ(TXLSPHQW_

$7UDGLWLRQDO5HDFK,QV 6WDLQOHVV6WHHO  5HIULJHUDWRUV DQG )UHH]HUV IHDWXUH VWDLQOHVV VWHHO LQWHULRU H[WHULRU IURQW DQG VLGHV ZLWK PDWFKLQJ DOXPLQXP EDFN IRU WKRVH ZKR DSSUHFLDWH WKH YDOXH RI VWDLQOHVV (QYLURQPHQWDOO\ IULHQGO\ RYHUVL]HG DQG EDODQFHG UHIULJHUDWLRQ V\VWHP %RWWRP PRXQW FRPSUHVVRU 5HIULJHUDWRU KROGV ƒ) WR ƒ) )UHH]HU KROGV ƒ) IRU IUR]HQ IRRG DQG LFH FUHDP )RDPHG LQSODFHSRO\XUHWKDQHKLJKGHQVLW\FHOO LQVXODWLRQ &)& IUHH  6RODU GLJLWDO WKHUPRPHWHU0RGHO76VKRZQ

%*ODVV'RRU 5HIULJHUDWRUV)UHH]HUV 6ZLQJ'RRU  5HIULJHUDWRUV DQG )UHH]HUV SURYLGH H[FHSWLRQDO GLVSOD\ IRU SURILWDEOH IRRG DQG EHYHUDJHV LQ KLJK LPSXOVH VDOHV DUHDV 2YHUVL]HG UHIULJHUDWLRQ V\VWHP KROGVƒ)WRƒ) 5HIULJHUDWRU

DQGƒ) )UHH]HU 1RQSHHORU FKLS ZKLWH ODPLQDWHG YLQ\O H[WHULRU EODFN DQG FKHUU\ H[WHULRU DOVR DYDLODEOH 16) ZKLWHDOXPLQXPLQWHULRUOLQHUZLWK VWDLQOHVV VWHHO IORRU 6HOI FORVLQJ % GRRU 3RVLWLYH VHDO WRUVLRQ W\SH FORVXUH V\VWHP 5HIULJHUDWRU² ³/RZ(´ WKHUPDO LQVXODWHG JODVV GRRU )UHH]HU²7ULSOH SDQH WKHUPDO JODVV GRRU )RDPHGLQSODFH XVLQJ (FRPDWH D KLJK GHQVLW\ SRO\XUHWKDQH LQVXODWLRQ WKDW KDV ]HUR R]RQH GHSOHWLRQ SRWHQWLDO 2'3 DQG]HURJOREDOZDUPLQJSRWHQWLDO *:3 

$ 0RGHO'HVFULSWLRQ 76 [[/66'RRU6KOYV 76) [[/66'RRU6KOYV 76 [[/66'RRUV6KOYV 76) [[/66'RRUV6KOYV 76 [[/66'RRUV6KOYV 76) [[/66'RRUV6KOYV 76* [[/*ODVV'RRU66'RRU6KOYV $GGLWLRQDOPRGHOVDYDLODEOH

0RGHO'HVFULSWLRQ *'0 [[/'RRU6KOYV *'0) [[/'RRU6KOYV *'0 [[/'RRU6KOYV *'0) [[/'RRU6KOYV *'0 [[/'RRUV6KOYV $GGLWLRQDOPRGHOVDYDLODEOH

& &*ODVV'RRU5HIULJHUDWRUV 6OLGH'RRU  7KH *'0 6HULHV SURYLGHV H[FHSWLRQDO GLVSOD\ IRU SURILWDEOH IRRG DQG EHYHUDJHVLQKLJKLPSXOVHVDOHVDUHDV(QYLURQPHQWDOO\IULHQGO\RYHUVL]HG DQG EDODQFHG UHIULJHUDWLRQ V\VWHP ƒ) WR ƒ) WHPSHUDWXUHV %RWWRP PRXQW FRPSUHVVRU 'RXEOH SDQH WKHUPDO JODVV KHOSV PLQLPL]H FRQGHQVDWLRQ 1R KHDWHU ZLUHV UHTXLUHG ([WUD KLJK GHQVLW\ SRO\XUHWKDQH LQVXODWLRQ &)& IUHH  6HOIFRQWDLQHG V\VWHP ZLWK  IW SOXJLQ FRUG 6WDQGDUG FRDWHG ZLUH VKHOYHV  SHU GRRU )OXRUHVFHQW LQWHULRU OLJKWLQJ LPSURYHV SURGXFW GLVSOD\ 6WDLQOHVV VWHHO LQWHULRU ERWWRP²&RQYHQLHQW FOHDQRXWGUDLQLVHDV\WRPDLQWDLQ0RGHO*'0VKRZQ 0RGHO'HVFULSWLRQ *'0 [[/'RRUV6KOYV *'0 [[/'RRUV6KOYV *'0 [[/'RRUV6KOYV *'0 [[/'RRUV6KOYV *'0 [[/'RRUV6KOYV *'0 [[/'RRUV6KOYV *'0 [[/'RRUV6KOYV $GGLWLRQDOPRGHOVDYDLODEOH

' '6SHF6HULHV67567$67*6HULHV 1HZO\ UHGHVLJQHG 6SHF 6HULHV 67567$67* 7KH VWDQGDUG RI H[FHOOHQFH IRU HQGXULQJ TXDOLW\ /(' LQWHULRU OLJKWLQJ 675 DQG 67$ PRGHOV RQO\  )RXU VKHOYLQJ NLWV DYDLODEOH 3RVLWLYH VHDO VHOIFORVLQJ GRRUZLWKƒVWD\RSHQIHDWXUH/LIHWLPHJXDUDQWHHGH[WHUQDOFDPOLIW GRRU KLQJH IRXU KLQJHV SHU IXOO GRRU VHFWLRQ VWDQGDUG /LIHWLPH JXDUDQWHHG EROW VW\OH GRRU ORFN /LIHWLPH JXDUDQWHHG KHDY\GXW\ DOO PHWDOZRUNLQJGRRUKDQGOHV(OHFWURQLFFRQWUROZLWKDXGLEOHDODUPDQG H[WHULRUGLJLWDOGLVSOD\LQHLWKHUƒ)RUƒ&+LJKHIILFLHQF\HOHFWURQLFDOO\ FRPPXWDWHG IDQ PRWRUV +LQJHG IURQW ORXYHU IRU HDVH RI SHULRGLF PDLQWHQDQFH5HYHUVHFRQGHQVHUIDQPRWRUDLGHVZLWKHIILFLHQF\DQG SHULRGLFPDLQWHQDQFH0RGHO67556VKRZQ 0RGHO'HVFULSWLRQ 67$)6 5HIULJHUDWRU66 'RRU 67$)+6 5HIULJHUDWRU66 'RRUV 67$5* 5HIULJHUDWRU66 'RRU 67$5+*+6 5HIULJHUDWRU*ODVV'RRUV 67$56 )UHH]HU66 'RRUV $GGLWLRQDOPRGHOVDYDLODEOH


Refrigeration Equipment | 11

B. 6000XL Series Reach-In Refrigerators/Freezers. The 6000XL series uses a top mount refrigeration system and Delfield’s patented ABS liner to improve insulation and decrease thermal leakage. Design improvements include oversized evaporators and condensers, a unique tri-seal door gasket and high-efficiency fans. Stay-open doors for easier loading and seamless liners for easy cleaning. Holds 18"x26" pans. Field reversible doors. Available in 1, 2, or 3 door configurations. 3-year part and labor warranty standard. Model Description 6025XL-S Refrigerator, 1 Door 6051XL-S Refrigerator, 2 Door 6076XL-S Refrigerator, 3 Door 6125XL-S Freezer, 1 Door 6151XL-S Freezer, 2 Door 6176XL-S Freezer, 3 Door 6025XL-SH Refrigerator, 2 Half Height S/S Doors

B

A Line®.

A. Specification Delfield’s Specification Line is the right refrigeration for today’s busy kitchens, with over 950 distinct models and a vast array of options available. Standard features: • Stainless steel finish • LED digital thermometer • Easy access flip-up shroud • One-piece top mount refrigeration system • Thermostatic expansion valve metering • Hot gas condensate removal • Advanced Control Technology • Door heater with on/off switch • Available field door rehingability • Built-in door locks • 3 wire shelves per section • ABS door liners 3 years part and labor, 5 year compressor parts warranty standard. Model SSR1-SH shown. Contact our customer service department for assistance.

Refrigeration Hints Separate food items into several categories depending upon the frequency they are needed. Store infrequently used items away from frequently used items. For example, beef patties and French fries can be stored together in one refrigerator; other items used less frequently can be stored in another refrigerator. Label items to avoid searching with the door open. Do not set the thermostat below the needed temperature. Though doing this fractionally decreases the freezing or cooling time, it uses significantly more energy. Let hot items cool before placing them in the refrigerator. Thaw frozen food in the refrigerator. The frozen food will reduce the load on your refrigerator and in winter food thawed at room temperature may add a heating load to the HVAC system. Do not store food in a way that it blocks circulation within the refrigerator. Use several trays so that cold air can circulate well over all the products. Position the refrigeration equipment away from sources of heat such as ovens and grills.

C. Nova™ Reach-Ins. Energy Star® approved! Standard features include: Refrigerators 38°F and Freezers 0°F. Top mount refrigeration system. Available in 1, 2 or 3 door models. Stainless steel interior and exterior. Micro-processor with digital display. Heavy-duty hardware. UL, C-UL, UL Sanitation, MEA listed. Standard models ship the same day! Half door and glass door models also available. 3-year parts and labor, 5-year compressor warranty standard. Model NR241SSS/0 NR522SSS/0 NR803SSS/0 NF241SSS/0 NF522SSS/0 NF803SSS/0

Description Refrigerator, 1 Door Refrigerator, 2 Door Refrigerator, 3 Door Freezer, 1 Door Freezer, 2 Door Freezer, 3 Door

C D. Reach-In Refrigerators/Freezers, Fusion Series. Efficiency fused with reliability. Versatility fused with value. Equipment fused with environment. Solid door reach-ins feature stainless steel interior and exterior. Top, bottom and back constructed of galvanized steel. Equipped with an electronically controlled monitoring system with door alarm function. Self-contained bottom mount refrigeration system— freezer R404A and refrigerator R134A. Temperature range 32° to 40°F for refrigerators and -22° to 8°F for freezers. Limited 3-year parts and labor warranty with 5-year compressor part warranty. UL and ETL listed. Energy Star® qualified.

Model MBR23-S MBR49-S MBR72-S MBF23-S MBF49-S MBF72-S

Description Refrigerator, 1 Door Refrigerator, 2 Door Refrigerator, 3 Door Freezer, 1 Door Freezer, 2 Door Freezer, 3 Door

D


5HIULJHUDWLRQ(TXLSPHQW_

(GCVWTGF%JGH &KHI&OLIIRUG&URRNV &RUSRUDWH([HFXWLYH&KHI (6TXDUHG+RVSLWDOLW\%/75HVWDXUDQWV 1HZ<RUN1< <HOORZILQ 7XQD ZLWK 0DUFRQD $OPRQG &HOHU\ &KLOL <LHOGVVHUYLQJV UHFWDQJXODUFXWSLHFHVRI7XQD R]

FXS0DUFRQDDOPRQGV EODQFKHG

$

FXSVZKROHPLON

$*6HULHV3DVV7KUX5HIULJHUDWRUV 2XWVWDQGLQJ WHPSHUDWXUH PDLQWHQDQFH UHOLDELOLW\ HQHUJ\ HIILFLHQF\ GXUDELOLW\ DQG ODUJH XVDEOH FDSDFLWLHV 9DOXHDGGHG IHDWXUHV LQFOXGH 0LFURSURFHVVRUFRQWUROOHUZLWK/('WHPSHUDWXUHUHDGRXW/RDGVXUHJXDUG SURWHFWV DJDLQVW LPSURSHU ORDGLQJ 'DPDJH UHVLVWDQW VWDLQOHVV VWHHO EUHDNHU FDSV  HSR[\ FRDWHG VKHOYHV DQG  FDVWHUV IRU HDVH RI PRELOLW\'HVLJQHGWRSURYLGHUHDOFRVWVDYLQJEHQHILWVLQLPSRUWDQWDUHDV VXFKDVOLIHWLPHVHUYLFHFRVWV5HOLDEOHUHIULJHUDWLRQFRVWVOHVVWRUXQDQG PDLQWDLQ DQG LV EXLOW WR ODVW PDNLQJ LW QRW MXVW ORZSULFH EXW UHDOO\ ORZFRVW8/DQG16)OLVWHG 0RGHO'HVFULSWLRQ *3 6LQJOH*ODVV+DOI'RRU5LJKW/HIW+LQJH *3 6LQJOH*ODVV+DOI'RRU5LJKW5LJKW+LQJH *3 6LQJOH*ODVV+DOI'RRU/HIW5LJKW+LQJH *3 6LQJOH*ODVV+DOI'RRU/HIW/HIW+LQJH *3 6LQJOH*ODVV)XOO'RRU5LJKW/HIW+LQJH *3 6LQJOH*ODVV)XOO'RRU5LJKW5LJKW+LQJH *3 6LQJOH*ODVV)XOO'RRU/HIW5LJKW+LQJH $GGLWLRQDOPRGHOVDYDLODEOH



FXSDOPRQGRLO

 JUDPV[DQWKDQJXP 6DOWWRWDVWH 

FXSOLPHMXLFH



FXSJLQJHUMXLFH

FXSJUDSHVHHGRLO WDEOHVSRRQ$OHSSRSHSSHU 7KDLFKLOL VOLFHGLQWRSDSHUWKLQURXQGV

FORYHJDUOLFFRQILW 0LFURFHOHU\ 3LFNHGFHOHU\OHDYHV =HVWRIOLPHVGHK\GUDWHGLQDPLFURZDYHIRUVHFRQGVDQGUXQRYHU DWDPLVWRWXUQWRSRZGHU ,Q D VDXFH SDQ DGG DOPRQGV DQG PLON VLPPHU XQWLO DOPRQGV DUH VRIW 6WUDLQ PLON UHVHUYLQJ  DQG SODFH DOPRQGV LQ IRRG SURFHVVRU DGG MXVW HQRXJKPLONWRJHWPRYLQJDWILUVWWKHQDGGUHVW)LQLVKZLWKWKHDOPRQG RLO DQG VDOW WR WDVWH 3DVV WKURXJK &KLRQLV DQG WUDQVIHU EDFN WR IRRG SURFHVVRU DGG [DQWKDQ JXP DQG EOHQG ZHOO 3DVV WKURXJK &KLRQLV DJDLQ )RUYLQDLJUHWWHPL[WKHFORYHRIJDUOLFFRQILWOLPHMXLFHJLQJHUMXLFHZLWK WKH $OHSSR SHSSHU DQG VOLFHG 7KDL FKLOL 8VLQJ D ZKLVN VORZO\ SRXU LQ JUDSHVHHGRLODQGFKHFNVHDVRQLQJZLWKVDOW 8VLQJ D VPDOO RIIVHW VSDWXOD VPHDU D GROORS RI DOPRQG SXUHp RQ SODWH DQG SODFH D VOLFH RI WXQD RQ RQH FRUQHU *DUQLVK ZLWK PLFUR FHOHU\ FHOHU\OHDYHVWKHYLQDLJUHWWHDQGGHK\GUDWHGOLPHSRZGHU

% %5 $6HULHV ,QWHOD7UDXOŠ 5HIULJHUDWRUV)UHH]HUV 'HVLJQHGWRRIIHUPD[LPXPVWRUDJHFDSDFLW\DORQJZLWKZLGHGRRUVIRU HDV\ DFFHVV 56HULHV IHDWXUHV VWDLQOHVV VWHHO LQWHULRUH[WHULRU $6HULHV IHDWXUHV DQRGL]HG DOXPLQXP LQWHULRU DQG VWDLQOHVV VWHHO H[WHULRU%RWK5 $6HULHVPRGHOVLQFOXGH7UDXOVHQ¶VH[FOXVLYHQH[W JHQHUDWLRQ ,QWHOD7UDXO PLFURSURFHVVRU FRQWURO V\VWHP 3UHFLVH WHPSHUDWXUH WROHUDQFHV ZLWK VHYHUDO LPSRUWDQW FRPPXQLFDWLRQV DQG DODUP IHDWXUHV 1$)(0 'DWD 3URWRFRO &RPSOLDQW 0RVW 5  $ 6HULHV FDELQHWVDUH(QHUJ\6WDUŠ OLVWHG6KRZQZLWKRSWLRQDOFDVWHUV 0RGHO'HVFULSWLRQ 5+7:87)+6 2QH6HFWLRQ5HIUZ)XOO/HQJWK'RRUV $+7:87)+6 2QH6HFWLRQ5HIUZ)XOO/HQJWK'RRUV $+7:87)+6 7ZR6HFWLRQ5HIUZ)XOO/HQJWK'RRUV $+7:87)+6 7KUHH6HFWLRQ5HIUZ)XOO/HQJWK'RRUV $/7:87)+6 2QH6HFWLRQ)U]UZ)XOO/HQJWK'RRUV $/7:87)+6 7ZR6HFWLRQ)U]UZ)XOO/HQJWK'RRUV $/7:87)+6 7KUHH6HFWLRQ)U]UZ)XOO/HQJWK'RRUV $GGLWLRQDOPRGHOVDYDLODEOH

& 0RGHO'HVFULSWLRQ 1/56 5HIULJHUDWRU'RRU 1/56 5HIULJHUDWRU'RRU 1/56 5HIULJHUDWRU'RRU

&$GYDQW('*(Œ5HDFK,QV 7KH$GYDQW('*(ŒZLOOSURYLGHJUHDW VDYLQJV IRU \RXU FXVWRPHUV ZKLOH GHOLYHULQJ WKH SURYHQ UHOLDELOLW\ RI D SUHPLXPSURGXFW7KHQHZGHVLJQRQ WKH $GYDQW('*(Œ EDVHPRXQW UHDFKLQ UHIULJHUDWRU DQG IUHH]HU SURYLGHVDVWDLQOHVVVWHHOLQWHULRUDQG H[WHULRU DQG LV DYDLODEOH LQ RQH WZR RUWKUHHGRRUPRGHOV,WVQHZH[WHULRU ORRN LQFOXGHV D FXUYHG KDQGOH ZLWK UHFHVVHG GRRU SRFNHW DXWRPDWLF FRQGHQVDWLRQ HYDSRUDWLRQ PLFUR SURFHVVRU ZLWK GLJLWDO GLVSOD\  YLQ\O FRDWHG VKHOYHV SHU GRRU DQG D GRRURSHQ DODUP $OO PRGHOV FRPH VWDQGDUG ZLWK FDVWHUV 6DPH GD\ VKLSSLQJ DYDLODEOH RQ DOO VWDQGDUG PRGHOV8/&X/DQG(7/VDQLWDWLRQ (QHUJ\6WDUŠ DSSURYHG

0RGHO'HVFULSWLRQ 1/)6 )UHH]HU'RRU 1/)6 )UHH]HU'RRU 1/)6 )UHH]HU'RRU


Refrigeration Equipment | 13

A

A. V-Series Refrigerators & Freezers. New V-Series™ Electronic Control is state-of-the-art with many exclusive features including SUPERCOOL Mode, Energy Saving Mode, multiple audible and visual alarms (min/max temp., door ajar, probe failure, clean condenser and compressor protection). Self-contained top mounted refrigeration system features stainless steel exterior with an aluminum interior. Self-closing doors have a 120° hold open feature. Other standard features include 3 epoxy coated shelves per cabinet section, interior lights, cylinder locks and swivel casters. 3-year parts and labor, 5-year compressor warranty. Model VR-SA-1D shown. Model Description VF-SA-1D Freezer, 1 Solid Door (Energy Star®) VR-SA-1D Refrigerator, 1 Solid Door (Energy Star®) VR-SA-2D Refrigerator, 2 Solid Doors (Energy Star®) VR-SA-3D Refrigerator, 3 Solid Doors (Energy Star®) VR-SA-1D-HD Refrigerator, 2 Half Solid Doors VR-SA-2D-HD Refrigerator, 4 Half Solid Doors VR-SA-3D-HD Refrigerator, 6 Half Solid Doors Additional models available.

B B. Glass Lid Horizontal Freezer, Flat Lid. Uniquely designed to promote high-profit frozen novelties in high impulse retail traffic areas. Ideal for bolstering incremental sales of frozen merchandise and seasonal specialties. Cold wall, environmentally friendly (134A) refrigeration system. Maintains -10°F (-23.33°C), ideal for both ice cream and frozen food. Exterior—non-peel or chip white laminated vinyl, durable and permanent; with gray mitered plastic top and lid frames. Optional heavy duty novelty baskets available. 3-year parts and labor warranty. 5-year compressor warranty. Model TFM-41FL shown. Model Description TFM-29FL 297/8"Lx261/8"Dx315/8"H TFM-41FL 413/8"Lx261/8"Dx315/8"H TFM-51FL 517/8"Lx261/8"Dx315/8"H

C. ULTRASPEC™ Series. The sleek, new ULTRASPEC™ SERIES by Victory offers the ultimate in design, efficiency, durability and overall performance. It features industry leading V-TEMP™ electronic control technology. This smart micro-processor has a HACCP memory feature that records up to 9 critical temperature alarm events including the date and time they occurred. V-TEMP™ control is simple to use and is loaded with standard features including SUPERCOOL mode, energy saving mode, clean condenser alarm and a manager’s lock-out feature. Model RD-2D-S1 shown. Model RS-1D-S1 RS-2D-S1 FS-1D-S1 FS-2D-S1 RA-1D-S1 RA-2D-S1 FA-1D-S1

Description “S” Series Refrigerator, 1 Door Reach-In, Long Door “S” Series Refrigerator, 2 Door Reach-In, Long Doors “S” Series Freezer, 1 Door Reach-In, Long Door “S” Series Freezer, 2 Door Reach-In, Long Doors “A” Series Refrigerator, 1 Door Reach-In, Long Door “A” Series Refrigerator, 2 Door Reach-In, Long Doors “A” Series Freezer, 1 Door Reach-In, Long Door

C D D. 18" Shallow Depth Refrigerators. The shallow-depth refrigerator series is designed for a variety of foodservice and hospitality applications. Includes 5 year compressor and 1-year parts and labor warranty. All models are 24" long, 18" deep and 32" high. Refrigerator or wine reserve models available with solid or glass doors. Standard features include front-vented compressor, selfclosing doors, stainless steel interior/exterior, interior light, 4 adjustable full-extension pull-out vinyl coated shelves. Model HD24WSG shown. Model Description HD24RS 33°-39°F, S/S Refrigerator HD24WS 40°-65°F, Wine Reserve (20 wine bottles) HD24RSG 33°-39°F, S/S Refrigerator w/Glass Doors HD24WSG 40°-65°F, Wine Reserve w/Glass Doors (20 wine bottles)

E E. FX-Series Refrigeration. Increase shelf life and safety of your products with FX precision refrigeration. The FX-series is the perfect refrigeration system for a wide variety of applications. Precise temperature controls allow FX units to be used at any set temperature from -5°F to 40°F depending on the products need. Insulated inserts and an exclusive, innovative design keeps valuable cold air where it belongs—with the food. The FX-1UCB (1 drawer) and FX-2UCB (2 drawer) are the long awaited solutions for hospital tray make-up and other beverage challenges. Or use the FX as the first effective ice-less fish storage unit.

Model Description FX1-4N1 4N1 1 Section w/Unfinished Top, Refr/Frzr/Safety Thaw/Rapid Chill FX-1 27" 1 Section w/Unfinished Top FX-1RECS 38" 1 Section w/Cooking Equipment Finished Top w/Casters FX-2CS 96" 2 Section w/Cooking Equipment Finished Top w/Casters FX-2WS 46" 2 Section w/Finished Top w/Casters FX-3SS 46" 3 Section w/Finished Top w/Casters Additional models available.


Refrigeration Equipment |14

A. Bottom Mounted Open Display Merchandisers. Merchandiser has interior and exterior textured finish and electronically controlled monitoring system. Comes standard with LED lighting, adjustable two-position shelves, independent shelf lighting and a perforated interior back wall. Self-contained refrigeration system has a front condenser air intake and rear air discharge; R-404A refrigerant. Temperature range 34°F to 41°F. Limited 3-year extended compressor warranty and 2-year limited parts and labor warranty. UL, C-UL and UL EPH classified. Model BMOA-48 shown. Model Description BMOA-36 36"Lx331/4"Dx79"H, 3 Shlvs BMOA-48 52"Lx331/4"Dx79"H, 3 Shlvs BMOA-74 78"Lx331/4"Dx79"H, 6 Shlvs BMOA-36GE Glass Ends, 36"Lx331/4"Dx79"H, 3 Shlvs BMOA-48GE Glass Ends, 52"Lx331/4"Dx79"H, 3 Shlvs BMOA-74GE Glass Ends, 78"Lx331/4"Dx79"H, 6 Shlvs

A

Reasons to Use Glass Merchandisers Products and key brands are in front of the customer. Promotes impulse buying, increasing product sales. Products and packages look their best because there are no broken packages. Consumers have easier access to products and have the option of self-service. See-through glass allows employees to stay on top of product inventory.

B. Horizontal Air Curtain Merchandisers. Provides fast, easy access to product while maximizing attention to merchandising. Oversized refrigeration system holds 35°F to 40°F. Fan motors reverse during defrost off cycles keeping condenser coil free from dust and debris. Durable non-peel or chip white powder coated steel exterior. NSF white aluminum interior liner with stainless steel floor. Entire cabinet structure is foamed-in-place using Ecomate—a new, innovative, high density, polyurethane insulation that has zero ozone depletion potential (ODP) and zero global warming potential (GWP). Model THAC-60 shown. Model Description THAC-36 361/8"Lx301/8"Dx433/8"H, 3 Shlvs THAC-36S 361/2"Lx301/8"Dx433/8"H, 3 Shlvs (S/S) THAC-48 481/8"Lx301/8"Dx433/8"H, 3 Shlvs THAC-48S 481/8"Lx301/8"Dx433/8"H, 3 Shlvs (S/S) THAC-60 601/8"Lx301/8"Dx433/8"H, 3 Shlvs THAC-60S 601/8"Lx301/8"Dx433/8"H, 3 Shlvs (S/S)

B

C. Vertical Air Curtain Merchandisers. Perfect for impulse traffic areas. Oversized refrigeration system holds 35°F to 40°F. Exclusive, reversing condenser fan motors. Permanent non-peel or chip white laminated vinyl exterior with white aluminum interior and stainless steel floor and deck pans. Foamed-in-place polyurethane high density cell insulation (CFC free). Adjustable, heavy-duty PVC coated shelves. Model TAC-72 comes standard with 2 white cantilever shelves. Black also available. TAC-14GS shown. Model Description TAC-14GS 303/8"Dx563/8"Hx301/4"L, Glass Side, 3 Shlvs TAC-30GS 293/4"Dx803/4"Hx303/8"L, Glass Side, 4 Shlvs TAC-30 301/8"Dx805/8"Hx30"L, 4 Shlvs TAC-36 301/8"Dx805/8"Hx36"L, 4 Shlvs TAC-48GS 301/4"Dx805/8"Hx48"L, Glass Side, 4 Shlvs TAC-48 301/8"Dx805/8"Hx48"L, 4 Shlvs TAC-72 301/8"Dx817/8"Hx72"L, 8 Shlvs

C

D. Glass Door Refrigerators/Freezers (Counter-Top). Designed for convenient access, fast service, attractive display and dependable holding temperatures. Illuminated sign panel. Heavy duty adjustable PVC coated wire shelves. Exterior is non-peel or chip white laminated vinyl. Stainless steel exterior available on the GDM-5-S, GDM-5-PT-S, GDM-7-S, GDM-9-S. True’s GDM-7F freezer generates high volume sales of profitable novelties and seasonal specialties; it holds -10°F temperatures. Model GDM-7 shown.

Model Description GDM-5 24"x231/2"x37", 1 Swing Door, 2 Shlvs GDM-5-S 24"x231/2"x37", 1 Swing Door, 2 Shlvs GDM-5-PT 24"x237/8"x37", 1 fr / 1 bk Swing Door, 2 Shlvs GDM-5-PT-S 24"x237/8"x37", 1 fr / 1 bk Swing Door, 2 Shlvs GDM-7 24"x243/4"x393/4", 1 Swing Door, 3 Shlvs GDM-9 361/8"x233/8"x391/2", 2 Slide Doors, 3 Shlvs GDM-9-S 361/8"x223/8"x391/2", 2 Slide Doors, 3 Shlvs Additional models available.

D


Refrigeration Equipment | 15 A. Impulse Refrigerated Self-Service Drop-In Counter Cases. Low profile refrigerated self-service drop-in counter cases are designed to turn precious counter space into increased sales. Units drop into existing counters and are perfect for cafeteria style serving lines. Innovative air curtain ensures integrated average product temperature of 41°F. Features Breeze™ slide-out refrigeration package, proven to simplify maintenance and expedite service. Easy-to-own cases offer compact footprints and flexible product merchandising. Model Description DO3616R 381/8"Lx283/4"Dx391/4"H DO4816R 501/8"Lx283/4"Dx391/4"H

A

B. Oasis® Open Air Screen Merchandisers. The Oasis series is a comprehensive offering of open air screen cases in a variety of heights and sizes. Standard with Breeze-E (NSF Type II) with EnergyWise slide-out refrigeration system proven to reduce energy consumption and save up to $1,000 in electricity costs per year. Breeze-E is designed to hold safe product temperatures in NSF Type II conditions - operating in 80°F and 60% humidity. Features two full end panels with mirror interior, adjustable shelves, black interior and wide selection of exterior laminate choices. Model CO57R shown. Model Description Models feature full end panels w/mirror, 4 non-lighted metal shelves, black interior, Wilsonart or Formica non-premium laminate exterior, Breeze-E with EnergyWise Refrigeration System CO35R 361/4"Lx325/8"Dx615/8"H CO45R 471/4"Lx325/8"Dx615/8"H CO47R 471/4"Lx325/8"Dx795/8"H CO55R 591/4"Lx325/8"Dx615/8"H CO57R 591/4"Lx325/8"Dx795/8"H CO67R 711/4"Lx325/8"Dx795/8"H Additional models available.

C

D. Harmony Narrow Depth Combination Case. The narrow depth combination case easily fits through standard door openings. Equipped with Breeze™ slide-out refrigeration package. Baffle system easily converts upper service display area from refrigerated to non-refrigerated. Features T-8 top light and shelf lights. Upper rear swinging door on 26" model, rear sliding doors on all other models. Refrigerated self-serve lower section for grab ’n go display. Single cutaway end panels with mirror. Wilsonart or Formica non-premium laminate exterior, black interior. Integrated average product temperature of 41°F. Model HMBC4 shown.

B

C. Encore Combination Display Case w/Service Display above Refrigerated Self-Service Display. The Encore combination case quickly keeps pace with changing menu needs. A quick flip of the baffle system and the upper section easily converts from refrigerated to non-refrigerated and back again. Upper display includes a double pane lift-up front glass that simplifies cleaning and merchandising from the front and removable rear sliding doors. Features Breeze™ slide-out refrigeration system. NSF 7 approved. Model HOU4852R shown. Model Description Models feature full end panels w/mirror, straight laminated front panel, clear glass upper shelf, black interior/trim, Wilsonart or Formica non-premium laminate exterior, Breeze Refrigeration System HOU3852R 40"Lx42"Dx53"H HOU4852R 50"Lx42"Dx53"H HOU5652R 58"Lx42"Dx53"H HOU7452R 76"Lx42"Dx53"H

Model HMBC2 HMBC3 HMBC4 HMBC5 HMBC6

Description 263/4"Lx341/8"Dx561/4"H 383/4"Lx341/8"Dx561/4"H 503/4"Lx341/8"Dx561/4"H 625/8"Lx341/8"Dx561/4"H 751/8"Lx341/8"Dx561/4"H

D


5HIULJHUDWLRQ(TXLSPHQW_ $&XUYHG*ODVV'U\%DNHU\'LVSOD\&DVHV 7UXH¶VQRQUHIULJHUDWHG³GU\´GLVSOD\FDVHFRPELQHVHIILFLHQWKLJKYROXPHPHUFKDQGLVLQJZLWKDQ HOHJDQW FXUYHG JODVV IURQW IRU VRSKLVWLFDWHG SUHVHQWDWLRQ RI EUHDGV GHVVHUWV DQG SDVWULHV 6L[ FRORUV DYDLODEOH 6WDLQOHVV VWHHO WRS :KLWH YLQ\O FRDWHG DOXPLQXP LQWHULRU FDELQHW OLQHU (QHUJ\ HIILFLHQW³/RZ(´WKHUPDOJODVVUHDUGRRUV'RRUVH[WHQGIXOOZLGWKRIFDELQHWVKHOO 0RGHO'HVFULSWLRQ 7&*' /6ZLQJ'RRUV6KHOYHV 7&*' /6ZLQJ'RRUV6KHOYHV 7&*' /6OLGH'RRUV6KHOYHV 7&*' /6OLGH'RRUV6KHOYHV 7&*' /6OLGH'RRUV6KHOYHV

$

%

%&XUYHG*ODVV%DNHU\'HOL'LVSOD\&DVHV &XUYHGJODVVIURQWIRUHOHJDQWSUHVHQWDWLRQRIGHOLDQGEDNHU\SURGXFWV6HOIFRQWDLQHG&)&IUHH$ UHIULJHUDWLRQ V\VWHP ,QVXODWHG DQG WHPSHUHG GRXEOH SDQH JODVV IRU JUHDWHU HIILFLHQF\ DQG HQHUJ\ VDYLQJV /RZ 89 HPLWWLQJ IOXRUHVFHQW ODPSV HQKDQFH SURGXFW DSSHDUDQFH 7&** DQG 7&*5 PRGHOV DUH GHVLJQHG WR RSHUDWH LQ DQ HQYLURQPHQW ZKHUH WHPSHUDWXUH DQG KXPLGLW\ GR QRW H[FHHG ƒ) DQG  UHODWLYH KXPLGLW\ &KRRVH IURP  ODPLQDWH H[WHULRUV RQ WKH 7&*5¶V 7&**¶V KDYH D ZKLWH ODPLQDWHGH[WHULRUEXWDUHDOVRDYDLODEOHLQVWDLQOHVV 0RGHO'HVFULSWLRQ 7&** 'HOL[[6OLGH'RRUV6KHOYHV 7&** 'HOL[[6OLGH'RRUV6KHOYHV 7&** 'HOL[[6OLGH'RRUV6KHOYHV 7&*5&' 'HOL[[6OLGH'RRUV/LJKWHG6KHOI 7&** 'HOL[[6OLGH'RRUV6KHOYHV 7&**6 'HOL[[6OLGH'RRUV6KHOYHV6WDLQOHVV6WHHO 7&*5 %DNHU\ 5HIULJHUDWHG [[6OLGH'RRUV6KHOYHV $GGLWLRQDOPRGHOVDYDLODEOH

&'HOL&DVHV ([WUD ODUJH YLHZLQJ JODVV IRU JUHDWHU SURGXFW YLVLELOLW\ (QYLURQPHQWDOO\ IULHQGO\ RYHUVL]HG DQG EDODQFHG UHIULJHUDWLRQ SURYLGHV KLJK KXPLGLW\ WR SUHVHUYH VOLFHG PHDWV ,QWHULRU ZKLWH DOXPLQXP VLGHV DQG WRS DQG VWDLQOHVV VWHHO IORRU ZLWK FRYHG FRUQHUV ([FOXVLYH IURQW DQG UHDU IOXRUHVFHQW LQWHULRU OLJKWLQJ 'HIURVW V\VWHP WLPHLQLWLDWHG WLPH WHUPLQDWHG DQG DGMXVWDEOH 9HUVDWLOH VWDLQOHVV VWHHO WRS 6LQJOHGXW\ FDVHV IHDWXUH DGMXVWDEOH ZLUH FRDWHG VKHOYHV '[+ 'RXEOHGXW\ FDVHV IHDWXUH VSDFH VDYLQJ UHDU VOLGLQJ GRRUV RSHQ IRU ORZHU UHIULJHUDWHG SURGXFW VWRUDJH '[+&RXQWHUKHLJKWFDVHVIHDWXUHSHUIHFWRYHUDOOKHLJKWIRUIDVWSDFHGVDOHVWUDQVDFWLRQV '[+0RGHO76,'VKRZQ 0RGHO'HVFULSWLRQ 76,'/ [;/'RRU6KHOI 76,' [[/'RRU6KHOYHV 76,' [[/'RRU6KHOYHV 76,' [[/'RRU6KHOYHV 76,' [[/'RRU6KHOYHV 76,' [[/'RRU6KHOYHV 7'%' [[/'RRU)XOO/HQJWK6KHOI 7'%' [[/'RRU)XOO/HQJWK6KHOI 7'%' [[/'RRU+DOI/HQJWK6KHOYHV 7'%' [[/'RRU+DOI/HQJWK6KHOYHV

'&XUYHG*ODVV'LVSOD\&DVHV 'XDO=RQH  &RPELQHV ³GU\´ DQG ³UHIULJHUDWHG´ SURGXFW GLVSOD\ LQWR RQH FRQYHQLHQW FDELQHW &XUYHG JODVV IURQW IRU D VRSKLVWLFDWHGSUHVHQWDWLRQRIKLJKHQGRSHQGHOLDQGEDNHU\SURGXFWV2YHUVL]HGHQYLURQPHQWDOO\IULHQGO\ $ IRUFHGDLUUHIULJHUDWLRQV\VWHP5HIULJHUDWHGVLGHKROGVƒ)WRƒ)IRUIUHVKHUEDNHU\SURGXFWV ([FOXVLYH WRS DQG VKHOI SRVLWLRQHG LQWHULRU OLJKWLQJ /RZ 89 HPLWWLQJ IOXRUHVFHQW ODPSV²SURGXFWV HQKDQFHG LQ IDLWKIXO FRORU )RDPHGLQSODFH KLJK GHQVLW\ SRO\XUHWKDQH LQVXODWLRQ &)& IUHH  0RGHO7&*'=VKRZQ 0RGHO'HVFULSWLRQ 7&*'= /6OLGH'RRUV6KHOYHV 7&*'= /6OLGH'RRUV6KHOYHV

&

'


Refrigeration Equipment | 17 A. Elements™ Display Cases. Value, Performance, Quick Ship! The Elements™ line is perfect for any location that doesn't require customization. These outstanding cases come with standard sizes and features for quick-ship times, value pricing and the same high-quality performance components as the Signature lines. Choose from a variety of merchandisers, from bakery/deli to specialty display cases. Model ECGR-59 shown.

Model Description ECGR-50 Bakery Refr., 50"Lx35"Wx48"H ECGR-59 Bakery Refr., 59"Lx35"Wx48"H ECGR-77 Bakery Refr., 77"Lx35"Wx48"H ECGD-50 Bakery Non-Refr., 50"Lx35"Wx48"H ECGD-59 Bakery Non-Refr., 59"Lx35"Wx48"H ECGD-77 Bakery Non-Refr., 77"Lx35"Wx48"H ECGR-50CD Deli Refr., 50"Lx35"Wx48"H Additional models available.

A B. Combination Sandwich or Salad Prep Refrigerated Self-Serve. Designed with impulse sales in mind. Attention grabbing merchandisers allow for preparing sandwiches or salads along with offering impulse sales of prepared foods, sandwiches, salads and beverages. Top prep area has a stainless steel condiment well that accepts foodservice pans. Prep board is removable so that the case can fit through a standard door opening. Refrigerated self-serve bottom with solid black shelf for merchandising. Clear coil refrigeration control system delivers precise electronic temperature control, on-demand defrost prevents coil freeze up. Available in lengths of 50", 59" and 77". Model Description SSRSP5052 50"Lx34"Wx52"H SSRSP5952 59"Lx34"Wx52"H SSRSP7752 77"Lx34"Wx52"H

B

C

C. Refrigerated Low Profile Merchandisers. Bring product to the customer for increased sales with the reduced labor of a self-serve display case. Maximize your display potential with Federal’s low-profile, refrigerated self-serve glass-end merchandisers. Standard features include two tier solid black metal shelves, choice of six standard laminates on exterior, black trim, stainless steel display deck and black interior ends and back panel. Horizontal top light. Automatic defrost and condensate evaporator for a totally self-contained system. Insulated with high-density foam. Temperature controls maintain 40°F. Thermometer provided. UL Safety and UL Sanitation listed. Available in lengths of 3', 4', 5', and 6'. Model Description LPRSS3 36"Lx46"H, 1/3 HP LPRSS4 48"Lx46"H, 1/3 HP LPRSS5 60"Lx46"H, 1/2 HP LPRSS6 72"Lx46"H, 3/4 HP

E. Refrigerated Self-Serve Specialty Merchandisers. Designed with impulse sales in mind. Get maximum return from attentiongrabbing merchandisers and increase profits. This high profile specialty merchandiser is available in lengths of 3', 4' and 6' and 60" or 78" high. Adjustable black metal shelves with price tag molding can be flat or slanted. The 60" case has two tiers of shelves and the 78" case has four tiers. Insulated with high-density urethane foam, refrigeration controls maintain 40°F. UL Safety and UL Sanitation Listed.

Model RSSM-360SC RSSM-460SC RSSM-560SC RSSM-660SC RSSM-378SC RSSM-478SC RSSM-578SC RSSM-678SC

D D. Convertible Refrigerated Self-Serve Merchandisers. Convertible service top over refrigerated bottom merchandisers in 36", 50", 59", 77" widths. Refrigerated bottom includes steel base construction with black exterior, black interior, glass end panels, horizontal shielded top light, two-tier black display step, thermometer and a condensate evaporator for a totally selfcontained system. Top display features divided merchandise area, clear glass rear sliding doors, tempered lift-up thermopane front glass, adjustable black wire shelf, shielded top and shelf light. Baffle system converts display from non-refrigerated to refrigerated. Model Description SSRC3652 36"x34"x52" SSRC5052 50"x34"x52" SSRC5952 59"x34"x52" SSRC7752 77"x34"x52"

Description 36"Lx351/4"Wx60"H 471/4"Lx351/4"Wx60"H 591/4"Lx351/4"Wx60"H 711/4"Lx351/4"Wx60"H 36"Lx351/4"Wx78"H 471/4"Lx351/4"Wx78"H 591/4"Lx351/4"Wx78"H 711/4"Lx351/4"Wx78"H

E


Refrigeration Equipment | 18 A. Pizza Prep Tables. Oversized and balanced (134A) environmentally friendly refrigeration system, with airflow directed at pans to hold 33°F to 41°F temperature. All stainless steel front, top, and sides. Stainless steel foam insulated cover. Top rail has patented, removable, stainless steel foam insulated covers. Foamed-in-place high density polyurethane insulation. (CFC Free). Extra deep 19 1/ 2 " full length removable cutting board. 6" deep, clear polycarbonate insert pans included. NSF 7 approved. Model Description TPP-44 321/4"Dx353/4"Hx441/2"L, 1 Door, 2 Shelves TPP-44D-2 321/4"Dx353/4"Hx441/2"L, 2 Drawers TPP-67 321/4"Dx353/4"Hx671/4"L, 2 Doors, 4 Shelves TPP-67D-2 321/4"Dx353/4"Hx671/4"L, 1 Door, 2 Shelves, 2 Drawers TPP-67D-4 321/4"Dx353/4"Hx671/4"L, 4 Drawers TPP-93 321/4"Dx353/4"Hx931/4"L, 3 Doors, 6 Shelves TPP-93D-6 321/4"Dx353/4"Hx931/4"L, 6 Drawers Additional models available.

A B B. Sandwich/Salad Prep Tables. Designed with enduring quality that protects your long-term investment. Oversized, environmentally friendly, forced-air refrigeration system holds 33°F to 41°F. Complies with and listed under ANSI/NSF-7-1997-6.3. Stainless steel front, top and ends. Stainless steel foam insulated lid(s) and hood keep pan temperatures colder, lock in freshness and minimize condensation. NSF white polyethylene 11 3 / 4 "x 1 / 2 " removable cutting board. PVC coated wire shelves. Foamed-in-place using Ecomate— a polyurethane insulation that has zero ozone depletion potential and zero global warming potential. Height doesn’t include 6 1 / 4 " for casters. Model TSSU-27-8 shown. Model Description TSSU-27-8 301/8"Dx363/4"Hx275/8"L, 1 Door-2 Shlvs TSSU-27-8D-2 301/8"Dx363/4"Hx275/8"L, 2 Drawer TSSU-36-8 301/8"Dx363/4"Hx363/8"L, 2 Door-4 Shlvs TSSU-48-8 301/8"Dx363/4"Hx483/8"L, 2 Door-4 Shlvs TSSU-48-12 301/8"Dx363/4"Hx483/8"L, 2 Door-4 Shlvs TSSU-60-16 301/8"Dx363/4"Hx603/8"L, 2 Door-4 Shlvs TSSU-72-18 301/8"Dx363/4"Hx723/8"L, 3 Door-6 Shlvs Additional models available.

C. Food Prep Units. Food prep units are energy saving and environmentally friendly (134A refrigerant). Patented forced-air refrigeration system holds 33°F to 41°F. Stainless steel front, top and ends; matching aluminum finished back. Full set of 1/6 size, NSF, polycarbonate insert pans included in condiment rail. Extra deep 8" full length removable white polyethylene cutting board provides a large comfortable working area. Each drawer accommodates two 6"D full size food pans (sold separately). 3-year parts and labor; 5-year compressor warranty. Model TFP-32-12M-D-2 TFP-48-18M-D-4

Description 2 Drawer, 12-Pans, 321/8"Lx311/2"Dx453/4"H 4 Drawer, 18-pans, 481/8"Lx311/2"Dx453/4"H

D. VPT-Series Pizza Prep Tables. Victory's pizza prep tables feature energy efficient, easy to clean “cold-wall construction” for the pan rail which keeps food safe at temperatures between 35°F and 41°F. Interior is constructed of ABS, which is easy to clean and keeps its appearance for years. An 18" reversible cutting board is provided for ample work space. A “night switch” control allows the condiment rail to be turned off overnight for energy savings. Includes 1-year parts and labor warranty and 5-year compressor warranty. Model Description VPT-46 44"Hx341/2"Dx46"W, 11 cu. ft., 2 Shelves VPT-65 44"Hx341/2"Dx655/16"W, 19.7 cu. ft., 4 Shelves VPT-88 44"Hx341/2"Dx885/16"W, 35.5 cu. ft., 6 Shelves VPT-119 44"Hx341/2"Dx119"W, 48.7 cu. ft., 8 Shelves

C

D

E. Dipping Cabinet. Uniquely designed to provide the user maximum functional reliability in an attractive merchandiser to brilliantly display and serve ice cream product. Cold wall refrigeration system. Maintains -10°F to 8°F. Patented reversing condenser fan motors reverse during defrost off cycles to help keep condenser coil free from dirt, dust and debris. Keeping coils clean optimizes the unit’s performance providing colder holding temperatures and increased energy efficiency. NSF removable magnetic frost shields for easy clean up and removal of ice build-up on cabinet walls. For those tight spaces, choose our new slim freezer! Model Description TDC-27 (4) 3 gal. can cap., 261/4"x273/8"x513/8" TDC-47 (13) 3 gal. can cap., 471/8"x273/8"x513/8" TDC-67 (20) 3 gal. can cap., 673/4"x273/8"x513/8" TDC-87 (28) 3 gal. can cap., 885/8"x273/8"x513/8"

E


Refrigeration Equipment | 19 A. 18000 PTB Series Prep Tables. Do you need a production center that keeps your costs low, productivity high and delivers a quality product? Delfield’s pizza prep tables meet those needs with an integrated production center that promotes efficiency and production quality. In addition to the standard features, a wide offering of options are available that allow you to configure your pizza prep table to meet your specific needs. 3-year parts and labor warranty standard. Model 18699PTBM shown.

A

Model 18648PTBM 18660PTBM 18672PTBM 18691PTBM 18699PTBM 186114PTBM

Description 12-Pan Cap., 1/4 HP, 10 Amps 14-Pan Cap., 1/3 HP, 12 Amps 18-Pan Cap., 1/2 HP, 14 Amps 22-Pan Cap., 1/2 HP, 14 Amps 24-Pan Cap., 1/2 HP, 14 Amps 28-Pan Cap., 3/4 HP, 16 Amps

Designed for Foodservice

B. MegaTop 4400 Series Front Breathing Refrigerators. Patented air screen technology ensures that food stays cold without drying it out. Available in 27", B 32", 48", 60", 64" and 72" lengths. 100% front breathing, allowing units to be flush against a wall or built into a cabinet or existing line up. Food is kept at safe, consistent temperatures, keeping your meal quality high and your food waste costs low. Standard with 1/6 size plastic pans and anti-microbial polyethylene cutting boards. Stainless steel top, sides and front. Backs are galvanized; interior is durable, easy to clean ABS. Optional full extension plus drawer system shown in photo, Model D4460N-24M. 3 year parts and labor warranty standard. Model Description 4427N-9M Single-Section, 27"W, 1 Door, (9) 1/6 size pans 4432N-12M Single-Section, 32"W, 1 Door, (12) 1/6 size pans 4448N-18M Two-Section, 48"W, 2 Door, (18) 1/6 size pans 4460N-12M Two-Section, 60"W, 2 Door, (12) 1/6 size pans 4460N-18M Two-Section, 60"W, 2 Door, (18) 1/6 size pans 4460N-24M Two-Section, 60"W, 2 Door, (24) 1/6 size pans 4464N-12M Two-Section, 64"W, 2 Door, (12) 1/6 size pans Additional models available.

D D. 8000N Series Raised Rail Preparation Tables. Randell’s wrapped wall prep table is designed to protect your food from heat gain in the hottest kitchens. The base is cooled by a mullion coil allowing air flow between products stored in the base while protecting the coil from damage behind the door mullion. The raised rail is mechanically cooled instead of forcing air from a base coil. The wrapped wall design produces no air movement only a cold blanket of air that rests above the product protecting it. Standard features include rail drain, with clean out valve, rail on/off switch and separate temperature adjustment for base and rail. Model 8268N shown. Model 8148N 8260N 8268N 8383N 8395N 84111N

Description 48", Holds (6) 1/3 size pans 60", Holds (8) 1/3 size pans 68", Holds (9) 1/3 size pans 83", Holds (10) 1/3 size pans 95", Holds (12) 1/3 size pans 111", Holds (14) 1/3 size pans

C C. 4400 Series Front Breathing Refrigerators. Versatile, high performance units designed to work in the real world. Our 4400 series prep tables provide an integrated design solution to your salad, sandwich and other meal preparation needs. Designed to be easy to work from, they provide a compact area where storage and assembly areas are combined to create an efficient production system. Labor productivity is high. Operational costs are low. Food is kept at safe, consistent temperatures, keeping your meal quality high and your food waste costs low. 3-year parts and labor warranty standard. Model 4472N-18 shown. Model Description 4427N 27" Refrigerator Base Flat Top & Work Top 4427N-6 27" Salad Top Refrigerator Base 4448N 48" Refrigerator Base Flat Top & Work Top 4448N-12 48" Salad Top Refrigerator Base, 2 Door 4464N 64" Refrigerator Base Flat Top & Work Top 4464N-12 64" Salad Top Refrigerator Base, 2 Door 4464N-16 64" Salad Top Refrigerator Base, 2 Door Additional models available.

E. Compact Refrigerators and Freezers. Victory’s line of compact undercounter refrigerators and freezers have more usable storage space and are easier to clean than other brands. Stainless steel top, sides and door and a rugged, one piece ABS interior liner that does not have any seams to catch dirt or debris. Comes standard with four 5" high swivel casters, two epoxy coated shelves and product stops in the rear to maximize air flow. Model UR-27-SST shown. Model Description UR-27-SST Refrigerator 27" Flat Top URD-27-SST Refrigerator 27" Flat Top w/2 Drawer UR-27-SBS Refrigerator 27" w/Back Splash URD-27-SBS Refrigerator 27" w/Backsplash, 2 Drawer UR-48-SST Refrigerator 48" Flat Top UR-48-SBS Refrigerator 48" w/Back Splash UF-27-SST Freezer 27" Flat Top Additional models available.

E


Refrigeration Equipment | 20

A. Compact Undercounter Refrigerators, Freezers & Prep Tables. Door and drawer models now available on select models! Stainless steel exterior sides and top offer durability with an attractive appearance. Anodized aluminum interior stands up to kitchen wear. Stainless steel door with anodized aluminum liner. Self-contained, front-breathing design allows “zero clearance” installation. Meets NSF 7 requirement. Refrigerator models are Energy Star ® listed. Prep Tables come standard with pans, adapter bars and cutting boards. 35 1 / 2 "H, 30 7 / 8 "D and available in convenient 27", 32", 48" and 60" widths.

A Model UHT27-R UHT27-L UHT48-LR UHT60-LR

Description Refr 27" (Right) Refr 27" (Left) Refr 48" (Left/Right) Refr 60" (Left/Right)

Model Description ULT27-L Frzr 27" (Left) ULT48-LR Frzr 48" (Left/Right) ULT60-LR Frzr 60" (Left/Right) Additional models available.

C. TS Series Self-Contained Prep Tables. All day temperature performance to NSF7 requirements. No pan stirring required. Traulsen Prep Table’s TempAssure air flow system circulates cold air around and underneath the pans as well as lofting a protective blanket of cold air over the food surface. Even cooling prevents dried or frozen product. Features include Intela-Traul micro-processor control, high quality easy to clean stainless steel interior/exterior construction. Available in 48", 66", 72" and 90" models. Model TS072HT shown. Model TS048HT TS066HT TS072HT TS090HT

Description 48", Holds (6) 1/3 Size Pans 66", Holds (9) 1/3 Size Pans 72", Holds (10) 1/3 Size Pans 90", Holds (12) 1/3 Size Pans

D Model 9030K-7 9040K-7(s) 9045K-7(s) 9050K-7

Description 48", Holds (3) 12"x20" Pans 60", Holds (4) 12"x20" Pans 72", Holds (5) 12"x20" Pans 84", Holds (5) 12"x20" Pans

B B. AdvantEDGE™ Sandwich Food Prep Refrigerators. AdvantEDGE™ Sandwich Food Prep Refrigerators are available in standard and mega top sizes. Come standard with following features: • Stainless steel interior and exterior • Self closing doors • Cutting board and casters • Curved handle with recessed pocket • 1/6 size pans included, 4"D pans are standard but will accept 6"D pans. • UL, C-UL and ETL Sanitation listed. • Optional drawers and 1- or 2-tier overshelf available. • 3-year parts & labor, 5-year compressor warranty. Model NLSP72-18 shown. Model Description NLSP27-8 1 Door (27") NLSP36-10 1 Door (36") NLSP48-12 2 Door (48") NLSP60-16 2 Door (60") NLSP72-18 3 Door (72") NLSP27-8-001 1 Door (27") w/Drawers NLSP48-12-001 2 Door (48") w/Drawers Additional models available.

C

D. 9000K Refrigerated Sandwich/Saladtop Series. Cool air-over design offers more flexibility, superior air circulation, space and energy savings and ease of use. Maximum top capacity for condiments and maximum base storage capacity with our “front breathing” side-compressor 9000K series. With full depth interiors, you can add high capacity drawers, tray racks for 18"x26" sheet pans or simply store more items in the large storage space that is available. Includes expansion valve refrigeration, high impact ABS door liners, casters, hot gas evaporator and comes fully assembled.

E E. Griddle Stand Refrigerators. Speed up line production with Victory Griddle Stands. All models feature durable stainless steel case front and drawers, self contained energy efficient refrigeration system, dial thermometer and adjustable stainless steel legs. Easy glide drawers have self-adjusting magnetic gaskets for positive seal. Humidity control wires around drawers prevent condensation formation. Model Description GRS-1-S1 501/8"Wx345/8"Dx251/2"H, 6 cu. ft., 1/4 HP GRS-2-S1 771/4"Wx345/8"Dx251/2"H, 12 cu. ft., 1/4 HP GRS-3-S1 105"Wx345/8"Dx251/2"H, 18 cu. ft., 1/4 HP


Refrigeration Equipment | 21 A. Blast Chillers. TBC series blast chillers offer outstanding chill performance combined with durable, easy to use touch screen controls. Exclusive Epicon™ control offers three ways to start chilling. Smart Probe™ mode requires no buttons to be pushed. Auto menu mode for simple menu item recall. Operation is regulated by the food probes, A insuring proper cycle performance every time. Manual menu mode for advanced operators. All modes offer chill setting adjustments, such Description as HACCP documentation provided Model TBC5-50 Undercounter, (5) levels, chills 40#-75# at the end of cycle through an TBC13-24 Reach-In, 13 levels, chills 75#-150# on-board printer and USB port. TBC1H-20 Roll-In, chills 150#-250# Additional models available. C. Undercounter Quick Chiller. Ideal for smaller sized restaurants, deli-areas, schools, hospitals or any foodservice operator concerned with safe temperatures and optimizing operating costs. Designed to safely cool down hot product to food safe temperatures. Innovative chilling refrigeration system features quick temperature pull down performance that can be used for a variety of food products. Equipped with an easy-to-use microprocessor controller which will complement a HACCP documentation program. Stainless steel construction and quality components ensure durability and longer equipment life. 115V, UL and NSF listed. Shown with optional caster, top and door hinging. Model TU048QC 48"L, 9.2 cu. ft.

D E

B. Air-Curtain Refrigerator. Ideal for tray assembly lines in hospitals, flight kitchens, cafeterias or any meal tray assembly operation. Cold air is circulated across the cabinet front, assuring safe product temperatures. Door swings 270º to allow full access and can be kept open for up to 45 minutes with the food product maintaining food safe temperature of 41ºF or less. 15 pair of tray slides for 18"x26" trays maximize the storage capacity. Model ACRS-1D-S1-STS shown. Also available with glass door, model ACRS-1D-S1-STS-GD

D D. Blast Chillers. Great for batch cooking applications resulting in cost savings, better utilization of labor, and increased efficiency. With undercounter, worktop and upright units from 30-200 lbs. cap., Randell Blast Chillers chill food safely exceeding HACCP guidelines. Automatic cooling system with food probes for accurate temperature control. Solid state control with digital read-outs for more accurate data collection. Dual stainless steel air flow plenums for easy cleaning. Model Description BC-3(1) 27”W Undercounter 3-Pan (30 lb.) BC-5E(1) Worktop/Undercounter 5-Pan (50 lb.) BC-20(2) Upright 20-Pan (200 lb.)

C

E. Blast Chillers & Shock Freezers. Increase productivity and coordinate meal plans more efficiently while promoting food safety and conserving energy. The largest line of blast chillers and shock freezers on the market is now more versatile than ever. An optional thaw feature allows food products to be safely thawed and held at temperature, all within HACCP guidelines. An optional UV light sterilizes all Model Description metal surfaces within the cabinet AP5BCF45-2 Cap.: 45 lb. Chill, 27 lb. Freeze, 5-Pan, 291/2"Wx281/4"Lx351/2"H for an added layer of sanitation. AP7BCF70-2 Cap.: 100 lb. Chill, 60 lb. Freeze, 7-Pan, 321/4"Wx36"Lx53"H With 24 different models ranging AP10BCF100-2 Cap.: 100 lb. Chill, 60 lb. Freeze, 10-Pan, 291/2"Wx281/4"Lx601/2"H from 5- to 120-pan, HURRiCHiLL AP12BCF110-3 Cap.: 160 lb. Chill, 90 lb. Freeze, 12-Pan, 321/4"Wx36"Lx74"H has a unit for any application. AP20BCF175-2 Cap.: 200 lb. Chill, 120 lb. Freeze, 20-Pan, 471/4"Wx42"Lx865/8"H Model AP12BCF110-3 shown. Additional models available.

F. Versa Drawer™. Each drawer is its own separate compartment and can operate as a refrigerator, freezer, chiller or thaw cabinet. Operate any of the drawers in any mode, at any time. Fewer refrigeration systems mean reduced service cost and energy consumption. Built-in alarm notifications and service diagnostics. Each drawer holds 2 full size pans. Available in 2- or 4-drawer undercounter models. Model 18650VDR 18650VDL 18682VDR 18682VDL F2984VDR F2984VDL F18VD50 F18VD82 F17VD84

B

Description 2 Drawer (Freestanding/Right Compressor) 2 Drawer (Freestanding/Left Compressor) 4 Drawer (Freestanding/Right Compressor) 4 Drawer (Freestanding/Left Compressor) 2 Drawer (Freestanding/Right Compressor) 2 Drawer (Freestanding/Left Compressor) 2 Drawer (Component) 4 Drawer (Component) 2 Drawer (Component)

F


Blast Chillers Why do you need a blast chiller? Peace of Mind – Knowing that you have properly chilled your hot food through the danger zone and are in full compliance with the FoodSafe practices of HACCP. Food Quality – You spent a great deal of time creating that perfect recipe and purchased only the best ingredients, so don’t destroy it by not chilling properly. Blast chilling maintains food texture, flavor and appearance. Strengthen your bottom line while cultivating satisfied customers. Wider Menu/Greater Choices – Increase your profitability by adding new menu items that have been prepared during slow times, properly chilled and are ready to be finished in a first class manner when ordered by your patrons. Meet Unexpected Demand – When that unexpected after theatre crowd arrives, have the entrees they want ready to go from your Food Bank. Less Shrinkage – Increase the yield of your prepared foods by not losing out to normal moisture loss through evaporation during slow cooling. Less Waste – Finish only the number of entrees or meals actually ordered and don’t throw out good (profitable) product because of no-shows or cancellations. Time & Labor Savings – Prepare foods when you want to; when the staff is available; and when the pace best suits your creative juices without the normal hustle and bustle of a busy kitchen. Cook now, blast chill and finish later. Improved Shelf Life – Capture that seasonal or special bulk buy opportunity and blast chill for a few extra days or shock freeze to stock up for the winter. Source: American Panel


5HIULJHUDWLRQ(TXLSPHQW_ $'HHS8QGHUFRXQWHU5HIULJHUDWRUV)UHH]HUV $Q H[FHSWLRQDO FRPELQDWLRQ RI UHIULJHUDWLRQ XQLWV WKDW HLWKHUVOLGHHDVLO\XQGHUZRUNFRXQWHUVIRUVSDFHHIILFLHQF\ RUSURYLGHDIXQFWLRQDOZRUNVXUIDFHIRUHDV\SUHSDUDWLRQ 0RGHOV IHDWXUH VWDLQOHVV IURQWV WRSV DQG VLGHV DQG  GLDPHWHUFDVWHUV 0RGHO'HVFULSWLRQ 78& '[+[/'RRU6KHOYHV 78&) '[+[/'RRU6KHOYHV 78&' '[+[/'RRU6KHOYHV'UDZHU 78& '[+[/'RRU6KHOYHV 78&' '[+[/'RRU6KHOYHV'UDZHU 78& '[+[/'RRU6KHOYHV 78&) '[+[/'RRU6KHOYHV 78& '[+[/'RRU6KHOYHV $GGLWLRQDOPRGHOVDYDLODEOH

$

&/RZ3URILOH5HIULJHUDWHG (TXLSPHQW6WDQGV 'HVLJQHG E\ WKH VWDQGDUG OHQJWKV RI FRRNWRSHTXLSPHQW6KLSSHGLQDVIDVWDV  KRXUV 0RGHOV ZLWK ³&´ VXIIL[ FRPH VWDQGDUG RQ FDVWHUV )HDWXUH 'HOILHOG¶V IXOO H[WHQVLRQ SOXV GUDZHU V\VWHP DQ LQFUHGLEO\ VPRRWK V\VWHP ZLWK QR PHWDO WRPHWDO FRQWDFW EDFNHG E\ D \HDU GUDZHU WUDFN ZDUUDQW\ 2WKHU IHDWXUHV LQFOXGH IURQW PDULQH HGJH PXOOLRQ VW\OH FRLOV EHWZHHQ HYHU\ GUDZHU DQG VWDLQOHVV VWHHO WRS IURQW VLGHV DQG LQWHULRU ERWWRP DQGEDFN'+$YDLODEOHVHOIFRQWDLQHGDQG UHPRWH\HDUSDUWVDQGODERUZDUUDQW\VWDQGDUG

% %&KHI%DVHV $FFRPPRGDWH DOO EUDQGV RI FRXQWHUWRS FRRNLQJ HTXLSPHQW 2YHUVL]HG HQYLURQPHQWDOO\ IULHQGO\ UHIULJHUDWLRQ V\VWHP $  +ROGV ƒ) WR ƒ) WHPSHUDWXUHV([WHULRUPRXQWHGGLJLWDOWHPSHUDWXUH PRQLWRU &KHI EDVH WRS LV PDGH RI RQHSLHFH KHDY\GXW\ UHLQIRUFHG VWDLQOHVV VWHHO ZLWK GULS JXDUG ,QWHULRU 16) DSSURYHG ZKLWH DOXPLQXP OLQHUFRYHGFRUQHUVDQGVWDLQOHVVVWHHOIORRU 0RGHO'HVFULSWLRQ 75&% [[/'UDZHU 75&% [[/'UDZHU 75&% [[/'UDZHU 75&% [[/'UDZHU 75&% [[/'UDZHU 75&% [[/'UDZHU

&

0RGHO'HVFULSWLRQ )& 6HOI&RQWDLQHG/  'UDZHUV+ROGV3DQV )& 6HOI&RQWDLQHG/  'UDZHUV+ROGV3DQV )& 6HOI&RQWDLQHG/    'UDZHUV+ROGV3DQV )& 6HOI&RQWDLQHG/  'UDZHUV+ROGV3DQV ) 5HPRWH/  'UDZHUV+ROGV3DQV ) 5HPRWH/    'UDZHUV+ROGV3DQV ) 5HPRWH/  'UDZHUV+ROGV3DQV $GGLWLRQDOPRGHOVDYDLODEOH

(

'

'6HULHV5HIULJHUDWHG(TXLSPHQW6WDQGV (TXLSPHQW VWDQGV FRPELQH 5DQGHOO UHIULJHUDWLRQ H[SHUWLVH ZLWK VWUXFWXUDO LQWHJULW\ 5HLQIRUFHG JDXJH VWDLQOHVV VWHHO VXEWRS ZLWK PDULQH HGJH IRU GXUDELOLW\ DQG FOHDQDELOLW\ )XOO\ H[WHQGDEOH GUDZHUV DFFRPPRGDWH WZR [[ SDQV SHU GUDZHU SDQV QRW LQFOXGHG  $YDLODEOH LQ OHQJWKV  WR  3DWHQWHG GUDZHU FDUWULGJHV\VWHPZLWKD\HDUZDUUDQW\RQWKHHQWLUHGUDZHUV\VWHP([SDQVLRQYDOYH UHIULJHUDWLRQV\VWHPZLWKWKHUPRVWDWLFFRQWUROIRURSHUDWRUDGMXVWDELOLW\16)8/ 0RGHO'HVFULSWLRQ 6& Z  'UDZHUV '3DQV

6& Z  'UDZHUV '3DQV

6& Z  'UDZHUV '3DQV

(7(6HULHV5HIULJHUDWHG(TXLSPHQW6WDQGV +HDY\ GXW\ (TXLSPHQW 6WDQGV DUH HTXLSSHG ZLWK ,QWHOD7UDXOŠ PLFURSURFHVVRU IRU SUHFLVH WHPSHUDWXUH FRQWURO 'HGLFDWHG HYDSRUDWRU IDQ GHVLJQ IRU HDFK VHFWLRQNHHSVIRRGFROG6WDLQOHVVVWHHOPDULQHWRSFDQ KDQGOH HTXLSPHQW ZHLJKLQJ IURP  OEV RQ WKH VPDOOHVW  XQLW WR  OEV RQ WKH ODUJHVW  XQLW²,GHDO IRU XVH ZLWK EURLOHUV RYHQV IU\HUV RU JULGGOHV &DQ DFFRPPRGDWH ' SDQ LQ HYHU\ GUDZHU 2XUGUDZHUGHVLJQRIIHUVWKHPD[LPXPSDQFDSDFLW\LQ WKHPDUNHW)URQWEUHDWKLQJGHVLJQIRU³]HURFOHDUDQFH´ LQVWDOODWLRQ 0RGHO'HVFULSWLRQ 7(+7 /'UDZHU  [ 3DQ&DS 7(+7 /'UDZHU  [ 3DQ&DS 7(+7 /'UDZHU  [ 3DQ&DS 7(+7 /'UDZHU  [ 3DQ&DS 7(+7 /'UDZHU  [ 3DQ&DS 7(+7 /'UDZHU  [ 3DQ&DS 7(+7 /'UDZHU  [ 3DQ&DS 7(+7 /'UDZHU  [ 3DQ&DS $GGLWLRQDOPRGHOVDYDLODEOH


Refrigeration Equipment | 24 A. Refrigerator/Freezer Worktops. Slide easily under work counters for maximum space efficiency. An exceptional combination of refrigeration units that provide a functional work surface for easy preparation. Stainless fronts, tops and sides, adjustable legs and self-closing doors. The worktop offers an exclusive one-piece formed construction stainless back splash that prevents food and bacteria entrapment. Height doesn’t include 61/4" for casters. Model TWT-48 shown. Model Description TWT-27 301/8"Dx333/8"Hx275/8"L, 1 Door, 2 Shelves TWT-27F 301/8"Dx333/8"Hx275/8"L, 1 Door, 2 Shelves TWT-36 301/8"Dx333/8"Hx363/8"L, 2 Door, 4 Shelves TWT-48 301/8"Dx333/8"Hx483/8"L, 2 Door, 4 Shelves TWT-48F 301/8"Dx333/8"Hx483/8"L, 2 Door, 4 Shelves TWT-60 301/8"Dx333/8"Hx603/8"L, 2 Door, 4 Shelves TWT-60F 301/8"Dx333/8"Hx603/8"L, 2 Door, 4 Shelves TWT-72 301/8"Dx333/8"Hx723/8"L, 3 Door, 6 Shelves

A

B. Milk Coolers. This school favorite sports a convenient drop front and flip-up tops, door locks, easily visible digital thermometers and a new hold open feature for the flip-up top. True’s high performance, forced-air milk coolers provide colder product temperatures and lower utility costs. The TMC series offers a broad range of applications including dual-sided models, two exterior options, reinforced stainless interior floor and food safe 33°F to 38°F temperature for improved milk quality and better milk taste. Uses 134A refrigerant. Front casters lock in place. Model TMC-49 shown. Model Description TMC-34 333/8"x411/2"x34"L, 2 Door, Holds 8 Crates TMC-34S 333/8"x411/2"x34"L, 2 Door, Holds 8 Crates TMC-49 333/8"x411/2"x49"L, 2 Door, Holds 12 Crates TMC-49S 333/8"x411/2"x49"L, 2 Door, Holds 12 Crates TMC-58 333/8"x411/2"x58"L, 2 Door, Holds 16 Crates TMC-58S 333/8"x411/2"x58"L, 2 Door, Holds 16 Crates TMC-49-DS Dual-Sided, 333/8"x411/8"x49"L, 4 Door, Holds 12 Crates TMC-49S-DS Dual-Sided, 333/8"x411/8"x49"L, 4 Door, Holds 12 Crates TMC-58-DS Dual-Sided, 333/8"x411/8"x58"L, 4 Door, Holds 16 Crates TMC-58S-DS Dual-Sided, 333/8"x411/8"x58"L, 4 Door, Holds 16 Crates

C. Shelleymatic® Air Curtain Milk Coolers. This patented air curtain design retains cold air in the interior of the unit for maximum cooling ability. Interior is lined with 22-gauge stainless steel. Cabinet is fully insulated with 2" of high-density foamed-in-place polyurethane. Cabinet maintains 36°F to 40°F interior temperature. Properly chilled food product will maintain 40°F for up to 2 hours with lids open. Capacity 8, 12 or 16 (13"x13"x101/2") milk crates. Uses HFC-134A refrigerant, 115V, 60 HZ. Model Description NLFAC-8 Holds 8 Crates NLFAC-12 Holds 12 Crates NLFAC-16 Holds 16 Crates

C

D. Milk Coolers. Powerful refrigeration system enables unit to maintain product temperature for longer periods of time with the door open. Storage for 8, 12 or 16 cases of milk cartons. Drop lid provides selfserve milk with easy access. Exterior self-service doors are stainless steel. Casters. Heavy-duty floor racks and key locking feature. Our dual access milk cooler enables one unit to serve two serving lines. 3-year parts and labor, 5-year compressor warranty standard. Model Description AR082SSS/0-A Open Front, 8 Case Cap. AR122SSS/0-A Open Front, 12 Case Cap. AR162SSS/0-A Open Front, 16 Case Cap. AR084SSS/0-A Dual Access, 8 Case Cap. AR124SSS/0-A Dual Access, 12 Case Cap. AR164SSS/0-A Dual Access, 16 Case Cap.

B

E

E. Shelleymatic® Milk or Beverage Dispensers. Mobile, self-contained milk dispenser is available in 12 and 18 crate capacities. Drop front allows for easy access. Door lock is standard. Casters provide serving mobility and convenience. Cabinet maintains temperature of 36°F to 40°F with lids closed. Fiberglass/laminate panels are available to match any décor. Uses HFC-134A refrigerant. UL, NSF, 120V. Model Description NDF-12 12 Crates NDF-18 18 Crates

D


Refrigeration Equipment | 25

A. CU50-Series Undercounter Cube Ice Machines. 15" wide and compact enough to fit under a standard 40" counter. Ideal where space is limited. Unique inside door flap prevents spillage and maximizes storage. Produces small cube ice. Model CU50 shown with stainless steel kick plate. Model CU50GA-1A CU50PA-1A

Description 44 lb. Air, 115V, Gravity Drain 44 lb. Air, 115V, Pump Drain

B A B. Undercounter Gourmet Ice Machine. These self-contained ice machines are 15" wide and compact enough to fit under a standard 40" counter. Durable stainless steel construction. Ideal for bar use, upscale restaurants and office suites. Produces clear, long-lasting gourmet shaped ice. Model CU0515GA-1A

C. Prodigy速 Undercounter Cube Ice Machines. Compact enough to fit under a standard 40" counter. With easy front access, front air circulation and serviceability, they can be built in almost anywhere. Removable door and top provide ample access to components and easier service. Combined with the Prodigy速 control board with code and component light displays, technicians can determine operating issues quickly, ensuring the right fix the first time. Produces small or medium cube ice. Air-cooled models are Energy Star速 rated. Model CU1526MA-1A CU1526SA-1A CU1526MW-1A CU1526SW-1A CU2026MA-1A CU2026SA-1A CU2026MW-1A CU2026SW-1A CU3030MA-1A CU3030SA-1A CU3030MW-1A CU3030SW-1A

Description 150 lb. Air, 115V, Medium Cube 150 lb. Air, 115V, Small Cube 175 lb. Water, 115V, Medium Cube 175 lb. Water, 115V, Small Cube 200 lb. Air, 115V, Medium Cube 200 lb. Air, 115V, Small Cube 240 lb. Water, 115V, Medium Cube 240 lb. Water, 115V, Small Cube 250 lb. Air, 115V, Medium Cube 250 lb. Air, 115V, Small Cube 310 lb. Water, 115V, Medium Cube 310 lb. Water, 115V, Small Cube

C

E

E. Modular Ice Storage Bins. These bins feature easy front access to ice. Storage capacity from 200 to 1,700 lb. of ice per day. Available in durable roto cast plastic or stainless steel finishes. ARI, NSF approved. D. Self-Contained Undercounter Flake Ice Machines. Compact enough to fit under a standard 40" counter. With easy front access, front air circulation and serviceability, they can be built in almost anywhere. Perfect problem solver for locations where space is limited. Features a continuous ice-making process, no harvest time delays. Delivers steady flow of ice for fast recovery of ice supply. One heavy duty flaker mechanism with a stainless steel auger. Stainless steel or roto-cast grey finish. Produces flake ice.

D

Model AFE424A-1A AFE424W-1A

Description 395 lb. Air, 115V 395 lb. Water, 115V

Model B322S B330P B530S B530P B842S B948S BH1100SS-A BH1100BB-A

Description 300 lb. Stainless 300 lb. Poly 500 lb. Stainless 500 lb. Poly 800 lb. Stainless 900 lb. Stainless 1100 lb. Stainless 1100 lb. Stainless w/ Galvanized Back & Bottom BH1300SS-A 1300 lb. Stainless BH1300BB-A 1300 lb. Stainless w/ Galvanized Back & Bottom BH1600SS-A 1600 lb. Stainless BH1600BB-A 1600lb. Stainless w/ Galvanized Back & Bottom KBT40A ID150 Bin Top for 22" Eclipse Additional models available.


5HIULJHUDWLRQ(TXLSPHQW_

$

$3URGLJ\Š 1XJJHW0RGXODU,FH0DFKLQHV 6RIW FKHZDEOH QXJJHW LFH LV WKH  FKRLFH DPRQJ FRQVXPHUV 5HIUHVKWKHHQWLUHEHYHUDJHH[SHULHQFHZLWKDXQLTXHRSWLRQWKDWJHWV FRQVXPHUV H[FLWHG DQG FRPLQJ EDFN IRU PRUH 3URGLJ\Š 1XJJHW LFH PDFKLQHV XVH OHVV ZDWHU DQG HOHFWULFLW\ WKDQ VWDQGDUG FXEH LFH PDFKLQHV 7KH VHOIPRQLWRULQJ V\VWHP DQG $XWR$OHUWŒ H[WHUQDO LQGLFDWRU OLJKWV FRQVWDQWO\ FRPPXQLFDWH WKH PDFKLQH¶V RSHUDWLQJ VWDWXVDQGVLJQDOVZKHQLW¶VWLPHWRSHUIRUPPDLQWHQDQFHEHIRUHWKHUH LV DQ LVVXH 8/ $5, 16) DSSURYHG %LQV VROG VHSDUDWHO\ 0RGHO 1VKRZQRQ%6ELQ 0RGHO'HVFULSWLRQ 1$ OE$LU&RROHG 1: OE:DWHU&RROHG 1$ OE$LU&RROHG 15 OE5HPRWH&RROHG 1: OE:DWHU&RROHG 1$ OE$LU&RROHG 1$ OE$LU&RROHG 15 OE5HPRWH&RROHG 1/ OE5HPRWH/RZ6LGH 1/ OE5HPRWH/RZ6LGH

% %8SULJKW,FH6WRUDJH%LQV 0RUHVWRUDJHHDVLHULFHUHPRYDO)ROOHWWXSULJKW ELQV HQVXUH WKDW ILUVW LFH LQWR WKH ELQ LV WKH ILUVW LFH RXW IRU IUHVKHU FOHDQHU GHOLYHUHG LFH 3DWHQWHG 6PDUW*DWH WHFKQRORJ\ SURYLGHV DFFHVV DQG FRQWURO RI LFH IORZ ZLWKLQ WKH ELQ 1RZ ZLWK HDV\ WR FOHDQ FRUURVLRQUHVLVWDQW $%6SRO\ WRSV  R] SODVWLF LFH VFRRS DQG  DGMXVWDEOH VWDLQOHVV VWHHO OHJV 6KLSV IXOO\ DVVHPEOHG DQG FRPHV ZLWK D OLIHWLPH FDELQHW DQG OLQHU ZDUUDQW\ 1HZ VSDFH VDYLQJ GHVLJQ 6LQJOH 'RRU 8SULJKW %LQ ZLWK  OEV RI VWRUDJHFDSDFLW\LQDIRRWSULQWWKDWILWVXQGHU D VWDQGDUG  IW FHLOLQJ ZLWK PRVW LFHPDNHUV 0RGHO6*VKRZQ 0RGHO'HVFULSWLRQ 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6*6 6JO:OEFDS 6* 'EO:OEFDS 6* 'EO:OEFDS 6* 'EO:OEFDS $GGLWLRQDOPRGHOVDYDLODEOH

7KH,FH0DFKLQH &RQGHQVHU4XHVWLRQ :KLFK RQH LV LGHDO" $ ZDWHUFRROHG PRGHO LV TXLHW HDV\ WR LQVWDOO DQG GRHV QRWHPLWH[FHVVKHDWLQWRWKHURRP7KH WUDGHRIILVWKHFRVWRIWKHZDWHU,QPDQ\ DUHDV ZDWHUFRROHG PDFKLQHV DUH QRW HYHQ DOORZHG VR FKHFN ZLWK WKH ORFDO DXWKRULWLHV 6HOIFRQWDLQHG DLUFRROHG PDFKLQHV DUH WKH HDVLHVW DQG FKHDSHVW WR LQVWDOO KRZHYHU WKH\ PDNH WKH PRVW QRLVH DQG H[KDXVW KHDW LQWR WKH VXUURXQGLQJ DLU 5HPRWH DLUFRROHG PRGHOV KDYH D ORZ QRLVH DGYDQWDJH RYHU ZDWHUFRROHG DQG XVHQRPRUHZDWHUWKDQDVHOIFRQWDLQHG DLUFRROHG EXW WKH\ DUH H[SHQVLYH WR LQVWDOO

&3URGLJ\Š 0RGXODU&XEH,FH0DFKLQHV 8VHV OHVV HQHUJ\ DQG ZDWHU WKDQ WUDGLWLRQDO LFH PDFKLQHV H[FHHGLQJ IHGHUDO HQHUJ\ HIILFLHQF\ UHJXODWLRQV E\ XS WR  $XWR$OHUWŒ LQGLFDWRU OLJKWV FRPPXQLFDWH RSHUDWLQJ VWDWXV DQG VLJQDOV ZKHQ LW¶V WLPH WR SHUIRUP QRUPDO PDLQWHQDQFH RU WLPH IRUVHUYLFHEHIRUHWKHUHLVDQHPHUJHQF\3DWHQWHG:DWHU6HQVH DGDSWLYH SXUJH FRQWURO UHGXFHV VFDOH EXLOGXS E\ GHWHFWLQJ KDUG ZDWHU FRQGLWLRQV DQG SXUJLQJ PLQHUDOODGHQ ZDWHU 6WDLQOHVVVWHHOILQLVK3URGXFHVVPDOORUPHGLXPFXEHLFH%LQV VROGVHSDUDWHO\ 0RGHO'HVFULSWLRQ &0$& OE$LU&RROHG0HGLXP&XEH &0:& OE:DWHU&RROHG&XEHU0HGLXP&XEH &6$& OE$LU&RROHG&XEHU6PDOO&XEH &6:& OE:DWHU&RROHG&XEHU6PDOO&XEH &0$% OE$LU&RROHG0HGLXP&XEH &6$% OE$LU&RROHG6PDOO&XEH $GGLWLRQDOPRGHOVDYDLODEOH

&

'

',FH‡'HY,FHDQG7UDQVSRUW6\VWHPV )LUVW LFH PDGH LV ILUVW LFH RXW PHDQLQJ IUHVKHU WDVWLQJ LFH /HW JUDYLW\ UHSODFH GLIILFXOW WLPHFRQVXPLQJ VFRRSLQJ DQG VKRYHOLQJ RI LFH /HW ZKHHOV HOLPLQDWH GDQJHURXV PHVV\ XQVDQLWDU\ FDUU\LQJ RI LFH EXFNHWV )ROOHWW¶V QRQPHFKDQLFDO ,FH‡'HY,FHŒGHVLJQXVHVJUDYLW\WRUHPRYHLFHIURPWKHELQ² MXVW RSHQ WKH IURQW FKXWH DQG FXEH LFH IORZV RXW RI WKH ELQ 6PDUW&$57ZLWKWRWHVWKDWFDUU\OEVRILFHUHGXFHVULVNRI EDFN LQMXULHV DQG VOLSV DQG IDOOV 'LIIHUHQW FDUW VL]HV DYDLODEOH IRUYDULHGQHHGV7RWHVDUHQRQQHVWLQJWRDYRLGFRQWDPLQDWLRQ 0RGHO'HVFULSWLRQ '(96* 6LQJOH'RRUZ6&:OEFDS '(96* 6LQJOH'RRUZ6&:OEFDS '(96* 6LQJOH'RRUZ6&:OEFDS '(96* 6LQJOH'RRUZ6&:OEFDS '(96* 6LQJOH'RRUZ6&:OEFDS '(96* 6LQJOH'RRUZ6&:OEFDS '(96* 6LQJOH'RRUZ6&:OEFDS '(96* 6LQJOH'RRUZ6&:OEFDS $GGLWLRQDOPRGHOVDYDLODEOH


Refrigeration Equipment | 27

A

A. ICE Series™ Modular Cube Ice Makers. Ice-O-Matic’s modular cubers have been redesigned to offer better reliability and care-free operation. The machines are perfect for foodservice and hospitality needs, and meet CEC or Energy Star® criteria. PURE ICE® provides built-in anti-microbial protection for the life of the machine, inhibiting bacteria, slime and fungus growth. The optional water filtration system protects against unpleasant tastes, odors and scale formation, and our unique Harvest Assist feature overpowers scale and boosts energy efficiency by speeding up the ice production. Model ICE0400 shown on B55 bin (bins sold separately). Model Description ICE0320A 22"W, 334 lbs., use bin B42PS sold separately ICE0520A 22"W, 520 lbs., use bin B42PS sold separately ICE0250A 30"W, 336 lbs., use bin B40PS sold separately ICE0400A 30"W, 505 lbs., use bin B40PS sold separately ICE0500A 30"W, 565 lbs., use bin B55PS sold separately ICE0500R 30"W, 567 lbs., Remote (condenser sold separately) ICE0606A 30"W, 652 lbs., use bin B55PS sold separately Additional models available.

B Easy to Clean and Maintain

C. Self-Contained Cube Ice Machines. The perfect ice maker for small-space applications such as bars, coffee shops and wait stations. This small self-contained machine comes in several cube configurations. These offer the highest level of production and storage of any self-contained model in the industry. Most are Energy Star® approved. Model Description ICEU070A 15" Air Cooled, 84 lbs. ice per day, 24 lb. stor. cap. ICEU150FA 24" Air Cooled, 185 lbs. ice per day, 74 lb. stor. cap. ICEU150FW 24" Water Cooled, 185 lbs. ice per day, 74 lb. stor. cap. ICEU220FA 24" Air Cooled, 238 lbs. ice per day, 74 lb. stor. cap. ICEU220FW 24" Water Cooled, 251 lbs. ice per day, 74 lb. stor. cap. ICEU300FA 30" Air Cooled, 309 lbs. per day, 112 lb. stor. cap. ICEU300FW 30" Water Cooled, 356 lbs. per day, 112 lb. stor. cap.

Model GEM0450A GEM0650W GEM0650R GEM0956A GEM0956W GEM0956R GEM0650A GEM0450W KBT19 KBT24

Model MFI0500A

Description 540 lbs. ice per 24 hrs., 70° Air / 50° Water, Range due to Condenser Type (Bin Required) MFI0500W 541 lbs. ice per 24 hrs., 70° Air / 50° Water, Range due to Condenser Type (Bin Required) MFI0800A 768 lbs. ice per 24 hrs., 70° Air / 50° Water, Range due to Condenser Type (Bin Required) MFI0800R 819 lbs. ice per 24 hrs., 70° Air / 50° Water, Range due to Condenser Type (Bin Required) MFI0800W 859 lbs. ice per 24 hrs., 70° Air / 50° Water, Range due to Condenser Type (Bin Required) Additional models available.

C

D. Pearl Ice® Ice Makers. Making ice shouldn’t be complicated, so we’ll make it easy for you to see why installing a Pearl Ice® Chewable Nugget Ice Maker is a no-brainer. Pearl Ice enhances beverage programs and lowers operating costs. Soft, chewable ice crystals are ideal for quick serve restaurants, convenience stores and medical applications. Mount on a dispenser or use in combination with a traditional ice storage bin (sold separately). Model GEM0650 shown on B42 bin.

D

B. MFI-Series Modular Flake Ice Makers. High quality flaked ice is ideal for medical, supermarket or restaurant applications. The MFI-series is the best ice making solution for hard water, food safety and tight spaces. Corrosion-resistant 300series stainless steel construction available with an air- or watercooled condenser. Maximum ice production in a minimum amount of space—16"W cabinet. Maximum ice production in a 115 volt ice maker. Works on all industry dispensers and bins. No air filter to change. Removes excess water by pushing the flaked ice through an extrusion process. Model MFI0500 shown on B55 bin.

Description 21"W Air, 464 lbs.-use bin B42PS w/KBT24 kit, sold separately 21"W Water, 770 lbs.-use bin B55PS w/KBT19 kit, sold separately 21"W Remote,770 lb.-use bin B55PS w/KBT19 kit, sold separately; Cndsr sold sep. 21"W Air, 1100 lbs.-use bin B55PS w/KBT19 kit, sold separately 21"W Water, 1020 lbs.-use bin B55PS w/KBT19 kit, sold separately 21"W Remote, 1100 lb.-use bin B55PS w/KBT19 kit, sold separately; Cndsr Sold Sep. 21"W Air, 740 lbs.-use bin B55PS w/KBT19 kit, sold separately 21"W Water, 508 lbs.-use bin B42PS w/KBT24 kit, sold separately Bin Storage Adapter-use w/bin B55PS Bin Storage Adapter-use w/bin B42PS

E. Hotel Dispensers. Designed for rugged, high usage environments, these 22" and 30" stainless steel dispensers have fingerprint-proof dispensing areas and oversized sinks to accommodate almost any size ice bucket. Both models dispense 1/4 lb. ice per second, allow for easy cleaning and provide ice storage in a minimum amount of space. The 30" dispenser is available with push-to-dispense and water filler options. Model CD40030 shown with ICE0400 Cube Ice Maker (sold separately). Model CD40022

E

Description 22" Push-to-Dispense, 120 lbs. Storage, for 22" Cubers (sold separately) CD40130 30" w/Water Filler Option, 180 lbs. Storage, for 22" or 30" Cubers (sold separately) IOD150 22"W, Ice Only Dispenser, 150 lbs. Storage, for 22" Cuber or 21" Pearl Ice® machines (sold separately) Additional models available.


Refrigeration Equipment | 28 B. Indigo™ Ice Machines. The award-winning Indigo uses technology to simplify everything about the ice making process. State-of-the-art diagnostics provide constant and reliable monitoring of refrigeration systems. In turn, that information is used to improve energy management, set proper ice production levels, streamline cleaning processes, ease food safety concerns, maintain ice quality and quickly display up-to-date service information. Several models are Energy Star ® qualified. Model IY0504A shown on B570 bin. B-style bins feature DuraTech™ stainless finish exterior and a soft trim around the opening to help silence bin door closing. Convenient stay-open design keeps bin door out of the way while scooping ice. Internal scoop holder stays above the ice line for easy access and better sanitation. Bins sold separately. Model Description ID0322A-161 22"W Dice, Air 115V, 335 lbs. 24-Hr. ID0323W-161 22"W Dice, Water 115V, 330 lbs. 24-Hr. IY0324A-161 22"W Half Dice, Air 115V, 350 lbs. 24-Hr. IY0325W-161 22"W Half Dice, Water 115V, 350 lbs. 24-Hr. ID0502A-161 30"W Dice, Air 115V, 530 lbs. 24-Hr. ID0503W-161 30"W Dice, Water 115V, 550 lbs. 24-Hr. Additional models available.

B A A. ICE-Series™ Modular Cube Ice Makers with Top Air Discharge. “Off-the-top” exclusive by Ice-O-Matic®...The Best Solution for Tight Spaces! Ice-O-Matic offers its exclusive top-air discharge as an optional free feature on 30"W air-cooled ICE-Series™ modular cubers up to 600 lbs. Requires 30" of total clearance, compared to 42" required by other 30" modular ice machines. The result: a space savings of close to 30%. Top air discharge units direct the hot discharge air towards the ceiling and not at the customer. It can even be directed towards air return ducts or tied into the HVAC to eliminate the hot air completely. Model ICE0400 shown on B55 bin. Also available in half (HT) or full (FT) cube. Bins sold separately. Model ICE0250 Top Air ICE0400 Top Air ICE0500 Top Air ICE0606 Top Air

Description 353 lbs., 70° Air / 50° Water 499 lbs., 70° Air / 50° Water 565 lbs., 70° Air / 50° Water 652 lbs., 70° Air / 50° Water

C. B-Style Ice Storage Bins. Highly styled design offers perfect fit for ice machines. DuraTech stainless finish exterior is durable, corrosion resistant and attractive. Soft durometer trim around opening helps silence bin door closing. Convenient stay-open design keeps bin door out of the way while scooping ice. Internal scoop holder stays above ice line for easy access and better sanitation.

C

Model B-170 B-320 B-400 B-420 B-570 B-970

Description 150 lb. bin 210 lb. bin 290 lb. bin 310 lb. bin 430 lb. bin 710 lb. bin

D. Pearl® Undercounter Ice Maker. The best solution for hard water, food safety and tight spaces. This 15"W undercounter ice maker is ideal for small-space applications, such as suites for entertainment venues, break rooms, offices and cafés—and it’s approved for outdoor use. This small self-contained machine features a consumer favorite, chewable Pearl Ice®. Enjoy quiet operation and easy installation with a simple 115 volt plug-in design. Model GEMU090

D

E. Slope Front Storage Bins. Ice-O-Matic slope-front storage bins are the best solution for low- to medium-volume ice storage needs. Industry-leading design includes a safe-hold door hinge, a built-in scoop holder, tightly sealed bin doors and a stainless exterior. One-piece polyethylene bin liners and industrial foam insulation provide maximum ice preservation with less congealing. These reliable bins are constructed with practicality in mind for years of carefree operation.

E

Model Description B42PS 22"W, 351 lbs. cap. B25PP 30"W, 242 lbs. cap. B40PS 30"W, 344 lbs. cap. B55PS 30"W, 510 lbs. cap. B100PS 48"W, 854 lbs. cap. B120SP 48"W, 1142 lbs. cap. B120SS 48"W, 1142 lbs. cap. B150SP 60"W, 1447 lbs. cap. Additional models available.


Refrigeration Equipment | 29

B. Modular Nugget Ice Machine. Modular Nugget Ice Machines offer the ultimate flexibility. Select the bin and head unit separately and build your own custom unit. Standard measurements for perfect pairing with 22" bins. No adapter needed. Produces up to 306 lbs. of nugget ice daily. Model RNS0308A-161

B A A. Flake Ice Machines. When it comes to food preservation, a cool presentation can lead to cold, hard profits. Not only does your product need to look good and stay fresh, the ice needs to look good too. Manitowoc flake ice machines offer quick cooling, moldable flakes. Small, soft pieces of ice with a 73% ice-to-water ratio form around objects without bruising and hold in place without tipping or spilling. Perfect for food and beverage presentation and hand scooping into drinks. RFS0650A shown on top of a B420 bin. Model Description RFS0300A-161 384 lbs. production, 22" Air Cooled, 115V RFS0650A-161 717 lbs. production, 22" Air Cooled, 115V RFS0650W-161 722 lbs. production, 22" Water Cooled, 115V RFS0650A-261 747 lbs. production, 22" Air Cooled, 208-230V RFS0650W-261 726 lbs. production, 22" Water Cooled, 208-230V RFS1200A-261 1202 lbs. production, 30" Air Cooled, 208-230V RFS1200W-261 1339 lbs. production, 30" Water Cooled, 208-230V

E

C. Hotel Ice Dispensers. These automatic-fill, floor-standing ice dispensers meet the strict sanitary needs of the lodging, foodservice and healthcare industries. Providing daily ice production up to 940 lbs. 426 kg, the SPA dispensers feature a patented “push for ice” dispense mechanism and paddlewheel ice delivery. The SFA models add a built-in water valve for filling buckets, cups or refillable bottles. Attractively styled to complement any décor. Available with room card or coin option for ice activation. Model Description SPA-160-161 120 lbs. stor., 22"Wx31"Dx48"H, 115V SPA-160-261 120 lbs. stor., 22"Wx31"Dx48"H, 208-230V SPA-310-161 120 lbs. stor., 30"Wx32"Dx601/2"H, 115V SPA-310-261 120 lbs. stor., 30"Wx32"Dx601/2"H, 208-230V Additional models available.

D. RNS Series Countertop Nugget Ice Maker & Dispenser. Nugget ice provides a high quality, soft, chewable texture while still providing maximum cooling effect. Bite size nuggets boast 90% ice content with only 10% water content offering one of the best nugget ratios for minimum drink dilution. Small pieces ranging from 3/8" to 1/2" (0.95 to 1.27 cm) width and length on average make up Manitowoc nugget ice. Small nuggets of ice make these ice machines perfect for drink dispensing, ice packs, blended beverages and ice/water needs. Model Description RNS12A-161 35"Hx161/4"Wx24"D, 12 lbs. bin cap., lever activated RNS20A-161 42"Hx161/4"Wx24"D, 20 lbs. bin cap., lever activated RNS12AT-161 35"Hx161/4"Wx24"D, 12 lbs. bin cap., sensor activated RNS20AT-161 42"Hx161/4"Wx24"D, 20 lbs. bin cap., sensor activated

E. NEO Ice Machine. The NEO provides a new level of performance, intelligence and convenience. Depending on model, it can deliver up to 40 lbs. more ice over a 24 hour period as previous models but keeps the same compact footprint. Saves at least 10% on energy consumption and a minimum of 25% on water usage. Smart control panel with recognizable display icons provide on-the-spot feedback. Easy access, angled door with larger opening makes ice more visible and easier to scoop. Features removable, forward-sliding storage bin for easy access to refrigeration components. Pop-out air filter protects against lint, grease and dust.

Model UD0140A-161B

C

D

Description 130 lbs. of production, Air Cooled, 115V, Dice Cube UD0140W-161B 130 lbs. of production, Water Cooled, 115V, Dice Cube UY0140A-161B 130 lbs. of production, Air Cooled, 115V, Half-Dice Cube UY0140W-161B 130 lbs. of production, Water Cooled, 115V, Half-Dice Cube UR0140A-161B 130 lbs. of production, Air Cooled, 115V, Regular Cube UD0240A-161B 230 lbs. of production, Air Cooled, 115V, Dice Cube Additional models available.


5HIULJHUDWLRQ(TXLSPHQW_

$

$,FH2QO\DQG,FH%HYHUDJH'LVSHQVHUV ,'6HULHV ,FH 2QO\ 'LVSHQVHUV DUH DWWUDFWLYH FRQWHPSRUDU\ GHVLJQHG DYDLODEOH LQ  RU  ZLGWKV VWRULQJ IURP  WR  OEV RI LFH 'XUDEOHVWDLQOHVVVWHHOH[WHULRUUHVLVWVFRUURVLRQ DQG FDQ ZLWKVWDQG WKH SXQLVKPHQW RI HYHU\GD\ XVH&DQEHFRPELQHGZLWKDQ\RUZLGH LFH PDFKLQH $OO VWRUDJH ELQV DUH PDGH RI UXVW IUHH SODVWLF DQG WKH GLVSHQVLQJ PHFKDQLVP LV PDGH RI KHDY\ GXW\ FRPSRQHQWV IRU ORQJ OLIH 6WDLQOHVVVWHHOILQLVK 0RGHO'HVFULSWLRQ ,'%$ OE6WRUDJH&XS$FWLYDWHG &RXQWHU7RS,FH2QO\'LVS ,'%$ OE6WRUDJH&XS$FWLYDWHG &RXQWHU7RS,FH2QO\'LVS ,'%$ OE6WRUDJH&XS$FWLYDWHG &RXQWHU7RS,FH2QO\'LVS ,2%'06 0DFKLQH6WDQGIRU,' ,2%'06 0DFKLQH6WDQGIRU,',' .18*',9 .LW)LHOG,QVWDOOHG1XJJHW,FH 'LYHUWHUIRUDOO,' (''LVS .:*),' .LW)LHOG,QVWDOOHG:DWHU*ODVV )LOOHUIRUDOO,''LVS

%7RXFK)UHHŠ ,FH0DNHU'LVSHQVHU 7RXFK)UHH DFWXDWLRQ SURYLGHV FRQYHQLHQW RQHKDQG RSHUDWLRQ DQG HOLPLQDWHV WKH ULVN RI FURVVFRQWDPLQDWLRQ ,WV XQLTXH LQIUDUHGVHQVRUGHWHUPLQHVZKHQWRGLVSHQVHLFHRUZDWHUZKLFK PLQLPL]HV WKH SRVVLELOLW\ RI FURVVFRQWDPLQDWLRQ &RPSOLHV ZLWK WKH PRVW VWULQJHQW UHTXLUHPHQWV RI 16) DQG WKH VSLULW RI WKH $PHULFDQVZLWK'LVDELOLWLHV$FW7KH7RXFK)UHHOEWROE XQLWV PDNH DQG GLVSHQVH VRIW FKHZDEOH QXJJHW LFH ZKLOH WKH  OE WR  OE XQLWV PDNH DQG GLVSHQVH IODNH LFH %RWK LFH IRUPV DUH D IDYRULWH IRU SDWLHQW FDUH DV ZHOO DV EHYHUDJHV 6WDLQOHVVVWHHOILQLVK0RGHO0'71VKRZQ 0RGHO'HVFULSWLRQ 0'7&$$ OE$LU&RROHG&XEHOHW 0'7)$+ OE$LU&RROHG)ODNHU 0'7)$+ OE$LU&RROHG)ODNHU 0'71$OE$LU&RROHG1XJJHW 0'71:OE:DWHU&RROHG1XJJHW 0'71$OE$LU&RROHG1XJJHW 0'71:OE:DWHU&RROHG1XJJHW 0'71$OE$LU&RROHG1XJJHW

%

&3URGLJ\Š (FOLSVHŠ &XEH,FH0DFKLQHV )HDWXUHV 3URGLJ\Š LQQRYDWLYH VPDUW WHFKQRORJ\ DQG LQGXVWU\ OHDGLQJ HQHUJ\HIILFLHQF\1RLVHDQGKHDWDUHPRYHGWRWKHURRIIRUDTXLHWHU PRUH SOHDVDQW GLQLQJ H[SHULHQFH 6PDOO IRRWSULQW DQG QDUURZ SURILOH DOORZ FXEHU WR EH SODFHG DQ\ZKHUH LFH LV QHHGHG 6WDQGDUG TXLFNFRQQHFW RIIHUV IDVW DQG IOH[LEOH LQVWDOODWLRQV FRQQHFWLQJ WR VLQJOHRUGXDOSDWK6FRWVPDQFRQGHQVHU&DQDOVREHFRQQHFWHGWRD SURSHUO\ VL]HG XQLYHUVDO UDFN RU PXOWLSDVV FRQGHQVHU V\VWHP 6WDLQOHVVVWHHOILQLVK3URGXFHVVPDOORUPHGLXPFXEHLFH6KRZQRQ DEHYHUDJHGLVSHQVHU VROGVHSDUDWHO\ 

&

0RGHO'HVFULSWLRQ (+6/% OEV:6PDOO&XEH,FH 5HTXLUHV&RQGHQVHU&RPSUHVVRU (+6/% OEV:6PDOO&XEH,FH 5HTXLUHV&RQGHQVHU&RPSUHVVRU (+0/% OEV:0HGLXP&XEH,FH 5HTXLUHV&RQGHQVHU&RPSUHVVRU &&3$ OEV &&3$ OEV &&3$ OEV &&3$ OEV &&3$ OEV &&3$ OEV $GGLWLRQDOPRGHOVDYDLODEOH

':DWHU)LOWHUV ([WHQGWKHOLIHRI\RXU6FRWVPDQLFHPDFKLQHVDQGSURYLGHFOHDQHUPRUHFRQVLVWHQW LFH E\ XVLQJ 6FRWVPDQ¶V 660 3OXV ZDWHU ILOWUDWLRQ V\VWHPV E\ (YHUSXUH 8OWUDILQH KDOIPLFURQ ILOWUDWLRQ FRPELQHG ZLWK IRRGJUDGH SRO\SKRVSKDWH DVVXUHV WKDW FKORULQH RIIWDVWHV RGRUV DQG SDUWLFOHV RI GLUW VWD\ RXW RI \RXU LFH 6LQJOH GRXEOH DQG WULSOH ILOWHUV\VWHPVDYDLODEOHDORQJZLWKFRDUVHSUHILOWHUVDQGUHSODFHPHQWFDUWULGJHV 0RGHO'HVFULSWLRQ 6&$ &RDUVH3UHILOWHU 6&$ &RDUVH3UHILOWHU 6&5& 6&5HSODFHPHQW&DUWULGJH 6&5& 6&5HSODFHPHQW&DUWULGJH 6603 6LQJOH)LOWUDWLRQ6\VWHP 6603 7ZLQ)LOWUDWLRQ6\VWHP 6603 7ULSOH)LOWUDWLRQ6\VWHP $GGLWLRQDOPRGHOVDYDLODEOH

'

((=+2Š %RWWOH)LOOLQJ6WDWLRQV +\GUDWLRQLVHVVHQWLDOIRUJRRGKHDOWK(OND\¶VQHZ(=+2Š ERWWOHILOOLQJVWDWLRQSURYLGHVDUDSLGILOORIILOWHUHG ZDWHUWRTXHQFKWKLUVWDQGPLQLPL]HSODVWLFERWWOHZDVWHLQWKHHQYLURQPHQW2QHKDQGHGRSHUDWLRQDOORZVIRU DTXLFNILOOEHWZHHQDFWLYLWLHVWLPHVIDVWHUWKDQDWUDGLWLRQDOGULQNLQJIRXQWDLQ0LQLPL]HWKHVSUHDGRIJHUPV ZLWK KDQGVIUHH RSHUDWLRQ 1HZ :DWHU6HQWU\ Š 3OXV ILOWHU ZLWK HQFKDQFHG VHGLPHQW FDSDELOLWLHV 6LOYHU $JLRQ DQWLPLFURELDO SURWHFWV DJDLQVW PROG DQG PLOGHZ JURZWK ,QQRYDWLYH*UHHQ7LFNHUŒWUDFNVWKHERWWOHVVDYHGIURPODQGILOOV 0RGHO'HVFULSWLRQ /=:65. (=+25HWUR)LW8QLW)LOWHUHG (=:65. (=+25HWUR)LW8QLW1RQ)LOWHUHG

)


Ice Machines Make cleaning easy and improve your bottom line. Let’s start with two topics we can all agree on... 1. Because ice is considered a food product, your ice machine is subject to the same cleanliness standards and inspections as the rest of your kitchen equipment. 2. Employees have many demands on their time. The easier the process, the more likely it is to be completed as scheduled to the quality you expect. When you purchase your ice machine there are a number of items to consider: cost, ice production, water conservation, life expectancy, availability of parts and service, and . . . ease of cleaning. Multiply that cleaning job by the life of the product and you can see how your employees’ time adds up. Let’s face it, you’d like your employees to be working at top efficiency throughout their shift, but sometimes the process itself is cumbersome and gets in the way. So what makes for an easy cleaning process? Ask yourself the following questions • How many steps does it take to get to the food zone? • Are special tools required? • Are parts, like the water trough, removable so they can be easily cleaned in a sink? • Are the components light colored so you can spot mold growth? • Are corners rounded for easy cleaning? • Can you see the evaporator surfaces to confirm that lime and scale are not building up? • Is the water pump easily accessible and removable to clean any buildup of scale, lime or sediment? • Is the outside of the machine easy to clean? Will it hold up to the sometimes harsh conditions of a commercial kitchen? Setting yourself up for success with the purchase of an easy-to-clean machine is the single most important thing you can do to ensure your customers are served safe and fresh tasting ice while allowing employees to quickly move on to tasks that positively impact your bottom line. Source: Manitowoc Ice


Refrigeration Equipment | 32

A. “M” Series Strip Doors. Save energy costs and separate environments. Perfect for walk-in coolers, freezers. Drastically reduce heating and cooling costs, reduce moisture and frost build-up. These models are available in 6" and 8" wide PVC strip material in both USDA Polar and Standard grades. Easy to clean and virtually maintenance free. Each strip has a heat-sealed loop at the top which slides onto the mounting bar. USDA compliant. Model M108-PR-4080 shown.

B

A Model M108-PR-4080

Description Polar Reinforced PVC 8" Loop Strip, 40"Wx80"H (Mounting Hardware included) 6 pc. min. M106-PR-4080 Polar Reinforced PVC 6" Loop Strip, 40"Wx80"H (Mounting Hardware included) 6 pc. min. M108-PR-80-6PK Polar Reinforced PVC 8" Loop Strip 80"H Replacement Strip Pkg of 6 M106-PR-80-6PK Polar Reinforced PVC 6" Loop Strip 80"H Replacement Strip Pkg of 6 Additional models available.

B. Walk-In Freezers & Coolers. Exceptional quality at a low life-cycle cost. These versatile and dependable walk-in coolers, freezers and combination cold rooms are custom designed to satisfy exacting job site conditions. Indoor or outdoor models are available in 4" or 5" thickness to ensure that the space available is used most efficiently. Choose from a large selection of metal finishes, walk-in accessories and custom engineered refrigeration systems. Our System 100 monitoring system is standard equipment and includes a digital display, audio/visual alarm, light switch, remote alarm hookup and door heater control. 5-year compressor and 1-year parts warranty. Contact us for additional information.

C

C. DUO-PAK Multi-Circuit Condensing Unit. Performs the function of 2 condensing units! Replaces either a 95M (1 HP) or 70M (3/4 HP) condensing unit and a 199L (2 HP) or 149L (1 1/2 HP) condensing unit. Supplies refrigeration to both a walk-in cooler and a freezer. Available as PCL (pre-charged with refrigerant and up to 40' of pre-charged lines provided) or PR (pre-assembled remote system shipped with nitrogen holding charge). Liquid line sight glass. Energy efficient PSC fan motors. Two 14" fan blades. ETL listed to UL Standard 1995.

D

D. Air Shield. Reduces the amount of warm air infiltration—up to 20% more energy efficient! Keep the cool air where it belongs and eliminate the hassles of strip curtains. Mounts vertically, adjacent to the walk-in door on the interior wall surface. Channels a barrier of refrigerated air and is automatically activated when the door is opened and shuts off when the door closes. Use on 26", 30", 34" and 36"W door openings and 74" to 80"H. NSF. UL listed. 1-year parts and labor warranty. Available for cooler and freezer applications. Contact us for additional information.

E E. Refrigeration Systems. Complete selection of high performance refrigeration equipment and accessories for the most efficient and reliable installation possible. The factory engineered remote, remote quick connect, pre-assembled remote or top/side quick connect self-contained units are available for any indoor or outdoor application. All systems are fully EISA compliant and come with a 5-year compressor warranty with labor warranties available on pre-charged systems. Contact us for additional information.


Refrigeration Equipment | 33

A. Walk-In Refrigerators and Freezers. Superior quality from top to bottom. Kolpak’s modular construction can meet your exact requirements in an indoor or outdoor cooler, freezer or combination, with the size, roof configuration, and options you want. Indoors and out, you get quality with features that make Kolpak a sound investment: energy saving 4" thick foamed-in-place urethane insulation; standard galvalume metal finish provides greater corrosion resistance; energy saving Kolpak 120 series refrigeration operates at higher ambient temperatures.

A B. ArcticFox™ Total Cooling Control. Meet the next generation walk-in Total Cooling Control with Tru-Dmnd™ defrost—pays for itself in less than two years. The Tru-Dmnd™ defrost initiates defrost cycles only when the defrost is needed. Avoids up to 93% of standard system defrost cycles and up to 12% fewer cycles than a “smart defrost” control. Self-adjusting defrost cycles mean no need for seasonal adjustments. The 120° ambient refrigeration design maximizes performance range on the hottest days. Programmable light control turns on the light when the door is opened and turns off at the desired time. Door ajar alarm. User interface can be located remotely in a manager’s office. CAT 5 cable connectivity for ease of installation. Diagnostic functionality for tracking usage, temperature variations, door opening duration and more. Controls the door heater cycles for further energy savings. Contact us for additional information.

B

C

C. Polar-Pak® System. Easily installed without the services of a refrigeration technician or plumber. Corners, wall panels and doors are quickly assembled on the unit’s floor (or 11/2 screeds), and the ceiling panels lifted in place. The self-contained wall-mounted refrigeration unit, equipped with casters for leveling, is simply rolled up and fitted into place. The top mount offers an easy install and is flush to the interior ceiling allowing maximum use of storage space. 4" urethane panels meet 2009 Federal standards for insulation requirements and energy efficiency. Choose from a variety of sizes and configurations, coolers or freezers. Some top mount units are available to ship in 48 hours. Contact us for additional information.

D

D. Quick Ship Coolers & Freezers. We’ve designed our indoor and outdoor units for maximum cold holding performance with minimum environmental impact, all while saving you money on energy costs, operating costs and overall cost of ownership. 48-hour shipping now available on 7'6" Single Compartment Coolers or Freezers with Remote Refrigeration Systems. Indoor Walk-Ins feature: • Standard door, right or left hinged (no options) • NSF approved .100 smooth aluminum floor (coolers available floorless) • 26 gauge stucco-embossed galvalume steel in and out Contact us for additional information.

E

E. R-Series Walk-Ins. R You Ready to Walk-in to the Future? The revolutionary R-Series from Kolpak features all of the industry-leading advances that, together, you’ll find nowhere else. You’ll enjoy convenient features such as 120 refrigeration systems, more efficient lighting options, highly durable flooring materials and a smooth, ergonomic look. Meets stringent California Energy Commission guidelines for standard and combo box configurations. Patent pending transition panel for combo boxes allows 4" cooler panels to transition to 5" freezer panels to meet the R-value insulation properties required. Contact us for additional information.


Refrigeration Equipment | 34 A. Kold Locker™ Walk-ins. SAME DAY SHIPMENT! Choose from over 10,000 Indoor or Outdoor Coolers, Freezers and Combination Cooler/Freezers! Sizes from 4'x5' to 8'x20'. Heights from 6'7" and 7'7" with floor; 7'4" floorless. Three temperatures: +35°F, -10°F, -20°F. 26 gauge stucco embossed coated steel. 26" wide self-closing doors. FRP threshold. 15-year panel warranty; 18-month parts and labor warranty. Model Description KLB7746-Cx 7'7"H 4'x6' Cooler KLB7766-Cx 7'7"H 6'x6' Cooler KLB7768-Cx 7'7"H 6'x8' Cooler KLB7788-Cx 7'7"H 8'x8' Cooler KLF7746-Cx 7'7"H 4'x6' Freezer KLF7766-Cx 7'7"H 6'x6' Freezer KLF7768-Cx 7'7"H 6'x8' Freezer KLF7788-Cx 7'7"H 8'x8' Freezer

A

B. Walk-In Cooler. Save money and space with a one-piece outdoor walk-in from ICS. And avoid the installation costs associated with site built outdoor walk-ins. Whether it’s new construction, remodel or refurbishment, we can produce a solution for your application. B • Coolers, freezers and combinations up to 14"x50". • 4", 5" or 6" wall thickness and with or without floors to withstand any environment. • Fully weatherproof, engineered roof load, seismic, and wind ratings for all locales. • Many finish options, including architectural finishes.

Recommended Storage For Refrigerated Foods Maximum Storage Food Temp °F Dairy Products Milk (fluid) 40 Butter 40 Cheese (hard) 40 Cheese (soft) 40 Ice Cream & Ices 10 Eggs 45 Fish Fresh 36 Shell Fish 36 Fruits Peaches, Plums, Berries 50 Apples, Pears, Citrus 50-70 Poultry 36 Meat Ground 38 Fresh Meat Cuts 38 Liver & Variety Meats 38 Cold Cuts (sliced) 38 Cured Bacon 38 Ham (tender cured) 38 Ham (canned) 38 Dried Beef 38 Vegetables Leafy 45 Potatoes, Onions, Root Vegetables 50-70

Maximum Storage Period 3 days 2 weeks in waxed cartons 6 months tightly cov. 7 days in tightly cov. cont. 3 months in orig. cov. cont. 7 days 2 days loosely wrapped 5 days in cov. cont. 7 days unwashed 2 weeks, orig. cont. 7 days 2 days 6 days 2 days 6 days 1-4 weeks 1-6 weeks 6 weeks, orig. cont. 6 weeks 7 days 7-30 days, dry in vent. cont.

Recommended Storage For Frozen Foods Frozen Food Eggs Fruit French-Fried Potatoes Meats Beef Lamb & Veal Pork Sausage & Ground Meat Cooked Meat, not covered with gravy or other sauces Meat Sandwiches Poultry Chicken Turkey Giblets Cooked Poultry Meat Cooked Poultry Dishes

Maximum Storage Period at 0°F 6-12 months 8-12 months 2-6 months 6-12 months 6-9 months 3-6 months 1-3 months 1 month 1 month 6-12 months 3-6 months 3 months 1 month 3-6 months

Refrigeration Solutions

C C. MRS Series Modular Multi-Compressor Refrigeration System. This outside system reduces noise level and extends the life of equipment. Remove the heat produced by multiple refrigeration systems and reduce air conditioning load by installing a single MRS System. Each module includes a compressor with refrigeration components pre-piped to its own modular condenser—MRS can house up to 16 modules. Units are pre-wired to an electrical panel for one-point connection. The compactly stacked condenser modules are designed for 110ºF temperatures but are also protected in cold weather by integrated low ambient components, including head masters and crankcase heaters. Contact our customer service department for assistance.

D D. DRS Series Dual Compressor Refrigeration Systems. DRS systems allow the remoting of multiple refrigeration units used in walk-ins, reach-ins and other refrigerated equipment to one system. Benefits include reductions in inside heat, air conditioning load and noise levels. Features include pre-wired electrical panel with one-point connection and disconnect switch, common base and frame assembly and standard galvanized finish with optional stainless steel finish. Contact us about our full range of systems including multi-compressor and rack systems.


Refrigeration Equipment | 35 B. Walk-in Liner Panel. Has your walk-in seen better days, but not reached the end of its life? Maybe it’s time for an ICS Makeover. Refurbishing walk-ins is easy when you work with the professionals at ICS. They provide all the materials to repair or replace floors, walls, and doors. They can also provide installation services as well. And what’s more, they can refurbish any manufacturer’s equipment. So when it’s time to update the walk-in, think ICS. Contact our customer service department for assistance.

A

B

A. Walk-Ins. ThermalRite Walk-ins are engineered and built to your exact dimensions and specification. Custom designs; indoor, outdoor, angles, rectangles are all available in a variety of finishes and in thicknesses of 4, 5 or 6 inches. With panels up to 30 feet in length, these walk-ins are ideal for any application. High density foam rail and foamed-in-place bonding equals strong panels. Nationwide installation available. Four plants to serve you—California, Minnesota, Mississippi and Tennessee. Cooler/Freezer Combo shown. Contact our customer service department for assistance.

C C. Portable Cold Room. Need temporary refrigerated space outdoors? Consider a portable room from ICS. These are skid mounted for easy transport, unloading, and relocation. Designed to operate both at (35°F) and (0°F), one room can serve both of your needs with just the flip of a switch. Just plug it in (25 foot cord furnished), and it’s ready to operate. Doors are heavy duty with locking bars, and secondary locking system included. Contact our customer service department for assistance.

D

D. Replacement Doors. ThermalRite Replacement Doors are designed to fit any manufacturers’ cooler or freezer. Cooler and freezer doors really take a pounding from hand trucks, fork lifts, pallet jacks, ice build-up and everyday use—resulting in dangerous, unsanitary and inefficient coolers and freezers. A replacement door from ThermalRite will help prevent accidents, provide energy savings and is simple to order. Contact our customer service department for assistance.

E E. Refrigerated Trailers. Mobile refrigerated rooms are just the answer when there is a need for temporary storage. These trailers come in two sizes and are capable of being operated as either a cooler (35°F) or freezer (0°F). They operate on 230V current, and come complete with generator for remote use. Lighting, load levelers, and spare tire are all included in this complete ready to operate trailer package. From the nation’s leader in portable innovative solutions. Contact our customer service department for assistance.

F

F. Sliding Doors. The ultimate solution for temperature controlled environments. Suitable for new build or retrofit installations. Foamed-in-place with non-CFC polyurethane for rigidity and excellent insulation characteristics. Single Sliding Manual and Power Doors from 3'x8' to 10'x12'. Bi-Part Manual and Power Doors from 5'x8' to 10'x12'. Other sizes and a comprehensive range of options available upon request. Contact our customer service department for assistance.


%HYHUDJH%DU (TXLSPHQW &RIIHH%UHZHUV %OHQGHUV %DU&RROHUV *ODVV:DVKHUV 3RUWDEOH%DUV

$

0RGHO'HVFULSWLRQ &3 &XS3HUFRODWRU &3 &XS3HUFRODWRU &3 &XS3HUFRODWRU &%6 &RIIHH%UHZHU

&RIIHH0HDVXULQJ*XLGH 5HJXODU$SSUR[ )LQLVKHG *ULQG&RIIHH %UHZLQJ %UHZ R]  R]'U\0HDV7LPH 6HUYLQJV LQFXSV LQPLQ                                        OEUHJXODUJULQGFRIIHHHTXDOVFXSV  8VHPRUHRUOHVVGHSHQGLQJXSRQGHVLUHGVWUHQJWK

3UHSDULQJ&RIIHH<RXU&XVWRPHUV:LOO/RYH $VWHPSHUDWXUHVGLSFRIIHHVDOHVULVH$IWHUDOOWKHUHLVQRWKLQJOLNH D KRW FXS RI MRH WR FKDVH DZD\ WKH FKLOO $V FRIIHH UHDFKHV UHFRUG SRSXODULW\ $PHULFDQ FRIIHH WDVWHV DUH FKDQJLQJ &RQVXPHUV DUH EHFRPLQJEHWWHULQIRUPHGDQGPRUHGLVFULPLQDWLQJZKLFKLVZK\LW LVEHFRPLQJVRLPSRUWDQWWRVHUYHDJRRGFXSRIFRIIHH7KHUHDUH PDQ\WKLQJVWRFRQVLGHUEXWRQHRIWKHPRVWLPSRUWDQWLVIUHVKQHVV 7KHUHDUHSUHFDXWLRQVWRWDNHWRKHOSDFKLHYHWKLV

$&RIIHH3HUFRODWRUV %UHZHU 6WDLQOHVV VWHHO SHUFRODWRUV DUH HTXLSSHG ZLWK D FOHDU ZDWHU OHYHO JDXJH ,QGLFDWRU VLJQDOV ZKHQ FRIIHH LV GRQH EUHZLQJ $XWRPDWLF WHPSHUDWXUH FRQWURO NHHSV FRIIHH ZDUP DQG UHDG\ WR VHUYH 9 : 7KUHH SRSXODU VL]HV WR FKRRVH IURP 7KH VWDLQOHVV VWHHO 3RXU2YHU %UHZHU KDV  VZLWFKHV IRU ZDUPLQJ DQG EUHZLQJ %UHZLQJ LQGLFDWRU DOHUWV ZKHQ F\FOH LV FRPSOHWH +HDWLQJ SODWHV HQVXUH RSWLPDO WHPSHUDWXUH IRU H[WHQGHG SHULRGV &RPSOHWHO\ SRUWDEOH UHTXLUHV QR SOXPELQJ $FFHSWV VWDQGDUG ILOWHUV DQG GHFDQWHUV VROG VHSDUDWHO\ 9 : $OO PRGHOV DUH (7/ OLVWHG DQG (7/ VDQLWDWLRQ

%

%5HJDOZDUHŠ )RRGVHUYLFH$OXPLQXP&RIIHH0DNHUV 2QO\DYDLODEOHWRWKHIRRGVHUYLFHLQGXVWU\3ROLVKHGDOXPLQXPFRIIHHPDNHUV EULQJ D WRXFK RI FODVV WR HYHU\ RSHUDWLRQ $OVR DYDLODEOH LQ VDWLQILQLVK EODFN ZLWKQRQVWLFNH[WHULRU%UHZVWRWKHSHUIHFWIODYRUDQGDXWRPDWLFDOO\KROGVLWDW WKH LGHDO VHUYLQJ WHPSHUDWXUH 1RQGULS IDXFHWV VWD\ FRRO EODFN SKHQROLF KDQGOHV DQG FRYHU NQRE /RFNRQ FRYHUV %UHZYLHZ JDXJHRQ DQG FXS XQLWV (DV\ WR FOHDQ LQVLGH DQG RXW %UXVKHG FRYHUV DQG EDVHV ZRQ¶W VKRZILQJHUSULQWV&RPPHUFLDOO\UDWHGZLWK\HDUOLPLWHGZDUUDQW\8/&6$ DQG16)DSSURYHG0RGHOV555DQG5VKRZQ 0RGHO'HVFULSWLRQ 5 &XS3URQJ$OXPLQXP 5 &XS3URQJ$OXPLQXP 5 &XS$OXPLQXP 5 &XS$OXPLQXP 5 &XS6DWLQ%ODFN 5 &XS6DWLQ%ODFN

 8VH FOHDQ HTXLSPHQW IUHH RI RLOV DQG UHVLGXH IURP ZDVKLQJ RU SUHYLRXVXVH  8VHIUHVKZDWHUSUHIHUDEO\ILOWHUHGQRWMXVWWDSZDWHU  %UHZ DW WKH FRUUHFW WHPSHUDWXUH ,GHDO ZDWHU WHPSHUDWXUH IRU EUHZLQJLVƒ)ƒ)%ULQJ\RXUZDWHUWRDERLOZDLWDWOHDVW PLQXWHVDQGEUHZ  8VH KLJK TXDOLW\ IUHVKO\ JURXQG FRIIHH $QRWKHU LPSRUWDQW WKLQJ WRFRQVLGHULVWKHWHPSHUDWXUHUHWHQWLRQIRUKRWEHYHUDJHV)RU SODVWLF LQVXODWHG VHUYHUV WHPSHUDWXUH ZLOO GURS DSSUR[LPDWHO\ ƒLQWKHILUVWKRXUƒLQWKHVHFRQGKRXUDQGƒLQWKHWKLUG KRXU)RUJODVVLQVXODWHGVHUYHUVWHPSHUDWXUHZLOOGURSDSSUR[L PDWHO\ƒHYHU\KRXU5HVXOWVDUHEDVHGRQSUHKHDWLQJVHUYHUV ZLWKERLOLQJZDWHUSULRUWRXVH $VNXVDERXWPRUHSURGXFWVXJJHVWLRQVIRU\RXUFRIIHHVHUYLFH

& &&RIIHH8UQV 7KHVH VWDLQOHVV VWHHO XUQV DUH IDVWEUHZLQJ²  RU  FXSV LQ DERXW  PLQXWHV DQG  FXSV LQ DERXW  PLQXWHV $OO PHWDO XUQV DOVR IHDWXUH PXJ FOHDUDQFH DQG GXDO WKHUPRVWDWV IRU GXUDELOLW\ DQG RSWLPXP FRIIHH VHUYLQJ WHPSHUDWXUH )HDWXUHV QRQGULS IDXFHWV DQG VLJKW JODVV WR OHW \RX NQRZ KRZ PXFK FRIIHH LV OHIW LQ SRW   VWDLQOHVV VWHHO &RPPHUFLDOO\ UDWHG ZLWK \HDU OLPLWHG ZDUUDQW\ 8/ &6$ 16)  0RGHOV . . DQG .VKRZQ 0RGHO'HVFULSWLRQ .$ &XS .$ &XS .$ &XS


%HYHUDJH%DU(TXLSPHQW_

%7HPSHVWŒ%OHQGHUV 7KH :DYH$FWLRQŒ V\VWHP SXOOV FRQWHQWV GRZQ LQWR WKH EODGHV IRU VPRRWK FUHDP\ UHVXOWV HYHU\ WLPH )RU XOWLPDWH IOH[LELOLW\ RSHUDWRUV FDQ FKRRVH IURP KLJK DQG ORZ VSHHGV WLPHG F\FOHV DQG D MXPS F\FOH VWDUWV LQ ORZ VSHHG WKHQ UDPSVXSWRKLJK ,QFOXGHVR]VWDFNDEOHFRQWDLQHUWLPHU ZLWKDXWRPDWLFVKXWRIIDQGDMDUSDGVHQVRUZKLFKWXUQVWKH PRWRU RII ZKHQ FRQWDLQHU LV QRW LQ SODFH  +3 PRWRU \HDU RU  F\FOH SDUWV DQG ODERU IXOO UHSODFHPHQW ZDUUDQW\0RGHO+%+

$ %

$9DOXH%DU%OHQGHUV $Q\  R] LF\ GULQN VHUYHG SHUIHFWO\ VPRRWK DQG ZLWK QR LFH FKXQNV²LQ DV OLWWOH DV  VHFRQGV 6WDLQOHVV VWHHO EODGHV TXLFNO\ FXW WKURXJK LFH DQG RWKHU LQJUHGLHQWV +LJKORZRII WRJJOH VZLWFK LV HDV\ WR UHDFK DQG FRQWURO \HDU ZDUUDQW\ 8/ 16) &6$ 36 IHDWXUHV D  +3 PRWRU DQG D  R] SODVWLF FRQWDLQHU +%% IHDWXUHV D  +3 PRWRU DQG D  R] SRO\FDUERQDWH FRQWDLQHU ZLWK ILOOHUFDS DQG PHDVXUHPHQW PDUNV IRU HDV\ ILOOLQJ +%% IHDWXUHV D  +3 PRWRU DQG D  R] VWDLQOHVVVWHHOFRQWDLQHU 0RGHO'HVFULSWLRQ 36 R]3ODVWLF&RQWDLQHU 3URFWRU6LOR[

+%% R]3RO\&RQWDLQHU +%% R]66&RQWDLQHU

')XU\Œ%OHQGHU 8QOHDVK WKH )85< 3RZHUIXO  +3 PRWRU RIIHUV VXSHULRU EOHQGLQJ SHUIRUPDQFH DW D FRPSHWLWLYH SULFH ,QFOXGHV D \HDU RU  F\FOH IXOO UHSODFHPHQW ZDUUDQW\ ZLWK ([SUHVV&DUH :DYHa$FWLRQ Š 6\VWHP SURYLGHV VXSHUVPRRWK GULQN SURILOH HYHU\ WLPH 7LPHU DQG  VSHHGV ZLWK SXOVH RSWLRQ LV LQGLVSHQVDEOH IRU EXV\ EDUV 7ZR VSHHGV RIIHU SUHFLVLRQ EOHQGLQJ IRU D ZLGH YDULHW\ RI PL[WXUHV 6WDLQOHVV VWHHO EODGHV DUH PDGH WR ODVW DQG JHW WKH MRE GRQH IDVW 7KH VWDFNDEOH  R] EUHDNUHVLVWDQW SRO\ FDUERQDWH FRQWDLQHU ZLWK HDV\WRUHDG PHDVXUHPHQW PDUNV VWDFNV XS IRU VWRUDJH 3DGGOH VZLWFKHV PDNH WKLV HDV\ WR XVH 0RGHO+%+

&6SLQGOH'ULQN0L[HU *UHDW IRU HYHU\WKLQJ IURP PL[LQJ LFH FUHDP VKDNHV WR ³IODVKLQJ´ EDU GULQNV DQG EOHQGLQJ HJJV SDQFDNH DQG ZDIIOH EDWWHU 3HUIRUPDQFH²3RZHUIXO+3PRWRUSHUPL[LQJ KHDG PL[HV WZLFH DV IDVW 3UHFLVLRQ 0RWRU² 0RWRU LQGLYLGXDOO\ EDODQFHG WR PLQLPL]H YLEUDWLRQ %XLOW WR ODVW ZLWK VHDOHG SHUPDQHQWO\ OXEULFDWHG EDOO EHDULQJV 7ZR:D\ 0RWRU $FWLYDWLRQ²2SHUDWRUV FDQ VWDUW DQG VWRS PL[LQJ DFWLRQ E\ LQVHUWLQJ FXS LQWR FXS JXLGH RU E\ XVLQJWKHSXOVHVZLWFKRQWRSRIPL[HU16)8/

' (

)7RXUQDQWŒ)RRG%OHQGHU 7KH 7RXUQDQW GRHV LW DOO²&KRS 0L[ 3XUHH*ULQG(PXOVLI\%OHQG)RUEXV\ FKHIV WRS SHUIRUPDQFH LV HVVHQWLDO 7KH 7RXUQDQWŒ LV HQJLQHHUHG WR JLYH FKHIV WKH EOHQGLQJ FRQILGHQFH DQG FRQWUROWKH\QHHG0DNHKXPPXVVDOVD PD\RQQDLVH GUHVVLQJV IORXUV FRPSRWHV ,W WUXO\ LV WKH 72851$17 (QJOLVK WUDQVODWLRQ³&KHI ZKR GRHV DOO WKLQJV´ LQWKHEXV\IRRGVHUYLFHNLWFKHQ $QG ZLWK LWV SDWHQWHG ³FKRS´ IHDWXUH ZRUNLQJZLWKKHDY\LQJUHGLHQWVDQGWKLFN HPXOVLRQV DUH DOO ³LQ D GD\¶V ZRUN´ ) 0RGHO+%)VKRZQ 0RGHO'HVFULSWLRQ +%) +3R]3RO\FDUE&RQWDLQHU +%)6 +3R]66&RQWDLQHU +%) +3R]3RO\FDUE&RQWDLQHU +%)6 +3R]66&RQWDLQHU

& 0RGHO'HVFULSWLRQ +0' 6LQJOH6SLQGOH +0' 7ULSOH6SLQGOH

(7DQJR%OHQGHUV %OHQGVDR]GDLTXLULLQVHFRQGV3RZHUIXO+3PRWRU RIIHUV H[FHSWLRQDO WRUTXH DQG EOHQGLQJ SHUIRUPDQFH IRU D YDULHW\RILFHGGULQNVVSHHGPRWRUZLWKSXOVH6WDFNDEOH R] SRO\FDUERQDWH FRQWDLQHU ZLWK :DYHa$FWLRQ Š 6\VWHP FRQWLQXDOO\ IRUFHV PL[WXUH GRZQ LQWR WKH EODGHV $OO PHWDO PRWRU GULYH FRXSOLQJ LV EXLOW WR ODVW $GMXVWDEOH WLPHU DXWRPDWLFDOO\ WXUQV EOHQGHU RII \HDU SDUWV DQG ODERU ZDUUDQW\ FRYHUHG XQGHU RXU ([SUHVV &DUH 6HUYLFH 3URJUDP IUHHZDUUDQW\UHSODFHPHQW &8/8/16)0RGHO+%+

*&RIIHH%UHZHUV ,I \RX¶UH ORRNLQJ IRU ULFK IODYRUIXO FRIIHH EXW DUH WLJKW RQ FRXQWHU VSDFH SOXJ LQ D %ORRPILHOG /R3URILOHŠ EUHZLQJ V\VWHP$WDOLWWOHXQGHUWDOOWKH\¶UHVKRUWLQVWDWXUHEXW ORQJ RQ IHDWXUHV $ UHDG\WREUHZ OLJKW LQGLFDWHV WKH SURSHU ZDWHU WHPSHUDWXUH WR KHOS HOLPLQDWH EUHZLQJ JXHVVZRUNDQGRXUSDWHQWHGZDWHUGHOLYHU\V\VWHPJHQWO\ VSUHDGV D SUHFLVH DPRXQW RI ZDWHU RYHU WKH FRIIHH JURXQGV IRU FRPSOHWH VDWXUDWLRQ DQG RSWLPXP IODYRU 8/16) 0RGHO'HVFULSWLRQ ' .RIIHH.LQJ:DUPHU3RXU2YHU ' .RIIHH.LQJ:DUPHU3RXU2YHU,QOLQH ' .RIIHH.LQJ:DUPHU3RXU2YHU6WHSSHG5LJKW ' ,QWHJULW\:DUPHU3RXU2YHU)DXFHW

*


%HYHUDJH%DU(TXLSPHQW_

(GCVWTGF%JGH

&KHI:LOO0HWFDOI &DQ\RQ5DQFK 7XFVRQ$=

$&RPPHUFLDO%OHQGHUV 7KRXJKWIXOO\ GHVLJQHG WR JLYH PRUH IRU OHVV 7KH %/( 6SHHG %DU %OHQGHU FRPELQHVDWRXJK+3PRWRUZLWKDYLUWXDOO\ XQEUHDNDEOH VWDFNDEOH  R] %3$IUHH 7ULWDQ FRQWDLQHU DQG VWDLQOHVV EDOO EHDULQJ EODGH V\VWHP 7KH UHVXOW LV D EOHQGHU WKDW GHOLYHUV WKH PRVW LFH FUXVKLQJ SRZHU LQ LWV FODVV 3HUIHFW IRU D EXV\ EDU )RU HYHU\WKLQJ IURP VRXSV WR VPRRWKLHV \RX QHHG WKH  JDOFDSDFLW\7KH+3%/(IHDWXUHVD ODUJH  R] %3$IUHH 7ULWDQ FRQWDLQHU -XVW VHW WKH GHVLUHG VSHHG DQG WLPH IRU D SHUIHFW EOHQG HYHU\ WLPH ,QFOXGHV ³DXWR RII´ DQG WRXFK SDG FRQWUROV IRU ³LQILQLW\´ DQG ³SXOVH´ 7KH XOWLPDWH LQ SRZHU SHUIRUPDQFH DQG FRQYHQLHQFH 0RGHO'HVFULSWLRQ %/(66 R]66&RQWDLQHU %/( R]7ULWDQ&RQWDLQHU %/( R]7ULWDQ&RQWDLQHU

$

$OPRQG/HPRQ7DUW 3kWH%ULVpH

%;WUHPH+L3RZHU%OHQGHUV 0RUHSRZHUDQGOHVVQRLVHLVJRRGIRUDQ\ EXVLQHVV DQG :DULQJ Š ;WUHPH %OHQGHUV GHOLYHU ERWK +HDY\GXW\  +3 PRWRU DQG  530 SURYLGH DZHVRPH VSHHG DQG SHUIRUPDQFH 2SWLRQDO VROLG VRXQG HQFORVXUH NHHSV LW TXLHW &KRRVH VLPSOH SDGGOH VZLWFKHV IRU WKH TXLFN DQG HDV\ RSHUDWLRQ RU HDV\WRFOHDQ HOHFWURQLF PHPEUDQH NH\SDG 3RZHU XS TXLHW GRZQ DQG NHHS LW HDV\ ZLWK :DULQJ Š ;WUHPH %OHQGHUV &KRRVH D  R] XQEUHDNDEOH %)$IUHH FRSRO\HVWHU RU VWDLQOHVV VWHHO FRQWDLQHU F(7/XV 16) /LPLWHG \HDU PRWRU DQG \HDU SDUWV DQG ODERU ZDUUDQW\ 0RGHO0;;7;VKRZQ

FXSDOOSXUSRVHIORXU 

WHDVSRRQVHDVDOW



WHDVSRRQHYDSRUDWHGFDQHMXLFH

WDEOHVSRRQVFROGXQVDOWHGEXWWHUGLFHG WRWDEOHVSRRQVLFHZDWHU 

FXSILQHO\FKRSSHGDOPRQGV

WDEOHVSRRQVDOPRQGSDVWH 

FXSHYDSRUDWHGFDQHMXLFH

WHDVSRRQVIUHVKOHPRQMXLFH  WDEOHVSRRQVJUDWHGOHPRQULQG DERXWOHPRQV

%

ZKROHHJJV 

FXSEXWWHUPLON



WHDVSRRQSXUHDOPRQGH[WUDFW



WHDVSRRQSXUHOHPRQH[WUDFW

1RWH $OPRQG SDVWH FDQ XVXDOO\ EH SXUFKDVHG LQ VSHFLDOW\ IRRG VWRUHV VXFK DV :LOG 2DWV 7UDGHU -RH¶V RU &RVW3OXV:RUOG0DUNHW 3UHKHDWRYHQWRƒ)3ODFHIORXULQDPHGLXPERZO$GGVDOW DQG HYDSRUDWHG FDQH MXLFH DQG PL[ ZHOO $GG EXWWHU DQG FXW LQWRIORXUXVLQJDSDVWU\FXWWHUXQWLOEXWWHULVWKHVL]HRIVPDOO SHDV $GG ZDWHU  WDEOHVSRRQ DW D WLPH PL[LQJ JHQWO\ DIWHU HDFK DGGLWLRQ 'RXJK ZLOO EHJLQ WR IRUP D EDOO ZKHQ HQRXJK ZDWHUKDVEHHQDGGHG*DWKHUGRXJKZLWKGU\KDQGVDQGIRUP LQWRDQHYHQEDOO/HWUHVWIRUPLQXWHV5ROOSkWHEULVpHWRD LQFKFLUFOH3ODFHLQDLQFKWDUWSDQDQGOLJKWO\SUHVVLQWR SDQ%DNHXVLQJSLHZHLJKWVRUWRFXSVGULHGEHDQVIRU PLQXWHVWRSUHYHQWFUXVWIURPEXEEOLQJ 3ODFHDOPRQGVDOPRQGSDVWHDQGHYDSRUDWHGFDQHMXLFHLQD IRRG SURFHVVRU DQG SXOVH XQWLO LW KDV WKH FRQVLVWHQF\ RI ILQH FUXPEV 6WRS WKH IRRG SURFHVVRU WR DGG OHPRQ MXLFH ]HVW HJJV EXWWHUPLON DQG H[WUDFWV 3URFHVV XQWLO EOHQGHG ZHOO 3RXU PL[WXUH LQWR SUHSDUHG WDUW SDQ DQG EDNH IRU  PLQXWHV 6OLFH WDUW LQWR  VOLFHV DQG VHUYH ZLWK  WHDVSRRQ RI FKHUU\ FRPSRWH 0DNHV  VHUYLQJV HDFK FRQWDLQLQJ DSSUR[LPDWHO\  FDORULHV  JP FDUERK\GUDWH  JP IDW  PJ FKROHVWHURO JPSURWHLQPJVRGLXPJPILEHU

0RGHO'HVFULSWLRQ 0;;7; R]&R3RO\HVWHU&RQWDLQHU7RJJOH6ZLWFKHV 0;;7; R]&R3RO\HVWHU&RQWDLQHU(OHFWURQLF.H\SDG 0;;7; R]&R3RO\HVWHU&RQWDLQHU(OHFWURQLF.H\SDGZ 6HFRQG&RXQWGRZQ7LPHU 0;;7; R]&R3RO\HVWHU&RQWDLQHU(OHFWURQLF.H\SDGZ 5H3URJUDPPDEOH6HOHFWLRQV$GM6SHHG&RQWUROV 0;;76 R]6WDLQOHVV6WHHO&RQWDLQHU7RJJOH6ZLWFKHV 0;;76 R]6WDLQOHVV6WHHO&RQWDLQHU(OHFWURQLF.H\SDG $GGLWLRQDOPRGHOVDYDLODEOH

&KHUU\&RPSRWH 

FXSXQVZHHWHQHGIUR]HQFKHUULHVSLWWHG

WDEOHVSRRQVZDWHU WDEOHVSRRQIUHVKOLPHMXLFH WDEOHVSRRQVHYDSRUDWHGFDQHMXLFH WHDVSRRQFRUQVWDUFK WHDVSRRQ*UDQG0DUQLHU ,Q D PHGLXP VDXFHSDQ FRPELQH FKHUULHV ZDWHU OLPH MXLFH DQG VXJDU &RRNRQPHGLXPKHDWDQGEULQJWRDERLO5HGXFHKHDWWRPHGLXPORZDQG VLPPHU IRU  PLQXWHV VWLUULQJ RFFDVLRQDOO\  ,Q D VPDOO ERZO FRPELQH FRUQVWDUFKDQG*UDQG0DUQLHUDQGDGGWRFKHUU\PL[WXUH5HWXUQWRDERLO DQGFRRNIRUPLQXWHZKLOHVWLUULQJ5HGXFHKHDWWRORZDQGVLPPHUXQWLO WKLFNHQHG DERXWPLQXWHV 


%HYHUDJH%DU(TXLSPHQW_

A

A. Electric Glass Washers & Accessories. ,QVWDOOLQYLUWXDOO\DQ\EDUVLQNLQVHFRQGVZLWKQRVSHFLDO SOXPELQJ RU HOHFWULFDO KRRNXSV %DU 0DLG *ODVV :DVKHUVJHWJODVVZDUHFOHDQHUIDVWHUXVLQJOHVVZDWHU DQG FKHPLFDOV WKDQ PRVW RWKHU JODVV ZDVKLQJ V\VWHPV )LYH VSLQQLQJ EUXVKHV VFUXE LQVLGH DQG RXW UHPRYLQJ WRXJKVWXIIOLNHOLSVWLFNDQGIUXLWSXOS&RPELQHZLWK%DU 0DLG /R6XGV GHWHUJHQW VDQLWL]HU DQG WHVW VWULSV DQG \RXKDYHWKHXOWLPDWHJODVVZDVKLQJV\VWHP Model Description $ 8SULJKW 66 6XEPHUVLEOH %56 6WDQGDUG%UXVK %566/ 8QLYHUVDO%UXVK %56 7DOO*ODVV&HQWHU%UXVK %566/ 8QLYHUVDO%UXVK '(7 /R6XGV'HWHUJHQW ',6 6DQLWL]HU7DEOHWV ',6 4XDWHUQDU\7HVW6WULSV ',6 &KORULQDWHG7HVW6WULSV Additional models available.

C. Glass Frosters. 3XVKEXWWRQ GHIURVW V\VWHP VHOIFRQWDLQHG QR SOXPELQJ UHTXLUHG%ODFNVWDLQOHVVRUDOOVWDLQOHVVH[WHULRU6WDLQOHVVVWHHO LQWHULRU$YDLODEOHLQDQGIRRWPRGHOV'[+ Model Description )536  /%ODFN )566  /6WDLQOHVV6WHHO )536  /%ODFN )566  /6WDLQOHVV6WHHO )536  /%ODFN )566  /6WDLQOHVV6WHHO C )536  /%ODFN )566  /6WDLQOHVV6WHHO

E E. Dual-Zone Wine Centers. 3HUOLFN¶V QHZ OLQH RI GXDO]RQH ZLQH FHQWHUV FDQ EH WDLORUHG WR ILW \RXU H[DFW ZLQH VHUYLQJ DQG VWRUDJH QHHGV 1RZ \RX FDQ SURSHUO\ VWRUH DQG GLVSHQVH ZLQH DW  VHSDUDWH WHPSHUDWXUHV LQ WKH VDPH FDELQHW²:KLWH :LQH ƒ)ƒ)  RU 5HG :LQH ƒ)ƒ)  &XVWRPL]H \RXU GXDO]RQH ZLQH FHQWHU ZLWK RSWLRQV WR VXLW \RXU VSHFLILF QHHGV 2SWLRQV LQFOXGH ZLQH GUDZHUV VROLG GRRUV ZLWK IXOOH[WHQVLRQ ZLQH VKHOYHV VWDLQOHVV JODVV GRRUV ZLWK IXOO H[WHQVLRQ ZLQH VKHOYHV DQG     RU IDXFHW ZLQH WDSSLQJ0RGHO'=6:LQH&HQWHUVKRZQZLWKVWDLQOHVVVWHHOJODVVGRRUIXOOH[WHQVLRQ VKHOYHV OHIW DQGVROLGVWDLQOHVVGRRUZVLQJOHIDXFHWZLQHGLVSHQVLQJ ULJKW 

F

B

B. The REDHEAD Electric Glass Washer. 5HPRYHV VWDLQV RQ JODVV VXUIDFH )HDWXUHV WKDW \RX FDQ UHO\ RQ LQFOXGH TXLFN DQG HDV\ LQVWDOODWLRQ KHDY\GXW\ FRQVWUXFWLRQ DQG D SRZHUIXO  +3 PRWRU &RPHV FRPSOHWH ZLWK IRXU  EUXVKHV DQG RQH  FHQWHU EUXVK 9 DPSV0RGHO*:

D

D. Concessionaire Beer Dispensers. 3RUWDEOH &RQFHVVLRQDLUH EHHU GLVSHQVHUV DUH YHU\ SRSXODULQVWDGLXPVDQGODUJHYHQXHVWKDWKRVWHYHQWV 7KLVFDELQHWLVIXOO\SRUWDEOHDQGVHOIFRQWDLQHGVWRULQJ D &2  GUXP UHJXODWRU DQG OLTXLG ZDVWH WDQN LQ DQ DFFHVV DUHD ,QFOXGHV \HDU FRPSUHVVRU DQG \HDU ODERUZDUUDQW\ ‡ +LJKLPSDFWFRUQHUEXPSHUV ‡ $OOVWDLQOHVVVWHHOH[WHULRU ‡ +HDY\GXW\FDVWHUV ‡ )URQWYHQWHGFRPSUHVVRU ‡ 6HOIFORVLQJILHOGUHYHUVLEOHGRRUV ‡ IRDPHGLQSODFHZDOOVH[WHQGFDELQHWOLIHVDYH HQHUJ\DQGDGGVWUXFWXUDOVWUHQJWK New dual dispensers featuring 2 tappers now available. Model Description ''& .HJ ''& .HJ ''& .HJ

F. AdvantEDGE™ Back Bar Refrigeration. .HHS \RXU SURGXFW FRRO DQG UHIUHVKLQJ ZLWK $GYDQW('*(Œ %DFN %DU 5HIULJHUDWLRQ 6WDQGDUG IHDWXUHV LQFOXGH ILHOG LQWHUFKDQJHDEOH VROLG RU JODVV GRRUV VWDLQOHVV VWHHO WRS JDOYDQL]HG VWHHO LQWHULRU DQG EODFN YLQ\O FRDWHG H[WHULRU IURQW VLGHV DQG EDFN (7/ 6DIHW\ DQG 6DQLWDWLRQ 16) DSSURYHG IRU ERWWOH DQG SUHSDFNDJHG JRRGV \HDU SDUWV DQG ODERU \HDUFRPSUHVVRUZDUUDQW\0RGHO1/%%*VKRZQ

Model 1/%% 1/%% 1/%% 1/%% 1/%%* 1/%%* 1/%%* 1/%%*

Description :6ROLG'RRUV :6ROLG'RRUV :6ROLG'RRUV :6ROLG'RRUV :*ODVV'RRUV :*ODVV'RRUV :*ODVV'RRUV :*ODVV'RRUV


%HYHUDJH%DU(TXLSPHQW_

%

$ $'LUHFW'UDZ%HHU'LVSHQVHUV &DELQHWV GHVLJQHG WR DFFRPPRGDWH DOO W\SHV RI EHHU NHJV (DVLO\ PDLQWDLQV ƒ) WR ƒ) $OO VWDLQOHVV VWHHO FRXQWHUWRS ,QWHULRU VWDLQOHVV VWHHO IORRU ZLWK  OLS DQG KHDY\ JDOYDQL]HG VWHHO ZDOOV (QYLURQPHQWDOO\IULHQGO\ IRUFHG DLU UHIULJHUDWLRQ V\VWHP )RDPHGLQSODFH KLJK GHQVLW\ SRO\XUHWKDQH LQVXODWLRQ  GLDPHWHU LQVXODWHG EHHU FROXPQV ZLWK VWDLQOHVV VWHHO WXEHV ,QFDQGHVFHQW LQWHULRU OLJKWLQJ IRU DOO XQLWV H[FHSW 7''  'RRU ORFNV 2SWLRQDO PXOWLSOH IDXFHW GUDIW DUPV DYDLODEOH $OVR DYDLODEOHLQVWDLQOHVVVWHHO0RGHO7''VKRZQ 0RGHO'HVFULSWLRQ 7'' [[/'RRU 7'' [[/'RRU 7'' [[/'RRU 7'' [[/'RRU

%%DFN%DU&RROHUV $WWUDFWLYHZHDUUHVLVWDQWODPLQDWHGKHDY\GXW\EODFNYLQ\OH[WHULRU6WDLQOHVVVWHHO FRXQWHUWRS )RUFHGDLU UHIULJHUDWLRQ V\VWHP ,QWHULRU VWDLQOHVV VWHHO IORRU ZLWK KDOI LQFK OLS DQG KHDY\ JDOYDQL]HG VWHHO ZDOOV 0DLQWDLQV FROG ƒ) WR ƒ) SURGXFW WHPSHUDWXUHV$OVRDYDLODEOHLQVWDLQOHVVVWHHODQGJODVVGRRUV 0RGHO'HVFULSWLRQ 7%% [[/'RRU6KHOYHV&DS  SDFNV 7%% [[/'RRU6KHOYHV&DS  SDFNV 7%% [[/'RRU6KHOYHV&DS  SDFNV 7%% [[/'RRU6KHOYHV&DS  SDFNV 7%%*$/ [[/'RRU6KHOYHV&DS  SDFNV 7%% [[/'RRU6KHOYHV&DS  SDFNV 7%%*$/ [[/'RRU6KHOYHV&DS  SDFNV

' & &*ODVV:DVKHUV &KDPSLRQ JODVV ZDVKHUV FOHDQ DQG VDQLWL]H XS WR  JODVVHV SHU KRXU &KRRVH D URWDU\ RU SDVVWKURXJK XQLW ERWK SURYLGLQJ XS WR  RI FOHDUDQFH IRU WDOOHU VWHPZDUH 7KH SXPS LQMHFWLRQ V\VWHP SURYLGHV SUHFLVH FKHPLFDO GLVSHQVLQJ 8SSHU DQG ORZHU ZDVK DQG ULQVH DUPV SURGXFH VSDUNOLQJFOHDQJODVVHVHYHU\WLPH)UHVKFRROZDWHUVDQLWL]HV JODVVHV LQ WKH ILQDO ULQVHV VR WKH\ DUH UHDG\ IRU LPPHGLDWH XVH0RGHO&*VKRZQ 0RGHO'HVFULSWLRQ &* 5RWDU\7\SH+[: &* 3DVV7KUX+[: &* 3DVV7KUX+[:

(

'+RUL]RQWDO%RWWOH&RROHUV 8QLTXH FRQGLWLRQHG DLU FLUFXODWLRQ LV IRUFHG HYHQO\ RYHU WKH WRS URZ RI SURGXFWV IRULGHDOFKLOOLQJRIERWWOHV6WDQGDUGIHDWXUHVLQFOXGHVWDLQOHVVFRXQWHUWRSDQGOLGV GXUDEOH EODFN YLQ\O H[WHULRU VWDLQOHVV H[WHULRU DYDLODEOH DQG YLQ\OFRDWHG VWRUDJH GLYLGHUV ,QWHULRUV IHDWXUH ORQJ ODVWLQJ KHDY\GXW\ JDOYDQL]HG VWHHO /DUJH HYDSRUDWRUFRLOUXQVWKHOHQJWKRIWKHFRROHUIRUHIILFLHQWEDODQFHGFRROLQJ &DSDFLW\ &DVHV

0RGHO'HVFULSWLRQR]%WOVR]&DQV 7' [[/%LQ'LYLGHUV   7' [[/%LQ'LYLGHUV   7'6 [[/%LQ'LYLGHUV   7' [[/%LQ'LYLGHUV   7' [[/%LQ'LYLGHUV   7'6 [[/%LQ'LYLGHUV   7' [[/%LQ'LYLGHUV   7'6 [[/%LQ'LYLGHUV  

(6WDLQOHVV6WHHO%HYHUDJH&DUWV (OLPLQDWHWKHQHHGIRUVHUYLQJWDEOHVE\WUDQVSRUWLQJDQGVHUYLQJIURPWKHVHDWWUDFWLYHFDUWV6SDFLRXVWRS IRUFRIIHHXUQVFXSVVQDFNWUD\VDQGPRUH/DUJHGURSOHDYHVZLWKULJLGVZLQJRXWSRVLWLYHORFNLQJVXSSRUWV SURYLGH H[WUD VHUYLQJ DUHD /DUJH ZDWHUSURRI DQG VWDLQ UHVLVWDQW ODPLQDWH WRS KDV EXLOWLQ UDLOV 6WDLQOHVV VKHOYHVDQGLQWHULRUSURYLGHH[WUDVWRUDJH6WDQGDUGILQLVKLV:DOQXW2SWLRQDOILQLVKHV%ODFN/LJKW0DSOH DQG5HG0DSOH$YDLODEOHLQWKUHHVL]HV 0RGHO'HVFULSWLRQ  :[+[/ OHDYHVGRZQ DQG/ OHDYHVXS

 :[+[/ OHDYHVGRZQ DQG/ OHDYHVXS ZGRRUV9LFWRULDQ&KHUU\  :[+[/ OHDYHVGRZQ DQG/ OHDYHVXS


%HYHUDJH%DU(TXLSPHQW_ %5R\DO6HULHV6OLGH7RS%RWWOH&RROHUV +LJKTXDOLW\KHDY\GXW\XQLWVLQ  DQG PRGHOV )HDWXUHV LQFOXGH  IURQWWREDFN WR PDWFK XQGHUEDU VWDLQOHVV VWHHO IORRUV KHDY\GXW\ GRRUV DQG FHQWHU EDU FRQVWUXFWLRQ IRU GXUDELOLW\ UXJJHG JUDE EDU KDQGOHV HDV\WRFOHDQ FRYHG FRUQHU FRQVWUXFWLRQ LQVLGH IORRU GUDLQ FRQQHFWHG WR FRQGHQVDWHHYDSRUDWRUSDQHDV\WRVHUYLFH\HDU FRPSUHVVRUZDUUDQW\$YDLODEOHLQEODFNRUVWDLQOHVV VWHHO H[WHULRUV 9 VLQJOH SKDVH  +] 0RGHO %&%*VKRZQ

% $ $,FH%LQV &RPSOHWHOLQHRILFHELQVDYDLODEOHLQRUGHSWKVZLWK RU ZLWKRXW EXLOWLQ FLUFXLW KLJK YROXPH VROLG FDVW DOXPLQXP FROGSODWHIRUVRGDV\VWHPVGHHSELQGHSWKLVWKHPRVW SRSXODU )RU FROG SODWH RSWLRQ DGG ³´ WR WKH HQG RI PRGHO QXPEHU)HDWXUHVFRPSOHWHVWDLQOHVVVWHHOFRYHGFRUQHUOLQHU ZLWK FHQWHU GUDLQ 5HPRYDEOH ERWWOH UDFNV LQFOXGHG 16) 0RGHOVKRZQZLWKRSWLRQDOVSHHGUDLO 0RGHO'HVFULSWLRQ  '[/ '3 '[/  '[/  '[/ '3 '[/  '[/Z%XLOWLQ&ROG3ODWH  '[/Z%XLOWLQ&ROG3ODWH

0RGHO'HVFULSWLRQ&DSDFLW\ R]%WOV  %&%* %ODFN9LQ\O([WHULRUIWZGLYLGHUUDFN  %&66 6WDLQOHVV6WHHO([WHULRUIWZGLYLGHUUDFN  %&%* %ODFN9LQ\O([WHULRUIWZGLYLGHUUDFNV  %&66 6WDLQOHVV6WHHO([WHULRUIWZGLYLGHUUDFNV  %&%* %ODFN9LQ\O([WHULRUIWZGLYLGHUUDFNV  %&66 6WDLQOHVV6WHHO([WHULRUIWZGLYLGHUUDFNV  %&%* %ODFN9LQ\O([WHULRUIWZGLYLGHUUDFNV  %&66 6WDLQOHVV6WHHO([WHULRUIWZGLYLGHUUDFNV 

& &8QGHUEDU6LQNV &RPSOHWHOLQHDYDLODEOHLQDQGIURQWWREDFNGHSWK)HDWXUHVFRPSOHWHVWDLQOHVV VWHHO HPERVVHG GUDLQERDUGV ODUJH [[ GHHS GUDZQ ERZOV ZLWK UHDU FRUQHU GUDLQV &RPHV FRPSOHWH ZLWK GUDLQV RYHUIORZV DQG ORZ OHDG FRPSOLDQW IDXFHWV 16) 0RGHO&VKRZQZLWKRSWLRQDOVSHHGUDLOV 0RGHO'HVFULSWLRQ 6HULHV & &RPS6LQNZ%RZO,Q&HQWHU)DXFHW /RU5 &RPS6LQNZ%RZORQ/HIWRU5LJKW)DXFHW /RU5 &RPS6LQNZ%RZORQ/HIWRU5LJKW)DXFHW & &RPS6LQNZ%RZOLQ&HQWHU)DXFHW & &RPS6LQNZ%RZOLQ&HQWHU)DXFHW 6HULHV & &RPS6LQNZ%RZO,Q&HQWHU)DXFHW & %DU6LQN)DXFHW 'UDLQ $GGLWLRQDOPRGHOVDYDLODEOH

' '%OHQGHU'XPS6LQN 7KHXOWLPDWHEOHQGHUVWDQGZLWKODUJH[[ GHHSVLQNERZOZKLFKFDQEHXVHGDVDGXPSVLQN RU KDQG VLQN /DUJH VWHSGRZQ VKHOI EHORZ IRU EOHQGHUDQGEDUDFFHVVRULHV6WDLQOHVVVWHHOVLGHV )DXFHWDQGGUDLQLQFOXGHG$YDLODEOHLQDQG ZLGWKV16)0RGHO%'VKRZQ 0RGHO'HVFULSWLRQ %' 6LQN %' 6LQN

)5R\DO6HULHV8QGHUEDU 'HOX[H OLQH RI VWDQGDUG DQG FXVWRP XQGHUEDU HTXLSPHQW IHDWXUHV KHDY\GXW\ FRQVWUXFWLRQ EXLOW IRU GXUDELOLW\ )XOO $XWR&$' OD\RXW DQG GHVLJQ DYDLODEOH +LJK TXDOLW\ EXLOWLQ VRXQG GHDGHQHG VSHHG UDLOV 6WDLQOHVV VWHHO VLGHV DQG OHJV +LJK TXDOLW\FDUWULGJHYDOYHIDXFHWV16)

(&ORVHG*ODVV6WRUDJH (QGWKHVWRUDJHSUREOHPZLWKDZLGHFDELQHWWKDW KROGV WKUHH [ JODVV UDFNV EHORZ 6WDLQOHVV VWHHOFDELQHWZLWKGUDLQRQERWWRP$OVRDYDLODEOH ZLWKVROLGPLGGOHVKHOI16)0RGHO*6%

(

)


%HYHUDJH%DU(TXLSPHQW_

(GCVWTGF%JGH &KHI-RQDWKDQ%HQQHWW 0R[LH7KH5HVWDXUDQW &OHYHODQG2+ &UXQFK\$UWLFKRNH 7RPDWR6DODG HD*OREHDUWLFKRNHVFOHDQHG OEV+HLUORRPWRPDWRHVFXWWR GHVLUHGVKDSH

$



OEDUXJXOD

7EVSIUHVKPLQWILQHULEERQV $&DPEDU'HVLJQHU6HULHV &DPEUR¶V 'HVLJQHU 6HULHV RIIHUV RSWLRQDO DSSHDUDQFH XSJUDGHV WR DGG WR DQ\ DPELHQFH &KRRVH IURP  GHFRU SDFNDJHV (DFK SDFNDJH LQFOXGHV DQ XSJUDGHG DSSHDUDQFH ZLWK LQODLG IURQWDQGVLGH SDQHOV DQG D JUDQLWH SDWWHUQHG FRXQWHUWRS 7KH 'HVLJQHU6HULHVKDVDOOWKHVDPHIHDWXUHV\RX¶YHFRPH WR H[SHFW²0DGH RI GXUDEOH SRO\HWK\OHQH ZKLFK ZRQ¶WGHQWFUDFNUXVWFKLSRUEUHDN 0RGHO'HVFULSWLRQ %$5'6 /[:[+'HFRUDWLYH&QWUWRS %$5'6 /[:[+8SJUDGHG'HFRU %$5'6 /[:[+8SJUDGHG'HFRU

HDOHPRQMXLFHG ]HVWHG 7EVSH[WUDYLUJLQROLYHRLO R]JRDWFKHHVHIUHVKRUVRIWULSHQHG 6DOW SHSSHUWRWDVWH

6KDYH WKH DUWLFKRNHV RQ D VOLFHU DV WKLQ DV SRVVLEOH ,Q D PL[LQJ ERZO VHDVRQWKHDUWLFKRNHVDQGWRPDWRHVZLWKWKHOHPRQMXLFHRLODQGVRPH VDOW  SHSSHU /HW VWDQG IRU  PLQXWHV $GG LQ WKH DUXJXOD PLQW DQG FKHHVH6HDVRQZLWKDWRXFKPRUHVDOWWRVVDQGVHUYH

%0D[LPL]HUŒ3RUWDEOH%DU 7ZRVWHS EDU DQG FRXQWHUWRS GHVLJQHG IRU HDVH RI GULQN SUHSDUDWLRQ DQG VHUYLQJ 0ROGHGLQ EDUPDW ZHOO DQG EXLOWLQ FXWWLQJ ERDUG 6OLGLQJ VWRUDJH GUDZHU DFFRPPRGDWHVPL[HUVVRGDVRUEXVER[HVJDOORQ LFH ELQ ZLWK LQWHJUDWHG GUDLQ DQG ZDWHU WUDS  QRQPDUNLQJ FDVWHUV ZLWK EUDNHV )XOO\ DVVHPEOHG +[/[: %ODFN FRXQWHUWRS VNLUW DQG VWDQFKLRQV)URQWDQGVLGHSDQHOFRORUV&KHUU\:RRG   6WDLQOHVV 6WHHO   7UDGLWLRQDO *UH\   RU %ODFN'XUDJUDLQ   0RGHO'HVFULSWLRQ  0D[LPL]HU3RUWDEOH%DU  0D[LPL]HU9LQ\O%DU&RYHU

% & &'HOWDŠ 5RWDU\*ODVV:DVKHU &RPSRVLWH FDURXVHO UDFN SUHYHQWV GDPDJH WR JODVVZDUH 7KH  YHUWLFDO FOHDUDQFH DFFRPPRGDWHV WDOOHU JODVVZDUH DQG FOHDQV XSWRJODVVHVSHUKRXU6LQJOHVZLWFK DXWRILOO DXWRVWRS RSHUDWLRQ $GMXVWDEOH ULQVH FRQWURO DOORZV KRW RU FROG ZDWHU ILQDO ULQVHIRUIOH[LEOHVDQLWL]LQJPHWKRGV%XLOWLQ FKHPLFDO SXPSV DQG RQERDUG FKHPLFDO VWRUDJH FRPH VWDQGDUG (IILFLHQW  +3 ZDVK PRWRU 'XUDEOH  VWDLQOHVV VWHHO FRQVWUXFWLRQ ZLWK GRXEOHZDOO LQVXODWHG FDELQHW IRU TXLHW RSHUDWLRQ 16) DQG F8/XVOLVWHG

''HOWD*ODVV:DVKHU (QHUJ\ 6WDUŠ TXDOLILHG DQG UDWHG E\ 16) DV ERWK D GLVK ZDVKHU DQG JODVV ZDVKHU &OHDQV XS WR  UDFNV  JODVVHV  SHU KRXU %XLOWLQ FKHPLFDO SXPSV IRU GHWHUJHQW ULQVH DLG DQG VDQLWL]HU VHFRQG RSHUDWLQJ F\FOH ZLWK   FOHDUDQFH WKDW DFFRPPRGDWHV WDOOHU ZDUHV 3XVKEXWWRQ VWDUW ,QWHJUDWHG VXVWDLQHUKHDWHUNHHSVZDVKZDWHUKRWEHWZHHQF\FOHV(DV\WR FOHDQ ZDVK DUPV ZLWK UHPRYDEOH HQG FDSV %XLOWLQ VFUDS DFFXPXODWRUSUHYHQWVGUDLQIURPFORJJLQJ'XUDEOHVWDLQOHVV VWHHOFRQVWUXFWLRQ$GMXVWDEOHEXOOHWIHHW16)DQGF8/XVOLVWHG

'


Cooking Equipment Ranges Convection Ovens Steam Equipment Ventilation Fryers Microwaves Toasters Deck Ovens vs. Conveyor Ovens A deck oven lends itself to a wide variety of menu items. It is simply designed and usually requires less servicing. The deck oven requires a higher skill level to operate. Conveyor ovens reduce bake times and out-produce deck ovens due to the dynamic of forced air. They also offer increased consistency. Because no tending is necessary, conveyor ovens can be used by lesser skilled employees.

Pizza Ovens The most important piece of equipment in any pizza operation is the oven. Pizza ovens deliver high heat, rapid temperature recovery and a high production environment. These “specialty” ovens range in size from countertop to large, multi-level floor models. The oven is an expensive investment and selecting the proper one is crucial.

A A. XL-Series Challenger Restaurant Ranges. Stronger. Faster. Better. Stainless steel front, sides, back riser with lift off high shelf and 6" adjustable legs. All welded frame construction. 30,000 BTU/hr. open-top burners with lift-off burner heads. Flashtube pilot ignition system. Extra deep pull-out crumb tray. Full size models offer a 35,000 BTU/hr. standard oven. Baker’s depth standard oven holds sheet pans front-to-back and side-to-side. Other features include adjustable thermostat from 250°F to 500°F, 1 oven rack, 2 sets of rack guides and 4 rack positions. 1-year limited parts and labor warranty. 24", 36", 48", 60" and 72" size ranges available in a variety of open burner and griddle top combinations. Model Description C24-S-4B 24" Space-Saver Oven w/4 Open Burners, 140,000 BTU C36-S-36G 36" Std Oven w/36" Fry Top, 95,000 BTU C36-S-2B-24G 36" Std Oven w/2 Open Burners, 24" Fry Top, 135,000 BTU C36-S-6B 36" Std Oven w/6 Open Burners, 215,000 BTU C36-C-2B-24G 36" Conv Oven w/2 Open Burners, 24" Fry Top, 135,000 BTU C36-C-6B 36" Conv Oven w/6 Open Burners, 215,000 BTU Additional models available.

Some things to consider when selecting the right pizza oven for your operation: • How big a footprint is available for an oven? • What is the volume production necessary during the busiest shift? • What is the budget for equipment purchases? • Will more than one oven be needed, or is the unit stackable? • What is the skill level of the operator? • What is the available power source?

B. S-Series Restaurant Range. The S-Series Restaurant Range offers a quality, versatile range for commercial foodservice applications. 24", 36", 48" and 60" widths and a number of top configurations are available. Configurations include combinations of open burners and griddles. Model S36D shown.

• Will a ventilation system be required?

B Model S24E S24C S36D S36A S36C S48EE S48DC S48AC S60DD S60AA S60AD S60DC S60AC S60CC

Description 24" RR, 4 Burners, Standard Oven 24" RR, 4 Burners, Cabinet 36" RR, 6 Burners, Standard Oven 36" RR, 6 Burners, Convection Oven 36" RR, 6 Burners, Cabinet 48" RR, 8 Burners, Dual Standard Ovens 48" RR, 8 Burners, Standard Oven/Cabinet 48" RR, 8 Burners, Convection Oven/Cabinet 60" RR, 10 Burners, Dual Standard Ovens 60" RR, 10 Burners, Dual Convection Ovens 60" RR, 10 Burners, Standard Oven/Convection Oven 60" RR, 10 Burners, Standard Oven/Cabinet 60" RR, 10 Burners, Convection Oven/Cabinet 60" RR, 10 Burners, Cabinet/Cabinet


Cooking Equipment | 44

A

A. Ultimate 400-Series Restaurant Ranges. Meet the needs of any operation with 24", 36", 48" and 60" widths. Hundreds of combinations, including the only 5 burner configuration in the industry, stainless steel construction, snap action oven thermostat, 45K BTU standard oven, 32K BTU convection oven, heavy duty counter balance oven door. Choice of cast iron non-clog (33K BTU) burners, star/saute burners (33K BTU) or pyromax (40K BTU) burners. Available with wavy or standard grates, metal knobs with manual gas shut off valve. Standard battery spark ignition for oven and optional for charbroiler, griddle, open top and hot top. New charbroiler configurations available in 24" and 36" (32K BTU). Model 4365A shown.

B

Model Description 4241E 4 Burners (33K BTU), 1 Economy Standard Oven 4361D 6 Burners (33K BTU), 1 (45K) Standard Oven 4601DD 10 Non-Clog Burners, Standard Grates, Dual Standard Ovens 4361D2G 2 Non-Clog Burners, Standard Grates, 24" Griddle (L or R), Standard Oven 4366D 3 Star/Saute Burners Front, 2 Pyromax Burners Back, Standard Grates/Oven 4362D 6 Non-Clog Burners, Wavy Grates, Standard Oven 4363D 6 Star/Saute Burners, Standard Grates/Oven Additional models available.

C

C. Platinum Sectional Ranges. Designed to withstand the rigors of high-volume restaurants, hotels and institutional kitchens. Heavy-duty ranges, griddles, charbroilers, hot tops, fryers and broilers can be combined for a custom line-up to fit the needs of any operation. Heavy-duty, stainless steel welded grates; stainless steel front, sides and shelf; front and rear gas; porcelain oven interior fits full size pans in either direction; 2-year parts and labor warranty. Model Description P32D-BBB 32" Sectional w/6 Burners/Standard Oven P32D-BBB-SU 32" Sectional w/6 Burners/Standard Oven, Step-Up P32D-CC 32" Sectional w/Charbroiler/Standard Oven P32D-GG 32" Sectional w/Griddle Top/Standard Oven P32D-GRAD 32" Sectional w/Graduated Hot Top, Standard Oven Additional models available.

Model Description Restaurant Series 24-BP-4B-S20 24", 4 Burners, 20" Standard Oven 36-BP-6B-S30 36", 6 Burners, 30" Standard Oven 60-BP-10B-S26 60", 10 Burners (2) 26" Standard Ovens Vantage Series 24-BPV-4B-S20 24", 4 Burners, 20" Standard Oven Additional models available.

D. Starfire Pro 36" Ranges, G-Series. Garland Restaurant Ranges are equipped with a large capacity oven, 357/ 16" wide and 27" deep work top surfaces. Feature stainless steel front, sides and 5" wide front rail, 6" legs with adjustable feet and six Starfire Pro 2-piece, 33,000 BTUH, cast open burners set in split cast iron ergonomic grates. Fully porcelain oven interior with ribbed oven bottom and inner door liner, with heavy duty “keep cool” door handle. Oven controlled by even bake, fast recovery snap action modulating oven thermostat. D Model Description G36-6R Open-Top 6 Burners, 1 Standard Oven G36-6S Open-Top 6 Burners, 1 Storage Base G36-6T Open-Top 6 Burners, Modular Top G36-4G12R Open-Top 4 Burners, 12" Griddle, 1 Standard Oven G36-4G12S Open-Top 4 Burners, 12" Griddle, 1 Storage Base G36-4G12T Open-Top 4 Burners, 12" Griddle, Modular Top G36-2G24R2 Open-Top 2 Burners, 24" Griddle, 1 Standard Oven G36-2G24S2 Open-Top 2 Burners, 24" Griddle, 1 Storage Base G36-2G24T2 Open-Top 2 Burners, 24" Griddle, Modular Top G36-G36R 36" Griddle, 1 Standard Oven G36-G36S 36" Griddle, 1 Storage Base G36-G36T 36" Griddle, Modular Top

E. Endurance Gas Restaurant Ranges. Built to stand up to the demands of high-volume cooking, with rugged, heavy duty construction. Fully MIG welded aluminized steel frame with stainless steel front, sides, back riser, high lift-off shelf and 6" adjustable legs. Six 32,000 BTU/hr. with lift-off heads, individual pilot for each burner, heavy duty cast grates, easy lift-off 12"x12" (front) and 12"x14" (rear), pull-out crumb tray with welded corners, 35,000 BTU/hr. baker’s depth standard oven cavity; full size sheet pans fit side-to-side or front-to-back, cast burners with lift-off heads, oven thermostat adjusts 250ºF to 500ºF, cool touch oven door handle, 2 oven racks and 4 rack positions.

E

B. Restaurant Series & Vantage Series Ranges. Restaurant Series Ranges come standard with many “best in the industry” features. Available in a multiple of configurations to meet every kitchen specification. Feature 40,000 BTU burners, 1" thick griddle option, 7" landing ledge, 5 rack positions. Wide variety of cooking chamber sizes include 30" wide ovens and 15" high oven. Vantage Series Ranges come standard with 28,000 BTU burners, 3 / 4 " thick griddle plate option, 5" landing shelf and 2 rack positions.

The Endurance

Model Description 24S-4B 24", 4 Burners, Standard Oven Base, 143,000 BTU 36S-6B 36", 6 Burners, 27"D Standard Oven Base, 215,000 BTU 36S-6B-I 36", 6 Burners, 27"D Standard Oven Base, 215,000 BTU 36S-2B-24G 36", 2 Burners, 24" Griddle w/Manual Controls, Standard Oven Base, 135,000 BTU 36S-2B-24GT 36", 2 Burners, 24" Griddle w/Thermostatic Controls, Standard Oven Base, 135,000 BTU 36S-36G 36", 36" Griddle w/Manual Controls, Standard Oven Base, 95,000 BTU Additional models available.


Cooking Equipment | 45

A

A. Xcel Premium Convection Ovens. Blodgett XCEL will ensure a perfect bake time after time ... every time! Standard features include 2-speed convection motor for fast and gentle baking, fully welded angle iron frame, double sided porcelain baking compartment liner, stainless steel front, top and sides, triple-mounted dependent doors. Includes one chrome plated EZ-slide rack with ball bearing slides capable of gliding completely out of the oven cavity. Stackable. 2-year parts and 1-year labor warranty, 5-year limited warranty on door. Shown with optional casters. Model Description DFG100XCEL Sgl Single Gas DFG100XCEL Dbl Double Gas MARK VXCEL Sgl Single Electric MARK VXCEL Dbl Double Electric

C. CNVX/BCX/BX-Series Combi/Convection Ovens. Want the capacity and versatility of both a convection and combi? The Blodgett CNVX/BCX provides both a combi and convection oven in the same compact footprint. The BCX14 Combi offers increased production while decreasing your labor and maintenance. Exclusive “deliming indicator” tells you when to delime; with the deliming pump, you simply push a button to delime. For more versatility, stack with the CNVX-14 Companion Convection Oven. With the same footprint as the BCX and BX ovens, the CNVX is the ideal convection/combi stack. Model BCX-14E shown on CNVX-14E. Model Description BCX-14G Gas Combi BCX14G/CNVX14G Gas Combi/Convection Oven BCX-14E Electric Combi BCX-14E/CNVX14E Electric Combi/Convection Oven BX-14G Gas Combi (Boilerless) BX-14E Electric Combi (Boilerless)

B. VC Series Full Size Convection Ovens. The versatile performance you need for preparing a varied menu with consistently great results. With gentle air circulation and even heat distribution, these all-purpose ovens produce delicious, evenly cooked casseroles, meats, vegetables and baked goods. They also save on B operating costs with an energy-efficient heat recovery system. 1-year limited parts and labor warranty. Model VC44GD shown. • Electric: 12.5 kW input burner per oven section, 208 or 240 V, 60 Hz, 1 or 3-phase. • Gas: 44,000 BTU/hr. burner per oven section. Model Description Models w/Solid State Controls VC4GD Gas Single VC44GD Gas Double VC6GD Gas Single Deep Depth VC66GD Gas Double Deep Depth VC4ED Elecric Single VC44ED Elecric Double VC6ED Elecric Single Deep Depth VC66ED Elecric Double Deep Depth

C

Convection Oven Sizing Guide Meals Served 50 to 100 100 to 400 400 to 750 750 up 750+ meals

Size 1 - Half Size Convection Oven 1 - Full Convection Oven 1 - Double Convection Oven 1 - Double Convection Oven, plus 1 - Single Convection Oven Consideration should be given to mobile Roll-In or Drive-In Style Ovens

E D. DFG Standard Convection Ovens. Best in class and energy efficient DFG ovens feature a Dual Flow™ system combining direct and indirect heat. Standard features include fully welded angle iron frame, all stainless steel exterior, double-sided porcelain liner and triple mounted doors. Easy access-dual pane glass or solid stainless steel dependent doors open simultaneously with one hand, and the porcelain door handle stays cool to the touch. The DFG200 features an extra-depth baking compartment to accept full-size baking pans lengthwise and widthwise.

D

Model DFG50 Sgl DFG100 Dbl DFG100 Sgl DFG200 Sgl

Description Half-Size Oven, 4" Legs & Draft Diverter 6" S/S Legs, Draft Diverter & Flue Connector 25" Legs & Draft Diverter 25" Legs & Draft Diverter

E. SG Series Convection Ovens. Lower profile, ergonomically designed to fit under today’s lowest hoods at comfortable working height. 60,000 BTU/hr. direct fired combustion system in conjunction with exclusive power level control allows operator to adjust heat input to match the oven load. Solid state temperature control is adjustable from 200°F to 500°F. Features include 1/3 HP, 2-speed fan motor, stainless steel front, sides, top, legs and doors with windows. 1-year limited parts and labor warranty. Model SG4D shown. Additional options available Model Description SG4D Single Deck SG44D Double Deck


Cooking Equipment | 46 A. Marathoner Gold Convection Ovens. Patented soft heat mixing zone and in-shot burners for perfect baking every time. Ovens available in standard or bakery depth, single or double deck with standard or cook and hold programmable controls. 90,000 BTU for both standard and bakery depths. Electric models 11kW per deck. Stainless steel front, sides, legs, top and door seals. Interchangeable control panels. Solid state controls. 140°F to 500°F thermostat range. Porcelain enamel interior. 64"H (double deck)—lowest height in the industry! Model GS/15SC shown. Model Description Standard Depth Models w/Standard Controls EH/10SC Electric, Single Half Size Convection Oven B EH/20SC Electric, Double Half Size Convection Oven ES/10SC Electric, Single ES/20SC Electric, Double GS/15SC Gas, Single GS/25SC Gas, Double A B. SilverStar Convection Ovens. Additional models available. Patented soft heat mixing zone and patented in-shot burners for perfect baking every time. With 72,000 C. Hydrovection™ . BTU per deck, SilverStar is available in several sizes Move your product from the kitchen to the table quickly with the to accommodate various kitchen needs. Ovens are Hydrovection™ by Blodgett. Hydrovection™ unites hot air available in standard or bakery depth, single or cooking with moisture to produce a quality product faster than double deck, standard or cook and hold controls, and standard convection ovens. Its innovative air distribution with a variety of interchangeable control panels. system combines a multi speed bi-direction/bi-functional blower Energy Star® qualified for standard depth convection wheel designed to form a unique air flow pattern resulting in a oven. Model SLGS/22SC shown. high quality bake, with increased product yields that generate Model Description savings for you. Electric and gas models now available! Models w/Standard Controls Model HV-100E double shown with optional casters. SLES/10SC Electric, Single, Standard Depth Model Description SLES/20SC Electric, Double, Standard Depth Full Size Hybrid Ovens w/Menu Select Controls SLGS/12SC Gas, Single, Standard Depth HV-100E Single Electric Oven SLGS/22SC Gas, Double, Standard Depth HV-100E Double Electric Oven SLEB/10SC Electric, Single, Bakery Depth C HV-100G Double Gas Oven SLGB/12SC Gas, Single, Bakery Depth HV-100G Single Gas Oven SLGB/22SC Gas, Double, Bakery Depth ®

D. Chef Series™ Convection Ovens. The most advanced ovens in the industry. Standard features include one-shot and pulse steam injection, even baking without rotating pans, cook and hold feature, 6 wire racks with 12-position pan slides, simultaneously opening doors with large, double-pane glass windows and a porcelainized cooking compartment. Chef Series ovens offer 2 control options (a knob control or a fully programmable, icon-driven control) and can be double stacked for maximum capacity. Model Description Models w/EnviroStar Controls GCSF-ES1 Gas-Full, Natural or LP ECSF-ES1 Electric-Full, 208/240V

D

E

E. Cyclone Series Convection Ovens. No more fryers! No added fat! Bakes like a Combi but at 1/3 the price! Energy Star® rated full and half size, single and double convection ovens with 60,000 BTU per oven or 11 Kw electric power. Feature 2-speed, high-low fan with cool-down setting and 4-second cycle hot surface ignition system. Stainless steel front, top, sides and doors. Fully insulated doors feature “cool touch” handles, stainless door seals and double-pane thermal glass windows. Lighted porcelain enamel interiors have 11-position, removable rack guide and 5 racks. Model BCOE-1 shown with optional casters. Model Description BCOG-1 Single Gas, Limited Options (Value) Energy Star® BCOG-2 Double Gas, Limited Options (Value) Energy Star® BCOE-1 Single Electric, Limited Options (Value) BCOE-2 Double Electric, Limited Options (Value) GDCOG-1 Single Gas, (Mid Range) Energy Star® GDCOG-2 Double Gas, (Mid Range) Energy Star®

Charbroiler Tips Use the appropriate grate for the menu selection. Some grates help drain away fat while giving the characteristic charbroiled markings. Season the grates before the first use by pre-heating them to open the pores and brushing them with oil. Be sure to pre-heat the grates before cooking. The hotter the better. This helps reduce sticking. Dip the food product in seasoned oil before grilling. This also reduces sticking and enhances flavor. Position the grates on an angle for charbroiling. This helps drain the grease and gives you better control over heat distribution. Well done items go to the top position, farthest away from the heat source so they cook more slowly and thoroughly. Rare items should be in the lower position so they cook rapidly on the outside and leave the inside rare. Wire brush the grates after each use or batch of food product.


Cooking Equipment | 47

B

A A. HearthBake Series Countertop Ovens. Compact by design, high-volume and inexpensive. Engineered for fast pre-heat and quick recovery, HearthBake ovens deliver precise and balanced cooking and baking results for an unequaled variety of menu items. Ideal for baking, roasting, re-therming, warming and holding of pizza, meat, vegetables, breads, deserts, fish and chicken. Bake directly on the hearth deck, on screens, or on baking sheets. Choose gas or electric. Ovens are stackable. Optional brick lining now available. Model GP-51 GP-61 GP-52 GP-62 BK-18 P18S P22S P44S P22-BL

Description Gas Single w/2 Decks, 40,000 BTUH Gas Single w/2 Decks, 45,000 BTUH Gas Double w/4 Decks, 80,000 BTUH Gas Double w/4 Decks, 90,000 BTUH Electric Single 18"x18" Electric Double 18"x18" Electric Double 21"x21" Electric Double w/4 Decks 21"x21" Bricked Lined Double 21"x21"

B. Cayenne® Convection Ovens. Ideally suited for dough products, pastries, and cakes—use with pre-made frozen products to achieve fresh-baked sales with high speed and minimal fuss. Cayenne® Convection Ovens offer the perfect opportunity for operations to break into the fresh-baked market or expand existing menus. Features include: • 120-minute timer automatically turns oven off after set time • Removable cool-touch door for easy cleaning • Heavy-duty stainless steel construction and hinges • Removable shelf runners and rounded interior corners • Non-tip, chrome plated steel shelves • Interior light • 150°F to 570°F temperature range • Knob guard protects thermostat and timer against damage or accidental changes • NSF, ETL approved Model 40702 40701 40703

Description Full-Size, Steam Injection System, 4 Shelves Half-Size, Broil Function, 4 Shelves Half-Size, Broil Function, 3 Shelves, Portable

D C. Infrared & Radiant Broilers. Used by some of the best steakhouses in the world! Intense energy quickly penetrates meat, locking in natural juices and reducing broiling time as much as 50%. Broil in half the time with 1/3 less gas for fuel savings up to 66% over ordinary broilers. Schwank tiles pre-heat to 1650°F in 90 seconds. Warming oven above broiler. Stainless steel front, sides and top. 674 sq. inches per rack. Grease filtration system for clean air intake. Available with 45,000 BTU standard oven or convection oven. Model P32D-171 shown.

C Model Description 170 Infrared Single, Free-Standing 171 Infrared Single w/Warming Oven, Free-Standing 270 Infrared Double, Free-Standing P32A-171 Platinum Infrared w/Convection Oven P32D-171 Platinum Infrared w/Standard Oven P32D-3240 Platinum Radiant w/Standard Oven P32C-32B Platinum Radiant w/Cabinet P32A-3240 Platinum Radiant w/Convection Oven Additional models available.

D. LineChef™ Manual Convection Ovens. Expect the same cooking performance as Cadco’s digital convection ovens, except with manual controls! • Advanced airflow design with patented baffle • Manual controls (time and temperature) • Heat settings from 175°F to 500°F • 60-minute timer • Humidity feature on half and full size models • Heavy-duty stainless steel construction • Interior halogen light • 3" between shelves • Cool-touch double wall glass door • Oven cavity wrapped in high “R” value insulation • Designed to accommodate stacking • NSF, UL through CSA standards Model XAF-193 shown. Model Description XAF-103 Quarter Size, Holds (3) 1/4 Size Pans XAF-113 Half Size w/Humidity, Holds (3) 1/2 Size Pans XAF-133 Half Size w/Humidity, Holds (4) 1/2 Size Pans XAF-183 Full Size w/Humidity, Holds (3) Full Size Pans XAF-193 Full Size w/Humidity, Holds (4) Full Size Pans (Pans not included)


Cooking Equipment | 48

B A A. High Performance Griddles. All the features of the MKG standard series including 1” thick griddle plate; Imbedded temperature sensors for accuracy of temperature reading and double walled stainless steel cabinet. Now Energy Star® qualified both plain steel and chrome. 30% faster recovery and lower BTU rating than the MKG (26,500 BTU per 12"). Features unique copper heat exchangers. More even heat front-to-back and left-toright, with 27% less variance. More energy efficient, lower idle energy consumption. Gas or electric models available in 5 sizes. Model Description MKH24-ST Gas, 53,300 BTU, Electric T-stat MKH36-ST Gas, 80,000 BTU, Electric T-stat MKH48-ST Gas, 106,600 BTU, Electric T-stat MKH60-ST Gas, 133,300 BTU, Electric T-stat MKH72-ST Gas, 160,000 BTU, Electric T-stat MKE24-E Electric, 11.4kW, Electric T-stat Additional models available.

B. Restaurant Series Countertop Line. Countertop line delivers the performance and optimal response time required for professional chefs. Each cooktop is stainless steel, gas operated, provided with an LP conversion kit and has 4" adjustable legs for easy height variation. Griddles feature embedded snap-action thermostat, pilot safety valves and thick deep plate for increased production capacity. Charbroilers equipped with 27" chassis with cast iron burners, top grates and radiants. Unique underburner deflector system creates a cool zone in the tray and drip areas. Hot Plates runs at peak efficiency and have a full-width, easy-to-empty front crumb tray. Two-piece burner allows ease of cleaning and minimizes impact of spills. Models shown—VCRH36 (left), VCRG36T (middle), VCRB36 (right). Model Description VCRH36 36" Hot Plate, 6 Burner VCRG36-T 36" Griddle, Thermostatic VCRB36 36" Charbroiler Additional models available.

D

C C. Medium Duty Electric Griddles. Highly-polished 1/2" thick griddle plate fully welded to stainless steel frame for consistent cooking and easy clean-up. Stainless steel construction and extended cool-to-touch front edge. Heat and thermostatic control every 12". Removable, easy-to-clean, stainless steel, large capacity catch tray. Model GEG36 shown. Model Description GEG24 24", 208-240V, 4,200W/5,600W GEG36 36", 208-240V, 6,300W/8,400W GEG48 48", 208-240V, 8,400W/11,200W

D. HDC Series Counter Charbroiler. Charbroil with briquettes or radiants and with the new Southbend design, also grill on an optional griddle. Features 2-position, 2-sided cooking grids, 40,000 BTU per foot, wide or narrow branding by inverting grates, wide front grease trough, stainless steel front and sides, 5" stainless steel flue riser, 4" stainless steel legs and fully insulated for zero side clearance. Field convertible from radiant to briquette cooking, no tools required. Model HDC24 shown with optional battery spark ignition. New rounded front rail to match the Ultimate Restaurant Range. Model Description HDC-24 24" Radiant HDCL-24 24" Briquettes HDC-36 36" Radiant HDCL-36 36" Briquettes HDC-48 48" Radiant HDCL-48 48" Briquettes

E. Gas Countertop Equipment. High quality at a great price! Globe’s line of gas radiant and char rock charbroilers, manual and thermostatic griddles, fryers and hot plates feature high performance BTUs and are available in all the popular sizes. Standard features include stainless steel construction (front, sides and back), stainless E steel 4" adjustable legs, removable stainless steel catch Model Description trays, heavy-duty cast iron GG15G Griddle, 15"W, 30,000 BTU cooking grates. Units ship GF30G Fryer, 30-lb. fat cap., 53,000 BTU natural gas and include LP GG24TG Griddle, Thermostatic, 24"W, 60,000 BTU conversion kit. Models GHP12G Hot Plate, 2 Burner, 44,000 BTU GCB15G, GF30G, GG24TG, Additional models available. GHP12G shown.

F F. HDO Series Counter Range. Available in 2, 4 and 6 burner models. Step-up models provide additional flexibility when working with skillets, and are available on 4 and 6 burner models. Features: 33,000 BTU cast-iron burners with lifetime guarantee against clogging, all stainless steel construction, heavyduty cast iron split grates, flush top design. 4" stainless steel legs. Fully insulated for zero clearance. Full-width crumb tray. Model HDO24 shown with optional battery spark ignition. New rounded front rail to match the Ultimate Restaurant Range! Model Description HDO-12 HD Counter Open Top,12" - 2 Burner HDO-24 HD Counter Open Top,24" - 4 Burner HDO-24SU HD Open Top Step Up, 24" - 4 Burner HDO-36SU HD Open Top Step Up, 36" - 6 Burner HDO-36 HD Counter Open Top,36" - 6 Burner


Cooking Equipment | 49

A B A. Gas Countertop Equipment. Unsurpassed performance, combining proven control systems with Wells quality and durability. All units shipped with natural gas configuration. Constructed of 300 series stainless steel for added durability and easy clean up. Available in 3 popular sizes. Charbroilers–25,000 BTU every 6" of grill width. Griddles–30,000 BTU per 12" section. Hot Plates–26,000 BTU per burner.

Model 23191 23192 23193 23143 23144 23145 23146 23147 23148

Description Charbroiler, 24" Charbroiler, 36" Charbroiler, 48" Griddle, 24" Griddle, 36" Griddle, 48" Hot Plate, 2 Burner Hot Plate, 4 Burner Hot Plate, 6 Burner

C. Griddles. The perfect addition to your kitchen countertop. Large, heavy cast non-stick griddle has a 21"x12" cooking surface. Its high tech non-stick surface and a removable stainless steel grease tray and splash guard make it easy to clean. Even heating throughout griddle surface up to 450°F. On/off switch with indicator light; power light indicates griddle is turned on. UL Safety and Sanitary approved. Model CG-10 shown. Model CG-10 CG-20

Description 21"x12", 120V, 1500 Watts 21"x12", 220V, 1500 Watts

B. Cayenne® Heavy Duty Counter Line. Cayenne® heavy-duty back-of-the-house line up of griddles, charbroilers and induction ranges are built solid to handle the requirements of today’s dynamic kitchens. Features include higher BTU cooking power, all-metal knobs and knob guards GUARANTEED FOR LIFE. Fully-welded construction eliminates grease and dirt traps; stainless steel construction for corrosion resistance. Lava rock charbroilers include radiant conversion kit; gas griddles include propane conversion kit. Induction hot plates have same look and operating height as charbroilers and griddles. Models shown: 912HIDC, 924CG, 924GGM, 924HIMC. Model Description 912HIDC 12" Induction Dual-Hob, Digital Control 924HIMC 24" Induction Dual-Hob, Manual Control 924CG 24" Charbroiler, Lava/Radiant 924GGM 24" Griddle, Manual Control Additional models available.

C

D

D. Star-Max® Counter Equipment. This complete line of ruggedly constructed gas and electric griddles, charbroilers, fryers and hot plates delivers heavy-duty performance and excellent results. Heavy gauge stainless steel construction. UL, AGA, NSF. Newly upgraded and new 2-year warranty! Model Description 624MD 24" Gas Griddle, 24"Wx273/4"Dx151/2"H 536TGD 36" Electric Griddle, 36"Wx277/8"Dx151/2"H 648TD 48" Thermostat Griddle, 48"Wx273/4"Dx151/2"H 5124CD 24" Electric Charbroiler, 24"Wx255/8"Dx141/4"H 6036CBD 36" Gas Charbroiler, 36"Wx253/4"Dx151/2"H Additional models available.

E F E. HDG Series Thermostatic Counter Griddles. Perfect for the high volume kitchen with the exclusive “no cold” zone. New snap-action thermostatic controls provide precise temperature settings of 150°F to 400°F. A 1" thick steel griddle plate means quick recovery and even heat on even the fullest loads. • 30,000 BTU per foot Model Description • Wide spatula-width grease trough for HDG-24 24" easy cleaning HDG-36 36" • Stainless steel front and sides HDG-48 48" • Flame failure safety device standard HDG-60 60" • 4" stainless steel legs • Fully insulated for zero clearance Model HDG24 shown w/standard battery spark ignition.

F. Electric Griddle. Perfect for your busy kitchen—Quickly prepare chicken, beef, fish and grilled vegetable dishes. Constructed of heavy-duty stainless steel. Temperature control switch adjusts from 120°F to 570°F. Large 151/2"x16" cooking area and 3" front and back splash for protection. Bottom mounted removable grease collection pan for easy cleaning. 120V. 1750 Watts. 1-year warranty. NSF and CE approved. Model GRID-16 shown. Model Description GRID-16 16" Electric Griddle GRID-24 24" Electric Griddle GRID-30 30" Electric Griddle


&RRNLQJ(TXLSPHQW_

$ $*ULGGOH7RSVDQG%URLOHUV *ULGGOHWRSV EXUQHUDQGEXUQHU DUHPDGHRIKHDY\JDXJH     VWHHO DQG LQFOXGH D UHPRYDEOH VWDLQOHVV VWHHO JUHDVH GUDZHU DQG VSHFLDOO\ GHVLJQHG UHDU IOXH $GGRQ JULGGOH WRSV LQFOXGHKHDWUHVLVWDQWKDQGOHV7KHDGGRQEURLOHU EXUQHU LV PDGH RI JDXJH VWHHO ZLWK D JULG FRQVWUXFWHG RI  VWHHO URGV,QFOXGHVDUHPRYDEOHVWDLQOHVVVWHHOJUHDVHGUDZHU1RW IRUXVHRQHOHFWULFHTXLSPHQW 0RGHO'HVFULSWLRQ  *ULGGOH3RUWDEOH %XUQHU

 *ULGGOH3RUWDEOH %XUQHU

 *ULGGOH$GG2Q %XUQHU

 *ULGGOH$GG2Q %XUQHU

 %URLOHU$GG2Q %XUQHU

%5DSLG5HFRYHU\*ULGGOHV 7KH 55*55( VHULHV RIIHUV RSHUDWRUV D KHDY\GXW\JULGGOHVROXWLRQWKDWGHOLYHUVKLJK HIILFLHQF\ KLJK SURGXFWLRQ FDSDELOLW\ DQG ODERU VDYLQJV 7KH SURSULHWDU\ FRPSRVLWH JULGGOH SODWH KDV WKH IDVWHVW KHDW WUDQVIHU FKDUDFWHULVWLFV RI DQ\ JULGGOH GHVLJQ LQ LWV FODVV 3URYLGHV WKH RSHUDWRU ZLWK WUXH ³FRUQHUWRFRUQHU´WHPSHUDWXUH XQLIRUPLW\ DOORZLQJ RSHUDWRU WR XVH HYHU\ VTXDUH LQFK % IRU SURGXFWLRQ 6WDLQOHVV VWHHO FRRNLQJ 0RGHO'HVFULSWLRQ VXUIDFHLVHDV\WRFOHDQDQG GRHVQ¶W UHTXLUH WKH XVH RI 55* *DV%78 FDXVWLF FOHDQHUV JULGGOH 55* *DV%78(QHUJ\6WDUŠ EULFNV RU VSHFLDO WRROV 55* *DV%78(QHUJ\6WDUŠ 0RGHO55('VKRZQ 55* *DV%78(QHUJ\6WDUŠ 55(' (OHFWULFN: 55(' (OHFWULFN:(QHUJ\6WDUŠ 55(' (OHFWULFN:(QHUJ\6WDUŠ

'

& &8OWUD0D[+HDY\'XW\&RRNLQJ(TXLSPHQW 8/75$0$; 32:(5 'HVLJQHG IRU WKH PRVW GHPDQGLQJ IRRGVHUYLFH DSSOLFDWLRQV $OO 8OWUD0D[ HTXLSPHQW IHDWXUHV ZHOGHG VWHHO IUDPH FRQVWUXFWLRQ ZLWK KHDY\GXW\ VWDLQOHVV VWHHO IURQW DQG VLGH SDQHOV \HDUSDUWVDQGODERUZDUUDQW\ Charbroilers—$YDLODEOH LQ  VL]HV UDGLDQW RU ODYD URFN DQG  %78EXUQHUVHYHU\ Griddles—$YDLODEOH LQ  VL]HV  JULGGOH VXUIDFHV  WHPSHUDWXUH FRQWUROV\VWHPVDQG%78HYHU\ Step-Up Hot Plates—$YDLODEOHLQVL]HV 0RGHO'HVFULSWLRQ 0$ *ULGGOH 0DQXDO

76$ *ULGGOH 6QDS$FWLRQ7KHUPRVWDWLF

&%$ &KDUEURLOHU /DYD5RFN

5&%$ &KDUEURLOHU 5DGLDQW

+$ +RW3ODWH%XUQHU Additional models available.

(6HULHV3L]]D 'HFN2YHQV )XOO\ ZHOGHG DQJOH LURQ IUDPH RYHQV KDYH D IXOO ZLGWK GXDO VSULQJ FRXQWHU EDODQFHG DQG VWDLQOHVV VWHHO EDNLQJ GRRU 2YHQ FRPSDUWPHQW LQWHULRU KDV DQ DOXPLQL]HG VWHHO EDNLQJ FRPSDUWPHQWOLQHUDQGXOWUDURNLWH ( VWRQH GHFN )HDWXUHV  IUHHIORDWLQJ HDVLO\ UHPRYDEOH GXSOH[WXEH EXUQHUV  %78¶V SHU VHFWLRQ WHPSHUDWXUH FRQWURO UDQJH RI ƒ) WR ƒ) DQG VWDLQOHVV VWHHO IURQW VLGHV DQG WRS 7KH + EDNLQJFRPSDUWPHQWKROGV  SL]]DVDQG  SL]]DV\HDU SDUWV DQG \HDU ODERU ZDUUDQW\ \HDU OLPLWHG GRRU ZDUUDQW\ 86 DQG&DQDGD 0RGHO6LQJOHVKRZQ

'6HULHV&KDUEURLOHUV &RPSXWHU GHVLJQHG KHDWLQJ SDWWHUQ IRU HGJHWRHGJH HYHQ FRRNLQJ 3DWHQWHG(=WLOWWRSJULGGUDLQVRIJUHDVHWRUHGXFHIODUHXS6WDQGDUG IHDWXUHV LQFOXGH VWDLQOHVV VWHHO FRQVWUXFWLRQ IXOO\ LQVXODWHG FDELQHW URXQG URG VWHHO WRS JULG ZDWHU WXEV  IURQW VKHOI ZLWK WRZHO EDU VFUDSHU DQG  %78 SHU EXUQHU $30 DQG &0 PRGHOV FDQ EH XVHG RQ VWDQG FRXQWHURUUHIULJHUDWHGEDVH)0PRGHOFDQEHRUGHUHGZLWKOHJVRURSWLRQDO FDVWHUV 16) $*$ DQG &( DSSURYHG &RXQWHUWRS PRGHO VKRZQ ZLWK RSWLRQDOEDFNVKHOIORZHUUDFNVKHOIFXWRXWFXWWLQJERDUGDQGIDMLWDUDFN 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ Floor Models Counter Models )050% 5DGLDQW &050% 5DGLDQW )050% 5DGLDQW &050% 5DGLDQW )050% 5DGLDQW &050% 5DGLDQW )050% 5DGLDQW &050% 5DGLDQW Additional models available. )6HULHV%DNH 5RDVW 'HFN2YHQ 7KHYHUVDWLOHVHULHVJDVRYHQV FDQEHVWDFNHGLQDQ\FRPELQDWLRQ DQG FRPH LQ IRXU EDVLF VHFWLRQV 6HSDUDWH KHDW FRQWUROV IRU HDFK VHFWLRQ SHUPLW FRRNLQJ DQG EDNLQJ DW GLIIHUHQW WHPSHUDWXUHV DW WKH VDPH WLPH LQ RQH RYHQ )HDWXUHV LQFOXGH VWDLQOHVV VWHHO IURQW WRS VLGHV DQG EDFN D :[' EDNLQJ FRPSDUWPHQW FRXQWHU EDODQFHG GRRUV KHDY\ FKURPH SODWHG WXEXODU VWHHO GRRU KDQGOH ) DQJOH LURQ IUDPH DOXPLQL]HG VWHHO FRPEXVWLRQ  FKDPEHU DQG EDNLQJ FRPSDUWPHQWPHFKDQLFDOWKHUPRVWDWDQGVWHHOGHFN&DQEHXSJUDGHGWRD SL]]DRYHQ 3 E\DGGLQJVWRQHGHFNHWFIRUDQXSFKDUJH 0RGHO'HVFULSWLRQ 6LQJOH 'HFN2YHQ+%DNLQJ&RPSDUWPHQW 6LQJOH 'HFN2YHQ+%DNLQJ&RPSDUWPHQW 6LQJOH 'HFN2YHQ+%DNLQJ&RPSDUWPHQW 6LQJOH 'HFN2YHQ  +%DNLQJ&RPSDUWPHQW 36LQJOH 3L]]D2YHQ+%DNLQJ&RPSDUWPHQW +ROGV  3L]]DV  3L]]DV


Cooking Equipment | 51 B. Low Temperature Cook & Hold Ovens. Gently recirculated heated air moves uniformly and consistently around food product. Optional Touch-Matic control lets you cook, roast, bake, rethermalize and hold a wide variety of menu items with the same consistent results every time. Cook by time or use the meat probe to monitor internal cooking temperature and automatically switch the oven from cook to hold mode at the pre-selected temperature. All stainless steel construction. Set of four 5" casters. Choose from Institutional or Restaurant Series. Model VCH16 shown.

A. FPR Series Rotating Pizza Oven. Doyon’s FPR series oven is the most advanced “Jet Air” compact oven, with rotating shelves, known for their 100% uniform baking and a display oven that no one can match. Bake directly on the rotating nickel plated perforated shelves in 25% to 45% less time than traditional deck ovens. No cold spots. Save from 35% to 65% in energy costs versus deck ovens. Model FPR3 shown with optional stand.

A B

Cooking the perfect pizzas

Model VCH16 VCH8 VCH88 VRH8 VRH88

C C. Y-Series Deck Ovens. Designed for high-volume pizza and all-purpose operations. Features hearth decks and unique micro-slide top and bottom heat controls. Gas powered at 120,000 BTU per oven and may be stacked two high. Stainless steel exterior. DSP models are designed for display kitchens, decorated with brick, tile or stone finishes. New brick lined ovens feature a completely hearth stone brick-lined ceiling and deliver quick bake times, faster recovery, increased production and energy savings! Model Y-602 shown with optional casters. Model Description Y-600 Single, 6 Lg. Pizzas-120,000 BTUH Y-602 Double, 12 Lg. Pizzas-240,000 BTUH Y-602-DSP Double, Built-In Display Ovens-240,000 BTUH Additional models available.

E

E. Rotating Rack Oven. Mini-rotating rack oven does the work of a full-size model at half the size. Standard features include a continuously rotating 8-pan rack and unique airflow system. Internal steam production for bagels or similar products. In-shot burner technology provides energy efficiency with low maintenance. Rack and slides can be removed without tools for servicing and easy dishwasher cleaning. Digital programmable controls. The 12-pan stand provides storage for baking pans and supplies. Model XR8-G shown with optional stand and casters.

D

Description Institutional Series, Holds (16) 18"x26" or (32) 12"x20" pans Institutional Series, Holds (8) 18"x26" or (16) 12"x20" pans Institutional Series, Holds (16) 18"x26" or (32) 12"x20" pans, 2 Sections Restaurant Series, Holds (8) 18"x26" or (16) 12"x20" pans Restaurant Series, Holds (16) 18"x26" or (32) 12"x20" pans, 2 Sections

D. Ovens & Oven Proofers. Compact oven gives high quality hearth bake in minimum space. Natural convection and radiant heat design does not dry out product. Each deck individually thermostatically controlled. Stainless steel construction easily cleaned and maintained. Positive magnetic door closure. Bake right on the deck or use full or half size sheet pans. Model Description OP-4H 4 Half Pan Oven, 8 Half Pan Proofer OP-3 3 Pan Oven, 9 Pan Proofer OP-3SL 3 Pan Oven, 9 Pan Proofer Slim DO-PBG 6 Pan Oven, 16 Pan Proofer DO-PB-9G 9 Pan Oven, 24 Pan Proofer Additional models available.

F. Pizza Ovens. Stackable, stainless steel pizza ovens— perfect for use in kitchens with limited space. Ideal for pizzas, breads and various bakery products. Each oven has 2 removable ceramic hearth baking shelves with a 31/4" deck height. With a thermostat range of 284°F to 680°F, they also have a 15-minute continuous timer and a 6 foot power cord. CE. Model Description PO-18 23"W x 25"D x 21"H. 240V, 2850W, 12 Amps PO-22 26"W x 28"D x 21"H. 240V, 3600W, 15 Amps

F


&RRNLQJ(TXLSPHQW_

% $ $6HULHV,PSLQJHU,,([SUHVV 7KHPRVWYHUVDWLOH&RQYH\RU3L]]D2YHQRQWKHPDUNHW 6WDQGDUGIHDWXUHV ‡ $GYDQFHG$LU,PSLQJHPHQWWHFKQRORJ\HQKDQFHVEDNHTXDOLW\DQG XQLIRUPLW\²IDVWHUEDNHWLPHVLPSURYHWLPHRIVHUYLFH ‡ )URQWORDGLQJUHPRYDEOHFRQYH\RUIRULPSURYHGFOHDQLQJLQWLJKWVSDFHV ‡ :[/FRQYH\RUEHOWZLWKSURGXFWVWRSEDNLQJFKDPEHU ‡ $GMXVWDEOHWHPSHUDWXUHUDQJHWRƒ) ‡ $GMXVWDEOHFRQYH\RUVSHHGIURPWRPLQXWHVFRRNLQJWLPH ‡ 6WDFNDEOHXSWRWKUHHKLJK $YDLODEOHZLWKRSWLRQDO)DVW%DNHŒWHFKQRORJ\ 0RGHO'HVFULSWLRQ 8 1DWXUDO*DV86$*$&*$9 $PS3K+] 8 /3*DV86$*$&*$9 $PS3K+] 8 (OHFWULF8/&6$9$PS 3K+]NZ 8 (OHFWULF8/&6$ Additional models available.

%8OWUD0D[Š *DV (OHFWULF&RQYH\RU2YHQV 'HVLJQHG IRU KLJKYROXPH IRRGVHUYLFH RSHUDWLRQV ZLWK OLPLWHG VSDFH 2YHQV XVH KRW DLU XQGHU SUHVVXUH GHOLYHULQJ XQPDWFKHGSHUIRUPDQFHDQGVSHHG$LULPSLQJHPHQWVHDOVLQ PRLVWXUH DQG IODYRU SURYLGLQJ VXSHULRU IRRG TXDOLW\  FRQYH\RU EHOW  EDNLQJ FKDPEHU DQG  SURGXFW RSHQLQJ DFFRPPRGDWH D YDULHW\ RI SURGXFWV IURP  SL]]DV WR VXE VDQGZLFKHV6WDLQOHVVVWHHOFRQYH\RUEHOWVDYDLODEOHLQRU OHQJWKV 0RGHO'HVFULSWLRQ 80 *DV:[/%HOW%78KU 80$ (OHFWULF:[/%HOW 80$ (OHFWULF:[/%HOW (680 (TXLSPHQW6WDQG

'

& &6HULHV 'LJLWDO

&RXQWHUWRS,PSLQJHUŠ &RQYH\RU2YHQV 1RZ8/%DSSURYHGIRUYHQWOHVVRSHUDWLRQ6PDOOHQRXJKWRILWRQPRVW FRXQWHUWRSVEXWODUJHHQRXJKWRUHSODFHDKDOIVL]HFRQYHFWLRQRYHQRUXS WR  PLFURZDYH RYHQV 0HQX IOH[LELOLW\ LV HQKDQFHG GXH WR LPSURYHG DGMXVWDEOH FRQYH\RU VSHHG WKDW UDQJHV IURP  VHFRQGV WR  PLQXWHV DQG ZLGHU WHPSHUDWXUH UDQJH RI ƒ) WR ƒ) 2SWLRQDO )DVW%DNHŒ WHFKQRORJ\DQGTXLHWVORZHUEDNHPRGHOVDYDLODEOH /LQFROQ¶V QHZ PRGHO DGGV D FDWDO\WLF FRQYHUWHU IRU YHQWOHVV DSSOLFDWLRQV VDYLQJ PRQH\ DQG WLPH GXULQJ LQVWDOODWLRQ %HFDXVH QR YHQWLQJ KRRG LV UHTXLUHG RSHUDWRUV KDYH PRUH IOH[LELOLW\ DV WR ZKHUH WKH RYHQ FDQ EH LQVWDOOHG/RFDOFRGHVGRSUHYDLO 0RGHO'HVFULSWLRQ  &RQYH\RU9  &RQYH\RU94XLHW6ORZ%DNH0RWRU  &RQYH\RU9  &RQYH\RU94XLHW6ORZ%DNH0RWRU  1RQ6WLFN&RQYH\RU9 Ventless Models 9 &RQYH\RU9 9 &RQYH\RU94XLHW6ORZ%DNH0RWRU 9 &RQYH\RU9 9 &RQYH\RU94XLHW6ORZ%DNH0RWRU Additional models available.

'6HULHV $QDORJ

&RXQWHUWRS,PSLQJHUŠ &RQYH\RU2YHQV 7KH/LQFROQDQDORJ&7,OLNHWKHGLJLWDOPRGHOLVDVHOIFRQWDLQHG FRQYH\RU HOHFWULF ,PSLQJHUŠ RYHQ WKDW LV VWDFNDEOH XS WR  KLJK DQG GHVLJQHG IRU FRXQWHUWRS XVH 7KH DQDORJ RYHQ FRQWUROV DUH ORFDWHGRQWKHIURQWRIWKHRYHQDQGLQFOXGHDSRZHURQRIIVZLWFK WHPSHUDWXUH FRQWURO DQG FRQYH\RU VSHHG FRQWURO $ KHDWLQJ LQGLFDWRUOLJKWLOOXPLQDWHVOHWWLQJWKHRSHUDWRUNQRZZKHQWKHRYHQ LV FDOOLQJ IRU KHDW 7HPSHUDWXUH LV DGMXVWDEOH IURP ƒ) WR ƒ)&RQYH\RUVSHHGDGMXVWVIURPPLQXWHVFRRNLQJWLPH 0RGHO'HVFULSWLRQ  &RQYH\RU9  &RQYH\RU9  &RQYH\RU94XLHW6ORZ%DNH0RWRU  &RQYH\RU94XLHW6ORZ%DNH0RWRU  &RQYH\RU9  &RQYH\RU9  &RQYH\RU94XLHW6ORZ%DNH0RWRU  &RQYH\RU94XLHW6ORZ%DNH0RWRU  1RQ6WLFN&RQYH\RU9 Additional models available.


&RRNLQJ(TXLSPHQW_

(GCVWTGF%JGH &KHI6KROHP3RWDVK 2ZQHURI&XOLQDU\'HSRW 0RQVH\1<

$

3RW5RDVW

$6HULHV,PSLQJHUŠ &RQYH\RU2YHQV 8VLQJ WKH ODWHVW DGYDQFHPHQWV LQ DLU LPSLQJHPHQW WHFKQRORJ\ ,PSLQJHUŠ FRQYH\RURYHQVDOORZIRUUDSLGKHDWLQJFRRNLQJEDNLQJ DQGFULVSLQJRIIRRGV,PSLQJHUDQGIHDWXUHVLQFOXGH ‡ DQGVL]HEDNLQJFKDPEHUV ‡ )DVW%DNHŒWHFKQRORJ\ ‡ )URQWFRQWUROSDQHOLVHDV\WRUHDGDQGDFFHVV ‡ $GMXVWDEOHGLJLWDOFRRNWLPHDQGWHPSHUDWXUHFRQWUROV ‡ (DV\DFFHVVUHPRYDEOHODUJHIURQWSDQHO ‡ 6ROLGVDQGZLFKGRRU ‡ 6WDFNDEOHXSWRKLJK ‡ 1DWXUDORU/3JDV 0RGHO'HVFULSWLRQ  6LQJOH%78 ' 'RXEOH%78 7 7ULSOH%78  6LQJOH%78 ' 'RXEOH%%78 7 7ULSOH%78

6 lb. roast, preferable shoulder or chuck 2 large onions, sliced 2 large carrots, sliced 4 stalks celery, sliced 1 red pepper, cored and sliced in half 1 parsnip 4 cloves garlic 2 tomatoes, quartered ½ cup ketchup ½ cup sweet red wine ¼ cup soy sauce 5 bay leaves 1 Tbsp. kosher salt 3 Tbsp. granulated garlic 3 Tbsp. paprika 3 cups water 3UHKHDW RYHQ WR ƒ) /LQH ERWWRP RI SDQ ZLWK YHJHWDEOHV DQG SODFH URDVW RQ WRS 0L[ UHPDLQLQJ LQJUHGLHQWV H[FHSW ZDWHU DQG UXE RQWR URDVW $GG ZDWHU WR SDQ %DNH FRYHUHG IRU  KRXUV 7XUQ RYHU DQG EDNH DQ DGGLWLRQDO PLQXWHVXQFRYHUHG

% %6HULHV,PSLQJHUŠ,&RQYH\RU2YHQV 7KH,PSLQJHUŠ,RYHQFDQEHVWDFNHGKLJKIRUPD[LPXPFRRNLQJFDSDFLW\ :LWKD:UHYHUVLEOHFRQYH\RUEHOWDQGEDNLQJFKDPEHUHDFKRYHQ FDQUHSODFHXSWRIXOOVL]HGHFNRYHQV6WDQGDUGIHDWXUHV ‡ &XVWRPHUVSHFLILFILQJHUVHWXSVIRUPHQXIOH[LELOLW\ ‡ $GMXVWDEOHWHPSHUDWXUHIURPƒ)WRƒ) ‡ $GMXVWDEOHFRQYH\RUVSHHGIURPPLQXWHFRRNLQJWLPH ‡ 'LJLWDOFRQWUROSDQHO ‡ )URQWORDGLQJJODVVDFFHVVGRRUZLWKFRROWRWKHWRXFKKDQGOH ‡ 5HPRYDEOHIURQWILQJHUVDQGVLGHEHOWIRUHDV\FOHDQLQJ ‡ 1DWXUDO/3RU(OHFWULF Easy Order Package and FastBake™ technology also available. 0RGHO'HVFULSWLRQ 8 1DWXUDO%78 8 /3%78 8 (OHFWULFN:9 8 (OHFWULFN:9  (DV\2UGHU3FNJ  2YHQZ5DGLDQW)LQJHU6HWXS 7DNH2II6KHOI 6WDQG  (DV\2UGHU3FNJ  2YHQVZ5DGLDQW)LQJHU6HWXS 7DNH2II6KHOI 6WDQG )% (DV\2UGHU3FNJ  )DVW%DNHŒ2YHQZ5DGLDQW)LQJHU 6HWXS7DNH2II6KHOI 6WDQG )% (DV\2UGHU3FNJ  )DVW%DNHŒ2YHQVZ5DGLDQW)LQJHU 6HWXS7DNH2II6KHOI 6WDQG

&

&6HULHV,PSLQJHUŠ /RZ3URILOHŒ&RQYH\RU2YHQV 7KH ,PSLQJHUŠ /RZ 3URILOH SXWV WKH FDSDFLW\ RI WKH ,PSLQJHUŠ, LQ D VKRUWHU IUDPH WKDW FDQ EH VWDFNHG  KLJK ,QGLYLGXDOO\ HDFK RYHQ ERDVWV D : FRQYH\RU EHOW DQG  EDNLQJ FKDPEHU IRU KLJKFDSDFLW\ QHHGV 7ULSOHVWDFNHG LW SXWV LQFUHGLEOH EDNLQJ FDSDFLW\DQGIOH[LELOLW\LQDPRGHVWDPRXQWRIVSDFH1DWXUDO/3RU (OHFWULF PRGHOV DYDLODEOH Easy Order Package and FastBake™ technology also available. 0RGHO'HVFULSWLRQ 8 1DWXUDO*DV%78 8 /3%78 8 (OHFWULFN:9 8 (OHFWULFN:9 8 (OHFWULFN:9  (DV\2UGHU3FNJ  2YHQZ5DGLDQW)LQJHU6HWXS 7DNH2II6KHOI 6WDQG  (DV\2UGHU3FNJ  2YHQVZ5DGLDQW)LQJHU6HWXS 7DNH2II6KHOI 6WDQG  (DV\2UGHU3FNJ  2YHQVZ5DGLDQW)LQJHU6HWXS 7DNH2II6KHOI 6WDQG Additional models available.


Cooking Equipment | 54

A. Roller Grills. Cook hot dogs, brats and sausages! Two convenient, easy-to-use sizes. 11 chrome A plated rollers. Stainless steel construction. Energy regulator control for front and back rollers. Individual heating element within each roller. Individual 360º roller rotation. Removable, easy-to-clean, stainless steel catch tray. Non-slip rubber feet. 4-foot power cord. Optional sneeze guard cover available. Model RG30 shown. Description Model Holds 30 Hot Dogs RG30 Holds 50 Hot Dogs RG50

B B. Mini JetStar™ 4 oz. Popcorn Popper. The Mini JetStar™ can be placed in small kiosks, coffee shops, small business lobbies, break areas, rental facilities and other small foodservice operations. The 4 ounce popper is perfect for your home theater, office, recreation room, kitchen or whereever you might want to pop and dispense popcorn. 157/8"Wx147/8"Dx233/4"H. Model J4R

C C. Hot Dog Steamer, Bun Warmer & Roller Grills with Covers. Constructed of stainless steel, this hot dog steamer will steam your dogs to perfection! The HDS-1000W features all day steaming with a 6 quart capacity water pan and adjustable thermostat. Convenient humidity control system in bun compartment keeps buns fresh while your hot dogs steam. Tempered glass on both sides provides excellent merchandising. The BW-450 unit provides gentle warming heat for up to 32 buns and includes a removable stainless steel pan and bun rack for your convenience. Model HDS-1000W BW-450

Description Steams 100 Hot Dogs, Holds 36-48 Buns Bun Warmer, 32 Buns

D D. Butane Products. Engage. Excite. Entice. The Culinary Jet brings cooking out of the kitchen and offers you a world of dynamic, new opportunities for meeting guest dining desires and giving you a proprietary edge. Add the perfect finishing tool to your culinary collection with the Culinary Torch. It works wonders on crème brûlèes and is great for crisping, browning, melting, caramelizing and creating beautiful ice sculptures! Model Description 50114 Butane Culinary Torch 50110 Culinary Jet

E E. Grill-Max® Electronic Roller Grills. Patent-pending electronically controlled roller grills provide the latest technology for heating and holding hot dogs and other specialty products designed for roller grills. Electronic controls significantly improve multi-zone temperature control throughout entire grill surface. This technology breakthrough significantly improves food safety and minimizes product waste as a result of accurate temperature control. LED display provides temperature reading for both the cook and hold cycles. Model Description Chrome Models 30CE 30 Hot Dog Cap., 233/4"Wx205/8"Dx121/2"H 50CE 50 Hot Dog Cap., 353/4"Wx205/8"Dx121/2"H 75CE 75 Hot Dog Cap., 353/4"Wx281/2"Dx151/2"H Duratec Models 30SCE 30 Hot Dog Cap., 233/4"Wx205/8"Dx121/2"H 50SCE 50 Hot Dog Cap., 353/4"Wx205/8"Dx121/2"H 75SCE 75 Hot Dog Cap., 353/4"Wx281/2"Dx151/2"H Additional models available.

F F. Butane Stoves. Perfect for any location where you need an “on-site” cooking station. Foodservice professionals can’t beat the selection of butane equipment and fuel options from SternoCandleLamp. Commercial quality portable butane stove features 7,000, 9,000, 15,000 BTU, solid brass burner, auto piezo ignition switch and boil-to- simmer heat range. Carrying case included. Long reach lighters provide the safe way to light candles, chafing fuels and other professional equipment. Model Description 50104 7K BTU Butane Stove (Stainless) 50106 9K BTU Butane Stove (Black) 50108 15K BTU Butane Stove w/Wind Guard (Black) 50100 Butane Fuel, 8 oz. 50112 Butane Lighter


&RRNLQJ(TXLSPHQW_ $&UHDWLRQ([SUHVVŒ0RELOH&RRNLQJ&DUW $WWUDFWLYH DQG FRPSDFW ZLWK D GHVLJQHU IODLU )HDWXUHV  EXLOWLQ LQGXFWLRQ VWRYHV IRU HQHUJ\ HIILFLHQW FRRNLQJ $YDLODEOH ZLWK VWDJH FRRNLQJ H[KDXVW ILOWUDWLRQ V\VWHP 6WDLQOHVV VWHHO FDELQHW DQG WRS VXUIDFH DUH HDV\ WR FOHDQ DQG VDQLWL]H ([WHULRU LV ODPLQDWH RYHU VWDLQOHVV VWHHO LQ D FKRLFH RI VWDQGDUG RU FXVWRP ILQLVKHV ,QGXFWLRQ VWRYHV DUH 9$& ZLWK  :DWW RXWSXW 3RZHU PDQDJHPHQW V\VWHP VWDQGDUG UHTXLUHV9$&DPSSRZHUVXSSO\ 0RGHO'HVFULSWLRQ  )LOWUDWLRQ,QFOXGHG/[:[+VWRYHILOWHU  )LOWUDWLRQ,QFOXGHG/[:[+VWRYHVILOWHU  )LOWUDWLRQ,QFOXGHG/[:[+VWRYHVILOWHUV  /[:[+VWRYH  /[:[+VWRYHV  /[:[+VWRYHV

$

Planning Food Portions for Events

% %0DJL&DWHU7UDQVSRUWDEOH*ULOOV ,GHDO IRU IRRGVHUYLFH RSHUDWLRQV ZLWK RXWGRRU GLQLQJ 0RGXODU GHVLJQ PDNHV VHW XSWDNH GRZQ VLPSOH 6WDLQOHVV VWHHO IURQW VLGH EDFN VHUYLFH VKHOI UDGLDQWV DQG SLORW V\VWHP 6WDLQOHVV VWHHO ZDWHUWXEV SUHYHQW JUHDVH ILUHV DQG SURPRWH HDV\ FOHDQLQJ +HDY\GXW\ WRS JULG V  VWDLQOHVV VWHHO OHJV ZLWK KHDY\ GXW\ FDVWHUV QHZ VSDUN LJQLWHU V\VWHP $YDLODEOH LQ  DQG  PRGHOV 0RGHO /3$*$66 VKRZQ ZLWK RSWLRQDO VWHDP SDQ VHW  VWHDP VXSSRUW DQG  VWDLQOHVVKRRG 0RGHO'HVFULSWLRQ /3$*$ *ULOO $*$&*$$SSURYHG

/3*66 66 1DWXUDO*DV

/3$*$66  OE7DQN&DUW  $*$&*$$SSURYHG

 6WHDP3DQ6XSSRUW & 6WHDP6HW QHHGHGIRUVWHDPVXSSRUW

66+RRG +RRG IRU/3*/3*/3$*$ 1HHGIRUXQLWV

66+RRG +RRG IRU/3*/3$*$

 2XWGRRU9LQ\O&RYHU $GGLWLRQDOPRGHOVDYDLODEOH

Appetizers (YHQLQJIXQFWLRQZLWKQRGLQQHUVHUYHG SLHFHVSHUVRQ7KHVHVKRXOGEHKHDUW\DSSHWL]HUV %HIRUH'LQQHU SLHFHVSHUVRQ %HIRUH/XQFK SLHFHVSHUVRQ7KHVHFDQEHOLJKWHU YHJJLHVRUFKHHVH  Beverages EHYHUDJHVSHUVRQ )RUOXQFKDQGGLQQHUVHUYHVRGDEHHUZLQHPL[HGGULQNVWHDRU OHPRQZDWHU  &RIIHH³FXSRIFRIIHHHYHU\ KRXUVSHUSHUVRQ Lunch (DFKSHUVRQVKRXOGJHWDPDLQHQWUHH R]  VLGHV R]HDFK EUHDGRUDVWDUFKDQGGHVVHUW Dinner 6HUYHZDWHUZLWKDOHPRQVOLFHDORQJZLWKDQ\RWKHUEHYHUDJH R]HQWUHHGLVKVLGHV R]HDFK EUHDGDQGVRXSRUVDODG Dessert SLHFHSHUSHUVRQ Beverage Guide &RIIHHSRXQG  FXSVHUYLQJV 3XQFKJDOORQ  RXQFHVHUYLQJV 6RGDOLWHU   RXQFHJODVVHV  RXQFHJODVVHV

&

&9HQWOHVV)U\HUV*ULGGOHV &RRNWRSV *2 9(17/(66²7KH LPSRVVLEOH LV SRVVLEOH ZLWK:HOOV9HQWOHVVKRRGV7KHVHDSSOLDQFHV XVH DQ H[KDXVW KRRG WKDW LV QRW GLUHFWO\ FRQQHFWHG WR WKH RXWVLGH 6HOIFRQWDLQHG YHQWLODWLRQ V\VWHP LQFOXGHV DQ LQWHJUDO ILUH VXSSUHVVLRQ V\VWHP WKDW VROYHV FKDOOHQJLQJ WUDGLWLRQDO YHQWLODWLRQ SUREOHPV KLJK ULVHV KLVWRULFDO ORFDWLRQV VSRUWV YHQXHV HWF  6HOHFWLRQV LQFOXGH EDVH PRGHOV ZLWK FRQYHFWLRQ RYHQ GUDZHU ZDUPHUV RU FDELQHWV &RRNWRS ZLWK IU\HUV JULGGOHV KRW SODWHV RU FRPELQDWLRQV WR PHHW \RXU QHHGV &KRRVH IURP  PRGHOV 0RGHO:92+)*VKRZQ

0RGHO'HVFULSWLRQ :98 8QLYHUVDO9HQWOHVV+RRG9 :9+)* &RQYHFWLRQ2YHQ%DVHZ*ULGGOH)UHQFK3ODWH&RRNWRS 93KDVH :9+) &RQYHFWLRQ2YHQ%DVHZ)UHQFK3ODWH&RRNWRS93K :9)*5: 'XDO'UDZHU:DUPHU%DVHZ)U\HU*ULGGOH&RPER8QLW9 :9*5: 'XDO'UDZHU:DUPHU%DVH+RRGHGZ*ULGGOH9 :93() :DUPHU%DVHZOE(OHFWULF)U\HUZ7LPHU9 $GGLWLRQDOPRGHOVDYDLODEOH


Cooking Equipment | 56 A. MJ Performance Gas Fryers. Master Jet Series fryers are world-recognized masters of open-pot frying. They are unsurpassed in their versatility, proven worldwide performance and low maintenance needs. Whether it’s a single fryer, a fryer with built-in filtration or a battery of fryers with a filtration system, Master Jet fryers achieve a long and dependable life through simplicity of design. Model offerings provide 40, 50 and 80 lb. oil capacity options, with and without electrical hook-up. The Master Jet series is unmatched in the industry. NSF, CSA. Model Description MJ35E-SD* 40 lb. Cap., 12"Wx15"Dx41/4"H Fry Area, Stainless Steel Frypot/Door, Enamel Cabinet, 110,000 BTU MJ45E-SD* 50 lb. Cap., 14"Wx15"Dx5"H Fry Area, Stainless Steel Frypot/Door/Cabinet, Melt Cycle, 122,000 BTU MJCFE-SD* 80 lb. Cap., 18"Wx19"Dx41/2"H Fry Area (for chicken & fish) Stainless Steel Frypot/Door, Enamel Cabinet, 150,000 BTU Additional models available. *Includes thermostatic controller, rack-type basket support, basket hanger, flue deflector, twin baskets, signal lights, on/off switch, reliable centerline fast-action temperature probe and 6" adjustable legs.

A C. Portable Oil Filters. Frymaster portable filtration units are designed to support routine oil filtration, which preserves oil life and maintains consistent fried food quality. Powerful steel gear pump with 1/3 HP motor filters 50 lbs. of oil in 5 minutes. The 5 ft. hose returns filtered oil with ease amply reaching the frypot to wash crumbs from the walls and the bottom of the frypot. Durable stainless steel pan and pump housing is made to stand up to heavy use and make the filter easy to clean. Model Description PF50S 50 lb. cap., Std. Gravity Drain PF50R 50 lb. cap., Reversible Pump MF90OU/80LP 80 lb. cap., Low Profile, Gravity Drain

C

D

D. FootPrint® & FootPrint PRO® Filtration Systems. Designed to support good oil station management and maximize oil life, Frymaster’s renowned, built-in filtration puts filtration where it’s most convenient to use - right within the fryer - eliminating the need for additional floor and storage space. The filtering process is fast and easy, encouraging frequent filtering. The filter, housed beneath 2 fryers or 1 fryer and spreader, is capable of filtering up to 6 fryers individually, without having to be moved from fryer to fryer saving valuable labor. Model Description FPP235SD (2) MJ35 Performance Gas Frypots, 40 lb. cap., 12"Wx15"Dx41/4"H Frying Area FPP245ECSD (2) MJ45 Performance Gas Frypots, 50 lb. cap., 14"Wx15"Dx5"H Frying Area FPPH255CSD (2) H55 High Efficiency Gas Frypots, 50 lb. cap., 14"Wx15"Dx41/2" H Frying Area FPPH355CSD (3) H55 High Efficiency Gas Frypots, 50 lb. cap.,14"Wx15"Dx41/2"H Frying Area Additional models available. E. OCF Fryers. OCF30 Fryers provide outstanding results with 40% less oil, 10% less energy. Frymaster’s OCF30 open-pot, oil-conserving fryers offer the next generation of cost savings and green benefits to the industry. They are made of stainless steel on the outside, but their hearts are green on the inside. They are healthier for the environment, customers, workers and the bottom line. Green benefits range from reduction of oil use to less energy consumption. Energy Star®, NSF, CSA. Model Description FPEL214-4CA* Electric, 30 lb. oil cap./Full Frypot, (2) Split Frypots, Frying Area: 6"Wx14"Dx33/4"H Split Frypot, 14 kw FPEL217CA* Electric, 30 lb. oil cap./Full Frypot, (2) full frypots, Frying Area: 13"Wx14"Dx33/4"H, 17 kw Additional models available.

E

*Includes 3000 controller, rack-type basket support, basket hanger, twin baskets, filter starter kit, auto top-off, built-in filtration, stainless steel frypot, door and cabinet sides and adjustable casters.

Provides Outstanding Results

B

B. MagiCater Outdoor Fryers. It’s not too soon to plan for the upcoming outdoor catering season. MagiCater’s new Outdoor Fryers come standard with a stainless steel cabinet and fry tank, 2 fry baskets per tank. 4 (MCF14) and 5 (MCF18) tubes per tank positioned for easy cleaning. High limit shut-off safely shuts off gas flow if fryer temperature exceeds high limit. Millivolt thermostat control adjusts from 200°F to 400°F. Ships fully assembled. CSA design certified, NSF. 1-year parts and labor warranty. Includes 14" easy roll wheels and swivel casters, 40 lb. LP tank. Model Description MCF14 40 lb. oil cap., 115k BTU MCF18 65 lb. oil cap., 150k BTU

F

F. High-Efficiency, Open-Pot, Gas Fryers. Frymaster’s H55 gas fryers set the standard for high-efficiency open-pot frying. The H55 fryer is a premium open-pot fryer that combines state-of-the-art technology with decades of frying experience and customer satisfaction to set the standard for high-efficiency frying. H55 fryers are the industry’s first green fryers meeting Energy Star® guidelines long before any guidelines were established. H55 fryers are the foundation of Frymaster’s ever-evolving conserving fryer technology. 14"Wx15"Dx41/2"H frying area, 80,000 BTU, Energy Star®, NSF, CSA. Model Description H55SD* 50 lb. oil cap. FPH55SD* 50 lb. oil cap. (w/Built-in filtration) *Includes analog controller, rack-type basket support, basket hanger, twin baskets, automatic melt cycle, boil-out temp control, electric ignition, center mounted RTD, 1° compensating temperature probe, stainless steel frypot and door, enamel cabinet, 6" adjustable legs.


Cooking Equipment | 57

Determining If Your Fryer Can Keep Up With Demand Fryer productivity is usually measured by pounds of product per hour. Generally, a fryer that will handle a minimum of 80 pounds of French fries per hour is sufficient. In smaller, less demanding, environments, a 65 lb. fryer may be sufficient.

Frying Oil Life

A

A. 1814 Gas Fryers. Designed to handle high production demands of a varied menu while conserving space, energy and oil. The 1814 gas fryer has a 63 lb. frypot oil capacity with an 18"x14" cooking area that can be combined in a two frypot battery or combined with an HD50G. The ability to cook three baskets of food in an 18"x14" cooking area maximizes floor space and uses less oil and less energy than standard 50 lb. fryers. Two 1814 fryers can do the work of three standard fryers and two 1814 fryers combined with an HD50 fryer allow three fryers to do the work of four standard fryers. The savings adds up quickly using 11-14% less space and 12-16% less oil while using upwards of 50% less energy. Energy Star®. Models 11814/HD50G/11814 shown. Model Description 11814 Single, High Production Gas Fryer 21814 Two Frypot, High Efficiency Gas Fryer Battery 11814/HD50G/11814 Tri Config. High Efficiency Gas Fryer Battery

B

The life of the frying oil can be indefinitely prolonged by filtering the fat twice every day (or at the end of every shift) and then adding 10% new oil, which is enough to rejuvenate the original oil. (If less than 10% of the oil was absorbed by the fried products, dip out enough to permit the addition of the 10% new oil. The oil removed can be used on the griddle or for other cooking needs.) For example, for a 35 lb. fryer, 31/2 lbs. of fresh oil must be added. With this method, high annual savings in fat costs can be realized.

Oil Filters If you fry breaded, watery or battered products in large quantities, you will need to filter more often. Remember to rinse well. Soap residue is the number one enemy of cooking fat as it accelerates cooking fat breakdown.

Oil Breakdown According to several master fry chefs, water is one of the major causes of rapid breakdown of cooking oil. Ideally, if a balance can be maintained between the frying of dry items (i.e. breaded products) and wet items (i.e. frozen French fries) the life of the cooking oil can be considerably extended. When this is not possible, and most or all of the fried items are wet, several slices of dried bread can be nested between the twin baskets periodically, and “fried” to absorb the water which has been added by the wet products.

B. Single and Double Deep Fryers. Cook up to 15 lbs. of food per hour per tank in Adcraft’s new deep fryers. Constructed of heavy duty stainless steel for durability, each tank comes with a heavy duty fryer basket. Temperature control switch adjusts from 120°F to 375°F. Each tank has a capacity of 6 liters and includes small handles for easy cleaning. The double fryer includes 2 cords so 1 fryer can be used at a time. 120V, 1750W per tank. CE and UL. Model Description DF-6L Single Tank Fryer DF-6L/2 Double Tank Fryer

C. High Efficiency Decathlon Gas Fryers. High efficiency gas tube-type fryers are designed for high-volume frying and maximum energy efficiency. Maximize your profits and make the most of your energy dollars with innovative design changes that have improved the efficiency of the HD fryers over 40%. The MVP’s of high-efficiency, tube-type frying, the HD gas fryers have low idle costs, offer low gas consumption per pound of food cooked and extend oil life. The 6" versus 4" diameter tubes provide 36% more surface area for heat transfer from the input energy to the oil. This minimizes the heat stress on the oil, preserving oil life. Energy Star®, NSF, CSA. Model Description HD50* 50 lb. cap., 14"Wx14"Dx33/4"H Fry Area, 100,000 BTU HD60* 80 lb. cap., 18"Wx18"Dx33/4"H Fry Area, 125,000 BTU HD63* 90 lb. cap., 18"Wx18"Dx45/8"H Fry Area, 125,000 BTU HD65* 100 lb. cap., 18"Wx18"Dx53/4"H Fry Area, 125,000 BTU CFHD60* 80 lb. cap., 18"Wx18"Dx33/4"H Fry Area, 125,000 BTU (w/Built-in filtration & casters) *Includes thermatron controller, rack-type basket support, basket hanger, twin baskets, automatic melt cycle, boil-out temperature control, stainless steel frypot, front, door & cabinet sides and 6" adjustable legs.

C


&RRNLQJ(TXLSPHQW_

$(=*ULSDQG(=*ULS3OXV)U\HU%DVNHWV 7KH (= *ULS Š KDQGOH LV YLQ\OFRDWHG DQG HUJRQRPLFDOO\ GHVLJQHG WR QDWXUDOO\ ILW WKH VKDSH RI D KDQG JULSSLQJ D IU\HU EDVNHW ,PSURYHG JULS PHDQV UHGXFHG VWUHVV RQ WKH KDQG ZULVW DQG IRUHDUP ,W DOVR JLYHV EHWWHU OHYHUDJH ZKHQ WXUQLQJWKHEDVNHWWRGXPSLWVFRQWHQWV(=*ULSŠ 3OXV  IU\HU EDVNHWV DOVR LQFOXGH SDWHQWHG FRUQHU SURWHFWLRQDQGGRXEOHKRRNFRQVWUXFWLRQWRH[WHQG WKHOLIHRIWKHEDVNHW \HDUZDUUDQW\ 0RGHO'HVFULSWLRQ E-Z Grip® Baskets  [[7HDO+DQGOH  [[7HDO+DQGOH  [[7HDO+DQGOH E-Z Grip® Plus* Baskets  [[7HDO+DQGOH  [[7HDO+DQGOH  [[7HDO+DQGOH Additional models available.

%

$

&.OHHQ6FUHHQ3OXVŠ )LOWUDWLRQ6\VWHP *5VHULHVJDVVWDLQOHVVVWHHO IU\HUV DUH WRS SHUIRUPHUV WKDW FDQ PDWFKWKHGHPDQGVRIDQ\VL]HRSHUDWLRQ7KH.OHHQVFUHHQ3OXVŠ )LOWUDWLRQ 6\VWHP VDYHV WLPH DQG H[WHQGV RLO OLIH  VWDLQOHVV VWHHO IU\ WDQN ZLWK WZLQ EDVNHWV  WKHUPDO HIILFLHQF\  IXOO SRUWGUDLQYDOYH RQOEPRGHOV  UHDUJDVFRQQHFWLRQ VLQJOH IU\HUV  RU  UHDU JDV FRQQHFWLRQ EDWWHULHV  $YDLODEOH ZLWK0LOOLYROW6ROLG6WDWHRU&RPSXWHUFRQWUROV(OHFWURQLFLJQLWLRQ VWDQGDUGRQ ' DQG & FRQWUROV 0RGHO'HVFULSWLRQ *50) )U\HU%DWWHU\Z.OHHQ6FUHHQ0LOOLYROW&RQWUROV OEVFDSSHUWDQN *50) )U\HU%DWWHU\Z.OHHQ6FUHHQ0LOOLYROW&RQWUROV OEVFDSSHUWDQN *50) )U\HU%DWWHU\Z.OHHQ6FUHHQ0LOOLYROW&RQWUROV OEVFDSSHUWDQN *50) )U\HU%DWWHU\Z.OHHQ6FUHHQ0LOOLYROW&RQWUROV OEVFDSSHUWDQN *50) )U\HU%DWWHU\Z.OHHQ6FUHHQ0LOOLYROW&RQWUROV OEVFDSSHUWDQN Additional models available.

%756HULHV)U\HUV 75 VHULHV IU\HUV RIIHU IDVWHU UHFRYHU\ ZLWK 9XOFDQ¶V 7KUHH3DVVŒ KHDW WUDQVIHU WHFKQRORJ\ 7KLV SDWHQWHG V\VWHPSURGXFHVVKRUWHUFRRNWLPHVEHWWHUWDVWLQJIRRG DQG VDYHV PRQH\ ZLWK OHVV RLO WRS RII (QHUJ\ 6WDUŠ TXDOLILHG PHDQV ORZ FRVW RI RZQHUVKLS 6HDOHG FRPEXVWLRQ V\VWHP H[WHQGV WKH WDQN OLIH &RPHV VWDQGDUG ZLWK HOHFWURQLF LJQLWLRQ²SRZHU EXWWRQ VWDUWV WKH IU\HU LQVWDQWO\ $YDLODEOH ZLWK 6ROLG 6WDWH $QDORJ .QRE $  6ROLG 6WDWH 'LJLWDO '  RU 3URJUDPPDEOH &RPSXWHU &  FRQWUROV \HDU OLPLWHG WDQN \HDU SDUWVDQGODERUZDUUDQW\16)&6$ 0RGHO'HVFULSWLRQ 75$ :.%78[ OERLOFDS.QRE&RQWUROV 75$ :.%78[ OERLOFDS.QRE&RQWUROV 75') :.%78[.OHHQ6FUHHQ  OERLOFDS'LJLWDO&RQWUROV 75$) :.%78[.OHHQ6FUHHQ OEHDRLOFDS.QRE&RQWUROV Additional models available.

&

'6XSHU0DUDWKRQ)U\HUVZ%XLOW,Q)LOWUDWLRQ 6XSHU 0DUDWKRQ JDV IU\HUV DUH GHVLJQHG IRU YHUVDWLOH IU\LQJ SURGXFWLRQ DQG VROLG SHUIRUPDQFH 7KHVH DOOSXUSRVH IU\HUV IHDWXUH RXWVWDQGLQJ 'HDQ UHOLDELOLW\ DQG GXUDELOLW\ 'HDQ¶V EXLOWLQILOWUDWLRQV\VWHPLVGHVLJQHGWRVXSSRUWJRRGRLOVWDWLRQ PDQDJHPHQW DQG PD[LPL]H RLO OLIH ,W SXWV ILOWUDWLRQ ZKHUH LW¶V PRVW FRQYHQLHQW WR XVH ULJKW LQ WKH IU\HU 7KLV HOLPLQDWHV WKH QHHGIRUDGGLWLRQDOIORRUDQGVWRUDJHVSDFH$OOEXLOWLQILOWUDWLRQ RIIHULQJV DUH TXLFN FRQYHQLHQW DQG UHOLDEOH 16) &6$ 0RGHO6&)60*VKRZQ

'

(&RXQWHUWRS)U\HUV 'HVLJQHG IRU KHDY\GXW\ FRXQWHUWRS IU\LQJ VXFK DV )UHQFK IULHV RQLRQ ULQJV ( FKLFNHQ GRQXWV ILVK ILOHWV VKULPS  DQGPRUH6WDLQOHVV VWHHO GRXEOH ZDOO FRQVWUXFWLRQ +LJK OLPLW WKHUPRVWDW SURWHFWLRQ $GMXVWDEOH 

 VWDLQOHVV VWHHO OHJV +HDY\ GXW\ QLFNHOSODWHG IU\ EDVNHWV ZLWK LQVXODWHG KDQGOHV 6WDLQOHVV VWHHO IU\ SRW ZLWK GUDLQ YDOYH DQG H[WHQVLRQ SLSH8QLWVKLSV1DWXUDOJDV/3RUHOHFWULF7KHUPRVWDW UDQJHIURPƒ)WRƒ)0RGHO*)*VKRZQ

0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ 6&)60*  )U\HUEDWWHU\OEFDS.%78 *)* *DVOERLOFDS :['[+)U\$UHD *)* *DVOERLOFDS 6&)60*  )U\HUEDWWHU\OEFDS.%78 *)3* *DVOERLOFDS /3

:['[+)U\$UHD *)3* *DVOERLOFDS /3

&)60*  )U\HUOEFDS.%78 3)( (OHFWULFOERLOFDS  :['[ +)U\$UHD 3)( (OHFWULFOERLOFDS &)60*  )U\HUOEFDS.%78 3)( (OHFWULFOERLOFDS :['[+)U\$UHD Additional models available. 7XEHW\SHIU\HUVLQFOXGHPLOOLYROWFRQWUROVGXUDEOHWHPSHUDWXUHSUREHUDFNW\SHEDVNHW VXSSRUWEDVNHWKDQJHUWZLQEDVNHWVVWDLQOHVVVWHHOIU\SRWGRRUDQGFDELQHWVLGHV FDVWHUVEXLOWLQILOWUDWLRQZLWK*30SXPSDQGILOWHUVWDUWHUNLW


Cooking Equipment | 59 A. Solstice FD Filter Drawer/Frying System. The new Filter Drawer System adds 40-50% to your oil life. Faster cooking and more cooking power for quality production and increased profits. New burner design improves efficiency over 13%. Two-step filtering makes for ease of filtering. Filter drawer designed to fit under fryers; no extra space required under hood. Upgraded controls aid the cooking process by controlling cooking times and temperatures for a more consistent product. Model Description FD-2 Filter Drawer Filtration for 2 Gas or Electric Fryers-Solstice Series FD-3 Filter Drawer Filtration for 3 Gas or Electric Fryers-Solstice Series FD-4 Filter Drawer Filtration for 4 Gas or Electric Fryers-Solstice Series FD-5 Filter Drawer Filtration for 5 Gas or Electric Fryers-Solstice Series BNB Dump Bread and Batter Dump Station Casters Set of 4 heavy duty casters Additional models available.

A

B. Solstice Supreme High Efficiency Fryers. Combine any Solstice Supreme to create the perfect combination for your individual needs. Pitco’s Solstice Supreme fryer category has many gas models that achieve the Energy Star® rating. With the push of a button, the matchless ignition system ignites a standing pilot, which begins a 30-second automatic self-cleaning burner procedure. This procedure ensures the burners stay clean and efficient all day, every day. The down draft protection system prevents errors from ventilation issues. Choose solid state thermostat, digital or computerized control. 10-year tank warranty. Model 2-SSH60W-C-S/FD shown. Model Description SSH55T-SSTC-SS Twin, 40,000 BTU ea., 7"x14" Fry Area, S/S Cabinet SSH55-SSTC-SS Full Tank, 80,000 BTU,14"x14" Fry Area, S/S Cabinet SSH60-SSTC-SS Full Tank, 80,000 BTU, 14"x18" Fry Area, S/S Cabinet SSH60W-SSTC-SS Full Tank, 100,000 BTU, 18"x14" Fry Area, S/S Cabinet SSH75-SSTC-SS Full Tank, 105,000 BTU, 18"x18" Fry Area, S/S Cabinet

B

C. Solstice™ Gas Fryers. High production, 57% thermal efficient solstice burner design allows you to cook more product, more efficiently and provide an improved operating environment with cooler flue temperatures. Less labor and downtime. Choice of 2 nickel-plated, oblong, wire-mesh baskets or 1 nickel-plated, square, wire-mesh basket. Self-cleaning burners standard on solid state and computer controls. Available with filtration system.

C

Model Description SG14S 50 lb. Oil Cap., 14"x14" Fry Area, 110K BTU, Millivolt Controls SG14R 50 lb. Oil Cap., 14"x14" Fry Area, 122K BTU, Millivolt Controls SG14RS 50 lb. Oil Cap., S/S Tank, 14"x14" Fry Area, 122K BTU, Millivolt Controls SG14RS-D 50 lb. Oil Cap., S/S Tank, 14"x14" Fry Area, 122K BTU, Digital Controls SG14RS-C 50 lb. Oil Cap., S/S Tank, 14"x14" Fry Area, 122K BTU, Computer Controls SG18 90 lb. Oil Cap., 18"x18" Fry Area, 140K BTU, Millivolt Controls SG18S 90 lb. Oil Cap., S/S Tank, 18"x18" Fry Area, 140K BTU, Millivolt Controls Additional models available.

D. Economy Fryers. Pitco quality at value price. The Economy fryers are free-standing, stand-alone fryers with a welded tank. Smooth machine peened finish ensures easy cleaning. Long lasting, high temperature alloy stainless steel heat baffles are mounted in the heat exchanger tubes to provide maximum heating and combustion efficiency. Standing pilot light design provides a ready flame when heat is required. Cabinet is constructed of stainless steel front and door with galvanized sides and back. And, don’t forget to inquire about the first ever Energy Star ® Value-Priced Fryer (VF35). Model 35C+S shown.

Model VF35S 35C+ 35C+S 45C+ 45C+S 65C+ 65C+S

Description 59 lbs. Fries/Hr., 70K BTU, Mild Steel Tank 63 lbs. Fries/Hr., 90K BTU, Mild Steel Tank 63 lbs. Fries/Hr., 90K BTU, S/S Tank 85 lbs. Fries/Hr. 122K BTU, Mild Steel Tank 85 lbs. Fries/Hr. 122K BTU, S/S Tank 105 lbs. Fries/Hr., 150K BTU, Mild Steel Tank 105 lbs. Fries/Hr., 150K BTU, S/S Tank

D


Cooking Equipment | 60 A. Doughnut Fryers. Atmospheric burner system combined with stainless steel heat tubes utilizes high temperature alloy stainless steel baffles. Thermostat maintains temperature between 200°F and 400°F. Fryer has a deep cool zone; minimum 20% of total oil capacity to trap burnt particles, crumbs and black specks. Accessories include wire mesh tube screen, mesh doughnut screen with handles, submerger screen with grip handles, doughnut turner stick, drain clean-out rod, drain nipple, heat deflector and drainboard. Model Description 24P 150 Oil Cap., 120,000 BTU 34P 210 Oil Cap., 110,000 BTU

B A

C. SwivelMAX™ Gas Connector Fittings & Kits. Blue Hose™ kits with SwivelMAX® enable easier movement of caster-mounted appliances at angles, back and forth and from side-to-side, while relieving stress at the ends of the hose. Required by code in many states for both caster and fixed leg mounted gas-fired cooking equipment that is moved on a regular basis for cleaning, service or facility maintenance. Prevents premature failure of the connector. Provides more aisle space in a commercial kitchen by allowing the appliances to be positioned closer to the wall. Available with 1 or 2 SwivelMAX® fittings. CSA and NSF design certified. Model Description 1/2"x48" Gas Connector Kit, 2 Swivels 1650KIT2S48 3/4"x48" Gas Connector Kit, 2 Swivels 1675KIT2S48 16100KIT2S48 1"x48" Gas Connector Kit, 2 Swivels 16125KIT2S48 11/4"x48" Gas Connector Kit, 2 Swivels 1/4" SwivelMAX™ Fitting SM75 1/2" SwivelMAX™ Fitting SM50 SM100 1" SwivelMAX™ Fitting SM125 11/4" SwivelMAX™ Fitting

B. Safety-Set™ Placement System. If safety and consistent equipment placement are priorities in your kitchen, Safety-Set™ is the solution for you! Safety-Set™ allows equipment to be returned to its design specified location after cleaning or maintenance. Satisfies NFPA codes 17A (5.6.4) and 96 (12.1.2.3). Open-floor design allows casters to rest level on the floor to ensure even cooking. Fast, easy installation with choice of adhesive foam tape or thumb screw hardware pack (both included). Compatible with 4", 5" and 6" casters. Withstands 1,000 lbs. of crush force. Certified to NSF/ANSI Standard 169 (Special Purpose Food Equipment and Devices).

Advantages of using flexible gas appliance connectors

C

• Improves sanitation and safety. Equipment can be easily moved and cleaned on a regular basis, reducing dirt and grease buildup. That means improved cleanliness and reduced fire hazards. In most traditional installations, there are 6"-9" of dead space behind stoves and grills. That space is blocked from cleaning and can fill with debris and grease, causing unpleasant odors and attracting insects and rodents. • Increases aisle work space and decreases the space needed behind equipment. • Easier movement makes servicing and cleaning easy. • Longer product life because torsion stress is greatly reduced.

E. Gas Connector Kits. Specifically engineered for the commercial kitchen. Kits feature the Blue Hose™ flexible stainless steel gas connector with Stress Guard ® and anti-microbial PVC coating. SnapFast® one-handed quick disconnect with thermal shut-off, restraining cable with hardware, full port valve and elbows. With a limited lifetime warranty, the Dormont gas connector kits are designed for use in all commercial kitchen applications. CSA and NSF design certified.

D

D. SafetyQuik® Gas Connector Fitting. Safety Quik® does the work of both a quick-disconnect and shut-off valve. The Safety Quik QDV fitting, with its innovative safety-sleeve, incorporates added special safety design features. With this unique item, the gas connector cannot be disconnected until the gas valve on the Safety Quik is shut off— and the valve cannot be opened until the gas connector is attached. Includes automatic safety thermal shut-off that stops gas flow if temperature exceeds 350°F. Model Description 1/2" Gas Connector Kit w/Safety Quik® QDV 1650KITCF48 3/4" Gas Connector Kit w/Safety Quik® QDV 1675KITCF48 16100KITCF48 1" Gas Connector Kit w/Safety Quik® QDV 1/2" Safety Quik® QDV CF-50 3/4" Safety Quik® QDV CF-75 CF-100 1" Safety Quik® QDV

E Model 1650KIT48 1675KIT48 16100KIT48 16125KIT48

Description Gas Connector Kit 3/4"x48" Gas Connector Kit 1"x48" Gas Connector Kit 11/4"x48" Gas Connector Kit 1/2"x48"


Cooking Equipment | 61

Featured Chef Chef/Owner Eric Williams Momocho mod mex restaurant Cleveland, OH

Braised Beef Brisket (Machaca)

A. SPINFRESH for Solstice Fryers. A difference you can see. Patented SPINFRESH technology spins off excess oil from fried products after cooking. The lack of excess oil produces a fried food that is less greasy and lower in fat without sacrificing taste. Built-in acceleration and deceleration of the spin speed allows for food to be spun without damage. The excess oil from the spin process is returned to the fry tank reducing oil loss. Tank enclosure saves energy while the fryer is idle. Available as an upgrade to most Solstice fryers. Model SSH55 shown with optional SpinFresh.

5 Ib. piece beef brisket

A

2 cups red wine 20 oz. tomato juice

B. Gas Pasta Cookers. Solstice high efficiency burner technology. Self-cleaning burner. Solid state cooking controls integrated into the digital control. Programmable simmer temperature. Separate rinsing/hold tanks equipped with drain and overflow. Swing away faucet. Stainless steel cabinet. Cooker and rinse station constructed of marine grade 316 stainless. Automatic basket lift. Cooking rack accommodates smaller baskets. Quick opening 11/4" drain valve in each tank. Tank design features a self-skimming 1" overflow drain in each tank. AGA, CGA, NSF, MEA.

1/4

cup lime juice 1 cup red wine vinegar

1/2

cup salt

1/2

cup chopped garlic 2 Tbsp. black pepper 4 Tbsp. ancho powder or 2 whole chiles 1 Tbsp. cinnamon

1/2

cup coffee, ground (guatamalan bean preferred) 2 bay leaves 1 spanish onion, rough cut Season brisket with coffee, ancho powder and salt. Grill/sear beef to caramelize. Cut beef into similar size pieces (3). Put in large braising pan or metal hotel pan with all remaining ingredients. Add enough water to cover brisket. Cover with foil and place in 300 degree oven for 3-4 hours. Discard whole onions and bay leaves. Remove brisket from liquid and pull all meat. Reserve liquid to reheat.

C Model GPCSC GPCBSC GPCRSC GPCRBSC

C. Pasta Magic™ Gas Cookers. Endless pastabilities for your operation! State-of-the-art features and benefits for quick, consistent and perfect pasta every time. Features open, easy-to-clean cookpot design. Stainless steel cookpot, front, door and cabinet. High-efficiency, infrared burners; 80,000 Btu/hr. 18"x24"x63/4" cooking area. 1-gallon (56.8-liter) water capacity. Electrical components are separated from the heating source and protected from moisture. Standard features include: Programmable timer controller, large overflow drain, auto-fill/skim, bulk pasta basket. Portion cup rack and 24 portion cups or 3 round baskets in lieu of portion cups & rack. Model GPCSC shown w/stainless steel cabinet and optional casters.

Description 15 gal. cap., 6" steel legs w/1" adjustment 15 gal. cap., automatic timed basket lifts, casters 15 gal. cap., Rinse tank, swing away hot/cold rinse faucet 15 gal. cap., automatic timed basket lifts, rinse tank, swing away hot/cold rinse faucet, casters

B

Model SSPG14 SSPG14/SSRS14 SSRS14 Rinse Station

Description Gas Pasta Cooker Only Gas Pasta Cooker System (Complete) Gas Rinse Tank Only

D D. Gas Appliance Connector & Installation Kits. It’s necessary to properly secure and maintain your gas hoses to keep injuries and accidents to a minimum. Safe.T.Link gas connectors and installation kits assure safe installation of your gas appliance. Includes AGA-certified foodservice gas ball valve, 90° street elbow and all necessary hardware for complete installation. SureLink adjustable restraining cable and a SwiveLink gas connector swivel provides the most reach with shortest hose, reduces stress on the hose and keeps gas flow unrestricted. Posi-Set wheel placement system ensures proper relocation of equipment after moving, cleaning or repairs. Model Description HG-4D-24SK Kit w/QD 3/4" NPT & 24" Hose w/SwiveLink Fittings HG-4D-36SK Kit w/QD 3/4" NPT & 36" Hose w/SwiveLink Fittings HG-4D-48SK Kit w/QD 3/4" NPT & 48" Hose w/SwiveLink Fittings HG-4D-60SK Kit w/QD 3/4" NPT & 60" Hose w/SwiveLink Fittings HG-4D-72SK Kit w/QD 3/4" NPT & 72" Hose w/SwiveLink Fittings Posi-Set Wheel Placement System


Cooking Equipment | 62

A. Eclipse™ Ergonomic Tilting Braising Pans. The Groen Eclipse Ergonomic Tilting Braising Pan line of products and accessories is expanding to include a new 15-gallon version in both gas and electric models. The 15-gallon model will fit into most configurations and provide the same performance as the larger units. Features include a 5/8" clad plate cooking surface, heating to 350°F in just 4 minutes, a 100-grit hand-ground finish to reduce sticking and hinged cover with torsion spring-assisted hinges. Model BPM-15 shown.

B

A

Model Description TD/FPCM 10-Gal, Table Top, Manual Tilt, Configurable BPM-15G 15-Gal, Manual Tilt, Gas, Electric Spark Ignition BPM-30EM 30-Gal, Manual Tilt, Electric, Etch Marks, Configurable BPP-30EM 30-Gal, Power Tilt, Electric, Etch Marks, Configurable BPM-30GM 30-Gal, Manual Tilt, Gas, Etch Marks, Configurable BPM-40EM 40-Gal, Manual Tilt, Electric, Etch Marks, Configurable BPP-40EM 40-Gal, Power Tilt, Electric, Etch Marks, Configurable Additional models available.

B. Modular Tilting Braising Pans. Stainless steel exterior, frame and flanged feet. Stainless steel pan with embossed gallon markings and pouring lip strainer. Watertight controls and enclosure. Electronic ignition (gas models). Stainless steel hinged cover with drip edge. Stainless steel drop-down food receiving pan support. Solid state temperature controls adjust from 50°F to 425°F. 1-year limited parts and labor warranty. Model Description VE30 30 gal. Electric VE40 40 gal. Electric VG30 30 gal. Gas (90,000 BTU/hr) VG40 40 gal. Gas (120,000 BTU/hr)

C. Mini Combi Oven-Steamers. Affordable Mini Combi-Oven can do it all, automatically! Steam, bake and fry all in one compact model. Attract more customers and increase sales by featuring aromatic and visually appealing fresh cooked food. The multi-faceted “mini” combi oven significantly improves the quality of food and speed of preparation so you can now offer a greater selection of healthy food choices for your customers. EasyToUch™ controls are easily programmed for most frequently served foods, offer service diagnostics and HACCP logging! Model OES 6.10 Mini shown. Model Description OES-6.10 Mini Elec Boilerless, 3 Pans (21/2") OES-10.10 Mini Elec Boilerless, 10 Pans (21/2")

C

E D. Combi Ovens, BCP/BCM Series. Reward your staff, customers, owners, and yourself with a Blodgett Combi oven and help reduce labor, energy, and water consumption while increasing the quality, yield, and speed of the food your culinary team produces. Choose manual (BCM) or programmable (BCP) controls. The BCP CombiOptima takes control after you set the temperature, humidity and time or internal temperature and gives you reproducible results, time after time. When it comes to automatic cleaning, no need for proprietary chemicals! Electric Mini Combi Oven/Steamers now available! Model BCP-101E shown. Model Description BCP-61E Holds (5) 12"x20"x21/2" Pans, Prog. Controls BCM-101E Holds (8) 12"x20"x21/2" Pans, Manual Controls BCP-101E Holds (8) 12"x20"x 21/2" Pans, Prog. Controls BCM-102E Holds (16) 12"x20"x21/2" Pans, Manual Controls BCP-102E Holds (16) 12"x20"x21/2" Pans, Prog. Controls

D

E. ComboEase Combi Oven. Simple to operate. Easy to maintain. Energy efficient. Affordable. ComboEase Combination Steamer-Oven is a full size, gas, combination oven that brings simplicity to the traditionally complex world of combination cooking. Featuring Groen’s new and exclusive boilerless steaming reservoir system, the ComboEase addresses the needs of institutional and commercial foodservice operators for easy steam, convection and combination cooking that provides maximum, energy-efficient performance at an affordable price. Shown on optional stand. Model Description CBE-10G Holds (10) Pans, Triple Reservoir, Configurable 152055 Regular Stand w/Casters


&RRNLQJ(TXLSPHQW_ %6WHDP&KHIŒ%RLOHUOHVV6WHDPHUV )LQDOO\ D ERLOHUOHVV FRQYHFWLRQ VWHDPHU WKDW FRRNV IDVW VWD\V FOHDQ DQG LV HDV\ WR PDLQWDLQ 3DWHQWHG .OHDQ6KLHOGŒ FRRNLQJ FRPSDUWPHQW HOLPLQDWHV IRDPLQJ FRQWDPLQDWLRQ RI ZDWHU UHVHUYRLU DQG IODYRU WUDQVIHU +LJK VSHHG FRQYHFWLRQ VWHDP IRU IDVW FRRNLQJ (DV\ WR RSHUDWH 6XUH&RRNŒ WLPHU DXWRPDWLFDOO\ FRPSHQVDWHV IRU WKH YROXPH RI IRRG EHLQJ FRRNHG (DV\ WR FOHDQ²VLPSOH YLQHJDU FOHDQXS 1HZ GHVLJQ VDYHV ZDWHU DQG HQHUJ\ ,GHDO IRU KHDY\ EDWFK FRRNLQJ DQG PHGLXP YROXPH D OD FDUWH VW\OH FRRNLQJ (QHUJ\ 6WDUŠ UDWHG HQHUJ\ VDYLQJSHUIRUPDQFH0RGHO&(7VKRZQ 0RGHO'HVFULSWLRQ &(7 (OHFWULF  3DQ&DSN: &(7 (OHFWULF  3DQ&DS N: &*7 *DV  3DQ&DS%78 &*7 *DV  3DQ&DS%78

$&RXQWHUWRS.HWWOHV *UHDW IRU VDXFHV DQG VRXSV $YDLODEOHLQHOHFWULFJDVDQGGLUHFW VWHDP 7\SH  VWDLQOHVV VWHHO NHWWOHDQGVXSSRUWV-DFNHWUDWHGDW SVLZLWKVDIHW\YDOYH&RPSOHWH ZLWK VROLG VWDWH ZDWHU OHYHO WHPSHUDWXUH DQG VDIHW\ ORZ ZDWHU SRZHU FXWRII /(' LQGLFDWRUV DQG PDULQH ORFN VWDQGDUG &DSDFLW\ IURPWRJDOORQV $ 0RGHO'HVFULSWLRQ  JDO'LUHFW6WHDP .'77 .'77 JDO'LUHFW6WHDP .'77 JDO'LUHFW6WHDP .'77 JDO'LUHFW6WHDP .'77 JDO'LUHFW6WHDP .(77 JDO(OHFWULF .(77 JDO(OHFWULF .(77 JDO(OHFWULF $GGLWLRQDOPRGHOVDYDLODEOH

&

%

&6WHDP&XE%RLOHUOHVV6WHDPHU FRPSDUWPHQW VWHDPHU PRGHO 6&( KDV HOHFWURQLF FRQWUROV ZLWK  RSHUDWLQJ PRGHV FRQVWDQW VWHDPLQJ VWHDPKROG DQG KROGLQJ RQO\ $XGLEOH ORZ ZDWHU DQG KLJK WHPSHUDWXUHVDIHW\LQGLFDWRU&KRRVHPLQXWHPHFKDQLFDO WLPHURUVROLGVWDWHGLJLWDOFRQWUROV+ROGVILYHGHHSIXOO VL]H VWHDP WDEOH SDQV  JDXJH VWDLQOHVV VWHHO LQQHU FRRNLQJ FRPSDUWPHQW  JDXJH VWDLQOHVV VWHHO RXWHU FRPSDUWPHQWZLWKSLHFHFRPSDUWPHQWGRRUN:9 SKDVH(QHUJ\6WDUŠ DSSURYHG0RGHO6&(0&6VKRZQ 0RGHO'HVFULSWLRQ 6&( 'LJLWDO&RQWUROV 6&(0&6 0HFKDQLFDO&RQWUROV 6WHDP2QO\

' '6WHDP&UDIWŠ 6WHDPHUV $YDLODEOH LQ JDV HOHFWULF DQG GLUHFW VWHDP JHQHUDWRUV 6WHDP JHQHUDWRUZLWKDXWRPDWLFZDWHUILOORQVWDUWXSDXWRPDWLFERLOHU EORZGRZQ HOHFWURQLF VSDUN LJQLWLRQ DQG JHQHUDWRU VWDQGE\ IRU LQVWDQWVWHDP&KRRVHPLQXWHPHFKDQLFDOWLPHURUHOHFWURQLF FRQWUROV 0DQXDO E\SDVV RSHUDWLRQ PRGH 3DWHQWHG FROG ZDWHU FRQGHQVHU GHVLJQ 7\SH  VWDLQOHVV VWHHO FRQVWUXFWLRQ SLHFH GRRU GHVLJQ &DSDFLW\ IRU WKUHH ILYH VL[ DQG WHQ  GHHSIXOOVL]HVWHDPWDEOHSDQV 0RGHO'HVFULSWLRQ &(7 3DQ&DS (OHFWULF

&(7 3DQ&DS (OHFWULF

&($ 3DQ&DS (OHFWULF

&*$ 3DQ&DS *DV

&'3 3DQ&DS 'LUHFW6WHDP

&*3 3DQ&DS SVL%RLOHU

(6 6KHOI6WDQG IRU&(7RU&(7

8QLVWDQG +6WDQG IRU&(7RU&(7

$GGLWLRQDOPRGHOVDYDLODEOH

&KHI6WHYH 6KDUHV+LV 6HFUHWV )

(6KRUW6HULHV.HWWOHV 5LPKHLJKWLV RQWKLV6KRUW6HULHV.HWWOH IORRU PRGHO 7\SH  VWDLQOHVV VWHHO FRQ VWUXFWLRQDQGVXSSRUWV)XOO\VWHDPMDFNHWHG SVLVWHDPMDFNHWUDWLQJ$YDLODEOHLQWLOWLQJ DQGVWDWLRQDU\PRGHOV*DVDQGHOHFWULFKDYH VSODVKSURRIVROLGVWDWHWHPSHUDWXUHFRQWUROV 0RGHO'HVFULSWLRQ .'/6+ JDO'LUHFW6WHDP6WDWLRQDU\ .'/76+ JDO'LUHFW6WHDP7LOWLQJ .'/76+ JDO'LUHFW6WHDP7LOWLQJ .'/76+ JDO'LUHFW6WHDP7LOWLQJ .*/76+ JDO*DV7LOWLQJ .*/6+ JDO*DV6WDWLRQDU\ .*/6+ JDO*DV6WDWLRQDU\ $GGLWLRQDOPRGHOVDYDLODEOH

(

),QWHN&RQQHFWLRQOHVV6WHDPHU 7KH EHVW SRVVLEOH FRPELQDWLRQ RI FRRNLQJ VSHHG SURGXFWLYLW\  HIILFLHQF\ DQGUHOLDELOLW\RIDQ\VWHDPHURQWKHPDUNHWWRGD\7KH,QWHNSURGXFWOLQH IURP*URHQLVDKLJKSHUIRUPDQFHERLOHUOHVVDQGFRQQHFWLRQOHVVHOHFWULFRU JDVVWHDPHUDYDLODEOHZLWKVLQJOHRUGRXEOHVWDFNLQJVWDQGVDVDFRXQWHU WRSXQLWDQGZLWKRUZLWKRXWDQDXWRZDWHUILOOV\VWHP$OOXQLWVDUH(1(5 *<67$5Š UDWHGDQG/(('FRPSOLDQWGXHWRWKHLUVXSHULRUGHVLJQ:LWK DQG SDQ FDYLW\ FDSDFLWLHV RQ WKH HOHFWULF PRGHOV DQG D SDQ FDSDFLW\ RQ WKH JDV PRGHO WKH\ DUH D SHUIHFW ILW IRU QHDUO\ HYHU\ DSSOLFDWLRQ $OO XQLWVDOVRFRYHUHGE\D\HDUZDUUDQW\0RGHO;6VKRZQ 0RGHO'HVFULSWLRQ ;6 (OHFWULFSDQFDS ;6 (OHFWULFSDQFDS ;6* *DVSDQFDS


&RRNLQJ(TXLSPHQW_

$7LOWLQJ%UDLVLQJ3DQ6NLOOHWV %UDLVH URDVW DQG JULOO PHDWV DQG VHDIRRG %DWWHU IRRGV 6WHDP YHJHWDEOHV DQG VHDIRRG 3UHSDUH VRXSV VDXFHV DQG FKLOL $OO VWDLQOHVV VWHHO FRQVWUXFWLRQ FRPSOHWH ZLWK WKHUPRVWDWLF DQG VDIHW\ FRQWUROV *DOORQ PDUNLQJV 6WDLQOHVV VWHHO FODG 7KH    ³EHDG EODVWHG´ FRRNLQJ VXUIDFH SUHYHQWV IRRG VWLFNLQJ WR VXUIDFH &KRRVH SRZHU WLOW RU PDQXDO K\GUDXOLF KDQG WLOW SOHDVH VSHFLI\  6SULQJ DVVLVWFRYHUZLWKDGMXVWDEOHYHQW1RFOHDUDQFHVUHTXLUHG &KRRVH IURP HOHFWULF RU JDV LQ  DQG  JDOORQ PRGHOV 16)0RGHO6(/75VKRZQ 0RGHO'HVFULSWLRQ 6(/75 *DO(OHFWULF6NLOOHW 6(/75 *DO(OHFWULF6NLOOHW 6*/75 *DO*DV6NLOOHW 6*/75 *DO*DV6NLOOHW

% $

&3RZHU3DQ7LOWLQJ6NLOOHWV *ULOO EUDLVH VWHDP ERLO DQG VR PXFK PRUH 0RVW YHUVDWLOH SLHFH RI FRRNLQJ HTXLSPHQW RQ WKH PDUNHW $YDLODEOH LQ  DQG   DQG  OLWHU  JDOORQ FDSDFLWLHV 2SHQ EDVH GHVLJQ IRU HDV\ FOHDQLQJ DQG PDLQWHQDQFH  WKLFNFRRNLQJVXUIDFH6SODVKSURRI FRQWUROV /RZ  ULP KHLJKW IRU HDV\ RSHUDWLRQ 0RGHO6*/7VKRZQ

&

0RGHO'HVFULSWLRQ 6*/7 *DO*DV 6*/7 *DO*DV 6(/7 *DO(OHFWULF 6(/7 *DO(OHFWULF

'&RQYRWKHUP ,W¶VDFRQYHFWLRQRYHQRUFRQYHFWLRQVWHDPHU%HWWHU \HW LW¶V D FRQYHFWLRQ RYHQ DQG VWHDPHU &RPEL  DW WKH VDPH WLPH 7KH $GYDQFHG &ORVHG 6\VWHP  WDNHVWKHJXHVVZRUNRXWRIFRRNLQJ3UHSDUHPHQX LWHPV IDVWHU DQG HIILFLHQWO\ LQFUHDVLQJ RYHUDOO \LHOG DQGH\HDSSHDO(YHQEURZQLQJHOLPLQDWHVQHHGWR URWDWH SDQV GXULQJ FRRNLQJ &ULVS  7DVW\ IHDWXUH UHPRYHV PRLVWXUH IRU FULVS JROGHQ UHVXOWV ZLWKRXW GHHSIU\LQJ3UHVV *REXWWRQVRIIHUIRROSURRIRQH WRXFK FRRNLQJ 'LVDSSHDULQJ GRRU IUHHV XS DLVOH VSDFH&RQYR&OHDQIHDWXUHFOHDQVDQGVWHULOL]HVWKH LQWHULRU DXWRPDWLFDOO\ &KRRVH ZLWK RU ZLWKRXW D ERLOHU 8/ 16) 0RGHOV 2(% DQG 2(6 VKRZQTry our Electric Mini Combi! 0RGHO'HVFULSWLRQ 2*6 +DOI*DV%RLOHUOHVV3DQV 

2(6 )XOO(OHF%RLOHUOHVV3DQV 

2*6 )XOO*DV%RLOHUOHVV3DQV 

2(% )XOO(OHFZ%RLOHU3DQV 

2*% )XOO*DVZ%RLOHU3DQV 

2(% +DOI(OHFZ%RLOHU3DQV 

Additional models available.

%.6HULHV.HWWOHV &RPSOHWHO\ UHGHVLJQHG ZLWK PRUH FXVWRPHU IHDWXUHV LQFOXGLQJ WUXH ZRUNLQJ FDSDFLW\ HPERVVHGJDOORQOLWHUPDUNLQJVDQGKHDY\EDUULP 7\SH  VWDLQOHVV VWHHO RIIHUV SURWHFWLRQ IURP SLWWLQJ DQG FRUURVLRQ IURP KLJK DFLG IRRG SURGXFWV VXFK DV EDUEHTXH DQG VSDJKHWWL VDXFH 1R KRW VSRWV RU VFRUFKHG VRXSV ZLWK VWHDP MDFNHWHG NHWWOHV $ ODUJHU KHDW WUDQVIHU VXUIDFH UHVXOWV LQ PRUH HQHUJ\ EHLQJ WUDQVIHUUHG WR WKH IRRG &OHDQ ORFNIHDWXUHIDFLOLWDWHVFOHDQXSDQGIDVWWXUQDURXQG *DV HOHFWULF DQG GLUHFW VWHDP PRGHOV DYDLODEOH 0RGHO.*/7VKRZQ 0RGHO'HVFULSWLRQ .'77 7LOWLQJ'LUHFWJDOFRXQWHUWRS 0DQXDOWLOW%+3 .(77 7LOWLQJ(OHFWULFJDOFRXQWHUWRS SVLN: Additional models available.

(

'

(&RXQWHUWRS6NLOOHWV +LJK HIILFLHQF\ KHDWLQJ V\VWHP IRU IDVW KHDWXS DQG UHFRYHU\ WLPH 7\SH  VWDLQOHVV VWHHO FRQVWUXFWLRQ 6SODVK SURRI %HDG EODVWHG FRRNLQJ VXUIDFH SUHYHQWV IRRG VWLFNLQJ WR VXUIDFH 6HOIORFNLQJ PDULQH W\SH WLOW PHFKDQLVP SUHYHQWV DFFLGHQWDOWLOWLQJ6WDQGDUGZLWKWKHUPRVWDWLFVDIHW\ DQG PDLQ SRZHU FRQWUROV ZLWK OLJKWHG LQGLFDWRUV /LIWRII FRYHU ZLWK FRQGHQVDWH YHQW VWDQGDUG &KRRVH IURP HOHFWULF  DQG  JDOORQ PRGHOV IRU WDEOHWRS RU VWDQG PRXQWLQJ 9  +]  SKDVH8/&6$DQG16) 0RGHO'HVFULSWLRQ 6(7 JDO 6(7 JDO


Cooking Equipment | 65 A. Space-Saving Combination Steamer/Kettle. Pressureless cooking with forced convection steam holds up to six 12"x20" pans. Solid state controls operate water level and safety functions. Each compartment equipped with 60-minute mechanical timer. Durable 14 gauge stainless steel construction with removable 6-gallon tilting kettle made of 304 stainless steel. The 2/3 jacketed kettle includes trunnion mounted steam control valve 50-psi pressure rating. Lift-off cover. Double pantry faucet with swing spout included. Available in gas or electric. Model Description 24CEM24 Electric 24"W Steamer, 24 kW 42CKEM24 Electric Steamer w/6 Gal. Kettle on 42" cabinet, 24 kW 24CGM200 Gas 24"W Steamer, 200K BTU 36CGM300 Gas 36"W Steamer, 300K BTU 42CKGM200 Gas Steamer w/6 Gal. Tilt Kettle on 42" cabinet, 200K BTU 42CKGM300 Gas Steamer w/6 Gal. Tilt Kettle on 42" cabinet, 300K BTU 24CSM Steam-Coil 24"W Steamer, 35-psi 42CKSM Steam-Coil Steamer w/6 Gal. Kettle on 42" cabinet, 50-psi

C. Gemini™ 6 Gas-Fired Steamer. Each steam-cooking compartment is independently operated and controlled by a separate stainless steel steam generator, gas valve, power on/off control levers and an exclusive, remote probe-type water level control. Exclusive Gemini drain/power control system. Manual 1/2" “ball valve” type drain controls main power on/off and automatically fills generator. 304 stainless steel construction. CSA (AGA, CSA) and UL/NSF#4. Model 24CGA10.2 shown. Model Description 24CGA10.2 10 Pan Cap. 24CGA6.2S 6 Pan Cap.

C

D. Blodgett Steam Equipment. Electric tilting kettles feature 316 stainless steel kettle liner, 2/3 jacketed with hemispheric design and up to 50-psi for quick recovery. Manual tilt braising pans feature 304 stainless steel and heavy-gauge, fully adjustable one-piece cover. Unique finned heat distribution and electronic ignition standard on all gas models. Model Description 20E-KLT 20 gal. Kettle (Electric) 40E-KLT 40 gal. Kettle (Electric) 60E-KLT 60 gal. Kettle (Electric) 30E-BLT 30 gal. Braising Pan (Electric) 40E-BLT 40 gal. Braising Pan (Electric) 30G-BLT 30 gal. Braising Pan (Gas) 40G-BLT 40 gal. Braising Pan (Gas) Additional models available.

E

D

E. R Series Counter Steamers. Its small 24"W profile doesn’t take up much counter space, yet it can quickly steam-cook a wide variety of food, thanks to its powerful heating element and boilerless design. Durable stainless steel steam generators are easily accessible for routine maintenance. Stainless steel construction for maximum corrosion resistance and coved interior corners for easy cleaning. Model R24-5 shown with optional stainless steel stand. Model Description R18-4 Electric, 4-Pan Cap., Auto Fill/Manual Drain, 18"W R18A-4 Electric, 4-Pan Cap., Auto Fill/Auto Drain, 18"W R24-3 Electric, 3-Pan Cap., Auto Fill/Auto Drain, 24" R24-5 Electric, 5-Pan Cap., Auto Fill/Auto Drain, 24" RG24-5 Gas, 5-Pan Cap., Auto Fill/Auto Drain, 24"

A B

B. SteamPro XVI Gas Large Capacity Steamers. Two compartment steamers. Electric, gas and direct steam boilers. Pressure/convection modes with no restrictions as to any combination of modes. Solid state controls operate timing, water level and safety functions. Automatic water fill on start up and automatic blowdown with additional manual drain valve. 60-minute mechanical timer or electronic controls. Manual operation mode and patented cold water condenser. Type 304 stainless steel construction. Model 36PCGM300 shown. Model Description 36PCEM48 16 Pans, Electric 48 kW 36PCGM300 16 Pans, Gas, 300K BTU 36PCSM 16 Pans, Steam Coil

F

F. EZ Series Steamers. Steam is generated by the product being cooked, which greatly reduces water usage. Reduced water means reduced mineral deposits, plus utility savings. Standard features include 18" or 24" narrow footprint design, manual fill, electromechanical controls and constant steam feature. 304 stainless steel construction. 316 stainless steel cooking chamber with coved corners. 3- and 5-pan models available. Model EZ18-3 shown. Model Description EZ18-3 3-Pan Cap., 18"W EZ18-5 5-Pan Cap., 18"W EZ24-3 3-Pan Cap., 24"W EZ24-5 5-Pan Cap., 24"W


Cooking Equipment | 66

Featured Chefs Nicholas Type and Seth Leifer

Using a measuring cup, place all ingredients in mixing bowl. With a whisk, gently mix the ingredients until fully emulsified and homogenous. If sauce is too thick, add drops of cold water until the sauce is a thick, ketchup-like consistency.

Station Eats Stamford, CT

Korea Burger

A

Pickled Vegetable Salad**

4 oz. organic beef burger (75/25) 3 shakes of kosher salt & ground black pepper mix

A. Electric Counter Convection Steamers. A real production workhorse with superior energy and water savings. The electric counter series is part of the PowerSteam™ Series. Super-heated steam results in faster cook times. Staged water fill for superior heat up and steam quality. Deluxe controls with 60-minute timer, buzzer and constant steam feature. Cook/ready light. Lighted power switch. Auto SmartDrain PowerFlush™ System. Stainless steel exterior/cooking compartments. Heavy-duty door and latch mechanism. Split water line connection. External deliming port. Model C24EA5-DLX shown. Model Description C24EA3-DLX 3-Pan Deluxe Elec Ctr. (Prof. Control Pkg) C24EA5-DLX 5-Pan Deluxe Elec Ctr. (Prof. Control Pkg)

11/2 oz. Korean red chili sauce* 2 oz. Asian pickled vegetable salad** 1 oz. spicy mayo*** 1/4

oz. melted butter

1 Toasted Martin’s potato sliced sandwich roll (1.9 oz.)

Make sure the griddle surface is hot. Season both sides of burger with kosher salt and fresh ground pepper. Place burger on griddle. Grill for 60-90 seconds and flip burger. Cook for an additional 60-90 seconds. While burger is grilling, drizzle melted butter on griddle and toast bun for 20 seconds. Note: Potato buns contain a high level of sugars and can burn if not attended to. Transfer burger and bun to a clean surface in order to dress. Apply toppings in the following order: 11/2 oz. Korean red chili sauce on top of the burger, 2 oz. pickled vegetable salad, 1 oz. spicy mayo. Note: a fried egg can be an additional topping option.

How Steam Cooking Works Steam is an extremely efficient heat transfer medium. It carries a great deal of energy which readily transfers directly to food (in steamers) or indirectly through a heat transfer surface (such as a kettle wall) and then into food. Steam is water (a liquid) that has been converted to its gaseous state by the application of heat energy. Heat energy typically is measured in British Thermal Units (BTU). The BTU is defined as the amount of energy required to raise the temperature of one pound of water by one degree Fahrenheit at sea level. It takes 180 BTUs to raise the temperature of one pound of water from 32°F (0°C) to 212°F (100°C), the point at which it starts to boil. However, to evaporate that same pound of boiling water into steam requires 970 BTUs. As a result, steam carries many times the energy of boiling water. Steam readily gives up that energy load when it condenses back into water (condensate) upon contact with the food.

Carefully close up the bun.

B

Korean Red Chili Sauce “Kochujang”* 1.1 lb. jar red pepper paste “Kochujang” 1/4 cup iced cold water 3/4 cup granulated white sugar 1/2 cup toasted sesame oil

1 seedless english cucumber, matchstick 2 cups carrots, matchstick 1 cup rice wine vinegar 1 cup granulated white sugar 1 oz. cup kosher salt 1 /2 oz ground black pepper In a bowl, mix vinegar, sugar and seasoning thoroughly. Calibrate height of Japanese berniner mandoline to that of a thick matchstick. Insert julienne blade (matchstick size). Cut washed vegetables into 3" sections. Using safety guard, move 3" vegetable section over the blade to create matchstick vegetable slices. Transfer julienned vegetables to mixing bowl and mix well with vinegar-sugar liquid. Allow 30-minutes to marinate before serving. Note: When placing pickled vegetables on burger, use tongs and make sure that the pickle juice is drained. This prevent diluting the Korean red chili sauce and causing dripping. Spicy Mayo*** 4 cups (1 qt.) mayonnaise cup siracha Using a measuring cup, place all ingredients in a mixing bowl. With a sanitized whisk, gently mix the ingredients until fully emulsified and homogenous.

1/3

B. SmartSteam 100 Boilerless Steamer. Groen has combined the convenience of boilerless steamers with twice as much cooking power for heavy-duty a la carte and production steaming. Different foods can be cooked simultaneously with no transfer of odors or tastes. Whether you choose gas or electric, you’ll get a fast, high-performance steamer that’s easy to install, operate and maintain. Automatic water fill and drain are standard for easy, convenient operation. UL listed or AGA design certified and NSF listed. Model Description SSB-3GM3-Pan, Gas SSB-3EM3-Pan, Electric SSB-3E 3-Pan, Electric, LH Door, 208V/60 Hz/3-Ph SSB-5EM5-Pan, Electric SSB-5E 5-Pan, Electric, LH Door, 208V/60 Hz/3-Ph SSB-10EFM10-Pan, Electric (2)SSB-3EFM(2) 3-Pan Electric, Stand Mount (2)SSB-5EFM(2) 5-Pan Electric, Stand Mount (2)SSB-10EFM- (2) 10-Pan Electric, Stand Mount (2)SSB-10GFM- (2) 10-Pan Gas, Stand Mount Additional models available.


&RRNLQJ(TXLSPHQW_

(GCVWTGF%JGH +RZWR6DYH(QHUJ\ 7XUQ RII (TXLSPHQW :KHQHYHU 3RVVLEOH ³ /HDYLQJ HTXLSPHQW WR LGOHXVHVHQHUJ\,GHQWLI\SHDNRSHUDWLRQWLPHVDQGWLPHVWKDWPD\ EHVORZHU

([HFXWLYH&KHI 0DUN9DQQDVGDOO 7KH5HVWDXUDQWVDW&KHVDSHDNH 2NODKRPD&LW\2.

6WDII 7UDLQLQJ ³ 0DNH VXUH \RXU VWDII LV WUDLQHG DQG XWLOL]LQJ WKH HTXLSPHQWWRLWVIXOOHVWFDSDFLW\

/REVWHU:KLWH*D]SDFKR

([DPLQH \RXU &RRNLQJ 0HWKRGV ³ %\ ORRNLQJ DW \RXU PHQX GHWHUPLQH ZKDW LWHPV FRXOG EH FRRNHG RQ PRUH HQHUJ\ HIILFLHQW HTXLSPHQW DQG PRGLI\ WKH XVH RI WKRVH SLHFHV RI HTXLSPHQW WKDW FUHDWHHQHUJ\ZDVWH

UHGJUDSHVFXWLQKDOI

R]OREVWHUWDLOV òFXSWRDVWHGDOPRQGV òFXSVFROGZDWHU òTWKHDY\FUHDP

0DLQWHQDQFH DQG 5HSDLU ³ +DYLQJ \RXU HTXLSPHQW VHUYLFHG UHJXODUO\FDQHOLPLQDWHHQHUJ\ZDVWH

òFXSFXFXPEHUVHHGHGDQGSHHOHG òFXSVFRFRQXWPLON

0DQXIDFWXUHU3DUWV³8WLOL]LQJPDQXIDFWXUHUSDUWVFDQKHOSUHGXFH HQHUJ\ZDVWHDVWKH\DUHPDGHVSHFLILFDOO\WRILW\RXUHTXLSPHQW

òFXS&RFR/RSH]

5HFDOLEUDWH ³ (QVXUH WKDW \RXU WKHUPRVWDWV DQG FRQWURO V\VWHPVDUHLQSURSHUZRUNLQJRUGHU&KHFNWKHPRIWHQWRHQVXUH FRUUHFWFRRNLQJWHPSHUDWXUHVWRUHGXFHHQHUJ\ORVV

7EVSVHDVDOW

6HDOV³&KHFNDOOGRRUVHDOVRQDUHJXODUEDVLVDQGUHSODFHZRUQ RXWVHDOVSURPSWO\WRUHGXFHHQHUJ\ORVV

FXSROLYHRLO

1HZ $SSOLDQFHV ³ :KHQ FRQVLGHULQJ WKH SXUFKDVH RI QHZ DSSOLDQFHV WDNH LQWR DFFRXQW HQHUJ\ UDWLQJV DV ZHOO DV WKH SRWHQWLDOIRUPXOWLSOHXVHV

FXSROLYHRLO

&DSDFLW\ ³ 3XUFKDVH NLWFKHQ HTXLSPHQW ZLWK FDSDFLW\ LQ PLQG (TXLSPHQW WKDW LV WRR ODUJH IRU \RXU RSHUDWLRQ ZDVWHV HQHUJ\ DV \RXKDYHWRKHDWRUFRROFDSDFLW\\RXZLOOQHYHUXVH /LJKWLQJ³)OXRUHVFHQWOLJKWVXVHPXFKOHVVHQHUJ\WKDQWUDGLWLRQDO OLJKWLQJ 7KH UDGLDQW KHDW LV DOVR OHVV ZLWK IOXRUHVFHQW OLJKWLQJ UHGXFLQJWKHRYHUDOOKHDWLQWKHNLWFKHQ

2YHQV³7RS(QHUJ\6DYLQJV7LSV &RPEL³0DNHVXUHWRIROORZWKHPDQXIDFWXUHUUHFRPPHQGDWLRQV IRUXVDJH/HDUQWKHSURJUDPPDEOHIHDWXUHVWKDWZLOODOORZ\RXWR LQFUHDVHHQHUJ\HIILFLHQFLHVDQGPD[LPL]HSURGXFWLRQ 6KXW 'RRUV ³ $ EXV\ NLWFKHQ FDQ JHW FUD]\  :KHQ WKH RYHQ LV HPSW\PDNHVXUHWKHGRRUVDUHIXOO\FORVHGWRUHGXFHWKHKHDWWKDW HVFDSHV 5HGXFH7HPSHUDWXUH³'XULQJVORZWLPHVWXUQWKHRYHQGRZQWR UHGXFHHQHUJ\FRQVXPSWLRQ )XOO\ /RDGHG ³ :KHQ SRVVLEOH ILOO WKH RYHQ WR FDSDFLW\ DV D IXOO RYHQZLOOLQFUHDVHWKHRYHQ·VHIILFLHQF\ 0DLQWDLQ³5HSODFHVHDOVDQGWLJKWHQ²PDNHVXUHWRUHDOLJQGRRUV WR NHHS KHDW LQ .HHS HTXLSPHQW FOHDQ DQ RQ D UHJXODU PDLQWH QDQFHVFKHGXOH

6WHDPHUV³7RS(QHUJ\6DYLQJV7LSV &ORVHWKH'RRU³.HHSLQJWKHGRRUFORVHGZLOONHHSWKHIRRGKRW DQGVWHDPLQEXWZLOODOVRUHGXFHZDVWHGHQHUJ\

FXSZKLWHEUHDGFUXVWVUHPRYHG FORYHJDUOLF &KLSRWOHSHSSHU EXQFKFKLYHV

7RDVW DOPRQGV 6HW D IHZ DVLGH WR JDUQLVK ILQDO GLVK 6RDN WKH UHVW RI DOPRQGVLQZDWHU RYHUQLJKWLVEHVW 3ODFHDOPRQGPL[WXUHLQEOHQGHUDQG SXUHH $GG LQ FXFXPEHUV FRFRQXW PLON EUHDG DQG JDUOLF %OHQG XQWLO VPRRWK 5HGXFHKHDY\FUHDPE\KDOIDQGVHWDVLGHWRFRRO$GGFUHDPDQG&RFR /RSH] WR PL[WXUH DQG VHDVRQ ZLWK VDOW 6WUDLQ OLTXLG WR UHPRYH DOPRQGV $GGTXDUWHURIDOPRQGSXUHHEDFNLQ3ODFHLQUHIULJHUDWRUWRFKLOO 5HPRYH OREVWHUV IURP VKHOOV DQG VOLFH LQWR VPDOO SLHFHV 6DXWH LQ EXWWHU XQWLO ³EDUHO\´ GRQH 7KH\ VKRXOG EH UHDOO\ WHQGHU 0DNH FKLSRWOH RLO DQG FKLYHRLOE\SXUHHLQJLQJUHGLHQWVWRJHWKHU3ODFHRLOVLQVTXHH]HERWWOHV 3ODFHOREVWHUDQGJUDSHKDOYHVLQPDUWLQLJODVVRUJODVVERZO7RSZLWK  R] RI VDXFH *DUQLVK ZLWK GURSV RI HDFK RLO DQG D IHZ VOLYHUV RI DOPRQGV +RSHIXOO\IURPHDFKELWH\RXZLOOJHWDULFKWDVWHRIWKHOREVWHUVZHHWQHVV RI WKH FRFRQXW D OLWWOH WDUW IURP WKH JUDSH VRPH FUXQFK IURP WKH DOPRQG DQGDOLWWOHKHDWIURPWKHFKLOLRLO(QMR\

&RPSDUWPHQWV³6KXWGRZQXQQHFHVVDU\FRPSDUWPHQWVGXULQJVORZSHULRGV 7LPHUV³6DYHHQHUJ\E\HQVXULQJWKDWWKHVWHDPHUUXQVDWIXOOKHDWRQO\ZKHQ QHHGHG &OHDQ,W³5HJXODUFOHDQLQJVZLOOKHOSHQVXUHWKDWHTXLSPHQWLVDOZD\VRSHUDWLQJ DWPD[LPXPHIILFLHQF\ 0DLQWDLQ ³ 6HUYLFLQJ WKH VWHDPHU UHJXODUO\ DQG UHSODFLQJ DQ\ ZRUQ RU EURNHQ SDUWVZLOOLQFUHDVHHQHUJ\HIILFLHQFLHV


&RRNLQJ(TXLSPHQW_ $3RZHU6WHDPŒ3UHVVXUHOHVV&RQYHFWLRQ6WHDPHUV 3DWHQWHGFDSDELOLW\VXSHUKHDWVWKHVWHDPEHIRUHLWHQWHUV WKH FRRNLQJ FRPSDUWPHQWV WR ƒ) UHVXOWLQJ LQ IDVWHU FRRN WLPHV 7ZR FRPSDUWPHQW VWHDPHU LV FRQVWUXFWHG RI  VHULHV VWDLQOHVV 7ZR KLJK RXWSXW VWDLQOHVV VWHHO JHQHUDWRUVLQHOHFWULFPRGHOV*DVPRGHOVIHDWXUH %78 VWDLQOHVV VWHHO JHQHUDWRU (DFK FRPSDUWPHQW KDV VHSDUDWH PDQXDO FRQWUROV 6SOLW ZDWHU OLQH FRQQHFWLRQ \HDU OLPLWHG SDUWV DQG ODERU ZDUUDQW\ 16) 8/ 0RGHO&($'/;VKRZQ

(GCVWTGF%JGH

$

&KHI%ULDQ5REHUWVRQ ([HFXWLYH&KHI 6DQ/XLV5HVRUW6SD &RQIHUHQFH&HQWHU *DOYHVWRQ7;

0RGHO'HVFULSWLRQ Includes Professional Control Package &*$'/; *DV3DQ'HOX[H6WHDPHUZ&DELQHW%DVH%78 &*$'/; *DV3DQ'HOX[H6WHDPHUZ&DELQHW%DVH%78 &($'/; (OHFWULF3DQ'HOX[H&RXQWHU6WHDPHU N: &($'/; (OHFWULF3DQ'HOX[H&RXQWHU6WHDPHU N: &($'/; (OHFWULF3DQ'HOX[H6WHDPHUZ&DELQHW%DVHN: &($'/; (OHFWULF3DQ'HOX[H6WHDPHUZ&DELQHW%DVHN:

6HDUHG3RUN%HOO\ 1 berkshire pork belly 1 slice brioche 1 whole egg 1/8

oz. frisee

1 Tbsp. rice wine vinegar 1 Tbsp. maple syrup 1 tsp. Sri Racha

6FRUHDQGVHDUWKHEUDLVHGR]IDWW\VLGHRI SRUN EHOO\ LQ D VNLOOHW XQWLO FULVS\ 7XUQ RYHU DQG JOD]H ZLWK PDSOH V\UXS )LQLVK KHDWLQJ LQ RYHQWRLQWHUQDOWHPSRIƒ)7RDVWEULRFKH LQ WKH VDPH VNLOOHW LQ WKH UHQGHUHG SRUN IDW IURPWKHEUDLVH6HSDUDWHHJJ\RONDQGZKLWH IU\ WKH HJJ ZKLWH LQ WKH UHQGHUHG SRUN IDW 3RDFK WKH HJJ \RON PHGLXP LQ WKH JHODWLQ UHVHUYHGIURPWKHEUDLVLQJOLTXLG /D\ WKH EULRFKH LQ WKH FHQWHU RI WKH SODWH 3ODFHWKHSRUNEHOO\IDWW\VLGHXSRQWRSRIWKH EULRFKH 5ROO WKH HJJ \RON OLNH D FLJDU DQG SODFHDFURVVWKHSRUNEHOO\7RVVWKHIULVHHLQ WKHULFHZLQHYLQHJDUDQGSODFHGLUHFWO\RQWRS RI WKH UROOHG HJJ ZKLOH IRUPLQJ D VPDOO QHVW 3ODFH WKH PHGLXP SRDFKHG HJJ \RON LQ WKH QHVW 'UL]]OH D WDEOHVSRRQ RI WKH SRDFKLQJ OLTXLG RQ WKH SODWH *DUQLVK ZLWK 6UL 5DFKD PDNLQJGRWVDURXQGWKHSRUNEHOO\

+RZ0XFK6WHDPHU'R<RX1HHG" 0HDOV6HUYHG 3HU+RXU

   

1RRI 6WHDPHUV

2QH 2QH 2QH 7ZR

1RRI&RPSDUWPHQWV 3HU6WHDPHU

2QH 7ZR 7KUHH 7ZR

7KLVLQIRUPDWLRQDVVXPHVWKDWHDFKFRPSDUWPHQWKROGVWKUHHWRIRXU[[ IRRGSDQVRUWZRWRWKUHH[[IRRGSDQV

% %([KDXVW)DQV %XLOWIRUHQGXUDQFH&DSWLYH$LUH¶VKHDY\GXW\ZHDWKHUSURRIIDQVDUHDYDLODEOHZLWKEHOWRU GLUHFWGULYHPRWRUV&DSWLYH$LUH¶VH[KDXVWIDQVDUHPDQXIDFWXUHGVRWKDWIRUFHGIUHVKDLU WKURXJKWKHPRWRUFRPSDUWPHQWFRROVPRWRUDQGHQVXUHVORQJPRWRUOLIH$TXLFNUHOHDVH ODWFKDOORZVIRUHDV\DFFHVVWRWKHPRWRU$OOXQLWVFRPHZLWKDVWDQGDUGGLVFRQQHFWVZLWFK Contact our Customer Service Department for assistance.


Cooking Equipment | 69

A

A. Utility Distribution System. Captive-Aire’s utility distribution system (UDS) provides unequaled cooking line versatility, flexibility and convenience. The UDS provides gas, water, steam and electrical connections to accommodate for kitchen cooking appliance needs. Each UDS system is designed with spare connection points allowing for future cooking equipment expansion. ETL and NSF listed. Contact our Customer Service Department for assistance.

Kitchen Ventilation Systems Tips for the Selection and Use When Selecting: 1. Know what your local codes require for ventilation. 2. Know what your growth plans are. It is easy to buy a little extra now but difficult to add on later. 3. Know how the ventilation system is designed to perform. An improperly designed ventilation system will dramatically affect your monthly utility bills, as well as create an uncomfortable, and possibly dangerous, working environment. 4. Use listed products. UL or ETL listing on hood, duct and fans may result in substantially lower insurance rates. Ask your underwriter for an assessment.

When Operating:

B. Exhaust Hood w/PSP. Captive-Aire’s next generation exhaust hoods provide superior low exhaust flow rates with exceptional capture and containment of cooking vapors. Constructed of stainless steel and double wall insulated front, CaptiveAire’s exhaust hoods are essential for your kitchen ventilation needs. Features include heavy-duty grease baffle filters, grease drain systems, pre-punched hanging angles and pre-wire lighting. ETL, NSF. Model ND2-PSP shown. Contact our Customer Service Department for assistance.

B

1. Always service your fans. A loose fan belt or clogged in-take filter on the supply air fan will affect the performance of the system. Results of letting this maintenance lapse can be anything from a lack of capture ability, resulting in smoke and grease escaping into the surrounding area, to the fans shutting down completely, or worse. Set up a regular maintenance schedule at the same time you have your heating/air conditioning units checked. The same company can perform both maintenance functions. 2. Always keep the exhaust duct clean. A regular cleaning schedule should be set up with a cleaning company. Frequency of cleaning is dictated by the type and volume of cooking—in some cases every 30 days; in other cases, every 6 months. You must make the determination. 3. Clean the grease filters as often as necessary. They are made to be cleaned in most commercial dishwashers or the pot sink. If they are not cleaned regularly, the performance of the system suffers. 4. To help in maintaining the surface appearance, coat all stainless surfaces with a LIGHT covering of mineral oil, then wipe dry. This soaks into the pores of the metal and makes clean-up easier. Do not use mineral oil on the stainless grease filters. It is not necessary to coat the stainless every time you clean, only to keep a film of oil on the surfaces.

C C. Modular Package Unit. Packaged air conditioning and heating unit for 100% outdoor air applications. Units are sized to operate between 360 to 600 cfm/ton of cooling, depending on climate. These units provide sensible cooling, efficient heating and the most intelligent approach to make-up air. Contact our Customer Service Department for assistance.

The key to all of the above is maintenance. The ventilation system is more than just the stainless box that you see in your kitchen. It includes the grease filters, grease duct, exhaust fan, supply fan, supply fan filters, supply fan duct, electrical or gas controls, motors and belts and design. If properly sized and properly maintained, it will save you money on your utilities. However, if the system is neglected, it will cost you each and every day of operation. The first cost of an improperly designed system may be lower, but the long term effect on heating/air conditioning equipment, as well as the energy usage, will soon catch up with your bottom line.


&RRNLQJ(TXLSPHQW_

(GCVWTGF%JGH

$6RQLF6WHDPHU /DUJHFDSDFLW\VWHDPHURIIHUVDFRVWHIIHFWLYHDQG FRQYHQLHQW DOWHUQDWLYH WR D ³WUDGLWLRQDO´ VWHDPHU 1RZDWHUOLQHQRGUDLQOLQHRUYHQWKRRGWRZRUU\ DERXW +ROGV  IXOOVL]H  VWHDP WDEOH SDQV ZLWK FRYHUV&RQQHFWLRQOHVVVWHDPHUIHDWXUHVLQFOXGH KHDWLQJ HOHPHQWV  SURJUDPPDEOH PHPRU\ SDGV ZLWK  PHPRU\ FDSDELOLW\ SURJUDPPDEOH RU GLDO WLPHU  SRZHU OHYHOV VWDJH FRRNLQJ DQG UHPRYDEOHFHQWHUVKHOI6HHWKURXJKRYHQGRRULV GURSGRZQFRXQWHUVW\OH 0RGHO'HVFULSWLRQ 1( :DWWV 1( :DWWV

$

&KHI&DUO'H/XFH &UDQZHOO5HVRUW6SD *ROI&OXE /HQR[0$ %/LJKW'XW\&RPPHUFLDO0LFURZDYH2YHQV /LJKW 'XW\ &RPPHUFLDO 0LFURZDYH 2YHQV DUH FRQVWUXFWHG ZLWK D VWDLQOHVV VWHHO GRRU DQG FDQ FRPH ZLWK GXUDEOH VWDLQOHVV VWHHO LQVLGH DQG RXW DOOWRPHHW16)VWDQGDUGV'RRUKLQJHVDUHWHVWHG XSWRWLPHVPRUHWKDQUHTXLUHG $OOPRGHOVKDYHZDWWVRIFRRNLQJSRZHUDQG IHDWXUH D XQLTXH ³%RWWRP (QHUJ\ )HHG´ V\VWHP WKDWJHWVWKDWFRRNLQJSRZHUULJKWWRWKHIRRG3LFN \RXUSURGXFW ‡1()PLQXWHGLDOWLPHU ‡1() VKRZQ SURJUDPPDEOHPHPRU\SDGV ‡1()³$OOVWDLQOHVV´ FDELQHWERG\ SURJUDPPDEOH 0RGHO'HVFULSWLRQ 1() 66([WHULRU0LQ'LDO7LPHU 1() 66([WHULRU3RZHU/HYHOV 1() 66,QWHULRU([WHULRU3RZHU/HYHOV

$SSOH7DUWZLWK&DUDPHO6DXFH ,FH&UHDP 7DUW FRUHGDQGSHHOHG*UDQQ\6PLWKDSSOHV VL[LQFKURXQGSXIISDVWU\VKHHWV WVSVXSHUILQHVXJDU VFRRSVYDQLOODLFHFUHDP WVSFRQIHFWLRQHUVVXJDU

%

0RGHO'HVFULSWLRQ 1( :DWW <HDU:DUUDQW\

1( :DWW <HDU:DUUDQW\

1( :DWW <HDU:DUUDQW\

1( :DWW <HDU:DUUDQW\

1( :DWW <HDU:DUUDQW\

1( :DWW <HDU:DUUDQW\

& &3UR,0LFURZDYHV 'HVLJQHG IRU KLJK YROXPH XVH DQG FHUWDLQ WR DVVLVW DQ\ W\SH RI NLWFKHQ ZLWK HIILFLHQF\ DQGXVH(TXLSSHGZLWKWRSDQGERWWRPHQHUJ\ IHHG D ³JUDE  JR´ GRRU KDQGOH DQG  SURJUDPPDEOHSDGV8VLQJRU ZDWWVRISRZHUWKHVHPRGHOVDUHWKHGHILQLWLRQ RIWKHZRUG³GXUDEOH´8/DQG16)DSSURYHG

&XW VL[LQFK URXQGV RI SDVWU\ IURP SDUWLDOO\ WKDZHG SXII SDVWU\ GRXJK 3ODFH RQ JUHDVHG FRRNLH VKHHW &XW WKH FRUHG DSSOHV LQ KDOI DQG VOLFH WKLQO\ LQWR LQFK VOLFHV $UUDQJH DSSOH VOLFHV RQ WKH SDVWU\ LQ DQ RYHUODSSLQJ FLUFOH NHHSLQJWKHDSSOHVLQFKIURPWKHHGJHRIWKH SDVWU\'XVWHDFKZLWKDWHDVSRRQRIVXSHUILQH VXJDU3ODFHDWHDVSRRQRIEXWWHULQWKHFHQWHU RI HDFK WDUW %DNH DW ƒ IRU DSSUR[LPDWHO\  PLQXWHV 127( 7KH DSSOH WDUWV FDQ EH PDGH LQ DGYDQFH DQG IUR]HQ )UR]HQ WDUWV WDNH DQ DGGLWLRQDOPLQXWHVWRFRRN &DUDPHO6DXFH FXSKHDY\FUHDP FXSVXJDU 3ODFH D KHDY\ VDXFHSDQ RQ WKH VWRYH RYHU PHGLXP KHDW 3RXU VXJDU LQ SDQ 8VLQJ D ZRRGHQVSRRQVSUHDGWKHVXJDUHYHQO\DFURVV WKHERWWRPRIWKHSDQDQGWKHQVWLUVORZO\XQWLO WKH VXJDU LV GLVVROYHG DQG LV D JROGHQ FRORU 6ORZO\ DGG WKH FUHDP DQG VWLU RYHU PHGLXP KHDWXQWLOLWLVDOLJKWFRORUHGFUHDP\FDUDPHO 7R6HUYH 3XWFDUDPHOVDXFHRQERWWRPRIDQWRLQFK SODWH 3ODFH DSSOH WDUW LQ WKH FHQWHU 7RS ZLWK LFH FUHDP GUL]]OH ZLWK D OLWWOH FDUDPHO VDXFH DQGGXVWZLWKFRQIHFWLRQHUVVXJDU


&RRNLQJ(TXLSPHQW_ $+'&6HULHV0LFURZDYHV &RPSDFW IOH[LEOH SRZHUIXO YDOXH +HDY\GXW\ RYHQV RIIHU SRZHUIXO KHDWLQJ SHUIRUPDQFH LQ D VSDFHVDYLQJ GHVLJQ 'XUDEOH DQG VWDFNDEOH WKHVH RYHQV DUH LGHDO IRU KDUGXVH KLJKYROXPH RSHUDWLRQV DQG IHDWXUH D XQLTXHPHWKRGRIHQHUJ\GLVWULEXWLRQWRSURYLGHVXSHULRU HYHQKHDWLQJ ,WV FRPSDFW IRRWSULQW HDVLO\ FRRNV DQG VWHDPVZLWKSRZHUOHYHOVSURJUDPPHPRU\DQG VWDJH;PXOWLSOHTXDQWLW\ SDG ,QFOXGHV D IXOO \HDU ZDUUDQW\ ([WHULRU +[:[' ,QWHULRU +[:[' 0RGHO'HVFULSWLRQ +'&$ :DWWV +'& :DWWV +'& :DWWV

%

&RPPHUFLDOYV5HVLGHQWLDO 0LFURZDYHV

$

8VLQJ D PLFURZDYH EXLOW IRU UHVLGHQWLDO XVH LQ D IRRGVHUYLFHHQYLURQPHQWFDQEHYHU\FRVWO\DQGFDQ DOVR FUHDWH VRPH YHU\ VHULRXV VDIHW\ KD]DUGV DV LW WULHVWRNHHSXSZLWK\RXUGHPDQGV +HUH DUH D IHZ IDFWV LOOXVWUDWLQJ WKH EHQHILWV RI FRPPHUFLDO

%5&6HULHV0LFURZDYHV 6WDLQOHVV VWHHO RYHQV IHDWXUH  SRZHU OHYHOV VWDJH FRRNLQJSURJUDPVHWWLQJVDQGD\HDUIXOOZDUUDQW\ ,GHDO IRU TXLFN VHUYLFH FKDLQV EDUV FRQYHQLHQFH VWRUHV DQG IDPLO\ UHVWDXUDQW IRRGVHUYLFH RSHUDWLRQV DQG PRUH *UHDW IRU VWHDPLQJ 4XDQWLW\ SDG WR DXWRPDWLFDOO\ DGMXVW FRRNLQJ WLPH IRU XS WR  SRUWLRQV ([FOXVLYH DXWRPDWLF YROWDJH VHQVRU IRU HDV\ LQVWDOODWLRQ 0XOWLOHYHO IHHG V\VWHPIRUKHDWLQJXQLIRUPLW\7LPHHQWU\RSWLRQIRUQRQ SURJUDPPHGFRRNLQJ([WHULRU:[+[' ,QWHULRU:[+[' 0RGHO'HVFULSWLRQ 5&6 :DWWV 5&6 :DWWV 5&6 :DWWV

0HHWV FRPPHUFLDO LQVXUDQFH SROLF\ DQG KHDOWK LQVSHFWRUUHTXLUHPHQWV 7HVWV WR KLJKHU VWDQGDUGV IRU DGGHG VDIHW\ DQG SHDFHRIPLQG %XLOW VWURQJHU ZLWK KLJKHU TXDOLW\ FRPSRQHQWV FRROLQJ IDQV WUDQVIRUPHUV DQG FRQWURO SDQHOV (TXLSSHG ZLWK KHDY\GXW\ SRZHU FRUGV DQG FRPPHUFLDOTXDOLW\UHOD\V &RQWURO SDQHO DOORZV HDV\ PHQX SURJUDPLQJ IRU FRQVLVWHQWUHVXOWVHYHU\WLPH 0RUHSRZHUIXOIRUIDVWHUKHDWLQJDQGEHWWHUTXDOLW\ UHVXOWV ,QWHUQDO VWLUUHU JLYHV \RX HYHQ FRRNLQJ UHVXOWVZLWKRXWWKHKDVVOHVRIDWXUQWDEOH &RPPHUFLDO PLFURZDYHV FRPH ZLWK D ZLULQJ GLDJUDP WKDW DOORZV IRU IDVWHU DQG PRUH DFFXUDWH VHUYLFLQJ 5HVLGHQWLDO PLFURZDYHV RIWHQ UHTXLUH FRPSOHWHUHSODFHPHQWDIWHUDFRPSRQHQWIDLOXUH

&RRNLQJ *XLGHV 5HFLSHV

&

&5&66HULHV0LFURZDYHV 'XUDEOH VWDLQOHVV VWHHO FRQVWUXFWLRQ IRU \HDUV RI UHOLDEOH IRRGVHUYLFH XVH 6WDLQOHVV VWHHO FRQVWUXFWLRQ FDELQHWDQGFDYLW\DUHGXUDEOHDQGSURIHVVLRQDOORRNLQJ6WDFNDEOHGHVLJQPD[LPL]HVFRRNLQJVSDFH$LU ILOWHUSURWHFWVRYHQFRPSRQHQWVIURPJUHDVHODGHQDLU,WVFXELFIRRWFDSDFLW\DFFRPPRGDWHVD SODWWHU 0RGHO 5&676 IHDWXUHV  SRZHU OHYHOV VWDJH FRRNLQJ RSWLRQ  SURJUDP PHPRU\ PXOWLSOH TXDQWLW\ SDG DQG WLPH HQWU\ RSWLRQ IRU DGGHG IOH[LELOLW\ 0RGHO 5&6'6 VKRZQ  IHDWXUHV PLQXWHWLPHUZDWW 0RGHO'HVFULSWLRQ 5&6'6 0LQXWH'LDO7LPHU 5&6'6( 0LQXWH'LDO7LPHU 5&676 3RZHU/HYHOV;4W\3DG3URJUDP3DGVIRU0HQX,WHPV

'+LJK6SHHG2YHQV 0RGHO 0;3 FRPELQHV GLUHFWHG DLU UDGLDQW DQG PLFURZDYH FRRNLQJ WHFKQRORJLHV ZKLOH WKH 0&( FRPELQHV FRQYHFWLRQ DQG PLFURZDYH FRRNLQJ WHFKQRORJLHV (UJRQRPLF HDV\WRFOHDQ GHVLJQ LV VLPSOHWRXVH ZLWK SURJUDPPDEOH FRQWUROV ,QWHOOLJHQW GHVLJQ GHWDLOV LQFOXGLQJ WKH DELOLW\ WR XVH VWDQGDUG PHWDO SDQV 2SHUDWRUV DFKLHYH DPD]LQJ UHVXOWV LQ D IUDFWLRQ RI WKH WLPHRIWUDGLWLRQDOFRRNLQJPHWKRGV 0RGHO'HVFULSWLRQ 0&( &RQYHFWLRQ0LFURZDYH²ƒ)WRƒ)&RQYHFWHG+HDW:DWWV0LFURZDYH3RZHU ([WHULRU+[:[',QWHULRU+[:[' 0;3 'LUHFWHG$LU5DGLDQW0LFURZDYH²:DWW5DGLDQW:DWWV0LFURZDYH3RZHU ([WHULRU+[:[',QWHULRU+[:['

0&(

'

0;3


&RRNLQJ(TXLSPHQW_

$

$5066HULHV0LFURZDYH2YHQV 7KHVHGHSHQGDEOHRYHQV DUH HDV\ WR XVH IRU IDVW FRQYHQLHQW RSHUDWLRQ 0RGHO506'IHDWXUHVXVHUIULHQGO\PLQXWHGLDOWLPHUZLWKLOOXPLQDWHG GLJLWV DQG HQGRIF\FOH DXGLEOH VLJQDO 0RGHO 5067 DQG 50676 IHDWXUH WRXFK SDG SURJUDPV IRU XS WR  PHQX LWHPV  SRZHU OHYHOV DQG  FRRNLQJ VWDJHV 2YHQV IHDWXUH VWDLQOHVV VWHHO H[WHULRU ZUDS DQG D ZKLWH SRZGHU FRDW SDLQWHG LQWHULRU 506'5067  RU VWDLQOHVV VWHHO LQWHULRU 50676 ,WVFXELFIWFDSDFLW\DFFRPPRGDWHVDSODWWHU ZDWW0RGHO506'VKRZQ 0RGHO'HVFULSWLRQ 506' 0LQXWH'LDO7LPHU 5067 3RZHU/HYHOV3URJUDP3DGVIRU0HQX,WHPV VWDJH&RRNLQJ 50676 3RZHU/HYHOV3URJUDP3DGVIRU0HQX,WHPV VWDJH&RRNLQJ$OO6WDLQOHVV6WHHO

% %5)66HULHV0LFURZDYH ([WUD SRZHU UHOLDELOLW\ DQG YDOXH 6WDLQOHVV VWHHO RYHQV FDQ EH FXVWRPL]HGIRUHYHU\DSSOLFDWLRQIURPVQDFNEDUVDQGUHVWDXUDQWV WR KRVSLWDO IRRG VWDWLRQV  SRZHU OHYHOV²KROG GHIURVW PHGLXP PHGLXPKLJK DQG IXOO  SURJUDP PHPRU\ VWDJH FRRNLQJ IRU DGGLWLRQDOSUHSDUDWLRQVRSKLVWLFDWLRQDQGFDSDFLW\'LJLWDOGLVSOD\ ZLWK FRXQWGRZQ WLPHU IRU DWDJODQFH PRQLWRULQJ 8SJUDGHG PRGHOV IHDWXUH FRQWURO SDQHO JUDSKLFVLFRQV UDWKHU WKDQ ZRUGV WR HOLPLQDWHODQJXDJHEDUULHUVFXELFIWFDS)XOO\HDUZDUUDQW\ ([WHULRU+[:[',QWHULRU+[:[' 0RGHO'HVFULSWLRQ 5)6036$ :DWWV 5)6036 :DWWV

& &5LFH&RRNHUV :LWK LWV ODUJH FDSDFLW\ WKHVH 16) DQG 8/ FRPPHUFLDOOLVWHG 5LFH &RRNHUV DUH HQJLQHHUHG ZLWK SXVKEXWWRQ RSHUDWLRQ D EXLOWLQ WKHUPRVWDWIRUSUHFLVLRQFRQWURODQGDGLUHFWKHDWLQJV\VWHP²UHVXOWLQJLQ ULFHWKDWLVFRRNHGHDVLO\VDIHO\DQGHIIHFWLYHO\,WV³QHZ´GHQWUHVLVWDQW SDQ LV HDV\ WR FOHDQ   DQG FXS FDSDFLWLHV DYDLODEOH 0RGHO65+=3VKRZQ 0RGHO'HVFULSWLRQ 65= &XS  R]3RUWLRQV 1RQ6WLFN

65+=3 &XS  R]3RUWLRQV 65*$ &XS  R]3RUWLRQV

'5LFH&RRNHU 6WDQGDUG IHDWXUHV LQFOXGH WULJJHU KDQGOH²SUHVV EXWWRQ DQG OLIW WR RSHQ 7KH KHDWHGOLQHG OLG HQVXUHV HYHQ FRRNLQJ $ UHPRYDEOH OLQHU PDNHV FOHDQXS HDV\ 1RPHVV VHUYLQJ² PRLVWXUHFXSFROOHFWVZDWHUVRLWZRQ¶W GULSRQFRXQWHU,QVXODWHGGRXEOHZDOO VWDLQOHVV VWHHO FRQVWUXFWLRQ KROGV LQ KHDWNHHSLQJFRQWHQWVPRLVWDQGZDUP IRUKRXUV$XWRPDWLFDOO\VKLIWVWRZDUP PRGHZKHQIRRGKDVILQLVKHGFRRNLQJ 0HDVXULQJ FXS DQG SDGGOH LQFOXGHG 16)0RGHO

'

( (5HWUR6WRFN3RW.HWWOH5HWKHUPDOL]HUV 6OHHNUHWURVW\OLQJDFRROWRWRXFKH[WHULRUDQGILYHFRORURSWLRQV PDNH WKH 5HWUR .HWWOH WKH JRWRFKRLFH IRU VKRZFDVLQJ SURGXFWV VXFK DV FKLOL VRXSV DQG VWHZV 9LEUDQW FRORUV HQKDQFH SUHVHQWDWLRQ DQG GUDZ DWWHQWLRQ WR YDULHW\ LQ PHQX RIIHULQJV 'HVLJQHGZLWKIURQWRIWKHKRXVHORRNVWKH5HWUR.HWWOH6WRFN3RW 5HWKHUPDOL]HUV DOVR IHDWXUH EDFNRIWKH KRXVH SHUIRUPDQFH DQG GXUDELOLW\ $ FHUDPLF EDVH HOHPHQW DQG WKHUPRVWDWLF FRQWURO HQVXUHDIDVWVWDUWXSDQGSUHFLVHFRQVLVWHQWSHUIRUPDQFH6WXUG\ KDQGOHVPDNHWKHVHXQLWVHDV\WRWUDQVSRUWDQGKDQGOH 0RGHO'HVFULSWLRQ  4W1DWXUDO  4W*UHHQ$SSOH  4W3HDUO:KLWH  4W)LUH(QJLQH5HG  4W%ODFN  4W1DWXUDO  4W*UHHQ$SSOH  4W3HDUO:KLWH  4W)LUH(QJLQH5HG  4W%ODFN


&RRNLQJ(TXLSPHQW_ $*ULOO([SUHVVŒ7ZR6LGHG6DQGZLFK*ULOOV 7KHVHWZRVLGHGJULOOVSURYLGHKLJKSHUIRUPDQFHDWDQDIIRUGDEOHSULFH+HDY\GXW\FDVWLURQSODWHQVDYDLODEOHLQVPRRWK RUJURRYHGSURYLGHORQJOLIHDQGVXSHULRUSHUIRUPDQFHWRPHHW\RXUPHQXUHTXLUHPHQWV7KHUPRVWDWLVUDWHGIURPƒ) WRƒ)DQGSURYLGHVDFFXUDWHVHQVLQJRIWHPSHUDWXUH6XSHULRUKHDWGLVWULEXWLRQIDVWUHFRYHU\HIIRUWOHVVRSHUDWLRQDQG FRQVLVWHQWUHVXOWV5HPRYDEOHJUHDVHWURXJKDOORZVHDV\FOHDQXS 0RGHO'HVFULSWLRQ *;,* :['[+,URQ*URRYHG *;,6 :['[+,URQ6PRRWK *;,* :['[+,URQ*URRYHG *;,6 :['[+,URQ6PRRWK *;,* :['[+,URQ*URRYHG $ *;,6 :['[+,URQ6PRRWK *;,*6 :['[+,URQ*URRYHG6PRRWK

& % %3DQLQL 6DQGZLFK*ULOOV (YHQO\GLVWULEXWHGFRRNLQJWHPSHUDWXUHVIRUXSSHUDQGORZHUSODWHV DOORZ \RX WR JULOO ERWK VLGHV ZLWKRXW IOLSSLQJ +HDY\GXW\ VWDLQOHVV VWHHO FRQVWUXFWLRQ ZLWK D WHPSHUDWXUH FRQWURO VZLWFK DGMXVWV IURP ƒ) WR ƒ) 5HPRYDEOH VWDLQOHVV VWHHO RLO WUD\ DQG EUXVK IRU HDV\ FOHDQLQJ 'RXEOH VDQGZLFK JULOO LQFOXGHV  FRUGV VR RQH JULOO FDQEHXVHGDWDWLPH6LQJOHGLPHQVLRQV[ XSSHU [ ORZHU  'RXEOH GLPHQVLRQV [ XSSHU  [ ORZHU  3DQLQL GLPHQVLRQV[ XSSHU [ ORZHU 9:&( DQG16)DSSURYHG 0RGHO'HVFULSWLRQ 6*( 5LEEHG3DQLQL*ULOO 6*() )ODW3DQLQL*ULOO 6* 5LEEHG6DQGZLFK*ULOO 6*) )ODW6DQGZLFK*ULOO 6* 'RXEOH6DQGZLFK*ULOO

'

'3UR0D[Š 7ZR6LGHG6DQGZLFK*ULOOV 'LVWLQFWLYHJULGSDWWHUQFUHDWHVDWWUDFWLYHVHDU PDUNV RQ 3DQLQL VDQGZLFKHV KDPEXUJHUV FKLFNHQ EUHDVWV DQG RWKHU IRRG SURGXFWV (XURVW\OH GHVLJQ LV EXLOW WR GHOLYHU \HDUV RI PDLQWHQDQFH IUHH RSHUDWLRQ 6WDU¶V QHZ ³3UR/LIW´Œ KLQJH GHVLJQ SURYLGHV VXSHULRU GXUDELOLW\SHUIRUPDQFHDQGVDIHW\3UR/LIWLV GHVLJQHGWRRSHUDWHRYHUPLOOLRQF\FOHVDQG LWVXQLTXHGHVLJQSURYLGHVWKHRQO\WUXHOHYHO IORWDWLYH V\VWHP RQ WKH WRS SODWHQ IRU LPSURYHGSHUIRUPDQFH

0RGHO'HVFULSWLRQ &*,% :['[+,URQ*URRYHG &*,($ :['[+,URQ*URRYHGZ7LPHU &*($ :['[+$OXPLQXP*URRYHGZ7LPHU *5($ :['[+$OXPLQXP6PRRWKZ7LPHU &*% :['[+$OXPLQXP*URRYHG *5% :['[+$OXPLQXP6PRRWK $GGLWLRQDOPRGHOVDYDLODEOH

&3DQLQL 6DQGZLFK*ULOOV 3HUIHFW IRU &XEDQ VDQGZLFKHV TXHVDGLOODV EXUULWRV KDP DQG FKHHVH VDQGZLFKHV YHJJLHV DQG 3KLOO\ VWHDN VDQGZLFKHV 6HDVRQHG KHDY\GXW\ FDVW LURQ JULGGOH SODWHV 3DQLQL JULOOV KDYH JURRYHG SODWHV 6DQGZLFK JULOOV KDYH VPRRWK SODWHV 0DFKLQH ILQLVKHG FRRNLQJ VXUIDFH 6WDLQOHVV VWHHO FRQVWUXFWLRQ 2QRII VZLWFK +DQGOHV IRU HDV\ WRWLQJ +HDY\ GXW\ KLQJH 

 VWDLQOHVV VWHHO DGMXVWDEOH IHHW 5HPRYDEOH HDV\WRFOHDQ VWDLQOHVV VWHHO FDWFKWUD\IRRWSRZHUFRUG0RGHOV6*DQG3*VKRZQ 0RGHO'HVFULSWLRQ &33*6 6PDOO3DQLQL/[:[+ 3* 3DQLQL9/[:[+ 3* 3DQLQL9/[:[+ &36*6 6PDOO6DQGZLFK*ULOO/[:[+ 6* 6DQGZLFK*ULOO/[:[+

( (3DQLQL*ULOOV (YHQO\ GLVWULEXWHG FRRNLQJ WHPSHUDWXUHV DOORZ \RX WR JULOO ERWK VLGHV ZLWKRXW IOLSSLQJ &RQVWUXFWHG RI KHDY\GXW\ EUXVKHG VWDLQOHVV VWHHO ZLWK DQ DGMXVWDEOH WKHUPRVWDW WR ƒ) +LQJHG DXWREDODQFLQJWRSSODWHWRVXLWIRRGVXSWRWKLFN3RZHUDQG UHDG\ LQGLFDWHU OLJKWV +HDWUHVLVWDQW KDQGOHV /LPLWHG \HDU ZDUUDQW\8/16) 0RGHO'HVFULSWLRQ :3* 5LEEHG[[ :3* 5LEEHG[[ :3* 5LEEHG'XDO[[ :)* 6PRRWK[[ :)* 6PRRWK[[ :)* 6PRRWK'XDO[[


Cooking Equipment | 74

A B A. Induction Cookers. Garland’s Green Heat induction ranges deliver superior energy efficiency and fast heating in any application. Features a rotary switch for precise power level control. No open flame allows for much cooler working conditions. Its RTCS system automatically shuts off when the pan is removed and provides boil-dry protection for workplace safety. RTCS system auto adjusts for best performance with a variety of induction pans. Stainless steel body provides superior durability, while its ceramic glass top makes it easy to clean. Model Description GI-BH/BA 2500 10.2W"x10.2"D Ceramic Top, 2,500W, 2.5 kW, 208/240V GI-BH/BA 3500 10.2W"x10.2"D Ceramic Top, 3,500W, 3.5 kW, 208/240V GI-SH/BA 3500 12.6W"x12.6"D Ceramic Top, 3,500W, 3.5 kW, 208/240V GI-SH/BA 5000 12.6W"x12.6"D Ceramic Top, 5,000W, 5 kW, 208V

C. 13" Countertop Induction Range. This new induction range provides the most energy efficient cooking in the world! Seamless stainless steel construction with durable ceramic cooktop and easy-toclean controls. This portable and C lightweight induction cooker will heat food up to 460°F while maintaining a safe cooking surface that won’t burn or injure cooks. Perfect for buffet lines and front-of-the-house use where a hot surface could cause discomfort or pose a danger to guests. Features adjustable feet, 7 power levels, error code alert display, automatic empty pan shut off and digital timer. Model GIR18

B. Griddle Top Induction Cookers. Garland’s Green Heat induction griddles let you cook up your signature burgers, eggs and pancakes, while delivering superior energy efficiency and lightning-fast heating. The RTCS system automatically compensates for minor temperature changes on the cooking surface and maintains even temperature across the entire cooking surface. Rotary dial with LED readout sets temperature for instant searing and precise temperature control on delicate items. The removable splash guard protects walls and countertop. Front grease trough for easy cleaning. Model Description GI-SH/GR 3500 19.1W"x13.6"D, 3,500W, 31/2 kW, 208V GI-SH/GR 3500 19.1W"x13.6"D, 5,000W, 5 kW, 208V

Energy efficient cooking power

D D. Induction Wok Cookers. Garland’s Green Heat induction wok cookers deliver superior energy efficiency and fast heating in any application. Its recessed ceramic bowl and protective stainless steel edge accepts wok pans, allowing you to make delicious stir fry dishes with ease. Rotary dial with LED readout adjusts for precise power level control. RTCS system automatically shuts off when the pan is removed and provides boil-dry protection for workplace safety. Stainless steel body provides superior durability. Model Description GI-SH/WO/3500 11.8" Dia., 3,500W, 31/2 kW, 208/240V GI-SH/WO/5000 11.8" Dia., 5,000W, 5 kW, 208V

F E

E. Induction Ranges. Wide selection of induction ranges available in Commercial, Professional and Ultra Series. The new Mirage ® series expand the selections of both countertop and drop-in units. Just a few of the many features include over-heat protection, pan-auto detection and auto shut-off function. 18 gauge, 304 stainless steel constructed case frame with ceramic top. Push-button controls. UL, FC, NSF. Parts and labor warranty: 1-year on Mirage and Commercial, 2-year on Professional and Ultra Series. Model Description 59501 Mirage Series, Drop-In Single 6950020 Commercial Series, Counter Single 69504 Ultra Series, Countertop Single 69520 Professional Series, Countertop Single Additional models available.

F. Hot Plates. Single and double burner hot plates save counter space due to the compact size. Cadco’s Hot Plates are the newest models available. Industrial rated hot plates have high speed tubular elements (CDR-2CFB has cast iron elements) and come with a 1-year warranty. Standard features include heavy-duty stainless steel construction, Robertshaw thermostat with infinite heat control, on/off rocker switch. Power light(s) indicates burner is turned on. UL safety and sanitary, C-UL. Model Description CSR-1T Single, 6" Burner, 1,100 Watts CSR-3T Single, 8" Burner, 1,500 Watts CDR-1T Double, 6" Burners, 825 Watts/Burner CDR-1TFB Double Space Saver Hot Plate w/tubular elements (120 volts) CDR-2TFB Double Space Saver Hot Plate w/tubular elements (220 volts) CDR-2CFB Double Space Saver Hot Plate w/cast-iron elements (120 volts)


&RRNLQJ(TXLSPHQW_

$

(GCVWTGF%JGH

$7RDVW4ZLFNŠ &RQYH\RU7RDVWHUV 3UHFLVH FRQWURO DQG LPSURYHG SHUIRUPDQFH 6WDWHRIWKHDUW HOHFWURQLF FRQWUROV SUHFLVHO\ UHJXODWH WRS DQG ERWWRP KHDWLQJ HOHPHQWV 3DWHQWHG FRORUJXDUG VHQVLQJ V\VWHP 74  DQG  PRGHOV  PRQLWRUV DQGDGMXVWVVSHHGGXULQJKLJKXVDJHSHULRGV WRDVVXUHXQLIRUPLW\3RZHUVDYHPRGHZLWK LQGLFDWRU OLJKW VDYHV HQHUJ\ DQG PRQH\ GXULQJ VORZ SHULRGV &DSDFLWLHV UDQJH IURP  WR  VOLFHV SHU KRXU 6WDQGDUG DQG EDJHO PRGHOV DV ZHOO DV YHUVLRQV ZLWK D WDOOHU RSHQLQJ DQG D KLJKVSHHG PRGHO DUH DYDLODEOH0RGHO74VKRZQ

0RGHO'HVFULSWLRQ 74 (FRQRP\6OLFH&DS 74 6OLFH&DS 74%$ 6OLFH&DS IRU%DJHOV%XQV

74 6OLFH&DS 74%$ 6OLFH&DS IRU%DJHOV%XQV

74 6OLFH&DS Additional models available.

&KHI5REHUW%ODFN %

%3RS8S7RDVWHUV )RU WKH JROGHQ WRDVW \RX ZDQW DQG WKH TXDOLW\ \RX QHHG 3HUIHFW IRU VHOIVHUYH DUHDVDQGOLJKWYROXPHDSSOLFDWLRQV+DWFR¶V 3RS8S 7RDVWHUV SURYLGH HYHQ JROGHQ WRDVWLQJ RI D YDULHW\ RI EUHDG SURGXFWV 'XUDEOH VWDLQOHVV VWHHO KRXVLQJ FRQWDLQV  VHOIFHQWHULQJ VORWV ZLWK LQGLYLGXDO WRDVWLQJ FRQWUROV DQG UHPRYDEOH FUXPE WUD\ (YHQO\ WRDVWV D YDULHW\ RI EUHDG SURGXFWV LQFOXGLQJ EDJHOV 7H[DV WRDVW ZDIIOHV DQG (QJOLVK PXIILQV0RGHOV737 OHIW DQG737 ULJKW VKRZQ 0RGHO'HVFULSWLRQ 737 :6ORWV9 737 :6ORWV9 737 :6ORWV9

$*RRG(JJ'LQLQJ*URXS 2NODKRPD&LW\2. &KRFRODWH%DQDQD6WUXGHO 6HUYHV 1 sheet puff pastry 8 oz. cream cheese 1 Tbsp. all-purpose flour 1/3

cup confectioner’s sugar

1/4

cup ground almonds

1 tsp. pure vanilla 1 Tbsp. unsalted butter (softened) ½ cup semi-sweet chocolate (chopped) 1 each banana (peeled, sliced) /D\RXW WKH SXII SDVWU\ RQ D OLJKWO\ IORXUHG ZRUN WDEOHDQGDOORZWRWKDZ5ROORXWXVLQJDIORXUHGUROOLQJ SLQWRIRUPD VTXDUH

&4&64&6HŠ 6HULHV&RQYH\RU7RDVWHUV 1RPDWWHUKRZ\RXVOLFHLWFRQVLVWHQWTXDOLW\ KLJK FDSDFLW\ DQG HQHUJ\ HIILFLHQF\ LV  D SLHFH RI WRDVW +ROPDQ¶V IRUFHG FRQYHFWLRQ V\VWHP NHHSV WKH WRDVWHU FRROWRWKHWRXFK DQG LQFUHDVHV SURGXFWLYLW\ E\ FLUFXODWLQJ SUHKHDWHG DLU LQWR WKH WRDVWLQJ FKDPEHU 4XDUW] LQIUDUHG KHDWHUV SURYLGH IDVWHU PRUH FRQVLVWHQW KHDWLQJ WKDQ WUDGLWLRQDO KHDWLQJ HOHPHQWV +HDW RQ GHPDQG LQ RQO\  VHFRQGV $GMXVWDEOH EHOW VSHHG FRQWUROV 3RZHU FRQVXPSWLRQ LV UHGXFHG E\  LQ VWDQGE\PRGH&UXPEWUD\LQFOXGHG 0RGHO'HVFULSWLRQ 4&6 6OLFHV+RXU&RPSDFW 4&6 6OLFHV+RXU 4&6% 6OLFHV+RXU%DJHO 4&6+$ 6OLFHV+RXU 4&6$ 6OLFHV+RXU 4&6$ 6OLFHV+RXU+LJK9ROXPH 4&6% 6OLFHV+RXU%DJHO Additional models available.

0HDQZKLOH WR PDNH WKH FUHDP FKHHVH ILOOLQJ FRPELQH WKH FUHDP FKHHVH  7EVS IORXU VXJDU JURXQG DOPRQGV YDQLOOD DQG VRIWHQHG EXWWHU LQ D PL[HUDQGZKLSXQWLOVPRRWK

&

6SUHDG WKH ILOOLQJ RQWR WKH PLGGOH RI WKH SXII SDVWU\ XVLQJ DQ RIIVHW VSDWXOD OHDYLQJ  FOHDU DURXQG WKH HGJHV 7RS ZLWK WKH FKRSSHG FKRFRODWH SLHFHV DQG WKH VOLFHG EDQDQD )ROG D WKLUG RI WKH SDVWU\ RYHU RQWR LWVHOI WKHQ IROG WKH UHPDLQLQJ WKLUG RYHUWKDWMXVWDV\RXZRXOGIROGDVKHHWRISDSHUWRILW LQWRDQHQYHORSH 7UDQVIHU RQWR D EDNLQJ VKHHW DQG JHQWO\ EUXVK WKH WRS ZLWK HJJZDVK OLJKWO\ EHDWHQ HJJ ZLWK ZDWHU  %DNH LQ D SUHKHDWHG ƒ) RYHQ IRU DERXW  PLQXWHV RU XQWLO WKH HGJHV DUH JROGHQ EURZQ /HW FRROIRUPLQXWHVEHIRUHFXWWLQJDQGVHUYLQJ *DUQLVK ZLWK FKRFRODWH VDXFH IUHVK PLQW DQG SRZGHUHGVXJDU


&RRNLQJ(TXLSPHQW_

$ $6ORW%DJHO7RDVWHUV 6WDLQOHVV WRDVWHU ZLWK EODFN HQG SDQHOV IHDWXUHV ORQJ ODVWLQJ .RYHU 7HFŒ PLFD KHDWLQJ HOHPHQWV WLPHU FRQWURO DQG SXOO RXW FUXPE WUD\ 6HSDUDWH VHOHFWRU EXWWRQ IRU  RU VORW RSHUDWLRQV 0DQXDO HMHFWRU ZLWK NHHS ZDUP IHDWXUH6ORWGLPHQVLRQV:+/8/16)&6$YROWV :DWWV$PSV.RYHU7HFŒHOHPHQWVJXDUDQWHHGIRU\HDUV:KLWHHQG SDQHOVDOVRDYDLODEOH 0RGHO'HVFULSWLRQ &%7% 6WDLQOHVVZ%ODFN(QG3DQHOV &%7 6WDLQOHVVZ:KLWH(QG3DQHOV

% %7RDVWHUV $VWDQGRXWRQDQ\FRXQWHUWRSRUVHUYLQJDUHD)RXUZLGH VORWVKROGDYDULHW\RIEUHDGVIURP(QJOLVKPXIILQVWREDJHOVWR WKLFNKRPHPDGHVOLFHV)HDWXUHVHOHFWURQLFEURZQLQJFRQWUROV  VHOIFHQWHULQJ EUHDG UDFNV DQG UHPRYDEOH FUXPE WUD\V %UXVKHG FKURPH VWHHO KRXVLQJ /LPLWHG \HDU ZDUUDQW\ 8/ &8/16)VORWPRGHOVDOVRDYDLODEOH 0RGHO'HVFULSWLRQ :&7 6ORW0HGLXP'XW\ 6OLFHV3HU+RXU

:&7 6ORW/LJKW'XW\ 6OLFHV3HU+RXU

:&7 /RQJ6ORW/LJKW'XW\3LHFHVRI%UHDG 6OLFHV3HU+RXU

(GCVWTGF%JGH &KHI$QG\8UHOO 3RUWHUKRXVH*ULOO $WKHQV*$ 6HDUHG6HD6FDOORSVZLWK6ZHHW 3RWDWR3DQFDNHV $SSOH3HDU 5HOLVK 6HDUHG6HD6FDOORSV ODUJHVHDVFDOORSV R]VDODGRLO 6DOW SHSSHU +HDWVNLOOHWWRPHGLXPKLJKDQGDGGRLO 6HDVRQ VFDOORSV ZLWK VDOW DQG SHSSHU 3ODFH RQH RI WKH WZR IODW VOLGHV RI WKH VFDOORS GRZQ XQWLO ZHOO EURZQHG 7XUQ RYHUDQGUHSHDW5HPRYHVFDOORSVIURP VNLOOHW

&([WUD:LGH6ORW7RDVWHUV (DVLO\ DFFRPPRGDWHV EDJHOV ZDIIOHV DQG JRXUPHW EUHDGV 3URFWRU6LOH[7RDVWHUVIHDWXUHH[WUD & ZLGH  VORWV $XWRPDWLF WRDVW ERRVW PDNHV VPDOO VOLFHV HDV\ WR UHDFK %DJHO IXQFWLRQ WRDVWV WKH FXW VLGHDQGZDUPVWKHRXWVLGH)URQWFUXPEWUD\VOLGHVRXWIRUTXLFN FOHDQXS 'XUDEOH EUXVKHG FKURPH UHVLVWV ILQJHUSULQWV $YDLODEOH LQVORW  RUVORW  WRDVWHU16)F8/XV

6ZHHW3RWDWR3DQFDNHV VZHHWSRWDWR FXSIORXU  WVSEDNLQJSRZGHU WVSVXJDU  WVSVDOW  FXSZKROHPLON HJJ R]VDODGRLO %DNHVZHHWSRWDWRDWƒ)IRURQHKRXU'LVFDUGVNLQDQGSXUHHSRWDWR LQ IRRG SURFHVVRU XQWLO VPRRWK ,Q PL[LQJ ERZO FRPELQH IORXU EDNLQJ SRZGHUVXJDUDQGVDOW$GGPLONHJJDQGKDOIRIWKHRLO XVHUHPDLQGHU RIRLOIRUVHDVRQLQJJULGGOHRUSDQ )ROGLQSXUHHGSRWDWR/DGOHPL[WXUH LQ  R] SRUWLRQV RQWR JULGGOH 7XUQ ZKHQ ILUVW VLGH LV JROGHQ 5HPRYH ZKHQVHFRQGVLGHLVGRQH $SSOH3HDU5HOLVK 7EVSEXWWHU UHGDSSOHSHHOHGFRUHGGLFHG SHDUSHHOHGFRUHGGLFHG YDQLOODEHDQ +HDW VNLOOHW WR PHGLXP $GG DOO LQJUHGLHQWV DQG VDXWH IRU DERXW  VHFRQGV 5HPRYH YDQLOOD EHDQ DGG MXLFH DQG DOO RWKHU LQJUHGLHQWV WR IRRG SURFHVVRU &KRS WR GHVLUHG FRQVLVWHQF\ 7R DVVHPEOH SODFH SDQFDNHVRQDSSHWL]HUSODWHVDQGWRSZLWKVFDOORSVHDFK6SOLWUHOLVK DPRQJDSSHWL]HUV*DUQLVKZLWKVRXUFUHDPDQGHQMR\6HUYHV

' '+HDY\'XW\7RDVWHUV 8QLIRUPO\ WRDVWV UHJXODU EUHDG WH[DV WRDVW EDJHOV IUR]HQ ZDIIOHVDQGPDQ\RWKHUIRRGV0RGHOV:&7:&75& :&7 DQG :&7% KDYH IRXU  UHJXODU WRDVW VORWV DQG WZR  H[WUDZLGH VORWV IRU EDJHOV (DVLO\ UHSODFHDEOH LQGXVWULDO KHDWLQJ SODWHV (OHFWURQLF EURZQLQJ FRQWUROV &DUULDJH FRQWURO OLIW OHYHU 'LVKZDVKHUVDIH FUXPE WUD\ (7/16)8/DQG&8/DSSURYHG 0RGHO'HVFULSWLRQ :&75& 6OLFHV3HU+RXU9 :&7 6OLFHV3HU+RXU9 :&7 &RPER 7RDVW%DJHO 6OLFHV3HU+RXU9 :&7% 6OLFHV6OLFHV3HU+RXU9 :&7% &RPER 7RDVW%DJHO 6OLFHV3HU+RXU9 :&7 &RPER 7RDVW%DJHO 6OLFHV3HU+RXU9


 (QHUJ\&RQVHUYDWLRQ&KHFNOLVW :KHQ FRROLQJ HDFK GHJUHH WKH WHPSHUDWXUH LV UDLVHG UHGXFHV HOHFWULFDO FRQVXPSWLRQ E\  :KHQ KHDWLQJ HDFKGHJUHHORZHUHGUHGXFHVFRQVXPSWLRQE\

,Q FRQYHFWLRQ RYHQV FOHDQ WKH IDQ EODGHV $FFXPXODWHG GLUWUHVWULFWVWKHDPRXQWRIDLUGHOLYHUHG .HHS PLFURZDYH RYHQ LQWHULRU VXUIDFHV IUHH RI IRRG SDUWLFOHVWKDWLQKLELWRYHQSHUIRUPDQFH

)OXRUHVFHQW EXOEV DUH DERXW IRXU WLPHV PRUH HQHUJ\ HIILFLHQWLQGRRUVWKDQVWDQGDUGLQFDQGHVFHQWEXOEV

6WDUW WKH GD\¶V EDNLQJ ZLWK IRRGV WKDW UHTXLUH WKH ORZHVW RYHQWHPSHUDWXUH

6XEVWLWXWH D ZDWW LQFDQGHVFHQW EXOE IRU WZR ZDWW EXOEVDQGVDYHHQHUJ\ZLWKQRORVVRIOLJKW

)LOWHU FRRNLQJ IDW %XLOWXS VHGLPHQW UHGXFHV FRRNLQJ HIILFLHQF\

2SHUDWH D GHKXPLGLILHU LQ WKH VXPPHU 'U\ DLU FDQ EH WROHUDWHGDWKLJKHUWHPSHUDWXUHVWKDQKXPLGDLU

3ODFH IUHTXHQWO\ XVHG LWHPV LQ WKH IURQW RI UHIULJHUDWRUV WR UHGXFHWKHWLPHWKDWWKHGRRUVDUHRSHQ

2SHUDWLQJDKXPLGLILHULQZLQWHUZLOODOORZFROGHUDLUWRIHHO PRUHFRPIRUWDEOH

,Q KLJK FHLOLQJ URRPV UHSODFH WKH FHLOLQJ OLJKWLQJ ZLWK KDQJLQJODPSVWREULQJOLJKWFORVHU

%HIRUH FORVLQJ IRU WKH QLJKW FORVH H[KDXVW V\VWHPV DQG SUHFRRO LQVXPPHU RUSUHKHDW LQZLQWHU 

8VHGLUHFWFROGRXWVLGHDLUIRUNLWFKHQFRROLQJ

,QVWDOODZQLQJVRYHUZLQGRZVWKDWJHWGLUHFWVXQOLJKW

,QWKH.LWFKHQ &HQWUDO +9$& V\VWHPV DUH  PRUH HIILFLHQW WKDQ VHSDUDWH KHDWLQJ DQG FRROLQJ V\VWHPV DQG DOORZ LQFRUSRUDWLRQRIQHZHQHUJ\HIILFLHQWHTXLSPHQW 5HPHPEHUWKDWZDWHUDQGRWKHUZDWHUEDVHGOLTXLGVERLODW ƒ)7XUQLQJWKHIODPHKLJKHUGRHVQRWFRRNIRRGIDVWHU LWRQO\XVHVPRUHHQHUJ\ &RYHU GLVKHV ZLWK OLGV WR UHWDLQ KHDWHG DLU LQ SRWV DQG GHFUHDVHFRRNLQJWLPH 0RQLWRUSUHKHDWWLPHVZLWKWKHUPRVWDWVDQGWLPHUV :KHQ SRVVLEOH XVH LQIUDUHG EURLOHUV ZKLFK FDQ EH WXUQHG RIIZKHQQRWLQXVHDQGTXLFNO\UHKHDWHGUDWKHUWKDQLGOLQJ OHVVHIILFLHQWHTXLSPHQW 7XUQ RII H[KDXVW IDQ ZKHQ QRW UHTXLUHG 7KLV VDYHV WKH HQHUJ\ QHHGHG WR UXQ WKH IDQ DQG HDVHV WKH ORDG RQ WKH KHDWLQJFRROLQJ V\VWHP EHFDXVH \RX DUH H[KDXVWLQJ OHVV DLUIURPWKHURRP 'RQ¶W ORDG IU\HU EDVNHWV EH\RQG WKHLU VWDWHG FDSDFLW\ QRUPDOO\ WR IXOO&URZGHGIRRGWDNHVORQJHUWRFRRN +LJKHUWHPSHUDWXUHVGRQRWSUHKHDWRYHQVDQ\IDVWHUWKDQ PRGHUDWHWHPSHUDWXUHV 8VH KLJK HQHUJ\GHPDQG HTXLSPHQW VHTXHQWLDOO\ UDWKHU WKDQVLPXOWDQHRXVO\LISRVVLEOH +RW ZDWHU ERRVWHUV VKRXOG EH ZLWKLQ ILYH IHHW RI D GLVKZDVKHUWRDYRLGKHDWORVVLQWKHSLSHV ,QJDVILUHGXQLWVDGMXVWWKHIODPHWREOXHZLWKDILUPFHQWHU FRUH$\HOORZWLSLQGLFDWHVJDVLVHVFDSLQJ )OXVK ZDWHU KHDWHUV HYHU\ VL[ PRQWKV WR SUHYHQW DFFXPXODWLRQRIVROLGVWKDWSUHYHQWKHDWWUDQVIHU &RRN DW ORZHVW SRVVLEOH WHPSHUDWXUHV 6ORZ FRRNLQJ UHWDUGV PHDW VKULQNDJH UHWDLQV QXWULHQWV DQG FRORU DQG FXWVHQHUJ\XVDJH 0DLQWDLQ VWHDPWDEOHV DW WHPSHUDWXUHV WKDW DOORZ IRRG WR ZDUP ZLWKRXW IRUPLQJ FORXGV RI VWHDP &ORXGV LQGLFDWH XQQHFHVVDU\KLJKWHPSHUDWXUHV (YHU\ IHZ PRQWKV KDYH D TXDOLILHG VHUYLFH UHSUHVHQWDWLYH FDOLEUDWHRYHQWKHUPRVWDWVZLWKDWKHUPRFRXSOH

(1(5*< 67$5Š TXDOLILHG HTXLSPHQW FDQ EH DQ DQVZHU WRPRXQWLQJHQHUJ\ELOOV 3XUFKDVLQJ (1(5*< 67$5 Š TXDOLILHG FRPPHUFLDO IRRG VHUYLFH &)6  HTXLSPHQW DV D SDFNDJH IRU QHZ NLWFKHQ FRQVWUXFWLRQ RU DV D UHSODFHPHQW IRU DJLQJ HTXLSPHQW FDQ VDYH VLJQLILFDQW DPRXQWV RI PRQH\ DQG HQHUJ\ RQ IRRGVHUYLFH RSHUDWRUV¶ HOHFWULF JDV ZDWHU DQG VHZHU ELOOV &RPPHUFLDO IRRGVHUYLFH SURGXFWV LQ  FDWHJRULHV PD\ HDUQ WKH(1(5*<67$5ŠGLVKZDVKHUVIU\HUVJULGGOHVKRWIRRG KROGLQJFDELQHWVLFHPDFKLQHVRYHQVUHIULJHUDWRUVIUHH]HUV DQG VWHDP FRRNHUV 4XDOLILHG SURGXFWV FDQ VDYH XS WR DV PXFKDVRYHUWKHLUFRQYHQWLRQDOFRXQWHUSDUWV 6DYH(QHUJ\6DYH0RQH\ (1(5*< 67$5 Š KHOSV UHVWDXUDQW RZQHUV DQG RSHUDWRUV LPSURYH WKH SHUIRUPDQFH RI WKHLU IDFLOLWLHV DQG HTXLSPHQW ZKLOH UHGXFLQJ HQHUJ\ FRVWV 5HVWDXUDQWV WKDW LQYHVW VWUDWHJLFDOO\ FDQ FXW XWLOLW\ FRVWV  WR  ZLWKRXW VDFULILFLQJ VHUYLFH TXDOLW\ VW\OH RU FRPIRUW ² ZKLOH PDNLQJ VLJQLILFDQWFRQWULEXWLRQVWRDFOHDQHUHQYLURQPHQW 2XWILWWLQJ DQ HQWLUH NLWFKHQ ZLWK D VXLWH RI (1(5*< 67$5Š TXDOLILHG &)6 HTXLSPHQW FRXOG VDYH RSHUDWRUV DERXW  0EWX\HDU DQQXDOO\ RU WKH HTXLYDOHQW RI DSSUR[LPDWHO\  %HVLGHV VDYLQJ HQHUJ\ (1(5*< 67$5 Š TXDOLILHG VWHDP FRRNHUV DQG FRPPHUFLDO GLVKZDVKHUV VDYH ZDWHU 6WHDP FRRNHUV WKDW KDYH HDUQHG WKH (1(5*< 67$5Š DUH  PRUH ZDWHU HIILFLHQW WKDQ QRQTXDOLILHG VWHDP FRRNHUV DQ (1(5*< 67$5Š TXDOLILHG FRPPHUFLDO GLVKZDVKHU LV  PRUHZDWHUHIILFLHQWWKDQVWDQGDUGPRGHOV +HOS3URWHFWWKH(QYLURQPHQW %DVHG RQ SURMHFWHG VKLSPHQWV RI (1(5*< 67$5Š TXDOLILHG &)6 HTXLSPHQW LW¶V H[SHFWHG WKDW DSSUR[LPDWHO\  PHWULF WRQV RI JUHHQKRXVH JDV HPLVVLRQV ZLOO EH DYRLGHG DQQXDOO\HTXLYDODQWWRHPLVVLRQVIURPDERXWFDUV 9LVLWZZZHQHUJ\VWDUJRY IRUPRUHLQIRUPDWLRQ


+ROGLQJ (TXLSPHQW +ROGLQJ&DELQHWV :DUPHUV 'LVSOD\&DELQHWV 6HUYLQJ/LQHV 6DIHO\+ROGLQJ)RRGIRU6HUYLFH

$ $)ODY56DYRUŠ +ROGLQJ&DELQHWV (QHUJ\ HIILFLHQW KROGLQJ FDELQHWV NHHS SUHSDUHG IRRGVDWRSWLPXPVHUYLQJWHPSHUDWXUHVIRUKRXUV 7KHUPRVWDWLFDOO\ FRQWUROOHG KHDW DQG KXPLGLW\ DOORZV IRRG WR EH SUHSDUHG LQ DGYDQFH RI SHDN VHUYLQJ SHULRGV (OHFWURQLF FRQWURO ZLWK GLJLWDO UHDGRXWWHPSHUDWXUHUDQJHRIƒ)WRƒ)DQG KXPLGLW\FRQWUROOHU7\SHVWDLQOHVVVWHHOLQWHULRU 1RHOHPHQWFRQWDFWZLWKZDWHUPDNHVWKHXQLWHDVLHU WR FOHDQ $FFRPPRGDWHV *DVWURQRUP SDQV $YDLODEOH LQVWDLQOHVVVWHHORUGHVLJQHUFRORUV EODFNLVVWDQGDUG 0RGHO)6+&:(( VKRZQLQGHVLJQHUEODFNZLWKRSWLRQDOEXPSHUNLWDQGULJKWKDQGKLQJHGGRRU 0RGHO'HVFULSWLRQ )6+&: /RZ3URILOH*ODVV'RRU3DQ&DS )6+&:(( 66'RRU3DQ&DS (QHUJ\6WDUŠ

)6+& *ODVV'RRU3DQ&DS )6+&: 7DOO*ODVV'RRUV3DQ&DS $GGLWLRQDOPRGHOVDYDLODEOH

,Q PDQ\ IRRGVHUYLFH RSHUDWLRQV IRRG LV FRRNHG WR RUGHU )RRG WKDW LV VWRUHG SUHSDUHG FRRNHG SURSHUO\ DQG WKHQ VHUYHG LPPHGLDWHO\ LV OHVV OLNHO\ WR FDXVH LOOQHVV +RZHYHU HYHQLQRSHUDWLRQVWKDWFRRNWRRUGHUPDQ\PHQXLWHPVDUH FRRNHG DQG KHOG IRU VHUYLFH 7KLV LV D SHUIHFWO\ DFFHSWDEOH SUDFWLFHDVORQJDVVDIHW\JXLGHOLQHVDUHIROORZHG

%&Œ6HULHV&RQWUROOHG +XPLGLW\&DELQHWV %\ FRQWUROOLQJ ERWK WHPSHUDWXUH DQG KXPLGLW\ RSHUDWRUV FDQ EH DVVXUHG WKDW WKHLU SURGXFW ZLOO FRPH RXW DV GHOHFWDEOH DV LW ZHQW LQ 7HPSHUDWXUH DQG DFWXDO UHODWLYH KXPLGLW\ DUH FRQVWDQWO\ PHDVXUHG PDLQWDLQHG DQG GLVSOD\HG $YDLODEOH LQ WKH FRQILJXUDWLRQ WR ILW \RXU DSSOLFDWLRQ )XOO KHLJKW   KHLJKW   KHLJKW XQGHU FRXQWHU VL]HV ZLWK IXOO OHQJWK GXWFK VROLG DQG FOHDU GRRU RSWLRQV 3DVVWKUX PRGHOV DOVR DYDLODEOH +LJKTXDOLW\ FRPSRQHQWV DQG FRQVWUXFWLRQSURYLGHDORQJOLIHRIZRUU\IUHHXVH 9DPS

+RW)RRGV  1HYHU XVH KRWKROGLQJ HTXLSPHQW WR UHKHDW IRRG LI LW LV QRWGHVLJQHGWRGRVR  2QO\ XVH KRWKROGLQJ HTXLSPHQW WKDW FDQ NHHS IRRG DW DQLQWHUQDOWHPSHUDWXUHRIƒ)RUKLJKHU  6WLU IRRG DW UHJXODU LQWHUYDOV WR GLVWULEXWH WHPSHUDWXUH HYHQO\  .HHSIRRGFRYHUHG  &KHFNLQWHUQDOIRRGWHPSHUDWXUHVHYHU\KRXUV  'LVFDUG SRWHQWLDOO\ KD]DUGRXV IRRG DIWHU  KRXUV LI LW KDVQRWEHHQKHOGDWRUDERYHƒ)  1HYHU PL[ IUHVKO\ SUHSDUHG IRRG ZLWK IRRG EHLQJ KHOG IRUVHUYLFH

% 0RGHO'HVFULSWLRQ &6'68 )XOO66'XWFK6ROLG'RRU8QLY6OLGHV &6)68 )XOO6ROLG'RRU8QLY6OLGHV &6)6/ )XOO6ROLG'RRU/LS/RDG6OLGHV &6'6/ )XOO'XWFK6ROLG'RRU/LS/RDG6OLGHV &6)&8 )XOO&OHDU'RRU8QLY6OLGHV $GGLWLRQDOPRGHOVDYDLODEOH

 3UHSDUHIRRGLQVPDOOEDWFKHVVRLWZLOOEHXVHGIDVWHU &ROG)RRGV  2QO\ XVH FROG KROGLQJ HTXLSPHQW WKDW FDQ NHHS IRRG DWƒ)RUORZHU  'RQRWVWRUHIRRGGLUHFWO\RQLFH  &KHFNLQWHUQDOIRRGWHPSHUDWXUHVHYHU\KRXUV  3URWHFW IRRG IURP FRQWDPLQDQWV ZLWK FRYHUV RU VQHH]H JXDUGV

&KRW/2*,;+XPLGLILHG +ROGLQJ&DELQHWV /DUJHFDSDFLW\ KXPLGLILHG KHDWHG KROGLQJ DQG SURRILQJ FDELQHWV IHDWXUH VWDLQOHVV VWHHO FRQVWUXFWLRQDQGGLJLWDOFRQWUROVIRUKHDWDQGKXPLGLW\ VHWWLQJV /DUJH UHPRYDEOH ZDWHU UHVHUYRLU LV ORFDWHG DZD\ IURP WKH IRRG ]RQH DQG LV LQH[SHQVLYH WR UHSODFH)RUYHUVDWLOHKROGLQJWKH\FDQEHXVHGZLWK RU ZLWKRXW KXPLGLW\ 8QLYHUVDO VOLGHV IRU [ DQG [ SDQ VL]HV 0RGHO +/ VKRZQ ZLWK GXWFKGRRUV

&

0RGHO'HVFULSWLRQ +/ /RJL[ +W(OHF&RQWUROV  [RU  [ 8QLYHUVDO6OLGHV,QVXODWHG&DVWHUV(QHUJ\6WDUŠ +/ /RJL[ +W(OHF&RQWUROV  [RU  [ 8QLYHUVDO6OLGHV&DVWHUV(QHUJ\6WDUŠ +/ /RJL[)XOO+W  3L]]D,Q%R[XSWR  [ 'XWFK'RRUV(QHUJ\6WDUŠ +/ /RJL[)XOO+W(OHF&RQWUROV  [RU  [ 8QLYHUVDO6OLGHV,QVXODWHG&DVWHUV(QHUJ\6WDUŠ +/ /RJL[8QGHUFWU(OHF&RQWUROV  [RU  [ 8QLYHUVDO6OLGHV,QVXODWHG&DVWHUV +/ /RJL[ +W0HFKDQLFDO&RQWUROV)L[HG:LUH8QLYHUVDO6OLGHV  [  [[1RQ,QVXODWHG&DVWHUV $GGLWLRQDOPRGHOVDYDLODEOH


+ROGLQJ(TXLSPHQW_ $&Œ6HULHV+HDWHG +ROGLQJ&DELQHWV 'HVLJQHG IRU WKH ULJRUV RI HYHU\GD\ XVH LQ WKH GHPDQGLQJ SURIHVVLRQDO IRRGVHUYLFH HQYLURQPHQW %DVLF WHPSHUDWXUH FRQWURO DQG DQ ³DOZD\V RQ´DQDORJWKHUPRPHWHUSURYLGHVLPSOH \HW HIIHFWLYH FRQWURO RYHU WKH LQWHUQDO WHPSHUDWXUHRIWKHFDELQHWDQGLVLGHDO ZKHQ SRZHU PXVW EH LQWHUUXSWHG IRU WUDQVSRUW $YDLODEOH LQ DOXPLQXP DQG VWDLQOHVV VWHHO DQG LQ   KHLJKW IXOO KHLJKW SDVV WKUX  KHLJKW DQG XQGHU WKH FRXQWHU  PRGHOV 'XWFK VROLG RU FOHDUGRRURSWLRQVDYDLODEOH

$ 0RGHO'HVFULSWLRQ &6'68 66)XOO+W'XWFK6ROLG'RRU8QLYHUVDO &6'&8 66)XOO+W'XWFK&OHDU'RRU8QLYHUVDO &6)68 66)XOO+W6ROLG'RRU8QLYHUVDO &6)68 66 +W6ROLG'RRU8QLYHUVDO &6)68 66 +W6ROLG'RRU8QLYHUVDO &1'68 66 +W6ROLG'RRU8QLYHUVDO &1'&8 $OXP)XOO+W'XWFK&OHDU'RRU8QLYHUVDO &1)68 $OXP +W6ROLG'RRU8QLYHUVDO Additional models available.

&+ROGLQJ 7UDQVSRUW&DELQHWV 'HVLJQHG WR NHHS IRRGV KRW DQG GHOLFLRXV IURP FRRNLQJWRVHUYLQJ$FFRPPRGDWHDZLGHYDULHW\ RI SDQ VL]HV  &DELQHWV IHDWXUH DOO ZHOGHG VWDLQOHVV VWHHO FRQVWUXFWLRQ IXOO SHULPHWHU KLJK LPSDFW EXPSHUV DQG UHXVDEOH FROG FDUWULGJHV $YDLODEOHLQDZLGHYDULHW\RIVL]HVWRDFFRPPR GDWH YLUWXDOO\ DQ\ YROXPH  'HVLJQHG WR ILW WKURXJK DQ\ VWDQGDUG GRRU    DQG  YROWKHDWHUV 0RGHO'HVFULSWLRQ 9+3 +ROGV  [ 3DQV 9%3, +ROGV  [ RU[ 3DQV 9+3 +ROGV  [ 3DQV 9%3, +ROGV  [ RU[ 3DQV

&

(

(*6HULHV+RW)RRG&DELQHWV (YHQ KROGLQJ WHPSV PHDQV EHWWHU SURG XFW  TXDOLW\ DQG UHGXFHG VKULQN²OHVV IRRG FRVW (QHUJ\ 6WDU Š PHDQV ORZHU XWLOLW\  ELOOV 0LFURSURFHVVRU FRQWURO IRU JUHDWHUDFFXUDF\DQGUHOLDELOLW\$OOPHWDO KHDWLQJ HOHPHQW PHDQV UHGXFHG OLIHWLPH VHUYLFH FRVWV *DVNHW DQG GRRU SDQ GHVLJQ UHGXFHV UHSODFHPHQW IUHTXHQF\ 6HOIFORVLQJVWD\RSHQ GRRUV SURYLGH RSHUDWRU FRQYHQLHQFH )DFWRU\ LQVWDOOHG VKHOYLQJ VDYHV LQVWDOODWLRQ WLPH DQG PRQH\ \HDU SDUWV DQG ODERU OLIHWLPH GRRU KDQGOH KLQJH DQG \HDU GRRU ZDUUDQW\ 0RGHO'HVFULSWLRQ * 6HFWLRQ6ROLG+DOI'RRU+LQJH5LJKW * 6HFWLRQ6ROLG+DOI'RRU+LQJH/HIW * 6HFWLRQ6ROLG)XOO'RRU+LQJH5LJKW * 6HFWLRQ6ROLG)XOO'RRU+LQJH/HIW * 6HFWLRQ6ROLG+DOI'RRU+LQJH/HIW5LJKW * 6HFWLRQ6ROLG+DOI'RRU+LQJH5LJKW5LJKW Additional models available.

%&Œ6HULHV&RQWUROOHG 7HPSHUDWXUH+HDWHG+ROGLQJ&DELQHWV 'HVLJQHG WR SUHFLVHO\ PDLQWDLQ IRRG WHPSHUDWXUH ,QWHOOLJHQW WHPSHUDWXUH FRQWURO WDNHV WKH JXHVV ZRUN RXWRIKROGLQJ\RXUIRRGSURGXFW6HWWKHGHVLUHGFDEL QHWWHPSHUDWXUHDQGWKHSURSULHWDU\FRQWUROOHUGRHVWKH UHVW E\ FRQWLQXRXVO\ PRQLWRULQJ PDLQWDLQLQJ DQG GLVSOD\LQJ WKH LQWHUQDO WHPSHUDWXUH 3UHFLVH FRQWURO JLYHV SURIHVVLRQDO UHVXOWV $YDLODEOH LQ DOXPLQXP DQG VWDLQOHVV VWHHO DQG LQ  KHLJKW IXOO KHLJKW SDVV WKUX  KHLJKW DQG XQGHU WKH FRXQWHU PRGHOV 'XWFK VROLG RUFOHDUGRRURSWLRQVDYDLODEOH 0RGHO'HVFULSWLRQ &1)&/ $OXP +W&OHDU'RRU/LS &1)&8 $OXP +W&OHDU'RRU8QLY &1)&/3)& $OXP +W3DVV7KUX&OHDU'RRU/LS &1)&/3)6 $OXP +W3DVV7KUX&OU6OG'U/LS &1)&83)& $OXP +W3DVV7KUX&OHDU'RRU8QLY &1)&83)6 $OXP +W3DVV7KUX&OU6OG'U8QLY Additional models available.

%

' '&Œ76HULHV&DELQHWV .HHSVIRRGKRWIRUKRXUV²8VHVOHVVHQHUJ\WKDQOHDGLQJILEHUJODVV LQVXODWHG FDELQHWV 8QLTXH IHDWXUHV RI 7UDQVSRUW $UPRXUŒ PDNH LW WKH LGHDOVROXWLRQIRURYHUWKHURDGDSSOLFDWLRQV6WDLQOHVVVWHHOVWUXFWXUHZLWK IRDPHGLQSODFH SRO\XUHWKDQH LQVXODWLRQ SURYLGHV VXSHULRU KHDW UHWHQWLRQ 7HPSHUDWXUH VWUDWLILFDWLRQ LV  WLPHV EHWWHU ZLWK 0HWUR¶V PRELOH SRZHU RSWLRQ,QWHOOLJHQWRUEDVLFFRQWUROV'LJLWDOFRQWURORSWLRQZLWKPRELOHSRZHU JHQWO\ FLUFXODWHV DLU LQ FDELQHW DQG SURYLGHV WHPSHUDWXUH DOHUWV ZKLOH XQSOXJJHG DQG LQ WUDQVLW (QHUJ\ 6WDUŠ DSSURYHG )RXU VL]HV WR FKRRVH IURP 0RGHO'HVFULSWLRQ * 6HFWLRQ6ROLG+DOI'RRU+LQJH5LJKW * 6HFWLRQ6ROLG+DOI'RRU+LQJH/HIW * 6HFWLRQ6ROLG)XOO'RRU+LQJH5LJKW * 6HFWLRQ6ROLG)XOO'RRU+LQJH/HIW * 6HFWLRQ6ROLG+DOI'RRU+LQJH/HIW5LJKW * 6HFWLRQ6ROLG+DOI'RRU+LQJH5LJKW5LJKW Additional models available.

)

)&Œ56HULHV0RELOH 5HIULJHUDWRUV .HHSFROGIRRGFROGDQGLPSURYHIRRGTXDOLW\RQWKHJR ZLWK 0HWUR &Œ 56HULHV 0RELOH 5HIULJHUDWRUV ZLWK 5HIULJHUDWLRQ $UPRXUŒ ZKLFK DUH HQJLQHHUHG WR ZLWKVWDQG WKH VKRFN DQG YLEUDWLRQ DVVRFLDWHG ZLWK PRELOH DSSOLFDWLRQV )RDPHGLQSODFH SRO\XUHWKDQH LQVXODWLRQ SURYLGHV VXSHULRU ULJLGLW\ DQG LPSURYHG HQHUJ\ HIILFLHQF\ YHUVXV FRPPRQ ILEHUJODVV FRQVWUXFWLRQ $OOLQRQH HDVLO\ UHPRYDEOH UHIULJHUDWLRQ FDVVHWWH LV PRXQWHG RQ YLEUDWLRQ  VKRFN LVRODWRUV IRU FRPSOHWH UHIULJHUDWLRQ V\VWHP SURWHFWLRQ $YDLODEOH LQ WKUHH GLIIHUHQW SDQ VOLGH FRQILJXUDWLRQV WR VXLW HDFK QHHG$OVRDYDLODEOHLQ9+]YHUVLRQV 0RGHO'HVFULSWLRQ &56% 9'RRU)XOO+HLJKW$GM%RWWRP/RDG3DQ6OLGHV &56/ 9'RRU)XOO+HLJKW$GM/LS/RDG3DQ6OLGHV &56) 9'RRU)XOO+HLJKW)L[HG/LS/RDG3DQ6OLGHV


+ROGLQJ(TXLSPHQW_ $)6HULHV'LVSOD\&DVHV ([WHULRU VLGHV DUH PDGH RI JDXJH VWDLQOHVV VWHHO *DOYDQL]HG VWHHO UHLQIRUFHG $%6SODVWLFLQWHULRUVLGHVZLWK PROGHG VKHOI VXSSRUWV )RXU DGMXVWDEOHHSR[\FRDWHGZLUH VKHOYHV2QRIIVZLWFKIRUWKH GLVSOD\ VHFWLRQ OLJKW V  7RS PRXQW FRLO ZLWK PXOWLSOH IDQV $ FLUFXODWHV WKH DLU WKURXJKRXW WKH FDELQHW 'LVSOD\ VHFWLRQ UXQV IURP WKHUPRVWDWLF FRQWURO 6OLGLQJDQGUHPRYDEOHVHOIFORVLQJ WKLFNDUJRQILOOHGORZ( ZDUP HGJH LQVHUW WKHUPRSDQH JODVV GRRUV ZLWK OHIW DQG ULJKW YHUWLFDO JDVNHW +LJK GHQVLW\ HQYLURQPHQWDOO\ IULHQGO\ .\RWR 3URWRFRO &RPSOLDQW 1RQ2'3 2]RQH 'HSOHWLRQ 3RWHQWLDO  1RQ*:3 *OREDO :DUPLQJ 3RWHQWLDO  SRO\XUHWKDQH IRDP WKURXJKRXW XQLW (QYLURQPHQWDOO\ IULHQGO\ +)&$ UHIULJHUDQW\HDUSDUWVDQGGD\ODERUZDUUDQW\ 0RGHO'HVFULSWLRQ Self-Contained, Single Serve Models )0&1 '[/0LUURUHG%DFN )3&1 '[/3DVV7KUXZ*ODVV'RRUV %RWK6LGHV

)6&1 '[/6HH7KUX%DFN )0&' '[/0LUURUHG%DFN )3&' '[/3DVV7KUXZ*ODVV'RRUV %RWK6LGHV

)3&' '[/3DVV7KUXZ*ODVV'RRUV %RWK6LGHV

Remote, Single Serve Models )051 '[/0LUURUHG%DFN )051 '[/0LUURUHG%DFN )351 '[/3DVV7KUXZ*ODVV'RRUV %RWK6LGHV

Additional models available.

%0RGXODU)RRG +ROGLQJ&DELQHWV ,QGLYLGXDOO\ KHDWHG SDQ FDYLWLHV H[WHQG KROGLQJ WLPHV ZKLOH PDLQWDLQLQJ MXVWFRRNHG TXDOLW\ DQG IUHVKQHVV 'LUHFW WUDQVIHU RI KHDW WR WKHIRRGSDQFUHDWHVWKHSHUIHFWKROGLQJ HQYLURQPHQW IRU MXVW DERXW DQ\ SURGXFW $OO XQLWV RSHUDWH RQ HQHUJ\HIILFLHQW  DPSV RU OHVV :DUPXS WDNHV MXVW D IHZ VHFRQGV DQG XVHV KDOI WKH HQHUJ\ DV WUDGLWLRQDO KRW ZHOOV $GDSWDEOH IRU DZLGHUDQJHRIXVHVDQGDYDULHW\RIVSDFHV 0RGHO'HVFULSWLRQ 3DQVQRWLQFOXGHG 0&6 +ROGV  [3DQV '6LGHORDGHG (OHFWURQLF7HPSHUDWXUH&RQWURO 0&6%5 +ROGV  [3DQV '6LGHORDGHG (OHFWURQLF7HPSHUDWXUH&RQWURO1RWFKHG/LG 0&67 +ROGV  [RU  [3DQV '6LGH/RDGHG (OHFWURQLF7HPSHUDWXUH&RQWUROZ,QGLYLGXDO3DQ7LPHUV Additional models available.

&

' 0RGHO'HVFULSWLRQ 'HVLJQHU:DUPHUZ/LJKWV7RS %RWWRP+HDW 6QHH]H*XDUGV *5%: : *5%: : *5%: : *5%: : *5%: : Additional models available.

'*OR5D\%XIIHW:DUPHU *OR5D\ Š 'HVLJQHU %XIIHW :DUPHUV DUH GHVLJQHG WR VDIHO\ NHHS IRRG DW RSWLPXP VHUYLQJ WHPSHUDWXUHV &RPELQLQJ VWDWHRIWKHDUW GHVLJQ ZLWK SHUIRUPDQFH WKHVH EXIIHW ZDUPHUV SODFH WKH IRFXV RQ WKH SURGXFW ZKLOH KROGLQJ KRW IRRG VDIHO\ DW SURSHU VHUYLQJ WHPSHUDWXUHV 7KH PRGHUQ GHVLJQ LV SHUIHFW IRU IURQWRIWKHKRXVH XVH ZLWK GHVLJQHU SRZGHUFRDWLQJ WKDW EOHQGV LQWR DQ\ GpFRU0RGHO*5%:VKRZQ

)&Œ6HULHV1RQ,QVXODWHG +HDWHG+ROGLQJ 3URRILQJ&DELQHWV &ŒVHULHVKHDWHGFDELQHWVGHOLYHUUHOLDEOHSHUIRUPDQFH LQ D WULHG DQG WUXH GHVLJQ &KRLFH RI FRPELQDWLRQ KROGLQJSURRILQJ KROGLQJ RU SURRILQJ FRQWURO PRGXOHV 7KUHHVOLGHVW\OHVIRUPD[LPXPKROGLQJFDSDFLW\XQLYHUVDO VOLGHV IL[HG VOLGHV DQG OLSORDG VOLGHV IRU VKHHW SDQV 5HPRYDEOHZDWHUSDQDQGHDV\WRFOHDQGULSWURXJK 0RGHO'HVFULSWLRQ &&)& )XOO&RPER&OHDU'RRU)L[HG6OLGHV &&)&/ )XOO&RPER&OHDU'RRU/LS/RDG &+)&8 )XOO&OHDU'RRU8QLY6OLGHV  &RPER&OHDU'RRU)L[HG6OLGHV &&)& &&)&8  &RPER&OHDU'RRU8QLY6OLGHV Additional models available.

)

%

&+HDWHG'LVSOD\&DVHV 6KRZ RII \RXU SURGXFW ZLWK WKLV GHVLJQHU PHUFKDQGLVHU ([FOXVLYH LQIUDUHG KHDW SDWWHUQ FRPELQHG ZLWK KHDWHG EDVH NHHSV IRRG DW WKDW ³MXVW PDGH´ WDVWH DQG WHPSHUDWXUH &XUYHG WHPSHUHGJODVV VW\OLQJ DQG LQFDQGHVFHQW OLJKWLQJ 6WDLQOHVV VWHHO FRQVWUXFWLRQ 'XDO VKHOI ZDUPHU LV DYDLODEOH LQ  RU SDQ PRGHOV ZLWK DQGZLWKRXWKXPLGLW\6KLSSHGZLWKDGMXVWDEOH OHJV DQG IDFWRU\ DWWDFKHG   FRUG DQG SOXJ $YDLODEOH LQ +XQWHU *UHHQ :DUP 5HG %ODFN :KLWH*UDQLWH1DY\%OXH*UD\*UDQLWH$QWLTXH &RSSHU 0RGHO'HVFULSWLRQ *5&'3 6LQJOH6KHOI3DQ *5&'+3 6LQJOH6KHOIZ+XPLGLW\3DQ *5&'3' 'XDO6KHOI3DQ *5&'+3' 'XDO6KHOIZ+XPLGLW\3DQ *5&'3' 'XDO6KHOI3DQ *5&'+3' 'XDO6KHOIZ+XPLGLW\3DQ Additional models available.

(&Œ6HULHV+HDWHG +ROGLQJ 3URRILQJ&DELQHWV ([FOXVLYH FRROWRWRXFK ,QVXODWLRQ $UPRXU LQVXODWHV DQG SURWHFWV HPSOR\HHV IURP KRW VXUIDFHV  DV HIILFLHQW DV D WUDGLWLRQDO LQVXODWHG KROGLQJ FDELQHW %XLOWLQ KDQG KROGV PDNH FDELQHW HDV\ WR KDQGOH IRU PRELOH DSSOLFDWLRQV &KRLFH RI FRPELQDWLRQ KROGLQJSURRILQJ RU KROGLQJ PRGXOH $YDLODEOH ZLWK WKH QHZ PRLVWXUH PRGXOH 7KUHH VOLGH VW\OHV IRU PD[LPXP KROGLQJ FDSDFLW\ XQLYHUVDO RQ      LQFUHPHQWV ZLWK 6LWH6HOHFW IL[HG RQ  LQFUHPHQWV DQG OLSORDG IRU VKHHW SDQV 5HPRYDEOH ZDWHU SDQ DQG GULS WURXJK 6WDQGDUG FRORUVUHGEOXHDQGJUD\(QHUJ\6WDUŠ DSSURYHG0RGHO&0'&8VKRZQ 0RGHO'HVFULSWLRQ &0'&8 )XOO0RLVWXUH'XWFK&OHDU'RRU8QLY &0'68 )XOO0RLVWXUH'XWFK6ROLG'RRU8QLY &+'&8 )XOO+ROGLQJ'XWFK&OHDU'RRU8QLY &+'68 )XOO+ROGLQJ'XWFK6ROLG'RRU8QLY  +ROGLQJ6ROLG'RRU8QLY &+)68  +ROGLQJ6ROLG'RRU)L[HG &+)6 Additional models available.

(


+ROGLQJ(TXLSPHQW_ $7UDQVSRUW&DELQHWV %XLOW H[WUDVWURQJ WR ZLWKVWDQG WKH ULJRUV RI WUDQVSRUWLQJEDNHU\DQGIRRGVHUYLFHSURGXFWV $ ZHOGHG ERWWRP HQVXUHV ULJLGLW\ DV ZHOO DV SHUPLWVIRUNOLIWORDGLQJDQGXQORDGLQJ+HDY\ GXW\SODWHFDVWHUVSURPRWHHDV\PRELOLW\DQG ZLWK PDQ\ VL]HV WR FKRRVH IURP VWRUDJH VSDFH ZLOO QHYHU EH D SUREOHP 3LSHU¶V VXSHULRU IRXQGDWLRQ IHDWXUHG RQ RXU WRXJKHVW UDFNV²WZR  JDXJH DOXPLQL]HG VWHHO UHLQIRUFLQJ FKDQQHOV VXSSRUW RXU  WKLFN DOXPLQXP ERWWRP SDQHO (GJHV DUH IRUPHG DQG UROOHG WR FUHDWH D EXLOWLQ EXPSHU +HDY\GXW\ SODWH FDVWHUV PDNH WKLV WKH VWURQJHVWIRXQGDWLRQLQWKHLQGXVWU\ 0RGHO'HVFULSWLRQ  +ROGV  [6KHHW3DQV  +ROGV  [6KHHW3DQV  +ROGV  [6KHHW3DQV  +ROGV  [6KHHW3DQV Additional models available.

%+HDWHG=RQH0HUFKDQGLVHUV ([FOXVLYH HQHUJ\HIILFLHQW PHUFKDQGLVHUV KROG KRW SDFNDJHG IRRG LQ D VPDUWO\ GHVLJQHGGLVSOD\WKDWDWWUDFWVFXVWRPHUV (QHUJ\ DQG FRVWV DUH UHGXFHG ZLWK +DWFR¶V QHZ 6SRW2Q Š WHFKQRORJ\ ,QVWDQWRQ RYHUKHDG KHDW DQG EDVH KHDW JRHV IURP HQHUJ\VDYLQJ PRGH WR WKHUPRVWDWLFDOO\ FRQWUROOHG 21/< ZKHQ % SURGXFWLVSODFHGRQWKHVKHOI6LGHJODVV LVKLQJHGWRWKHSRVWDQGVZLQJVRXWIRUHDV\FOHDQLQJ 0DJQHWLF FKDQQHO GLYLGHUV FDQ EH UHDUUDQJHG IRU DQ\ SURGXFW PL[ $YDLODEOH LQ  GHVLJQHU FRORUV EODFN LV VWDQGDUG  0RGHO +=06'VKRZQZLWKRSWLRQDO/('DFFHQWOLJKWLQJLQVXSSRUWSRVWV 0RGHO'HVFULSWLRQ +=0+ +RUL]RQWDO:DUPHU6LQJOH6KHOI:[' +=0+ +RUL]RQWDO:DUPHU6LQJOH6KHOI:[' +=0+ +RUL]RQWDO:DUPHU6LQJOH6KHOI:[' +=0+ +RUL]RQWDO:DUPHU6LQJOH6KHOI:[' +=0+ +RUL]RQWDO:DUPHU6LQJOH6KHOI:[' Additional models available.

$

&

&,QIUDUHG)RRG:DUPHUV .HHS IRRGV KRW ZLWKRXW DOORZLQJ IRRG WR GU\ RXW RU EHFRPH GLVFRORUHG/HQJWKVXSWR  DOXPLQXPKRXVLQJRQO\ DQGXSWR

VWDLQOHVV KRXVLQJV  +HDWLQJ HOHPHQWV JXDUDQWHHG DJDLQVW EXUQRXWDQGEUHDNDJHIRU\HDUV$YDLODEOHLQYDULRXVOHQJWKVDQG PRXQWLQJFRQILJXUDWLRQVLQERWKVWDQGDUGDQGKLJKZDWWDJH9 9DQG9:DUPHUVDUHDYDLODEOHLQGHVLJQHUFRORUVDQG JORVVILQLVKHV0RGHO*5$+VKRZQLQ+XQWHU*UHHQ 0RGHO'HVFULSWLRQ *5$+ $OXPLQXP)RRG:DUPHU *5$+ $OXPLQXP)RRG:DUPHU *5$+ $OXPLQXP)RRG:DUPHU *5$+ $OXPLQXP)RRG:DUPHU Additional models available.

'

'+RW)RRG0HUFKDQGLVHUV 3HUIHFWIRUPHUFKDQGLVLQJVDQGZLFKHVEXUULWRV FRRNLHV RU DQ\ PHQX LWHP LQ  RU  RI FRXQWHU VSDFH ,QWHULRU WKHUPRPHWHU %RWWRP FRQWURO SDQHO KRXVHV RQRII VZLWFK DQG WHPSHUDWXUH NQRE IRU HDVH RI RSHUDWLRQ &RQVWUXFWHG ZLWK KHDY\GXW\ DOXPLQXP FRUQHU SRVWV *ODVV SDQHO ERG\ FRQVWUXFWLRQ ZLWK D  WKLFN JODVV GRRU DQG D SLHFH IXOO OHQJWK KLQJH DQG KDQGOH )RUFHG DLU V\VWHP FLUFXODWHV DLU WKURXJKRXW FDELQHW ,QFOXGHV 

FRUGDQG1(0$3&8/8/8/VDQLWDWLRQ DQG16)DSSURYHG 0RGHO'HVFULSWLRQ 0& :['[+ 3HUIRUDWHG6KHOYHV

0& :['[+ 3HUIRUDWHG6KHOYHV

0&3 :['[+ 666ROLG6KHOYHV

)

( (+RW &ROG0HUFKDQGLVHUV 7KHVH PHUFKDQGLVLQJ FDELQHWV SURYLGH VHOIVHUYLFH IRU D ZLGH YDULHW\RIIRRGVZKLOHGLVSOD\LQJWKHPDWWUDFWLYHO\LQDZD\VXUHWR DWWUDFW FXVWRPHUV 7KH UHIULJHUDWLRQ DQG KHDWLQJ V\VWHPV DUH FDUHIXOO\ HQJLQHHUHG WR KROG WKH FROG IRRGV DW WHPSHUDWXUHV RSWLPL]HG IRU SURWHFWLRQ RI WKHLU VDIHW\ DQG DSSHDUDQFH LQ DFFRUGDQFHZLWKWKHODWHVWIRRGVDIHW\VWDQGDUGV 0RGHO'HVFULSWLRQ 27+ ::DWWV+HDWHG6KHOYHV 27+ ::DWWV+HDWHG6KHOYHV 27+ ::DWWV+HDWHG6KHOYHV 27+ ::DWWV+HDWHG6KHOYHV Additional models available.

)6HUY5LWHŒ3RUWDEOH%XIIHW:DUPHUV 'HVLJQHG WR NHHS SUHSDUHG IRRGV DW RSWLPXP VHUYLQJ WHPSHUDWXUHV ZLWKRXW DIIHFWLQJ TXDOLW\ 'HVLJQHG WR NHHS SUHSDUHG IRRGV DW RSWLPXP VHUYLQJ WHPSHUDWXUHV ZLWKRXW DIIHFWLQJ TXDOLW\ 3HUIHFW IRU VHOIVHUYHEXIIHWDUHDVDQGFXVWRPHUVHUYLQJSRLQWV6HUY5LWH%XIIHW :DUPHUVIHDWXUHDWKHUPRVWDWLFDOO\FRQWUROOHGKHDWHGEDVHZLWKGLJLWDO WHPSHUDWXUH LQGLFDWLQJ GLVSOD\ GXUDEOH VWDLQOHVV VWHHO FRQVWUXFWLRQ VWXUG\ DOXPLQXP H[WUXVLRQV DQG D   FRUG ZLWK SOXJ 6KRZQ ZLWK RSWLRQDORYHUKHDGKDORJHQKHDWWKDWLVFRQWUROOHGE\DEDVHPRXQWHG VWDQGDUGWRJJOHVZLWFK 0RGHO'HVFULSWLRQ 65%: %XIIHW:DUPHUZ)RRG3DQV 65*%: %XIIHW:DUPHUZ%ODFN*ODVV )RRG3DQV 65% 6KHOIZ)RRG3DQV 65* 6KHOIZ%ODFN*ODVV )RRG3DQV


+ROGLQJ(TXLSPHQW_

$

$'HFRUDWLYH&DUYLQJ6WDWLRQ 7KH'HFRUDWLYH&DUYLQJ6WDWLRQFRPELQHVWKH+DWFR'HFRUDWLYH +HDW /DPS ZLWK WKH 6ZDQVWRQH +HDWHG %DVH WR FUHDWH DQ DWWUDFWLYH FDUYLQJ GLVSOD\ 3DWHQWSHQGLQJ WHOHVFRSLQJ DQG SLYRWLQJVWHPJLYHV\RXIOH[LELOLW\VW\OHDQGTXDOLW\IRU\RXUFKHI VWDWLRQ 'HFRUDWLYH SRVWV DQG ODPSV DYDLODEOH LQ EULJKW EUDVV EULJKWQLFNHODQGDQWLTXHEURQ]H&KRRVHIUHHVWDQGLQJRUZLWKD URXQGHG RU UHFWDQJXODU KHDWHG VWRQH EDVH DYDLODEOH LQ JUD\ JUDQLWHEHUPXGDVDQGQLJKWVN\DQGVDZJUDVV&DUYLQJVWDWLRQ XQLWV FRPH ZLWK PDWFKLQJ FXWWLQJ ERDUG H[FHSW '6&

NHHSLQJMXLFHVFRQWDLQHGDQGWDEOHFORWKVFOHDQ 0RGHO'HVFULSWLRQ '&6 %UDVV  3RVW6KDGH '&6%5 %URQ]H  3RVW6KDGHZ1LJKW6N\%DVH '&6% 1LFNHO  3RVW6KDGHZ1LJKW6N\%DVH '&6% %UDVV  3RVWV6KDGHVZ1LJKW6N\%DVH Additional models available.

&*OR5D\Š 1DUURZ +DORJHQ)RRGZDUPHUV $WWUDFWLYH XQREWUXVLYH VOLP OLQH VWULS KHDWHUV DUH RQO\  KLJK DQG  GHHS PDNLQJ \RXU IRRG WKH FHQWHU RI DWWHQWLRQ 7KH KDORJHQ KHDW ODPS EXOELVFRQWUROOHGE\DGLPPHUVZLWFKDQGFRPHV ZLWK QRQDGMXVWDEOH  DQJOH EUDFNHWV &KRRVH IURP  GHVLJQHU SRZGHUFRDWHG FRORUV  JORVV ILQLVKHVSODWHGILQLVKHVVWDLQOHVVVWHHOKRXVLQJ RSWLRQ DOVR DYDLODEOH 6WXUG\ FRQWLQXRXV SDLQWHG VWHHOKRXVLQJVDYDLODEOHLQZLGWKVIURPWR 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ *51 : *51 : *51 : *51 : *51 : *51 : Additional models available.

% %7KHUPR)LQLVKHUŒ)RRG)LQLVKHUV  VHFRQGV 7KDW¶V KRZ TXLFNO\ WKH 7KHUPR )LQLVKHUŒ SHUIRUPV IURP ³VWDQGE\´ WR ³IXOO WHPSHUDWXUH´6RPHIRRGVFDQEHSURFHVVHG LQDVOLWWOHDVVHFRQGV3HUIHFWIRUPHOWLQJ WRSSLQJV WRDVWLQJ EXQV RU ILQLVKLQJ VRXSV DQGIRRGVOLNH0H[LFDQHQWUHHVQDFKRVDQG SRWDWRVNLQV&DQDOVREHXVHGWRWKHUPDOL]H IUR]HQ IRRGV VXFK DV DSSHWL]HUV )UHQFK IULHVDQGSL]]D 0RGHO'HVFULSWLRQ 7) 8SSHU/RZHU(OHPHQW 96LQJOH3KDVH 7) 8SSHU/RZHU(OHPHQW 97KUHH3KDVH

&

'3RUWDEOH)RRGZDUPHUV 6SHFLDOO\GHVLJQHGVWDQGNHHSVIRRGKROGLQJSDQVXSRIIWKHZRUNDUHD DQGDOORZVDFFHVVIURPVLGHV7KHFHUDPLFKHDWLQJHOHPHQWDOORZVD JUHDWHUGLVWDQFHEHWZHHQKHDWVRXUFHDQGIRRGSURGXFWPDNLQJLWLGHDO IRUXVHQH[WWRIU\VWDWLRQVDQGVHUYLFHDUHDVWKDWUHTXLUHIUHTXHQWDQG HDV\ DFFHVV $YDLODEOH ZLWK PHWDO VKHDWKHG HOHPHQWV RU FHUDPLF HOHPHQWV 0RGHO'HVFULSWLRQ *5% +HDWHG%DVH0HWDO6KHDWKHG(OHPHQW *5)) 3RUWDEOH)RRGZDUPHU0HWDO6KHDWKHG(OHPHQW *5))/ *5))Z/LJKWV0HWDO6KHDWKHG(OHPHQW *5))% *5))Z+HDWHG%DVH0HWDO6KHDWKHG(OHPHQW *5))%/ *5))%Z/LJKWV0HWDO6KHDWKHG(OHPHQW 8*)) 8*))&HUDPLF+HDWLQJ(OHPHQW 8*))/ 8*))/Z/LJKWV&HUDPLF+HDWLQJ(OHPHQW 8*))% 8*))%&HUDPLF+HDWLQJ(OHPHQW 8*))%/ 8*))%/Z/LJKWV&HUDPLF+HDWLQJ(OHPHQW

'

)+HDWHG%ODFN*ODVV6KHOYHV 7KH+HDWHG*ODVV6KHOIVXUIDFHFRORULVDQ HOHJDQWEODFNWRDGGWKHULJKWWRXFKWRDQ\ ) GpFRU 7KHUPRVWDWLFDOO\FRQWUROOHG KHDWHG FHUDPLFJODVVVXUIDFHKHOSVKROG\RXUIRRG KRW DQG GHOLFLRXV DW D VXUIDFH WHPSHUDWXUH UDQJLQJIURPƒ)WRƒ)16)DSSURYDO DOORZV\RXWRSODFHIRRGSURGXFWGLUHFWO\RQ 0RGHO'HVFULSWLRQ WKHJODVVVXUIDFH7KH+HDWHG%ODFN*ODVV +%* [3RUWDEOHZ+DQGOHV 6KHOI H[FHOV LQ SDVVWKURXJK DUHDV EXIIHW +%* [3RUWDEOHZ+DQGOHV OLQHV DQG DV D WHPSWLQJ KRUV G¶RXHYUH +%* [3RUWDEOHZ+DQGOHV GLVSOD\ %XLOWLQ PRGHOV DOVR DYDLODEOH +%* [3RUWDEOHZ+DQGOHV 0RGHO +%*% VKRZQ ZLWK RSWLRQDO +%* [3RUWDEOHZ+DQGOHV GHVLJQHUEODFNSRZGHUFRDWHGWULPULQJ +%* [3RUWDEOHZ+DQGOHV Additional models available.

( (*OR5D\Š +HDWHG6WRQH6KHOYHV ,GHDO IRU XVH RQ EXIIHW OLQHV DQG DV KRUV G¶RXHYUH GLVSOD\V 7KHVH XQLTXH IRRGZDUPHUVZLOOVDIHO\KROGIRRGKRWZKLOH EOHQGLQJLQWR\RXUGpFRU7KHUPRVWDWLFDOO\ FRQWUROOHG KHDWHG EDVH H[WHQGV IRRG KROGLQJ WLPHV $YDLODEOH LQ SRUWDEOH RU EXLOWLQ PRGHOV %XLOWLQ PRGHOV LQFOXGH D UHPRWH ER[ ZLWK D   FRQGXLW DQG   FRUG DQGSOXJ&RORUV6DZJUDVV*UD\*UDQLWH 1LJKW6N\%HUPXGD6DQG 0RGHO'HVFULSWLRQ *566% [%XLOW,Q *566 [)UHH6WDQGLQJ *566% [%XLOW,Q *566 [)UHH6WDQGLQJ *566% [%XLOW,Q *566 [)UHH6WDQGLQJ Additional models available.


+ROGLQJ(TXLSPHQW_ $*OR5D\Š 'HVLJQHU0HUFKDQGLVLQJ:DUPHUV %RRVW LPSXOVH VDOHV E\ VKRZFDVLQJ \RXU KRW IRRGV LQ *OR5D\Š 'HVLJQHU 0HUFKDQGLVLQJ :DUPHUV 'HVLJQHG VSHFLILFDOO\ IRU GLVSOD\LQJ ZUDSSHG RU ER[HG SURGXFW WKHVH ZDUPHUV KROG KRW IRRG VDIHO\ DW SURSHU VHUYLQJ WHPSHUDWXUHV $YDLODEOH LQ VLQJOH RU WZRWLHU PRGHOV ZLWK KRUL]RQWDO RU VODQWHG VKHOYHV IRU HDV\ DFFHVV )HDWXUHV FRQWUROOHGWRSDQGERWWRPKHDW2IIHUVWKHFRQYHQLHQFHRI VHOIVHUYH DQG WKH HIILFLHQF\ RI NLWFKHQWRVHUYH KROGLQJ ,QFDQGHVFHQW OLJKWLQJ VKRZFDVHV KRW IRRG 0RGHO *56'6' VKRZQ ZLWK VWDQGDUG GHVLJQHU EODFN LQVHW SDQHOV 0RGHO'HVFULSWLRQ *56'6' 6LQJOH6KHOIZ5RGV *56'6' 6LQJOH6KHOIZ5RGV *56'6' 6LQJOH6KHOIZ5RGV *56'6' 6LQJOH6KHOIZ5RGV *56'6' 6LQJOH6KHOIZ5RGV *56'6' 6LQJOH6KHOIZ5RGV *56'6' 6LQJOH6KHOIZ5RGV Additional models available.

$

% %'XDO+HDW/DPS )XOO\ DGMXVWDEOH WR WKH RSHUDWRU¶V QHHGV 7KLV DWWUDFWLYHO\ VW\OHG GXDO KHDW ODPS LV FRQVWUXFWHG RI KHDY\GXW\ DOXPLQXP 6KDGHV GHVLJQHG ZLWK IODUHG VKDSHIRUVWUHQJWKDQGHYHQKHDWGLVWULEXWLRQ2QRII VZLWFK ORFDWHG RQ DUP DZD\ IURP KHDW ]RQH $UP HDVLO\ DGMXVWV IURP  WR  &HUDPLF LQVXODWHG VRFNHWVZLWKQLFNHOSODWHGFRQWDFWVWRSUHYHQWIXVLQJ ,QFOXGHV WZR  :DWW FOHDU EXOEV 9 8/ DSSURYHG\HDUZDUUDQW\0RGHO+/

& &/LTXL7HF&ROG3DQV 8VLQJSDWHQWHGHXWHFWLFIOXLGWHFKQRORJ\/LTXL7HF&ROG3DQVIDUVXUSDVVWUDGLWLRQDOPHWKRGV RI FROG SDQ RSHUDWLRQ /LTXL7HF FUHDWHV XS WR  PRUH UHIULJHUDWHG VXUIDFH FRYHUDJH JHQHUDWLQJ D VXSHUFRROLQJ HIIHFW DOORZLQJ SDQV DQG IRRG WR EH IOXVK ZLWK WKH FRXQWHUWRS ZKLOH PDLQWDLQLQJ 16) VDIH IRRG WHPSHUDWXUHV $GGLWLRQDOO\ WKH VXSHUFRROLQJ HIIHFWV UHVXOWLQHQHUJ\VDYLQJV 0RGHO'HVFULSWLRQ () () () () ()

+ROGV  [3DQ +ROGV  [3DQV +ROGV  [3DQV +ROGV  [3DQV +ROGV  [3DQV

((OHFWULF)RRG:DUPHU (QHUJ\ HIILFLHQW GHVLJQ IRU IDVWHU KHDWLQJ DQG ORZHU XWLOLW\ FRVWV ,GHDO IRU NHHSLQJ D ZLGH YDULHW\RIIRRGLWHPVSLSLQJKRWXQWLO\RXQHHG WRVHUYHWKHP+HDY\GXW\VWDLQOHVVVWHHOERG\ IRU FRPPHUFLDO XVH )LWV PRVW IXOOVL]H SDQV ZLWK GHSWKV RI XS WR  : 16) 0RGHO ):6

(

' '+RW0RGXODU'URS,QV 8QLTXH HQHUJ\HIILFLHQW GHVLJQ DYDLODEOH LQ PXOWLSOH ZDWWDJHV 'HHS GUDZQ  VWDLQOHVV ZHOOV DOORZ IRU IXOOVL]HDQGIUDFWLRQDOSDQV'ULSIUHHIODQJHFRQWDLQV PRLVWXUH DQG VSLOOV WR SUHYHQW IRRG FRQWDPLQDWLRQ )XOO SHULPHWHU JDVNHW 3UHDVVHPEOHG FRUG DQG SOXJ FRQILJXUDWLRQ HOLPLQDWH WKH QHHG IRU HOHFWULFLDQ 6WDQGDUG LQGLYLGXDO ZHOO GUDLQ RU RSWLRQDO PDQLIROG GUDLQ RIIHUV  IOH[LELOLW\ LQ FOHDQLQJ DQG RSHUDWLRQ $XWRILOO RSWLRQ DYDLODEOH 16) \HDU SDUWV DQG ODERUZDUUDQW\ 0RGHO'HVFULSWLRQ 2-Well w/Infinite Control, 120V  :3HU:HOO6WG'UDLQ  :3HU:HOO6WG'UDLQ  :3HU:HOO0DQLIROG'UDLQ  :3HU:HOO0DQLIROG'UDLQ 2-Well w/Thermostatic Control, 120V  :3HU:HOO6WG'UDLQ  :3HU:HOO6WG'UDLQ Additional models available.

) ))RRG:DUPHUV +HDY\GXW\VWDLQOHVVVWHHOFRQVWUXFWLRQERWKLQVLGHDQGRXWIRUH[FHOOHQW GXUDELOLW\$YDLODEOHLQERWKDVTXDUHDQGURXQGGHVLJQDQGDUHILWWHGWR DFFRPPRGDWH PRVW VWDQGDUG VL]H SDQV 0DLQWDLQV IRRG WHPSHUDWXUH LQ H[FHVV RI ƒ) WKH UHTXLUHPHQW IRU VDIH IRRGVHUYLFH  (DV\ WR FOHDQ 6TXDUH PRGHOV DYDLODEOH LQ  DQG  ZDWWV DQG URXQG PRGHO FRPHV LQ  ZDWWV 16) DQG 8/ DSSURYHG 0RGHOV ):: )::5DQG)::VKRZQ 0RGHO'HVFULSWLRQ ):: 5HFWDQJOH:DWWV )::5 5RXQG:DWWV  6L]H:DWWV )::

*

*6RXS.HWWOH ([FHOOHQWIRUGHOLVGLQLQJURRPVFDIHWHULDVDQG IRRG FRXQWHUV 7KH SUHPLXP NHWWOH KROGV XS WR TXDUWVRIOLTXLGZLWKDKHDY\GXW\VWDLQOHVV VWHHO LQVHUW DQG OLG FRPSOHWH ZLWK D SLDQR KLQJH IRU HDVH RI XVH 7KH RXWVLGH VKHOO LV FRQVWUXFWHG ZLWK D VFUDWFKDQGGHQW UHVLVWDQW VKHOO 7KH HFRQRP\ PRGHOV KROG XS WR  TXDUWV DQG DUH DYDLODEOH LQ EODFN SRZGHU DQG VWDLQOHVV VWHHO VKHOOV 3UHPLXP PRGHO LV (7/ OLVWHG DQG HFRQRP\ NHWWOHV DUH 8/ /LVWHG DQG8/6DQLWDWLRQ 0RGHO'HVFULSWLRQ 6. TW: %ODFN3RZGHU6KHOO

6.: TW: %ODFN3RZGHU6KHOO


+ROGLQJ(TXLSPHQW_

$

% %'URS,QV+RW&ROG&RQYHUWLEOH +DYH WKH RSWLRQ RI VZLWFKLQJ \RXU XQLW IURP KRW WR FROG DQGEDFN7KHVHVWDLQOHVVVWHHOXQLWVDUHLQVXODWHGRQDOO  VLGHV DQG WKH ERWWRP ZLWK D  EUDVV GUDLQ DQG DGMXVWDEOH UHPRYDEOH DGDSWHU EDUV DQG EUDFNHWV 7KH HIILFLHQW HOHFWULF LPPHUVLRQ KHDWHUV PHHW 16) VWDQGDUG DQGWKHVHOIFRQWDLQHGV\VWHPPHHWV16)VWDQGDUG RSHUDWLRQZLWKRQHFRQWUROVZLWFKWRFKDQJHIURPKRWWR FROGRSHUDWLRQ 0RGHO'HVFULSWLRQ $',+& :HOOV +RW&ROG&RQYHUWLEOH

$',+& :HOOV +RW&ROG&RQYHUWLEOH

$',+& :HOOV +RW&ROG&RQYHUWLEOH

$',+& :HOOV +RW&ROG&RQYHUWLEOH

$',+& :HOOV +RW&ROG&RQYHUWLEOH

$'UDZHU:DUPHUV ,GHDO IRU FDVVHUROHV SRW SLHV UROOV QDFKR FKLSV SRWDWRHV YHJHWDEOHV SRXOWU\ PHDW DQGGHVVHUWV(DFKSRVLWLYHFORVLQJGUDZHUKDVQ\ORQUROOHUVDUHFHVVHGWKHUPRVWDWLF FRQWURO DQG WHPSHUDWXUH PRQLWRU 6WDLQOHVV VWHHO VOLGHV DQG UHPRYDEOH GUDZHU ERGLHV PDNHFOHDQLQJHDV\$YDLODEOHLQDQGGUDZHUIUHHVWDQGLQJRUEXLOWLQXQLWVDQG WKHQHZ6SOLW'UDZHU:DUPHUZKLFKH[SDQGVKROGLQJFDSDELOLWLHVE\DFFRPPRGDWLQJ PRUHSDQVLQWKHVDPHVSDFHDVDVWDQGDUGVLQJOHGUDZHUPRGHO0RGHOV+':DQG +':VKRZQ 0RGHO'HVFULSWLRQ +': )UHHVWDQGLQJ:'UDZHU +': )UHHVWDQGLQJ:'UDZHU +': )UHHVWDQGLQJ:'UDZHU +': )UHHVWDQGLQJ:'UDZHU +':1 )UHHVWDQGLQJ1DUURZ:'UDZHU Additional models available.

& &%XLOW,Q0RGXODU)RRG:DUPHUV 'HVLJQHGIRUZHWRUGU\RSHUDWLRQ:HOOVKHDY\GXW\WRSPRXQW GURSLQ PRGXODU IRRG ZDUPHUV DUH GHVLJQHG WR KROG KHDWHG IRRGV DW VDIH DQG IUHVK VHUYLQJ WHPSHUDWXUHV $FFRPPRGDWHV [VWDQGDUGIRRGVSDQVRUHTXLYDOHQWIUDFWLRQDOLQVHWSDQV 2QHSLHFH VWDLQOHVV VWHHO WRS IODQJH DQG KHDY\ JDXJH GHHS GUDZQVWDLQOHVVVWHHOZDUPLQJSDQVDUHVWDQGDUGIHDWXUHVRQDOO PRGHOV :HOOVORNV DUH VWDQGDUG IRU TXLFN DQG HDV\ LQVWDOODWLRQ 6LGHV IURQW EDFN DQG ERWWRP DUH IXOO\ LQVXODWHG IRU HQHUJ\ VDYLQJVHIILFLHQF\TXLFNHUSUHKHDWDQGIDVWHUUHFRYHU\ 0RGHO'HVFULSWLRQ  ,QILQLWH&RQWUROV:HOO  ,QILQLWH&RQWUROV:HOO  ,QILQLWH&RQWUROV:HOO,QGLYLGXDO'UDLQV  ,QILQLWH&RQWUROV:HOO  ,QILQLWH&RQWUROV:HOO,QGLYLGXDO'UDLQ Additional models available.

'

'&D\HQQHŠ0RGHO:DUPHU $WWUDFWLYHO\ GLVSOD\ DQG PDLQWDLQ WKH VHUYLQJ WHP SHUDWXUH RI \RXU SUHSDUHG IRRGV ZLWK OHVV HQHUJ\ WKDQ D WUDGLWLRQDO ZDUPHU )HDWXUHV 9ROOUDWK¶V 'LUHFW&RQWDFW+HDWLQJ6\VWHPLQZKLFKWKHKHDW LQJ HOHPHQW LV LQ GLUHFW FRQWDFW ZLWK WKH ZDWHU IRU WKHPRVWHIILFLHQWKHDWWUDQVIHUSRVVLEOH1RQVWLFN DOXPLQXP GRPH KHDWLQJ HOHPHQW XVHV  OHVV HQHUJ\DQGUHGXFHVVFDOHEXLOGXSIRUHDV\FOHDQ LQJ DQG ORQJHU RSHUDWLQJ OLIH 'ULSOHVV OLS FDWFKHV DQG GUDLQV PRLVWXUH EDFN LQWR WKH ZHOO 6WDLQOHVV VWHHOH[WHULRUPHHWV8/VXUIDFHWHPSHUDWXUHVWDQ GDUGV IRU RSHUDWRU DQG FXVWRPHU VDIHW\ 0HHWV 16)VWDQGDUGV

)

(6PDUW)DEULFDWLRQΠ<RXU GHVLJQ \RXU VSHFV $GYDQFH 7DEFRVWDQGDUGL]HVFXVWRPIDEULFDWLRQ E\SDLULQJFDWDORJLWHPVZLWKKXQGUHGV RIVWRFNPRGLILFDWLRQVDQGDFFHVVRULHV WKDWPHHW\RXUVSHFLILFDWLRQV

(

&RQVLVWHQW TXDOLW\ DOO ZLWKLQ \RXU WLPH DQG EXGJHW FRQVWUDLQWV LV WKH UHDVRQ 6PDUW )DEULFDWLRQΠLV WKH RQO\ IDEULFDWLRQ\RXZLOOHYHUQHHGContact our customer service department for assistance.

)+5&36HULHV'XDO7HPSHUDWXUH'URS,QV 7ZR XQLWV LQ RQH :LWK D IOLS RI D VZLWFK TXLFNO\ FRQYHUW IURP KRW WR FROG RSHUDWLRQ )URP  WR  SDQV :HOOV GHOLYHUV XQLWV WKDW FDQ IXOO\ VXSSRUW \RXU PHQX LQ DQ\ IRRGVHUYLFH RSHUDWLRQ 6HOIFRQWDLQHG DQG &)&IUHH 5HFHVVHG  WR FRPSO\ ZLWK 16) SHUIRUPDQFH UHTXLUHPHQWV 0RGHO+5&3VKRZQ 0RGHO'HVFULSWLRQ +5&3 +RW&ROG:HOO [3DQV

+5&3 +RW&ROG:HOOV [3DQV

+5&3 +RW&ROG:HOOV [3DQV

+5&3 +RW&ROG:HOOV [3DQV

+5&3 +RW&ROG:HOOV [3DQV

+5&3 +RW&ROG:HOOV [3DQV

Additional models available.


+ROGLQJ(TXLSPHQW_

$+RW &ROG'URS,Q8QLWV 5DQGHOO¶V H[SHUWLVH RQ WKH UHIULJHUDWHG VLGH LV PDUULHG WRJHWKHU ZLWK WKHLU UHQRZQHG KRW IRRG ZHOO SHUIRUPDQFH WR RIIHU D PDWFKLQJ OLQH RI GURSLQV $YDLODEOH LQ VHOIFRQWDLQHGPHFKDQLFDO FROGZDOO XQLWV LFHFRROHG DQG IURVWWRS XQLWV IRU WKH FROG VLGH DQG LQGLYLGXDO ZHOO DQG ZDWHU EDWK PRGHOV RQ WKH KRW VLGH )RU WKRVH ZKR DUH WRUQ EHWZHHQ WKH WZR WKH\ DOVR RIIHU D FRPELQDWLRQ KRWFROG XQLW WKDW DOORZV \RX WR GRERWKLQWKHVDPHVSDFH

$

0RGHO'HVFULSWLRQ 6&$ V

6HOI&RQWDLQHG5HIULJHUDWHG&ROG3DQ  [3DQ&DSDFLW\ ,& ,FH&RROHG5HIULJHUDWHG&ROG3DQ  [3DQ&DSDFLW\ 6&$ 6HOI&RQWDLQHG0HFKDQLFDOO\&RROHG)URVW7RS[  'URS,Q(OHFWULF&RPPRQ:DWHU%DWK+RW:HOO  [3DQ&DSDFLW\  'URS,Q(OHFWULF&RPPRQ:DWHU%DWK+RW:HOO  [3DQ&DSDFLW\ = 'URS,Q&RPELQDWLRQ(OHFWULF+RW&ROG:HOO  [3DQ&DSDFLW\ $GGLWLRQDOPRGHOVDYDLODEOH

& 0RGHO'HVFULSWLRQ 9%57/  7DEOH/RZ+HLJKWZ6WG&DVWHU 9%57/+'  7DEOH/RZ+HLJKWZ+Y\'XW\&DVWHU 9%5  )RRG%DUZ6QHH]H*XDUGZ6WG&DVWHU 9%5+'  )RRG%DUZ6QHH]H*XDUGZ+Y\'XW\&DVWHU $GGLWLRQDOPRGHOVDYDLODEOH

% %1DFKR&KLS:DUPHUV ,GHDO IRU 0H[LFDQ DQG 7H[0H[ UHVWDXUDQWV EDUV WKHDWHU VQDFN EDUV FDUQLYDO IRRGVHUYLFH FDWHULQJ DQG PXFK PRUH )UHVK ZDUP FKLSV DSSHDO WR \RXU FXVWRPHUV DQG GULYH PHQX VDOHV 3DWHQWHG ILUVWLQ ILUVWRXW SURGXFW URWDWLRQ UHGXFHV FKLS EUHDNDJH DQG HQVXUHV D FRQWLQXRXV VXSSO\ RI IUHVK FKLSV 7KUHH VL]HV WR FKRRVHIURP 0RGHO'HVFULSWLRQ &: *DO &:( *DO &: *DO

&9HUVD)RRGVHUYLFH6\VWHP 9HUVD )RRG %DUV IHDWXUH FRXQWOHVV FRQILJXUDWLRQV IRU DQ\ VLWXDWLRQ )XOO\ SRUWDEOH V\VWHP NHHSV IRRG FROG IRU KRXUV (DV\ FDUH DQG XQPDWFKHG GXUDELOLW\ 6QHH]H JXDUGV DUH FRPSOLDQW ZLWK  16) UHTXLUHPHQWV 8VH WKH VWUDLJKWRUFRUQHUFRQQHFWRUWRFRQQHFWIRRGEDUVZRUNWDEOHVDQGFDVKLHUVWDWLRQV WR FUHDWH D SURIHVVLRQDO XQLIRUP ORRN -RLQ D FDVKLHU VWDWLRQ ZLWK D IRRG EDU IRU IDVWHU FKHFNRXW DQG LPSURYHG WUDIILF IORZ 0D[LPL]H VSDFH E\ FRQQHFWLQJ  )RRG %DUV ZLWK WKH FRUQHU FRQQHFWRUV²WKH SRVVLELOLWLHV DUH HQGOHVV 8OWUD 6HULHV QRZ DYDLODEOH ZLWK WZR VHFXUH VWRUDJH FDELQHWV WKDW FDQ HDFK KROG XS WR  OEV RI QRQSHULVKDEOHLWHPV

'+HDWHG 5HIULJHUDWHG'URS,QV %XLOWLQ ZHOOV JLYH \RX UHOLDEOH SHUIRUPDQFH DQG NHHS \RXU IRRG KRW RU FROG² ZLWKRXW WKH JXHVVZRUN +HDWHG PRGHOV IHDWXUH UHPRWH WKHUPRVWDW ZLWK VHSDUDWH OLJKWHG SRZHU VZLWFK ([FOXVLYH ORQJOLIH KHDWLQJ HOHPHQW GHVLJQ ZLWK D \HDU ZDUUDQW\\HDUSDUWVDQGRQVLWHODERUZDUUDQW\&KRRVHWKHQXPEHURIZHOOVLQ PRGXODUJDQJHG IURP  WR  FRQILJXUDWLRQV DV ZHOO DV YROWDJH ILOO GUDLQ DQG PRXQWLQJ RSWLRQV 7RS DQG ERWWRPPRXQW IXOO UHFWDQJXODU ZLWK RU ZLWKRXW LQVXODWLRQ VL]HVTWTWTWLQORZVWDQGDUGDQGKLJKZDWWPRGHOV1HZ 16) DSSURYHG 5HIULJHUDWHG 'URS,Q IHDWXUHV WRS PRXQW ZLWK  WR SDQ FRQILJXUDWLRQV HOHFWURQLF FRQWUROOHU ZLWK DXWRGHIURVW DQG JUHHQIULHQGO\ LQVXODWLRQWKURXJKRXW 0RGHO'HVFULSWLRQ +:%/)8/ +HDWHG)XOO6L]H[ :DWW

+:%)8/ +HDWHG)XOO6L]H[ :DWW

+:%+)8/ +HDWHG)XOO6L]H[ :DWW

+:%/)8/' +HDWHG)XOO6L]HZ'UDLQ[ :DWW

+:%)8/' +HDWHG)XOO6L]HZ'UDLQ[ :DWW

+:%+)8/' +HDWHG)XOO6L]HZ'UDLQ[ :DWW

$GGLWLRQDOPRGHOVDYDLODEOH

'

(

($HURKRW6WHDP7DEOHV (DFKKRWIRRGZHOOLVLQGLYLGXDOO\FRQWUROOHG :HWEDWKPRGHOVH[FOXGHG 6WDLQDQGFRUURVLRQUHVLVWDQW WRSLVKHDY\JDXJHW\SHVHULHVVWDLQOHVVZLWKKLJKQLFNHOFRQWHQW6WDLQOHVVVWHHOERG\&DUYLQJ ERDUG LV KLJKJUDGH SRO\ ZLWK URXQGHG FRUQHUV 0RXQWHG RQ VWDLQOHVV VWHHO VXSSRUW EDVH DQG GLH VWDPSHGEUDFNHWV²HDVLO\UHPRYHGIRUFOHDQLQJ99RU9DVZHOODVQDWXUDORUSURSDQH JDV(OHFWULFXQLWDYDLODEOHLQH[SRVHGDQGVHDOHGZHOOGHVLJQ8/16)$*$ 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ ( (OHFWULF  :HOOV  *DV  :HOOV ( (OHFWULF  :HOOV  *DV  :HOOV ( (OHFWULF  :HOOV  *DV  :HOOV ( (OHFWULF  :HOOV  *DV  :HOOV $GGLWLRQDOPRGHOVDYDLODEOH


+ROGLQJ(TXLSPHQW_

$6WHDP7DEOH%D\ 7KLV RSHQ ZHOO VWHDP WDEOH IHDWXUHV VWDLQOHVV VWHHO FRQVWUXFWLRQ ZLWK JDOYDQL]HG VWHHO ZHOOV DQG OHJV ,WV  GHHS RSHQ ZHOO GHVLJQ ILWV IXOO VL]H VSLOODJH SDQV (TXLSSHG ZLWK DQ DGMXVWDEOH VWDLQOHVV VWHHO XQGHUVKHOI DQG DQ [     SRO\FDUERQDWH FXWWLQJ ERDUG 7ZR LQGLYLGXDOO\ FRQWUROOHG : KHDWLQJ HOHPHQWV ZLWK LQILQLWH FRQWURO VZLWFKHV RIIHUV H[WUHPH YHUVDWLOLW\ +[:[' 9 : 0RGHO 67

%

$

%6HUYH:HOOŠ )RRG7DEOHV ,QQRYDWLYH GHVLJQ LQ YDOXHSULFHG PRELOH VHUYLQJ HTXLSPHQW ([FOXVLYH WKHUPRVHW PDWHULDO FDQQRW SLW RU UXVW 'RPH KHDWLQJ HOHPHQWVPRXQWHGLQVLGHZHOO(DFKZHOOHTXLSSHGZLWKLQGLYLGXDO GUDLQ $ QRQUHIULJHUDWHG FROG IRRG WDEOH RI WKH VDPH VROLG FRQVWUXFWLRQ DYDLODEOH 6WDLQOHVV VWHHO LFH ZHOO LV GHVLJQHG WR DFFRPPRGDWH VWDQGDUG [[ VWHDP WDEOH SDQV DQG DFFHVVRULHV 0DGH LQ WKH 86$ 16) 0RGHO  VKRZQ ZLWK RSWLRQDO6HUYLFH6LGH3RO\&XWWLQJ%RDUGZ0RXQWLQJ.LW 0RGHO'HVFULSWLRQ  :HOO+RW:DWWV:HOO9$  :HOO+RW:DWWV:HOO9$  :HOO+RW:DWWV:HOO9$  :HOO+RW:DWWV:HOO9$  :HOO+RW:DWWVZHOO9$  :HOO+RW:DWWV:HOO9$ $GGLWLRQDOPRGHOVDYDLODEOH

&

&(OHFWULF+RW)RRG7DEOHV +RW IRRG WDEOHV DUH KHDY\GXW\ IXOO\ DVVHPEOHG VWDLQOHVV VWHHO DQG GHVLJQHG IRU WKH PRVW GHPDQGLQJ DSSOLFDWLRQV $YDLODEOH LQ HOHFWULF ZHWGU\ LQGLYLGXDO ZHOO DQG HOHFWULF ZHW ZDWHU EDWK PRGHOV 2SWLRQV LQFOXGH FRXQWHU SURWHFWRUV HQFORVHG EDFN IRU LVODQG FRQILJXUDWLRQV  WUD\ VOLGHV FDVWHUV DQG RYHUVKHOYHV 6ROLG ZHOGHG VWDLQOHVV VWHHO FRQVWUXFWLRQ 'LH VWDPSHG LQGLYLGXDO [ UDLVHG VDQLWDU\ ULP RSHQLQJV (DFK ZHOO KDVLWVRZQWKHUPRVWDWLFFRQWUROIRUDFFXUDWHIRRGWHPSHUDWXUH

' '6KHOOH\VWHHOŒ0RELOH&DIHWHULD(TXLSPHQW 6KHOOH\VWHHOFRPELQHVWKHORQJODVWLQJGXUDELOLW\RIVWDLQOHVVVWHHOZLWK WKH GHVLJQ RI PRELOH PRGXODU FDIHWHULD V\VWHPV &RVWHIIHFWLYH DQG HDVLO\ PRGLILHG WR ZRUN LQ DQ\ DSSOLFDWLRQ +RW XQLWV FROG XQLWV RU FRPELQDWLRQXQLWVJLYH\RXWKHDELOLW\WRSURYLGHDIXOOVHUYLFHPHQXLQD OLPLWHGDPRXQWRIVSDFH2SWLRQDOODPLQDWHILQLVKDQGJUDSKLFVFDQEH DGGHG 7UD\ VOLGHV FRXQWHU SURWHFWRUV FXWWLQJ ERDUGV RYHUVKHOYHV VLJQDJH GHFRU SDQHOV KHDW ODPSV DQG OLJKWLQJ DUH RSWLRQDO &RQWDFW RXUFXVWRPHUVHUYLFHGHSDUWPHQWIRUDVVLVWDQFH

0RGHO'HVFULSWLRQ  /:HOOV'U\ Z6SLOODJH3DQ

 /:HOOV'U\ Z6SLOODJH3DQ

 /:HOOV'U\ Z6SLOODJH3DQ

 /:HOOV'U\ Z6SLOODJH3DQ

 /:HOOV:HW Z'UDLQV 0DQLIROG

 /:HOOV:HW Z'UDLQV 0DQLIROG

 /:HOOV:HW Z'UDLQV 0DQLIROG

 /:HOOV:HW Z'UDLQV 0DQLIROG

( (6KHOO\JODVŠ 0RELOH(TXLSPHQW 5HDUUDQJH \RXU HTXLSPHQW ZKHQHYHU \RX ZDQW 6WHHO UHLQIRUFHG ILEHUJODVV EDVH LV OLJKWHU WKDQ VWDLQOHVV VWHHO 0DWFK \RXU GpFRU² VWDQGDUG FRORUV RU FXVWRP FRORUV DYDLODEOH $Q HDV\WRXVH VWDLQOHVV VWHHOLQWHUORFNV\VWHPDOORZVXQLWVWREHFRQQHFWHG7UD\VOLGHVFRXQWHU SURWHFWRUV FXWWLQJ ERDUGV RSHQ XQGHUVWRUDJH DQG RYHUVKHOYHV DUH RSWLRQDO+HDWHGZHOOVFROGSDQVRUFRPELQDWLRQFRXQWHUVDUHDYDLODEOH /RZ PDLQWHQDQFH UHIULJHUDWLRQ V\VWHPV DQG WRSQRWFK PDWHULDOV DQG ZRUNPDQVKLS&RQWDFWRXUFXVWRPHUVHUYLFHGHSDUWPHQWIRUDVVLVWDQFH


+ROGLQJ(TXLSPHQW_

$0RELOH6HUY 7HPSHUDWXUH5HDG\ 6HUYLQJ&DUWV 3URYLGHVDQDWWUDFWLYHGLVSOD\ RI YDULRXV PHQX LWHPV ULJKW LQ IURQWRIWKHFXVWRPHUV7KLVODUJH PRELOH KRWFROG EXIIHW FDUW DOORZV RSHUDWRUV WR NHHS IRRGV RQ WKH EXIIHWWRSKRWRQRQHVLGHDQGFROGRQWKH RWKHU VLGH (DVLO\ UHSOHQLVK ZLWK EDFNXS PHQX LWHPVFORVHDWKDQGLQWKHRSWLRQDOKRWFROGER[RQFDUW¶V ORZHU VWRUDJH VKHOI 6WDLQOHVV VWHHO FDUW ZLWK KDQGOH DQGZKHHOV 0RGHO'HVFULSWLRQ &%&+& 66%ODFN:$PSV &%&+++ 66%ODFN: $PSV

&

%

$

& 6LJQDWXUH 6HUYHU Š &ODVVLF 0RELOH(TXLSPHQW 'HVLJQ LQGLYLGXDO VHUYLQJ OLQH XQLWV RU FRPSOHWH OLQHXSV LQ PLQXWHV &KRRVH IURP KXQGUHGV RI PDWHULDO FRORUDQGHTXLSPHQWRSWLRQV'ULYHQE\ \RXU VSHFLILFDWLRQV WKHVH XQLWV DUH GHVLJQHG WR ILW \RXU XQLTXH DSSOLFDWLRQ QHHGV ZLWK D PL[ RI FXVWRP DQG VWDQGDUG RSWLRQV WR DFKLHYH WKH RSWLPXP IXQFWLRQDOLW\ DQG SULFLQJ &RQWDFW RXU FXVWRPHU VHUYLFH GHSDUWPHQWIRUDVVLVWDQFH

'&DP.LRVNŠ &DUWV 6\VWHP 'XUDEOH SRO\HWK\OHQH FDUWV DUH OLJKWZHLJKW DQG ZRQ¶W GHQW FUDFN EXEEOHFKLSRUEUHDN+ROGLQJFDELQHWV KDYH WKLFN IRDP LQVXODWLRQ DQG H[WHUQDOO\ PRXQWHG WKHUPRPHWHUV 6QHH]H JXDUG PHHWV IRRG SUHSDUDWLRQ UHTXLUHPHQWV 0ROGHGLQ KDQGOHV DQG VZLYHOFDVWHUVPDNHWUDQVSRUWHDV\ 2SWLRQDO +DQG 6LQN &DUW ZLWK 7RZHO DQG 6RDS 'LVSHQVHU PDNHV KDQG ZDVKLQJ FRQYHQLHQW RU :RUN 6WDWLRQ ZLWK 7RZHO 'LVSHQVHU SURYLGHV DGGLWLRQDO VSDFH IRU SUHSDULQJ IRRG RU FRPSOHWLQJVDOHVWUDQVDFWLRQV 0RGHO'HVFULSWLRQ .9& .LRVN3DQ .9&& .LRVN3DQZ&DQRS\ .9&8 .LRVN3DQZ8PEUHOOD .9& .LRVN3DQ .9&& .LRVN3DQZ&DQRS\ .9&8 .LRVN3DQZ8PEUHOOD .6& +DQG6LQNZ7RZHO 6RDS'LVSHQVHU .:6 :RUN6WDWLRQZ7RZHO'LVSHQVHU

%6HUYLQJ6\VWHPV 'XNH6HUYLQJ6\VWHPVGHOLYHUVRPHRIWKHIDVWHVWUHWXUQRQ LQYHVWPHQWV LQ WKH IRRGVHUYLFH HTXLSPHQW LQGXVWU\ &DQ EH FRQILJXUHG WR ILW YLUWXDOO\ DQ\ IRRWSULQW DQG FXVWRPHU QHHG ,QFUHDVHG SDUWLFLSDWLRQ DQG SURILWV DUH DVVXUHG E\ EULQJLQJ WKH DWPRVSKHUH RI D PDOO IRRG FRXUW WR D IRRGVHUYLFH RSHUDWLRQ &RPSOHWH ZLWK FRXQWHUV GLVWLQFWLYH VLJQDJH DGDSWDEOH IURQW GHFRU SDQHOV WUDQVLWLRQ PHUFKDQGLVLQJ VKHOYLQJDQGGHFRUDWLYHVRIILWVS\ORQDQGJUDSKLFVV\VWHPV (QJLQHHUHG WR JLYH WKH GHVLJQHU IOH[LELOLW\ LQ GHYHORSLQJ D IRUP DQG IXQFWLRQ XQLTXH WR WKH ORFDWLRQ 6WDQGDUG EDVH IHDWXUHV DUH VWDLQOHVV VWHHO LQWHULRUV DQG )RUPLFD H[WHULRUV 16)FROGSDQVDUHVWDQGDUG&RQWDFWRXUFXVWRPHUVHUYLFH GHSDUWPHQWIRUDVVLVWDQFH

(

'

(7KXUPDGXNH6HUYLQJ6\VWHPV $Q XSVFDOH ³WUDGLWLRQDO´ VHUYLQJ V\VWHP SHUIHFW IRU HOHPHQWDU\ VFKRROV PLGGOH VFKRROV DQG KLJK VFKRROV7KXUPDGXNHPHDQVTXDOLW\DWDQDIIRUGDEOH SULFH 1RZ ZLWK LQWHUQDO ORFNLQJ GHYLFHV LW¶V HYHQ HDVLHU WR SXW D OLQHXS WRJHWKHU DQG EUHDN LW DSDUW ZKHQ QHHGHG IRU PHQX FKDQJHV RU PXOWLSOH IXQFWLRQV )URP VWDUW WR ILQLVK 7KXUPDGXNH LV \RXU LQVWLWXWLRQDO V\VWHPV OHDGHU &RQWDFW RXU FXVWRPHU VHUYLFHGHSDUWPHQWIRUDVVLVWDQFH


+ROGLQJ(TXLSPHQW_ % $(+(,6HULHV(&KHIŒ+RW)RRG7DEOHV 'HVLJQHGZLWKWKHTXDOLW\\RXZRXOGH[SHFWIURP'HOILHOGZLWKWKHIHD WXUHV\RXQHHGWRNHHS\RXURSHUDWLRQUXQQLQJHIILFLHQWO\DQGSURILWDEO\ $OO DW D SULFH WKDW¶V HDV\ RQ \RXU ERWWRP OLQH 7KH (+(, VHULHV RI KRW IRRG WDEOHV FDQ IXQFWLRQ DV VWDQG DORQH SLHFHV RU DV D FRPSRQHQW RI 'HOILHOG¶V (&KHI 3URGXFWLRQ 6\VWHPV 5HDOL]H WKH HFRQRP\ RI DQ DWWUDFWLYHSXUFKDVHSULFHZLWKRXWVDFULILFLQJXVDELOLW\RUGXUDELOLW\ %6OHHN6KLHOGVŒ 0RGHO'HVFULSWLRQ ,QWURGXFLQJ 6OHHN 6KLHOGVŒ ZLWK &KDPEHU /RFNŒ WHFK (+(,& +RW)RRG7DEOH(OHFWULFZ&DVWHUV QRORJ\ PDNLQJ URWDWLQJ )RRG 6KLHOGV HDVLHU WKDQ HYHU (+(,/ +RW)RRG7DEOH(OHFWULFZ/HJV 6D\JRRGE\HWRWKHGD\VRIORRVHQLQJDQGWLJKWHQLQJEROWV (+(,& +RW)RRG7DEOH(OHFWULFZ&DVWHUV RQERWKVLGHV6LPSO\UHOHDVHWKHFKDPEHUDQGWXUQIURP (+(,/ +RW)RRG7DEOH(OHFWULFZ/HJV RQO\ RQH VLGH )URQW JODVV HDVLO\ URWDWHV WR DQ\ SRVLWLRQ (+(,& +RW)RRG7DEOH(OHFWULFZ&DVWHUV &KDPEHU/RFNŒOHWV\RXSRVLWLRQIURQWJODVVDWƒLQWHU $GGLWLRQDOPRGHOVDYDLODEOH YDOV7KLVORZSURILOHGHVLJQPHDQVOHVVPHWDODQGPRUH YLVLEOH JODVV PDNLQJ WKLV WKH VOHHNHVW )RRG 6KLHOG \HW 16)6HOIVHUYLFHRUFDIHWHULDPRGHOVDYDLODEOHZLWKJODVV RUVWDLQOHVVVWHHOWRS 0RGHO'HVFULSWLRQ *6* 6HOI6HUYLFH[[ *6* 6HOI6HUYLFH[[ *6* 6HOI6HUYLFH[[ $GGLWLRQDOPRGHOVDYDLODEOH

$

& &0RELOH6HUYLQJ/LQHV 0RELOH \HW UHWDLQLQJ WKH VXSHULRU 5DQGHOO GHVLJQ DQG WHFKQRORJ\²UHOLDEOH UHIULJHUDWLRQ KLQJHG ORXYHU ZLWK HDV\ DFFHVV WR GUDLQ DQG WHPSHUDWXUH FRQWUROV ([FOXVLYH HOHFWULFDO GLVWULEXWLRQ V\VWHP DOORZV WKH EDQNLQJ RI VHYHUDO XQLWV WRJHWKHU SURYLGLQJDFRPPRQFRQQHFWLRQSRLQW)HDWXUHVKHDWHGFROGZHOOXQLWVVKHOYLQJXQLWV GLVSOD\ FDVH XQLWV DQG FDVKLHUV DQG WUD\ VWDQGV 6WDLQOHVV VWHHO ODPLQDWHV VROLG VXUIDFHV DQG SRZGHUFRDWHG PDWHULDOV DYDLODEOH &RQWDFW RXU FXVWRPHU VHUYLFH GHSDUWPHQWIRUDVVLVWDQFH

'

(

(&RPSOHWHO\&XVWRP)DEULFDWLRQ )XOO FXVWRP IDEULFDWLRQ EXLOW ZLWK VHW GHVLJQVWDQGDUGVRUEXLOWWRFRQVXOWDQW VSHFLILFDWLRQV )URP WKH IURQWRIWKH KRXVH WR WKH EDFNRIWKHKRXVH 0DYHULFN SURGXFHV D ZLGH UDQJH RI TXDOLW\HTXLSPHQWWKDWH[FHHGVH[SHF WDWLRQV RI IRRGVHUYLFH SURIHVVLRQDOV DQGFRQVXOWDQWV&RQWDFWRXUFXVWRPHU VHUYLFHGHSDUWPHQWIRUDVVLVWDQFH

'5DQ&KHI&XVWRP3URGXFWV &KHI7DEOHV 'HVLJQHG WR ILW \RXU DSSOLFDWLRQ DQG EXGJHW )URP KHDY\GXW\ WR WKH EXGJHW FRQVWUDLQHG 5DQGHOO ZRUNV ZLWK \RX WR SURYLGH MXVW WKH ULJKW EOHQG RI SUHPLXP SHUIRUPDQFH VWDQGDUG SURG XFWVDQGFXVWRPIDEULFDWHGVKHOYLQJXQLWVRYHU VKHOYHVDQGDFFHVVRULHV0RGXODUSUHGHVLJQHG XQLWV DOORZ \RX WR VWDUW ZLWK WKH EDVLF PRGXOHV DQG WKHQ  FUHDWH \RXU YHU\ RZQ &HQWHU,VODQG &KHI¶V &RXQWHU 6HUYHU 6WDWLRQV RU &DIHWHULD &RXQWHUV16)DQG8/&RQWDFWRXUFXVWRPHU VHUYLFHGHSDUWPHQWIRUDVVLVWDQFH

)

)(OLWH6HUYLQJ6\VWHP 5HIOHFWLRQV&DVKLHU6WDQG (OLWH XQLWV IHDWXUH GXUDEOH HDV\ WR FDUH IRU VWDLQOHVV VWHHO RU RSWLRQDO IRUPLFD  DQG FRPH LQ EHDXWLIXO SL]]D]] SRZGHUFRDW FRORUV²RQH LV VXUH WR PHHW \RXU GpFRU GHPDQGV $OO (OLWH XQLWV DUH GHVLJQHG IRU PRGXODU LQVWDOODWLRQ 0RGHOV+)&%6767&'VKRZQ 0RGHO'HVFULSWLRQ +)+,% :HOO+HDWHG%DVH/[:[+: +)+,% :HOO+HDWHG%DVH/[:[+: +)+,% :HOO+HDWHG%DVH/[:[+: +)+,% :HOO+HDWHG%DVH/[:[+: +)+,% :HOO+HDWHG%DVH/[:[+: $GGLWLRQDOPRGHOVDYDLODEOH

* *&RPSRQHQW&UDIWHG&XVWRP(TXLSPHQW &RQILJXUDWLRQV LQFOXGH UHIULJHUDWHG SUHS WDEOHV FRXQWHU GLVSOD\FDVHVXWLOLW\FDELQHWVHTXLSPHQWVWDQGVXSULJKW UHIULJHUDWRUV DQG IUHH]HUV KRW IRRG WDEOHV DQG PRUH :KDWHYHU\RXQHHGFDQEHEXLOWWR\RXUVL]HDQGOD\RXW UHTXLUHPHQWV²ZKHWKHUVLPSOHRUFRPSOH[(DFKGUDZHU V\VWHPIHDWXUHVDQH[FOXVLYH)XOO([WHQVLRQ3OXV'UDZHU 6\VWHP ZKLFK LV LQFUHGLEO\ VPRRWK DQG KDV QR PHWDOWR PHWDOFRQWDFW²QR FRUURVLRQ %HVW RI DOO WKH GUDZHUWUDFNVDUHEDFNHGE\D\HDUZDUUDQW\


Kitchen Prep Slicers Mixers Food Processors Scales Work Tables A How much money will a food processor save you? Use the following formula based on actual figures for your operation. 1. Total length of time to process all items (items that are now processed by hand and the number of people and hours that are required for completion of those functions by hand). 2. The length of time these same functions will take one person using a food processor. 3. Subtract the lessor time (#2) from the greater time (#1). 4. Multiply the number of hours saved by the hourly wage paid to get the daily savings.

A. TRS Vegetable Cutters. The new and improved TRS vegetable cutter has a handle on the back of the unit allowing for easy lifting. The increased hopper allows for more input and quicker output of vegetables and fresh fruit; processing up to 850 lbs. per hour. The large selection of 32 cutting blades makes it possible to realize more than 80 different types of cuts without being an expert chef. All parts are easily removable and dishwasher friendly. Self-braking motor stops automatically when hopper and lever arm are raised. Model Description 603800 TRS22, 1-Speed, S/S, 1/2 HP (discs not included) 603801 TRS23, 1-Speed, S/S, 2/3 HP (discs not included) 603802 TRS24, 1-Speed, S/S, 1 HP (discs not included) 603803 TRSU, 2-Speed, S/S, 1 HP (discs not included)

5. Multiply the daily savings by the number of operating days per year. This will give you gross first-year savings. 6. Subtract the cost of the food processor from the gross first-year savings. This gives you a net first-year savings. Each year thereafter the savings is the full amount.

Finding A Slicer That Will Make The Cut Things to consider when selecting a slicer: Performance, Consistency and Construction. When considering performance, one true test of a slicer is its ability to slice tough products. Cheese is actually considered to be a tough product. The knife motor needs to be powerful enough so that it will not slow or get bogged down when the blade makes contact with the cheese. Another aspect of performance is the consistency and precision of the cut. All slicers can create thick slices but only a high quality slicer can create slices so thin you could read a paper through it. Why is that important? Thin slices enhance the taste and tenderness of the meat. Also, for sandwich operations, thin slices fold more, which create an appearance of a much larger amount of meat. You should also consider the construction of a slicer. It will affect both the cleanability and the sanitation of the slicer. The metal of choice for the foodservice industry is stainless steel. Stainless is resistant to corrosion and pitting which is caused by many acidic foods. Questions you should ask yourself: What types of product will I be slicing? How many hours will the slicer be used per day? What safety features are important? How much do I have budgeted for the slicer? Also, look at the out-ofwarranty costs to maintain and use the unit.

B

B. Shelleymatic速 Salad Ace. Get fresh, crisp and appealing salad products with no damage to the foods. Removes moisture from lettuce and other vegetables through efficient spin-action. Motor is completely enclosed and water-tight. Adjustable on/off timer. Standard with polyethylene inner liner and locking casters. 20-gallon capacity. Stainless steel outer shell provides durability and long-life. Model SALD-1


.LWFKHQ3UHS_ &

$

$(FRQRP\ 0HGLXP'XW\6OLFHUV (FRQRP\ DQG PHGLXP GXW\ VOLFHUV DUH SRZHUIXO \HW FRPSDFW 'XUDEOH DQRGL]HG DOXPLQXP FRQVWUXFWLRQ 7RSPRXQWHG NQLIH VKDUSHQHU LV DOO PHWDO VWRQH W\SH +DUG FKURPHG VSHFLDO DOOR\ KROORZ JURXQG NQLIH 0HWDO ERWWRP HQFORVXUH 5HPRYDEOH HDV\WRFOHDQFKXWHVOLFHGHIOHFWRUNQLIHFRYHU DQGVKDUSHQHU0RWRURYHUORDGSURWHFWLRQZLWK PDQXDO UHVHW  (7/ 16)  OLVWHG \HDU SDUWV DQG ODERU ZDUUDQW\ 0RGHO&VKRZQ 0RGHO'HVFULSWLRQ & .QLIH+3 (FRQRP\0DQXDO

& .QLIH+3 (FRQRP\0DQXDO

& .QLIH+3 (FRQRP\0DQXDO

* .QLIH+3 0HGLXP'XW\

* .QLIH+3 0HGLXP'XW\

* .QLIH+3 0HGLXP'XW\

%3UHPLXP+HDY\'XW\$XWRPDWLF 0DQXDO6OLFHUV )HDWXUHV D  3UHFLVH(GJHΠKDUGHQHG VWHHO DOOR\ NQLIH VWDLQOHVV VWHHO FRQVWUXFWLRQ ZLWK VXSHULRU UHVLVWDQFH DJDLQVW DFLGV IRXQG LQ IUXLW PHDWV DQG YHJHWDEOHV +LJK SHUIRUPDQFH PDLQ WHQDQFHIUHH JHDU NQLIH GULYH 5DWHG IRU  FRQWLQXRXV XVH IRU VOLFLQJ FKHHVH DQG RWKHU VWLFN\ IRRG SURGXFWV (=*OLGHΠVOLFH V\VWHP 3RZHUIXO  +3  DPS PRWRU $XWRPDWLF PRGHOVFDQEHGLVHQJDJHGIRUPDQXDORSHUDWLRQ 0RGHOV 1 DQG 1 DGGLWLRQDO IHDWXUHV LQFOXGH KRPH SRVLWLRQ VWDUW WDEOH ORFNRXW DXWRPDWLF VKXWRII DQG UHWXUQWRKRPH FKXWH \HDU SDUWV \HDU ODERU DQG \HDU ZDUUDQW\ % RQ NQLIH GULYH JHDUV (7/ DQG 16)  OLVWHG 0RGHOV1VKRZQ 0RGHO'HVFULSWLRQ 1 0DQXDO 1 0DQXDO 3URWHFK

1 6SHHG&KXWH6SHHGWRVSP 1 6SHHG&KXWH6SHHGWRVSP 1 6SHHG&KXWH6SHHGWRVSP 3URWHFK

6OLFHU&DUH ‡5XQQLQJEXWWHUWKURXJKWKHPHDWJULQGHUEHIRUHJULQGLQJRQLRQVPHDWV FKHHVHQXWVRUUDLVLQVZLOOPDNHFOHDQLQJHDVLHU ‡$IWHUXVLQJWKHHOHFWULFPHDWJULQGHUSXWVHYHUDOVOLFHVRIEUHDGWKURXJK WKHJULQGHU7KLVZLOODLGLQFOHDQLQJIDWDQGJUHDVHRXWRIWKHJULQGHU ‡,WLVLPSRUWDQWWRFOHDQ\RXUVOLFHUWKRURXJKO\EHIRUHDQGDIWHUVKDUSHQLQJ \RXUNQLIH ‡(PSOR\LQJKLJKVFKRROVWXGHQWV")HGHUDOODZSURKLELWVVOLFHURSHUDWLRQE\ SHUVRQVXQGHU

&6HULHV0DQXDO*UDYLW\)HHG6OLFHUV 0DQXDO JUDYLW\IHHG VOLFHUV IHDWXUH D KROORZ JURXQG FKURPLXPSODWHG FDUERQVWHHO NQLIH DQG EXLOWLQ GXDODFWLRQVKDUSHQHUZLWKFRQYHQLHQWKDQGOHORFDWHGRQWKHVKDUSHQHUFRYHU3URWHFWWKHEODGHDVZHOO DV\RXUILQJHUVZLWKWKHSHUPDQHQWULQJJXDUGDQGUHPRYDEOHFHQWHUSODWH'LVDVVHPEOHTXLFNO\ZLWKRXW WRROVIRUHDV\FOHDQLQJ(7/16)\HDUSDUWVDQGODERUZDUUDQW\ 0RGHO'HVFULSWLRQ ( .QLIH6OLFH$GMWR7KLFNQHVV+3 $ .QLIH$QJOHG ƒ 6OLFH$GMWR7KLFNQHVV+3 ( .QLIH6OLFH$GMWR7KLFNQHVV+3 $ .QLIH$QJOHG ƒ 6OLFH$GMWR7KLFNQHVV+3 ( .QLIH6OLFH$GMWR7KLFNQHVV+3 $ .QLIH$QJOHG ƒ 6OLFH$GMWR7KLFNQHVV+3 ( .QLIH$QJOHG ƒ 6OLFH$GMWR7KLFNQHVV+3

&

';6HULHV3UHPLXP6OLFHUV 'HVLJQHGXVLQJWKHODWHVWWHFKQRORJ\LQPRWLRQJHRPHWU\HQHUJ\DQGK\JHQLFV2QHSLHFHEDVHIUHHRI VHDPV MRLQWV DQG EDFWHULD KDUERUDJH SRLQWV SURYLGLQJ D )'$ DSSURYHG VXUIDFH IRU HDV\ HIIHFWLYH FOHDQLQJ 5HPRYDEOH DQG VXEPHUVLEOH WDEOH PRXQWHG VKDUSHQHU ZLWK ERUD]RQ VWRQHV IRU DFFXUDWH VKDUSHQLQJ9DULDEOHSLWFKEDUUHOFDPIRUSUHFLVHVOLFHDGMXVWPHQWVWRDWKLFNQHVVRI,QGH[NQREDQG FRQWUROV DUH HDV\ WR DFFHVV DQG DUH LQ SODLQ YLHZ RXW RI GULS ]RQH 3HUPDQHQW ULQJ JXDUGV SURWHFW WKH QRQVOLFLQJ NQLIH ]RQH 6LPSOH NLFN VWDQG IRU HDV\ FOHDQLQJ XQGHU VOLFHU )HQFH LV SURYLGHG IRU H[WUD KROGLQJRIVPDOOSURGXFWV+3(7/16)

'

0RGHO'HVFULSWLRQ ;( 0DQXDO6SHHG ;$( $XWRPDWLF6SHHG


.LWFKHQ3UHS_

$

$)RRG3URFHVVRU²&/( 3UHSDUHSOXVVHUYLQJVLQKRXUVRU OHVV $OO PHWDO FRQWLQXRXV IHHG XQLW LV GHVLJQHG IRU TXDOLW\ VOLFLQJ GLFLQJ VKUHGGLQJ JUDWLQJ MXOLHQQH DQG )UHQFK IU\ FXWV *HQHURXV VHOHFWLRQ RI  GLVFV DYDLODEOH IRU D YDULHW\ RI FXWV DQG SURGXFW SURFHVVLQJ &RQWURO SDQHO ZLWK ³RQRII¶¶ VZLWFK DQG PDJQHWLF VDIHW\ VZLWFK IRU XVHU VDIHW\ )HHG XQLW UHPRYHV IRU RSWLPXP VDQLWDWLRQ 5RXQG DQG NLGQH\ VKDSHG IHHG RSHQLQJV ,QFOXGHV  FXWWLQJ GLVFV 9  +]  DPSV VLQJOH SKDVH  +3 PRWRU \HDU SDUWV DQG ODERU ZDUUDQW\ 0RGHO&/(

&51&RPPHUFLDO)RRG3URFHVVRU 3UHSDUHVHUYLQJVLQKRXUVRUOHVV,QFOXGHVPRWRU EDVHXQLWZLWK³RQRII´SXOVHVZLWFKTXDUWFXWWHUERZO ZLWKVWDLQOHVVVWHHO³6´EODGHFRQWLQXRXVIHHGXQLWZLWK GLVFKDUJHGLVFRQHPHGLXP JUDWLQJGLVFDQGRQH  VOLFLQJ GLVF 6HOHFWLRQ RI  VWDLQOHVV VWHHO GLVFV DYDLODEOH IRU ODUJH YDULHW\ RI FXWV DQG SURGXFW SURFHVVLQJ $WWDFKPHQWV HDVLO\ UHPRYHG IRU RSWLPXP VDQLWDWLRQ&XWWHUERZOVKRZQLQFOHDUJUD\SODVWLFDOVR DYDLODEOH 6LQJOH SKDVH  +3 PRWRU \HDU PRWRU ZDUUDQW\\HDUSDUWVDQGODERUZDUUDQW\ 0RGHO'HVFULSWLRQ 51&/5 &OHDU%RZO8QLW 51 *UD\%RZO8QLW 518OWUD 66%RZO8QLW

%

&

%56HULHV&RPPHUFLDO )RRG3URFHVVRUV )RU OLJKW GXW\ YHJHWDEOH SUHS ,GHDO IRU SUHSDULQJ VSHFLDO GLHWV OLPLWHG TXDQWLW\ PHQX LWHPV DQG VDODG EDU FRPSOHPHQWV 5 FRPHV HTXLSSHG ZLWK  TW PL[LQJ ERZO ZLWK KDQGOH VWDLQOHVV VWHHO FXWWLQJ EODGH YHJHWDEOH VOLFHU OLG ZLWK LQWHUQDO HMHFWLRQ RQH VOLFLQJ DQG RQH JUDWLQJ GLVF 5 3OXV FRPHV HTXLSSHG ZLWK DQ DGGLWLRQDO MXOLHQQH GLVF $FFRPPRGDWHV  GLIIHUHQW GLVFV IRU ODUJH YDULHW\ RI FXWV 5% &/5 LV D ERZO RQO\ XQLW 6LQJOH VSHHG  530   DPSV VLQJOH SKDVH PRWRU \HDU SDUWV DQG ODERU ZDUUDQW\ +3IDQFRROHG9+] 0RGHO'HVFULSWLRQ 5 *UD\%RZO 5%&OHDU &OHDU%RZOZ/LGµ6¶%ODGH 53/86 &OHDU%RZO3XOVH6ZLWFK $GG¶O-XOLHQQH'LVF

' (5'LFH&RPPHUFLDO)RRG3URFHVVRU 3UHSDUH D YDULHW\ RI IDYRULWHV LQ OHVV WLPH &RQWLQXRXV YHJHWDEOH SUHS DWWDFKPHQW IRU GLFLQJ VOLFLQJ JUDWLQJ RU MXOLHQQHFXWVRUXVHWKHTXDUWJUD\SRO\FDUERQDWHFXWWHU ERZO IRU FKRSSLQJ PL[LQJ DQG WR SUHSDUH SXUHHV ,QFOXGHG DV VWDQGDUG HTXLSPHQW LV FXWWHU ERZO DWWDFKPHQW VWDLQOHVV VWHHO ³6´ EODGH YHJHWDEOH SUHS DWWDFKPHQW ZLWK H[WHUQDO HMHFWLRQ    JUDWLQJ GLVF    GLFLQJ NLW DQG    VOLFLQJ GLVF 0RGHO5',&(

( )3ODQHWDU\0L[HUV 3RZHUIXO JHDUGULYHQ PRWRUV UXJJHG FRQVWUXFWLRQ DQG GHSHQGDEOH RSHUDWLRQ SURYLGH \HDUV RI YDOXH DW D IUDFWLRQ RI WKH FRVW RI FRPSHWLWLYH PL[HUV 0L[HUV UDQJH IURP  TXDUW WR  TXDUW FDSDFLW\ 5HPRYDEOH ERZO JXDUG RQ  PRGHOV 'LJLWDO WLPHU DQG FRQWUROV RQ  TXDUW WKURXJK  TXDUW )ODW EHDWHU VWDLQOHVV VWHHO ZLUH ZKLS VSLUDO GRXJK KRRN DQG  VWDLQOHVV VWHHO ERZO LQFOXGHG 633 LQFOXGHV VWDLQ Starring in Food OHVV VWHHO ERZO GRXJK Networkâ&#x20AC;&#x2122;s KRRN DQG ERZO WUXFN  Cupcake Wars \HDU SDUWV \HDU ODERUZDUUDQW\16)(7/0RGHO63VKRZQ 0RGHO'HVFULSWLRQ 63 TW&RXQWHU+3 63 TW&RXQWHU+3Z5HPRYDEOH%RZO*XDUG 63 TW&RXQWHU+3Z5HPRYDEOH%RZO*XDUG 63 TW&RXQWHU+3Z5HPRYDEOH%RZO*XDUG 633 TW)ORRU 3L]]D +3Z5HPRYDEOH%RZO*XDUG 63 TW)ORRU+3Z5HPRYDEOH%RZO*XDUG Additional models available.

)

'58OWUD)RRG3URFHVVRU 3UHSDUH  WR  VHUYLQJV LQ OHVV WKDQ  KRXUV 9HJHWDEOH SUHS DWWDFKPHQW GHVLJQHG IRU TXDOLW\ FRQWLQXRXV IHHG VOLFLQJ VKUHGGLQJ JUDWLQJ DQG MXOLHQQH $FFRPPRGDWHV  GLIIHUHQW SURFHVVLQJ GLVFV %RZO DWWDFKPHQW GHVLJQHG IRU YHUWLFDO FXWWLQJ PL[LQJ FKRSSLQJ SXUHHV DQG EOHQGLQJ 6WDLQOHVV VWHHO ³6´ FXWWLQJ EODGH &RQWLQXRXV IHHG XQLW ZLWK DWWDFKHGODUJHIHHGSXVKHUSURFHVVLQJGLVFV    +3  530  9  +] VLQJOH SKDVHDPSV\HDUSDUWDQGODERUZDUUDQW\ 0RGHO58OWUDVKRZQ 0RGHO'HVFULSWLRQ 5  TW3RO\FDUERQDWH*UD\&XWWHU %RZO$VVHPEO\ 58OWUD  TW66&XWWHU%RZO$VVHPEO\

*0HDW&KRSSHUV 3RZHUIXO PRWRU ZLWK EXLOWLQ FRRO LQJ +RXVLQJ F\OLQGHU ZRUP DGMXVWLQJ ULQJ DQG SURGXFW WUD\ DUHFRQVWUXFWHGRIVWDLQOHVVVWHHO IRU HDV\ FOHDQLQJ DQG VXSHULRU VDQLWDWLRQ (DFK PHDW FKRSSHU FRPHV FRPSOHWH ZLWK D  NQLIH VWDLQOHVV VWHHO SURGXFW WUD\     PP  DQG     PP

SODWHV DQG SODVWLF IRRG SXVKHU \HDU SDUWV DQG ODERU ZDUUDQW\ (7/ DQG (7/ VDQLWDWLRQ OLVWHG 0RGHO&&VKRZQ 0RGHO'HVFULSWLRQ && OEVKU+XE+3 && OEVKU+XE+3

*


.LWFKHQ3UHS_ $3RZHU0L[HUV Š 7KHVH PL[HUV SHUIRUP D KRVW RI FXOLQDU\ IHDWV 7KH PL[HU DWWDFKPHQW ZLOO DOORZ \RX WR PDNH VRXSV YHJHWDEOH SXUHHV DQG SXOSV ZKLOH WKH ZKLVN DWWDFKPHQW LV LGHDO IRU PDNLQJ SDQFDNH EDWWHU PD\RQQDLVH EHDWHQ HJJ ZKLWHV FKRFRODWH PRXVVH EXWWHU VDXFHV ZKLSSHG FUHDP RU VPRRWKIURPDJHIUDLV7KHYDULDEOHVSHHGIXQFWLRQZLOOHQDEOH\RXWRDGMXVWWKHVSHHGWRVXLW HDFKSUHSDUDWLRQDQGWRVWDUWWKHSURFHVVLQJDWDORZHUVSHHGLQRUGHUWRUHGXFHVSODVKLQJ7KH SRZHUPL[HULVHDVLO\DVVHPEOHGDQGGLVDVVHPEOHGIRUPDLQWHQDQFHDQGFOHDQLQJ 0RGHO'HVFULSWLRQ 037XUER 6KDIW+3: 037XUER 6KDIW+3: 037XUER 6KDIW+3: 037XUER 6KDIW+3: 037XUER99 6KDIW9DULDEOH6SHHG+3: 037XUER99 6KDIW9DULDEOH6SHHG+3: 037XUER&RPEL 6KDIW :KLVN$WWDFKPHQW+3: 037XUER&RPEL 6KDIW :KLVN$WWDFKPHQW+3:

$

%

%&RXQWHUWRS'RXJK6KHHWHUV &RPSDFW HDV\ WR XVH DQG LQH[SHQVLYH (YHU\ SL]]HULD VKRXOG KDYH RQH )HDWXUHV  UROOHUV IURQW LQIHHGDQGIURQWGLVFKDUJH6KHHWGRXJKIURPWR  LQ GLDPHWHU WR D XQLIRUP WKLFNQHVV LQ VHFRQGV ZLWKPLQLPXPKDQGOLQJRISL]]DGRXJK 0RGHO'HVFULSWLRQ '/63 'LD6HWRI5ROOHUV '/'3 'LD6HWVRI5ROOHUV '/63 'LD6HWRI5ROOHUV '/'3 'LD6HWVRI5ROOHUV '/3 'LD6HWVRI3DUDOOHO5ROOHUV

&

&&RXQWHUWRS0L[HUV 'HVLJQHG IRU VPDOO FRPPHUFLDO PL[LQJ DSSOLFDWLRQV 7KHVHFRPSDFWWDEOHWRSPL[HUVDUHVPDOOHQRXJKWRILWLQWR DQ\ NLWFKHQ \HW UREXVW HQRXJK IRU FRQWLQXRXV XVH &RPPHUFLDO JUDGH WDEOH PRGHO ZLWK D SRZHUIXO  +3 PRWRU )LYHVSHHG GLUHFW GULYH WUDQVPLVVLRQ  JHDU GULYHQ 'LJLWDO FRQWURO SDQHO WR PDNH HDV\ VSHHG VKLIWV ZKLOHXQLWLVUXQQLQJ&RPSDFWGHVLJQIRUVPDOOHUIRRWSULQW HDVLHUFOHDQLQJDQGSRUWDELOLW\PLQXWHWLPHUVWRSVPL[HU ZKHQWLPHUHQGV1RQVNLGUXEEHUEDVH)ORRUPRGHOVDOVR DYDLODEOH0RGHOVKRZQ 0RGHO'HVFULSWLRQ  TW0L[HUZ*XDUG  TW0L[HUZ*XDUG

' '%HUPL[HUV 1(:  02'(/ 7KLV  ZDWW LPPHUVLRQ EOHQGHU LV SHUIHFW IRU VDOVDV VDXFHV SXUHHG YHJHWDEOHV VRXSV VDODG GUHVVLQJV SDVWULHV DSSOHVDXFH DQG PDVKHG SRWDWRHV UHFRQVWLWXWHG  7KH%VHULHVRIIHUVDFRPSOHWHSURGXFWUDQJH WR FKRRVH IURP  ZDWW  ZDWW  ZDWW DQG ZDWWPRGHOVZLWKDFKRLFHRIDQG FXWWHU WXEHV RU D  EHDWHU DWWDFKPHQW )HDWXUHV LQFOXGH GLJLWDO YDULDEOH VSHHG FRQWUROV HUJRQRPLF HDV\WRKDQGOH ERG\ DQG IXOO\ GLVFRQQHFWDEOH FXWWHU WXEH IRU HDV\ FOHDQLQJ DQG VWRUDJH (7/ OLVWHGIRU86$DQG&DQDGD 0RGHO'HVFULSWLRQ  :Z7XEH  :Z7XEHDQG%HDWHU  :Z7XEH  :Z7XEHDQG%HDWHU  :Z7XEH

( (%LJ6WLNŒ+HDY\'XW\,PPHUVLRQ%OHQGHUV 8QOLPLWHG VSHHG DGMXVWPHQW IURP  WR  530¶V SURYLGHV IXOO FRQWURO DQG FRQVLVWHQF\ IURP OLJKW PL[LQJ WR SXUHHLQJ DQG HPXOVLI\LQJ )HDWXUHV KHDY\GXW\ KLJK HIILFLHQF\  +3 YDULDEOH VSHHG PRWRU  ZDWWV 5XEEHUL]HG FRPIRUW JULS DQG VHFRQG KDQGOH DOORZ IRU VDIH DQG FRQWUROOHG RSHUDWLRQ &RPSOHWHO\ VHDOHG VWDLQOHVV VWHHO VKDIWV DUH HDVLO\ UHPRYDEOH DQG GLVKZDVKHU VDIH $YDLODEOH LQ  VL]HV DOO LQWHUFKDQJHDEOH ZLWK RQH XQLYHUVDOPRWRUKRXVLQJ16)(7/DSSURYHG 0RGHO'HVFULSWLRQ :6% +0L[HUZLWK6KDIW :6% +0L[HUZLWK6KDIW :6% +0L[HUZLWK6KDIW :6% +0L[HUZLWK6KDIW :6% +0L[HUZLWK6KDIW


.LWFKHQ3UHS_

(GCVWTGF%JGH

&KHI*X\)LHUL 7KH)RRG1HWZRUN² *X\¶V%LJ%LWH *X\2II7KH+RRN 'LQHUV'ULYH,QV 'LYHV &(2-RKQQ\*DUOLF¶V,QF 6DQWD5RVD&$

$5HGFR(D]L&OHDQŠ &DQ2SHQHUV 9ROOUDWK¶V QHZ JHQHUDWLRQ RI FDQ RSHQHUV JLYHV WKH FOHDQHVW DQG PRVW K\JLHQLF FXW HYHU (D]L&OHDQŒ EODGHV DUH ILQLVKHG ZLWK DQWLEDFWHULDO FRDWLQJ IRU LQFUHDVHG VDIHW\ +LJKJUDGH VWHHO FXWWLQJ PHFKDQLVP IRU FOHDQ FXW±QR ULVN RI IUD\HG PHWDO VKDYLQJV 3DWHQWHG TXLFNUHOHDVH EODGH FDUULHU IRU HDV\ FOHDQLQJ &DVHKDUGHQHG EODGH IRU ORQJHU OLIH :KHHOV PDGH IURP JHDUFXWWLQJ JUDGH VWHHO±DEOH WR ZLWKVWDQG LQWHQVH SUHVVXUH%HYHOHGJHDUZKHHOPDNHVDVVHPEO\HDV\&DQKHLJKWVXSWR RU'LVKZDVKHUVDIH16) 0RGHO'HVFULSWLRQ %&2 3UHPLXP IRUFDQVXSWR

%&2 0HGLXP'XW\ IRUFDQVXSWR

%&2 +HDY\'XW\ IRUFDQVXSWR

%&2 &DQ0DVWHU IRUFDQVXSWR

%&2 0HGLXP'XW\ IRUFDQVXSWR

%&2 +HDY\'XW\ IRUFDQVXSWR

%&2 7LWDQ IRUFDQVXSWR

$ %16)&HUWLILHG0DQXDO&DQ2SHQHUV 2SHQHUVWKDWZLOONHHSXSLQDGHPDQGLQJNLWFKHQ

-DPEDOD\D6DQGZLFK 

OEWKLFNFXWEDFRQGLFHG

OESRUNEXWWSRUNORLQFXWLQWR FXEHV OEVPRNHGVDXVDJHFXWLQWR VOLFHV 

OEDQGRXLOOHVDXVDJHFXWLQWR VOLFHV

UHGRQLRQFKRSSHG FXSUHGEHOOSHSSHUVWKLQO\MXOLHQQHG OEERQHOHVVFKLFNHQWKLJKVFXWLQWR FXEHV FHOHU\VWDONVWKLQO\VOLFHG FORYHVJDUOLFFKRSSHG 

FXSSDUVOH\OHDYHVFKRSSHG



FXSSOXV FXSFKRSSHGJUHHQRQLRQV

WVSFD\HQQHRUWRWDVWH 6DOWDQGSHSSHU 

FXSZDWHU

VRXUGRXJKEUHDGORDYHV OE+DYDUWLFKHHVHWKLQO\VOLFHG 3UHKHDWRYHQWRƒ) ,Q D ODUJH FDVW LURQ SRW RU KHDY\ERWWRPHG EUDLVLQJ SDQ RYHU PHGLXPKLJK KHDW FRRN WKH EDFRQ XQWLO FULVS DQG IDW LV UHQGHUHG 5HPRYH EDFRQ DQG GUDLQ RQSDSHUWRZHO6HWDVLGH $GG SRUN WR WKH SDQ ZLWK WKH EDFRQ IDW DQG FRRN RQ PHGLXP WR KLJK KHDW XQWLO SRUN LV EURZQHG RQ DOO VLGHVDERXWWRPLQXWHV$GGWKHVDXVDJHRQLRQV DQG EHOO SHSSHU &RRN XQWLO RQLRQV DUH WUDQVOXFHQW 1H[W DGG WKH FKLFNHQ FHOHU\ JDUOLF SDUVOH\ DQG  FXS FKRSSHG JUHHQ RQLRQV &RRN XQWLO FKLFNHQ LV FRRNHGWKURXJKDERXWWRPRUHPLQXWHV$GGWKH FD\HQQH DQG VHDVRQ ZLWK VDOW DQG SHSSHU WR WDVWH 6WLULQWKHZDWHUFRYHUDQGOHWVLWIRUKRXU &XW EUHDG OHQJWKZLVH DQG SODFH LQ RYHQ WR WRDVW OLJKWO\6SRRQVRPHRIWKHSRUNPL[WXUHRQWKHEUHDG ERWWRPVWRSHDFKZLWKVOLFHVRIFKHHVHWKHUHVHUYHG EDFRQ DQG WKH UHPDLQLQJ JUHHQ RQLRQV DQG ILQLVK ZLWKWKHEUHDGWRSV6HUYHLPPHGLDWHO\

%

0RGHO 6 7KH SUHPLHU 16) PDQXDO FDQ RSHQHU RQ WKH PDUNHW 2SHQV PRVW VKDSHVVL]H FDQV XS WR  WDOO 6WDQGDUG FDVW VWDLQOHVV VWHHO EDVH VWDLQOHVV VWHHO FODPSLQJ EDVH RSWLRQDO 'LVKZDVKHU VDIH \HDU ZDUUDQW\ (DV\WRFKDQJH NQLIHDQGJHDUDVVHPEOLHV 0RGHO * $ 16) YHUVLRQ RI WKH OLJKW GXW\  IHDWXUHV VWDLQOHVV VWHHO VKDIW HDV\ WR FKDQJH VWDLQOHVV VWHHO NQLIH DQG JHDU 7KH PHORQLWH DUERU DQG UHGHVLJQHG SODWHG VWHHO EDVH UHGXFH IULFWLRQ PDNLQJWKHXQLWHDVLHUWRXVH 80RGHOV6LPLODULQFRQVWUXFWLRQWRWKH*EXW FORVHULQVL]HDQGGHVLJQWRWKH6%RWK8DQG* PRGHOV KDYH TXLFN FKDQJH NQLIH DQG JHDU DVVHPEOLHV0RGHOV6/8/*/VKRZQ

0RGHO'HVFULSWLRQ 6 $OO6WDLQOHVV6WHHOZ4XLFN&KDQJH.QLIH *HDU 6& $OO6WDLQOHVV6WHHOZ4XLFN&KDQJH.QLIH *HDU&ODPS%DVH * /LJKWGXW\Z4XLFN&KDQJH6WDLQOHVV6WHHO.QLIH *HDU 8 4XLFN&KDQJHZ6WDQGDUG/HQJWK%DU 3ODWHG%DVH 8& 2SHQHUZ&DVW6WDLQOHVV6WHHO&ODPS%DVH 8/ 2SHQHUZ/RQJ%DU 3ODWHG6WHHO%DVH

&(OHFWULF&DQ2SHQHU 1RZ ZLWK D \HDU ZDUUDQW\ 2SHQV XS WR  FDQV SHU GD\ (TXLSSHG ZLWK VSHHG PRWRU DQG IHDWXULQJ NQLIH DQG JHDU DVVHPEOLHV WKDW FDQ EH UHPRYHG ZLWKRXW WRROV IRU HDV\ FOHDQLQJ 7KH VORZHU VHFRQG VSHHG KHOSV SUHYHQW VSLOODJH ZKLOH RSHQLQJ VPDOOHU FDQV 0DGH LQ WKH 86$ 0RGHOVKRZQ 0RGHO'HVFULSWLRQ 9 6SHHG & 6SHHGZ*DV6KRFN6OLGH%DU0RXQW

&


.LWFKHQ3UHS_

(GCVWTGF%JGH &KHI3KLOLSSH6FKPLW 3KLOLSSH5HVWDXUDQW /RXQJH +RXVWRQ7; 'XFN&RQILW7DPDOHV FXSV0DVHFDIORXU³IRUWDPDOHV´

$

FXSVZDUPFKLFNHQVWRFN WHDVSRRQVEDNLQJSRZGHU

$3RUWLRQ&RQWURO6FDOHV &RPSDFW DQG YHUVDWLOH GHVLJQ WR ILW DQ\ RSHUDWRU¶V EDVLF ZHLJKLQJ QHHGV :HLJKV LQ SRXQGV RXQFHV DQG JUDPV 3XVK EXWWRQ WDUH IRU LQFUHDVHG YHUVDWLOLW\ /&' SDQHO LV ODUJH DQG SRVLWLRQHG DW DQ DQJOH IRU HDV\ YLHZLQJ WR SUHYHQW PLVUHDGLQJ $XWR SRZHU VKXWRII DIWHU  PLQXWHV 'XUDEOH $%6 FRQVWUXFWLRQ DQG UHPRYDEOH VWDLQOHVV VWHHO SODWWHU PDNHV FOHDQLQJ HDV\ 2SHUDWHV RQ WKUHH & EDWWHULHV RU $& SRZHU DOORZLQJ WKH VFDOH WR EH XVHG DW DQ\ ORFDWLRQ 16) 1RW OHJDO IRUWUDGH0RGHO*36VKRZQ 0RGHO'HVFULSWLRQ *36 OEFDS *36 OEFDS

WHDVSRRQVVDOW  FXSVODUG  FXSVGXFNIDW  FXSVEXWWHUVRIWHQHG WDEOHVSRRQV*XDMLOORFKLOLSHSSHUSXUHHG ,Q D ODUJH PL[HU ZLWK SDGGOH DWWDFKPHQW FRPELQH ODUG GXFN IDW DQG VRIW EXWWHU0L[IRUPLQXWHRQVHWWLQJ6FUDSHVLGHVDQGSDGGOH 6ZLWFK WR  VHWWLQJ DQG PL[ IRU  PLQXWHV 6FUDSH VLGHV RI PL[LQJ ERZO DQGSDGGOH ,Q D ODUJH PL[LQJ ERZO FRPELQH WKH 0DVHFD IRU WDPDOHV VDOW EDNLQJ SRZGHUDQGFKLFNHQVWRFNDQGPL[E\KDQGXQWLOWKHGRXJKLVVPRRWK $GG WKLV FRUQ GRXJK WR WKH ODUG DQG IDW PL[WXUH DQG PL[ IRU  PLQXWHV WR ILQLVK $GGWKH*XDMLOORSXUHH  7UDQVIHUWKHILQLVKHGGRXJKWRDQDLUWLJKWFRQWDLQHUDQGVWRUH )RU*XDMLOOR3XUHH3ODFHFKLOOLHVLQVWRFNWRVRIWHQ:KHQFKLOOLHVDUHVRIW  PLQXWHV  WUDQVIHU WR EOHQGHU DQG SXUHH DV ILQH DV SRVVLEOH &KLOO SXUHHPL[DQGUHVHUYH

% 'XFN&RQILW6WXIILQJIRU7DPDOHV OEFRUQKXVNV



R] WRPDWR

OEVGXFNOHJVFRQILWVKUHGGHG



R] UHGEHOOSHSSHUV

TWWRPDWRFRQFDVVH



R] RQLRQ





R] MDODSHQRV

WHDVSRRQFXPLQ



R] JDUOLF

TWGXFNVDXFH



R] ROLYHRLO

6DOWDQGSHSSHUWRWDVWH



R] FKLOLVDXFH

'XFN&RQILW6WXIILQJ %3RVHLGRQŒ6XEPHUVLEOH6FDOH 5XJJHG ZDWHUSURRI GHVLJQ VR WKH XQLW FDQ EH GXQNHG LQ D SRW VLQN WR FOHDQ $OO VWDLQOHVV VWHHO ERG\ KDV ³'XDO +RXVLQJ 7HFKQRORJ\´ SURYLGLQJ WZLFH WKH PRLVWXUH UHVLVWDQFH DJDLQVW FRUURVLRQ ,WV ³6FDOH :LWKLQ D 6FDOH´ GHVLJQ KHOSV SURWHFW LQWHUQDO FRPSRQHQWV DJDLQVW GDPDJH GXH WR DFFLGHQWDO VKRFN 6L[ FDSDFLW\ GLVSOD\ RSWLRQV 3URJUDPPDEOH VR XVHUV FDQ VHOHFW OHQJWK RI WLPH IRU EDWWHU\VDYH IHDWXUHFKDQJHJUDYLW\VHWWLQJVDQGWXUQRIIVSHFLILFZHLJKLQJPRGHV WRUHGXFHFRQIXVLRQ16)DQG&(FHUWLILHG 0RGHO'HVFULSWLRQ :6& [663ODWIRUP :6&23 [663ODWIRUP

+DULVVD6DXFH R]+DULVVDSDVWH

TWEDVLOFKLIIRQDGH

WDEOHVSRRQSLPHQWG¶HVSHOHWWH WDEOHVSRRQVFKLSRWOHSXUHH ,QDODUJHPL[LQJERZOFRPELQHWKHGXFNOHJVFRQILWWKHWRPDWRFRQFDVVH EDVLO FKLIIRQDGH FXPLQ VDOW DQG SHSSHU SLPHQW G¶HVSHOHWWH FKLSRWOH SXUHH:KHQWKHPL[WXUHLVZHOOFRPELQHGDGGLQWKHGXFNVDXFH2QFHDOO WKHLQJUHGLHQWVDUHPL[HGZHOOWUDQVIHUWRDQDLUWLJKWFRQWDLQHUDQGVWRUH

3RUWLRQ&RQWURO)DFWV 3RUWLRQ FRQWURO LV SURILW FRQWURO :HLJK DOO LQJUHGLHQWV LQ D UHFLSH WR HQVXUH DFFXUDWH PHDVXUHPHQWV $  R]RYHUZHLJKWRQSRUWLRQVD GD\ FDQ OHDG WR WKRXVDQGV RI GROODUV LQ ORVW SURILWV HDFK \HDU ,I D  R] RYHUZHLJKWRFFXUVZLWKHDFKVHUYLQJDQGVWXGHQWVDUHVHUYHGWKLV H[WUD  R] WKDW GD\ UHVXOWV LQ  SRXQGV RI DGGLWLRQDO IRRG EHLQJ XVHG,QWKLVH[DPSOHLIWKHSURGXFWFRVWSHUSRXQGWKHORVVRYHU WKH\HDUZRXOGEH

6RDNWKHFRUQKXVNVLQKRWZDWHUXQWLOVRIW'UDLQ 8VLQJDSODVWLFVSDWXODVSUHDGDERXWR]RIPDVDGRXJKRQWRWKHFRUQ KXVN3XWWKHGXFNFRQILWVWXIILQJLQWKHFHQWHUDQGZUDSUROOLQJORQJZLVH DQGVHDOLQJERWKHQGV 8VLQJDVWHDPHUFRRNWKHWDPDOHVRQPHGLXPKHDWZLWKHQRXJKZDWHUIRU DERXWDQGDKDOIKRXUV


.LWFKHQ3UHS_

$ $'LJLWDO3RUWLRQ&RQWURO6FDOHV 5XEEHUPDLGLVWKHILUVWWREULQJGLJLWDOVFDOHPRGHOVWRWKHPDUNHW ZLWKDGLVKZDVKHUVDIHRXWHUVKHOOWRSURPRWHIRRGVDIHW\LQ\RXU NLWFKHQ:LWKWKHIXOOVL]HSUHPLXPVFDOHVDYDLODEOHLQVWDLQOHVV VWHHO RU DQWLPLFURELDO UHVLQ \RXU NLWFKHQ ZLOO EH PRUH HIILFLHQW PRUHSURGXFWLYHDQGVDIHULQ\RXUIRRGSUHSSUDFWLFHV3UHPLXP PRGHOV KDYH LQQRYDWLYH UHPRYDEOH VKHOO GHVLJQ 5HLQIRUFHG GHVLJQ SURWHFWV VFDOH FRPSRQHQWV IURP WKH GD\WRGD\ ZHDU 7ROHUDWHV D ZLGH UDQJH RI WHPSHUDWXUH DQG KXPLGLW\ FKDQJHV 'LVKZDVKHUVDIH SDUWV SURPRWH HDV\ FOHDQ XS DQG IRRG VDIHW\ 0RGHO'HVFULSWLRQ  +LJK3HUIRUPDQFHOE  3UHPLXP5HVLQ'LVKZDVKHU6DIHOE  3UHPLXP5HVLQ'LVKZDVKHU6DIHOE  3UHPLXP66'LVKZDVKHU6DIHOE

&0HFKDQLFDO3RUWLRQ&RQWURO6FDOHV 'HVLJQHG WR PHHW WKH GXUDELOLW\ WKH SURIHVVLRQDOPDUNHWUHTXLUHVZKLOHNHHSLQJ DFFXUDF\ DW WKH IRUHIURQW ([FOXVLYH UHPRYDEOH VWDLQOHVV VWHHO SODWIRUP GHVLJQ LPSURYHV FOHDQLQJ HIILFLHQF\ 6WDLQOHVV & VWHHO VSULQJ DQG FRUURVLRQUHVLVWDQW ZHLJKLQJ PHFKDQLVP IRU GXUDELOLW\ ORQJWHUP DFFXUDF\ DQG VWUHQJWK $QJOHG GLDO ZLWK EROG JUDSKLFV LPSURYHV UHDGLQJ DFFXUDF\ DQG HDVH RI XVH 6KDWWHUSURRI OHQV SURWHFWV GLDO 5RWDWLQJ GLDO DOORZV IRU FRQWDLQHU ZHLJKW GHGXFWLRQ DQG TXLFN ]HURIRUPXOWLSOHLQJUHGLHQWPHDVXULQJ16)OLVWHG 0RGHO'HVFULSWLRQ 76 R][ R]J[J 76 OE[ R] 76./ OE[R]NJ[J 76 OE[R]

% %(DV\:DVK0HFKDQLFDO3RUWLRQ&RQWURO6FDOHV 'LVKZDVKHU VDIH EHFDXVH QRWKLQJ LV PRUH LPSRUWDQW WKDQ WKH VDIHW\ RI \RXU FXVWRPHUV 'LVKZDVKHU VDIH IRU HDV\ FOHDQLQJ DQG FRPSOHWH VDQLWDWLRQ 5HTXLUHVQRWRROVWRDVVHPEOHDQGGLVDVVHPEOHZKLFKPHDQVQRORRVHSDUWV WR PLVSODFH 5RWDWLQJ GLDO IRU HDV\ WDUH DQG PXOWLSOH LQJUHGLHQW ZHLJKLQJ 3UHPLXPVWDLQOHVVVWHHOFRQVWUXFWLRQIRUVWUHQJWKZKLFKZLOOQRWUXVW3ODWIRUP PD\EHXVHGDVDKDQGOH$OLJQPHQWQRWFKIRUSUHFLVHDQGTXLFN]HURUHVHW $QJOHG GLDO IHDWXUHV HDV\WRUHDG JUDSKLFV DQG FRORUFRGHG FHQWHU LGHQWLILHV FDSDFLW\16) 0RGHO'HVFULSWLRQ )*65: R][ R][3ODWIRUP 5RWDWLQJ'LDO

)*65: R][ R][3ODWIRUP 5RWDWLQJ'LDO

)*65:4 R][ R][3ODWIRUP 4XLFN6WRS

)*65: OE[ R][3ODWIRUP 5RWDWLQJ'LDO

)*65:4 OE[ R][3ODWIRUP 4XLFN6WRS

)*65:4 OE[ R][3ODWIRUP 4XLFN6WRS

)*6: OE[R][3ODWIRUP )L[HG'LDO

)*65: OE[R][3ODWIRUP 5RWDWLQJ'LDO

+DYLQJD+$&&33ODQ,V&UXFLDO $ +D]DUG $QDO\VLV &ULWLFDO &RQWURO 3RLQW SURJUDP LV D V\VWHP RI VFLHQFH EDVHG SURFHVV FRQWUROV GHVLJQHG WR LGHQWLI\ DQG SUHYHQW SK\VLFDO FKHPLFDO DQGPLFURELDOKD]DUGVWKDWFDXVHIRRGERUQHLOOQHVVHV%\FKDUWLQJWKHIORZRI IRRGWKURXJK\RXURSHUDWLRQSRLQWVFDQEHLGHQWLILHGZKHUHFRQWDPLQDWLRQ RU JURZWK RI PLFURRUJDQLVPV RFFXU &RQWURO IHDWXUHV FDQ WKHQ EH LPSOHPHQWHGEDVHGRQWKHLGHQWLILHGKD]DUG +$&&3*XLGHOLQHV  $QDO\]HSRWHQWLDOKD]DUGVDQGGHVFULEHSUHYHQWLYHPHDVXUHV  ,GHQWLI\FULWLFDOFRQWUROSRLQWVDQGHVWDEOLVKDIORZFKDUW  (VWDEOLVKSUHYHQWLYHPHDVXUHVZLWKFULWLFDOOLPLWVIRUHDFKFRQWUROSRLQW  (VWDEOLVKSURFHGXUHVWRPRQLWRUWKHFRQWUROSRLQWV  (VWDEOLVKFRUUHFWLYHDFWLRQVWRFRUUHFWWKHKD]DUGLPPHGLDWHO\  6HWXSDQHIIHFWLYHUHFRUGNHHSLQJSURFHGXUHWKDWGRFXPHQWV WKH+$&&3V\VWHP  (VWDEOLVKSURFHGXUHVIRUYHULILFDWLRQWKDWWKH+$&&3V\VWHPLV ZRUNLQJFRUUHFWO\

''LJLWDO3RUWLRQ&RQWURO6FDOHV &XW\RXUORVVHVDQGERRVWSURILWVZLWK7D\ORU¶VGLJLWDOSRUWLRQFRQWUROVFDOHV&RQYHQLHQWKROGIXQFWLRQORFNV WKH ZHLJKW RQ VFUHHQ HYHQ DIWHU SURGXFW KDV EHHQ UHPRYHG $XWRRII IXQFWLRQ FRQVHUYHV SRZHU ZKLOH WKH FRQYHQLHQW WDUH IHDWXUH DOORZV \RX WR HDVLO\ ZHLJK SURGXFWV ZKLOH VWLOO LQ WKH FRQWDLQHU (DV\WRUHDG /&' GLVSOD\ SURYLGHV VLPSOH UHDGRXW DGMXVWPHQWV 5HPRYDEOH VWDLQOHVV VWHHO SODWIRUP DQG PRLVWXUH UHVLVWDQW VHDOHGFRPSRQHQWVPDNHFOHDQLQJVDQLWL]LQJDQGPDLQWHQDQFHHDVLHU2SHUDWHVRQDQLQFOXGHG$&DGDSWHU RU$$$EDWWHULHV QRWLQFOXGHG 16)0RGHO7()7VKRZQ 0RGHO'HVFULSWLRQ 7()7 OE[R][3ODWIRUP 7()7 OE[R]»[3ODWIRUP 7()7 OE[R]»[»3ODWIRUP 7()7 OE[R][3ODWIRUP

'


.LWFKHQ3UHS_

$

$776HULHV(FRQRP\:RUN7DEOHV )RU FRPPHUFLDO NLWFKHQV WKDW UHTXLUH SOHQW\ RI ZRUN VSDFH WKLV WDEOH LV D JUHDW YDOXH ,WV W\SH  JDXJH VWDLQOHVV VWHHO WRS LV LGHDO IRU WRXJK FRPPHUFLDO HQYLURQPHQWV DQG KDV EHHQ VRXQG GHDGHQHG 'LH IRUPHG KDW FKDQQHOV RQ WKH ERWWRP VLGH RI WKH WDEOH WRS SURYLGHV DGGLWLRQDO VWDELOLW\ DV ZHOO DV D OHYHO ZRUN VXUIDFH *DOYDQL]HG XQGHUVKHOI ZLWK DGMXVWDEOH OHJ FROODUV SURYLGHV DGGLWLRQDO VWRUDJH VSDFH $OO VWDLQOHVV VWHHO PRGHOV DOVRDYDLODEOH 0RGHO'HVFULSWLRQ 77; [ 77; [ 77; [ 77; [ 77; [ 77; [

&

&'HOX[H:RUN7DEOHV 'HOX[H:RUN7DEOHVIHDWXUHJDXJHVWDLQOHVVVWHHOWRSZLWKDGMXVWDEOH XQGHUVKHOI RU FURVVEUDFLQJ &KRRVH VWDLQOHVV VWHHO XQGHUVKHOI FURVVEUDFLQJ DQG IHHW RU JDOYDQL]HG XQGHUVKHOI RU FURVVEUDFLQJ DQG OHJV ZLWK SODVWLF IHHW ZRUNLQJKHLJKW16)FHUWLILHG$ZLGHYDULHW\RIVL]HVDUHDYDLODEOH7DEOHV ODUJHUWKDQKDYHOHJV 0RGHO'HVFULSWLRQ :76676; [)ODW7RS66$GM8QGHUVKHOI/HJV )HHW :7;676; [)ODW7RS66&URVVEUDFLQJ/HJV )HHW :76%6; [7RSZLWK%DFNVSODVK66$GM8QGHUVKHOI /HJV )HHW :7;%6; [7RSZLWK%DFNVSODVK66&URVVEUDFLQJ /HJV )HHW :76676; [)ODW7RS66$GM8QGHUVKHOI/HJV )HHW :7;676; [)ODW7RS66&URVVEUDFLQJ/HJV )HHW

%

%:RRG7RS:RUNWDEOHV +DUGURFNPDSOHZRUNVXUIDFHIODWWRSRUULVHUHLWKHURSHQ EDVH RU ZLWK ORZHU VKHOI VWDLQOHVV VWHHO RU JDOYDQL]HG EDVH ,Q VL]HV  ORQJ WKURXJK  ORQJ [   DQG ZLGHDYDLODEOHLQDQGWKLFNQHVV6KLSV NQRFNHGGRZQ 0RGHO'HVFULSWLRQ -16 [[Z6&72 6+) -16 [[Z6&72 6+) -16 [[Z6&72 6+) -16 [[Z6&72 6+) -16 [[Z6&72 6+) -16 [[Z6&72 6+) $GGLWLRQDOPRGHOVDYDLODEOH :RUN7DEOH+HLJKW

&RUUHFWZRUNLQJKHLJKWRIZRUNWDEOHVUHGXFHVIDWLJXHDQGSHUPLWVDQHYHQIORZRIZRUN 7KHUHVKRXOGEHWREHWZHHQWKHZRUNVXUIDFHDQGWKHEHQGRIWKHHOERZRIWKHZRUNHU 7KHLPPHGLDWHZRUNDUHDPD\EHDGMXVWHGWRWKHSURSHUKHLJKWE\XVLQJDZRRGHQFKRSERDUGDFURVVD [SDQ WKHGHSWKRIWKHSDQZLOOGHSHQGXSRQWKHKHLJKWWKHZRUNDUHDQHHGVWREHUDLVHG 

'

')%/*6HULHV%XGJHW:RUN7DEOHV <RXZLOOEHDPD]HGDWWKHYDOXHDQGTXDOLW\IRXQGLQWKHVHEXGJHWZRUNWDEOHVIURP-RKQ%RRV 6WDQGDUGIHDWXUHV ‡JDXJHW\SHVWDLQOHVVVWHHOZLWKDIODWWRSDQGDJDOYDQL]HGEDVHDQGVKHOI ‡VWDOOLRQHGJHRQIURQWDQGUHDUZLWKVLGHHGJHVƒEHQGGRZQ ‡8QGHUVKHOILVDGMXVWDEOHWRGHVLUHGKHLJKW ‡$GMXVWDEOHEXOOHWIHHW ‡6KLSSHGNQRFNHGGRZQHDV\WRDVVHPEOH ‡16)DSSURYHG 0RGHO'HVFULSWLRQ )%/* [)ODW7RSZ*DOY/HJV6KHOI )%/* [)ODW7RSZ*DOY/HJV6KHOI )%/* [)ODW7RSZ*DOY/HJV6KHOI )%/* [)ODW7RSZ*DOY/HJV6KHOI )%/* [)ODW7RSZ*DOY/HJV6KHOI )%/* [)ODW7RSZ*DOY/HJV6KHOI


.LWFKHQ3UHS_ %

$ $(FRQRP\(TXLSPHQW6WDQGV (TXLSPHQWVWDQGVDUHPDGHWRVHFXUHO\KROGVPDOOFRPPHUFLDOHTXLSPHQW VXFKDVEOHQGHUVDQGPL[HUV7KHJDXJHVWDLQOHVVVWHHOWDEOHWRSLV H[WUHPHO\ GXUDEOH DQG VDQLWDU\ $GMXVWDEOH XQGHUVKHOI DGGV H[WUD VWRUDJH IRUDGGLWLRQDODFFHVVRULHVDQGHTXLSPHQW7KHZRUNLQJKHLJKWPDNHVLW LGHDOIRUDQ\FRPPHUFLDONLWFKHQ16) 0RGHO'HVFULSWLRQ0RGHO'HVFULSWLRQ (*/*; [6WDQG (*/*; [6WDQG (*/*; [6WDQG (*/*; [6WDQG (*/*; [6WDQG (*/*; [6WDQG (*/*; [6WDQG (*/*; [6WDQG (*/*; [6WDQG

&

'(TXLSPHQW 0L[HU6WDQGV &KRRVHIURPDZLGHYDULHW\RI(TXLSPHQWDQG0L[HU6WDQGVZLWK DJDXJHVHULHVVWDLQOHVVVWHHOWRS/HJVDQGXQGHUVKHOI DYDLODEOH JDOYDQL]HG RU VWDLQOHVV VWHHO 0L[HU VWDQGV IHDWXUH DGMXVWDEOH IHHW (TXLSPHQW VWDQGV FRPH ZLWK D  WXUQXS RQ  VLGHV16) 0RGHO'HVFULSWLRQ Mixer Stands 06667*; [*DOY/HJV 86KHOI 06667*; [*DOY/HJV 86KHOI 06667*; [*DOY/HJV 86KHOI 066676; [66/HJV 86KHOI 066676; [66/HJV 86KHOI 066676; [66/HJV 86KHOI Equipment Stands 6(6667*; [*DOY/HJV 86KHOI/LSRQ6LGHV 6(6667*; [*DOY/HJV 86KHOI/LSRQ6LGHV 6(6667*; [*DOY/HJV 86KHOI/LSRQ6LGHV 6(6667*; [*DOY/HJV 86KHOI/LSRQ6LGHV 6(66676; [66/HJV 86KHOI/LSRQ6LGHV 6(66676; [66/HJV 86KHOI/LSRQ6LGHV 6(66676; [66/HJV 86KHOI/LSRQ6LGHV 6(66676; [66/HJV 86KHOI/LSRQ6LGHV

%6OLFHU0L[HU6WDQG 'HVLJQHGIRUDPXOWLWXGHRIVWDQGDUGIRRGSUHSDUDWLRQDSSOLFDWLRQV WKHVH6OLFHU0L[HU6WDQGVDUHLQGLVSHQVDEOHLQWKHNLWFKHQ8VHDV D VOLFHU RU PL[HU VWDQG PRELOH ZRUN VXUIDFH RU WR WUDQVSRUW WUD\V 0RGHO  HTXLSSHG ZLWK VWDLQOHVV VWHHO WRS UHWUDFWDEOH VKHOI VVWRS DQGSODWIRUPVZLYHOFDVWHUVZLWKORFNVRQDOOZKHHOV 0RGHO  KDV DOO VZLYHO FDVWHUV  ZLWK EUDNHV %RWK PRGHOV KDYHDOLIHWLPHZDUUDQW\DJDLQVWUXVWDQGFRUURVLRQ 0RGHO'HVFULSWLRQ  3DQ&DSZ5HFWUDFWDEOH6KHOI:[+['  3DQ&DS:[+['6S 16)

 3DQ&DS:[+['6S 16)

 3DQ&DS:[+['6S 16)

&:RUN7DEOHV (TXLSPHQW6WDQGV 2XUYDOXHOLQHRI(TXLSPHQW6WDQGVDQG:RUN7DEOHVDUHFRQVWUXFWHG RIJDXJHVWDLQOHVVVWHHOWRSDQGJDXJHVWDLQOHVVVWHHO ZHOGHGLQSODFH XQGHUVKHOYHV &RPHV VWDQGDUG ZLWK VWDLQOHVV VWHHO OHJVDQGDGMXVWDEOHEXOOHWIHHW:HOGHGVHWXSGHVLJQ16)DSSURYHG (TXLSPHQW6WDQGVIHDWXUHDZRUNKHLJKWZLWKWXUQXSRQVLGHV :RUN7DEOHVDYDLODEOHZLWKRUZLWKRXWDKLJKWKLFNEDFNVSODVK 0RGHO'HVFULSWLRQ Equipment Stands (69 [[ (69 [[ (69 [[ Work Tables :789 [)ODW7RS :789 [)ODW7RS :789 [)ODW7RS :78%9 [Z%DFN6SODVK :78%9 [Z%DFN6SODVK :78%9 [Z%DFN6SODVK Additional models available.

'


6DQLWDWLRQ 'LVKZDVKHUV 'LVSRVHUV 6LQNV )DXFHWV +RVHV1R]]OHV'UDLQV 7UDVK&RQWDLQHUV $ :KDW6L]H'LVKZDVKHU'R<RX1HHG" 7R KHOS GHWHUPLQH ZKDW VL]H GLVKZDVKLQJ PDFKLQH \RX ZLOO QHHG\RXPXVWILUVWGHWHUPLQHKRZPDQ\UDFNVRIGLVKHVSHU KRXU\RXZLOOJHQHUDWH+HUH·VDQHTXDWLRQWKDWPD\KHOS RISLHFHVSHUSHUVRQ[RISHUVRQVSHUKRXU¸ SLHFHVSHUUDFN UDFNVSHUKRXUUHTXLUHG

7HPSHUDWXUH5HTXLUHPHQWV 1DWLRQZLGH KHDOWK LQVSHFWRUV UHTXLUH WKDW GLVKPDFKLQH ULQVH WHPSHUDWXUHV EH YHULILHG WR UHDFK EHWZHHQ ƒ)ƒ) WKH UDQJHVXUHWRNLOOEDFWHULD

7KLQJVWR&RQVLGHU:KHQ%X\LQJ'LVKZDVKHU 5DFNV ‡ :KDWVL]HDUH\RXUJODVVHV" ‡ 'R\RXSODQRQXVLQJWKHUDFNVIRUVWRUDJHDOVR" ,WLVYHU\LPSRUWDQWWRFRQVLGHUWKHVHSRLQWV3XUFKDVLQJ LPSURSHUGLVKZDVKLQJUDFNVFDQUHVXOWLQPRUHEUHDNDJH$VN XVIRUKHOSLQVHOHFWLQJWKHSURSHUUDFNV

$8QGHUFRXQWHU'LVKZDVKHUVZ%XLOW,Q%RRVWHU+HDWHU (QHUJ\ 6WDUŠ TXDOLILHG 6LJQLILFDQWO\ UHGXFH ZDWHU DQG HQHUJ\ FRQVXPSWLRQ ZLWK QHZ H[FOXVLYH IHDWXUHV 6KHDU (QHUJ\²UHGXFH HQHUJ\ UHTXLUHPHQWV ZKLOH PD[LPL]LQJ SHUIRUPDQFH 0XOWL3KDVH²DOORZV IRU LQILHOG FRQYHUVLRQ IURP VLQJOH WR WKUHH SKDVH ZLWK HDVH 0XOWL9ROW²DOORZV LQILHOG FRQYHUVLRQ  YROW 5LQVH 6HQWU\²H[WHQGV WKH F\FOH WLPH WR HQVXUH ƒ) ILQDO ULQVH6RIW6WDUW²SURWHFWVGLVKHVDQGJODVVHVIURPFKLSSLQJDQGEUHDNLQJ 7KHFRPSDFWHIILFLHQF\PDNHVLWLGHDOIRUXQGHUWKHFRXQWHURUIUHHVWDQGLQJ LQVWDOODWLRQV ,WV YHUVDWLOH GHVLJQ PDNHV LW WKH SHUIHFW FKRLFH IRU VPDOO NLWFKHQVEDUVDQGQXUVLQJKRPHV16)(7/UDWHG0RGHO8+%VKRZQ 0RGHO'HVFULSWLRQ 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH (QHUJ\6WDUŠ

8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH (QHUJ\6WDUŠ

8+ JDOKUJDOUDFNUDFNVKUZR%RRVWHU 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH 8+ JDOKUJDOUDFNUDFNVKUZR%RRVWHU 8+ JDOKUJDOUDFNUDFNVKUZR%RRVWHU 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH

&OHDQ8S7LSV:KHQ:DVKLQJ'LQQHUZDUH 8VH UHFRPPHQGHG GHWHUJHQWV RQO\ 6RPH GHWHUJHQWV FDQ DWWDFN JOD]HG VXUIDFHV $VN \RXU GLQQHUZDUH UHVRXUFH IRU QDPHV RI SUHIHUUHG GHWHUJHQWV 'HWHUJHQW FRQFHQWUDWHV DOVR VKRXOG EH FRQVLGHUHG :KHQHYHU SRVVLEOH GHWHUJHQW VKRXOG EHDXWRPDWLFDOO\GLVSHQVHG %7HPS6WDUŠ'RRU7\SH'LVKPDFKLQHV +LJKWHPSHUDWXUH GRRUW\SH GLVKPDFKLQH IHDWXUHV D EXLOWLQ ƒ) ULVH ERRVWHU ZLWK 6DQL6XUHŒ ZKLFK HQVXUHV SURSHU VDQLWDWLRQ HYHU\ F\FOH ,QFOXGHV QRUPDO VHFRQG DXWRPDWLF F\FOH SOXV GHOLPLQJ DQG H[WHQGHG ZDVK F\FOHV %XLOWLQ 359 FRPHV VWDQGDUG )LHOG FRQYHUWLEOH IURP VWUDLJKWWKUX WR FRUQHU IURP SKDVH WR VLQJOHSKDVHDQGYLFHYHUVD'XUDEOH VWDLQOHVV VWHHO FRQVWUXFWLRQ 16) DQG F8/XV OLVWHG ++ PRGHO DFFRPPRGDWHV ODUJHU WUD\V DQG VKHHW SDQV 7HPS6WDU PRGHOVKRZQ

% 0RGHO'HVFULSWLRQ 7HPS6WDU (OHFWULFUDFNVKUJDOUDFN (QHUJ\6WDUŠ

7HPS6WDU++ (OHFWULF+LJK+RRGUDFNVKUJDOUDFN 7HPS6WDU67+ 6WHDPUDFNVKUJDOUDFN 7HPS6WDU++67+ 6WHDP+LJK+RRGUDFNVKUJDOUDFN 7HPS6WDU*3; *DVUDFNVKUJDOUDFN 7HPS6WDU++*3; *DV+LJK+RRGUDFNVKUJDOUDFN


6DQLWDWLRQ 'LVKZDVKHUV 'LVSRVHUV 6LQNV )DXFHWV +RVHV1R]]OHV'UDLQV 7UDVK&RQWDLQHUV $ :KDW6L]H'LVKZDVKHU'R<RX1HHG" 7R KHOS GHWHUPLQH ZKDW VL]H GLVKZDVKLQJ PDFKLQH \RX ZLOO QHHG\RXPXVWILUVWGHWHUPLQHKRZPDQ\UDFNVRIGLVKHVSHU KRXU\RXZLOOJHQHUDWH+HUH·VDQHTXDWLRQWKDWPD\KHOS RISLHFHVSHUSHUVRQ[RISHUVRQVSHUKRXU¸ SLHFHVSHUUDFN UDFNVSHUKRXUUHTXLUHG

7HPSHUDWXUH5HTXLUHPHQWV 1DWLRQZLGH KHDOWK LQVSHFWRUV UHTXLUH WKDW GLVKPDFKLQH ULQVH WHPSHUDWXUHV EH YHULILHG WR UHDFK EHWZHHQ ƒ)ƒ) WKH UDQJHVXUHWRNLOOEDFWHULD

7KLQJVWR&RQVLGHU:KHQ%X\LQJ'LVKZDVKHU 5DFNV ‡ :KDWVL]HDUH\RXUJODVVHV" ‡ 'R\RXSODQRQXVLQJWKHUDFNVIRUVWRUDJHDOVR" ,WLVYHU\LPSRUWDQWWRFRQVLGHUWKHVHSRLQWV3XUFKDVLQJ LPSURSHUGLVKZDVKLQJUDFNVFDQUHVXOWLQPRUHEUHDNDJH$VN XVIRUKHOSLQVHOHFWLQJWKHSURSHUUDFNV

$8QGHUFRXQWHU'LVKZDVKHUVZ%XLOW,Q%RRVWHU+HDWHU (QHUJ\ 6WDUŠ TXDOLILHG 6LJQLILFDQWO\ UHGXFH ZDWHU DQG HQHUJ\ FRQVXPSWLRQ ZLWK QHZ H[FOXVLYH IHDWXUHV 6KHDU (QHUJ\²UHGXFH HQHUJ\ UHTXLUHPHQWV ZKLOH PD[LPL]LQJ SHUIRUPDQFH 0XOWL3KDVH²DOORZV IRU LQILHOG FRQYHUVLRQ IURP VLQJOH WR WKUHH SKDVH ZLWK HDVH 0XOWL9ROW²DOORZV LQILHOG FRQYHUVLRQ  YROW 5LQVH 6HQWU\²H[WHQGV WKH F\FOH WLPH WR HQVXUH ƒ) ILQDO ULQVH6RIW6WDUW²SURWHFWVGLVKHVDQGJODVVHVIURPFKLSSLQJDQGEUHDNLQJ 7KHFRPSDFWHIILFLHQF\PDNHVLWLGHDOIRUXQGHUWKHFRXQWHURUIUHHVWDQGLQJ LQVWDOODWLRQV ,WV YHUVDWLOH GHVLJQ PDNHV LW WKH SHUIHFW FKRLFH IRU VPDOO NLWFKHQVEDUVDQGQXUVLQJKRPHV16)(7/UDWHG0RGHO8+%VKRZQ 0RGHO'HVFULSWLRQ 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH (QHUJ\6WDUŠ

8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH (QHUJ\6WDUŠ

8+ JDOKUJDOUDFNUDFNVKUZR%RRVWHU 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH 8+ JDOKUJDOUDFNUDFNVKUZR%RRVWHU 8+ JDOKUJDOUDFNUDFNVKUZR%RRVWHU 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH 8+%  JDOKUJDOUDFNUDFNVKUƒ) 5LVH

&OHDQ8S7LSV:KHQ:DVKLQJ'LQQHUZDUH 8VH UHFRPPHQGHG GHWHUJHQWV RQO\ 6RPH GHWHUJHQWV FDQ DWWDFN JOD]HG VXUIDFHV $VN \RXU GLQQHUZDUH UHVRXUFH IRU QDPHV RI SUHIHUUHG GHWHUJHQWV 'HWHUJHQW FRQFHQWUDWHV DOVR VKRXOG EH FRQVLGHUHG :KHQHYHU SRVVLEOH GHWHUJHQW VKRXOG EHDXWRPDWLFDOO\GLVSHQVHG %7HPS6WDUŠ'RRU7\SH'LVKPDFKLQHV +LJKWHPSHUDWXUH GRRUW\SH GLVKPDFKLQH IHDWXUHV D EXLOWLQ ƒ) ULVH ERRVWHU ZLWK 6DQL6XUHŒ ZKLFK HQVXUHV SURSHU VDQLWDWLRQ HYHU\ F\FOH ,QFOXGHV QRUPDO VHFRQG DXWRPDWLF F\FOH SOXV GHOLPLQJ DQG H[WHQGHG ZDVK F\FOHV %XLOWLQ 359 FRPHV VWDQGDUG )LHOG FRQYHUWLEOH IURP VWUDLJKWWKUX WR FRUQHU IURP SKDVH WR VLQJOHSKDVHDQGYLFHYHUVD'XUDEOH VWDLQOHVV VWHHO FRQVWUXFWLRQ 16) DQG F8/XV OLVWHG ++ PRGHO DFFRPPRGDWHV ODUJHU WUD\V DQG VKHHW SDQV 7HPS6WDU PRGHOVKRZQ

% 0RGHO'HVFULSWLRQ 7HPS6WDU (OHFWULFUDFNVKUJDOUDFN (QHUJ\6WDUŠ

7HPS6WDU++ (OHFWULF+LJK+RRGUDFNVKUJDOUDFN 7HPS6WDU67+ 6WHDPUDFNVKUJDOUDFN 7HPS6WDU++67+ 6WHDP+LJK+RRGUDFNVKUJDOUDFN 7HPS6WDU*3; *DVUDFNVKUJDOUDFN 7HPS6WDU++*3; *DV+LJK+RRGUDFNVKUJDOUDFN


6DQLWDWLRQ_

% $ &

%)OLJKW7\SH'LVKPDFKLQHV/R+ $$YHQJHUŠ 8QGHUFRXQWHU'LVKPDFKLQHV 1HZ GHVLJQ FOHDQV  GLVKHV XVLQJ RQO\ 3HUIHFWIRUVPDOOUHVWDXUDQWVFRIIHHVKRSVDQG  JDOORQV RI ZDWHU SHU KRXU ,QVXODWHG EDUV 7KH $YHQJHU IHDWXUHV SXVKEXWWRQ VWDUW GRXEOHZDOO FRQVWUXFWLRQ SURYLGHV ZKLVSHU DXWRILOO SXPSHG GUDLQ DERYHZDWHU VFUDS TXLHW RSHUDWLRQ ZLWK ORZ KHDW UDGLDWLRQ WR EDVNHW DQG D PDQXDO RYHUULGH IRU H[WHQGHG WKH GLVK URRP +LJKHIILFLHQF\ ZDVK DUP ZDVK F\FOHV DQG GHOLPLQJ 7KH VHOIGUDLQLQJ V\VWHP SRZHUV RII WKH WRXJKHVW VRLOV VWDLQOHVV VWHHO SXPS HOLPLQDWHV VRLO DQG 9WDQN FRQVWUXFWLRQ PLQLPL]HV VRLO EXLOGXS GHWHUJHQW FDUU\RYHU EHWZHHQ ZDVK DQG DQG SURYLGHV HDV\ DFFHVV IRU FOHDQLQJ DQG ULQVH F\FOHV %XLOWLQ FKHPLFDO SXPSV HQVXUH PDLQWHQDQFH 6SHFLILFDOO\ VL]HG DQG RXWILWWHG SURSHU FKHPLFDO XVDJH +7 PRGHO IHDWXUHV ZLWKRSWLRQVWRDFFRPPRGDWH\RXUIRRGVHUYLFH 6DQL6XUHŒ WHFKQRORJ\ HQVXULQJ SURSHU RSHUDWLRQ 16) DQG (7/ OLVWHG &RQWDFW RXU VDQLWDWLRQ HYHU\ F\FOH /7 PRGHO LV (QHUJ\ FXVWRPHUVHUYLFHGHSDUWPHQWIRUDVVLVWDQFH 6WDUŠ TXDOLILHG16)DQGF(7/XVOLVWHG 0RGHO'HVFULSWLRQ $YHQJHUŠ +7 +LJK7HPSUDFNVKU /RZ7HPSUDFNVKU $YHQJHUŠ /7 (QHUJ\6WDUŠ

'

&&RQVHUYHUŠ 'LVKPDFKLQHV ([FHSWLRQDO SHUIRUPDQFH PHHWV FRVW HIILFLHQF\ 7KH &RQVHUYHUŠ ;/+ IHDWXUHV  IXOO\DXWRPDWLF WLPHG F\FOHV IRU ZDUHZDVKLQJ SHUIRUPDQFH DQG IOH[LELOLW\2WKHUVWDQGDUGIHDWXUHVLQFOXGHEXLOWLQ FKHPLFDO SXPSV DQG SULPLQJ VZLWFKHV D ORZ SURGXFW LQGLFDWRU OLJKW DQG GRRU VDIHW\ VZLWFK 7KHVHOIGUDLQLQJVWDLQOHVVVWHHOSXPSHOLPLQDWHV VRLO DQG GHWHUJHQW FDUU\RYHU EHWZHHQ ZDVK DQG ULQVH F\FOHV 'XUDEOH  VWDLQOHVV VWHHO FRQVWUXFWLRQ7KH&RQVHUYHUŠ ;/+DQGWKHGXDO UDFN&RQVHUYHUŠ ;/DUH(QHUJ\6WDUŠ TXDOLILHG 16)DQGF8/XVOLVWHG 0RGHO'HVFULSWLRQ &RQVHUYHU;/ &KHPLFDO6DQLWL]LQJ 6LQJOH5DFNUDFNVKU &RQVHUYHU;/+ &KHPLFDO6DQLWL]LQJ 6LQJOH5DFNUDFNVKU &RQVHUYHU;/ &KHPLFDO6DQLWL]LQJ 'RXEOH5DFNUDFNVKU &RQVHUYHU;/& &KHPLFDO6DQLWL]LQJ &RUQHU  'RXEOH5DFNUDFNVKU

'&5(:Š &RQYH\RU'LVKPDFKLQHV -DFNVRQKDVVHWDQHZVWDQGDUGRIH[FHOOHQFHLQZDUHZDVKLQJIURPDSSHDUDQFHWRSHUIRUPDQFHWR FRVWRIRZQHUVKLS7KH&5(:Š LVORDGHGZLWKEHVWLQFODVVHQHUJ\VDYLQJIHDWXUHVEXLOWDURXQGWKH ODUJHVW ZDVK WDQN LQ WKH LQGXVWU\ 7KH :,65 Š &OHDQLQJ 6\VWHP SURYLGHV RQHSDVV FOHDQLQJ SHUIRUPDQFHZKLOHUHGXFLQJZDWHUFRQVXPSWLRQWRDQLQGXVWU\OHDGLQJJDOORQVSHUUDFNLQWKH &5(:Š &5(:Š ORZHUVZDWHUFKHPLFDODQGHQHUJ\FRVWVZKLOHDOZD\VJHWWLQJZDUHV³&OHDQWKH )LUVW7LPHŠ´16)DQGF(7/XVOLVWHG 0RGHO'HVFULSWLRQ &5(:Š (OHFWULF UDFNVKRXU(QHUJ\6WDUŠ &5(:Š 6WHDP UDFNVKRXU &5(:Š &KHP(OHFWULF UDFNVKRXU(QHUJ\6WDUŠ &5(:Š (OHFWULF UDFNVKRXU &5(:Š 6WHDP UDFNVKRXU &5(:Š &KHP(OHFWULF UDFNVKRXU

(9HQWOHVV'LVKPDFKLQH 7KLV KLJKWHPSHUDWXUH GRRU VLQJOH UDFN GLVKPDFKLQH ZDVKHV  UDFNV SHU KRXU 6DIH77HPS IHDWXUHDVVXUHVƒ)VDQLWL]LQJULQVHF\FOH0LQLPXPVHFRQGF\FOHVUXQVHFRQGZDVKULQVH DQGVHFRQGVWHDPHYDFXDWLRQ+HDWUHFRYHU\V\VWHPFDSWXUHVZDWHU YDSRU IURP WKH ZDVK DQG ULQVH F\FOH DQG FRQGHQVHV LW LQ RUGHU WR KHDW WKH LQFRPLQJ FROG ZDWHU DQG HYDFXDWH WKH VWHDP IURP WKH ZDVK FKDPEHU $OO VWDLQOHVV VWHHO FRQVWUXFWLRQ 0D[LPXP FOHDUDQFH IRU GLVKHVLV0RGHO&0$9/

(


Sanitation | 100

A. Chemical Sanitizing Single Rack Dishwasher. All stainless steel construction assures long life and years of trouble-free operation. Top mounted controls include built-in chemical pumps and deliming system that assures proper chemical usage. Power drain saves space, eliminates noisy solenoid and external sump—drains quickly. Straight application. Integrated scrap tray prevents food soil from entering drain system. Auto start/stop. Unique sanitizing system provides instant sanitation and eliminates chlorine damage to the machine. Energy Star® approved. Model Description EST-AH Straight, 40 racks, 160 covers/hr. EST-C Corner

A B

C

C. High Temperature Undercounter Dishmachine. Built-in detergent and rinse chemical pumps. Pump drain allows for multiple applications, including elevated drains. Safety temp feature assures 180°F sanitizing rinse every cycle. Double skin stainless steel provides consistent heating and a quiet operation. Door and water level safety switches, plus booster safety thermostat. Triple filtering protection system captures excess soil and debris. Operator friendly, removable wash and rinse arms allow for easy cleaning. Top mounted controls. Low 0.8 gal. water usage per rack. Energy Star® qualified. Model UC65E shown. Model Description UC50E 6kW Booster & 2.7 kW Wash Tank Heater, 133/4" Door Clearance UC65E 4kW Booster & 2 kW Wash Tank Heater, 141/2" Door Clearance

D. Genesis Door-Type Dishmachines. Energy usage savings of up to $5,000 the first year with the DH5000DV or VHR. No hood required! Features a sloped hood design to allow steam to escape from the unit rear, away from the operator. It offers two “Cycle Select” options of normal operation (53 racks per hour) and extended clean (38 racks per hour), and uses only .85 gallons of water per rack. Field convertible from single to three phase with voltage offerings between 208-480. NSF. Energy Star ® qualified. Choose direct vent, ventless and new extended hood. Model DH5000T shown. Model Description DH5000 Hood w/40°F/70°F Rise, Electric DH5000DV Hood w/Direct Vent Option DH5000VHR Hood w/Ventless Heat Recovery DH5000T Extended Hood w/40°F/70°F Rise, Electric DH5000T DV Extended Hood w/Direct Vent Option DH5000T VHR Extended Hood w/Ventless Heat Recovery

B. Rack Conveyor Dishwasher. Now you can save over 55% on water and utilities. When your dish room space is limited, rack conveyors facilitate high-volume dishwashing. New exclusive DualRinse Technology ensures wares are fully rinsed with more than 300 gallons per hour, while actual fresh water consumption is only 112 gallons per hour. Additional savings are found in the 40°F rise booster, which only requires 12 kW (optional 70°F rise requires 22 kW). New digital control panel for easy viewing. Rinse saver activates rinse only when dishes are present. Stainless steel one-piece upper and lower spray arms provide excellent washing results and ease of cleaning. Internal removable scrap basket and two-piece scrap screen. Model 66DRPW shown. Model Description 66DRPW* 44" Single Tank, 208 Racks/Hr., w/22" Pre-Wash & Dual Rinse 54DR* 54" Single Tank, 266 Racks/Hr., Dual Rinse 86-PW* 64" 2-Tank, 277 Racks/Hr., w/22" Pre-Wash 84* 84" 2-Tank, 356 Racks/Hr. *Energy Star® approved Additional models available.

D

E. Versa Clean Door Machine. Its in-field adjustable, all-in-one design, allows it to be installed either 208 or 240 volt, single or 3-phase, straight or corner configurations and operate with a 40°F/70°F rise booster. No kits or parts needed, all options are built into this single unit. A high-temp, Energy Star® qualified machine with a high efficiency 1 HP pump, .90 gallons per rack, 55 racks per hour. Standard features include Rinse Sentry to ensure 180°F final rinse, auto start and automatic drain. Model DH-2000

E


Sanitation | 101 X-Stream®

A. Wash System. The automated X-Stream® Wash increases the ease and effectiveness of your warewashing process by delivering the right amount of heat, cleaning solution and impingement for each job. It’s the only powered sink system on the market with the following features. • Variable, programmable wash schemes. • Batch-cycle washing notifies you when clean. • Idle mode between batch reduces energy costs. • Health reporting to track and monitor data. Contact our customer service department for assistance.

A X-Green™ for clean produce

B

B. X-Green™ Produce Safety System. The X-Green™ System automatically injects a wash solution into a cold, agitated bath and removes pesticides, wax, soil and bacteria from produce. The X-Green™ System is an entire food safety program, complete with reporting and traceability features to protect the health and safety of your customers. It enhances your HACCP program, and when combined with Fit ® produce wash, destroys 99.9% of the harmful bacteria that cause foodborne illnesses. Contact our customer service department for assistance.

D. Wall Signs. Make your customers aware of safety notices and warnings at a glance with clear and simple signage solutions from TableCraft. Self-adhesive backing for easy mounting. Guide your guests to their desired destination with restaurant signs and directional signage available in multiple languages and Braille. Model Description B10 5"x5" Men Restroom, S/S B11 5"x5" Women Restroom, S/S B12 5"x5" Men/Women Restroom, S/S B13 5"x5" Employees Only, S/S D B14 5"x5" No Smoking, S/S B20 5"x5" Men/Handicap Accessible, S/S B21 5"x5" Women/Handicap Accessible, S/S Additional models available.

C C. Hydro-Safe® Water Filtration. Hydro-Safe products deliver solutions for filtering sediment, sand, silt, rust and cysts, as well as chloramines, chlorine taste and odor. They are also used for reducing scale and softening and conditioning water, prolonging the life of your equipment and reducing maintenance. The Hydro-Safe family: • Cube Max™ for ice making equipment. • Cold Bev Max™ for cold beverage machines. • Steam Max™ for steamers and combi ovens. • Espresso Max™ for espresso machines. • Brew Max™ for coffee and hot beverage machines. Model Description CBMX-CP1L *Cube Max™ 1-Stage Filter, 2 GPM *Ice Maker System for filtering out chlorine, chloramine and controlling scale.

STMMAX-S1S

*Steam Max™ 1-Stage Filter, 1 GPM

*Steam/Combi Oven System for optimal scale control and extended performance.

Replacement Cartridges HSRCR-CFS8112-S For Cuno S8112-S HSR-EP-2000 For Everpure Insurice 2000 HSR-EP-4000 For Everpure Insurice 4000 Additional models available.

F E

E. Hot Water Dispenser. Speed up serving time in restaurants, school cafeterias, coffee shops, convenience stores and kiosks with InSinkErator’s hot water system— deliver up to 100 cups of near-boiling 200°F water per hour. These systems reduce serving time, require no expensive pipe runs and are easy to install. Model C1300 shown.

F. Floor Troughs. A safe addition fixture to any commercial kitchen or dish area, conveniently catching and draining excess water from the floor, thus preventing accidents. Constructed of 14-gauge, 304 stainless steel and includes 3/ 16"x1" stainless steel subway grating to catch any large objects preventing drainage problems. Includes stainless steel waste cut with removable stainless steel basket for up to 3" waste pipe. Available widths in 12" and 18". Lengths from 24" to 72". Custom sizes also available.

Model Description FTG-1224-X 12"x24"x4" FTG-1230 12"x30"x4" FTG-1236 12"x36"x4" FTG-1242 12"x42"x4" FTG-1248 12"x48"x4" FTG-1254 12"x54"x4" FTG-1260 12"x60"x4" FTG-1272 12"x72"x4" FTG-1824-X 18"x24"x4" Additional models available.


Sanitation | 102

A

Model C1114 C123 C13514 C185 RCB

A. OptiClean™ Glass/Dish Rack Systems. From the most fragile tableware to heavy-duty kitchen items, OptiClean™ offers the safest and most sanitary cleaning choices. NeWave™ racks hold 20% more glasses than comparable racks, while lowering chemical usage and labor costs. Unique open-side wall design promotes superior washing and thorough drying. Racks drain quickly to reduce spotting/drying; no flat surfaces to trap water or loose food particles. Full dividers in base rack for complete protection of glass rims. Sure-Lock™ extenders allow for fast and easy modification without screws, fasteners or tools. Baskets, rack dollies and rack covers available. Description Flatware Rack, Half-Size Cup Rack, 10-Comp. Open Bowl/Cup Rack, Half Size Glass Rack 41/2"H, 18-Comp. Coffee Bowl Rack

Model Description RE Open Extender RF14 Combination/Flatware Rack ROP14 Open Side Peg Rack RP14 All Purpose Plate & Tray Rack Additional models available.

C. Camracks. Pre-assembled or custom built to fit your dishrack needs now and as they change. Universal 4-way tracking system drives Camracks through all washers from any side to offer greater speed. The unique closed-wall design and protective splash guard preserve water and costly dishwashing solutions while thoroughly cleaning your dishes. Many sizes and variations available. New Camrack IceExpress Water Glass Filler makes quick work of a time-consuming banquet chore by enabling 25 glasses to be filled with ice simultaneously, rather than one at a time. Model Description 25S318 35/8"H, 25-Comp. 25S434 51/4"H, 25-Comp. 25S534 61/8"H, 25-Comp. 25S638 67/8"H, 25-Comp. 25S738 73/4"H, 25-Comp. 25S800 81/2"H, 25-Comp. PR314 Peg 9"x9" FR258 Flatware Full 8FB434 Flatware Basket w/Handle, 8-Comp. BR258 25/8" Base Full Additional models available.

B. Disposable Poly Aprons. Our aprons are available in white and clear. High quality, tear resistant with extra long ties for ease and comfort. Box dispenser adds to the convenience. Available in various sizes.

Model 11-004 250-FH10 250-FH20 250-FH3L 250-FH3L-CP 250-FH4L 250-FH4L-CP

D. Signature Warewashing Racks. Vollrath’s “Warewashing Systems” offer a complete selection of racks and accessories. 4-way tracking for fast loading. Peg corner design provides secure stacking. Color- coding for quick identification. Colors include: Light Green (1), Cocoa (2), Red (3), Light Blue (4), Gold (5), Gray (6), Royal Blue (7), and Burgundy (9). NSF. Outside Dimensions: 19 3 / 4 "x19 3 / 4 ". Full-Size Glass/Compartment Racks, Full-Size Flatware Rack, Full-Size All-Purpose Plate and Tray Rack, Full-Size Cup Racks, FullSize Open Racks.

Description Wall Mount Rack for Aprons, 10 pk 24"x42" White Dispenser Box, 10/100 pk 28"x46" White Dispenser Box, 5/100 pk 28"x46" Heavyweight White Dispenser Box, 10/50 pk 28"x46" Heavyweight White Dispenser Box, 4/50 pk 28"x46" Heavyweight Clear Dispenser Box, 10/50 pk 28"x46" Heavyweight Clear Dispenser Box, 4/50 pk

E

C

D

Model 52674 52677 52682 52805

B

Description Short Rack, 45/16"x45/16"x23/4", 16-Cup Medium Rack, 37/16"x45/16"x41/8", 20-Cup X-Tall Open Rack, 18"x18"x613/16" Half-Size Rack, 8-Cup Comp Size 43/8"x45/16", Inside Ht. 27/8" 52819 Half-Size Medium, 32-Comp. Comp Size 21/16" sq., Inside Ht. 49/16" 552729 XX-Tall Racks, 9-Comp. Comp Size 57/8" sq., Inside Ht. 81/2" 52720 X-Tall Racks, 16-Comp. Comp Size 43/8" sq., Inside Ht. 71/8" 52712 X-Tall Racks, 25-Comp. Comp Size 31/2" sq., Inside Ht. 71/8" 2725 XX-Tall Racks-49-Comp. Comp Size 27/16" sq., Inside Ht. 81/2" Additional models available.

E. Disposers. With 4 sizes, including 11 different models, we have a disposer for any size sink. All boast a stainless steel grind chamber, dualdirection cast iron shredders and heavy-duty Emerson motors for quiet operation and superior performance. Take your choice of a switch or multi-function control center, with an optional Aqua Saver® system that can cut water usage 70% or more. We also offer a variety of sink and trough mountings, including special assemblies for dishtables and drainboards—plus special control valves for more efficient operation. Model SS200 shown. Model Description LC50 Light Duty Commercial Disposer SS100 1 HP (Base Unit Only) SS125 11/4 HP (Base Unit Only) SS150 11/2 HP (Base Unit Only) SS200 2 HP (Base Unit Only) Additional models available.


Sanitation | 103

A

A. Fabricated Sinks-FE Series. • 18-gauge, 304 stainless steel construction. • All TIG welded. • 12"D sink bowls, 3/4" coved corner. • 9" backsplash has tile edge for ease of installation. • 15/8" dia. galvanized legs with 1" adjustable plastic bullet feet. • Supply is 1/2" IPS hot and cold. • Faucet holes on 8" centers (faucet not included). • Waste drains are 11/2" IPS stainless steel basket type, located in center of sink bowl, and are included. • NSF approved • 14" bowl depths now available. Model Description FE-1-1812 1-Comp., 18"x18"x23" (No Drainboard) FE-1-1812-18R or L 1-Comp., 18"x18"x381/2" (1 Drainboard) FE-2-1812-18RL 2-Comp., 18"x18"x72" (2 Drainboards) FE-3-1620-18RL 3-Comp., 16"x20"x84" (2 Drainboards) FE-3-1812-18RL 3-Comp., 18"x18"x90" (2 Drainboards) FE-3-1014-15RL 3-Comp. Spacesaver, 10"x14"x60" (2 Drainboards), 10"D Bowl Additional models available.

B. Economy Hand Sinks. Complete your utility area or kitchen station with the Advance Tabco hand sink. The 17" wall mounted sink features a 10"x14"x5" bowl and a 4" on-center splash mounted gooseneck faucet. The bowl is a 1-piece deep drawn sink design without seams and is rectangular for increased capacity and heightened versatility. The countertop edge is formed to prevent pools of water from forming, keeping it from dripping to the floor. Also available with 7 3 / 4 " side splashes. Model 7-PS-EC shown. Model Description 7-PS-EC 10"x14"x5" 7-PS-EC-SP 10"x14"x5" w/73/4" Side Splashes

B

C. Dishtable. 16-gauge, 300 series stainless steel dishtable with 36" long galvanized legs. Dishtable system consists of soil and clean sections. Seamless construction for unsurpassed strength and integrity. 10" extra large bold looking backsplash with 2" return and tile edge. Model DTC-S60-36LorR-X

C

D. Regaline NSF Sinks. NSF three compartment Regaline Sink with 18" right and left drainboards and 14"D bowls. One-piece deep drawn sink bowls feature 14 gauge, 304 stainless steel bowls, side rolls and splash. Welded leg assembly ensures stability and furnishes direct support of the column load requirement for the entire sink unit. Tile edge for ease of installation. Model 94-3-54-18RL

D

E

F E. Stainless Steel Compartment Sinks. Type 304, 16-gauge stainless steel construction, fabricated bowls with fully welded front apron, standard with stainless legs and bracing. Available in 1, 2, 3 or 4 bowls configuration; 3 and 4 bowl sinks standard with 2 sets of faucet holes. NSF. Also available in 14-gauge and 14" deep. Model Description 3PB18-2D18 3-18"x18"x12" w/2-18" Drainboards 3PB1824 3-18"x24"x12", No Drainboard 3PB1824-1D18 3-18"x24"x12" w/18" Drainboard 3PB1824-2D18 3-18"x24"x12" w/18" Drainboard L&R 3PB1824-2D24 3-18"x24"x12" w/24" Drainboard L&R Additional models available.

F. Task Master Power Wash Sink System. This continuous powered wash sink is the perfect solution for the scullery. A unique rear-mounted jet produces maximum agitation in all areas of the wash compartment. Optional built-in tank heater mounts outside of the compartment maximizing wash capacity. Many options and custom configurations available. Model PP-3.


Sanitation | 104

A

A. 14" Deep Standard Sinks. 14" Standard Series Sinks feature 16-gauge, 300 series stainless steel top and 14" deep welded tubs with 3/4" coved corners and 2" dividers between tubs. Basket strainers included. Galvanized legs with adjustable feet. Faucets not included. NSF. A variety of sizes are available both with and without drainboards. Model Description 14-1C16x20-0-X 16"x20"x14", 1-Comp., No Drainboard 14-1C16x20-L-18X 16"x20"x14", 1-Comp., 18" Left Drainboard 14-1C16x20-R-18X 16"x20"x14", 1-Comp., 18" Right Drainboard 14-3C16x20-0-X 16"x20"x14", 3-Comp., No Drainboard 14-3C18x24-L-24X 18"x24"x14", 3-Comp., 24" Left Drainboard 14-2C24x24-R-24X 24"x24"x14", 2-Comp., 24" Right Drainboard 14-3C24x24-0-X 24"x24"x14", 3-Comp., No Drainboard Additional models available.

C

C. Waste Xpress® Food Waste Reduction System. The Waste Xpress® helps reduce labor and waste-handling costs while increasing kitchen efficiency. The kitchen waste, consisting of food and non-food items, is ground into small particles in the disposer grind chamber. This ground waste is then transferred to the de-watering unit where the liquids are extracted and sent down the drain line. The compressed waste is then dispensed through the chute into a standard 10-gallon trash can. This reduces the volume by 85%—10 bags of waste can be turned into less than 2, so there’s less to haul away. Model WX300-18-A

B

B. Pre-Rinse Faucets. Elkay low-lead, compliant ADA pre-rinse faucet is precision crafted and especially designed for durability and ease of cleaning. Features: • 8" OC deck/wall mount • Flexible gooseneck with spray valve • 1/4-turn ceramic cartridge • Spout swing restriction pin • Wall bracket • Chrome-plated brass • 1/2"-14 NPT valve connection NSF, CSA, ASME, ADA, UPC/CUPC, IAPMO listed, Certified AB1953. Model Description LK943C 8" OC Splash/Wall Mount, Flexible Gooseneck with 3.2 gpm Spray Valve LK943LC 8" OC Splash/Wall Mount, Low Flow, Flexible Gooseneck with 2.2 gpm Spray Valve LK843C 8" OC Deck Mount, Flexible Gooseneck with 3.2 gpm Spray Valve LK843LC 8" OC Deck Mount, Low Flow, 44" Flexible Gooseneck with 1.2 gpm Spray Valve

E

D

D. Aqua Saver® Systems. Install an AquaSaver® control with an InSinkErator® Disposer and use up to 70% less water instantly! AquaSaver automatically senses the waste load through the disposer and regulates water flow. When less is needed, less is used! Easy to install. Made with stainless steel and backed by a 3-year warranty when purchased as part of a compete disposer package. Model AS101.

E. Grease Interceptors. Epoxy-coated, steel-constructed grease interceptors help to prevent greasy substances from entering plumbing systems, septic fields and waste water treatment facilities. Plumbing and Drainage Institute (PDI) certified. Full line of sizes available for: • Cooking/Prep Sinks • Pot, Pan and Scullery Sinks • Dishwasher applications Model Description WD-4 8 lb. Cap., 2" Connection WD-7 14 lb. Cap., 2" Connection WD-10 20 lb. Cap., 2" Connection WD-15 30 lb. Cap., 2" Connection WD-20 40 lb. Cap., 3" Connection WD-20L 40 lb. Cap., 3" Connection (Low Profile) WD-25 50 lb. Cap., 3" Connection WD-35 70 lb. Cap., 3" Connection WD-35L 70 lb. Cap., 4" Connection Low Profile) WD-50 100 lb. Cap., 4" Connection


6DQLWDWLRQ_ &(=,QVWDOOFF%DFNVSODVK 0RXQW3UH5LQVH8QLW 'HVLJQHG WR PHHW WKH ULJRURXV QHHGV RI WRGD\¶V FRPPHUFLDO NLWFKHQV DQG SURYHQ ORQJODVWLQJ SHUIRUPDQFH 0RGHO  LV DQ  FF EDFNVSODVK PRXQW SUHULQVH XQLW ZLWK ZDOO EUDFNHW DQG (= LQVWDOO DGDSWHUV IRU PRXQWLQJ RQ H[LVWLQJ KDUGZDUH ,QWHUFKDQJHDEOH ZLWK DOO EUDQGV    SO\ DLUFUDIW K\GUDXOLF KRVH LQWHUQDO VSULQJ ORDGHG FKHFN VWHPV 8OWUD 6SUD\ 9DOYH ZLWK  JSP # SVL $OVR DYDLODEOH LQ VWDLQOHVVVWHHO 0RGHO 

$ $(=,QVWDOOFF%DFNVSODVK 0RXQW)DXFHWV 'HVLJQHG WR PHHW WKH ULJRURXV QHHGV RI WRGD\¶V FRPPHUFLDO NLWFKHQV $OO )LVKHU IDXFHWV KDYH VWDLQOHVV VWHHO VHDWV JXDUDQWHHG IRUOLIHZLWKSDUWVZLYHOVWHPVIRU ORZHU PDLQWHQDQFH (=,QVWDOO DGDSWHUV DOORZ \RX WR UHSODFH DQ\ PDMRU EUDQG ZLWKRXW UHPRYLQJ WKH VLQNIURPZDOODQGUHSODFHDIDXFHW ZLWKLQ PLQXWHV 'RQ¶W IRUJHW DERXW RXU VWDLQOHVV VWHHO PRGHOV WRR 0RGHOVKRZQ 0RGHO'HVFULSWLRQ  FF%DFNVSODVK)DXFHW )DXFHWZ6ZLQJ6SRXW  FF%DFNVSODVK)DXFHW Z6ZLQJ6SRXW Additional models available.

%

&

%8OWUD6SUD\Œ9DOYHV0RGHO 'LVFRYHU ZKDW PXQLFLSDO ZDWHU FRQVHUYDWLRQ PDQDJHUV DJUHH XSRQ² WKDWUHWURILWWLQJ\RXUSUHULQVHXQLWVZLWK )LVKHU HIILFLHQW 8OWUD 6SUD\ 9DOYHV FDQ VDYH \RX WKRXVDQGV RI GROODUV LQ ZDWHUDQGHQHUJ\FRVWVHDFK\HDU JDOORQV SHU PLQXWH ILWV DOO EUDQGV RI SUHULQVH XQLWV $OVR DYDLODEOH LQ VWDLQOHVVVWHHO 0RGHO 

(

' '*ODVV)LOOHU0RGHO 2XWVWDQGLQJIXQFWLRQDOGHVLJQJLYHVEXV\RSHUDWRUVDIUHH KDQG )LHOGWHVWHG IRU GXUDELOLW\ VWUHQJWK DQG VHUYLFH (DV\ WR LQVWDOO DQG PDLQWDLQ $OVR DYDLODEOH LQ VWDLQOHVV VWHHO 0RGHO 

)3UH5LQVH+RVH0RGHO :KHQ\RXDUHLQQHHGRIDUHSODFHPHQW SUHULQVHKRVHWUXVW)LVKHUWRGHOLYHUWKH RQO\ SO\ DLUFUDIW K\GUDXOLF KRVH /DVWV  WLPHV ORQJHU WKDQ DQ\ RWKHU EUDQG DQGLWILWVDOOEUDQGVRISUHULQVHXQLWV

(3UH5LQVHZ$GG2Q)DXFHWV (OLPLQDWHV ³WRR WDOO´ SUREOHPV²H[FHVVLYH WRUTXHSXOO FHLOLQJ UHVWULFWLRQV DQG VKRUWHQHG SUHULQVH KRVH ,QFOXGHV SUHULQVH ZDOO EUDFNHWDQGDGGRQIDXFHW$ZLGHDUUD\RIVSULQJVW\OHPRGHOVWR ILW DQ\ LQVWDOODWLRQ UHTXLUHPHQW ,QGXVWU\ VWDQGDUG EDFNIORZ DQG FURVVIORZ SUHYHQWLRQ FRPSRQHQWV 6WDQGDUGL]HG IRU VLPSOLILHG LQVWDOODWLRQ0RGHOVKRZQ 0RGHO'HVFULSWLRQ  $GM:DOO0RXQWZ$GGRQ)DXFHW6SRXW  $GM:DOO0RXQWZ$GGRQ)DXFHW6SRXW  $GM:DOO0RXQWZ$GGRQ)DXFHW6SRXW  $GM:DOO0RXQWZ$GGRQ)DXFHW6SRXW  $GM:DOO0RXQWZ$GGRQ)DXFHW6SRXW  $GM:DOO0RXQWZ$GGRQ)DXFHW6SRXW Additional models available.

)

+ *$GGRQ)DXFHWZLWK6ZLQJ6SRXW 0RGHO 3XUFKDVH WKLV KDQG\ IDXFHW DQG LQVWDOO LW DV SDUWRI\RXUSUHULQVHXQLWVIRUDGGHGNLWFKHQ IOH[LELOLW\ )LWV RQ DOO EUDQGV RI SUHULQVH XQLWV $OVR DYDLODEOH LQ VWDLQOHVV VWHHO 0RGHO 

+)DXFHWV 7KH SHUIHFW FKRLFH IRU XVH LQ WKH EXVLHVW NLWFKHQV² JHWUHOLDELOLW\DQGTXDOLW\FRQVWUXFWLRQZLWK7 6%UDVV VLQN IDXFHWV &RPSRQHQWV FDQ EH VROG VHSDUDWHO\ $YDLODEOH LQ D YDULHW\ RI VW\OHV IRU DOO NLWFKHQ QHHGV 0RGHO%VKRZQ

*

,

,6LQJOH'HFN'XDO0RXQW3UH5LQVH8QLW0RGHO:% )HDWXUHVVWDLQOHVVVWHHOVHDWVJXDUDQWHHGIRUOLIHSDUWVZLYHO VWHPVIRUORZHUPDLQWHQDQFHDQGWKHZDWHUFRQVHUYDWLRQ8OWUD 6SUD\9DOYH$OVRDYDLODEOHLQVWDLQOHVVVWHHO 0RGHO 

-/RZ)ORZ6SUD\9DOYHV ,PDJLQHDSUHULQVHXQLWWKDWXVHVOHVVZDWHUZD\OHVVZDWHU3UHULQVH YDOYHV GHVLJQHG WR EHDW WKH VWULFWHVW RI VWDQGDUGV ZKLOH GHOLYHULQJ SRZHUIXO SHUIRUPDQFH DQG D ORZ ORZ IORZ UDWH RI  JDOORQV SHU PLQXWH 3RWHQWLDOO\ VDYH XS WR  JDOORQV  HYHU\ \HDU YHUVXV VSUD\YDOYHVUDWHGDWJSP&KRRVH7 6ORZIORZVSUD\YDOYHVDQG ZDWFK\RXUVDYLQJVEHJLQWRILOOXS0RGHOV%&%&VKRZQ *Assumptions: 5 hours/day, 365 days/year = 109,500 minutes.


6DQLWDWLRQ_

%

$

&

$0LQL3UH5LQVH8QLWV :DWHU FRQVHUYLQJ 0LQL 3UH5LQVH 8QLWV PHHW (3$FW VWDQGDUGV DQG DUH LQ IXOO FRPSOLDQFH RI WKH PDQGDWHG OHJLVODWLRQ JXLGHOLQHV 6LQJOH GHFN PRXQW EDVH PL[LQJ IDXFHW IHDWXUHV DGGRQ IDXFHW  VZLQJ QR]]OH FRPSDFW VSULQJDQGIOH[LEOHKRVHZDOOEUDFNHWDQGOHYHUKDQGOHV DQG % VSUD\ YDOYH IRU SRZHU DQG HIILFLHQF\ ZLWK D JSPIORZUDWH:DOOPRXQWDOVRDYDLODEOH 0RGHO'HVFULSWLRQ 03='/1 6LQJOH+ROH'HFN0RXQW 03=:/1 :DOO0RXQW

%.LWFKHQ6LQJOH/HYHU)DXFHWV 6LQJOH OHYHU IDXFHW ZLWK VLGH VSUD\ HTXLSSHG ZLWK  VSRXW GHFN SODWH WZR  VWDLQOHVV VWHHO IOH[LEOH VXSSO\KRVHV*30DHUDWRUDQGFHUDPLFFDUWULGJH ZLWK OLIHWLPH ZDUUDQW\ )HDWXUHV WHPSHUDWXUH OLPLW VWRS IRUJHG EUDVV ERG\ DQG VROLG EUDVV VWHP $'$ FRPSOLDQW $OVR DYDLODEOH ZLWKRXW VLGH VSUD\ 0RGHO %VKRZQ 0RGHO'HVFULSWLRQ % 6LQJOH/HYHU)DXFHWZ6LGH6SUD\ % 6LQJOH/HYHU)DXFHW

&5HWUDFWDEOH+RVH5HHO 6SUD\ 7KH 5HHO.OHHQ UHWUDFWDEOH KRVH UHHO DQG VSUD\ DUH FOHDQLQJ XS )HDWXUHVDOOKHDY\GXW\VWDLQOHVVVWHHOFRQVWUXFWLRQ5DWFKHWLQJV\VWHP KROGV WKH OHQJWK RI WKH KRVH XQWLO D VOLJKW WXJ UHWUDFWV DXWRPDWLFDOO\ $YDLODEOHZLWKIWRUIWKRVH 0RGHO'HVFULSWLRQ %&  +RVH(QFORVHG66,' %  +RVH2SHQ66,' %&  +RVH(QFORVHG66,'

'5R\DO6HULHV3UH5LQVH8QLWV %XLOWIRUKLJKYROXPHXVDJHDQGGXUDELOLW\+HDY\GXW\  WXUQFHUDPLFFDUWULGJHYDOYHV%XLOWLQLQWHUQDOFKHFNYDOYHV LQ VXSSO\ LQOHWV 3DUWV LQWHUFKDQJHDEOH ZLWK PRVW EUDQGV :DOO PRXQW SUHULQVH VKRZQ ZLWK UHFRPPHQGHG DGGRQ IDXFHWZLWKVSRXW$OOPRGHOVDUH/RZ/HDG&RPSOLDQW 0RGHOV:/:/DQG/VKRZQ 0RGHO'HVFULSWLRQ : :DOO0RXQW3UH5LQVH / :DOO)DXFHWZ6SRXW :/ 'HFN0RXQW3UH5LQVH : :DOO0RXQW3UH5LQVHZ$GGRQ)DXFHW / :DOO)DXFHWZ6SRXW

'

(

) )+RW:DWHU+RVHV 5HVWDXUDQW JUDGH KHDY\GXW\ KRW ZDWHU KRVH ZLWKVWDQGV WHPSHUDWXUHV XS WR ƒ) $OO UXEEHU MDFNHW UHVLVWV DEUDVLRQ DQG LV GXUDEOH XQGHU DQ\ FRQGLWLRQ $YDLODEOH LQ    DQG   OHQJWKV DQG  RU  LQVLGH GLDPHWHU 0RGHOVKRZQ 0RGHO'HVFULSWLRQ  IW  IW  IW

(&KHN3RLQW(OHFWURQLF)DXFHWV +DQGVIUHH IDXFHW LV D UHYROXWLRQDU\ EUHDNWKURXJK LQ KDQGZDVKLQJ WHFKQRORJ\² JUHDWO\ UHGXFHV ULVN RI FRQWDPLQDWLRQ 6HQVRURSHUDWHG IDXFHWV FRQVHUYH ZDWHU )HDWXUHV DGMXVWDEOH WHPSHUDWXUH FRQWURO IRU XVHU FRPIRUW DQG FRQWURO 3URYHQ HOHFWURQLFWHFKQRORJ\WHVWHGWRH[FHHGZDVKHV&KHFNYDOYHVIRUFURVVIORZ SUHYHQWLRQLQDOOPRGHOV$&'&FRQWUROPRGXOH1HZ+\GUR*HQHUDWRUPRGHOVVWRUH RZQ SRZHU ZLWK WKH IORZ RI ZDWHU DQG DUH WRWDOO\ VHOIFRQWDLQHG SRZHU VRXUFHV²QR WUDQVIRUPHU RU EDWWHULHV QHHGHG &DQ EH UHWURILWWHG WR DQ\ VHFRQGJHQHUDWLRQ &KHN3RLQW(OHFWURQLF)DXFHW0D\TXDOLI\WRZDUGFUHGLWVIRU/(('FHUWLILFDWLRQ 0RGHO'HVFULSWLRQ (& 'HFN0RXQW*RRVHQHFN$&'&&RQWURO0RGXOH (& :DOO0RXQW*RRVHQHFN$&'&&RQWURO0RGXOH (& 'HFN0RXQW6LQJOH+ROH6SRXW$&'&&RQWURO0RGXOH (& 'HFN0RXQW&HQWHUVHW$&'&&RQWURO0RGXOH 0RGHOVZ+\GUR*HQHUDWRU3RZHU6XSSO\ (&+* 'HFN0RXQW*RRVHQHFN (&+* :DOO0RXQW*RRVHQHFN (&+* 'HFN0RXQW6LQJOH+ROH6SRXW (&+* 'HFN0RXQW&HQWHUVHW


6DQLWDWLRQ_

$

$6OLP-LPŠ &RQWDLQHUV /LGV 'XUDEOHDOOSODVWLFFRQVWUXFWLRQLVHDV\WRFOHDQDQGSURYLGHVORQJOLIH 1RZDYDLODEOHZLWKYHQWLQJFKDQQHOVWRUHGXFHIRUFHUHTXLUHGWROLIWIXOO FDQ OLQHU E\ XS WR  9HQWHG 6OLP -LP FRQWDLQHUV KDYH  FDQ OLQHU FLQFKHV WR HOLPLQDWH NQRW W\LQJ 1HZ OLGV 6ZLQJ RIIHUV  PRUH XQREVWUXFWHG GLVSRVDO DUHD +LQJH VZLQJV ƒ WR ILW IODW DJDLQVW FRQWDLQHU EXW UHPDLQV VHFXUHO\ DWWDFKHG GXULQJ XVH 1HZ VWDLQOHVV VWHHO'ROO\DGGVPRELOLW\ZLWKFDVWHUVDQGUHVLVWVFKHPLFDOVUXVWDQG FRUURVLRQIRUXVHLQZHWHQYLURQPHQWV 0RGHO'HVFULSWLRQ )*%/$ *DO&RQWDLQHU )*%/$ *DOZ9HQW&KDQQHOV )*'*51 5HF\FOLQJZ9HQW&KDQQHOV )*%/8( 3DSHU5HF\FOLQJ %OXH

)**5$< 6ZLQJ7RS )*%/$ +LQJH7RS %ODFN

)*6667/ 6WDLQOHVV6WHHO'ROO\ )*%/$ 7UROOH\

% %3OD]DŠ &RQWDLQHUV 3OD]DŠ FRQWDLQHUVKDYHFRQWHPSRUDU\VW\OLQJZLWKVLGHRSHQLQJGRRUIRU QROLIW XQORDGLQJ6SULQJORDGHGGRRUVKHOSFRQWDLQ RGRUV&DQ EHXVHG ZLWK D ULJLG OLQHU RU ZLWK D FDQ OLQHU ,QFOXGHV EROWGRZQ FDSDELOLW\ $YDLODEOHZLWKRUZLWKRXWDWUD\WRSWRDFFRPPRGDWHXSWR[WUD\V $YDLODEOHZLWKRUZLWKRXWDQDVKWUD\LQVHUW:KHQXVHGZLWKDULJLGOLQHU   FRQWDLQHU LV )0&6)0 DSSURYHG &RORUV %HLJH %ODFN 'DUN *UHHQ 0RGHO'HVFULSWLRQ )*%/$ *DO&RQWDLQHUZ7UD\7RS %HLJH%ODFN

)*%/$ *DO&RQWDLQHU %ODFN*UHHQ%HLJH

)*%/$ *DO&RQWDLQHUZ$VKWUD\ %HLJH%ODFN*UHHQ

)**5$< 6TXDUH&RQWDLQHU6TXDUH[+

&%UXWHŠ 5RXQG&RQWDLQHUV/LGV 'ROO\ %UXWHŠ URXQG FRQWDLQHUV DUH GXUDEOH KHDY\GXW\ FRQWDLQHUV IRU D YDULHW\ RI XVHV $OOSODVWLF SURIHVVLRQDO JUDGH FRQVWUXFWLRQ ZLOO QRW UXVW FKLS RU SHHO DQG UHVLVWV GHQWV 6WURQJ VQDSRQ OLGV SURYLGH VHFXUH VWDEOH VWDFNLQJ $OO FRORUV DUH 86'$ DQG16)DSSURYHG%UXWHŠ FRQWDLQHUVDUHDYDLODEOHLQDQGJDOORQ FDSDFLWLHV9DULHW\RIOLGV VQDSRQIXQQHORUGRPH DQGDFFHVVRULHVDUHDYDLODEOH 0RGHO'HVFULSWLRQ )*'*51 *DO*UD\:KLWH )*%/8( *DO*UD\:KLWH<HOORZ'N%OXH )**5$< *DO*UD\:KLWH<HOORZ5HG'N%OXH )**5$< *DO*UD\:KLWH<HOORZ5HG%OXH )*'*51 )ODW/LG ILWV *UD\:KLWH )*%/$ )ODW/LG ILWV *UD\:KLWH<HOORZ )**5$< )ODW/LG ILWV *UD\:KLWH<HOORZ5HG )*%/$ )ODW/LG ILWV *UD\:KLWH<HOORZ5HG%ODFN )*%/$ 'ROO\ ILWV&RQWDLQHUV %ODFN )*<(/ &DGG\%DJ ILWV&RQWDLQHUV <HOORZ $GGLWLRQDOPRGHOVDYDLODEOH

&

(

' '7LOW7UXFNV 'XUDEOH FRQVWUXFWLRQ IRU WUDQVSRUWLQJ DQG GXPSLQJ KHDY\ ORDGV ZLWK HDVH6PRRWKVXUIDFHLVHDV\WRFOHDQDQGUHVLVWVSLWWLQJDQGFRUURGLQJ (DV\WRKDQGOH DQG PDQHXYHU &RQVWDQW IRUFH GHVLJQ DOORZV IRU FRQWUROOHG GXPSLQJ E\  SHUVRQ ,QVHW ZKHHOV SURWHFW ZDOOV DQG IL[WXUHV &RQVWUXFWHG ZLWK 86'$ DQG )'$ FRPSOLDQW PDWHULDOV 2SWLRQDOKLQJHGOLGVROGVHSDUDWHO\ 0RGHO'HVFULSWLRQ  )*%/$  FX\GOEFDS%ODFN<HOORZ5HG%OXH )*%/8(  FX\GOEFDS%OXHZ5HF\FOH6\PERO )*%/$ 7LOW7UXFN/LG ILWVDQG %ODFN

(*OXWWRQŠ 5HF\FOLQJ6WDWLRQ 7KLV UHF\FOLQJ VWDWLRQ SURYLGHV VRUWDWLRQ DQG FRQWDLQPHQW IRU  RU  VHSDUDWH PDWHULDO VWUHDPV 0XOWLSOH UHVWULFWLYHRSHQLQJ KROH VKDSHV DQG YDULRXV FRORUFRGHG LFRQLF DQGRU ZRUG ODEHOV SURYLGH IOH[LELOLW\ DQG KHOS PLQLPL]H FRQWDPLQDWLRQ E\ JLYLQJ YLVXDO FXHV IRU PDWHULDO LGHQWLILFDWLRQ 0RGHO'HVFULSWLRQ  JDO6WUHDP5HF\FOLQJ6WDWLRQ%OXH  JDO6WUHDP5HF\FOLQJ6WDWLRQ*UHHQ  JDO6WUHDP5HF\FOLQJ6WDWLRQ%HLJH  JDO6WUHDP5HF\FOLQJ6WDWLRQ%OXH  JDO6WUHDP5HF\FOLQJ6WDWLRQ*UHHQ  JDO6WUHDP5HF\FOLQJ6WDWLRQ%HLJH


6DQLWDWLRQ_ $+XVNHH6XSHU.DQŒ5HFHSWDFOHV 0ROGHG RI HQJLQHHUHG UHVLQV ZLWK VHDPOHVV FRQVWUXFWLRQ WKH +XVNHHŒ UHFHSWDFOH LV D VWURQJ ORQJODVWLQJ UHFHSWDFOH XVHG E\ YLUWXDOO\HYHU\LQGXVWU\%DJFLQFKDQGJDOORQHOLPLQDWHV WKHQHHGWRWLHNQRWVLQWKHSRO\OLQHUWRNHHSLWVHFXUHDURXQGWKH UHFHSWDFOH ULP 6WDFNDEOH ZLWK OLG RQ QHVWDEOH ZLWK OLG RII 6L]HV JDOORQDUH16)DSSURYHG 0RGHO'HVFULSWLRQ  *DO *UH\RU:KLWH

 *DO *UH\5HG:KLWH<HOORZ

 *DO *UH\5HG:KLWH<HOORZ

*< *DO *UH\

 /LGIRU*DO  /LGIRU*DO  /LGIRU*DO  /LGIRU*DO

$

% %6WHS2Q5HFHSWDFOHV &RPPHUFLDO JUDGH VWHSRQ ZDVWH UHFHSWDFOHV GHVLJQHG IRU FRQYHQLHQW DQGK\JLHQLFGLVSRVDORIYDULRXVZDVWH W\SHVXQGHUKHDY\XVH/LGLVDFWLYDWHG E\ IRRW SHGDO 6PRRWK SODVWLF ZLOO QRW UXVW FKLS RU SHHO OLNH PHWDO FDQV 8QLTXH QRWFK KROGV VWDQGDUG VL]H SRO\OLQHUV 2SWLRQDO ULJLG OLQHUV DOVR DYDLODEOH $YDLODEOH LQ  DQG  JDOORQ VL]HV LQ :KLWH %HLJH DQG 5HG 7KH  JDO VL]H KDV ZKHHOV IRU PRELOLW\ DQG D VWDLQOHVV VWHHO ZLUH IUDPH IRU H[WUD GXUDELOLW\ )0 DQG &6)0DSSURYHG 0RGHO'HVFULSWLRQ  *DOORQ  *DOORQ  5LJLG3ODVWLF/LQHU ILWV

 5LJLG3ODVWLF/LQHU ILWV

&:DOO+XJJHUŒ5HFHSWDFOHV 'ROO\ & &RQWLQHQWDO¶V VOHHN :DOO +XJJHU GHVLJQ KROGV  JDOORQV RI ZDVWH EXW SURWUXGHV OHVV WKDQ RQH IRRW IURP WKH ZDOO 7KH OLQH LQFOXGHV D YHUVLRQ ZLWK EXLOWLQKDQGOHVWRSURYLGHHDVHRIWUDQVSRUWDQGDVHFXUHJULSZKHQOLIWLQJDQG GXPSLQJ 0DWFK ZLWK FRORUFRGHG UHF\FOLQJ OLGV IRU HDV\ LGHQWLILFDWLRQ HQFRXUDJLQJ XVHUV WR VRUW WKHLU UHF\FODEOHV 8VH ZLWK D GROO\ IRU D FRPSOHWH PRELOHV\VWHP&RPSDWLEOHZLWK  'URS6KRW/LG  3XVK'RRU/LGRU QHZ  :DOO+XJJHU'ROO\ 0RGHO'HVFULSWLRQ  *DO %HLJH%ODFN%URZQ*UH\

+ *DOZ+GOV %HLJH%ODFN%URZQ*UH\

 *DO %HLJH%ODFN%URZQ*UH\%OXHRU*UHHQ5HF\FOH

+ *DOZ+GOV %HLJH%ODFN%URZQ*UH\%OXHRU*UHHQ5HF\FOH

 'URS6KRW/LG %ODFN%URZQ%HLJH*UH\

 'ROO\IRU +  4XDG&ROOHFWLRQ'ROO\IRU +  5HF\FOH/LGZ+ROHIRU&DQV %RWWOHV %OXH*UHHQ<HOORZ

$GGLWLRQDOPRGHOVDYDLODEOH '%URQFRŒ:DVWH&RQWDLQHUV (UJRQRPLF &RPIRUW &XUYHŒ KDQGOHV IRU HDV\ KDQGOLQJ 5HLQIRUFHG OLGV KDYH WDE ORFNV²VQDSV GRZQ WLJKW $YDLODEOH LQ  FRORUV IRU +$&&3 VXSSRUW 6XSSRUW FRPPXQLW\ UHF\FOLQJ SURJUDPV RU \RXU RZQ JUHHQ LQLWLDWLYHV ZLWK VLGHG ³5HF\FOH´ LPSULQWHG FRQWDLQHUV H[FHSW WKH 5(&  7KH 5ROO$ZD\ &RQWDLQHU *UH\ RQO\  KDV KHDY\GXW\D[OHDQGRYHUVL]HWUDFWLRQZKHHOVIRUKDXOLQJKHDY\ORDGV 6WXUG\KLQJHGOLGIOLSVRSHQƒIRUHDV\DFFHVV

'

(

0RGHO'HVFULSWLRQ  *DO  *DO/LG  *DOZ'ROO\  *DO  *DO/LG  *DOZ'ROO\ $GGLWLRQDOPRGHOVDYDLODEOH (7ULPOLQHŒ:DVWH&RQWDLQHUV +HDY\GXW\SODVWLFFRQVWUXFWLRQIRUHDV\FOHDQLQJ&RUQHUWDEVNHHSEDJVVHFXUHDQGKHOSHUKDQGOHRQ ERWWRP PDNHV OLIWLQJ DQG GXPSLQJ HDVLHU $YDLODEOH LQ EURZQ JUD\ DQG EODFN 1HZ UHF\FOH FRQWDLQHU GLVSOD\VWKHUHF\FOHV\PERORQERWKVLGHVDYDLODEOHLQEOXHDQGJUHHQ1HZFRPSRVWJUHHQFRQWDLQHU DGGUHVVHVFLW\UHTXLUHPHQWVIRUFRPSRVWIRRGZDVWH7RPDNHZDVWHPDQDJHPHQWGLVFUHWHERWKVZLQJ WRS DQG KDQGOHG OLGV FDQ EH SXUFKDVHG LQ DQ\ FRORU :LUH IUDPH GROO\ VROG VHSDUDWHO\  PDNHV ZDVWH FROOHFWLRQPRUHHIILFLHQWDQGVDIHUIRUHPSOR\HHV 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ  *DO&RQWDLQHU  'ROO\  *DO&RQWDLQHU6ZLQJ7RS/LG 5(& *DO³5HF\FOH´%OXHRU*UHHQ  *DO&RQWDLQHU+DQGOHG/LG &03 *DO³&RPSRVW´*UHHQ


6DQLWDWLRQ_ $6DIHW\&RQH %DUULFDGH6\VWHP &RQHV DYDLODEOH LQ  DQG  KHLJKWV 26+$ DQG $16, FRPSOLDQW FRORUV DQG JUDSKLFV ,PSULQWHG ZLWK KD]DUG PHVVDJHV LQ PXOWLSOH ODQJXDJHV %DUULFDGH 6\VWHP IHDWXUHV D  VHOIUHWUDFWLQJ \HOORZ DQG EODFN VWULSH WDSH :HW IORRU VLJQV DUH OLJKWZHLJKW YHUVDWLOH VLJQV IRU HIIHFWLYHVDIHW\FRPPXQLFDWLRQDQGIROGIRUHDV\VWRUDJH 0RGHO'HVFULSWLRQ )*<(/ 6DIHW\&RQHZ0XOWL/LQJXDO³&DXWLRQ:HW)ORRU´ )*<(/ )ORRU6LJQZ³&DXWLRQ´VLGHG )*<(/ 6DIHW\&RQHZ0XOWL/LQJXDO³&DXWLRQ´ )*<(/ )ORRU6LJQZ³&DXWLRQ:HW)ORRU´VLGHG )*%/$ :HLJKW5LQJIRU6DIHW\&RQHV )*<(/ 3RUWDEOH%DUULFDGH6\VWHP

$

%

%7&HOO'LVSHQVHUVDQG)UDJUDQFHV 7KH ZRUOG¶V ILUVW FRQWLQXRXV RGRU FRQWURO WKDW GHOLYHUV D SUHFLVH GRVH RI SXUH GHVLJQHUIUDJUDQFHDQGRGRUQHXWUDOL]HUIRUGD\VZLWKRXWWKHXVHRIEDWWHULHV 2QHGLVSHQVHUFRYHUVDSSUR[LPDWHO\WRWRLOHWVRUXULQDOVDQGDZLGHDUUD\RI IUDJUDQFHVDUHDYDLODEOH 0RGHO'HVFULSWLRQ )* 7&HOO'LVSHQVHU%ODFN )* 7&HOO'LVSHQVHU:KLWH )* 7&HOO'LVSHQVHU*UD\ )* 7&HOO5HILOO3XUH2GRU1HXWUDOL]HU )* 7&HOO5HILOO$ZDNHQLQJ6SULQJ )* 7&HOO5HILOO3RODU0LVW )* 7&HOO5HILOO%OXH6SODVK )* 7&HOO5HILOO&LWUXV )* 7&HOO5HILOO&U\VWDO%UHH]H $GGLWLRQDOPRGHOVDYDLODEOH

&'XR6ZHHSŠ $QJOH%URRPV 'HVLJQHGWRSURYLGHJHQHUDOSXUSRVHVZHHSLQJUHDFKLQJLQWRFRUQHUV DORQJ ZDOOV RU LQWR KDUG WR UHDFK DUHDV IRU IDVW HIILFLHQW FOHDQLQJ ([FHOOHQWEDODQFHWRUHGXFHVZHHSLQJIDWLJXH7ZRKDQGOHKROHVRQH DQJOHGRQHXSULJKWDQGEULVWOHIODUHFRDWHGPHWDOKDQGOHLV OLJKWZHLJKW\HWGXUDEOH

&

0RGHO'HVFULSWLRQ  /REE\$QJOH%URRPZ)ODUH3RO\SURS\OHQH%ULVWOHV )ODJJHGZ:RRG+DQGOH

 0HGLXP'XW\$QJOH%URRPZ)ODUH3RO\SURS\OHQH %ULVWOHV )ODJJHGZ:RRG+DQGOH

 +HDY\'XW\$QJOH%URRPZ)ODUH3RO\SURS\OHQH %ULVWOHV )ODJJHGZ:RRG+DQGOH

 5HSODFHPHQW+HDY\'XW\$QJOH%URRPZ)ODUH 3RO\SURS\OHQH%ULVWOHV +HDG2QO\  8QIODJJHG

 6SDUWDŠ 6SHFWUXPŠ $QJOH%URRPZ3RO\SURS\OHQH %ULVWOHV )ODJJHGZ)LEHUJODVV+DQGOH%OXH%URZQ *UHHQ5HG<HOORZ:KLWH7DQ

 6SDUWDŠ 6SHFWUXPŠ $QJOH%URRPZ3RO\SURS\OHQH %ULVWOHV 8QIODJJHGZ)LEHUJODVV+DQGOH%OXH%URZQ *UHHQ5HG<HOORZ:KLWH7DQ

' '(FR‡6WURQJŒ&DQ/LQHUV ,I \RX¶UH ORRNLQJ IRU D UHDVRQDEO\ SULFHG HQYLURQPHQWDOO\ UHVSRQVLEOH SURGXFWWKHQ(FR‡6WURQJŒFDQOLQHUVDUH WKH DQVZHU /LQHUV DUH IRUPXODWHG IURP UHF\FOHG YLUJLQ UHVLQ DQG KLJK TXDOLW\ SRVWFRQVXPHU UHVLQ 0DQXIDFWXUHG ZLWK XS WR  UHF\FOHG FRQWHQW PHDQV WKH\ PHHW WKH (3$¶V 3URFXUHPHQW *XLGHOLQHV DQG FDQ EH XVHG WR HDUQ /((' FUHGLW %ODFN$YDLODEOHLQDQDVVRUWPHQWRIVL]HV DQGJDXJHV

(/LQHDU/RZDQG+LJK'HQVLW\'LVSRVDEOH&DQ/LQHUV $OO\RXUFDQOLQHUQHHGVIURPRQHVRXUFH 0RGHO'HVFULSWLRQ %ODFN6WDU (FRQRPLFDOOLQHDUORZOLQHU %XII%DJ 0D[ILOPVWUHQJWKWHDUUHVLVWDQW (FR‡6WURQJ 5HF\FOHG )RRG 8WLOLW\ +LJKFODULW\IRRGVWRUDJHEDJ +LJK'HQVLW\056HULHV )RUKHDY\ZHWUHIXVHDQGWHPSHUDWXUHH[WUHPHV 0LJKW\7RXJK :KLWHOLQHUVRQDFRUHOHVVUROOIRUKHDY\SOXVDSSOLFDWLRQV 6KDUN6NLQ5;6HULHV /LQHDUORZGHQVLW\FRUHOHVVUROOV\VWHP 7UX0LO )XOOJDXJHEDJIRUH[WUDKHDY\XVH 9X7KUX &OHDUPD[ILOPVWUHQJWKWHDUUHVLVWDQW $GGLWLRQDOVL]HVDQGJDXJHVDUHDYDLODEOH&RQWDFWRXUFXVWRPHUVHUYLFHGHSDUWPHQW IRUDVVLVWDQFH

(


6DQLWDWLRQ_ $9DFXXPV &OHDQ PRUH HIIHFWLYHO\ LPSURYH SURGXFWLYLW\ DQG SURWHFW ZRUNHU ZHOOEHLQJ ZLWK WKH QHZ KHDY\GXW\ FRPPHUFLDOJUDGH YDFXXP OLQH 5XEEHUPDLG YDFXXPV SURYLGH HIIRUWOHVV PDQHXYHUDELOLW\ HDV\ PDLQWHQDQFH DQG RQERDUG LQWHOOLJHQFH 7KH\ DUH SRZHUIXOIRURQHSDVVFOHDQLQJDQGRIIHUPXOWLVWDJHILOWUDWLRQ5XEEHUPDLGYDFXXPV DUH&5,*UHHQ/DEHO&HUWLILHGIRUFOHDQDLUVWDQGDUGVDQGHIIHFWLYHFOHDQLQJ9DFXXP PRGHOVLQFOXGH3RZHU+HLJKW8SULJKW0DQXDO+HLJKW8SULJKW%DFNSDFN8OWUD/LJKW 8SULJKW7UDGLWLRQDO8SULJKW:HW'U\DQG'9$&0RGHOVVKRZQ OHIWWRULJKW ²'9$& 0+8/%3DQG:' 0RGHO'HVFULSWLRQ )*9%3 TW%DFNSDFN9DFXXP )*9%3 TW%DFNSDFN9DFXXP )*98/ 8OWUD/LJKW8SULJKW )*9&9 7UDGLWLRQDO8SULJKW )*90+ 0DQXDO+HLJKW8SULJKW )*93+ 3RZHU+HLJKW8SULJKW )*90+ 0DQXDO+HLJKW8SULJKW $ )*93+ 3RZHU+HLJKW8SULJKW )*9&9 7UDGLWLRQDO8SULJKW )*9:'  *DOORQ&DS:HW 'U\ )*9:' *DOORQ&DS:HW 'U\ $GGLWLRQDOPRGHOVDYDLODEOH

6DQLWDWLRQDQG3UHYHQWLQJ3RWHQWLDO3UREOHPV 6WD\ RQ WRS RI FOHDQLQJ HYHQ GXULQJ EXV\ KRXUV &OHDQ XS DOO VSLOOV LPPHGLDWHO\ DQG NHHS FRXQWHU WRSV DQG IORRUV IUHH RI FUXPEV DQG IRRG UHVLGXH 8VH RUJDQLF FOHDQHUV WR UHJXODUO\ FOHDQGUDLQVDQGJUHDVHWUDSVZKLFKDUHEUHHGLQJJURXQGVIRU IOLHV $W WKH HQG RI D ORQJ DQG EXV\ VKLIW WKRURXJK FOHDQLQJ LV HVVHQWLDOWRZDUGLQJRIISHVWV

% %/REE\3URŒ8SULJKW'XVW3DQV 6W\OLVKSDQGHVLJQ'XUDEOHUHDUZKHHOVLPSURYHZHDUUHVLVWDQFH:LOOQRWVWDLQRU GLVFRORU KHOSV DEVRUE RGRUV 6HOIRSHQLQJ DQG FORVLQJ OLG RQ  DQG 

FRQFHDOV XQVLJKWO\ GLUW DQG GHEULV $GMXVWDEOH KDQGOH JULS HQKDQFHV XVHU FRPIRUW VWDQGDUGRQ 3DQVDQGEURRPVVROGVHSDUDWHO\ 0RGHO'HVFULSWLRQ )*%/$ 8SULJKW'XVW3DQ/[:[+ )*%/$ 8SULJKW'XVW3DQZ&RYHU/[:[+ )*%/$ 'HOX[H8SULJKW'XVW3DQZ&RYHU $GMXVWDEOH+DQGOH*ULS )*%/$ /REE\%URRP6\QWKHWLF)LOO )*%51 /REE\%URRP&RUQ )*%/$ /REE\'XVW3DQ%URRP3RO\SURS\OHQH)LOO '.OHHQ3DLOV 0HHWV ERDUG RI KHDOWK DQG +$&&3 PDQGDWHV IRU GHGLFDWHG FRQWDLQHUV 1HZ KDQGOH GHVLJQ SUHYHQWV KDQGOH ORVV 1HZ LPSULQW IHDWXUH GHVLJQHG WR PHHW KHDOWKFRGH0DGHRIGXUDEOHLPSDFWUHVLVWDQWSODVWLF DQG FOHDUO\ PDUNHG IRU VSHFLILF XVH &RPSOHWH IDPLO\ RIIRXUVL]HVTWTWTWDQGTW$YDLODEOHLQ UHGIRUVDQLWL]LQJDQGJUHHQIRUGHWHUJHQW7KH.OHHQ 3DLO &DGG\ SURYLGHV HIILFLHQW FOHDQLQJ DQG VDQLWL]LQJ ZLWK RQH HDV\WRXVH WRRO ZLWK SDWHQW SHQGLQJ DWWUDFWLYH DQG SRUWDEOH GHVLJQ $YDLODEOH ZLWK RU ZLWKRXWVSUD\ERWWOHIRUVDQLWL]LQJ 0RGHO'HVFULSWLRQ .3 4W 5HGRU*UHHQ

.3 4W 5HGRU*UHHQ

.3 4W 5HGRU*UHHQ

.3 4W 5HGRU*UHHQ

.3 .OHHQ3DLO&DGG\LQFOXGLQJ6SUD\%RWWOH

'

&

&0LFURILEHU+<*(1Œ&ORWKV :HW'U\0RSV ,QQRYDWLYH VROXWLRQV DQG SURYHQ VXSHULRU SHUIRUPDQFH IRU PDLQWDLQLQJ KHDOWK\ VDIH HQYLURQPHQWV %HVWLQFODVV PLFURILEHU GHOLYHUV VXSHULRU FOHDQLQJ SHUIRUPDQFH DQG GXUDELOLW\ &RORUFRGHG SURGXFWV KHOS UHGXFH FURVV FRQWDPLQDWLRQ E\ GLIIHUHQWLDWLQJ DUHD RI XVH =LJ]DJ VFUXEELQJ VWULSV DQG KLJKTXDOLW\ NQLWWLQJ IRU EHWWHU DEVRUSWLRQ DQG GHEULV SLFNXS &OHDQV  EHWWHU WKDQ FRQYHQWLRQDO PLFURILEHU DQG WUDGLWLRQDO FRWWRQ FORWKV DQG XS WR  ODXQGHULQJV %OHDFK VDIH $YDLODEOH LQ *UHHQ %OXHDQG5HG 0RGHO'HVFULSWLRQ )*4</ [%DWKURRP <HOORZ

)*4%/ [*HQHUDO3XUSRVH 5HG%OXHDQG*UHHQ

)*4*5 [6SLOO&OHDQXS  /DUJH$UHD&OHDQLQJ *UHHQ

)*4%/ 0LFURILEHU'DPS0RS *UHHQ5HGRU%OXH7ULP

$GGLWLRQDOPRGHOVDYDLODEOH


6DQLWDWLRQ_

$(FRQRP\&RWWRQ0RS &XWHQG FRWWRQ PRSV IRU JHQHUDO DOOSXUSRVH FOHDQLQJ &XWHQG UD\RQ PRSV IRU ILQLVK DSSOLFDWLRQ $YDLODEOH LQ QDUURZ   RU ZLGH   KHDGEDQGV (FRQRP\ PRSV FRQWDLQ  SRVWLQGXVWULDO FRWWRQ$YDLODEOHLQ DQGVL]HV

$

0RGHO'HVFULSWLRQ )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ &RWWRQ0RSVL]H+HDGEDQG )*9:+ 5D\RQ0RSVL]H+HDGEDQG )*9:+ 5D\RQ0RSVL]H+HDGEDQG )*9:+ 5D\RQ0RSVL]H+HDGEDQG )*9:+ 5D\RQ0RSVL]H+HDGEDQG

&

'

&3XOVHŒ0RSSLQJ.LW &OHDQ PRUH VTXDUH IHHW LQ OHVV WLPH ZLWK WKH QHZ 5XEEHUPDLG 3XOVHŒ ,QGXVWU\EHVW PLFURILEHU RQERDUG UHVHUYRLU DQG XVHUFRQWUROOHG UHOHDVH RI VROXWLRQ PHDQV FOHDQHU IORRUV IDVWHU HDVLHU DQG PRUH HIIHFWLYHO\ 5HG HUJRQRPLF WULJJHU KDQGOH GLVSHQVHV  VWUHDPV RI FOHDQLQJ VROXWLRQ ZLWK HDFK SUHVV +LJKFDSDFLW\ UHILOODEOH UHVHUYRLU KROGV  R] RI VROXWLRQ WR FOHDQ XS WR  VT IW RI IORRU VSDFH  4XLFN&RQQHFW )UDPH LQFOXGHG 8VH D 4 0LFURILEHU :HW 3DG QRW LQFOXGHG 0RGHO)*4</

'8QLERG\0RSSLQJ6\VWHP 7KH RQHSLHFH GHVLJQ UHVXOWV LQ D SRVLWLYH WUDQVIHU RI IRUFH UHPRYLQJ PRUH ZDWHU SHU VWURNH )LYH FRORU RSWLRQV IRU FRORUFRGH SURJUDPV DQG FURVVFRQWDPLQDWLRQ SUHYHQWLRQ (UJRQRPLF KDQGOH UHGXFHV IDWLJXH DQG EDFN LQMXU\ %XFNHW LQWHULRU FOHDUO\ LQGLFDWHV ZLWK JUDGXDWHG VWHSV TXDUWV DQG OLWHUV IRU GLOXWLRQ PHDVXUHPHQWV +ROGV D YDULHW\ RI FDXWLRQ VLJQDJH 6HOIGUDLQLQJ VSLJRW SUHYHQWV KHDY\ OLIWLQJ DQG EDFN LQMXU\ 6HGLPHQW VFUHHQ WUDSV GLUWNHHSLQJZDWHUFOHDQHUORQJHU0RGHO

% %:DYH%UDNHŒ0RSSLQJ6\VWHP :DYH%UDNH 0RS %XFNHW UHGXFHV VSODVKLQJ E\  +LJKHIILFLHQF\ ZULQJHU UHTXLUHV  OHVV HIIRUW WR ZULQJ PRS DQG KDV EHHQ WHVWHG WR ODVW  WLPHV ORQJHU WKDQ FRPSDUDEOH ZULQJHUV 3UHPLXP WXEXODU VWHHO DQG VWUXFWXUDO ZHEPROGHG SODVWLF 2SWLRQDO GLUW\ ZDWHU EXFNHW &

VKRZQIRUVRUWDWLRQRIFOHDQDQGGLUW\ZDWHU$YDLODEOHPRGHOV0RSSLQJ 7UROOH\V  TW 6LGH 3UHVV &RPER  TW 'RZQ 3UHVV &RPER ,QVWLWXWLRQDO &RPERV RU SXUFKDVH VHSDUDWH EXFNHWV DQG ZULQJHUV &RORUV<HOORZ%URZQ*UHHQ5HG%OXH 0RGHO'HVFULSWLRQ )*<(/ 'RZQ3UHVV&RPERTW<HOORZRU%URZQ )*5(' 'RZQ3UHVV&RPERTW5HG*UHHQ%OXH )*<(/ 6LGH3UHVV&RPERTW<HOORZRU%URZQ )*5(' 6LGH3UHVV&RPERTW5HG*UHHQ%OXH )*<(/ ,QVWLWXWLRQDO&RPERTW<HOORZ )*<(/ 'XDO:DWHU'RZQ3UHVV&RPERTW<HOORZ )*<(/ 'XDO:DWHU6LGH3UHVV&RPERTW<HOORZ )*<(/ 6LGH3UHVV:ULQJHUIRU%XFNHWR]0RSV<HOORZ )*<(/ 'RZQ3UHVV:ULQJHUIRU%XFNHWR]0RSV <HOORZ%URZQ )*<(/ 6LGH3UHVV&RPER3DOOHW3NTWFDS<HOORZ )*<(/ %XFNHWZ&DVWHU.LWTWFDS<HOORZ )*<(/ %XFNHWZ&DVWHU.LWTWFDS <HOORZ5HG*UHHQ%URZQ%OXH )*<(/ %XFNHW 1R&DVWHUV TW <HOORZ5HG*UHHQ%OXH )*<(/ 0RSSLQJ7UROOH\'RZQ3UHVVTW<HOORZ )*<(/ 0RSSLQJ7UROOH\6LGH3UHVVTW<HOORZ )*&5(' 'LUW\:DWHU%XFNHWIRUTW&RPERVTW 5HG<HOORZ )*&%/$ 4XLHW&DVWHU'ROOH\/%ODFN

(

(+DQG6DQLWL]HU'LVSHQVHUV $ FRQYHQLHQW ZD\ WR NHHS \RXU KDQGV FOHDQ ZKHQZDWHULVQRWDYDLODEOH²JUHDWIRUSRUWDEOH UHVWURRPV'LVSHQVHVKDQGVDQLWL]LQJJHO VROG VHSDUDWHO\  DQG IHDWXUHV DQ DHVWKHWLFDOO\ SOHDVLQJGHVLJQWRHQKDQFHDQ\GpFRU5HDG\ DFFHVV HQFRXUDJHV KDQG K\JLHQH LQ DQ\ KLJK WUDIILF DUHD XVHG E\ SDWURQV DQG HPSOR\HHV 2SWLRQDO VWDQG FUHDWHV D KDQG VDQLWL]LQJ VWDWLRQIRUKHDOWKFDUHDQGLQVWLWXWLRQDOYHQXHV 0RGHO+6*(/VKRZQ


Sanitation | 112

Hotel Size Soap Pads

Scrubber Sponges

AntiMicrobial Scouring Pads Grill Cleaning Supplies

A

Stainless Steel Scrubbers

A. Professional Cleaning Products. Grill Cleaning Supplies: Grill Screens, Griddle Polishing Pads, Holders and Grill Bricks make grill cleaning fast and easy. Stainless Steel Scrubbers: Available in “300” series, wide band for more cutting power and “400” series corrosion resistant wire. 35 and 50 gram and a variety of pack sizes. USDA and FDA accepted. Anti-Microbial Scouring Pads: Available in medium and heavy duty abrasive. Great for cleaning everything from fine china to pots and pans. Scrubber Sponges: Nylon scouring pad laminated to a pure cellulose sponge. Available in light and medium duty. Hotel Size Soap Pads: Made of fine steel wool and fully saturated with cleaning formula for greater sudsing and more cleaning power. Model Description GB12-TSH Grill Bricks, 1/12 ct. SC200 6"x3" MD Scrub Sponge, 8/5 ct. 10-100 50 gm. S/S Scrubber 86-606 6"x9" HD Green Nylon Pad, 1/20 ct. 96-601 6"x9" MD Green Nylon Pad, 1/20 ct. 24-002TSH Steel Wool Soap Pads, Hotel Size Boxed, 12/10 ct. ISP01PB Steel Wool Soap Pads, Hotel Size Poly Bag, 12/10 ct. 24-005B Tough Scour Nylon Soap Pads, 31/2"x31/2", 4/5 ct. Additional models available.

B B. Scour Pro® Cleaning System. Scour Pro® Power Cleaning System revolutionizes cleaning commercial kitchen surfaces, such as flat-top grills, stainless steel counter tops and glass oven doors. Sealed switch and parts extend tool life. Hook and loop fastening system for easy pad changes. Lithium-ion battery out performs and outlasts any other. You will never clean another grill by hand again. The innovative iron shape allows you to get in corners like no other product ... ever! Comes complete with Scour Pro® unit, starter pads and battery charger. Replacement pads sold separately. Model Description SPP-06 Scour Pro® Unit, Starter Pads, Battery Charger GP100 4"x6" Polishing Grill Pad 617-6 Maroon Pad, Medium 98-606 White Pad, Fine GP406 Black Pad, Coarse 676 Grill Pad Holder GB12-TSH Grill Bricks, 1/12 ct. 20-682TSH Open-Mesh Screen GS106 Griddle Screen, Xtra Coarse

Brooms, Brushes & Mops Guide to Floor Brush Selection: Fine: Hard finished floors, wood, marble, terrazzo and ceramic tile. Medium: Resilient smooth floors, asphalt, vinyl, rubber, tile, linoleum and smooth concrete. Coarse: Rough unfinished surfaces, wood, rough concrete, paved and blacktop. Germs collect quickly. Throw old and particularly dirty, used brooms and brushes away. Hang brooms and brushes when not in use to keep bristles off floor.

C

C. Brooms & Mops. Natural Fiber Corn Brooms constructed of 100% corn fiber. Or choose blends, which are made up of corn fiber on the outside and stiffer Yucca fiber on the inside. Angle brooms constructed of flagged synthetic filaments are perfect for retail stores, foodservice, offices and general cleaning. Each broom comes protected with a poly sleeve. Available in full upright or shorter lobby type. Scrubble’s rayon and Blend Mops are very durable and provide quick absorption. Choose wood handle or high strength fiberglass. Each features non-corrosive hardware. Model Description Model Description M8702 Cotton Blend Natural, Medium B406 28# Warehouse Corn Broom (Blend) M8703 Cotton Blend Natural, Large B404 32# Warehouse Corn Broom (Blend) M8706 Blue Blend Wide Band, Medium B410 16# Maids Corn Broom (Blend) M8707 Blue Blend Wide Band, Large B408 18# Maids Corn Broom (Blend) M8824 Rayon Wide Band, Large M8910 Wood Handle M8911 Plastic Quick Change Fiberglass Handle B441L Plastic Small 71/2" Angle Broom (5 color-safe endcaps also available) B410A Plastic Large 12" Angle Broom Additional models available.


6DQLWDWLRQ_

% $ $7HN7RXJK-UŒ$QWL)DWLJXH0DW /LJKWHU ZHLJKW PDNHV KDQGOLQJ D VQDS DQG FOHDQXSHDVLHU0ROGHGLQEHYHOHGHGJHLPSURYHV VDIHW\DQGPDNHVFDUWWUDIILFHDV\ WKLFN)RXU VL]HV DQG WZR UXEEHU IRUPXODWLRQV DYDLODEOH $YDLODEOHLQ [  [  [ DQG [  0RGHO'HVFULSWLRQ   [ %ODFN*UHDVH5HVLVWDQW   [ 5HG*UHDVH3URRI   [ *UH\*UHDVH3URRI   [ %ODFN*UHDVH5HVLVWDQW   [ *UH\*UHDVH3URRI   [ 5HG*UHDVH3URRI   [ %ODFN*UHDVH5HVLVWDQW   [ 5HG*UHDVH3URRI   [ *UH\*UHDVH3URRI   [ %ODFN*UHDVH5HVLVWDQW   [ *UH\*UHDVH3URRI   [ 5HG*UHDVH3URRI

'

%5LGJH6FUDSHU0DW 3HUIHFWIRUHQWUDQFHVDQG&VWRUHV,W¶VGXUDEOHPROGHGUXEEHU FRQVWUXFWLRQ SURYLGHV DQ H[FHOOHQW VOLSUHVLVWDQW VXUIDFH 5DLVHGHGJH FRQWDLQV VSLOOV $YDLODEOH LQ  [   [   [   [ DQG [  0RGHO'HVFULSWLRQ   [

  [

  [

$GGLWLRQDOPRGHOVDYDLODEOH

&6XSHUIORZŠ 0DWV 6XSHUIORZ Š LV D OLJKWZHLJKW DQWLIDWLJXH PDW ZLWK PROGHGLQ EHYHOHG HGJHV IRU D PRUH ZRUNVWDWLRQ RULHQWHG HQYLURQPHQW $YDLODEOH LQ JHQHUDO SXUSRVH EODFN  DQG KHDY\GXW\ UHG  UXEEHU FRPSRXQGV IRU YDU\LQJ GHJUHHV RI JUHDVH DQG RLO SURWHFWLRQ 6XSHUIORZ Š LV UHYHUVLEOH IXUWKHU H[WHQGLQJ WKH OLIH RI  WKH PDW $ GUDLQDJH V\VWHP IDFLOLWDWHV WKH UHPRYDO RI OLTXLGV DQG GHEULV DQG WKH PROGHGLQ EHYHOHG HGJHV UHGXFH WULS KD]DUGV DQG DOORZ IRU HDV\ DFFHVV RQWR DQG RII RI WKH PDW 7KH DJJUHVVLYH WH[WXUHGWRSVXUIDFHSURYLGHVDGGLWLRQDOWUDFWLRQLQZHW RUJUHDV\DUHDV

'(OHFWURQLF7RXFKOHVV3DSHU7RZHO'LVSHQVHUV 7HDU µ1 'U\ (VVHQFHŒ FRQVLVWHQWO\ GLVSHQVHV  RI SDSHU ZLWK QR ZDLW PDNLQJ LW LGHDO IRU KLJK WUDIILF DUHDV /RQJHVW EDWWHU\ OLIH LQ WKH LQGXVWU\ UHTXLULQJ OHVV PDLQWHQDQFH 6PDUW (VVHQFH IHDWXUHV D VPDUW VHOIDGMXVWLQJ VHQVLQJ ILHOG DOORZLQJ FXVWRPHUV WR WRJJOH EHWZHHQ WKH VHQVRU PRGH RU WRZHORXW PRGH 'LVSHQVHVWRUROOVRI WRZHORQ'FHOOEDWWHULHV LQ VHQVLQJ PRGH %RWK GLVSHQVHUV DUH  VPDOOHU WKDQ RWKHUHOHFWURQLFGLVSHQVHUVDQGDUHVLPSOHWRXVH 0RGHO'HVFULSWLRQ 77%. 7HDUµ1'U\(VVHQFHŒ&ODVVLF%ODFN3HDUO 77%/ 7HDUµ1'U\(VVHQFHŒ&ODVVLF$UFWLF%OXH 77%. 7HDUµ1'U\(VVHQFHŒ2FHDQV%ODFN3HDUO 77%/ 7HDUµ1'U\(VVHQFHŒ2FHDQV$UFWLF%OXH 77%. 6PDUW(VVHQFH&ODVVLF%ODFN3HDUO 77%/ 6PDUW(VVHQFH&ODVVLF$UFWLF%OXH 77%. 6PDUW(VVHQFH2FHDQV%ODFN3HDUO 77%/ 6PDUW(VVHQFH2FHDQV$UFWLF%OXH

( ((OHPHQWŒ5ROO7RZHO'LVSHQVHU ,W¶VVPDOOHUWKDQDVWDQGDUGOHYHUUROOWRZHOFDELQHWEXWVWLOODFFRPPRGDWHV D VWDQGDUG    UROO WRZHO 7KLV FRPSDFW KLJKFDSDFLW\ GLVSHQVHU DFFHSWV DQ\EUDQGRUTXDOLW\RIUROOWRZHOSDSHU$YDLODEOHLQ%ODFN3HDUO 7%. DQG$UWLF %OXH 7%/ 0RGHO7

& 0RGHO'HVFULSWLRQ   [ %ODFN   [ 5HG 78%/  [ %ODFN 785'  [ 5HG

)

)6LPSOLFLW\0HFKDQLFDO+DQGV)UHH'LVSHQVHU +DQGVIUHHGLVSHQVLQJIRUPRVWW\SHVRIUROOWRZHO'RHVQRW UHTXLUH EDWWHULHV $XWRPDWLF PHFKDQLFDO FXWWLQJ GLVSHQVHV SRUWLRQVRIUROOWRZHO,WHPV7DQG7IHDWXUHD VWXE UROO DXWRPDWLF WUDQVIHU V\VWHP DQG GLVSHQVHV XS WR DQ GLDPHWHUUROOWRZHO,WHPV7DQG7DUHFRPSDFW IRU WLJKW DSSOLFDWLRQV DQG GLVSHQVH XS WR D  GLDPHWHU UROO WRZHO$YDLODEOHLQ%ODFN3HDUO 7%. RU$UFWLF%OXH 7%/  0RGHO'HVFULSWLRQ 77%. &ODVVLF%ON3HDUO 77%/ &ODVVLF$UFWLF%OXH 77%. 2FHDQV%ON3HDUO $GGLWLRQDOPRGHOVDYDLODEOH


6DQLWDWLRQ_

$6XSHUIRDPŠ 0DWV 1RQDEVRUEHQW FORVHG FHOO QLWULOH UXEEHU LV  OLJKWHU WKDQ FRQYHQWLRQDO PDWV :LOO QRW DEVRUE OLTXLGV DQG LV KLJKO\ UHVLVWDQW WR JUHDVHV RLOV DQLPDO DQG YHJHWDEOH IDWV 0ROGHGLQ EHYHOHG HGJH LPSURYHV VDIHW\ DQG PDNHV FDUW WUDIILF HDVLHU 2QHSLHFH FRQVWUXFWLRQ QR FRQQHFWRUVQHHGHG([FHOOHQWFKRLFHIRUILJKWLQJIDWLJXH DW FRRNLQJ OLQHV FKHFNRXWV SUHS VWDWLRQV VHUYLFH FRXQWHUV DQG RWKHU DUHDV ZKHUH HPSOR\HHV VWDQG RQ QRQJLYH VXUIDFHV $YDLODEOH LQ  [   [   [   [   [ DQG [ VL]HV'LVKZDVKHUVDIH

$ 0RGHO'HVFULSWLRQ   [

  [

  [

%

0RGHO'HVFULSWLRQ   [

  [

  [

7KLQJVWR&RQVLGHU:KHQ%X\LQJ)ORRU0DWV %HVXUHWRILUVWPHDVXUHWKHDUHDWKHPDWVZLOOEHXVHGLQ:LOO\RX XVHWKHPDWLQDZHWRUGU\DUHD"'R\RXQHHGDQWLIDWLJXHRUJUHDVH SURRI VW\OHV"  $VN XV  :H FDQ KHOS \RX GHWHUPLQHZKLFKPDWVZLOO PHHW\RXUQHHGV &7RSGHN)ORRU0DWV )RUQRQKHDY\XVHLQQRQJUHDVHDQGOLJKWJUHDVHDUHDV7RSGHNKDVEHFRPHWKH PRVWSRSXODUUXEEHUIORRUPDWFRPELQLQJJRRGTXDOLW\DQGH[FHOOHQWYDOXH&KRRVH IURP RXU KHDYLHU ³VHQLRU´ YHUVLRQ RU OLJKWHU ZHLJKW ³MXQLRU´ ZHLJKLQJ DERXW  OEV IRU D  [  PDW 7KH ³PROGHGRQ´ EHYHO UDPS SUHYHQWV WULSV ZKLOH WKH DJJUHVVLYH DQWLVOLS VXUIDFH FUHDWHV D VDIHU ZRUNLQJ HQYLURQPHQW (DV\ WR KDQGOH DQG FOHDQ IORRUPDWVDUHDYDLODEOHLQJHQHUDOSXUSRVHEODFNRUJUHDVHUHVLVWDQWUHG 0RGHO'HVFULSWLRQ & 6HQLRU [ %ODFN OE

5 6HQLRU [ 5HG OE

& 6HQLRU [ %ODFN OE

5 6HQLRU [ 5HG OE

& 6HQLRU [ %ODFN OE

5 6HQLRU [ 5HG OE

& 6HQLRU [ %ODFN OE

5 6HQLRU [ 5HG OE

& -XQLRU [ %ODFN OE

5 -XQLRU [ 5HG OE

& -XQLRU [ %ODFN OE

5 -XQLRU [ 5HG OE

& & -XQLRU [ %ODFN OE

5 -XQLRU [ 5HG OE

& -XQLRU [ %ODFN OE

5 -XQLRU [ 5HG OE

(,QILQLW\Š 6PRNLQJ0DQDJHPHQW ,QILQLW\ Š VPRNLQJ PDQDJHPHQW VROXWLRQV RIIHU D VW\OLVK DOOPHWDO FRQVWUXFWLRQ IRU HIILFLHQW VPRNLQJ OLWWHU PDQDJHPHQW +LJKFDSDFLW\ UHFHSWDFOHVUHGXFHIUHTXHQF\RIHPSW\LQJ6WDLQOHVVVWHHOVQXIISODWHV DQG ƒ GLVSRVDO DUHD 'RPHG WRSV IRU ZHDWKHU UHVLVWDQFH ,QWHJUDWHG SDGORFN WDEV IRU VHFXULW\ DJDLQVW WDPSHULQJ DQG WKHIW )0 DSSURYHG$YDLODEOHPRGHOV7UDGLWLRQDO%DVH0RXQW:DOO0RXQWDQG 8OWUD+LJK&DSDFLW\&RORUV%ODFN%URQ]H3HZWHU 0RGHO'HVFULSWLRQ )*:66%/$ :DOO0RXQWFLJDUHWWHFDS66 )*:66%/$ %DVH0RXQWFLJDUHWWHFDS66 )*:$*%51= 7UDGLWLRQDO5HFHSWDFOHFLJDUHWWHFDS %ODFN%URQ]H3HZWHU )*:$*%51= 8OWUD+LJK&DSFLJDUHWWHFDS %ODFN%URQ]H3HZWHU

(

%9,35HG&ORXG)ORRU0DW$QWL)DWLJXH 7KHXOWLPDWHDQWLIDWLJXHVROXWLRQOLJKWZHLJKWDQGLQFUHGLEOH FRPIRUW9,3&/28'LVDUHYROXWLRQDU\JUHDVHSURRIUXEEHU PDW PDGH RI D XQLTXH FORVHGFHOO QLWULOH FRPSRXQG RIIHULQJ WKH XOWLPDWH LQ FRPIRUW DQG SHUIRUPDQFH 6WDQGLQJ RQ WKLV SURGXFW PDNHV \RX IHHO OLNH \RXU ³VWDQGLQJ RQ D FORXG´ $W RQO\  OEV IRU D  [  VHFWLRQ DQG  OEV IRU D  [  LW¶V H[WUHPHO\HDV\WRKDQGOHDQGFOHDQ,WVWH[WXUHGVXUIDFHDQG WDSHUHG HGJHV SURPRWH DQWLVOLS DQG DQWLWULSSLQJ VDIHW\ \HDU JXDUDQWHH DJDLQVW EUHDNGRZQ IURP JUHDVH 1RW UHFRPPHQGHG IRU XVH LQ DUHDV ZLWK H[FHVVLYH ZDWHU %ODFNRUUHG0RGHO5

)LQJHU7RS

5LGJH6FUDSHU

' '6FUDSHU0DWV &KRRVH IURP  VFUDSHU PDWV 7KH ³)LQJHU 7RS´²LWVWLQ\UDLVHGILQJHUVFUHDWHQRWRQO\D VFUDSHU PDW EXW DOVR DQ DQWLIDWLJXH PDW 'XUDEOH  WKLFN PROGHG UXEEHU LV EHYHOHG RQDOOVLGHVIRUVDIHW\7KH³5LGJH6FUDSHU´ UHGXFHVVOLSVDQGIDOOVZLWKLWVWDSHUHGHGJH UDLVHG UXEEHU SDWWHUQ DQG FOHDWHG EDFNLQJ 'XUDEOH UXEEHUPDGDOVRDGGVUHVLOLHQFH IRUZRUNHUFRPIRUW%RWKDUHHDV\WRFOHDQ² MXVWVKDNHRUKRVHRII 0RGHO'HVFULSWLRQ  )LQJHU7RS[  )LQJHU7RS[  )LQJHU7RS[  5LGJH6FUDSHU [

 5LGJH6FUDSHU [


%HIRUH $Q,QVSHFWRU9LVLWV :LWKRXW D KHDOWK LQVSHFWLRQ \RXU UHVWDXUDQW FRXOG IDOO YLFWLP WR D IRRGERUQHLOOQHVV RXWEUHDN WKDW FRXOG UXLQ \RXU HVWDEOLVKPHQW¶V UHSXWDWLRQ DQG HYHQ IRUFH \RX WR FORVH\RXUGRRUV 7KHSURSHUVWUDWHJ\IRUDVXFFHVVIXOKHDOWKLQVSHFWLRQLVWR EH UHDG\ IRU DQ H[DPLQDWLRQ DW DQ\ WLPH 7KLV PHDQV WKDW \RX DQG \RXU PDQDJHUV VKRXOG EHFRPH LQVSHFWRUV DQG FRQGXFW ZHHNO\ LQKRXVH H[DPLQDWLRQV EHIRUH KHDOWK LQVSHFWRUVDUULYH

Â&#x2021;

:KHQFRQGXFWLQJDVHOIDVVHVVPHQW\RXVKRXOGXVHWKH VDPHIRUPRUDVLPLODUIRUPWKDW\RXUKHDOWKGHSDUWPHQW XVHVDQGSXW\RXUVHOILQWKHKHDOWKLQVSHFWRU¶VSODFH

Â&#x2021;

<RXU VHOILQVSHFWLRQ VKRXOG LQFOXGH ZDONLQJ LQWR \RXU HVWDEOLVKPHQW IURP WKH RXWVLGH WR JHW DQ RXWVLGHU¶V LPSUHVVLRQ

Â&#x2021;

$IWHU \RX LQVSHFW \RXU RSHUDWLRQ KROG D PLQXWH EULHILQJ ZLWK NLWFKHQ VWDII WR UHYLHZ DQ\ SUREOHPV 7KLV VWHS ZLOO KHOS FRQYH\ WKH LPSRUWDQFH RI IRRG VDIHW\ WR VWDIIPHPEHUV

Â&#x2021;

,I \RXU VWDII LQFOXGHV HPSOR\HHV IRU ZKRP (QJOLVK LV D VHFRQG ODQJXDJH DVN D ELOLQJXDO HPSOR\HH WR WUDQVODWH WKH ILQGLQJV WR WKHP VR WKH\ DOVR XQGHUVWDQG KRZ LPSRUWDQWFOHDQOLQHVVLVWRWKHVXFFHVVRI\RXUUHVWDXUDQW

Â&#x2021;

<RXU VHOILQVSHFWLRQ SULRULWLHV IRU NLWFKHQ HPSOR\HHV VKRXOG LQFOXGH IRRG WHPSHUDWXUH DZDUHQHVV RI IRRG W\SHVDQGKDQGZDVKLQJ

Â&#x2021;

7HPSHUDWXUHJXLGHOLQHVLQFOXGHFKHFNLQJWKHWHPSHUDWXUH RI SURGXFWV ZKHQ WKH\ DUULYH ZKHQ WKH\ DUH VWRUHG DQG ZKHQ WKH\ DUH VHUYHG 'RLQJ WKLV ZLOO UHGXFH IRRGERUQH LOOQHVVRXWEUHDNVE\SHUFHQW

Â&#x2021;

)RRGW\SH JXLGHOLQHV DUH GLYLGHG LQWR WKUHH FDWHJRULHV EHHIDQGEHHIEORRGFKLFNHQDQGDOORWKHUW\SHVRIIRRG 7KHVH  FDWHJRULHV FDQ QHYHU WRXFK HDFK RWKHU GXULQJ SUHSDUDWLRQ

Â&#x2021;

7KH LPSRUWDQFH RI KDQG ZDVKLQJ VKRXOG EH UHHQIRUFHG E\ SRVWLQJ VLJQV DW DOO NLWFKHQ VLQNV DQG LQ HPSOR\HH UHVWURRPV

Â&#x2021;

7UDLQ \RXU PDQDJHUV WR HQVXUH WKDW WKH\ DUH XSWRGDWH RQ WKH ODWHVW IRRGVDIHW\ WHFKQLTXHV 5HVWDXUDQW HPSOR\HHV FDQ XVH WKH 1DWLRQDO 5HVWDXUDQW $VVRFLDWLRQ (GXFDWLRQDO )RXQGDWLRQ¶V 6HUY6DIH IRRGVDIHW\ WUDLQLQJ SURJUDP

Â&#x2021; Â&#x2021;

5HYLHZ \RXU ORFDO KHDOWK FRGH IRU DQ\ VSHFLDO ORFDO UHTXLUHPHQWV $QRWKHU ZD\ WR LQIOXHQFH WKH RXWFRPH RI \RXU KHDOWK LQVSHFWLRQ LV WR JHW LQYROYHG SROLWLFDOO\ -RLQ \RXU VWDWH¶V KHDOWKFRGHUHYLVLRQ FRPPLWWHH WR JLYH D UHVWDXUDWHXU¶V SHUVSHFWLYH ,QYROYH VHQLRU VWDII RQ VXFK FRPPLWWHHV DVZHOO

'XULQJ $Q,QVSHFWLRQ 'RQ¶W SDQLF ZKHQ DQ LQVSHFWRU DUULYHV 7KLQN RI WKLV DV D OHDUQLQJ RSSRUWXQLW\ WKDW ZLOO EHQHILW \RXU RSHUDWLRQ E\ PDNLQJ LW DV VDIH DV SRVVLEOH 7R PDNH DQ LQVSHFWLRQ DV SDLQIUHHDVSRVVLEOH\RXVKRXOG

Â&#x2021;

$VN WR VHH WKH LQVSHFWRU¶V FUHGHQWLDOV ILUVW ,Q VRPH FDVHV SHRSOH KDYH WULHG WR SDVV WKHPVHOYHV RII DV KHDOWK RIILFLDOV ,I \RX¶UH XQVXUH RI WKH SHUVRQ¶V FUHGHQWLDOV FDOO WKH ORFDO KHDOWK GHSDUWPHQW RU WKH LQVSHFWRU¶VVXSHUYLVRUIRUYHULILFDWLRQ

Â&#x2021;

'RQRWUHIXVHDQLQVSHFWLRQ7KHH[DPLQHUZLOOOLNHO\JHW DQ LQVSHFWLRQ ZDUUDQW WKDW \RX FDQ¶W UHIXVH DQG WKH H[DPLQDWLRQZLOOEHHYHQPRUHWKRURXJK

Â&#x2021;

7DJ DORQJ ZLWK WKH LQVSHFWRU DQG WDNH QRWHV RI DQ\ YLRODWLRQVKHRUVKHILQGV7KLVJLYHV\RXWKHFKDQFHWR FRUUHFW VLPSOH SUREOHPV RQ WKH VSRW DQG WKH H[DPLQHU ZLOOQRWH\RXUZLOOLQJQHVVWRIL[SUREOHPV

Â&#x2021;

5HIUDLQIURPRIIHULQJDQ\IRRGRUDQ\RWKHULWHPWKDWFDQ EH PLVFRQVWUXHG DV DQ DWWHPSW WR LQIOXHQFH WKH LQVSHFWRU¶VILQGLQJV

Â&#x2021;

$IWHU WKH H[DP EH VXUH WR VLJQ WKH LQVSHFWRU¶V UHSRUW 6LJQLQJ LW GRHVQ¶W PHDQ WKDW \RX DJUHH WR WKH ILQGLQJV LWRQO\PHDQVWKDW\RXUHFHLYHGDFRS\RIWKHUHSRUW

Â&#x2021;

$VN WKH LQVSHFWRU WR H[SODLQ KLV ILQGLQJV WR \RXU VWDII DQGRIIHUVXJJHVWLRQVRQDUHDVWKDWQHHGLPSURYHPHQW (YHQ WKH FOHDQHVW UHVWDXUDQWV VRPHWLPHV FRQWDLQ KHDOWKFRGHYLRODWLRQV

$IWHU $Q,QVSHFWLRQ +HUH¶V ZKDW \RX FDQ GR WR OLPLW WKH GDPDJH RI DQ DGYHUVHKHDOWKLQVSHFWLRQ Â&#x2021; )L[ VPDOO SUREOHPV GXULQJ WKH LQVSHFWLRQ WR OHW WKH H[DPLQHUNQRZ\RXDUHZLOOLQJWRZRUNZLWKKLPRUKHU

Â&#x2021;

,I \RX GRQ¶W XQGHUVWDQG WKH YLRODWLRQ DVN WKH KHDOWK RIILFLDOWRH[SODLQ'RQ¶WEHFRQIURQWDWLRQDO

Â&#x2021;

,I\RXGLVDJUHHZLWKWKHLQVSHFWRU¶VILQGLQJVNHHSTXLHW IRU WKH WLPH EHLQJ DQG DSSHDO WKH GHFLVLRQ ODWHU <RXU KHDOWK LQVSHFWRU VKRXOG EH \RXU DOO\ +H RU VKH FDQ LPSURYH WKH TXDOLW\ RI \RXU FXLVLQH DQG VDYH \RX IURP WKHGHYDVWDWLRQRIDIRRGERUQHLOOQHVVLQFLGHQW


6WRUDJH 7UDQVSRUW 6KHOYLQJ 5DFNV &DUWV )RRG6WRUDJH $ FOHDQ ZHOO NHSW IRRG VWRUDJH DUHD LV YHU\ LPSRUWDQW +RZHYHUFOHDQLQJDQGPDLQWHQDQFHRIVKHOYLQJFDQEHDYHU\ WLPHFRQVXPLQJSURFHVV&KRRVLQJWKHULJKWVKHOYLQJIRU\RXU IRRG VWRUDJH DUHD FDQ HOLPLQDWH D ORW RI KHDGDFKHV DQG JULHI 6KHOYLQJWKDWFDQEHFOHDQHGTXLFNO\DQGHDVLO\ZLOOPRUHOLNHO\ EH GRQH PRUH RIWHQ DQG ZLOO QRW WDNH WRR PXFK WLPH DZD\ IURPRWKHUMREUHVSRQVLELOLWLHV &OHDQLQJ2SHQ:LUH6KHOYLQJ (TXLSPHQW1HHGHG%UXVKHV6SRQJHV7RZHOV%XFNHWV +RVHV0LOG'HWHUJHQW (VW7LPHPLQXWHVRQFHDPRQWK KRXUVSHU\HDU /DERUFRVW[KRXUV FOHDQLQJFRVWSHU\HDU

$6XSHU(UHFWDŒ6KHOYLQJ 6XSHU (UHFWD WKH RULJLQDO ZLUH VWRUDJH DQG KDQGOLQJ V\VWHP LV YHUVDWLOH GXUDEOH DQG UHOLDEOH6KHOYHVDUHDGMXVWDEOHDQGDYDLODEOH LQ D ZLGH UDQJH RI VL]HV 16)  DQG  GHSWKVDQGDIXOOOLQHRISRVWKHLJKWVDUHDOVR DYDLODEOH 6KHOYLQJ FRPHV VWDQGDUG ZLWK 0LFUREDQDQWLPLFURELDOSURGXFWSURWHFWLRQWR LQKLELW VWDLQ DQG RGRU FDXVLQJ EDFWHULD JURZWK $YDLODEOH ZLWK 0HWUR6HDO  &KURPH RU%ULJKWILQLVKDQGDOVR6WDLQOHVV6WHHO

$ %ULWH&KURPH0HWURVHDO6L]H %5 1& 1. [ %5 1& 1. [ %5 1& 1. [ %5 1& 1. [ %5 1& 1. [ %5 1& 1. [ %5 1& 1. [ 3RVWV &KURPH0HWURVHDO6L]H 3 3.  3 3.  3 3.  3 3.  $GGLWLRQDOPRGHOVDYDLODEOH

&OHDQLQJ6WHSV  5HPRYHDOOSURGXFWV  0RYHVKHOYLQJXQLWWRRXWVLGHDUHDRUDUHDDZD\IURP IRRGSURGXFWV 1RWHGRQRWFRQWDPLQDWHIRRGSURGXFW ZLWKFOHDQLQJFKHPLFDOV

 +RVHVKHOYLQJXQLWWRORRVHQJUHDVHDQGGLUW  8VHZDWHUPLOGGHWHUJHQWDQGVSRQJHVWRFOHDQVKHOYHV  8VHEUXVKHVWRFOHDQEHWZHHQZLUHVDQGUHPRYH VWXEERUQUHVLGXH  +RVHRIIXQLWDJDLQWRUHPRYHFOHDQLQJFKHPLFDOVDQG ORRVHGLUW  7RZHOGU\XQLWDQGPRYHEDFN  3ODFHSURGXFWEDFNRQVKHOI

%6XSHU$GMXVWDEOHΠ6XSHU(UHFWD6KHOYLQJ 7R UHSRVLWLRQ WKH VKHOI MXVW SXOO WKH TXLFN UHOHDVH OHYHU RQ HDFK VKHOI FRUQHU 3RVWV DUH JURRYHG DW  LQFUHPHQWV DQG QXPEHUHG DW  LQFUHPHQWV 3RVWV DUH GRXEOH JURRYHG HYHU\  IRU HDV\ LGHQWLILFDWLRQ DQG DVVHPEO\ 0HWURVHDO  ILQLVK VKRZQ LV FRDWHG ZLWK 0LFUREDQDQWLPLFURELDOSURGXFW SURWHFWLRQ WR LQKLELW VWDLQ DQG RGRU FDXVLQJ EDFWHULD $OVR DYDLODEOHLQ&KURPHILQLVK

&OHDQLQJ5HPRYDEOH3RO\PHU6KHOYLQJ (TXLSPHQW1HHGHG'LVKPDFKLQHRUSRWVLQN (VW7LPH PLQXWHVRQFHDPRQWK KRXUVSHU\HDU /DERUFRVW[KRXUV FOHDQLQJFRVWSHU\HDU &OHDQLQJ6WHSV  6KLIWSURGXFWVRQRQHHQGRIVKHOI  5HPRYHSRO\PHUPDWV  3ODFHLQGLVKPDFKLQHRUVLQNWRFOHDQ  5HSODFHPDWVDQGUHSHDWIRURWKHUVLGHRIXQLW

%

%ULWH0HWURVHDO6L]H $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [ $%5 $1. [

3RVWV &KURPH0HWURVHDO6L]H 3 3.  3 3.  3 3.  3 3.  $GGLWLRQDOPRGHOVDYDLODEOH


6WRUDJH 7UDQVSRUW_ $&DPVKHOYLQJŠ &DPVKHOYLQJFDQEHXVHGLQZDONLQUHIULJHUDWRUVDQGIUHH]HUVDVFROGDVƒ)6WHHOFRUH IRUVWUHQJWKDQGDSRO\SURS\OHQHH[WHULRUIRUHDV\FOHDQLQJ6\VWHPLVEDVHGRQVL[HDV\WR XVH HDV\WRDVVHPEOH SDUWV /LIHWLPH JXDUDQWHH (DV\WRDVVHPEOH :DOO 6KHOYHV IHDWXUH YLUWXDOO\ LQGHVWUXFWLEOH ,EHDP VKHOI VXSSRUWV DQG UHLQIRUFHG SRO\SURS\OHQH WR VXSSRUW XS WR OEVSHUVKHOI+LJK'HQVLW\6WRUDJH6\VWHP QHZ LQFUHDVHVVWRUDJHFDSDFLW\XSWR E\HOLPLQDWLQJDLVOHVDQGXWLOL]LQJDOODYDLODEOHVSDFH,GHDOIRURSHUDWLRQVZLWKOLPLWHGVSDFH )ORRUWUDFNV\VWHPSURYLGHVVDIHDQGHDV\DFFHVVWRVWRUHGSURGXFW+HDY\ZHLJKWORDGVUROO VHFXUHO\RQUDLVHGIORRUWUDFN&RQWDFWRXUFXVWRPHUVHUYLFHGHSDUWPHQWIRUDVVLVWDQFH 0RGHO'HVFULSWLRQ &69. 6KHOI.LW[9HQW &69. 6KHOI.LW[9HQW &69. 6KHOI.LW[9HQW &69. 6KHOI.LW[9HQW &69. 6KHOI.LW[9HQW &69. 6KHOI.LW[9HQW &6$ $GG2Q6[[ $GGLWLRQDOPRGHOVDYDLODEOH

$

%L4Œ6WRUDJH6\VWHP 0HWUR0D[LŒDQG0HWUR0D[4ŒDUHLQWHUFKDQJHDEOHPDNLQJWKHL46\VWHPDGDSWDEOHWR\RXU VSHFLILF DSSOLFDWLRQ &RUURVLRQ SURRI 0HWUR0D[ LŒ KDV DQ LQQRYDWLYH SRO\PHU GHVLJQ DQG WKH SHUIRUPDQFHRIVWDLQOHVVVWHHODWKDOIWKHFRVW0HWUR0D[4ŒSRO\PHUDQGHSR[\FRDWHGGHVLJQ RIIHUV VXSHULRU SHUIRUPDQFH YHUVXV ZLUH VKHOYLQJ 6KHOYHV FDQ EH FOHDQHG LQ D IUDFWLRQ RI WKH WLPHRIZLUHIRULPSURYHGSURGXFWLYLW\DQG52,7KHL46\VWHPKDVUHPRYDEOHSRO\PHUPDWVWKDW DUH HDVLO\ FOHDQHG LQ VLQNV RU GLVKPDFKLQHV &RPHV VWDQGDUG ZLWK 0LFUREDQ DQWLPLFURELDO SURGXFWSURWHFWLRQ&RQWDFWRXUFXVWRPHUVHUYLFHGHSDUWPHQWIRUDVVLVWDQFH

%

0RGHO'HVFULSWLRQ 0;* 0HWUR0D[L[*ULG6KHOI 0;* 0HWUR0D[L[*ULG6KHOI 0;* 0HWUR0D[L[*ULG6KHOI 04* 0HWUR0D[4[*ULG6KHOI 04* 0HWUR0D[4[*ULG6KHOI $GGLWLRQDOPRGHOVDYDLODEOH

&7RS7UDFNŒ6WRUDJH6\VWHP 2YHUKHDG WUDFN V\VWHP FRPSHQVDWHV IRU XQHYHQ IORRUV DQG PDNHV DFFHVV HDV\ ZLWK QR XQGHUIRRW WUDFNV WR VWXPEOH RYHU RU WUDS GLUW 0RELOH DQG VWDWLRQDU\ XQLWV DWWDFKHG WR RYHUKHDG WUDFNV LQFUHDVH VWRUDJHFDSDFLW\E\DVPXFKDV7RS7UDFN VLQJOHGHHS FDQEH XVHG ZLWK 0HWUR ZLUH VKHOYLQJ 6XSHU (UHFWD 6XSHU $GMXVWDEOH  6XSHU (UHFWD DQG 6XSHU (UHFWD 3UR  DQG SRO\PHU VKHOYLQJ V\VWHPV 0HWUR0D[LDQG0HWUR0D[4 $YDLODEOHLQDYDULHW\RIVL]HV&RQWDFW RXUFXVWRPHUVHUYLFHGHSDUWPHQWIRUDVVLVWDQFH 0RGHO'HVFULSWLRQ 7761$  7RS7UDFN6HW 7761$  7RS7UDFN6HW 7761$  7RS7UDFN6HW 7761$  7RS7UDFN6HW 7761$  7RS7UDFN6HW 7761$  7RS7UDFN6HW 7761$  7RS7UDFN6HW $GGLWLRQDOPRGHOVDYDLODEOH

&

'+'TZLN75$.6WRUDJH6\VWHP ,QFUHDVH VWRUDJH FDSDFLW\ E\  *XLGLQJ WUDFN LV DVVHPEOHG DQG SRVLWLRQHGRQWKHIORRUWRSURYLGHDVPRRWKDQGOHYHOVXUIDFHIRUPRELOH XQLWV(QGVWDWLRQDU\XQLWVFDQDQFKRUWKHV\VWHPDQGWKHJXLGLQJWUDFN WRWKHIORRU0RELOHXQLWVDUHSRVLWLRQHGEHWZHHQVWDWLRQDU\XQLWVDQGD VLQJOHDLVOHFDQEHRSHQHGEHWZHHQDQ\XQLWVDVQHHGHG+ROGVXSWR OEVSHUXQLWIRU6XSHU(UHFWD6XSHU(UHFWD3URDQG0HWUR0D[4 DQGXSWROEVSHUXQLWIRU0HWUR0D[L,QFOXGHV+SRVWV

'

0RGHO'HVFULSWLRQ %7(& 6WDWLRQDU\(QG8QLW.LWV %7$& 6WDWLRQDU\,QWHUPHGLDWH8QLW.LWV %70& 0RELOH8QLW.LWV


6WRUDJH 7UDQVSRUW_ $*UHHQ(SR[\&RDWHG6KHOYHV 3RVWV ,GHDO IRU GU\ RU ZHW VWRUDJH DUHDV 6KHOYHV DQG SRVWV FRQVWUXFWHG IURP KHDY\GXW\ VWHHO ZLWK D ]LQF SODWHG XQGHUFRDWLQJ 2SWLPDO WKLFNQHVV RI JUHHQ HSR[\ DSSOLHG WR LQVXUH ORQJ ODVWLQJ SHUIRUPDQFH HYHQ LQ WKH WRXJKHVW ZHW HQYLURQPHQWV )RU IDVW DQG HDV\ VHW XS SRVWV DUH JURRYHG LQ  LQFUHPHQWV GRXEOH JURRYHG HYHU\  DQG QXPEHUHG HYHU\  IRU IDVWHU UHIHUHQFH 6KHOYLQJ FDUULHV D \HDU ZDUUDQW\ DJDLQVWQDWXUDOO\RFFXUULQJUXVW16) 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ ))* [6KHOI 3RVWV ))* [6KHOI )** 6WDWLRQDU\ ))* [6KHOI )** 6WDWLRQDU\ ))* [6KHOI )** 6WDWLRQDU\ ))* [6KHOI )** 6WDWLRQDU\ ))* [6KHOI )*1* 0RELOH ))* [6KHOI )*1* 0RELOH ))* [6KHOI )*1* 0RELOH ))* [6KHOI )*1* 0RELOH ))* [6KHOI $GGLWLRQDOPRGHOVDYDLODEOH

$

&&KURPDWH)LQLVK6KHOYHV 3RVWV ,GHDO IRU GU\ VWRUDJH RU GLVSOD\ (DFK VKHOI XS WR LQOHQJWKLVUDWHGWRVXSSRUWXSWROEVRI XQLIRUPO\ GLVWULEXWHG ZHLJKW 6KHOYHV ORQJHU WKDQ  VXSSRUW  OEV )RU IDVW DQG HDV\ VHW XS SRVWV DUH JURRYHG LQ  LQFUHPHQWV GRXEOH JURRYHG HYHU\  DQG QXPEHUHG HYHU\  IRU IDVWHU UHIHUHQFH =LQF SODWHG IHHW DOORZ \RX WR NHHSVKHOYLQJXQLWOHYHORQXQHYHQIORRULQJ16) 0RGHO'HVFULSWLRQ ))& [6KHOI ))& [6KHOI ))& [6KHOI ))& [6KHOI ))& [6KHOI ))& [6KHOI )*& 6WDWLRQDU\3RVW )*& 6WDWLRQDU\3RVW )*1& 0RELOH3RVW )*1& 0RELOH3RVW )*1& 0RELOH3RVW $GGLWLRQDOPRGHOVDYDLODEOH

&

'6XSHU(UHFWD3URŒ 5HPRYDEOH SRO\PHU VKHOI PDWV SURWHFW DJDLQVW DEUDVLYH FRQWDLQHUV DQG DUH VL]HG WR ILW LQ VWDQGDUGGLVKPDFKLQHVIRUHDV\FOHDQLQJ6KHOYHV FDQEHDGMXVWHGDWLQFUHPHQWVWRPD[LPL]HWKH XVH RI DYDLODEOH YHUWLFDO VWRUDJH VSDFH 0LFUREDQ DQWLPLFURELDO SURWHFWLRQ LV EXLOW LQWR VKHOI PDWV DQG WKH HSR[\ FRDWLQJ +HOSV NHHS SURGXFW ³FOHDQHU EHWZHHQ FOHDQLQJV´ 5REXVW FRQVWUXFWLRQ LV FODVVLF 6XSHU (UHFWD +ROGV XS WR  OEV SHU VKHOI²OEVSHUVWDWLRQDU\XQLW$YDLODEOHLQ D YDULHW\ RI VL]HV LQWHUFKDQJHDEOH ZLWK H[LVWLQJ 6XSHU (UHFWD Š VKHOI V\VWHPV 0RGHOV VKRZQ²  351.  83.  03

'

0RGHO'HVFULSWLRQ 351. 6KHOI . [ 351. 6KHOI . [ 351. 6KHOI . [ 3. 3RVW . 6WDWLRQDU\3RVW 83. 3RVW . 0RELOH3RVW $GGLWLRQDOPRGHOVDYDLODEOH

%&DPVKHOYLQJŠ (OHPHQWV6HULHV $GYDQFHG PDWHULDOV DQG LQQRYDWLYH GHVLJQ SURYLGHV H[WUDRUGLQDU\ VWUHQJWK LQFUHDVHG GXUDELOLW\ DQG HQKDQFHG IRRG VDIHW\ $Q DIIRUGDEOH VROXWLRQ ZLWKRXW FRPSURPLVH ,QQRYDWLYH VWURQJ FRPSRVLWH PDWHULDO LV DV VWURQJ DV VWHHO² WUDYHUVH LV WKH ORQJHVW DQG VWURQJHVW LQ WKH LQGXVWU\ VXSSRUWV ORDGV XS WR  % OEV SHU VKHOI 8S WR  OLJKWHU LQ ZHLJKW WKDQ VWHHO HDV\ WR VHW XS DGMXVW DQG FKDQJH FRQILJXUDWLRQV :LWKVWDQGV WHPSHUDWXUHV IURPƒ)WRƒ)PDNLQJLWLGHDOIRUZHWGU\FROGRUKRW HQYLURQPHQWV,PSHUYLRXVWRPRLVWXUHVDOWDQGFKHPLFDOV² ZRQ¶WSHHOGHQWRUZDUSOLIHWLPHZDUUDQW\DJDLQVWFRUURVLRQ DQGUXVW5HPRYDEOHVKHOISODWHVIRUWKRURXJKGLVKZDVKHU FOHDQLQJ &DPJXDUG Š DQWLPLFURELDO SURWHFWLRQ LV SHUPDQHQWO\HPEHGGHGLQVKHOISODWHV 0RGHO'HVFULSWLRQ (68 6WDUWHU8QLW[[ (68 6WDUWHU8QLW[[ (68 6WDUWHU8QLW[[ (68 6WDUWHU8QLW[[ $GGLWLRQDOPRGHOVDYDLODEOH

( (6PDUWZDOO3OXV6WRUDJH6\VWHP $ XQLTXH VWRUDJH DQG ZRUN VWDWLRQ V\VWHP IRU RIWHQ XQGHUXWLOL]HGVSDFH±HPSW\ZDOOV6PDUW:DOO*DQGLWV V\VWHPRILQWHJUDWHGZDOOWUDFNVRIIHUWKHIOH[LELOLW\WRDGG ZDOO VKHOYLQJ DQG ZDOO PRXQWHG WDVN VWDWLRQV ZKHUH QHHGHG WKURXJKRXW D IDFLOLW\ 7KH XVH RI WKH V\VWHP DURXQGDQGDERYHVLQNVZRUNWDEOHVDQGHTXLSPHQWZLOO NHHS WKHVH DUHDV FOHDQHU DQG PRUH RUJDQL]HG 7DVN VWDWLRQV DQG DFFHVVRU\ SDFNV FDQ EH FRPELQHG IRU GLIIHUHQWFRQILJXUDWLRQV1RZDYDLODEOHLQWZRFRQYHQLHQW NLWV IRU HLWKHU WKH WDVN VWDWLRQ RU IRRG SUHS VWDWLRQ 6PDUW:DOO * FDQ EHFRPH DQ LQWHJUDO SDUW RI HYHU\GD\ RSHUDWLQJ SURFHVVHV WR LPSURYH HIILFLHQFLHV DQG XOWLPDWHO\ WKH UHWXUQ RQ LQYHVWPHQW 0RGHOV VKRZQ OHIW WR ULJKW ²6:.6:$ DQG 6:.6:$ &RQWDFWRXUFXVWRPHUVHUYLFHGHSDUWPHQWIRUDVVLVWDQFH

0RGHO'HVFULSWLRQ 6:. 7DVN6WDWLRQ 6WG'XW\

6:. 7DVN6WDWLRQ 0HG'XW\

6:$ $FFHVV3N³6LQN´ )LWV[*ULG  6:$ $FFHVV3N³)RRG3UHS´ )LWV[*ULG

6:.$65 6PDUWZDOO*³6LQN´7DVN6WDWLRQ :DOO6KHOYLQJ.LW 6:.$65 6PDUWZDOO*³)RRG3UHS´7DVN6WDWLRQ :DOO6KHOYLQJ.LW


6WRUDJH 7UDQVSRUW_

$6HFXULW\&DJHV 3URYLGHSURWHFWLRQIRUYDOXDEOHSURGXFWVIURP ORVV DQG PLQLPL]HVKULQNDJHZLWK ORFNLQJEDU(DV\DVVHPEO\VHFXULW\FDJHVDYDLODEOHLQFKURPDWHRUJUHHQHSR[\ RSHQ ZLUH FRQVWUXFWLRQ )URQW RSHQV ž IRU IDVW ORDGLQJXQORDGLQJ &DJH RQO\ FRQWDLQV  IURQWVLGHEDFN SDQHOV DQG KDUGZDUH IRU EDFN SDQHO DQG WRS ORRS DVVHPEO\ 3XUFKDVH FDJH RQO\ RU VHOHFW D VWDWLRQDU\ RU PRELOH NLW YHUVLRQ LQFOXGHV WRSERWWRP VKHOYHV DQG  SRVWV  5HFRPPHQGHG XVLQJ DW OHDVW  VKHOYHV ZLWK HDFK FDJH WR PD[LPL]H VWRUDJH FDSDELOLWLHV 16) &RQYHUVLRQ PRGXOHV DOVR DYDLODEOH 0RGHOV )06(&)06(&*1 VKRZQ ZLWK  DGGLWLRQDOVKHOYHVVROGVHSDUDWHO\ 0RGHO'HVFULSWLRQ )06(& [[ 0RELOH

)06(& [[ 0RELOH

)66(& [[ 6WDWLRQDU\

)66(& [[ 6WDWLRQDU\

)6(& [[ &DJH2QO\

)6(& [[ &DJH2QO\

$GGLWLRQDOPRGHOVDYDLODEOH

&

0RGHO'HVFULSWLRQ )6')36 [+6KHOI'LYLGHU )6')36 [+6KHOI'LYLGHU )6/)36 [6LGH/HGJH )6/)36 [6LGH/HGJH )6/)36 [6LGH/HGJH )%/)36 [%DFN/HGJH )%/)36 [%DFN/HGJH )%/)36 [%DFN/HGJH )%/)36 [%DFN/HGJH

&)363OXVŒ6KHOYLQJ$FFHVVRULHV 1HZ 6KHOI 'LYLGHUV NHHS \RXU VKHOYHV ZHOO RUJDQL]HG DQG RUGHUO\ ZLWK + GLYLGHUV (DV\WRUHPRYHVKHOIGLYLGHUEUDFNHWVILWVHFXUHO\RYHU)363OXVŒVKHOISDQHOV16)

% %)363OXVŒ3RO\PHU6KHOYLQJ 6WRUDJH V\VWHP LV HDVLHU WR FOHDQ DQG KDV WKH VDPH GXUDELOLW\DQGIOH[LELOLW\DVZLUHVKHOYLQJ3RO\PHUSDQHOV DQG JUHHQ HSR[\ FRDWHG IUDPHV DUH PDQXIDFWXUHG ZLWK 6DQL*DUGŒ DQWLPLFURELDO SURWHFWLRQ &KRLFH RI YHQWHGRUVROLGSDQHOV3RO\PHUVKHOISDQHOVKDYHDOLIH WLPH ZDUUDQW\ DJDLQVW UXVW DQG FRUURVLRQ 3RVWV DQG IUDPHVKDYHD\HDUZDUUDQW\DJDLQVWQDWXUDOO\RFFXU ULQJ UXVW 6KHOYHV XS WR  VXSSRUW  OEV VKHOYHV ORQJHU WKDQ  VXSSRUW  OEV *UHHQ HSR[\ SRVWV DYDLODEOHIRUPRELOHRUVWDWLRQDU\DSSOLFDWLRQV

1HZ 6KHOI /HGJHV KHOS SURPRWH VDIHW\ LQ \RXU RSHUDWLRQ E\ NHHSLQJ LWHPV IURP SURWUXGLQJ RU IDOOLQJ IURP VKHOYHV )LW EDFN RU VLGHV RI VKHOYLQJ XQLWV &DQ EH XVHG VHSDUDWHO\ RU LQ WDQGHP IRU FRPSOHWH SRVWWRSRVW FRQWDLQPHQW 6WDFNDEOH IRU DGGLWLRQDO KHLJKWDQGVHFXULW\16) '6HFXULW\&DUWV (DV\WRDVVHPEOH DQG HDV\WRXVH :LUH WXUQNH\ VW\OH KDQGOH IRU EHWWHU HUJRQRPLFV 6DIH VWRUDJH DQG WUDQVSRUWV\VWHPIHDWXUHVRSHQDLUFRQVWUXFWLRQWKDWDLGV LQ WKH YLVLELOLW\ RI LQYHQWRU\ ZKLOH LW SURWHFWV DJDLQVW SLOIHUDJH6KHOYLQJZLWK0LFUREDQŠ DQWLPLFURELDOSURGXFW SURWHFWLRQ LQKLELWV VWDLQ DQG RGRU FDXVLQJ EDFWHULDO JURZWK 6KHOYLQJ DGMXVWV DW  LQFUHPHQWV 5HPRYDEOH SRO\PHUPDWVFDQEHSODFHGLQWKHGLVKZDVKHUWRPDNH FOHDQLQJHDV\16)

0RELOH&DUWVLQFOXGHVKHOYHVPRELOHSRVWVHDFK  SRO\XUHWKDQH VZLYHO FDVWHUV  ZLWK EUDNHV  DQG EXPSHUV:HLJKWFDSDFLW\SHUFDUWLVOEV 0RGHO'HVFULSWLRQ )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW )036 [6KHOI0RELOH6KHOYLQJ&DUW $GGLWLRQDOPRGHOVDYDLODEOH

$

'

0RGHO'HVFULSWLRQ 0RELOH 046(&'( 0HWUR0D[4[ 046(&'( 0HWUR0D[4[ 046(&'( 0HWUR0D[4[ 6WDWLRQDU\ 046(&( 0HWUR0D[4[ 046(&( 0HWUR0D[4[ 046(&( 0HWUR0D[4[ 6WDWLRQDU\ 6(&& 6XSHU(UHFWD[ &KURPH  6(&. 6XSHU(UHFWD[ 0HWURVHDO

6(&& 6XSHU(UHFWD[ &KURPH

6(&. 6XSHU(UHFWD[ 0HWURVHDO

6(&& 6XSHU(UHFWD[ &KURPH

$GGLWLRQDOPRGHOVDYDLODEOH


6WRUDJH 7UDQVSRUW_ $

$(FRQRP\$OXPLQXP%XQ3DQ5DFN )HDWXUHVLQFOXGH Â&#x2021;$OO+HOLDUFZHOGHGRUNQRFNGRZQFRQVWUXFWLRQ Â&#x2021;$OOZHOGHGDQJOHSDQVOLGHVDFFRPPRGDWH[ IXOORU[ KDOIVL]HSDQV Â&#x2021;$OOZHOGHGPRGHOVDYDLODEOHZLWKSDQVWRSVDQGRUFRUQHUEXPSHUV Â&#x2021; VTXDUHWXEXODUDOXPLQXPIUDPHIRU\HDUVRIUHOLDEOHVHUYLFH Â&#x2021; DOOVZLYHOQRQPDUNLQJFDVWHUV Â&#x2021;)URQWDQGVLGHORDGPRGHOVDYDLODEOH Â&#x2021; KHLJKWDYDLODEOHWRILWLQVLGHZDONLQER[HV 0RGHO'HVFULSWLRQ $& )URQW/RDG3DQ&DS+ $& )URQW/RDG3DQ&DS+ $& 6LGH/RDG3DQ&DS+ $& 6LGH/RDG3DQ&DS+ $GGLWLRQDOPRGHOVDYDLODEOH

%

%+HDY\'XW\3DQ5DFN /LIHWLPHZDUUDQW\7KLVKHDY\GXW\EXQSDQUDFNLVSDUWRIWKH/LIHWLPH7RXJK 6HULHV +HOLDUF ZHOGHG DOXPLQXP FRQVWUXFWLRQ IHDWXUHV [[ GRXEOH ZHOGHG DQJOH SDQ VOLGHV WR DFFRPPRGDWH [ EXQ SDQV [ WKLFN WXEXODUIUDPHLVVWURQJHQRXJKWRPDQDJHDOOGD\WRGD\FKRUHVLQDQ\NLWFKHQ DQGWRSURYLGHDOLIHWLPHRIUHOLDEOHVHUYLFH([WUDKHDY\GXW\[DOOVZLYHO QRQPDUNLQJSRO\XUHWKDQHSODWHFDVWHUVIRUHDV\PRELOLW\)URQWORDGIRUHDV\ DFFHVVWRVSDFLQJDYDLODEOHDVZHOODV+IRUZDONLQVWRUDJH2SWLRQV LQFOXGHFRUQHUEXPSHUSHULPHWHUEXPSHUKHDY\GXW\FDVWHUEUDNHVSDQVWRS VROLGERWWRPVROLGWRS16) 0RGHO'HVFULSWLRQ $;' 6SDFLQJ3DQ&DS:['[+ $;' 6SDFLQJ3DQ&DS:['[+ $;' 6SDFLQJ3DQ&DS:['[+ $;' 6SDFLQJ3DQ&DS:['[+ $;' 6SDFLQJ3DQ&DS:['[+ $;' 6SDFLQJ3DQ&DS:['[+ $;' 6SDFLQJ3DQ&DS:['[+ &+HDY\'XW\0RELOH8QLYHUVDO5DFNV 7KHVH 8QLYHUVDO 5DFNV GR LW DOO DQG GR LW LQ VW\OH $OO ZHOGHG W\SH 7 DOXPLQXPFRQVWUXFWLRQIHDWXUHVDVTXDUHH[WUDKHDY\GXW\WXEXODUIUDPHZLWKEURDG H[WUXGHG DOXPLQXP DQJOHV ZKLFK DUH KHOLDUF ZHOGHG WR WKH IUDPH LQ IRXU SODFHV WR LQVXUH PD[LPXP VWUHQJWK DQG \HDUV RI VHUYLFH $OO VZLYHO  QRQPDUNLQJ SRO\XUHWKDQH FDVWHUV DUH VHFXUHO\ EROWHG WR WKH IUDPH /LIHWLPH ZDUUDQW\ DJDLQVW UXVWDQGFRUURVLRQ16) 0RGHO'HVFULSWLRQ $85 3DQ&DS+[:[' $85 3DQ&DS+[:[' 85 3DQ&DS+[:[' 85 3DQ&DS+[:[' 85 3DQ&DS+[:[' $GGLWLRQDOPRGHOVDYDLODEOH

'

7KLQJVWR&RQVLGHU:KHQ &KRRVLQJD5DFNRU&DELQHW Â&#x2021; :KDWLVWREHVWRUHG" Â&#x2021; :KDW VL]H FDQ \RX XVH" +HLJKW ZLGWK DQG GHSWK RI NLWFKHQ VSDFH DUH LPSRUWDQW <RX VKRXOG DOVR FRQVLGHU PDQHXYHULQJ DUHD LHFRUQHUVHOHYDWRUVHWF  Â&#x2021; :KDW FDSDFLW\ LV QHHGHG" 7KH PRVW SRSXODU + PRGHO KROGV   [ VKHHW SDQV SHU UDFN %XW D YDULHW\ RI FRQILJXUDWLRQVDQGVL]HVDUHDYDLODEOH Â&#x2021; :KDW NLQG RI VSDFLQJ LV QHHGHG" 7R PDLQWDLQ WKH LQWHJULW\ RI \RXU SURGXFW VSDFLQJ EHWZHHQ OHGJHV LV FULWLFDO )RU H[DPSOH D PHULQJXH SLH ZRXOGQ·W UHTXLUH WKHVDPHDPRXQWRIVSDFHDVDGRQXW Â&#x2021; 'R\RXQHHGWRORDGIURPWKHIURQWRUVLGH" Â&#x2021; :KDW W\SH RI FRQVWUXFWLRQ GR \RX ZDQW" $OXPLQXPRUVWDLQOHVV"$VNXVIRUKHOS:H DUHKDSS\WRKHOS\RXGHWHUPLQHZKDWUDFN RUFDELQHWZLOOIXOILOO\RXUQHHGV

&

'5DFN (TXLSPHQW&RYHUV 3URWHFWRFRYHUVNHHSIRRGIUHVKDQGFOHDQSUHYHQWIUHH]HUEXUQDQGRGRU WUDQVIHU7HDUSURRIDQGIODPHUHWDUGDQW(FRQRFRYHUVDUHWUDQVSDUHQWIRU HDV\ YLHZLQJ²SURWHFW IRRG IURP FRQWDPLQDWLRQ %UHDWKDEOH PHVK FRYHUV DOORZIUHVKEDNHGSURGXFWVWRFRROTXLFNHUIUR]HQGRXJKWRWKDZIDVWHUDQG PRLVWXUH WR GLVVLSDWH ,QVXOFRYHUV WUDQVIRUP DQ RSHQ UDFN LQWR D ³FORVHG FDELQHW´3UHYHQWVNLQEXUQVIURPKRWH[WHULRUPHWDOVXUIDFHV

0RGHO'HVFULSWLRQ 6WDQGDUG6L]H:['[+ 6XSUR&RORU PLO%OXH5HG<HOORZRU*UHHQZ(QG/RDG=LS)ODS&OHDU:LQGRZ,QIR3RFNHW /RRS 6XSUR(& PLO(FRQRP\LQ&OHDU39&Z(QG/RDG=LS)ODS 6XSUR%0&RORU %UHDWKDEOH0HVKLQ&RORUVZ(QG/RDG=LS)ODS&OHDU,QIR3RFNHW +DQJHU/RRS 6XSUR,&&RORU ,QVXO&RYHULQ%OXHRU*UHHQZ(QG/RDG=LS)ODS&OHDU,QIR3RFNHW+DQJHU/RRS %RWWRP,QVXODWHG3DG 6XSUR7: +'PLO7UDQV:KLWH5HLQIRUFHG9LQ\OZ(QG/RDG=LS)ODS&OHDU:LQGRZ,QIR3RFNHW /RRS


6WRUDJH 7UDQVSRUW_

$3URVHUYHŠ 6KHHW3DQ5DFNV 3URVHUYH Š 6KHHW 3DQ 5DFNV IHDWXUHV WKH 3DQ*XDUGŒ /RFNLQJ %DU IRU HQKDQFHG SDQ VHFXULW\ 8VHUIULHQGO\ KDQGOHV HQKDQFH FRQWURO DQG HQFRXUDJH VDIHW\ 5XJJHG LQGXVWULDO JUDGH SODVWLF WRS DQG ERWWRP (DV\ WR FOHDQ FKURPH SODWHG VLGH SDQHOV UHVLVW UXVW DQG FRUURVLRQ +HDY\GXW\  FDVWHUV  ORFNLQJ  3URWHFWLYH EXPSHUVUHGXFHVFUDSHVDQGEXPSV3DQKROGHUV KROG [ SDQV IURP EDVH IRU DGGHG VXSSRUW ([WHQGHG EDVH HQKDQFHV VWDELOLW\ HOLPLQDWLQJ WLSRYHUVDQGVSLOOV7HPSHUDWXUHUDQJHRIƒWR ƒ) ZLWK D ZHLJKW ORDG UDWLQJ XS WR  OEV 16)0RGHO)*)%/$VKRZQ 0RGHO'HVFULSWLRQ )*)%/$ /[:[+ )*)%/$ /[:[+

$

6WDQGDUG16)5HTXLUHPHQWV IRU)RRG3UHS 6WRUDJH(TXLSPHQW )RRG FRQWDFW DQG IRRGVSODVK VXUIDFHV PXVW EH HDV\WRUHDFK HDV\WRFOHDQ QRQWR[LF QRQDEVRUEHQW FRUURVLRQUHVLVWDQW QRQUHDFWLYHWRIRRGRUFOHDQLQJDQGVKRXOGQRWOHDYHDFRORU RGRURUWDVWHWRIRRG 6KRXOGEHURXQGHGZLWKWLJKWO\VHDOHGHGJHVDQGFRUQHUV 6KRXOG EH GHVLJQHG ZLWK VROLG DQG OLTXLG ZDVWH WUDSV WKDW DUH HDV\WRUHPRYH &RQVLGHUUHSODFLQJLWHPVLI 7KH\·UH ZRUQ RXW 7KH\ QR ORQJHU PHHW ORFDO KHDOWK FRGHV 7KH\DUHQRORQJHUWLPHRUFRVWHIIHFWLYH7KH\PDNHLWPRUH GLIILFXOWWRDGKHUHWR\RXURSHUDWLRQ·V+$&&3SODQ

&/LIHWLPH6HULHV%XQ3DQ5DFNV 7KH /LIHWLPH VHULHV ZLWKVWDQGV WKH DEXVLYH WUDQVSRUWDWLRQ DQG VWRUDJH QHHGHG LQ LQVWLWXWLRQ FRUUHFWLRQDO DQG KRWHO XVH 16) FHUWLILHG DOO ZHOGHG FRQVWUXFWLRQ )HDWXUHV HUJRQRPLFDOO\ IULHQGO\ ³'´ UDGLXV XSULJKWV DQG [ FDVWHUV /LIHWLPH ZDUUDQW\

% %5DFNV3DQ&DQ3L]]D &KRRVHIURPDYDULHW\RIDOXPLQXPSDQDQGFDQUDFNV 0RGHO'HVFULSWLRQ &5; )XOO&DQ5DFN &5; 0RELOH+DOI&DQ5DFN 35.; )URQW/RDG.QRFNGRZQ3DQ5DFNSDQFDS 35:; )URQW/RDG$OO:HOGHG3DQ5DFNSDQFDS 3=; 3L]]D3DQ5DFNSDQFDS

'$OXPLQXP%XQ3DQ5DFNV 3HUIHFWIRUFRPPHUFLDONLWFKHQV$OXPLQXP FRQVWUXFWLRQ UHVLVWV FRUURVLRQ DQG ZLOO ODVW IRU \HDUV WR FRPH ZLWKRXW ZDUSLQJ RU EHQGLQJ &DVWHUV IRU HDV\ PRELOLW\ 16) DSSURYHG 6KLSSHG NQRFNHG GRZQ H[FHSW IRU $:5. DQG $:5. 

 VSDFH EHWZHHQ UXQQHUV $VVHPEO\ UHTXLUHG 0RGHO$/5.VKRZQ

' 0RGHO'HVFULSWLRQ $/5. 3DQ$OXPLQXP5DFN6SDFLQJ $/5. 3DQ$OXPLQXP5DFN6SDFLQJ $/5.%. 3DQ$OXPLQXP5DFNZ%UDNH6SDFLQJ $/5.%. 3DQ$OXPLQXP5DFNZ%UDNH6SDFLQJ $:5. 3DQ$OXPLQXP5DFN:HOGHG $:5. 3DQ$OXPLQXP5DFN:HOGHG $/5.&9 &RYHUIRU3DQ $/5.&9 &RYHUIRU3DQ

& 0RGHO'HVFULSWLRQ  3DQ&DS:[+['6SDFLQJ  3DQ&DS:[+['6SDFLQJ  3DQ&DS:[+['6SDFLQJ

(&DPGROOLHVŠ 6DYH WLPH DQG PRQH\ E\ LQFUHDVLQJ WKH HIILFLHQF\ RI WUDQVSRUWLQJ DQ\WKLQJ IURP VWDFNV RI VKHHW SDQV WR FDWHULQJ HTXLSPHQW 5HGXFH WKH QHHG IRU HPSOR\HH OLIWLQJ DQG FDUU\LQJ ZKLFK FDQ OHDG WR DFFLGHQWV DQG LQMXULHV 0DGH RI UXJJHG SRO\HWK\OHQH +HDY\ GXW\ FDVWHUV DUH EROWHG LQWR PROGHGLQ VWHHO SODWHV WR HQVXUH WKH\ ZRQ¶W IDOO RXW ³+´ PRGHOV KDYH WRXJK EXLOWLQ KDQGOHVWKDWPDNHPDQHXYHULQJHDV\ 0RGHO'HVFULSWLRQ &'5 &DPGROO\IRU&DPUDFNV &'5+ &DPGROO\ZLWK+DQGOHIRU&DPUDFNV

(


6WRUDJH 7UDQVSRUW_ $%RZ7LHŒ'XQQDJH5DFNVZ0LFUREDQ$QWL 0LFURELDO3URGXFW3URWHFWLRQ 5DFNV MRLQ WRJHWKHU ZLWKRXW WRROV LQ ³HQGWRHQG´ DQG ³EDFNWREDFN´ FRQILJXUDWLRQV ZLWK WKH H[FOXVLYH %RZ7LHŒ IHDWXUH 5DFNV KDYH IURQWWREDFN VORWV IRU HDVLHUORDGLQJDQGXQORDGLQJDQGVXSHULRUDLUIORZZKLFK SURPRWHV ORQJHU VKHOI OLIH RI IRRG SURGXFW EHLQJ VWRUHG 5XVW DQG FRUURVLRQ SURRI  DQG ² OE FDS DQG²OEFDS16) 0RGHO'HVFULSWLRQ +33' [ +33' [ +33' [ +33' [

6WRUDJH7LSV

0RGHO'HVFULSWLRQ +33'0% [Z0LFUREDQ +33'0% [Z0LFUREDQ +33'0% [Z0LFUREDQ +33'0% [Z0LFUREDQ

%66HULHV'XQQDJH5DFNV .HHSIUR]HQFROGRUGU\LQYHQWRU\VDIHO\RIIWKHIORRU+HDY\ GXW\ SRO\HWK\OHQH ZLOO QHYHU UXVW FRUURGH RU EHQG DQG LV HDV\ WR FOHDQ 2QHSLHFH FRQVWUXFWLRQ FRPELQHG ZLWK VWXUG\ OHJV PDNHV WKHVHUDFNVHVSHFLDOO\GXUDEOHVWURQJDQGVWDEOH$YDLODEOHZLWKVROLGRUVORWWHG WRSV ZKLFK HQVXUH PD[LPXP DLU FLUFXODWLRQ DURXQG SHULVKDEOH SURGXFWV VWRUHGLQFRROHUVDQGIUHH]HUV2SWLRQDO&DPOLQNFRQQHFWRUVVHFXUHO\ORFN PXOWLSOHUDFNVWRJHWKHU$YDLODEOHLQGDUNEURZQRUVSHFNOHGJUD\ 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ '56 6ROLG '56 6ORW '56 6ROLG '56 6ORW '56 6ROLG '56 6ORW '56 6ROLG '56 6ORW

&'XQQDJH5DFNV .HHS SURGXFW RUJDQL]HG DQG RII WKH IORRU 6XSHULRU IRU FRROHUV DQG IUHH]HUV 7KHVH  OE FDSDFLW\ UDFNV DUH EXLOW WRXJK ZLWK 16)FHUWLILHGDOOZHOGHGDOXPLQXPFRQVWUXFWLRQ)HDWXUHV/,)(7,0( ZDUUDQW\DJDLQVWUXVWDQGFRUURVLRQ

0RGHO'HVFULSWLRQ  '[+[/  '[+[/  '[+[/  '[+[/  '[+[/  '[+[/ $GGLWLRQDOPRGHOVDYDLODEOH

3URSHUO\ VWRUH DOO SHULVKDEOH SURGXFWV ZLWKLQ  PLQXWHV RI EHLQJ XQORDGHG DQG LQVSHFWHG WR HQVXUHVDIHIRRGWHPSHUDWXUHV

&

.HHS UDZ DQG FRRNHG SURGXFWV VHSDUDWHG WR SUHYHQW FURVV FRQ WDPLQDWLRQ 5HDG\WRHDW IRRGV VKRXOG EH VWRUHG DERYH UDZ IRRGV DQG ERWK VKRXOG EH SURSHUO\FRYHUHG 6SHHG XS VWRUDJH RI QHZO\ GHOLYHUHG IRRG E\ XVLQJ ILUVW LQ ILUVW RXW ),)2  IRRG URWDWLRQ DW DOOWLPHV

%

'

',QJUHGLHQW%LQV 6WRUHDQGWUDQVSRUWDYDULHW\RIEXONGU\LQJUHGLHQWVLQWKHQHZ 6ODQW 7RS ,QJUHGLHQW %LQV )LW SHUIHFWO\ XQGHU VWDQGDUG KHLJKW SUHS WDEOHV DQGRU FRXQWHUWRSV 7ZR SLHFH &DPZHDU FOHDU SRO\FDUERQDWH OLG LV YLUWXDOO\ XQEUHDNDEOH DQG VOLGHV XS DQG EDFNIRUHDV\DFFHVVWRFRQWHQWV6KRRNRQWKHIURQWSURYLGHV FRQYHQLHQW ORFDWLRQ IRU KDQJLQJ D VFRRS²KHOSLQJ RSHUDWRUV FRPSO\ZLWKUHJLRQDOKHDOWKFRGHVWKDWGRQRWSHUPLWVFRRSVWR EHVWRUHGLQVLGHELQ16)0DGHRI)'$PDWHULDOV 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ ,% JDO ,%6 JDOVODQW ,% JDO ,%6 JDOVODQW ,% JDO ,%6 JDOVODQW ,%  JDO

(3UR6DYHŒ,QJUHGLHQW0DQDJHPHQW6\VWHP 3UR6DYH'XDO$FWLRQ)RRG%R[/LGVOLGHVEDFNRUIOLSVXSIRUSURGXFWLYLW\VDYLQJV 2QHKDQGHG DFFHVV DQG LQWHJUDWHG PHDVXULQJ WRRO LQFUHDVHV SUHSDUDWLRQ HIILFLHQF\ 5HFWDQJXODUGHVLJQLPSURYHVVSDFHRSWLPL]DWLRQXQGHUDSUHSWDEOHRULQDVWRUHURRP ,QWHJUDWHG VOLGLQJ OLG IRU RQHKDQGHG DFFHVV &OHDU GRRU IRU TXLFN LGHQWLILFDWLRQ RI LQJUHGLHQWV,QWHJUDWHGSRUWLRQLQJVFRRSDQGKRRNSURYLGHGHGLFDWHGVFRRSVWRUDJHIRU VDIHLQJUHGLHQWSRUWLRQLQJDQGIRRGFRGHFRPSOLDQFH6KHOIELQVSURYLGH),)2 ILUVWLQ ILUVWRXW EDUULHUWRDLGLQSURSHUURWDWLRQRILQJUHGLHQWV16)DSSURYHG

(

0RGHO'HVFULSWLRQ )*:+7 %LQ&XS)ODW7RSZ6OLGLQJ/LG )*:+7 %LQ&XS6ODQW)URQWZR]6FRRS )*:+7 %LQ&XS6ODQW)URQWZR]6FRRS )*:+7 %LQ&XS6ODQW)URQWZR]6FRRS )*)&/5 /LGZR]6FRRS IRU

)*)&/5 /LGZR]6FRRS IRU

)*)&/5 /LGZR]6FRRS IRU

$GGLWLRQDOPRGHOVDYDLODEOH


6WRUDJH 7UDQVSRUW_ $0RELOH,QJUHGLHQW%LQV 7KH WZRSLHFH FOHDU SRO\FDUERQDWH OLG DQG XQLTXH VORSHG IURQW OHW \RX VHH ZKDW¶V LQVLGH ZLWKRXW KDYLQJ WR PRYH WKH ELQ IURP XQGHU WKH FRXQWHU 7KH YHUVDWLOH OLG ZLOO WLOW XS RU VOLGH EDFN IRU FRQYHQLHQW DFFHVV 7KH ELQ LV FRQVWUXFWHG RI GXUDEOH 'HUPD7HN Š VPRRWK VXUIDFH SODVWLF 6HDPOHVV ZDOOV DQG URXQG FRUQHU GHVLJQ PDNH FOHDQLQJ VLPSOH DQG WKRURXJK16) 0RGHO'HVFULSWLRQ  JDO  JDO

$

(GCVWTGF%JGH &KHI%UDG-RKQVRQ +DO6PLWK5HVWDXUDQW*URXS 2NODKRPD&,W\2.

0DVKHG5HGVNLQ3RWDWRHV OEVUHGVNLQSRWDWRHV OE'DLV\VRXUFUHDP  7EVS IUHVK FUDFNHG EODFN SHSSHU 7EVSNRVKHUVDOW

%,QJUHGLHQW%LQV ,GHDO IRU PRELOH VWRUDJH LQ WKH NLWFKHQ $GYDQFHG VXSHU FODVS OLG GHVLJQ PDNHV LW HDV\ WR VFRRS LQJUHGLHQWV ZLWKRXW UHPRYLQJ WKH HQWLUH FRYHU &OHDU VHHWKUX SODVWLF IURQW FRYHU PDNHV LW VLPSOH WR LGHQWLI\ WKH LQJUHGLHQWV ZKLOHNHHSLQJIRRGIUHVKFDVWHUVZLWKEUDNHVPDNHWKLV ELQ D EUHH]H WR PRYH IURP RQH NLWFKHQ ZRUN DUHD WR DQRWKHU6FRRSKDQGOHGHVLJQHGWRUHPDLQRXWRIIRRGWR SUHYHQWFURVVFRQWDPLQDWLRQ16)0RGHO,%VKRZQ 0RGHO'HVFULSWLRQ ,% *DO

[

[

,% *DO

[

[



FXSWRSVRIJUHHQRQLRQVPLQFHG òOEVZHHWFUHDPXQVDOWHGEXWWHU %RLO SRWDWRHV VWDUWLQJ ZLWK FROG ZDWHU &RRN XQWLO IRUN WHQGHU 'UDLQ DQG DGG DOO LQJUHGLHQWV DQG PDVK XS 7KHXOWLPDWHFRPIRUWIRRG

%

6WRULQJ<RXU)UHVK3URGXFH /RFDWLRQRIIUXLWVDQGYHJHWDEOHVLVLPSRUWDQWEHFDXVHIUXLWVLQJHQHUDOSURGXFHHWK\OHQHJDVZKLFKIRVWHUVQDWXUDOULSHQLQJEXWFDQDOVRFDXVH PRVWYHJHWDEOHVDQGDIHZQRQHWK\OHQHSURGXFLQJIUXLWVWRGHWHULRUDWHPRUHTXLFNO\DQGGHYHORSXQGHVLUDEOHFKDUDFWHULVWLFV(WK\OHQHSURGXFLQJ IUXLWVVKRXOGEHVWRUHGDVIDUIURPHWK\OHQHVHQVLWLYHIUXLWVDQGYHJHWDEOHVDVSRVVLEOH6HHJXLGHEHORZ

(WK\OHQH3URGXFHUV

)URQW

0LGGOH

%DFN

(WK\OHQHSURGXFHUVWKDWFDQEHVWRUHG WRJHWKHUDQGVKRXOGEHVWRUHGWRZDUG WKHIURQWRIWKHZDONLQ

(WK\OHQHSURGXFHUVWKDWFDQEHVWRUHG WRJHWKHUDQGVKRXOGEHVWRUHGWRZDUG WKHPLGGOHRIWKHZDONLQ

(WK\OHQHSURGXFHUVWKDWFDQEHVWRUHG WRJHWKHUDQGVKRXOGEHVWRUHGWRZDUG WKHEDFNRIWKHZDONLQ

OHPRQV

RUDQJHV

SHDUV

OLPHV

WDQJHULQHV

SOXPV

PDQJRHV

FDQWDORXSH

EHUULHV

SLQHDSSOHV

PDQGDULQRUDQJHV

DSSOHV

WRPDWRHV

QHFWDULQHV

ZDWHUPHORQ

SHDFKHV

DYRFDGRV KRQH\GHZ JUDSHIUXLW (WK\OHQHVHQVLWLYHSURGXFWVWKDWFDQ EHVWRUHGWRJHWKHUDQGVKRXOGEH VWRUHGWRZDUGWKHEDFNRIWKHZDONLQ

SHSSHUV

(WK\OHQHVHQVLWLYHSURGXFWVWKDWFDQ EHVWRUHGWRJHWKHUDQGVKRXOGEH VWRUHGWRZDUGWKHPLGGOHRIWKH ZDONLQ

VXPPHUVTXDVK

DVSDUDJXV

FDUURWV

FXFXPEHUV

EUXVVHOVSURXWV

OHWWXFH

JUHHQEHDQV

EURFFROL

FRUQ

RNUD

FDEEDJH

JUHHQV

FDXOLIORZHU

VSLQDFK

PXVKURRPV

KHUEV

(WK\OHQH6HQVLWLYH

(WK\OHQH VHQVLWLYH SURGXFWV WKDW FDQ EH VWRUHG WRJHWKHU DQG VKRXOG EH VWRUHGWRZDUGWKHIURQWRIWKHZDONLQ

UDGLVKHV

IUHVKFXWSURGXFH


6WRUDJH 7UDQVSRUW_ $%XVVLQJ&DUWZ6LOYHUZDUHDQG5HIXVH%LQ &RQVWUXFWHG RI KLJKGHQVLW\ 'HUPD7HNŒ SODVWLF DQG HQJLQHHUHG DOXPLQXP :RQ¶W UXVW GHQW FUDFN RU FKLS (TXLSSHG ZLWK IRXU  QRQPDUNLQJ VZLYHO FDVWHUV DQG WKUHH UHLQIRUFHG VKHOYHV UDWHG  OEV FDSDFLW\ 7RS VKHOI KDV UDLVHG OLS RQ WKUHH VLGHV DQG RQH RSHQ VLGH 3RO\HWK\OHQHVLOYHUZDUHDQGUHIXVHELQV VROGVHSDUDWHO\

ILW SRSXODU VW\OH XWLOLW\ FDUWV DQG FDQ EH XVHG IRU D PXOWLWXGHRIDSSOLFDWLRQV 0RGHO'HVFULSWLRQ  6KHOI8WLOLW\&DUW %ODFNRU%HLJH

 6LOYHUZDUH%LQ %ODFN   5HIXVH%LQ %ODFN

$

&.'6HUYLFH&DUW 8WLOLW\&DUW 7KH .' 6HUYLFH &DUW DQG WKH QHZ ODUJH 8WLOLW\ &DUW DUHHFRQRPLFDOGXUDEOHDQGVKLS³NQRFNHGGRZQ´WR PLQLPL]HVKLSSLQJFRVWV$VVHPEOHVRXWRIWKHER[LQ PLQXWHV3RO\SURS\OHQHVKHOYHVZLWKPDULQHUDLOVDUH VWURQJ VWDLQ UHVLVWDQW DQG OLJKWO\ WH[WXUHG WR NHHS FRQWHQWVLQSODFH$OXPLQXPXSULJKWVHQVXUHVWUHQJWK DQG VWDELOLW\ 3RZGHU FRDWHG VWDLQOHVV VWHHO FDVWHUV 6HW XS FDUW ZLWK RQH RU ERWK HUJRQRPLF KDQGOHV 6HUYLFH &DUW KROGV XS WR  OEV DQG 8WLOLW\ &DUW KROGVXSWROEV 0RGHO'HVFULSWLRQ %&.' 8WLOLW\&DUW %&.' 6HUYLFH&DUW

% %%XVVLQJ&DUW ,WV VOHHN HUJRQRPLF GHVLJQ LV SHUIHFW IRU IURQWRIKRXVHVHUYLQJEXVVLQJRUHYHQURRP VHUYLFH DSSOLFDWLRQV 'XUDEOH FRQVWUXFWLRQ ZLOOVWDQGXSWRWKHWRXJKHVWXVHSRXQG FDSDFLW\ 5DLVHG HGJHV RQ VKHOYHV NHHS FRQWHQWV VHFXUH GXULQJ WUDQVSRUW (QG SDQHOV KHOS KLGH FOXWWHU  KHDY\ GXW\ QRQPDUNLQJVZLYHOFDVWHUV7UDVKFRQWDLQHU DQGVLOYHUZDUHKROGHUVROGVHSDUDWHO\ 0RGHO'HVFULSWLRQ && [ && [ +ROGVWXEVVLGHE\VLGH

&&7+ $FFHVVRU\7UDVK&RQWDLQHU &&6+ $FFHVVRU\)ODWZDUH&RQWDLQHU

&

*R0RELOH)RU/DERU6DYLQJV

'7UD\ 6LOYHUZDUH&DUW $OO VWDLQOHVV VWHHO FRQVWUXFWLRQ ZLWK VWXUG\ WXEXODU 8IUDPH FRQVWUXFWLRQ &OHDQV DQG VDQLWL]HV HDVLO\ /RZHU VKHOI LV [DQGZLOOKROGWZRWUD\VWDFNV6LOYHUZDUHUDFNKROGV WHQ VLOYHUZDUH F\OLQGHUV QRW LQFOXGHG  DQG IHDWXUHV QDSNLQ VKHOI$OOVZLYHOFDVWHUVZLWKQRQPDUNLQJWLUHV0RGHO

'

(%&6HULHV8WLOLW\&DUWV %&6HULHVVKHOYHVIHDWXUHDUDLVHGVKLS¶VHGJHGHVLJQWRFRQWDLQ SURGXFW RU VSLOOV 2SWLRQDO VKHOI DGMXVWV RQ  LQFUHPHQWV 3RO\PHU VKHOYHVDUHHDV\WRFOHDQDQGFRUURVLRQSURRI6KHOYHVDYDLODEOHZLWK 0LFUREDQŠ DQWLPLFURELDO SURGXFW SURWHFWLRQ WR LQKLELW VWDLQ RGRU FDXVLQJ EDFWHULD DQG SURGXFW GHJUDGDWLRQ (DFK VKHOI KROGV XS WR  OEV XQLW KROGV XS WR  OEV 7ZR DQG WKUHHVKHOI PRGHOV DYDLODEOHLQ*UD\%OXHDQG%ODFN16)'HHS/HGJH&DUWIHDWXULQJD GHHSVKHOIDOVRDYDLODEOH 0RGHO'HVFULSWLRQ %& :[/[+6KHOI8QLW %& :[/[+6KHOI8QLW %& :[/[+6KHOI8QLW %& :[/[+6KHOI8QLW %& :[/[+6KHOI8QLW %& :[/[+6KHOI8QLW $GGLWLRQDOPRGHOVDYDLODEOH

7KHUHLVKDUGO\DWDVNRUSURFHGXUHLQWRGD\·V IRRGVHUYLFH HQYLURQPHQW WKDW FDQQRW EH VLPSOLILHG E\ DGGLQJ PRELOLW\ WR WKH HTXLSPHQW :KHWKHU LW LV UHFHLYLQJ DQG PRYLQJ VXSSOLHV DQG HTXLSPHQW RU DXWRPDWLRQ RI IRRGVHUYLFH SURFHGXUHV PRELOH HTXLSPHQW ZLOO PDNH WKH WDVN HDVLHU DQG OHVV FRVWO\ 7KH PRVW FRPPRQ PRELOH HTXLSPHQW GHVLJQHG WR VDYH ODERU ZRXOG EH FDUWV $YDLODEOH LQ YDULRXV VL]HV FDUU\LQJ FDSDFLWLHV DQG VKHOI FRQILJXUDWLRQV FDUWV RIIHU PRUH WKDQ MXVW HDVH RI PDWHULDO PRYHPHQW 8VH RI D PRELOH FDUW ZLOO DOVR UHGXFH ´KLGGHQµ FRVWV RI RSHUDWLRQ VXFK DV EUHDNDJHGDPDJHDQGHPSOR\HHLQMXU\7KHUH DUH HYHQ FDUWV DYDLODEOH ZLWK HUJRQRPLF IHDWXUHV GHVLJQHG WR IXUWKHU UHGXFH FRVWO\ HPSOR\HH GRZQ WLPH GXH WR EDFN DUP DQG ZULVWLQMXULHV

7KLQJVWRFRQVLGHUZKHQEX\LQJFDUWV ‡ :KDWZLOO\RXEHXVLQJWKHFDUWIRU" ‡ :KDWVL]HDUHWKHREMHFWVWKDWZLOOEH SODFHGRQWKHFDUW"+RZPXFKRIWKHFDUW DUHDZLOOWKHREMHFWVFRYHU" ‡ +RZPXFKZHLJKWZLOOEHSXWRQWKHFDUW" ‡ +RZPDQ\VKHOYHVDUHUHTXLUHG"

(

‡ :KDWW\SHRIFDVWHUVGR\RXQHHG ORFNLQJ EUDNLQJRYHUVL]HG " ‡ 6KRXOG\RXEX\PHWDORUSODVWLF"


6WRUDJH 7UDQVSRUW_

%8WLOLW\&DUWV $KLJKYDOXHORZFRVWDGGLWLRQZKHUHYHUDXWLOLW\FDUWLVQHHGHG &RQVWUXFWHG RI HDVLO\ VDQLWL]HG VWDLQOHVV VWHHO $OOZHOGHG IXOO\ DVVHPEOHG&DSDFLW\RIRUOEV0RGHOVKRZQ 0RGHO'HVFULSWLRQ  OE&DS6WG'XW\[[  OE&DS6WG'XW\[[  OE&DS0HG'XW\[[  OE&DS0HG'XW\[[  OE&DS0HG'XW\[[  OE&DS0HG'XW\[[  OE&DS+Y\'XW\[[6KHOI  OE&DS+Y\'XW\[[6KHOI  OE&DS+Y\'XW\[[6KHOI  OE&DS+Y\'XW\[[6KHOI

$

$(QFORVHG%XVVLQJ&DUWV $WWUDFWLYHGHVLJQZLWKDYDULHW\RIYLQ\ORUODPLQDWH ILQLVKHV$OOZHOGHGVWDLQOHVVVWHHOFRQVWUXFWLRQLV HDV\WRFOHDQ DQG VDQLWL]H ,GHDO DV D VHWXS VWDWLRQ /HJ DQG KDQGOH EXPSHUV SURWHFW ZDOOV DQGIXUQLVKLQJV2SWLRQDOKLQJHGGRRUVDYDLODEOH 0RGHO'HVFULSWLRQ  6KHOI6WG'XW\OE&DS  6KHOI6WG'XW\OE&DS  6KHOI+Y\'XW\OE&DS  6KHOI+Y\'XW\OE&DS

'

&2SHQ6LGHG8WLOLW\&DUWV 'XUDEOH DQG DWWUDFWLYH FDUWV VWRUH DQG WUDQVSRUW IRU IURQW DQG EDFNRIKRXVH DSSOLFDWLRQV 8WLOLW\ FDUWV IHDWXUH DOXPLQXP XSULJKWV DQG PROGHG VKHOYHV HQJLQHHUHGIRUGXUDELOLW\DQGDSSHDUDQFH$YDLODEOHPRGHOV6KHOI2SHQ6LGHG 6KHOI 2SHQ 6LGHG 6KHOI  (QFORVHG 6LGHV DQG 6KHOI  (QFORVHG 6LGHV +HDY\'XW\6HUYLFH&DUWVIHDWXUHZLGHVKHOYHVXSWROEFDSDFLW\ 0RGHO'HVFULSWLRQ )*3/$7 8WLOLW\&DUW(QFORVHG(QG3DQHOV6KHOI 3ODWLQXP

)*%/$ 8WLOLW\&DUW2SHQ6LGHGVKHOI %ODFN*UD\2II:KLWH

)*2:+7 8WLOLW\&DUW(QFORVHG(QG3DQHOV6KHOI 2II:KLWH

)*%/$ 8WLOLW\&DUW6LGHV(QFORVHG6KHOI %ODFN2II:KLWH

)*%/$ 5HIXVH%LQIRU %ODFN

)*%/$ 6LOYHUZDUH%LQIRU %ODFN

$GGLWLRQDOPRGHOVDYDLODEOH

'7RXJK7UDQVSRUW%DQTXHW7UXFNV ,GHDO IRU EDQTXHW VHWXSV 6WDLQOHVV VWHHOXQLWL]HGZHOGHGFRQVWUXFWLRQJLYHV \RX \HDUV RI OLIH (DV\ WR FOHDQ DQG VDQLWL]H ([WHQGHG SHULPHWHU EXPSHUV IRU DGGHG SURWHFWLRQ ([WUD ORDG  FDVWHUV SURYLGH D VPRRWK HDV\ WUDQVSRUW &KRRVH VKHOI VW\OH  HGJHV XS  GRZQ WR KHOS KROG LWHPV RQ WKH VKHOYHV GXULQJ WUDQVSRUW RU DOO VKHOI HGJHV GRZQ IRU HDV\ ORDGLQJ DQG XQORDGLQJIURPDOOVLGHV%DQTXHWWUXFNV DUH[[RU[

0RGHO'HVFULSWLRQ  6KHOI[(GJHV8S'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[(GJHV8S'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[(GJHV8S'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[(GJHV8S'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[(GJHV8S'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[$OO(GJHV'RZQ  6KHOI[$OO(GJHV'RZQ

%

&

( (3URVHUYHŒ,QVXODWHG'HOLYHU\%DJV (OLPLQDWH WKH KHDGDFKHV DQG EDFNDFKHV RI WUDQVSRUWLQJ IRRG DQG EHYHUDJHV /LJKWZHLJKW DQG VW\OLVK GHVLJQ 5LJLG FRQVWUXFWLRQ DOORZVFDUULHUVWREHVWDFNHG'XUDEOHQ\ORQH[WHULRUUHVLVWVWHDULQJ DQG VWDLQLQJ $OXPLQXP UXQQHUV IRU SDQ VXSSRUW RQ HQG ORDG FDUULHUV$YDLODEOHLQIXOODQGKDOISDQVL]HVIRUWRSDQGHQGORDGLQJ 0RGHO'HVFULSWLRQ )*)&*5$< (QG/RDG&DUULHU&DS  RU   )*)&*5$< (QG/RDG&DUULHU&DS  RU   )*)&*5$< 7RS/RDG&DUULHU&DS  RU   )*)&*5$< 7RS/RDG&DUULHU&DS  RU   )*)%/$ &DUULHU'ROO\Z6WUDS%ODFNOE&DS )*)%*&*5$< ,QVXODWHG%DJIRU)*)(QG/RDG&DUULHU )*)%*&*5$< ,QVXODWHG%DJIRU)*)7RS/RDG&DUULHU $GGLWLRQDOPRGHOVDYDLODEOH


6WRUDJH 7UDQVSRUW_

%8OWUD3DQ&DUULHUV 'XUDEOH DQG YHUVDWLOH 5HWDLQ LQWHUQDO WHPSHUDWXUH DQG ZLWKVWDQG WRXJK H[WHUQDO WUHDWPHQW )RDP LQVXODWHG VWXUG\ OLG ZLWK Q\ORQ ODWFKHV IRU PD[LPXP KHDW UHWHQWLRQ +ROGV IXOO VL]H SDQV [ RU IUDFWLRQDO VL]HVZLWKGLYLGHUEDUV:RQ¶WUXVW0ROGHG KDQGOHV RQ DOO IRXU VLGHV (DV\ WR FOHDQ ORDG DQG XQORDG 16) &RORUV 6ODWH %OXH   1DY\ %OXH   &RIIHH %HLJH  'N%URZQ  *UHHQ  %ODFN   *UDQLWH *UD\   DQG *UDQLWH 6DQG  

$ $+6HULHV8OWUD3DQ&DUULHUDQG&DPFDUW (QHUJ\ 6WDUŠ DSSURYHG²8VHV OHVV HQHUJ\ WKDQ WKUHH  ZDWW OLJKWEXOEV(QDEOHV+$&&3FRPSOLDQFHE\PDLQWDLQLQJVDIHKRW IRRGWHPSHUDWXUHV6HUYLQJSRUWLRQFDSDFLWLHVUDQJHIURPLQ WKH 83&+ WR  VHUYLQJV LQ WKH 83&+ *HQWOH ƒWRƒ) KHDW ZLOO QRW FRRN IRRG DQG PDLQWDLQV IRRG PRLVWXUH PLQXWH SUHKHDW WLPH IURP URRP WHPSHUDWXUH 7KLFN IRDP LQVXODWLRQ UHWDLQV WHPSHUDWXUHV IRU KRXUV HYHQ ZKHQ XQSOXJJHG 83&+ PRGHOV VWDFN IRU VWRUDJH RU WUDQVSRUWLQJ RQ D &DPGROO\Š ZLWK VHFXULQJ VWUDS +HDWHG GRRU NLWV DOVR VROG VHSDUDWHO\WRUHWURILW83&83&DQG83& 0RGHO'HVFULSWLRQ 83&+ [[&RPS3DQ&DUULHUVHUYLQJV 83&+ [[&RPS&DPFDUW 83&+ [[&RPS&DPFDUWVHUYLQJV

& &8OWUD&DPFDUWVŠ DQG3DQ&DUULHUVŠ 7RXJK RQHSLHFH VHDPOHVV GRXEOHZDOO SRO\HWK\OHQH FRQVWUXFWLRQ LV HDV\ WR PDLQWDLQ DQG ZRQ¶W GHQW FUDFN UXVW FKLS RU EUHDN 7KLFN SRO\XUHWKDQH IRDP LQVXODWLRQ DQG DLU WLJKW JDVNHWV SURYLGH WRS WHPSHUD WXUH KROGLQJ SHUIRUPDQFH 'RRU RSHQV D IXOO ƒ IRU HDV\ ORDGLQJ DQG XQORDGLQJ0D\EHXVHGZLWK&DPEUR+3DQV±IRRGSDQVWKDWFDQJRIURP SUHSWRFRROHUWRRYHQWR VWHDP WDEOH KDQGOLQJ H[WUHPH WHPSHUDWXUHV RI ƒ)WRƒ) 0RGHO'HVFULSWLRQ 83& &DPFDUW+ROGV' 83& &DPFDUW+ROGV' 83& &DPFDUW+ROGV' 83& &DPFDUW+ROGV' 83& 3DQ&DUULHU+ROGV' 83&: &DPFDUW3DQ6WG 83&6 [[ 0XOWLSOH3DQ

',9 7KHUPR%DUULHU XVHZ83&83&6

&' &DPGROO\IRU83&

%

0RGHO'HVFULSWLRQ 03& :['[++ROGV3DQ 83& :['[++ROGV3DQ 83& :['[++ROGV3DQ 83& :['[++ROGV3DQ 83& :['[++ROGV3DQ ',9 'LYLGHU%DU

'HGLFDWHGWR )RRG6DIHW\

'&RPER&DUW3OXV (OHFWULF RU QRQHOHFWULF WUDQV SRUWHU KROGV IRRG SDQV VKHHW SDQVWUD\VDQGSL]]DER[HVDOO LQ RQH 'XUDEOH UXVWIUHH GHQWIUHH RQHSLHFH PROGHG SRO\HWK\OHQH ERG\ ILOOHG ZLWK SRO\XUHWKDQH IRDP LQVXODWLRQ WKDW HDVLO\KROGVIRRGDWVDIHWHPSHUDWXUHV 1RQHOHFWULF WUDQVSRUWHUV KROG KRW RU FROG IRU  KRXUV RU PRUH )HDWXUH DGMXVWDEOHVWDLQOHVVVWHHOXQLYHUVDOUDLOV (OHFWULF WUDQVSRUWHUV VHSDUDWH GXDO FRPSDUWPHQWVZLWKKHDWHUVRQRQHRUERWK GRRUV PD[LPL]H IRRG TXDOLW\ DQG PHQX IOH[LELOLW\$YDLODEOHLQHQHUJ\HIILFLHQW9DQG9PRGHOV 0RGHO'HVFULSWLRQ &0%3 1RQ(OHFWULF6WG&DVWHUV &0%3+' 1RQ(OHFWULF+'&DVWHUV &0%3+ (OHF96WG&DVWHUV &0%3++' (OHF9+'&DVWHUV &0%3+ (OHF96WG&DVWHUV &0%3++' (OHF9+'&DVWHUV &0%37++' (OHF97RS'RRU+HDW2QO\+'&DVWHUV &0%37+ (OHF97RS'RRU+HDW2QO\6WG&DVWHUV &0%37++' (OHF97RS'RRU+HDW2QO\+'&DVWHUV &0%37+ (OHF97RS'RRU+HDW2QO\6WG&DVWHUV

'


6WRUDJH 7UDQVSRUW_

$

$&DWHUDLGHŒ&DUULHUV 7RXJK VFUDWFKUHVLVWDQW SRO\HWK\OHQH FRQVWUXFWLRQ LV HDV\ WR FOHDQ DQG PDLQWDLQ %XLOWLQVHDOHOLPLQDWHVJDVNHWDQGNHHSVIRRGKRWRUFROGORQJHU6OHHNFRQWHPSRUDU\ DSSHDUDQFHHUJRQRPLFDOO\GHVLJQHGIRUHDV\ORDGLQJKDQGOLQJVWDFNLQJDQGVWRULQJ 16)1HZ0<(QG/RDGHUKROGVXSWRVL[IRRGSDQV'RRUUHPRYHVHDVLO\ IRUFOHDQLQJ3XUFKDVHFDVWHUNLWWRSHUPDQHQWO\DIIL[FDVWHUVWR&DWHUDLGHRUXVHZLWK 0<&.GROO\ZKLFKFDQDWWDFKWRWKHERWWRPRIWKH&DWHUDLGHZLWKDWKUHDGHGKDQGOH HOLPLQDWLQJWKHQHHGIRUVWUDSVWRVHFXUHWRDGROO\ 0RGHO'HVFULSWLRQ ;7 6OLGHµ16HDO7RS/RDGHU&DUULHU ;7 6OLGHµ16HDO7RS/RDGHU&DUULHU ;7 6OLGHµ16HDO7RS/RDGHU&DUULHU ;75 6OLGHµ16HDO(QG/RDGHU&DUULHU 3&1 6LQJOH&DUULHU4W 3&1 6LQJOH&DUULHU4W 3&1 6LQJOH&DUULHU4W 3&1 &RPELQDWLRQ&DUULHU4W 3&1 'RXEOH(QG/RDGHU&DUULHU 3&1 (QG/RDGHU&DUULHU 7&1 (QG/RDGHU6KHHW3DQ7UD\&DUULHU

%

%'LVK&DGGLHV 6WRUHDQGWUDQVSRUWYDOXDEOHGLQQHUZDUHZLWKFRQILGHQFH E\XVLQJ&DPEUR¶V'LVK&DGGLHV2SHQDFFHVVIRUHDV\ ORDGLQJDQGXQORDGLQJ0ROGHGLQKDQGOHVRQERWKHQGV 3RO\HWK\OHQH FRQVWUXFWLRQ ZLOO QRW UXVW FUDFN RU FKLS $GMXVWDEOH 'LVK &DGG\ FDQ EH DGMXVWHG WR KROG  SODWHVSHUVWDFN²IURPDVPDOOSODWHWRDFKDUJHU SODWH RU SDVWD GLVK 9LQ\O FRYHU LQFOXGHG 16) 1HZ 9HUVD'LVK&DGG\KROGVERWKVTXDUHDQGURXQGSODWHV 0RGHO'HVFULSWLRQ '& +ROGV3ODWHV '& +ROGV3ODWHV '& +ROGV3ODWHV '& +ROGV3ODWHV '& +ROGV3ODWHV '& +ROGV3ODWHV $'&6 $GMXVWDEOH+ROGV3ODWHV

&&ODVVLF&DUWHUŒ%DQTXHW&DUWV )URPWRSODWHFDSDFLWLHVPRGHOVIRUVWDQGDUGSODWHVXSWR;/SODWHV XS WR  DQG ;;/ SODWHV XS WR  GLD²WKHUH¶V D &DUWHU IRU DQ\ VL]H EDQTXHW )HDWXUH OLIWRXW KLJK SHUIRUPDQFH KHDWHU DOOZHOGHG XQLERG\ VWDLQOHVV VWHHO FRQVWUXFWLRQ KHDY\GXW\ DOXPLQXP EXPSHU ZLWK QRQPDUNLQJ JUD\ YLQ\O LQVHUW DQG ZKHHODKHDG FDVWHU FRQILJXUDWLRQ &DSDFLW\ GHSHQGV RQ VWDFNLQJ KHLJKW RI SODWHV DQGFRYHUV0RGHO%%VKRZQ

&

0RGHO3ODWH&DSDFLW\ %% +ROGVSODWHVXSWRGLD %% +ROGVSODWHVXSWRGLD %% +ROGVSODWHVXSWRGLD %% +ROGVSODWHVXSWRGLD %% +ROGVSODWHVXSWRGLD %% +ROGVSODWHVXSWRGLD %% +ROGVSODWHVXSWRGLD $GGLWLRQDOPRGHOVDYDLODEOH

' '+HDWHG%DQTXHW&DELQHWV 3URYLGH WKH FRQWURO WR VHUYH PHDOV KRW DQG RQ WLPH HYHU\ WLPH 6XSHULRU WKHUPDO SHUIRUPDQFH LQ ERWK VWDQGDUG HOHFWULF RU 4XDG+HDWΠ'XDO )XHO V\VWHPV 'XUDEOH FRQVWUXFWLRQ (UJRQRPLF WKUHHSRLQWFRQWURO KDQGOH +DQGVIUHH DFFHVV NLFNODWFK 8QLTXH FRQWURO SDQHO ZLWK WKHUPRPHWHU H[FOXVLYH FRXQWXSFRXQWGRZQ WLPHU DQG GU\HUDVH FOLSERDUG DOO LQ RQH 0DQ\ RSWLRQV DQG DFFHVVRULHV DYDLODEOH 0RGHO 0%4'4+ ZLWK DFFHVVRULHVVKRZQ

0RGHO'HVFULSWLRQ 0%4 2QH'RRU3ODWH&DS6WG(OHFWULF+HDW 0%4 2QH'RRU3ODWH&DS6WG(OHFWULF+HDW 0%4 2QH'RRU3ODWH&DS6WG(OHFWULF+HDW 0%4 2QH'RRU3ODWH&DS6WG(OHFWULF+HDW 0%4 2QH'RRU3ODWH&DS6WG(OHFWULF+HDW 0%4' 7ZR'RRU3ODWH&DS6WG(OHFWULF+HDW $GGLWLRQDOPRGHOVDYDLODEOH


6WRUDJH 7UDQVSRUW_

(GCVWTGF%JGH $6HOI/HYHOLQJ3ODWH'LVSHQVHUV 0RELOH FDELQHW GLVSHQVHUV DUH DOOZHOGHG VWDLQOHVV VWHHO +DQGDGMXVWDEOHSODWHJXLGHVDQGKHLJKWDGMXVWPHQWQRWRROV UHTXLUHG  GLDPHWHU DGMXVWPHQW UDQJH 6WDLQOHVV VWHHO (DV\*OLGHΠGHVLJQ SURYLGHV TXLHW QRQVWLFN RSHUDWLRQ (DFKKHDWHGGLVSHQVHUIHDWXUHVLWVRZQWKHUPRVWDWLFFRQWURO 0RGHO VKRZQ 1RQKHDWHGILWVSODWHVVL]HVWR $YDULHW\RIKHDWHGDQGQRQKHDWHGPRGHOVDUHDYDLODEOH 0RGHO'HVFULSWLRQ  1RQ+HDWHGWR3ODWHV  +HDWHGWR3ODWHV  1RQ+HDWHGWR3ODWHV  +HDWHGWR3ODWHV  1RQ+HDWHGWR3ODWHV  +HDWHGWR3ODWHV

([HFXWLYH&KHI3KLO<RXQJ 7KH6WRQH+HDUWK 1HZ+DYHQ&7

$

3DQ 6HDUHG 6HD 6FDOORSV ZLWK :DUPHG &RUQDQG%DFRQ6DOVD 8VHDVFDOORSV HDUVIUHVKFRUQ URDVWHGDQGFXWRIIFRE



FXSGLFHGUHGEHOOSHSSHU



FXSGLFHGJUHHQEHOOSHSSHU



FXSGLFHGRQLRQ



FXSKDOYHGJUDSHWRPDWRHV

WHDVSRRQFKRSSHGJDUOLF 

FXSFRRNHGFKRSSHGEDFRQ

WDEOHVSRRQVXQVDOWHGEXWWHU 3DQ VHDU WKH VFDOORSV RYHU KLJK KHDW XQWLO QLFHO\ EURZQHG 6HW DVLGH WKH VFDOORSV 8VLQJ WKH VDPH SDQ DGG WKH GLFHG YHJHWDEOHVFRRNHGEDFRQDQGEXWWHUWRWKH SDQ VDXWHLQJ WKHP XQWLO WKH\ DUH OLJKWO\ FRRNHG DQG WKH EXWWHU LV PHOWHG 6DOW DQG SHSSHUWRWDVWH 6SRRQ WKH PL[WXUH RYHU WKH VFDOORSV DQG VHUYHDVDQDSSHWL]HURUGRXEOHWKHUHFLSH WRPDNHHQWUHHV

%

%3RNHU&KLS'LVK'ROOLHVZLWK0LFUREDQŠ $QWL0LFURELDO3URGXFW3URWHFWLRQ (QKDQFHG ZLWK EXLOWLQ 0LFUREDQ Š DQWLPLFURELDO SURGXFW SURWHFWLRQ$YDLODEOHZLWKDGMXVWDEOHUHPRYDEOHGLYLGHUVIRU HDVH RI VWRUDJH DQG KDQGOLQJ RI SODWHV IURP  WR  GLD&KLSUHVLVWDQWSRO\PHUVKHOOZLWKIRDPFRUHFRQVWUXFWLRQ KDV VQDJSURRI VXUIDFH 7ZRKDQGOHG GLVK DFFHVV IRU HDV\ UHWULHYDO DQG OHVV FKDQFH RI EUHDNDJH 5HFHVVHG KDQGOHV DQGVTXDUHGHVLJQPD[LPL]HVSDFHHIILFLHQF\QHRSUHQH VZLYHO FDVWHUV  ZLWK EUDNHV  3URWHFWLYH YLQ\O GXVW FRYHU LQFOXGHG16) 0RGHO'HVFULSWLRQ 3&' &ROXPQV+ROGV  'LVKHV3HU&ROXPQ 3&' &ROXPQV+ROGV  'LVKHV3HU&ROXPQ 3&' &ROXPQV+ROGV  'LVKHV3HU&ROXPQ 3&' &ROXPQV+ROGV  'LVKHV3HU&ROXPQ 3&' &ROXPQV+ROGV  'LVKHV3HU&ROXPQ 3&'$ $GMXVWDEOH+ROGV  'LVKHV3HU&ROXPQ 3&' &ROXPQV+ROGV  'LVKHV3HU&ROXPQ $GGLWLRQDOPRGHOVDYDLODEOH

7LS 6DYH WKH EDFRQ IDW ZKHQ FRRNLQJ WKH EDFRQDGGWRWKHVDOVDPL[WXUH

&

&'LVK'LVSHQVHUV &DELQHWVW\OHPRELOHXQKHDWHGKHDWHGRUDOODGMXVWDEOH5HGXFHVEUHDNDJHPD[LPL]HVVWRUDJH&DSDFLW\ RIHDFKWXEXODUGLVSHQVHUDSSUR[LPDWHO\WRERZOVRUWRSODWHV)UDPHDQGERG\FRQVWUXFWHGRI DOO ZHOGHG KHDY\ JDXJH VWHHO $OO XQLWV DUH ILWWHG ZLWK PRGHO $7 DGMXVWDEOH GURSLQ GLVK GLVSHQVHUV 0RXQWHGRQIRXUGLDKHDY\GXW\GRXEOHEDOOEHDULQJVZLYHOFDVWHUVZLWKQRQPDUNLQJUXEEHUWLUHV&6$ 2SWLRQDOLWHPVDYDLODEOH 0RGHO'HVFULSWLRQ $767 7ZR7XEH&DELQHW8QKHDWHG/[: 'LVK6L]HWR $767+ 7ZR7XEH&DELQHW+HDWHG/[: 'LVK6L]HWR $767+ 7ZR7XEH&DELQHW+HDWHG/[: 'LVK6L]HWR $767 7KUHH7XEH&DELQHW8QKHDWHG/[: 'LVK6L]HWR $767 7KUHH7XEH&DELQHW8QKHDWHG/[: 'LVK6L]HWR $GGLWLRQDOPRGHOVDYDLODEOH


'LQLQJ_

'LQLQJ 'LQQHUZDUH *ODVVZDUH )ODWZDUH 7DEOHWRS$FFHVVRULHV 6HUYLQJ /LQHQV &KLQD&DUH ,I\RXQRWLFHPDQ\ULPFKLSVRQ\RXUFKLQD ‡ 'RQRWVWDFNFXSVRQRQHDQRWKHU ‡ &KHFNIRULPSURSHUZDVKLQJUDFNV ‡ /LQH\RXUVRDNVLQN ‡ :DWFKIRURYHUODSSHGSODWHVLQUDFNRURQEHOWLQ GLVKPDFKLQH ‡ %HFDUHIXODERXWPL[LQJKHDY\ZHLJKWDQG OLJKWZHLJKWERGLHGFKLQDLQGLVKURRP ‡ /RRNIRULPSURSHUEXVWXEORDGLQJ ,I\RXQRWLFHDORWRIVXUIDFHZHDU ‡ 0LQLPL]H XVH RI PHWDO VSRQJHV :KLWH SODVWLF VSRQJHV DUH PDGHIRUFHUDPLFDQGJODVVGLQQHUZDUH

,I\RXQRWLFHWRRPXFKEUHDNDJH ‡ $YRLGSODFLQJLQVRDNLQJWXEVURXJKO\ ‡ $OZD\VKROGLWHPXVLQJKDQGOH ‡ &KHFNIRULPSURSHUUDFNKHLJKW ‡ 8VHFRPSDUWPHQWUDFNV ‡ 8VHWUD\VWRFDUU\SODWHVWRWKHWDEOH QRWE\ KDQGRURQDUP

‡ :DWFKRYHUVWDFNLQJVHOIOHYHOHUV ‡ $YRLGWKHUPDOVKRFNFRQGLWLRQV ‡ 'RQRWKHDWGLQQHUZDUHRYHUDQRSHQIODPH

7UDGLWLRQDO6L]HV 3ODWH1DPHV

$

$(VSUHH&KLQD 8QGHFRUDWHG  *UDFHIXO 3OHDVLQJ 9HUVDWLOH )RRG FRPELQDWLRQV DUH EHDXWLIXOO\ IUDPHG E\ WKHVHVW\OLVKFXUYHGOLQHVDQGVFXOSWXUHGULP:KDWHYHU\RXUGpFRU(VSUHHFDQ VDWLVI\ LW ZLWK D IXOO VHOHFWLRQ RI GLVWLQFWLYH GHFRUDWLRQV )LQH JDXJH DQG OLJKW ZHLJKWPDNH(VSUHHLGHDOIRUWKHEHVWGLQLQJDQGEDQTXHWIDFLOLWLHV7KHPRGHVW ULPZLGWKSURYLGHVJHQHURXVVHUYLQJVSDFH 0RGHO'HVFULSWLRQ ) %RXLOORQ R] ) )UXLW R] ) *UDSHIUXLW R] ) 6RXS5LP'HHS R] ) 3ODWH ) 3ODWH ) 3ODWH ) 3ODWH ) &XS/RWXV R] 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

%)ORUHQFH'LQQHUZDUH&ROOHFWLRQ 7KH )ORUHQFH 'LQQHUZDUH FROOHFWLRQ LV WKHQHZHVWPHPEHULQWKH7X[WRQIDPLO\ RISURGXFWV$YDLODEOHLQSRUFHODLQZKLWH WKH FOHDQ OLQHV RI WKH FRXSH VKDSH DQG FRQWHPSRUDU\ ORRN DUH WKH SHUIHFW FDQYDVWRGLVSOD\\RXUFXOLQDU\DUWV7DS LQWRWKHDUWLVWU\RI)ORUHQFHDQGFUHDWHD PDVWHUSLHFHIRU\RXUWDEOHWRS

%

0RGHO'HVFULSWLRQ 93$ 3ODWH&RXSH 93$ 3ODWH&RXSH 93$ 3ODWH&RXSH 93$ 3ODWH&RXSH 93$ 3ODWH&RXSH 93( 6DXFHU 93) &XS5RXQGR] 93+ 3ODWWHU&RXSH[ 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

&KDUJHU  6HUYLFH3ODWH

&

'LQQHU3ODWH /XQFKHRQ3ODWH 6DODG3ODWH 'HVVHUW3ODWH %UHDG %XWWHU

'LQQHUZDUH&DUH 8QORDG GLQQHUZDUH RQH SLHFH DW D WLPH IURP WKH GLVK PDFKLQH7KLVSUHYHQWVFKLSSLQJDQGULPVFOLFNLQJWRJHWKHU $ TXLHW GLVK URRP LV HYLGHQFH RI ORQJHU GLQQHUZDUH DQG JODVVZDUH OLIH .HHS DQ DGHTXDWH VXSSO\ RI GLQQHUZDUH LQ VWRFN3URSHUURWDWLRQDQGFDUHIXOKDQGOLQJZLOOH[WHQGWKH VHUYLFHOLIHRI\RXUGLQQHUZDUHDQGNHHSUHSODFHPHQWFRVWV GRZQ

& 6DQ 0DULQR 'LQQHUZDUH &ROOHFWLRQ /HDG)UHH)XOO\9LWULILHG0LFURZDYH 6DIH 2YHQ 3URRI $OXPD7X[Š LV WKH QHZ VWDQGDUG LQ OLJKWZHLJKW KLJK GXUDELOLW\ FKLQD IRU WKH IRRGVHUYLFH LQGXVWU\ &KRRVH IURP D YDULHW\ RI VSHFLDOW\ LWHPV WR DFFRPSDQ\ WKH 6DQ0DULQRGLQQHUZDUHFROOHFWLRQWR HQKDQFH \RXU PRVW SRSXODU FXOLQDU\ FUHDWLRQ'LVKZDVKHUVDIH

0RGHO'HVFULSWLRQ $68 3ODWH $68 3ODWH $68 3ODWH $68 3ODWH $68 2YDO3ODWWHU[ $68 3DVWD6DODG%RZO R] $68 6WDFNDEOH$'&XSR] $68 $'6DXFHU 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ


'LQLQJ_

$

%

%%RWWLFHOOL8QGHFRUDWHG $ GUDPDWLF VWHHS OHDI HPERVVHG ZLWK KDQG FDUYHG WH[WXUHV FUHDWHV DQ LPSUHVVLYH $%XIIDOR5ROOHG(GJH&KLQD VKRZFDVH IRU IRRG SUHVHQWDWLRQV &UHDWHG E\ 'XUDEOH 'HSHQGDEOH 'HVLUDEOH 7KLV WLPH DZDUGZLQQLQJ (XURSHDQ GHVLJQ WHDP OHVVORRNLVGHILQHGE\FOHDQERG\OLQHVDQGD 4XHHQVEXU\+XQW %RWWLFHOOL DSSHDOV WR ERWK VSDFLRXV ULP 7KLV DSSHDOLQJ VKDSH LV FDVXDODQGILQHGLQLQJVHWWLQJV/LPLWHG\HDU GHVLJQHGWRZLWKVWDQGWKHULJRUVRIWKHEXVLHVW QRFKLSZDUUDQW\%ULJKWZKLWHSRUFHODLQERG\ GLQLQJ RSHUDWLRQV DQG LV UHFRPPHQGHG IRU SODWHVKDYHHUJRQRPLFEDFN GLQHUV ELVWURV FDIHV IDPLO\ UHVWDXUDQWV RU 0RGHO'HVFULSWLRQ VFKRROV 7KH UHLQIRUFHG UROOHG HGJH SURYLGHV 5 &XSV R] PD[LPXP UHVLVWDQFH WR FKLSSLQJ DQG DOORZV 5 %RXLOORQVR] IRUHDVLHUKDQGOLQJ 5 GLD)UXLWV&RQGLPHQW 0RGHO'HVFULSWLRQ 5 %RZOV&HUHDOR] ) %RXLOORQV$WODQWLF R]   5 GLD6RXSV5LP'HHS )  )UXLWV5H  R] 5 GLD3DVWD%RZOV ) )UXLWV5HR] 5 3ODWHV ) *UDSHIUXLWV5HR] 5 3ODWHV ) %RZOV-XQJ R] 5 3ODWHV ) %RZOV0DUN R] 5 3ODWHV ) 1DSSLHV5HR] 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ ) 1DSSLHV5H R] ) 1DSSLHV5HR] ) 6RXSV5LP'HHS5HR] ) 6RXSV5LP'HHS5HR] ) 3DVWD%RZOV5HR] ) 3ODWHV5H ) 3ODWHV5H 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

'

'7XQGUD'LQQHUZDUH&ROOHFWLRQ 7KHZLGHULPRI7XQGUDRIIHUVDPRUHGUDPDWLF SUHVHQWDWLRQ DQG EHWWHU SRUWLRQ FRQWURO 7KH 9LWULILHG +LJK $OXPLQD 9+$  ERG\ HQKDQFHV LPSDFWDQGFKLSSLQJUHVLVWDQFHIRUORQJVHUYLFH OLIH  'HVLUDEOH ERQH ZKLWH ERG\ FRORU  \HDU OLPLWHG QR FKLS ZDUUDQW\  +LJK SHUIRUPDQFH JOD]H  HQKDQFH UHVLVWDQFH WR VFUDWFKLQJ DQG PHWDOPDUNLQJ 0RGHO'HVFULSWLRQ ) %RXLOORQV R] ) )UXLWVR] ) *UDSHIUXLWVR] ) 6RXSV5LP R] ) 3DVWD%RZOVR] ) 3DVWD%RZOVR] ) 3ODWHV ) 3ODWHV 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

( (&RXUVHV&ROOHFWLRQE\2QHLGD &RXUVHVLVWKHDQVZHUIRUFDVXDOGLQLQJYHQXHV ORRNLQJWRDGGDQHZGLPHQVLRQDQGFRQWUDVWWR WKHLU WDEOHWRS 6TXDUH UHFWDQJOH DQG WULDQJXODU IRUPVSURYLGHDUHIUHVKLQJEUHDNIURPWUDGLWLRQDO URXQG VKDSHV 5HLQIRUFHG HGJHV DQG URXQG FRUQHUV PROGHG LQ WKH VXSHUGXUDEOH %XIIDOR &KLQD ERG\ SURYLGH PD[LPXP SHUIRUPDQFH LQ WKH IURQW DQG EDFN RI WKH KRXVH 8QGHFRUDWHG  $OVRDYDLODEOHLQFRORUV²%ODFN   &XUDFDR  3DSULND  6DIIURQ   0RGHO'HVFULSWLRQ ) 'LVKHV6DXFH 7ULDQJOH

) %RZOV 7ULDQJOH

)6 %RZOV 6TXDUH

)6 %RZOV 6TXDUH

) 3ODWHV 7ULDQJOH

) 3ODWHV 7ULDQJOH

) 3ODWHV 7ULDQJOH

)6 3ODWHV 6TXDUH

2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

&

&6DQW¶$QGUHD0RRG'LQQHUZDUH 0RRG¶V SOHDVLQJ WDFWLOH GHVLJQ HYRNHV D VRRWKLQJ SHDFH RI PLQG 7KLV H[WUDRUGLQDU\ OLQH RI VPRRWKFRUQHUHG DV\PPHWULF VKDSHV LVRIIHUHGLQWKHILQHVWEULJKWZKLWHSRUFHODLQ 0RGHO'HVFULSWLRQ 5 'LVKHV6DXFHR] 5 )UXLWV R] 5 %RZOV&HUHDOR] 5 %RZOV5LFHR] 5 6RXSV5LP%RZO 5 %RZOV6DODGR] 5 %RZOV3DVWD R] 5 3ODWHV 5 3ODWHV 5 3ODWHV 5 3ODWHV 5 3ODWWHUV6QDFN 5 3ODWWHUV 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

) )3RUFHODLQ8QGHFRUDWHG $QDIIRUGDEOHDVVRUWPHQWRIFRQWHPSRUDU\EULJKW ZKLWH UDQJHV 7KH XQLTXH LWHP VKDSHV PL[ QLFHO\ ZLWK RWKHU 2QHLGD EULJKW ZKLWH DQG VROLG FRORUGLQQHUZDUHVHWWLQJV%ULJKWZKLWHSRUFHODLQ ERG\ +DUG VFUDWFKUHVLVWDQW JOD]H )LQHO\ SROLVKHGIRRW 0RGHO'HVFULSWLRQ )0 0LQL$X*UDWLQ R] )0 0LQL5DPHNLQR] )0 0LQL/LRQ+HDG%RZO R] )6 3ODWWHU6TXDUH )6 3ODWWHU6TXDUH ) &DNH7UD\[ )6 3ODWHV 6TXDUH  )6 3ODWHV 6TXDUH  )6 3ODWHV 6TXDUH  ) %RZOV 7ULDQJOH  ) &XSV /RZ R] 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ


'LQLQJ_

$

&

&'XUD7X[&HUDPLF6HULHV 'XUD7X[ 7X[WRQ¶V OLQH RI FHUDPLF WDEOHWRS DFFHVVRULHV DQG RYHQ $*UDFHE\6FKRQZDOG ZDUH RIIHUV RQH RI WKH ZLGHVW *UDFHEULQJVLQVSLULQJHOHJDQFHWRGLVFULPLQDWLQJ VHOHFWLRQ RI LWHPV LQ WKH LQGXVWU\ JDVWURQRPLF SUHVHQWDWLRQ ,W RIIHUV IORZLQJ OLQHV $OO RI 7X[WRQ¶V 'XUD7X[ SURGXFWV DUH GHVLJQHG WR DQG VXUIDFHV HPERGLHG LQ ILQH SRUFHODLQ 7KH KDQGOH WKH GHPDQGV RI DQ\ IDVWSDFHG UHVWDXUDQW % DSSHDOLQJ LQWHUSOD\ RI FODVVLF VKDSHV DQG HQYLURQPHQWZLWKRXWEUHDNLQJ\RXUEXGJHW$QGOLNH H[FLWLQJKLJKOLJKWVRSHQVXSIDVFLQDWLQJZD\VRI WKHLU GLQQHUZDUH SURGXFWV DOO RI 7X[WRQ¶V RYHQZDUH VWDJLQJ\RXUSUHVHQWDWLRQVXIIXVHGZLWKGHOLFDWH LWHPV DUH IXOO\YLWULILHG PLFURZDYHVDIH RYHQSURRI SRHWU\ 'HVLJQHG DQG PDGH LQ *HUPDQ\ DQGGLVKZDVKHUIULHQGO\ +LJKILUH VFUDWFK DQG PDUN UHVLVWDQW JOD]H 0RGHO'HVFULSWLRQ %6XUUH\'LQQHUZDUHE\6DQW¶$QGUHD \HDUOLPLWHGJOD]HSHUIRUPDQFHZDUUDQW\ %3+ 7UD\[ 3:

0RGHO'HVFULSWLRQ7LPHOHVV DQG FRQWHPSRUDU\ 6XUUH\ %3= 7UD\[ 3:

IHDWXUHV D ZDUP 0D[DGXUD ERG\ FRORU ,WV ( %RZO&DOOD R]  %3%+ 6TXDUH%RZOR] 3:

ZLGHULP VL]H SUHVHQWV JHQHURXV SODWLQJ  ( %RZO&DOOD   R]  %3+ 6TXDUH3ODWH 3:

VXUIDFHV SHUIHFW IRU IUDPLQJ IRRG ( %RZO5RXQG  R]  %:; 5DPHNLQR] 3LSNLQ :KLWH DGDSWDEOH WR XSVFDOH FDVXDO DQG IRUPDO  ( %RZO5RXQG   R]  %3%- 2YDO%RZOR] 3:

PHQXV/LPLWHG\HDUQRFKLSZDUUDQW\ ( 6DODG'LVK R]  %:=- 7ULDQJOH3ODWH 3:

0RGHO'HVFULSWLRQ ( 6DODG'LVK  R]  %3%3 0LQL)RRWHG6TXDUH%RZOR] 3:

 : 3ODWH ( 3ODWH'HHS R]   3:

%3+6TXDUH3DVWD3ODWH&RXSH  : 3ODWH  ( 3ODWH'HHS  R]  75( )UHQFK&DVVHUROHR] (JJVKHOO

 : 3ODWH  ( 3ODWH)ODW  %$3 )U\3DQ6HUYHUR] &DUDPHO

: 3ODWH ( 3ODWH)ODW 3: 3RUFHODLQ:KLWH

: 3ODWH ( 3ODWH)ODW : 3ODWWHU 2YDO [ ( 3ODWH)ODW ( : 3ODWWHU 2YDO [  ( 3ODWWHU7RUWLOOD  2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ ( 3ODWWHU2YDO 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

'1H[XVE\6DQW¶$QGUHD 1H[XV LV WKH YHU\ ILUVW :HGJZRRG Š +RWHO 3RUFHODLQFROOHFWLRQ7KHXQLTXHDUFLQJ1H[XVŒ GHFRUDWLRQ DGRUQV WKH IDVKLRQIRUZDUG 7UDSH]H VKDSH &UHDWHG E\ WKH ZRUOGUHQRZQHG (QJOLVK GHVLJQ WHDP RI 'DYLG 4XHHQVEHUU\ DQG 0DUWLQ +XQW1H[XVRQ7UDSH]HLVDGDULQJVWDWHPHQWLQ FRQWHPSRUDU\WDEOHWRSVW\OH&XWWLQJHGJHVKDSH GHVLJQ DQG GHFRUDWLRQ +LJK ILUH EULJKW ZKLWH SRUFHODLQ JOD]H²HQKDQFHG UHVLVWDQFH WR VFUDWFKLQJ DQG PHWDO PDUNLQJ \HDU OLPLWHG QR FKLSZDUUDQW\RQURXQGLWHPV 0RGHO'HVFULSWLRQ : )UXLW5RXQG  R]  : %RZO5RXQG  R]  : 3ODWH)ODW5RXQG : 3ODWH)ODW5RXQG : 3ODWH)ODW5RXQG : 3ODWH)ODW5RXQG : 3ODWH)ODW5RXQG ' :6 3ODWH6TXDUH  :6 3ODWH6TXDUH  : 3ODWWHU5HFWDQJOH[ : &XS(VSUHVVR  R]  : 6DXFHU(VSUHVVR : &XS6WDFNDEOH R]  2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

(7X[&DUH+HDOWKFDUH6HULHV )XOO\ 9LWULILHG  0LFURZDYH 6DIH 2YHQ 3URRI  'LVKZDVKHU 6DIH 7X[&DUH KHDOWKFDUH SURGXFWV DUH SHUIHFWIRUQXUVLQJKRPHVDVVLVWHG OLYLQJIDFLOLWLHVKRVSLWDOVRUDQ\IXOOFDUHIDFLOLW\7KH SURGXFWVDUHGHVLJQHGWREHFRPELQHGZLWKLQVXODWHG GRPHV EDVHV DQG RWKHU LQQRYDWLYH IRRG GHOLYHU\ V\VWHPVIRUH[WHQGHGKHDWUHWHQWLRQ,QDGGLWLRQWKH UDQJH RI FRORUV VXSSRUW WKH %RVWRQ 8QLYHUVLW\ VWXG\ WKDW IRXQG $O]KHLPHU DQG DGYDQFHG 'HPHQWLD SDWLHQWVLQFUHDVHGWKHLUIRRGLQWDNHE\DQGWKHLU OLTXLGLQWDNHE\ZLWKWKHXVHRIEULJKWO\FRORUHG WDEOHZDUH 0RGHO'HVFULSWLRQ %(0 6WDFNDEOH0XJR] (JJVKHOO

%(. 2YDO)UXLW'LVKR] (JJVKHOO

%(. 2YDO%DNHUR] (JJVKHOO

%(. 2YDO%DNHUR] (JJVKHOO

%($ 3ODWH (JJVKHOO

+3$ 6TXDUH'LVK R] (JJVKHOO

%&$ 3ODWH&RPS &REDOW

2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ


'LQLQJ_ $

%$SSHWL]HU&ROOHFWLRQ 6KRZFDVH\RXUFUHDWLYLW\ZLWK$SSHWL]HUWKHQHZVW\OLVK \HW IXQFWLRQDO FROOHFWLRQ RI GLQQHUZDUH DFFHVVRULHV 7KH $SSHWL]HU FROOHFWLRQ RIIHUV D YDULHW\ RI SLHFHV WR FRPSOHPHQWWUDGLWLRQDOWDEOHZDUH 0RGHO'HVFULSWLRQ 5 0LQL6RXIIOH 5 'HHS6TXDUH%RZO R] 5 5HFWDQJXODU3ODWH[ 5 6TXDUH3ODWH 5 6SRRQ 5 %RZO[ 5 2YDO'HHS%RZOR] 5 /XGLFR'HHS%RZOR] 5 'HHS%RZOR] Other items available in this pattern.

$&\SUHVV'LQQHUZDUH &\SUHVVGLQQHUZDUHFRPELQHVWKHORRNDQG IHHO RI FKLQD ZLWK WKH GXUDELOLW\ RI IXOO WHPSHULQJ ,WV GLVWLQFW HPERVVHG SDWWHUQ LV WKHSHUIHFWFRPSOHPHQWWRDQ\GpFRU 0RGHO'HVFULSWLRQ  3ODWH )LWV+RVSLWDO3HOOHW6\VWHP   'LQQHU3ODWH  'HVVHUW3ODWH  /XQFK3ODWH  6RXS3ODWHR]  %UHDG %XWWHU3ODWH

& '

%

&,QWHQVLW\'LQQHUZDUH :KHQ WDEOH VHUYLFH FDOOV IRU WUDGLWLRQ DQG HOHJDQFH ,QWHQVLW\LVWKHSHUIHFWFKRLFH7KHSLHFHFROOHFWLRQ LVWKHVWDWHO\UHILQHGSHUVRQDOLW\RI=HQL['LQQHUZDUH ZLWK ZLGH ULPV DQG ODUJH VXUIDFH DUHDV SHUIHFW IRU LQURRP VHUYLFH EDQTXHWV DQG WDEOH VHUYLFH UHVWDXUDQWV 0RGHO'HVFULSWLRQ * 6HUYLFH3ODWH * 'LQQHU3ODWH * %DQTXHW3ODWH * 6DODG3ODWH * 5LP6RXS3DVWD%RZO R] * %UHDG %XWWHU3ODWH * 2YDO3ODWWHU[ * 3DVWD%RZO R] Other items available in this pattern.

(

) ''LQQHUZDUH 0HODPLQH LV GXUDEOH DQG GLVKZDVKHU VDIH 1RW VXLWDEOH IRU PLFURZDYH RU RYHQ XVH +HDW UHVLVWDQWXSWRƒ) 0RGHO'HVFULSWLRQ 0035 5RXQG3ODWH7DQ 0035: 5RXQG3ODWH:KLWH 0035 5RXQG3ODWH7DQ 0035: 5RXQG3ODWH:KLWH 0035 5RXQG3ODWH7DQ 0035: 5RXQG3ODWH:KLWH 00% R]*UDSHIUXLW%RZO7DQ 00%: R]*UDSHIUXLW%RZO:KLWH 00% R]5LPOHVV%RZO7DQ 00%: R]5LPOHVV%RZO:KLWH 00% R])UXLW%RZO7DQ'LD 00%: R])UXLW%RZO:KLWH 00% R]%RXLOORQ&XS7DQ 00%: R]%RXLOORQ&XS:KLWH 008 R]%XOERXV0XJ7DQ 008: R]%XOERXV0XJ:KLWH Other items available in this pattern.

(3KRHQL[&ROOHFWLRQ 7KLVQHZXSVFDOHERQHFKLQDOLQHFRPELQHV HOHJDQFH VLPSOLFLW\ DQG D WRXFK RI FODVV 3HUIHFWO\FRPSOHPHQWVDQ\WDEOHWRSGHVLJQ ZKHWKHU D FDVXDO RU IRUPDO VHWWLQJ $YDLODEOHLQDYDULHW\RIVKDSHVDQGVL]HV 0RGHO'HVFULSWLRQ 3+ &XSR] 3+ 6DXFHU 3+ )UXLW6RXS%RZO R] 3+ 6RXS3ODWH R] 3+ 3DVWD%RZOR] 3+ 6DODG%RZOR] 3+ 3ODWH 3+ 3ODWH 3+ 3ODWH 3+ 3ODWH 3+ 3ODWH 3+ 3ODWWHU[ 3+ 3ODWWHU[

)+DUYHVW&ROOHFWLRQ ,WV EULJKW SRUFHODLQ ERG\ VKLQHV $YDLODEOH LQ D YDULHW\ RI VKDSHV DQG VL]HV LQ YLEUDQW EOXH EODFN\HOORZDQGUHG0LFURZDYHDQGRYHQVDIH XSWRƒ)'LVKZDVKHUVDIH 0RGHO'HVFULSWLRQ (/%% 7DOO&XSR] (/%% 6DXFHU (/%% 6TXDUH6RXIIOH R] (/%% 6TXDUH)UXLW%RZOR] (/%% 6TXDUH*UDSHIUXLW R] (/%% 6TXDUH3ODWH (/%% 6TXDUH3ODWH (/%% 6TXDUH3ODWH (/%% 6TXDUH3ODWH (/%% 5HFWDQJXODU3ODWWHU[ Other items available in this pattern. BB=Blue, BL=Black, BN=Yellow, RH=Red


'LQLQJ_ $

$0DUGL*UDV'LQQHUZDUH &RORUVWKDWFHOHEUDWHDQGEULQJVSLULWWR\RXUGLQLQJDUHD 7KLV OLQH RI KHDY\ GXW\ GLQQHUZDUH WKH 'LDPRQG OLQH LV KHDYLO\ JOD]HG IRU VWURQJ VWDLQ UHVLVWDQFH 7KH RXWVWDQGLQJ TXDOLW\ LV VXSSRUWHG E\ D WZR\HDU OLPLWHG ZDUUDQW\ 0DGH RI FRPPHUFLDO GLVKZDVKHU VDIH PHODPLQH WKDW LV 16) FHUWLILHG &RORUV 3HDFRFN %OXH 3%  5LR 2UDQJH 52  5DLQIRUHVW *UHHQ )*  7URSLFDO <HOORZ 7< 

&2YDO3ODWWHU 5RXQG3ODWH&RYHUV 9ROOUDWK RIIHUV  VWRFN VL]HV RI URXQG FRYHUV &RQVWUXFWHG RI  VWDLQOHVV VWHHO 6DWLQILQLVK NHHSV FRYHUV ORRNLQJ EHWWHUORQJHUPLUURUILQLVKHGDYDLODEOHDW DGGLWLRQDOFKDUJH&XVWRP3ODWH&RYHUV IRU SODWHV  WR  DQG &XVWRP 3ODWWHU&RYHUVIRUSODWWHUV WR DQG OHQJWKV IURP      WR      DQG KHLJKWV IURP  WR  DOVR DYDLODEOH 3UHFLVLRQ ILWWLQJ VW\OHV HQVXUHV VWDFNDELOLW\ IRU IRRWHG RU QRQIRRWHG SODWHV

'

0RGHO'HVFULSWLRQ :3 :LGH5LP3ODWH :3 :LGH5LP3ODWH :3 :LGH5LP3ODWH :3 :LGH5LP3ODWH 13 1DUURZ5LP3ODWH 13 1DUURZ5LP3ODWH 13 1DUURZ5LP3ODWH 13 1DUURZ5LP3ODWH % %RZOR]' % %RZO R]' 6 3ODLQ5DPHNLQR] 50 3ODLQ5DPHNLQR] 23 2YDO3ODWWHU[ 23 2YDO3ODWWHU[ 23 2YDO3ODWWHU[ 73 7ULDQJOH3ODWH 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

% %'LDPRQG,YRU\ 7KLVOLQHRIEUHDNUHVLVWDQWPHODPLQHGLQQHUZDUH WKH 'LDPRQG ,YRU\ FROOHFWLRQ LV KHDYLO\ JOD]HG IRU VWURQJ VWDLQ UHVLVWDQFH 7KH RXWVWDQGLQJ TXDOLW\LVVXSSRUWHGE\D\HDUZDUUDQW\DJDLQVW EUHDNDJH'LVKZDVKHUVDIH16)FHUWLILHG 0RGHO'HVFULSWLRQ %&', %RZOR]' 13', 1DUURZ5LP3ODWH 13', 1DUURZ5LP3ODWH 13', 1DUURZ5LP3ODWH 13', 1DUURZ5LP3ODWH 23', 2YDO3ODWWHU[ 23', 2YDO3ODWWHU[ 68', 6DXFHU 73', 7ULDQJOH3ODWH :3', :LGH5LP3ODWH :3', :LGH5LP3ODWH :3', :LGH5LP3ODWH 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

& 'LQLQJ6HUYLFH*XLGH 0RGHO'HVFULSWLRQ  )LWV3ODWHVWR  )LWV3ODWHVWR  )LWV3ODWHVWR  )LWV3ODWHVWR  )LWV3ODWHVWR  )LWV3ODWHVWR  )LWV3ODWHVWR  )LWV3ODWHVWR $GGLWLRQDOPRGHOVDUHDYDLODEOH

'&DPZHDU&DPFRYHUV 'HQWV GLQJV DQG EUHDNDJH EHFRPH D SUREOHP RI WKH SDVW ZKHQ \RX XVH &DPEUR¶V &DPZHDU &DPFRYHUV 6XSHU WRXJK OLJKWZHLJKW SRO\FDUERQDWH FRQVWUXFWLRQ LV XQHTXDOOHG LQ VWUHQJWK DQG GXUDELOLW\ )RRG VWD\V KRW DQG DSSHWL]LQJ ZLWKRXW SUHKHDWLQJ &DPZHDU &DPFRYHUV FDQ EH XVHG LQ KHDWHG FDUWV XS WR ƒ) 7KH\ DUH 16) OLVWHG DQG GLVKZDVKHU VDIH $YDLODEOH LQ &OHDU   6LOYHU   $PEHU  DQG%HLJH   0RGHO'HVFULSWLRQ &: [ &: [ &: [ &: [ &: [ &: [[ &: [ &: [ &: [ &: [ &: [ &: [ &: [

6XJJHVWHGVHUYLFHIRUSHRSOH1XPEHUVDUHSHUGR]HQ ',11(5:$5($%&'() &XSV 6DXFHUV       %RXLOORQ6XJDUV             3ODWHV       3ODWHV 3ODWHV             3ODWHV %RZOVR]       *UDSHIUXLWV       )UXLW6DXFHUV       7$%/(:$5( 7HDVSRRQV 6RXS'HVVHUW6SRRQV 7DEOHVSRRQV ,FHG7HD6SRRQV &RIIHH6SRRQV $'

%RXLOORQ6SRRQV )RUNV 6DODG)RUNV &RFNWDLO)RUNV 'LQQHU.QLIH %XWWHU.QLIH .QLIH6WHHO

           

           

           

           

           

           

*/$66:$5( 7XPEOHUV -XLFH ,FHG7HD 0LON

   

   

   

   

   

   

$ +RWHOVDQG5HVWDXUDQWV% &RIIHH6KRSV& &DIHWHULDV ' &DWHUHUVIRU&OXEV&KXUFKHV( +RVSLWDOVDQG1XUVLQJ+RPHV ) 6FKRROVDQG&ROOHJHV


'LQLQJ_

$ $'DOODV:DUHŠ 'LQQHUZDUH 7KH RULJLQDO LQGXVWU\ VWDQGDUG IRU PHODPLQH GLQQHUZDUH 'HSHQGDELOLW\ TXDOLW\ DQG GXUDELOLW\ KDYH EHHQ WKH 'DOODV :DUHŠ WUDGHPDUN IRU RYHU ILIW\ \HDUV 2IIHUV VXSHULRU VWDLQ DQG VFUDWFK UHVLVWDQFH 5HGXFH EUHDNDJH DQG UHSODFHPHQWV ZLWK WKH 'DOODV :DUHŠ UHLQIRUFHG ULP DQG IRRW GHVLJQ 6DIH IRU WHPSHUDWXUHV XS WR ƒ) 'LVKZDVKHU VDIH 16)  $YDLODEOH LQ WHQFRORUV

0RGHO'HVFULSWLRQ  'LQQHU3ODWH  'LQQHU3ODWH  6DODG3ODWH  %UHDG %XWWHU3ODWH  &RPSDUWPHQW3ODWH  &RPSDUWPHQW3ODWH'HHS  1DSSLH%RZOR]  )UXLW%RZO R]  6WDFNLQJ&XSR]  [2YDO3ODWWHU  R]6WDFNLQJ&XS  [2YDO3ODWWHU $GGLWLRQDOPRGHOVDUHDYDLODEOH

%

%3DOHWWHŒ'HVLJQHU'LVSOD\ZDUHŒ (QMR\ WKH ORRN DQG IHHO RI FKLQD ZLWKRXW WKH UHSODFH PHQWFRVW(LJKWQHZSDWWHUQVKDYHEHHQDGGHGWRWKH 3DOHWWH 'HVLJQHU 'LVSOD\ZDUH OLQH )URP PRGHUQ WR FODVVLF VW\OHV²FKRRVH RQH WR SRUWUD\ WKH ORRN \RX ZDQW 'HVLJQHU SDWWHUQV DUH FRRUGLQDWHG WR FRPSOHPHQW PDQ\ RI WKH 3DOHWWH VROLG FRORUV DQG DUHDVPDUWZD\WRFKDQJHWKHORRNRI\RXUGLVSOD\ZLWK MXVW D IHZ QHZ GHFRUDWHG SLHFHV +LJK TXDOLW\ KHDY\ZHLJKW PHODPLQH LV OLJKWHU WKDQ FRPSDUDEOH FHUDPLFRUHQDPHOSLHFHV%UHDNUHVLVWDQWFRQVWUXFWLRQ UHGXFHV WKH FRVW DQG ULVNV DVVRFLDWHG ZLWK EURNHQ FHUDPLF 6DIH IRU WHPSHUDWXUHV XS WR ƒ) &'D\WRQ'LQQHUZDUH 'LVKZDVKHUVDIH16) 7KLV QHZ PHODPLQH GLQQHUZDUH LV PDGH 0RGHO'HVFULSWLRQ IURP  VXVWDLQDEOH QDWXUDO UHVRXUFHV  :56TXDUH3ODWH ZKLFK DUH ELRGHJUDGDEOH 'LQQHUZDUH LV  :56TXDUH%RZO VWDLQ VFUDWFK DQG EUHDNUHVLVWDQW 6DPH  :55RXQG3ODWWHU UHLQIRUFHG ULP DQG IRRW GHVLJQ DV 'DOODV  :55RXQG3ODWWHU Š :DUH 'LQQHUZDUH 0HHWV 36 VSHFLIL  [:52YDO3ODWWHU FDWLRQV 6DIH IRU WHPSHUDWXUHV XS WR ƒ)  [:52YDO3ODWWHU 16)OLVWHGDQGGLVKZDVKHUVDIH$YDLODEOHLQ  [:55HFWDQJOH3ODWWHU & %DYDULDQ &UHDP %ODFN +RQH\ <HOORZ  [:55HFWDQJOH3ODWWHU 2DWPHDO 3HSSHUFRUQ 5HG 7RIIHH 7UXIIOH  :56DOPRQ3ODWWHU 7XUTXRLVH:DVDEL  :5'LQQHU3ODWH $GGLWLRQDOPRGHOVDUHDYDLODEOH 0RGHO'HVFULSWLRQ  'LQQHU3ODWH  'LQQHU3ODWH 'LQQHUZDUH'XUDELOLW\  6DODG3ODWH %UHDG %XWWHU3ODWH   7\SLFDOO\ WKH KLJKHU WKH ZHLJKW RI WKH  1DSSLH%RZOR] GLQQHUZDUHWKHPRUHGXUDEOHLWZLOOEH%XW  5LP1DSSLH%RZOR] FRQVLGHUDWLRQ VKRXOG DOVR EH JLYHQ WR \RXU  1DSSLH%RZOR] ( ZDLWVWDII  *UDSHIUXLW%RZOR]  )UXLW%RZO R] +RZPXFKFDQEHFDUULHGRQRQHWUD\"+RZ  %RXLOORQ&XSR] IDUZLOOWKHWUD\VEHFDUULHG"  6WDFNLQJ&XSR]  [2YDO3ODWWHU )LQG D ZHLJKW WKDW SURYLGHV WKH ORRN \RX

ZDQWDQGLVFRPIRUWDEOHIRU\RXUHPSOR\HHV

''LQHWŠ 5HXVDEOH'LVKZDUH (QKDQFH\RXUSDWLHQWWUD\ZLWKWKHQHZ'LQHW&KLQD$YDLODEOHLQD HQWUpHSODWHEUHDGGHVVHUWSODWHDQGR]IUXLWGLVK'LQHW &KLQDSLHFHVDUHHOHJDQWO\HPERVVHGLQLYRU\FRORU8VHZLWKWKH QHZ WXOLS FXS DQG WXOLS ERZO ZLWK GLVSRVDEOH GRPH OLGV 0DGH RI VWXUG\ FU\VWDO FOHDU SODVWLF LQ D GHFRUDWLYH FRQWHPSRUDU\ VW\OH WR DFFHQWWKHSDWLHQWWUD\ 0RGHO'HVFULSWLRQ ';&%3% &KLQD'HVVHUW3ODWH ';&)1% &KLQD)UXLW%RZO R] ';&( &KLQD3ODWH ';&3 &KLQD3ODWH '; 'LVSRVDEOH'RPH/LG ';6:& 7XOLS&XS 6ZLUO R] '; 7UDQVOXFHQW/LG )LWV7XOLS&XSR]

6:& 7XOLS%RZO 6ZLUO R] '; 7UDQVOXFHQW/LG )LWV7XOLS%RZOR]

'

(6LHUUXV'LQQHUZDUH $OOSXUSRVHPHGLXPKHDY\ZHLJKWGLQQHUZDUH ZLWK WKH VDPH GHVLJQ DV 'XUXVŠ 6LHUUXV KDV D WZR\HDU ZDUUDQW\ DJDLQVW EUHDNDJH 'LVKZDVKHU VDIH EUHDNUHVLVWDQW GLQQHUZDUH LV VDIH IRU WHPSHUDWXUHV XS WR ƒ) 16) /LVWHG  &RORUV :KLWH   %RQH   6XQVHW 2UDQJH   +RQH\ <HOORZ   0HDGRZ *UHHQ  2FHDQ%OXH   0RGHO'HVFULSWLRQ  'LQQHU3ODWH  'LQQHU3ODWH  6DODG3ODWH  'LQQHU3ODWH  R]5LPPHG%RZO  R]3DVWD6RXS6DODG%RZO  R]5LPPHG%RZO  [2YDO3ODWWHU  [2YDO3ODWWHU $GGLWLRQDOPRGHOVDUHDYDLODEOH


'LQLQJ_

$ % % 3RUFHODLQ 6DOW  3HSSHU 6KDNHUV *LYH D QHZ ORRN WR \RXU VHWWLQJ ZLWKWKHVHXQLTXHO\VKDSHGVW\OLVK SRUFHODLQVDOWDQGSHSSHUVKDNHUV $ PXVW KDYH IRU WKH FUHDWLYH PHPRUDEOHWDEOHWRS 0RGHO'HVFULSWLRQ  6TXDUH6HWR]  7RZHU6HWR]

$$UWLVDQ%DVNHWV %UHDGVWLFN+ROGHU $GGWKDWH[WUDWRXFKRIHOHJDQFHWRDQ\WDEOHVHWWLQJ %ODFN SRZGHUHG FRDWHG PHWDO LQ D YDULHW\ RI VL]HV 0RGHOV %. %. %. %. %. %.DQG%.VKRZQ 0RGHO'HVFULSWLRQ %. 2EORQJ%VNW[[ %. 6ZLUO%UHDGVWLFN+ROGHU %. 5HFWDQJOH[[ %. 5HFWDQJOH[[ %. 2YDO%VNW[[ %. 2YDO%VNW[[ %. 5RXQG%DVNHW[ %. 5RXQG%DVNHW[ %. 5RXQG%DVNHW[ %. $SSHWL]HU&RQH[ %. $SSHWL]HU&RQH[ %. 6XJDU3DFNHW+ROGHU[[ %. $SSHWL]HU&RQH[ %. $SSHWL]HU&RQH[ %. 5RXQG6XJDU3DFNHW+ROGHU[

&9HUWLJR&ROOHFWLRQ $GGDELWRIIXQWR\RXUWDEOHWRSZLWKEODFNPHWDO DSSHWL]HU FRQHV  7KHVH FRQH VKDSHG VHUYHUV FRPH LQ D YDULHW\ RI VL]HV  $YDLODEOH ZLWK RU ZLWKRXW UDPHNLQ DWWDFKPHQWV IRU FUHDWLYH ZD\V WR VHUYH DOO \RXU IDYRULWH DSSHWL]HUV  &RQH SDSHUDQGOLQHUVDYDLODEOH 0RGHO'HVFULSWLRQ $&3 ['EO2SHQLQJ%DJVIRU&RQHV $&3 /LQHUVIRU&RQHV $&5 [%ODFN&RQHZUDPHNLQV $&5 [%ODFN&RQHZUDPHNLQ $&5 [%ODFN&RQHZUDPHNLQ $& [%ODFN&RQH $& [%ODFN&RQH $& [%ODFN&RQH $& [%ODFN&RQH

&

'

'9HUVD5DFNŒ5DFNV 0HGLWHUUDQHDQ&ROOHFWLRQ 7KH LGHDO VROXWLRQ IRU RUJDQL]LQJ DQG PHUFKDQ GLVLQJ\RXUWDEOHWRSV7KH9HUVD5DFNŒZLWKLWV EODFNSRZGHUFRDWHGPHWDO0HGLWHUUDQHDQVW\OH LVDYDLODEOHLQIXOORUKDOIUDFNVZLWKFOLSVWRKROG PHQXV RU SURPRWLRQDO FDUGV $YDLODEOH LQ DQ DUUD\RIVL]HV0RGHO%.VKRZQ 0RGHO'HVFULSWLRQ %. %ODFN0HGLXP5RXQG %. %ODFN6PDOO+DOI%DFN)URQW %. %ODFN0HGLXP5RXQG %. %ODFN/DUJH+DOI%DFN)URQW %. %ODFN0HGLXP5RXQG

( (0HODPLQH5DPHNLQV *HVVQHU SURGXFHV WKH PRVW H[WHQVLYH OLQH RI PHODPLQH DQG 6$1 UDPHNLQV LQ WKH IRRGVHUYLFH LQGXVWU\ 7KHVH UDPHNLQV KDYH WKH GLVWLQFW ORRN DQG IHHO RI FHUDPLF SRUFHODLQ DQG JODVV EXW WKH\ DUH PDGH WRXJK 5HGXFHG FKLSSLQJ DQG EUHDNDJH ORZHUV \RXU UHSODFHPHQW FRVWV PDNLQJ WKHP WKH EHVW ORQJWHUP LQYHVWPHQW 'LVKZDVKHUVDIH PLFURZDYHVDIH 6$1 RQO\  VWDFNDEOH IRU VLPSOH DQG HIILFLHQW VWRUDJH YHUVDWLOH VKDSHV VL]HV DQG FRORUV WR FRPSOHPHQW DQ\ VHWWLQJ DQG D ³JUHHQ´ DOWHUQDWLYHWRGLVSRVDEOHV 0RGHO'HVFULSWLRQ  0ROFDMHWH%RZOR]  &RQWHPSRUDU\5DPHNLQR]  6PRRWK6LGHG5DPHNLQ R]  )ODUHG6TXDUH'LVKR] $ )OXWHG5DPHNLQR] &/ 6WDFN%RZO R] $GGLWLRQDOPRGHOVDYDLODEOH

)

)$XWKHQWLF&ROOHFWLRQΠ7KLV GLVWLQFWLYH FROOHFWLRQ RI RLO DQG YLQHJDU ERWWOHV DQG PDWFKLQJ VDOW DQG SHSSHU VKDNHUV LV VXUH WR VKDNH XS \RXU WDEOHWRS ZLWK WKDW DXWKHQWLF ORRN RI UHF\FOHG JUHHQ JODVV DQG VWDLQOHVV VWHHO WRSV 0RGHO'HVFULSWLRQ  6KDNHUVR]  2LO 9LQHJDU'LVSHQVHUR]

*6WDLQOHVV6WHHO)U\&XSV 6HUYH VR PXFK PRUH WKDQ IULHV 7KHVH VWDLQOHVV VWHHO IU\ FXSV OHDYH D ODVWLQJ LPSUHVVLRQ 7KH  GLDPHWHU [     + IU\ FXS LV DYDLODEOH LQ VDWLQ KDPPHUHGDQGVPRRWKVDWLQILQLVK 0RGHO'HVFULSWLRQ ))+0 6DWLQ+DPPHUHG)LQLVK ))& 6PRRWK6DWLQ)LQLVK

*


'LQLQJ_

$

&

$6KDNHUV 3RXUHUV 6KDNHWKLQJVXSZLWKVKDNHUVDQGSRXUHUVIURP7DEOH&UDIW:KHWKHU\RXU VW\OH LV WUDGLWLRQDO RU DYDQWJDUGH DQG FRQWHPSRUDU\ WKH XQLTXH DQJOHV DQG FXUYHV RI 7DEOH&UDIW¶V SLHFHV DUH VXUH WR PHHW DOO RI \RXU WDEOHWRS QHHGV&KRRVHJODVVRUSRO\FDUERQDWHLQRUR]FDSDFLWLHV % 0RGHO'HVFULSWLRQ  6ZLUO*ODVV6KDNHU3HUIRUDWHG&KURPH3ODWHG7RSR] 6/ 6ZLUO*ODVV6KDNHU6ORWWHG667RSR] 6 )OXWHG*ODVV3RXUHU6LGH)ODS667RSR] 6 )OXWHG*ODVV3RXUHU&HQWHU+ROH667RSR] ;6/ 7HDUGURS*ODVV6KDNHU6ORWWHG&KURPH3ODWHG7RSR]  0RGHUQ*ODVV6KDNHU3HUIRUDWHG&KURPH3ODWHG7RSR] 3 )OXWHG3RO\FDUERQDWH6KDNHU3HUIRUDWHG667RSR] $GGLWLRQDOPRGHOVDYDLODEOH %3ODVWLF7RSVIRU6KDNHUV 3RXUHUV *UHDW IRU WDEOHWRS FRQGLPHQWV VXFK DV JUDWHG FKHHVHVRUYDULRXVVSLFHV&DQEHXVHGLQKLJK &3HSSHU0LOOV6DOW6KDNHU6HWV KXPLGLW\QRUXVWRUFRUURVLRQ'LVKZDVKHUVDIH &KHI 6SHFLDOWLHV FROOHFWLRQ RI SHSSHU PLOOV DQG VDOW &KRRVH SHUIRUDWHG RU VORWWHG LQ EODFN UHG VKDNHU VHWV RIIHU FODVVLF HOHJDQFH WR DQ\ WDEOH &UDIWHG JUHHQ ZKLWH JUD\ DQG FKURPH 8VH ZLWK DQ\ WR ZLWKVWDQG FRPPHUFLDO XVH WKH JULQGLQJ PHFKDQLVP 7DEOH&UDIWRUR]VKDNHUSRXUHU6KLSSHG DGMXVW IURP YHU\ ILQH WR YHU\ FRDUVH SHSSHU RQHGR]HQSHUSRO\EDJZLWKKHDGHUFDUG 3URIHVVLRQDO 6HULHV SHSSHU PLOOV DUH ILWWHG ZLWK RXU 0RGHO'HVFULSWLRQ 3HQQV\OYDQLD VWDLQOHVV VWHHO JULQGLQJ PHFKDQLVP &6/7*5 6ORWWHG7RS IRURUR] *UHHQ +RPH&RRNLQ¶ 6HULHV PLOOV DUH FRQVWUXFWHG ZLWK JULQG &75( 3HUIRUDWHG7RS IRURUR] 5HG FHUDPLF PHFKDQLVPV /LIHWLPH ZDUUDQW\ RQ JULQGLQJ &6/7%. 6ORWWHG7RS RUR] %ODFN PHFKDQLVPV &7%. 3HUIRUDWHG7RS RUR] %ODFN 0RGHO'HVFULSWLRQ &7%. 3HUIRUDWHG7RS R] %ODFN  ,PSHULDO3URIHVVLRQDOŒ:DOQXW3HSSHU0LOO &7&+ 3HUIRUDWHG7RS R]   )XWXUD3URIHVVLRQDOŒ30606WDLQOHVV6HW &KURPH3ODWHG  /DXUHO$FU\OLF3HSSHU0LOO6DOW6KDNHU6HW $GGLWLRQDOPRGHOVDYDLODEOH  3URIHVVLRQDOŒ:DOQXW30666HW6HULHV  6DOHP3URIHVVLRQDOŒ(ERQ\3HSSHU0LOO  6DOW6KDNHU6HW  3XHEOR3URIHVVLRQDOŒ3HSSHU0LOO  3UHVLGHQW3URIHVVLRQDOŒ1DWXUDO3HSSHU0LOO  0HWUR+RPH&RRNLQ¶30606HW

*URXQG3HSSHU )RU EHWWHU IODYRU DOZD\V XVH IUHVKO\ JURXQG SHSSHU 7KHIODYRUFRPHV IURPWKHRLOVRIWKHVOLFHGSHSSHUFRUQV7KHUHDUHWKUHHEDVLFW\SHVRI SHSSHUEODFNZKLWHDQGJUHHQ%ODFNLVWKHVWURQJHVW VOLJKWO\KRWZLWK DKLQWRIVZHHWQHVV IODYRURIWKHWKUHH:KLWHSHSSHUFRUQVDUHVPDOOHU KDYH D VPRRWKHU VNLQ DQG D OLJKWWDQ FRORU ZLWK D PLOGHU IODYRU 7KH JUHHQSHSSHUFRUQLVWKHVRIWXQGHUULSHEHUU\WKDWLVXVXDOO\SUHVHUYHG LQ EULQH ,W KDV D IUHVK IODYRU WKDW LV OHVV SXQJHQW WKDQ WKH EHUU\ LQ LWV RWKHUIRUPV 6WRUHZKROHLQDFRROGDUNSODFHIRUDERXWD\HDU*URXQGSHSSHUZLOO NHHS LWV IODYRU IRU DERXW IRXU PRQWKV *UHHQ SHSSHUFRUQV SDFNHG LQ EULQHVKRXOGEHUHIULJHUDWHGRQFHRSHQHGDQGZLOONHHSIRURQHPRQWK SDFNHGLQZDWHUZLOONHHSIRUDZHHN

'

'  0U 'XGOH\ 3HSSHU 0LOOV 6DOW *ULQGHUV 6DOW6KDNHUV 7UXVWHG IRU RYHU  \HDUV 0U 'XGOH\ ZRRG DQG DFU\OLF SHSSHU PLOOV KDYH HQMR\HG ZLGH DFFHSWDQFH IURP FRQVXPHUV DQG UHVWDXUDWHXUV DOLNH &KRRVH IURP D YDULHW\ RI FRPSHWLWLYHO\ SULFHG SURGXFWV DYDLODEOH LQ FOHDU DFU\OLF DQG WKUHH ZRRG ILQLVKHV PDWWH EODFN QDWXUDO ZDOQXW  0RGHO'HVFULSWLRQ 0U' 7HPSR&RPER3HSSHUPLOO 6DOW6KDNHU 0U'&630% 0DWWH%ODFN3HSSHUPLOO 0U';;60% 0DWWH%ODFN6DOW6KDNHU 0U'&63: :DOQXW3HSSHUPLOO 0U'&630% 0DWWH%ODFN3HSSHUPLOO 0U'&631 1DWXUDO3HSSHUPLOO 0U'&63: :DOQXW3HSSHUPLOO $GGLWLRQDOPRGHOVDYDLODEOH

(GCVWTGF%JGH &KHI$OH[(DWRQ 7KH0DQVKLS:RRG)LUHG.LWFKHQ -DFNVRQ 06 &KDUOHVWRQ5HG5LFH òFXSEDFRQIDW FXSVDQGRXOOLHVDXVDJHGLFHG TWFKRSSHGRQLRQ WEVSWK\PH TWJUHHQEHOOSHSSHU HDIUHVKFKLOL  WEVSFUXVKHGUHGSHSSHUIODNHV  FXSIUHVKJDUOLF WEVSVDOW  WEVSSHSSHU òFXSWRPDWRSDVWH òTWWRPDWRHV FDQQHG6DQ0DU]DQR

TWVWRFN TWULFH HDED\OHDI 6DXWpVDXVDJHDQGRQLRQLQEDFRQIDW$GGWK\PHJUHHQEHOO SHSSHUV FKLOOL DQG UHG SHSSHU 6WLU LQ JDUOLF VDOW SHSSHU WRPDWRSDVWHDQGWRPDWRHV$GGVWRFNDQGED\OHDIDQGEULQJ WRDVLPPHU$GGULFHFRYHUDQGEDNHDWƒ)IRUPLQXWHV


'LQLQJ_ $/RXLV7XPEOHUV $WWUDFWLYH /RXLV 7XPEOHUV KDYH DQ H[WUD WKLFNEDVHWKDWPLPLFVWKHORRNRIJODVVDQG D IDFHWHG ERG\ VKDSH WKDW PDNHV WKH WXPEOHUVHDVLHUWRKROG7KHH[WHULRUGHVLJQ GRXEOHV DV D VWDFNLQJ OXJ HOLPLQDWLQJ WKH QHHG IRU LQWHULRU OXJV $YDLODEOH LQ VHYHQ VL]HV LQFOXGLQJ  R] DQG  R] 2OG )DVKLRQ²GHVLJQHG IRU KHDOWKFDUH WUD\ EDU RU URRP VHUYLFH  /RXLV 7XPEOHUV DUH FKLS VKDWWHU DQG EUHDNUHVLVWDQW 'LVKZDVKHUVDIH&RORU&OHDU  

0RGHO'HVFULSWLRQ  R]  R]  R]  R]  R]  R]  R]

%

$

%6WDFNDEOH7XPEOHUV 7KHVHVWDFNDEOHWXPEOHUVDUHLGHDOIRUKLJKYROXPHLQVWLWXWLRQV VXFK DV VFKRROV KRVSLWDOV FDIHWHULDV DQG SULVRQV 'XUDEOH 6$1UHGXFHVEUHDNDJH7DSHUHGVLGHVPDNHWXPEOHUVHDV\WR VWDFN DQG SXOO DSDUW 7H[WXUHG H[WHULRU KLGHV ZHDU DQG WHDU 6WDFNLQJ OXJV LQVLGH SUHYHQW MDPPLQJ ZKHQ VWRUHG $YDLODEOH LQ$PEHU%OXH5R\DO%OXH5XE\DQG&OHDU 0RGHO'HVFULSWLRQ  R]  R]  R]   R]  R]  R]  R]  R]  R]7DOO  R]

& &$OLEL'ULQNZDUH 8SGDWH\RXUEDUZDUHSUHVHQWDWLRQZLWKWKHVRSKLVWLFDWHG VW\OLQJRI$OLEL*UHDWIRURXWGRRUDQGSRROVLGHEHYHUDJH VHUYLFH%DUZDUHLVOLJKWZHLJKW\HWGXUDEOH6$1DQGLV FKLS VKDWWHU DQG EUHDNUHVLVWDQW 7KH WKLFN EDVH PLPLFV JODVVZDUH 7KH VWHPZDUH LV VKDWWHUSURRI SRO\ FDUERQDWHRQHSLHFHFRQVWUXFWHGDQGKDVWKHFODULW\RI JODVV'LVKZDVKHUVDIH&RORU&OHDU   0RGHO'HVFULSWLRQ  6KRRWHU0LQL'HVVHUWR]  5RFNV-XLFHR]  'RXEOH)DVKLRQHGR]  %HYHUDJHR]  %DOORRQ  5HG:LQH  :KLWH:LQH  &KDPSDJQH)OXWHR]  0DUWLQLR] $GGLWLRQDOPRGHOVDYDLODEOH

'

'6ZLUO3RO\FDUERQDWH7XPEOHUV 8QLTXHVZLUOGHVLJQFUHDWHVDSHUIHFWJODVVOLNHWDEOHWRSEHYHUDJHSUHVHQWDWLRQ (QKDQFHG RXQFH PDUNLQJV ORFDWHG GLVFUHHWO\ RQ 6ZLUO 7XPEOHUV DOORZ IRU DFFXUDWH UHFRUGLQJ RI IOXLG LQWDNH E\ GLHWLWLDQV DQG QXUVLQJ VWDII 6KDWWHUSURRI SRO\FDUERQDWHGULQNZDUHLVWKHLGHDODOWHUQDWLYHWRJODVVDQ\ZKHUHEUHDNDJHLV DFRQFHUQ'LVKZDVKHUVDIH$YDLODEOHLQVL]HV 0RGHO'HVFULSWLRQ ';*& R] ';*& R] ';*& R]

( (%DKDPD7XPEOHUV 4XHQFK \RXU WKLUVW ZLWK WKHVH UHIUHVKLQJ WXPEOHUV0DGHRI6$1²EUHDNUHVLVWDQW SODVWLF PDWHULDO 'LVKZDVKHU VDIH $YDLODEOH LQ  FRORUV 5HG &OHDU -DGH DQG%OXH 0RGHO'HVFULSWLRQ  R]5RFN  R]5RFN  R]'RXEOH5RFN  R]%HYHUDJH  R]%HYHUDJH  R]&RROHU   R]5RFN

)

5RF1¶5ROOŒ /Œ

,ULVK&RIIHH0XJ 7DKLWLŒ7XPEOHUV

5RF1¶5ROOŒ 6WHPOHVV:LQH

)3ODVWLF'ULQNZDUH :H¶YH JRW ERWK HQGV RI WKH VSHFWUXP FRYHUHG²IURP WKH VRSKLVWLFDWHG 6$1 SODVWLF EDUZDUH WR WKH GXUDEOH OLQH RI WXPEOHUV IRU \RXU HYHU\GD\ QHHGV *(7¶V GULQNZDUH LV VR EHDXWLIXO WKDW \RX¶OO JDVS LI \RX GURS RQH 7KDW LV XQWLO \RX UHPHPEHU WKH\¶UH EUHDNUHVLVWDQW $OO EDUZDUH DYDLODEOH LQ FOHDUFRORUVDYDLODEOHRQVHOHFWEDUZDUH&XVWRPLPSULQWLQJ DOVRDYDLODEOH0RVW*(7GULQNZDUHLV16)FHUWLILHG 0RGHO'HVFULSWLRQ 6:&/ /5RFNVR] 6: 5RF1¶5ROO-XLFHR] 6:6$1 5RF1¶5ROO5RFNVR] 6: 5RF1¶5ROO%HYHUDJHR] 6:6$1 5RF1¶5ROO%HYHUDJHR]  7DKLWL7XPEOHUR]  7DKLWL7XPEOHUR]  7DKLWL7XPEOHUR]  7DKLWL7XPEOHUR] 6:&/ ,ULVK&RIIHH0XJZ+DQGOHR] 6: 5RF1¶5ROO6WHPOHVV:LQH*ODVVR] 6: 5RF1¶5ROO6WHPOHVV:LQH*ODVVR] $GGLWLRQDOPRGHOVDYDLODEOH


'LQLQJ_ $&ODULVVH &RQWHPSRUDU\ EHYHOHG VW\OLQJ HQKDQFHV WKH DSSHDUDQFH RI DQ\ EHYHUDJH 'XUDELOLW\ ZLWK D VW FHQWXU\ ORRN 5LPWHPSHUHG 1HZ VWDFNDEOHV DYDLODEOH² R] 5RFNV  R] '2)  R] %HYHUDJHDQGR]&RROHU 0RGHO'HVFULSWLRQ 5 R]5RFNV  R]+L%DOO 8 R]%HHU7DQNDUG 8 R]%HHU7DQNDUG 6WDFNDEOH  R]5RFNV  R]'2)  R]%HYHUDJH  R]&RROHU 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

$

%

'*UDQG:LQH&ROOHFWLRQ $PSOH ERZOV DQG ILQHO\ FUDIWHG VWHPV OHQG DQHOHJDQWORRNWR\RXUGLQLQJSUHVHQWDWLRQ 7KLV VLPSOH \HW VRSKLVWLFDWHG VWHPZDUH KDVWLPHOHVVDSSHDOWKDWZLOOFRPSOHPHQWD ZLGHUDQJHRIVHWWLQJV 0RGHO'HVFULSWLRQ  5HG R]  $OO3XUSRVHR]  5HG R]  %RUGHDX[R]

&

&1HZ2UOHDQV%DUZDUH 7KHPRVWSRSXODUEDUZDUHVW\OH&RPSHWLWLYHO\ SULFHG5LPWHPSHUHG 0RGHO'HVFULSWLRQ  5RFNVR]  5RFNVR]  5RFNVR]  5RFNVR]  5RFNV R]  'RXEOH5RFNVR] 8 +L%DOOR] 8 %HYHUDJHR] 8 %HYHUDJHR] 8 ,FHG7HDR]  ,FHG7HDR] 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

) )3LWFKHUV 7XPEOHUV &DPEURWXPEOHUVDQGSLWFKHUVKDYHWKHORRNDQGIHHORI JODVV EXW RIIHU FRVW VDYLQJV DQG OLJKWZHLJKW KDQGOLQJ 3LWFKHUVKDYHH[FOXVLYHWKXPEJULSDQGFRQWRXUHGLFHOLS 0RGHO'HVFULSWLRQ 17 1HZSRUW7XPEOHU17R] 17 1HZSRUW7XPEOHU17R] /7 /DJXQD7XPEOHUR] /7 /DJXQD7XPEOHUR] 3/&: /DJXQD3LWFKHUR] ' 'HO0DU7XPEOHU'0R] +7&: +XQWLQJWRQ7XPEOHUR] +

+7&: +XQWLQJWRQ7XPEOHUR] +

3&: &DPZHDU3LWFKHUR] 3&&: &DPZHDU3LWFKHU&RYHUHGR] $GGLWLRQDOPRGHOVDYDLODEOH

%0L[¶Q6HUYH*ODVVHV )XQFWLRQDO FODVVLF GHVLJQ &RPSHWLWLYHO\ SULFHG 5LP WHPSHUHG IRU GXUDELOLW\ RU XQWHPSHUHGIRUPD[LPXPYDOXH 0RGHO'HVFULSWLRQ )8 R] 8QWHPSHUHG

)8 R]  R]  R]  R]

(

'

(1DGLQH 6LPSOH9HUVDWLOH7LPHOHVV1DGLQH¶VGHILQLQJ IHDWXUH LV WKH H[FHSWLRQDOO\ VPRRWK OLQN EHWZHHQ WKH ERZO DQG VWHP FUHDWLQJ D VHDPOHVV IUHHIORZLQJ ORRN 7KLV UHVWDXUDQW TXDOLW\ FU\VWDO LV DOVR VDOXWHG IRU LWV VXSHULRU GXUDELOLW\ EULOOLDQFH DQG FODULW\  0L[ DQG PDWFK WKLV DOOSXUSRVH VWHPZDUH ZLWK WKH &OHUPRQWOLQHRIWXPEOHUV 0RGHO'HVFULSWLRQ $ %XUJXQG\R] $ *REOHWR] $ :LQH R] $ )OXWH R] $ ,FHG%HYHUDJH R] $ 5RXQG%XUJXQG\ R] $ 0DUWLQL R]

*$QJHOLQD 7DOO 7DSHUHG 7DVWHIXO $QJHOLQD¶V DPSOH ERZOV DQG ILQHO\ FUDIWHG VWHPV OHQG DQ HOHJDQW ORRN WR \RXU GLQLQJ SUHVHQWDWLRQ 7KLV VLPSOH \HW VRSKLVWLFDWHG VWHPZDUH KDV WLPHOHVV DSSHDO WKDW ZLOO FRPSOHPHQW D ZLGH UDQJH RI VHWWLQJV 6PRRWK IOH[LEOH DQG VWDEOH 7RS HGJHV DUH ODVHUFXW )LUH SROLVKLQJ IRU DGGLWLRQDO VWUHQJWK 6XSHULRU VWDELOLW\DQGGXUDELOLW\ 0RGHO'HVFULSWLRQ $ %XUJXQG\ R] $ %RUGHDX[ R] $ :LQH R] $ )OXWH R] $ *REOHW R] $ ,FHG%HYHUDJH R] $ 5RXQG%XUJXQG\ R] $ 0DUWLQL R]

*


'LQLQJ_ &KRRVLQJ*ODVVZDUH 7KHVL]HVVKDSHVDQGVW\OHVRIJODVV\RXFKRRVHZLOODIIHFW \RXU HQWLUH SUHVHQWDWLRQ RI EHYHUDJHV &RQVLGHU ZKDW W\SHRIGULQN\RXZLOOEHVHUYLQJPRVWDQGILQGDW\SHRI JODVV WR FRPSOHPHQW $VN \RXUVHOI ZLOO D ORW RI LFH EH XVHG":LOOWKHGULQNEHJDUQLVKHG":LOOOLTXRUEHVHUYHG WKDWQHHGVWREHSRUWLRQFRQWUROOHG" 'HWHUPLQHWKHDPRXQWRIRXQFHV\RXUGULQNZLOOEHSHU SRUWLRQ EDVHG RQ SULFH DQG SURILW $VN XV WR VKRZ \RX KRZ WKRVH RXQFHV ZLOO ORRN SUHVHQWHG LQ D YDULHW\ RI JODVVZDUH

8VLQJ*ODVVWR$FFHQWXDWH &RQVLGHU XVLQJ JODVVZDUH WR DFFHQWXDWH ,W FDQ DGG D VSHFLDOWRXFKWKDWVD\VHOHJDQFH8VHJODVVSODWHVDORQHRU ZLWKDFKDUJHUSODWHIRUDQHQWLUHO\GLIIHUHQWORRN6DODGV DSSHDUFULVSHUDQGORRNOLJKWHUZKHQVHUYHGLQJODVV

*ODVVZDUH&DUH

$([FDOLEXU6WHPZDUH 7KLV IXOO\ WHPSHUHG JODVVZDUH ODVWV  WLPHV ORQJHU WKDQ UHJXODU DQQHDOHG JODVVZDUH 7KH ([FDOLEXU OLQH RIIHUV  IXOO\ WHPSHUHG LWHPV IURP VWHPV WR FRFNWDLOV WR WXPEOHUV GHVLJQHG ZLWKH[WUDVWUHQJWKDJDLQVWEUHDNDJH 0RGHO'HVFULSWLRQ  R]*UDQG%DOORQ  R]$OO3XUSRVH   R]%DQTXHW  R]%UDQG\  R]*UDQG6DYRLH  R]*UDQG&XYHH   R]%DOORQ:LQH   R]*REOHW   R]7DOO:LQH   R])OXWH  R])RRWHG+L%DOO  R]3HWLWH&XYHH 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

7R NHHS \RXU JODVVZDUH LQ JUHDW VKDSH DYRLG JODVVRQ JODVVFRQWDFW'RQRWVWDFN\RXUJODVVZDUHRUFDUU\WKHP LQERXTXHWV:KHQEXVVLQJWDEOHVXVHDJODVVUDFNVRWKDW HDFK JODVV KDV LWV RZQ FRPSDUWPHQW 7KLV ZLOO JLYH \RXU JODVVZDUHDORQJHUOLIH

*ODVVZDUH'XUDELOLW\ 7KLFNHUJODVVZLWKDEHDGHGRUUROOHGULPLVOHVVOLNHO\WR EUHDN+HDWHGWUHDWHGJODVVLVDOVRPRUHGXUDEOH6WUDLJKW HGJHGJODVVHVDUHOHVVOLNHO\WREUHDNWKDQFXUY\RUIODUHG JODVVHV

*ODVV%DFNXS +DYH DQ DGHTXDWH EDFNXS VXSSO\ RI JODVVHV IRU UXVK SHULRGV 7R DYRLG WKHUPDO VKRFN QHYHU SODFH UHFHQWO\ ZDVKHG JODVVHV LQWR VHUYLFH /HW JODVVHV VWDQG ORQJ HQRXJKWRUHDFKURRPWHPSHUDWXUH

%

& &6HQVDWLRQ6WHPZDUH $ FROOHFWLRQ RI ILQH PLFURULP VWHPZDUH SHUIHFWO\ SURSRUWLRQHG ZLWK WKH H[FHOOHQW FRORU DQG FODULW\ RI .ZDU[Š PDWHULDO 7KLV LGHDOFRPELQDWLRQRIDHVWKHWLFVDQGOX[XU\ LVDYDLODEOHLQDZLGHUDQJHRIVL]HVVXLWLQJ ERWWOHVHUYLFHRUZLQHVE\WKHJODVV 0RGHO'HVFULSWLRQ  )OXWH R]  7DOO:LQH R]  7DOO:LQHR]  *REOHW R]  :LQH R]  :LQHR]

'

$

%&DEHUQHW6WHPZDUH &DEHUQHW KDV WKH TXDOLW\ RI ILQH FU\VWDO ZLWK H[FHOOHQW FRORU FODULW\ DQG D ILQH EHDGOHVV PLFURULP ,W FRPSDUHV ZLWK VWHPZDUH DW WZLFH WKH SULFH 0DGH RI .ZDU[Š PDWHULDO &DEHUQHW LV VXUSULVLQJO\DIIRUGDEOH²DJUHDWFKRLFHIRUHLWKHU JRXUPHWRUFDVXDOGLQLQJ 0RGHO'HVFULSWLRQ   R]7DOO:LQH  R]7DOO:LQH  R]7DOO:LQH   R]7DOO:LQH   R]7DOO:LQH  R]%DOORQ:LQH  R]%DOORQ:LQH  R]%DOORQ:LQH  R]%DOORQ:LQH   R]&RFNWDLO   R])OXWH * R],FHG7HD * R]$OO3XUSRVH  OLWHU0LOOHVLPH&DUDIH 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

'*UDQG&XYHHE\6WRO]OH &ODVVLF &KLF &OHDU $ FODVVLF VKDSH ZLWK D PRGHUQ WZLVW 7KH 1HR(XURSHDQ VW\OLQJ IURP WKH JODVVZDUH H[SHUWV DW 6WRO]OH ZDV GHYHORSHG WR KHOS GHOLYHU WKH RSWLPXP GULQNLQJ H[SHULHQFH 7KLV KLJK SHUIRUPDQFH VWHPZDUHOLQHLVPDQXIDFWXUHGRIOHDGIUHHFU\VWDOJODVV WKDWGHOLYHUVWKHXWPRVWLQFODULW\DQGEULOOLDQFH 0RGHO'HVFULSWLRQ  3LQRW%XUJXQG\ R]  5HG:LQH R]  &KDUGRQQD\ R]  )OXWH R]  /RQJ'ULQN R]  :KLVN\'2)R]  %HHU*ODVV R]  &KDPSDJQHR]  &DE%RUGHDX[R]


',1,1*

'LQLQJ_ $

$3U\VPE\$UFRURF 3U\VPSURYLGHVWKHXSVFDOHWUHQG\ ORRN ZKLOH RIIHULQJ GXUDELOLW\ DQG VWUHQJWK $Q HVVHQWLDO DFFHVVRU\ WKLV IXOO\ WHPSHUHG JODVVZDUH FROOHFWLRQ ZLOO DGG VW\OH DQG HOHJDQFH ZLWK D FRQWHPSRUDU\ WRXFK &OHDQ OLQHV FRPELQH ZLWK YLVXDO HIIHFWV LQ 3U\VP JODVVZDUH ,WV VOLJKWO\ WZLVWHG VTXDUH EDVH FUHDWHV WKH LOOXVLRQ RI PRYHPHQW ZKLOH FRQMXULQJ XS VXEWOH UHIOHF WLRQV 6L[ VKDSHV WR FKRRVH IURP %HYHUDJH  &RROHUV 'RXEOH 2OG )DVKLRQHG +LJK %DOO DQG 5RFNV FRPSOHWH WKH FROOHFWLRQ +LJK %DOO DQG&RROHUDUHPDGHLQWKH86$

%&DSUL6WHPZDUH&ROOHFWLRQ 2IIHULQJ D ³VWDQGDUG´ ORRN WKDW¶V DW KRPH LQ D YDULHW\ RI VHWWLQJV±IURP EDQTXHWV EDU RU ORXQJH RU HYHQ EUXQFK &DSUL LV D YHUVDWLOH FROOHFWLRQ RIQRQRQVHQVHEDVLFVWHPZDUH 0RGHO'HVFULSWLRQ  &KDPSDJQH R]  %UDQG\R]  *REOHW R]  7DOO:LQH R]  5HG:LQHR]  :LQH R]  :LQHR]  :LQH R]  :LQHR]  %HHU R]  %HHU R]  )OXWH R]  )RRWHG+L%DOOR]  )RRWHG+L%DOOR] 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ

0RGHO'HVFULSWLRQ ( %HYHUDJHR] ( 'RXEOH2OG)DVKLRQHG R] ( 5RFNVR] ( +LJK%DOOR] ( &RROHU R] ( &RROHUR]

% %

'

&([FDOLEXU0DUWLQL ([FDOLEXU0DUWLQLVLQWKHR] R]DQG  R] FDSDFLWLHV DUH QRZ IXOO\ WHPSHUHG IRU H[WUDRUGLQDU\ WRXJKQHVV ([FDOLEXU VHWV WKH VWDQGDUGIRUSURIHVVLRQDOJUDGHJODVVZDUH 0RGHO'HVFULSWLRQ  0DUWLQLR] ' &RFNWDLO R]  &RFNWDLOR]

(

'

&

(6WLOHWWR+ROORZZDUH 6WULNLQJ 6W\OLVK 6RSKLVWLFDWHG $ JOHDPLQJ ILQLVK RQ D JUHDW VKDSH 6WLOHWWR LV D VWDQGRXW ZKHQ LW FRPHV WR VWDLQOHVV VHUYHZDUH ,WV VOHHN XQFRPSOLFDWHG GHVLJQLVZHOOVXLWHGIRUDQ\GpFRU<RX¶OOEHSURXGWR VHUYH KRW FRIIHH WHD DQG PRUH IURP WKLV KDQGVRPH KROORZZDUH 0RGHO'HVFULSWLRQ $ &RIIHH3RW/RQJ6SRXWR] $ &UHDPHUZR&RYHUR] $ &UHDPHUZR&RYHUR] $ 6XJDU%RZOZR&RYHUR] $ 7HDSRW6KRUW6SRXWR] $ 7HDSRW6KRUW6SRXWR] $ :DWHU3LWFKHUZR,FH*XDUGR] % 6DOW 3HSSHU6HW

'6RSUDQRŒ+RWHO7UD\V +HDY\JDXJH  VWDLQOHVV VWHHO LV KLJKO\ UHVLVWDQW WR FRUURVLRQ SLWWLQJ DQG UXVWLQJ &RPSOHPHQW FDVXDO RU IRUPDO EDQTXHW DSSOLFDWLRQ DQG DUH LGHDO IRU FDWHUHG HYHQWV 5RXQG DQG UHFWDQJOHWUD\VDYDLODEOHLQDYDULHW\RIVL]HV 0RGHO'HVFULSWLRQ  5RXQG  5RXQG 28 5RXQG 28 5RXQG 28 [5HFWDQJOH 28 [5HFWDQJOH 28 [5HFWDQJOH 28+ [5HFWDQJOHZ+DQGOHV 28 [5HFWDQJOH 28 [5HFWDQJOH 28 [5HFWDQJOH 28 [7LS6XJDU &UHDP

))DEULF 9LQ\O7DEOHFORWKV 3HUIHFWIRUIDPLO\GLQLQJ0DUNRIDEULFVRIIHUGXUDELOLW\DQGHOHJDQFH LQ D UDQJH RI FRORUV DQG ZHDYHV )XOO OLQH RI WDEOHFORWKV QDSNLQV DQG VNLUWLQJ LQ GR]HQV RI FRRUGLQDWLQJ FRORUV 9LQ\O SURGXFWV DUH DYDLODEOH LQ IRXU SURIHVVLRQDO JUDGHV 7KH QHZHVW VHULHV RI YLQ\O WDEOH FRYHULQJV FDSWXUH WKH HOHJDQFH DQG GUDSH RI IDEULF ZLWK WKH GXUDELOLW\ RI YLQ\O &KRRVH IURP D YDULHW\ RI SDWWHUQV DQG FRORUV &XVWRPVL]HVDQGUROOVDOVRDYDLODEOH

)


'LQLQJ_ $

&

'

$/LEUD)ODWZDUH&ROOHFWLRQ 7KH SDWWHUQ RI /LEUD LV D VWDWHPHQW LWVHOI 7KH VXEVWDQWLDO FRQWHPSRUDU\ SDWWHUQ DOVR SRVVHVVHV D KLQW RI ZKLPV\ WKDW ZLOO OLYHQ XS DQ\ WDEOHWRS  VWDLQOHVVVWHHO+LJKSROLVKEULJKWILQLVK 0RGHO'HVFULSWLRQ 7676) 7HDVSRRQ 76'() 2YDO%RZO6RXS6SRRQ 765%) 5RXQG%RZO6RXS6SRRQ 76,7) ,FHG7HDVSRRQ 76$') $'&RIIHH6SRRQ 767%) 7DEOHVSRRQ6HUYLQJ6SRRQ 7)'1) 'LQQHU)RUN 7)'() 'HVVHUW6DODG)RUN 7)2<) 2\VWHU&RFNWDLO)RUN 7.'7) 'LQQHU.QLIH3F 7.%9) %XWWHU.QLIH3F 2WKHULWHPVDYDLODEOHLQWKLVSDWWHUQ &&RUHOOL)ODWZDUH &ODVVLF 5RPDQWLF 6W\OLVK 7KLV (XURSHDQ IODWZDUH GHVLJQLVQRWHGIRULWVVPRRWKJUDFHIXOIRUPDFFHQWHGE\ D GLPHQVLRQDO EDQG DW WKH WDSHUHG QHFN RI WKH KDQGOH 7KLV HOHJDQW SDWWHUQ FUDIWHG LQ DQ H[WUD ODUJH KHDY\ JDXJH IRUPDW SUHVHQWV DQ LPSUHVVLYH WDEOHWRS VWDWHPHQWIRUILQHGLQLQJ 0RGHO'HVFULSWLRQ 7676) 7HDVSRRQ866L]H 76'() 2YDO%RZO6RXS'HVVHUW6SRRQ 765%) 5RXQG%RZO6RXS6SRRQ 76,7) ,FHG7HDVSRRQ 76$') $'&RIIHH6SRRQ 767%) 7DEOHVSRRQ6HUYLQJ6SRRQ 7)',) 7DEOH)RUN(XURSHDQ6L]H 7)'() 6DODG'HVVHUW)RUN 7)2<) 2\VWHU&RFNWDLO)RUN 7.37) 7DEOH.QLIH3F 7.'() 'HVVHUW.QLIH3F 7.66) 6WHDN.QLIH3F 7.%%) %XWWHU.QLIH3F 7.6%) %XWWHU6SUHDGHU3F 7)6/) )LVK)RUN3F 7.)6) )LVK.QLIH3F

'5HIOHFWLRQV 3ROLVKHG ,QYLWLQJ 5HIUHVKLQJ 7KLV SDWWHUQ LV UHPLQLVFHQWRIDUHIOHFWLQJSRROZLWKLWVJHQHURXVO\ VKDSHG KDQGOH DQG EULJKW VSDUNOLQJ ILQLVK 'HVLJQHG  ZLWK EDODQFH DQG FRPIRUW LQ PLQG WKLVVWDUIODWZDUHIHHOVDVJUHDWDVLWORRNV 0RGHO'HVFULSWLRQ 7676) 7HDVSRRQ866L]H 76)7) 7HDVSRRQ(XURSHDQ6L]H 76'() 2YDO%RZO6RXS'HVVHUW6SRRQ 765%) 5RXQG%RZO6RXS6SRRQ 76,7) ,FHG7HDVSRRQ 76$') $'&RIIHH6SRRQ 767%) 7DEOHVSRRQ6HUYLQJ6SRRQ 7)',) 7DEOH)RUN(XURSHDQ6L]H 7)'() 6DODG'HVVHUW)RUN 7)6/) 2\VWHU&RFNWDLO)RUN 7))6) )LVK)RUN3F 7.37) 7DEOH.QLIH3F 7.'() 'HVVHUW.QLIH3F 7.6%) %XWWHU.QLIH3F 7.)6) )LVK.QLIH3F

(

%

%6FUROO)ODWZDUH *UDFHIXO 7UDQVLWLRQDO 2ULJLQDO 6ZHHSLQJ DV\PPHWULFDO OLQHV JLYH 6FUROO  VWDLQOHVV D IDVKLRQDEOH IUHVK ORRN 7KLV IODWZDUH H[XGHV WKH NLQG RI TXDOLW\ DQG FUDIWVPDQVKLS \RXU FXVWRPHUVH[SHFW 0RGHO'HVFULSWLRQ 6%/) %RXLOORQ6SRRQ .%)) %XWWHU.QLIH)+ )'1) 'LQQHU)RUN .39) 'LQQHU.QLIH6+3F 6,7) ,FHG7HDVSRRQ 6'() 2YDO%RZO6RXS'HVVHUW6SRRQ )2<) 2\VWHU)RUN )6/) 6DODG)RUN 67%) 7DEOHVSRRQ 676) 7HDVSRRQ

($FFOLYLW\)ODWZDUH&ROOHFWLRQ 6KRZFDVLQJ ERWK IRUP DQG IXQFWLRQ WKLV KHDY\ JDXJH  VWDLQOHVV VWHHO FROOHFWLRQ KDV D UHFHVVHG HOHPHQW DW WKH KDQGOH FHQWHU WKDW VWDQGV RXW ZLWK D EULJKW PLUURU ILQLVK 7KH EULJKWO\ SROLVKHG WHDUGURS KDQGOH FUHDWHV ERWK YLVXDO DQG WDFWLOH DSSHDO $ GHOLFDWH FRQYH[ HOHPHQW DW WKH EDVH RI HDFK ERZO DGGV IXUWKHU GLVWLQJXLVKLQJ GLPHQVLRQ IRU D WUXO\ XQLTXH GLQLQJDHVWKHWLF 0RGHO'HVFULSWLRQ %6)7) 7HDVSRRQ(XURSHDQ6L]H %676) 7HDVSRRQ %6'() 2YDO%RZO6RXS'HVVHUW6SRRQ %6%/) %RXLOORQ6SRRQ %6,7) ,FHG7HDVSRRQ %6$') $'&RIIHH6SRRQ %67%) 7DEOHVSRRQ6HUYLQJ6SRRQ %)'1) 'LQQHU)RUN %)',) 7DEOH)RUN(XURSHDQ6L]H %)'() 'HVVHUW6DODG)RUN %)2<) 2\VWHU&RFNWDLO)RUN %.'7) 'LQQHU.QLIH3F %.'$) 'HVVHUW.QLIH3F %.%9) %XWWHU.QLIH3F

)ODWZDUH <RXU'LVKZDVKHU &$87,21,I\RXDUHXVLQJDORZWHPSRUFKORULQHEDWKW\SHGLVKZDVKLQJV\VWHPWDNHJUHDWFDUHLQ IROORZLQJ WKH PDQXIDFWXUHU·V LQVWUXFWLRQV $Q RYHUFRQFHQWUDWLRQ RI VRGLXP K\SRFKORULWH EOHDFK  WKHDFWLYHVDQLWL]LQJDJHQWRIWKHVHV\VWHPVZLOODWWDFNPRVWPHWDOWDEOHZDUH,PSURSHUXVHRUIDXOW\ HTXLSPHQW IXQFWLRQLQJ ZLOO FDXVH VWDLQLQJ RU FRUURVLRQ RI HYHQ WKH ILQHVW VWDLQOHVV VWHHO ,W LV YHU\ LPSRUWDQW WKDW \RX XVH RQO\ D SODVWLF RU VWDLQOHVV VWHHO SDQ IRU SUHVRDNLQJ 1(9(5 86( $1 $/80,180 3$1 IRU SUHVRDNLQJ $OXPLQXP IUHHV WKH FKORULQH SUHVHQW LQ PRVW SUHVRDN FRPSRXQGVDQGFDXVHVWKHGLVFRORUDWLRQRIVWDLQOHVVVWHHO


'LQLQJ_ $1XRYR)ODWZDUH&ROOHFWLRQ &RQWHPSRUDU\DQGJUDFHIXOWKHFRPIRUWDEOHIHHORI 1XRYRVWULNHVDEDODQFHZLWKLWVPRGHUQDHVWKHWLF 0RGHO'HVFULSWLRQ 7 'LQQHU)RUN 7 'LQQHU6SRRQ 7 'LQQHU.QLIH VROLGKDQGOH

7 'HVVHUW)RUN 7 'HVVHUW6SRRQ 7 'HVVHUW.QLIH VROLGKDQGOH

7 6RXS6SRRQ 7 'HPLWDVVH6SRRQ 7 867HDVSRRQ 7 866DODG)RUN

$

%

&&KDQWHOOH)ODWZDUH&ROOHFWLRQ 3UHPLXP KHDY\JDXJH  VWDLQOHVV VWHHO WKH &KDQWHOOH FROOHFWLRQ GHOLYHUV VXSHULRU TXDOLW\ IODWZDUH DW DIIRUGDEOH SULFHV 0RGHO'HVFULSWLRQ  7DEOHVSRRQ  7HDVSRRQ  ,FHG7HDVSRRQ  'LQQHU6SRRQ  'HPLWDVVH6SRRQ  %RXLOORQ6SRRQ  'LQQHU)RUN  2\VWHU)RUN  6DODG)RUN  7DEOH)RUN  'LQQHU.QLIH6+  %XWWHU6SUHDGHU

&

%6RKR)ODWZDUH&ROOHFWLRQE\+DOOPDUN 5LFK (XURSHDQ GHVLJQ RI 2OGH :RUOG 7UDGLWLRQV FUDIWHGZLWKIURQWDOERZODQGWLQHKDOOPDUNLQJ WKH PDUNV RI H[FHOOHQFH 0LUURU ILQLVK DQG PROGHG WHDUGURSKDQGOHV²\RXFDQIHHOWKHWKLFNQHVV 0RGHO'HVFULSWLRQ  7HDVSRRQ  6HUYLQJ6SRRQ  ,FHG7HDVSRRQ  'LQQHU)RUN  'HVVHUW)RUN  %RXLOORQ6SRRQ  &RFNWDLO)RUN  'LQQHU.QLIH

(

' ) '  0RGHUQDLUHΠ)ODWZDUH &ROOHFWLRQ E\ +DOOPDUNΠ7KH 0RGHUQDLUH  &ROOHFWLRQ IHDWXULQJ IRUJHG EUXVKHG ILQLVKHG KDQGOHV ERZOV WLQHV DQGEODGHVRIIHUDULFKSHZWHUORRN7KHEHVWLQ FRQWHPSRUDU\ VW\OLQJ FUHDWHV D SRZHUIXO VWDWHPHQW RQ \RXU WDEOH $OVR DYDLODEOH LQ VLOYHUSODWH 0RGHO'HVFULSWLRQ  7HDVSRRQ  6HUYLQJ6SRRQ  ,FHG7HDVSRRQ  'LQQHU)RUN  (XURSHDQ)RUN  6DODG)RUN  'HVVHUW6SRRQ  %XWWHU.QLIH6+  %RXLOORQ6SRRQ  &RFNWDLO)RUN  'HPLWDVVH6SRRQ  .QLIH3F  (XURSHDQ.QLIH3F

(  6XVDQQDK )ODWZDUH &ROOHFWLRQ E\ +DOOPDUN 7KH KHDYLHVW IRUJHG  KDQGOHV FRPSOHWHO\ EUXVKHG WR D VDWLQ ILQLVK 3RSXODUWRGD\IRUWKHULFKSHZWHUORRN 0RGHO'HVFULSWLRQ  7HDVSRRQ  ,FHG7HDVSRRQ  'LQQHU)RUN  7DEOH)RUN  'HVVHUW6SRRQ  %XWWHU.QLIH  %RXLOORQ6SRRQ  &RFNWDLO)RUN  6WDQG8S.QLIH  7DEOH.QLIH3F

),OOXVWUD&ROOHFWLRQ $XQLTXHFROOHFWLRQWKDWJORZVZLWKWKHEHDXW\RI VLOYHU EXW LV PDGH LQ PDLQWHQDQFH IUHH  FKURPH  QLFNHO ,WV WUDGLWLRQDO ILGGOHEDFN GHVLJQ LV UHFRPPHQGHG IRU D EURDG UDQJH RI GLQLQJH[SHULHQFHV 0RGHO'HVFULSWLRQ  7HDVSRRQ  6HUYLQJ6SRRQ  ,FHG7HDVSRRQ  'LQQHU)RUN  (XUR)RUN  6DODG)RUN  'HVVHUW6SRRQ  %XWWHU6SUHDGHU)+  %XWWHU.QLIH6+  %RXLOORQ6SRRQ  &RFNWDLO)RUN  .QLIH++  'HPLWDVVH6SRRQ  .QLIH3F  (XURSHDQ.QLIH


'LQLQJ_ $

$

$6RPHUYLOOHŒ%XIIHW6HUYLFH ,QVSLUDWLRQDO GHVLJQ WKDW DOVR RIIHUV IXQFWLRQDOLW\ DQG KLJK TXDOLW\ 7KH HOHJDQW PLUURUILQLVKHG VWDLQOHVV VWHHO ILQLVK DQG XQLTXH DFFHQW IHDWXUHV EULQJ DQ XSVFDOH LPDJH WR DQ\ GpFRU 8VH VWDQGDUG IXHO RU 9ROOUDWK¶V 8QLYHUVDO (OHFWULF +HDWHU  VROG VHSDUDWHO\  ,QFOXGHG ZLQGJXDUG VKLHOGV IXHO IURP ZLQG 1HZ KLQJH GHVLJQ ZRUNV LQ WKH FORVHG ƒ DQG IXOO\RSHQ SRVLWLRQ XVLQJ RQO\ PRGHUDWH IRUFH WR FKDQJH SRVLWLRQ²QR OHYHUV RU VZLWFKHV UHTXLUHG WR RSHUDWH5HFWDQJOHFKDIHUIHDWXUHV9ROOUDWK6XSHU 3DQ Š IRRG SDQ 'XUDEOH VROLG OHJV DQG ZHOGHG FRQVWUXFWLRQ 0RGHO'HVFULSWLRQ  TW5RXQG'URS,Q&KDIHU  TW5HFWDQJOH&KDIHU  TW6RXS8UQ  TW*UDY\8UQ  JDO&RIIHH8UQ  JDO&RIIHH8UQ  TW0LON'LVSHQVHU  TW-XLFH&ROG%HYHUDJH'LVSHQVHU  'RXEOH&HUHDO'LVSHQVHUTWHDFK

& &0D[LPLOOLDQ6WHHOŒ&KDIHUV 0D[LPLOOLDQ 6WHHOŒ PLUURU ILQLVK VWDLQOHVV VWHHO FKDIHUV DUH GXUDEOH DQG HDV\ WR FOHDQ 3DWHQW SHQGLQJ FRQWHPSRUDU\ VW\OLQJ 5HFWDQJXODU FKDIHU IHDWXUHV 9ROOUDWK 6XSHU 3DQ Š IRRG SDQ (DFK SDFNHG LQ IXOO FRORU PHUFKDQGLVLQJ FDUWRQ $YDLODEOHLQVHYHQSRSXODUVW\OHV 0RGHO'HVFULSWLRQ  TW+DOI6L]H5HFWDQJXODU  TW5HFWDQJXODU  TW0HGLXP5RXQG  TW/DUJH5RXQG  TW6RXS0DUPLWH  TW6RXS0DUPLWH  TW&RIIHH8UQ

'

%

%*UDQGHXUŒ&KDIHU&ROOHFWLRQ *LYH \RXU EXIIHW DQ H[WUD WRXFK RI FODVV ZLWK WKLVHOHJDQWFKDILQJGLVK7KLVTWUHFWDQJXODU FKDIHU ZLWK IDVKLRQDEOH VWUDS VW\OH OHJV LV D VPDUW FKRLFH 7HQVLRQ FRQWUROODEOH FRYHU SUHYHQWVVODPGRZQVDQGRSHQVWRƒ 0RGHO'HVFULSWLRQ 6 5HFWDQJXODU6WDLQOHVV * 5HFWDQJXODU *ROG/HJV+DQGOHV 

',GROŒ&KDIHUVE\:DOFR *ODVV OLG OLIW WRS FKDIHUV DQG VRXS VWDWLRQ WKDW DUH EDQTXHW UHDG\ 6HOI FORVLQJ YHQWHG JODVV OLG NHHSV IRRG SUHVHQWDWLRQV IURP GU\LQJ RXW )RU DGGHG YHUVDWLOLW\WKHERG\UHPRYHGIURPWKHVWDQGFDQEH XVHG RQ DQ LQGXFWLRQ WDEOH 0DJQHWLF VWHHO FODG ERWWRPV LQVXUH H[FHOOHQW KHDWLQJ 0RGHO :/*/ VKRZQ 0RGHO'HVFULSWLRQ 0RGHOVZ)RRG3DQ6SRRQ+ROGHU%XUQHU6WDQG :,/*/ TW5HFWDQJXODU IXHOFXSV

:,/*/ TW5HFWDQJXODU IXHOFXS

:,/*/ TW5HFWDQJXODU IXHOFXS

:,/66*/  TW5RXQG6RXS6WDWLRQ IXHOFXS

:,/*/ TW5RXQG IXHOFXS

:,/8 JDO8UQ Z%DVH )XHO+ROGHU

:,/8 JDO8UQ Z%DVH )XHO+ROGHU

:,&8.,7 (OHFWULF+HDWLQJ3ODWH IRU,GROŒ8UQV

+RZ7R8VH&KDIHUVDQG8UQV 8VHRQO\FDQQHGIXHOLQWKHEXUQHU)LOOWKHZDWHUSDQXUQRUNHWWOHEHIRUHOLJKWLQJWKHEXUQHU /RZ IODPH LV VXIILFLHQW WR PDLQWDLQ SURSHU KHDW .HHS DZD\ IURP RSHQ IODPH RU KRW VWRYH )RRGSDQVFDQEHXVHGIRUFRRNLQJDQGRUSODFHGLQWKHRYHQWRUHWDLQKHDW)LOOFKDILQJGLVK ZLWK KRW ZDWHU &KHFN SDQ GXULQJ XVH WR PDLQWDLQ VXIILFLHQW ZDWHU OHYHO '2 127 86( :,7+287:$7(5

( ($GDJLR&KDIHUV 5HFWDQJXODU  TXDUW VWDLQOHVV VWHHO FKDIHU IHDWXUHV D ƒ UROO WRS DQG WKH ƒ LQWHUPHGLDWH VWRS SUHYHQWV KDQGOH IURP VFUDWFKLQJ WKH FKDIHU IUDPH ZKHQ IXOO\ RSHQHG &RPHV FRPSOHWH ZLWK IRRG SDQ ZDWHUSDQDQGWZRIXHOKROGHUV 0RGHO$'$*,257

%XIIHW7LSV $OZD\VZDVK\RXUKDQGVEHIRUHDQGDIWHUKDQGOLQJIRRG$OVRNHHSGLVKHVDQGXWHQVLOVFOHDQ $UUDQJHDQGVHUYHIRRGRQVHYHUDOVPDOOSODWWHUVUDWKHUWKDQRQRQHODUJHSODWWHU.HHSWKH UHVWRIWKHIRRGKRWLQWKHRYHQRUFROGLQWKHUHIULJHUDWRUXQWLOVHUYLQJWLPH7KLVZD\IRRGV ZLOOEHKHOGDWVDIHWHPSHUDWXUHVIRUDORQJHUWLPH $OZD\V UHSODFH HPSW\ SODWWHUV UDWKHU WKDQ DGGLQJ IUHVK IRRG WR D GLVK WKDW KDV DOUHDG\ KDG IRRGRQLW5HPHPEHU³PDQ\SHRSOHV·KDQGVPD\KDYHWDNHQIRRGIURPWKHGLVKZKLFKZDV DOVRVLWWLQJDWURRPWHPSHUDWXUHIRUDZKLOH .HHSKRWIRRGKRW ƒ) DQGFROGIRRGFROG ƒ)RUORZHU 


'LQLQJ_ $0DGLVRQ&KDIHU&ROOHFWLRQ $GGDWRXFKRIHOHJDQFHWR\RXUSUHVHQWDWLRQ ZLWK KLJKO\ SROLVKHG  VWDLQOHVV VWHHO FKDIHUVIURP:LQFR3HUIHFWIRUNHHSLQJIRRGV ZDUP RQ EXIIHW WDEOHV DW FDWHUHG HYHQWV UHVWDXUDQW EXIIHWV DQG KRWHO EXIIHWV ,W KDV D UROO WRS FRYHU ZLWK DQ ƒ RSHQLQJ DQG ƒ LQWHUPHGLDWH RSHQLQJ VR FXVWRPHUV DQG JXHVWV FDQ VHUYH WKHPVHOYHV ZLWK HDVH 7KUHH VL]HV WR FKRRVH IURP 0RGHO  VKRZQ 0RGHO'HVFULSWLRQ  )XOO6L]H4W  5RXQG4W  2YDO4W

$

&3RS8S&KDIHU6HW 5HDG\ 6HW 6HUYH 1RZ D FRQYHQLHQW SRUWDEOH DQG HDV\WRVWRUH FKDILQJ GLVK² UHDG\ WR VHW XS DQG VHUYH JXHVWV DQ\ZKHUH IRU PRVW DQ\ RFFDVLRQ 2IIVLWH FDWHULQJ PLQLEXIIHW VWDWLRQV RXWGRRU HYHQWV SDUW\ URRPV KRVSLWDOLW\ VXLWHV KDSS\ KRXUV ,QFOXGHV HYHU\WKLQJ \RX QHHG LQ RQH ER[²   +HDY\ 'XW\ 0HWDO 3DQ +ROGHU   5HXVDEOH $OXPLQXP :DWHU3DQ  $OXPLQXP)RRG+DOI3DQV  3ODVWLF6HUYLQJ6SRRQ )RUN6HWDQG   &DQV RI +RXU *HO &KDILQJ )XHO 0RGHO

'6WHUQRŠ %UDQG&KDILQJ)XHOV (FR*UHHQ²5HQHZDEOH VDIH FOHDQ QRQWR[LF QRQH[SORVLYH DQG HIILFLHQWIDVWOLJKWLQJ0D[LPXPKHDW RXWSXW &RQVLVWHQW GHOLYHU\ (YHQ ZKHQWKHOLGFRPHVRII\RXUFKDILQJ GLVK 6WHUQR Š %UDQG *HO &KDILQJ )XHO ZLOO NHHS \RXU IRRG LQ WKH WHPSHUDWXUH VDIHW\ ]RQH 6WHUQR Š %UDQG *HOV HPLW ]HUR FDUERQ PRQR[LGH DQG DUH QRQWR[LF 6WHUQRŠ %UDQG*HOVKHOSPDNHIRUD FOHDQHUVDIHUHQYLURQPHQW

&

%

%&KDILQJ)XHOV :LWK D FRPSOHWH VHOHFWLRQ RI +HDW SURGXFWV WR FKRRVH IURP \RX¶UH VXUH WR ILQG D FKDILQJ IXHO SHUIHFWIRU\RXUQHHGV7KHLQQRYDWLYHZLFNV\VWHP DIIRUGVWKHKHDWRIDJHOZLWKWKHVDIHW\RIDOLTXLG ZLFN FKDILQJ IXHO :LFN IXHOV LQFRUSRUDWH D ZLFN WR GHOLYHU DQ RSWLPXP IODPH KHLJKW WKDW UHPDLQV VWHDG\ DQG VWURQJ WKURXJKRXW WKH EXUQ F\FOH 6WHUQR&DQGOH/DPSDOVRFDUULHVWUDGLWLRQDOJHOIXHOV SRZHUHG E\ HLWKHU HWKDQRO SLQN  RU PHWKDQRO EOXH ERWKRIIHULQJVWURQJKHDWLQJSHUIRUPDQFHLQ FKDILQJGLVKHV 0RGHO'HVFULSWLRQ  KU+DQG\:LFN  KU+DQG\:LFN  KU+DQG\:LFN  KU6DIH+HDWZ3RZHU3DG  KU+DQG\)XHO0HWKDQRO*HO  KU6WHUQR*UHHQ*HO(WKDQRO*HO  PLQ6WHUQR*UHHQ*HO(WKDQRO*HO  KU6DIH+HDWZ3RZHU3DG  KU6DIH+HDWZ3RZHU3DG  KU6WHUQR*UHHQ+HDW  +DQG\:LFNKU:LFN

(GCVWTGF%JGH &KHI&KULV0F.HQQD ' 0RGHO'HVFULSWLRQ  0LQ6WHUQRŠ *UHHQ(WKDQRO*HO 5RRP6HUYLFH  *DOORQ(WKDQRO*HO  +RXU6WHUQRŠ *UHHQ(WKDQRO*HO  +RXU+DQG\)XHOŠ 0HWKDQRO  +RXU6WHUQRŠ *UHHQ+HDWŒ  0LQ+DQG\)XHOŠ 0HWKDQRO 5RRP6HUYLFH

6WHOOD0RGHUQ,WDOLDQ&XLVLQH 2NODKRPD&LW\2. &KRFRODWH6DODPL R]FKRFRODWHFKRSSHG OEEXWWHUVRIW HJJ\RONV 7EVSKRQH\ 7EVSHVSUHVVRSRZGHU FXSVFUXVKHGELVFRWWLRUYDQLOODZDIHUV FXSWRDVWHGDOPRQGV FXSVKHOOHGSLVWDFKLRVFUXVKHG FXSGULHGFKHUULHVRUILJV

8VHRI&DQQHG+HDW 3U\WKHOLGIURPWKHFDQQHGKHDWDQGSODFHFDQQHGKHDWLQWRKHDW FXS/LJKWIXHODGMXVWLQJWKHOLGWRDSSUR[LPDWHO\KDOIRSHQ 7R SURWHFW \RXU WDEOH OLQHQV RU VHUYLQJ VXUIDFH DOZD\V XVH DQ XQGHUOLQHUWUD\ZKHQXVLQJHTXLSPHQWWKDWKDVEXUQHUV

3RZGHUHGVXJDUWRFRDW 0HOWWKHFKRFRODWHZLWKWKHEXWWHULQWKHWRSRIDGRXEOH ERLOHU  7HPSHU \RONV ZLWK PHOWHG FKRFRODWH PL[WXUH WKHQ DGG \RON WR FKRFRODWH  0L[ LQ WKH KRQH\ DQG HVSUHVVR SRZGHU  )ROG LQ WKH FUXVKHG ELVFRWWL DOPRQGV SLVWDFKLRV DQG FKHUULHV  $OORZ PL[WXUH WR FRRO WKHQ IRUP LQWR  ORJV DSSUR[  LQFKHV HDFK 5ROOHDFKORJLQSRZGHUHGVXJDU6OLFHWRVHUYH


'LQLQJ_

$

&

$:LQG*XDUGŒ &KDILQJ)UDPHV &RQYHQLHQWO\ KHDW DQG KROG IRRGV DW WKH SHUIHFW WHPSHUDWXUH DQG VDYH YDOXDEOH WUDQVSRUWDWLRQ VSDFH ZLWK IROGDEOH FKDIHU IUDPH $ JUHDW VHUYLQJ VROXWLRQ IRU FDWHUHUV ZKR KDYH OLPLWHG VWRUDJH DQG WUDQVSRUWDWLRQ RSWLRQVWKHVSDFHVDYLQJGHVLJQIROGVIODWWR MXVW  WKLFN ZKHQ QRW LV XVH $YDLODEOH LQ WKUHHH\HFDWFKLQJILQLVKHVWRKHOS\RXFUHDWH D GLVWLQFWLYH ORRN DW \RXU QH[W FDWHUHG HYHQW 0DWFKLQJGRPHFRYHUVVROGVHSDUDWHO\ 0RGHO'HVFULSWLRQ  6WDQGDUG&KDILQJ'LVK5DFN  'RPH&RYHU6LOYHU9HLQ  'RPH&RYHU&RSSHU  :LQG*XDUGŒ)UDPH6LOYHU9HLQ  :LQG*XDUGŒ)UDPH&RSSHU  :LQG*XDUGŒ)ROGLQJ6LOYHU9HLQ  :LQG*XDUGŒ)ROGLQJ&RSSHU

&:URXJKW,URQ*ULGGOHVZLWK6WDQG $ JUHDW FKDIHUOHVV ZD\ WR VHUYH XS EUHDNIDVW LWHPV RU KRW VDQGZLFKHV 5HFWDQJXODU JULGGOHV FRPH LQ WZR VL]HV DQG WKH WULDQJXODU DQG URXQG JULGGOHV DGG D QHZ GLPHQVLRQ WR \RXU EXIIHWOLQH5HSODFHPHQWJULGGOHWRSVDOVRDYDLODEOH 0RGHO'HVFULSWLRQ *6 'LD5RXQG*ULGGOHZLWK'LD6WDQG 6HW

*6 [[5HFWDQJXODU*ULGGOHZLWK6WDQG 6HW

*6 [[5HFWDQJXODU*ULGGOHZLWK6WDQG 6HW

*67 [[7ULDQJXODU*ULGGOHZLWK6WDQG 6HW

*6 'LD5HSODFHPHQW5RXQG*ULGGOH * 7ULDQJXODU5HSODFHPHQW*ULGGOH * +DOI6L]H5HSODFHPHQW*ULGGOH *66 'LD6WDQG

(

%&KDIHU$OWHUQDWLYHV &RRN VHUYH DQG VKRZFDVH \RXU GHOLFLRXV DUUDQJHPHQWV RI IRRG ZLWK WKLV JUHDW DOWHUQDWLYH WRFRQYHQWLRQDOFKDIHUV,QFOXGHVZLUHJULOOIXHOFHOO UDLO ZLWK EXLOWLQ ZLQGJXDUG )HDWXUHV D VTXDUHG VW\OH FKDIHU DQG JULOO WKDW DOORZ \RX WR VHUYH DQG GLVSOD\ \RXU GLVKHV ZLWK VRPH VW\OH ,WV PRGHUQ IUDPH DQG EROG JULOO ZLOO FRPSOHPHQW DQ\ EXIIHW WDEOH DW \RXU UHVWDXUDQW KRWHO RU FDWHULQJ HYHQW +ROGVFDQVRIIXHOIRUNHHSLQJWKHIRRGZDUP(DV\ WRGLVDVVHPEOHIRUFOHDQLQJDQGWUDQVSRUWDWLRQ 0RGHO'HVFULSWLRQ  [%ULGJH6T6WDQGZ*ULOO :['[+  [%ULGJH5HF6WDQGZ*ULOO :['[+  %XWDQH6WRYH)UDPH :['[+  *ULGGOHZ%UDFNHWV:['

''RXEOH:DOO3ODWWHUV %HDXWLIXOVW\OLQJEULQJV\RXUVHUYLQJOLQHWROLIH 'RXEOHZDOOFRQVWUXFWLRQKHOSVNHHSKRWIRRGV KRW DQG FROG IRRGV FROG²ZLOO QRW FRQGHQVDWH 9DULHW\ RI VKDSHV DQG VL]HV DYDLODEOH WR SHUIHFWO\ FRPSOHPHQW \RXU EXIIHW OLQH XS 3ROLVKHGVWDLQOHVVVWHHOFRQVWUXFWLRQ 0RGHO'HVFULSWLRQ  [&XUYHG3ODWWHU  [&XUYHG3ODWWHU  [&XUYHG3ODWWHU  5RXQG3ODWWHU

(6TXDUH%HQW%XIIHW5LVHU6HWV )RU XVH RQ WDEOH WRSV RU XQGHU WDEOHFORWKV 3DWHQWHG VHW RI WKUHH ULVHUV WR DGG KHLJKW DQG LQWHUHVW WR DQ\ EXIIHW VHW XS $YDLODEOH LQ EUXVKHG VWDLQOHVV VWHHO EODFN EODFN GD]]OH UHG RU SHDUO ZKLWH +HDY\GXW\ VWDLQOHVVVWHHOFRQVWUXFWLRQ(DFKVHWLQFOXGHV  5LVHU[[  5LVHU[[  5LVHU[[ 6HUYLQJSODWWHUVVKRZQVROGVHSDUDWHO\ 0RGHO'HVFULSWLRQ  %UXVKHG66 ,QFOXGHVDQG5LVHU

 'D]]OH5HG ,QFOXGHVDQG5LVHU

 3HDUO:KLWH ,QFOXGHVDQG5LVHU

 %ODFN%ODFN ,QFOXGHVDQG5LVHU

%

)

'

)'RXEOH:DOO,QVXODWHG%RZOV 'RXEOH ZDOO FRQVWUXFWLRQ SURYLGHV LQVXODWLRQ WR PDLQWDLQ SURSHU IRRGWHPSHUDWXUH²KRWRUFROG5HTXLUHVQRSUHKHDWLQJRUFKLOOLQJ +HDY\ JDXJH VWDLQOHVV VWHHO ZLOO QRW DIIHFW WDVWH RU FRORU RI IRRG :LOO QRW VZHDW 6DWLQILQLVKHG LQWHULRU KLGHV VFUDWFKHV DQG ZHDU 'LVKZDVKHU VDIH 16) &KRRVH VWDLQOHVV VWHHO RU GXUDEOH FRORU ILQLVK 0HWDOOLF FRORUV 7DQJHOR   'D]]OH 5HG   &REDOW %OXH   /HPRQ /LPH   &ODVVLF &RORUV *UHHQ $SSOH   1XJJHW <HOORZ   3HDUO :KLWH   )LUH (QJLQH 5HG   %ODFN %ODFN   0RGHO'HVFULSWLRQ ;; 6TXDUHTW ;; 6TXDUHTW ;; 6TXDUHTW ;; 6TXDUHTW ;; 6TXDUHTW ;; 5RXQGTW ;; 5RXQGTW ;; 5RXQGTW ;; 5RXQGTW ;; 5RXQGTW


'LQLQJ_

$

0RGHO'HVFULSWLRQ  3RP7RQJV &OHDU

 3RP7RQJV &RORUV

 6DODG7RQJV &OHDU

 6DODG7RQJV &RORUV

 6DODG7RQJV &OHDU

 6DODG7RQJV &RORUV

 8WLOLW\7RQJV &OHDU

 8WLOLW\7RQJV &RORUV

 8WLOLW\7RQJV &OHDU

 8WLOLW\7RQJV &RORUV

 3ODLQ+DQGOH/DGOH  3ODLQ+DQGOH/DGOH

$&DUO\Š 7RQJV /DGOHV 7RQJV DQG ODGOHV DUH DYDLODEOH LQ D ZLGH VHOHFWLRQ RI FRORUV WR FRRUGLQDWH ZLWK VDODG DQG GHOL FURFNV +LJK +HDW &DUO\ 7RQJV DUH PDGH RI UHYROXWLRQDU\ SODVWLF PDWHULDO IRU VWUHQJWK DQG ORQJHYLW\FDUU\D\HDUZDUUDQW\&OHDU&DUO\7RQJVDUHPDGHIURPSRO\FDUERQDWHFRQVWUXFWLRQ WKDWLPSURYHVGXUDELOLW\DQGHDVHRIFOHDQLQJ3ODVWLFPDWHULDOGRHVQ¶WWUDQVIHUKHDWVRXWHQVLOV VWD\FRROWRWKHWRXFK&DUO\/DGOHRYDOVKDSHGR]ERZODOORZVSRXULQJRIGUHVVLQJVIURPERWK VLGHV'LVKZDVKHUVDIH16)

&

&9HQXH1DSNLQ'LVSHQVHUV 5HGXFH FRVWV DQG LQFUHDVH K\JLHQH ZLWK RQHDWDWLPH QDSNLQ GLVSHQVLQJ 3LQFK UHVWULFWLYH FRQWURO IDFH GHVLJQ UHGXFHV QDSNLQ XVDJH E\  +LJK FDSDFLW\   RI QDSNLQVWUDQVODWHVLQWRODERUVDYLQJVDVWKHXQLWVZLOOQRW KDYH WR EH UHILOOHG DV RIWHQ 7UDQVSDUHQW IRU HDV\ PRQLWRULQJRIQDSNLQOHYHOV3ULFHGDERXWKDOIWKHFRVW RI FRPSHWLWLYH PHWDO GLVSHQVHUV $YDLODEOH LQ FRXQWHUWRS WDEOHWRS VWDQG ZDOO PRXQW DQG LQFRXQWHU PRGHOV²LQ &OHDU RU %ODFN 3HDUO 0RGHOV VKRZQ OHIW WR ULJKW ²+7%. +67%.+37%.+7%. $GGLWLRQDOPRGHOVDYDLODEOH

'

'&DPWUHDG&DPWUD\V $Q LQGXVWU\ VWDQGDUG IRU FDWHUHUV KRWHOV EDQTXHW KDOOV GLQLQJ URRPV DQG EDUV +HDY\GXW\ GXUDEOH ILEHUJODVV ZLWK QRQVNLG VXUIDFH HQVXUHV GULQNV DQG PHDOV VWD\ LQ SODFHGXULQJWUDQVSRUW*XDUDQWHHGQRWWRFUDFNEXEEOHRU SHHO IRU ILYH \HDUV 6WDFNLQJ OXJV SURPRWH DLU FLUFXODWLRQ DQGSHUIHFWVWDFNLQJ'LVKZDVKHUVDIH16)&RORUV6ODWH %OXH  7DYHUQ7DQ  6WHHO*UD\  DQG%ODFN   1HZ ZRRG GHVLJQ SURYLGHV DQ HOHJDQW ORRN IRU XSVFDOHUHVWDXUDQWVEDUVDQGOX[XU\KRWHOV 0RGHO'HVFULSWLRQ &7 5RXQG &7 5RXQG &7 5RXQG &7 [5HFWDQJXODU &7 [5HFWDQJXODU &7 [2YDO &7 [2YDO &7 [2YDO $GGLWLRQDOPRGHOVDYDLODEOH

%

%&DPZHDU6HUYLQJ%RZOV 8WHQVLOV %RZOVKDYHDVW\OLVKFRQWHPSRUDU\DSSHDUDQFH WKDWPDNHVDGUDPDWLFSUHVHQWDWLRQ/DGOHVKDYH DQJOHG KDQGOHV IRU HDV\ DFFHVV DQG SRUWLRQ FRQWUROERZOVWRKHOSFRQWUROIRRGFRVWV/XJDQR WRQJV DUH DQJOHG IRU DQ HUJRQRPLF JULS WKDW PDNHV VHUYLQJ HDV\ 6HUYLQJ VSRRQV DYDLODEOH VROLG RU SHUIRUDWHG +LJK KHDW FDPWHQVLOV DUH LGHDOIRUH[WUHPHWHPSHUDWXUHV 0RGHO'HVFULSWLRQ %RZOV 36% 3HEEOHG5RXQG 36% 3HEEOHG5RXQG 56%&: 5LEEHG5RXQGTW 56%&: 5LEEHG5HFWTW 56%&: 5LEEHG5RXQGTW /DGOHV  6SRRQV  R] 3ODLQ

/' /' R] 3ODLQ

632&: 6SRRQ6ROLG'HOL 7RQJV 7*6 6FDOORS*ULS 7** (DV\*UDVS $GGLWLRQDOPRGHOVDYDLODEOH

(&RPSDUWPHQW7UD\V 6ORSLQJ FRPSDUWPHQW ZDOOV DOORZ WUD\V WR GU\ TXLFNO\ DQG DOVR JLYH WKH DSSHDUDQFH RI ODUJHU VHUYLQJV 7UD\V IHDWXUH ODUJH KDQGOH DUHDV RQ ERWK VLGHV 'XUDEOH &DPZHDU SRO\FDUERQDWHFRQVWUXFWLRQLVJXDUDQWHHGDJDLQVWEUHDNDJHIRU\HDUV7ZRWUD\VILWVLGH E\ VLGH LQ VWDQGDUG [ GLVKUDFN &RORUV 1DY\ &UDQEHUU\ %OXH %HLJH 6KHUZRRG *UHHQ5HG'LPHQVLRQV[[$OVRLQWUDQVOXFHQWFRORUV3XUSOHDQG%OXH 0RGHO&:

(

)

)&DPWUD\V)LEHUJODVV5HFWDQJXODU 6SHFLDOO\ GHVLJQHG WR SURYLGH WKH NLQG RI UXJJHG ODVWLQJ GXUDELOLW\ WKDW HQVXUHV D ³OLNH QHZ´ DSSHDUDQFH \HDU DIWHU \HDU 'UL6WDN VHSDUDWRUV DOORZ DLU WR FLUFXODWH EHWZHHQWUD\VIRUTXLFNGU\LQJ7UD\VFDQ EH FXVWRPL]HG ZLWK \RXU ORJR RU VORJDQ ,QFOXGHVILYH\HDUJXDUDQWHH 0RGHO'HVFULSWLRQ  [  [  [  [  [


'LQLQJ_ $*ULSWLWH7UD\V 3UHYHQWVVOLSSLQJDQGVOLGLQJRIJODVVDQGGLQQHUZDUH +HDY\ GXW\ FRQVWUXFWLRQ ZLWK PHWDO UHLQIRUFHPHQW URGVHOLPLQDWHVZDUSLQJ5XEEHUOLQHULVSHUPDQHQWO\ ERQGHGWRWKHWUD\DQGFRYHUVVLGHZDOODQGWUD\WRSWR SURYLGH H[WUD JULS SUHYHQWLQJ FRVWO\ EUHDNDJH DQG VSLOOV6WDLQDQGRGRUUHVLVWDQWGLVKZDVKHUVDIH16) OLVWHG5HGXFHODERUFRVWV  RYDO WUD\ LV GHVLJQHG WR VHUYH DQ HQWLUH EDQTXHW WDEOH ZLWK MXVW RQH WUD\ KROGVSODWHV &RORUV%ODFN  7DQ 

0RGHO'HVFULSWLRQ *5 5RXQG *5 5RXQG *5 5RXQG *5 2YDO *5 2YDO *5 [5HFWDQJOH *5 [5HFWDQJOH *5 [5HFWDQJOH *5 [5HFWDQJOH *5 [5HFWDQJOH *5 [5HFWDQJOH $GGLWLRQDOPRGHOVDUHDYDLODEOH

$

&'HFRUDWRU7UD\FRYHUV 0DGH RI KHDY\ZHLJKW SDSHU IRU JUHDWHU VWUHQJWK HYHQ ZKHQ ZHW WKH GHHSOLQHQ HPERVVHG WH[WXUH RI WKHVH WUD\FRYHUV SURYLGHVH[FHOOHQWVNLGUHVLVWDQFHIRUFOHDQHU WUD\ VHUYLFH ,Q DGGLWLRQ WR ILWWLQJ DOO LQGXVWU\ VWDQGDUG WUD\ VL]HV 'LQH[ WUD\FRYHUV DUH FRQYHQLHQWO\ SDFNDJHG LQ HDV\ WR KDQGOH FDVHV 6SHFLDO SULFLQJ DQG PLQLPXP RUGHU TXDQWLWLHV PD\ DSSO\ WR VSHFLDO FXW GHVLJQV &RQWDFWXVIRUPRUHLQIRUPDWLRQ

&

')HQZLFNŒ7UD\WRS:DUH 7KHGLVWLQFWLYHVFXOSWXUHGGHVLJQDGGVDQDLURIUHILQHPHQW WR SDWLHQW VHUYLFH E\ IXVLQJ WKH HOHJDQW ORRN RI FKLQD ZLWK WKH IXQFWLRQDOLW\ DQG GXUDELOLW\ UHTXLUHG IRU WKH KHDOWKFDUH IRRGVHUYLFH HQYLURQPHQW )HDWXUHV VXSHULRU WHPSHUDWXUH UHWHQWLRQGXUDEOHGRXEOHZDOOFRQVWUXFWLRQZLWKR]RQHVDIH XUHWKDQH IRDP LQVXODWLRQ DQG (=VLS GLVSRVDEOH GULQNWKURXJK OLG $YDLODEOH LQ 6DJH   /DWWH   2Q\[  0LGQLJKW%OXH  DQG&UDQEHUU\   ' 0RGHO'HVFULSWLRQ '; ,QVXODWHG0XJR] '; ,QVXODWHG%RZOR] '; ,QVXODWHG%RZOR] '; ,QVXODWHG'RPH ';)7 7XPEOHUR] ';)7 7XPEOHUR] ';)7 7XPEOHUR] ';)& &XSR]

(&RPSDUWPHQW7UD\V 3HUIHFW IRU XVH LQ VFKRROV FROOHJHV KRVSLWDOV DQGFDIHWHULDV7KHVHFRPSDUWPHQWWUD\VKROG JRYHUQPHQW ³7\SH $´ OXQFK DOO PDWHULDOV DUH )'$ DSSURYHG +HDY\ ULJLG PDWHULDO ZLWK WKH ORRN DQG IHHO RI FKLQD 9HU\ VFUDWFK DQG EUHDN UHVLVWDQWSHUIHFWFKRLFHIRUFRUUHFWLRQDOIDFLOLWLHV )DVW GU\LQJ KLJKO\ UHVLVWDQW WR FKHPLFDOV DQG IRRG DFLGV 7HPSHUDWXUH UDQJH WR ƒ) 3RO\SURS\OHQH$%6  DQG ƒ) 0HODPLQH 3RO\FDUERQDWH 'LVKZDVKHUVDIH$YDLODEOHLQD ZLGHYDULHW\RIFRORUV

%

%&DIp7UD\V (FRQRPLFDO OLJKWZHLJKW WUD\V LQ \RXU FKRLFH RIWKUHHVW\OHV6RIWH[Œ&DIp7UD\VSURYLGH DQ H[FHOOHQW VXUIDFH IRU KRW VWDPSLQJ 6WDQGDUG &DIp 7UD\V IHDWXUH WUDGLWLRQDO VFUDWFKUHVLVWDQWEDVNHWZHDYHGHVLJQZKLFK UHGXFHV VOLSSLQJ DQG KHOSV SUHYHQW DFFLGHQWDO VSLOOV 7UDSH]RLG &DIp 7UD\V DUH GHVLJQHG ZLWK D VSDFHVDYLQJ VKDSH ZKLFK DOORZV GLQHUV WR HDW GLUHFWO\ IURP WUD\V ZLWKRXW UHPRYLQJ SODWHV DQG FXSV +DQGOHG &DIp 7UD\V RIIHU FRQYHQLHQFH LQ FDUU\LQJ DQG SURYLGH DGGHG VWUHQJWK 2YHU  FRORUV DYDLODEOH 0RGHO'HVFULSWLRQ &7 [6WG&DIp 7UD\ &7 [6WG&DIp 7UD\ &7 [6WG&DIp 7UD\ 6&7 [6RIWH[&DIp 7UD\ &7 [+DQGOHG&DIp 7UD\ $GGLWLRQDOPRGHOVDUHDYDLODEOH

(

0RGHO'HVFULSWLRQ  +Y\:JW0HODPLQH /+

 +Y\:JW0HODPLQH 5+

 +Y\:JW0HODPLQH 5+ 6DQGVKDGH5RVH*UDQLWH  +Y\:JW0HODPLQH /+ 6DQGVKDGH5RVH*UDQLWH  $%6 /+

5 $%6 5+

3 3RO\SURS\OHQH /+

35 3RO\SURS\OHQH 5+

 6SDFH6DYHU0HODPLQH 5+

 6SDFH6DYHU0HODPLQH 5+ 6DQGVKDGH5RVH*UDQLWH  6SDFH6DYHU$%6 2PQL'LUHFWLRQDO


'LQLQJ_

$

$6RIW/LJKWŠ /LTXLG:D[&DQGOHV (DFK OLTXLG FDQGOH SURGXFHV D VRRWKLQJ JORZ \HW UHTXLUHV QR FOHDQ XS OLNH WUDGLWLRQDO ZD[ FDQGOH )XOO\GLVSRVDEOH6RIW/LJKWŠ OLTXLGZD[FDQGOHVDUH PDGH RI ELRGHJUDGDEOH SDUDIILQ RI WKH KLJKHVW TXDOLW\ %RWWOHV DUH PDGH RI HDVLO\ UHF\FODEOH SODVWLFIHDWXUHWRSVPDGHIURPUHF\FOHGVWHHODQG DUHFDSSHGZLWKUHVHDODEOHSODVWLFFDSV$YDLODEOH LQ VL]HV WR DFFRPPRGDWH DQ\ WDEOH OLJKWLQJ QHHG %XUQORQJHUFOHDQHUDQGPRUHHIILFLHQWO\WKDQZD[ FDQGOHV6PRNHOHVVDQGRGRUOHVV 0RGHO'HVFULSWLRQ  +U +['

+U +['

+U +['

+U +['

 +U +['

 +U +['

 +U +['

 +U +['

 +U&LWURQHOOD +['

 +U +['

 +U +[' Z6QXII,W  *DOORQ  +U +['

%

%/XPLQD);Œ /XPLQD);ŒLVWKHPRVWVSDFHVDYLQJFRVWHIILFLHQWDQG IXOO\ IHDWXUHG IODPHOHVV UHFKDUJH V\VWHP DYDLODEOH 7KH VWDFNDEOH GHVLJQ VDYHV XS WR  VSDFH FRPSDUHG WR VLPLODUFRPSHWLWLYHLWHPV 0RGHO'HVFULSWLRQ  5HFKDUJH6\VWHPZDQWLWKHIWIHDWXUH  5HFKDUJH6\VWHP  SNUHSODFHPHQWFDQGOHVZDQWLWKHIWIHDWXUH  SNUHSODFHPHQWFDQGOHVRQO\

&

'

&6PDUW&DQGOHŠ (YROXWLRQ6HULHV 6PDUW &DQGOHŠ ³)OLFNHU ZLWKRXW WKH IODPH´² 7KH QH[W JHQHUDWLRQ RI IODPHOHVVWDEOHOLJKWLQJ:LWKLWVLQGXFWLRQFKDUJLQJV\VWHPDQG6PDUW *XDUGWKHIWGHWHUUHQWV\VWHPUHVWDXUDQWVKRWHOVDQGQLJKWFOXEVFDQ SURYLGH WKH PRVW UHDOLVWLF IODPHOLNH DSSHDUDQFH DQ\ IODPHOHVV V\VWHP KDV WR RIIHU  KRXUV RI FDQGOHOLJKW IURP D KRXU FKDUJH /LQNDEOHSLQOHVVLQGXFWLRQFKDUJLQJWUD\/LQNXSFDQGOHVWUD\V WRJHWKHU XVLQJ D VLQJOH SRZHU DGDSWRUZDOO RXWOHW 7ZR PRGHV RI RSHUDWLRQ²IOLFNHU DQG VWDWLF 2SWLRQDO 6PDUW *XDUG DQWLWKHIW SURWHFWLRQ(DFKFDQGOHKDVXSWRKRXUVRIEDWWHU\OLIH 0RGHO'HVFULSWLRQ 0RGHOVZLWK6PDUW*XDUG 3RZHU$GDSWRU (92*&/ FKDUJLQJWUD\ FDQGOHV (92*&/ FKDUJLQJWUD\V FDQGOHV (92*&/ FKDUJLQJWUD\V FDQGOHV (92*&/ FKDUJLQJWUD\V FDQGOHV 0RGHOVZLWKRXW6PDUW*XDUG 3RZHU$GDSWRU (92;&/ FKDUJLQJWUD\ FDQGOHV (92;&/ FKDUJLQJWUD\V FDQGOHV (92;&/ FKDUJLQJWUD\V FDQGOHV (92;&/ FKDUJLQJWUD\V FDQGOHV

(

'7UDGLWLRQDO:D[&DQGOHV 7HD/LJKWV WR 7DSHUV WR 3LOODU FDQGOHV  +LJK TXDOLW\ ZD[ FDQGOHV WR VHUYH DOO \RXU QHHGV 0RGHO'HVFULSWLRQ 7/ 7HD/LJKWVKRXU  :D[9RWLYHVKRXU  :D[9RWLYHVKRXU $ %LUWKGD\&DQGOHVSN $GGLWLRQDOPRGHOVDYDLODEOH

('LVSRVDEOH)XHO&HOOV /DERU VDYLQJ²MXVW SODFH LQ ODPS DQG OLJKW 7KH EHVW OLTXLG ZD[ ODPS IXHO DYDLODEOH²EXUQV FOHDQHU WKDQ VROLG ZD[ FDQGOHV 1RQVWDLQLQJ DQG QR PHOWHG ZD[ PHVV $OO +ROORZLFN ODPSV FDQEHXVHGZLWKGLVSRVDEOHIXHOFHOOV6ROGE\WKHFDVH6DIHWRXVHRQWKHWDEOHWRSDQGWKHUH DUHQRVKLSSLQJUHVWULFWLRQVVWRUDJHOLPLWDWLRQVRULQVXUDQFHZRUULHV 0RGHO'HVFULSWLRQ +' +U/LTXLG7HDOLJKW'LVS)XHO&HOO+['LD +' +U/LTXLG9RWLYH'LVS)XHO&HOO+['LD +' +U/LTXLG9RWLYH'LVS)XHO&HOO+['LD +' +U'LVS)XHO&HOO+['LD +' +U'LVS)XHO&HOO+['LD +' +U'LVS)XHO&HOO+['LD +HLJKWGRHVQRWLQFOXGHEXUQHUDVVHPEO\$GGLWLRQDOPRGHOVDYDLODEOH


'LQLQJ_ $7,.,Š %UDQG2XWGRRU/LJKWLQJ3URGXFWV 7,.,Š %UDQGRXWGRRUOLJKWLQJSURGXFWVDUH$PHULFD¶V EUDQG IRU FLWURQHOOD IXHO DQG RXWGRRU WRUFKHV 1HZ %LWH)LJKWHU Š DGYDQFHG IRUPXOD WRUFK IXHO XVHV WKH QDWXUDO UHSHOOHQF\ RI &LWURQHOOD DQG &HGDU 2LO IRU WKDW RQHWZR SXQFK RI DPELDQFH DQG PRVTXLWR UHSHOOHQF\ ,IUHILOOLQJLVQRWIRU\RXWU\WKHFRQYHQLHQW%LWH)LJKWHUŠ 5HDG\  /LJKW Š  RXQFH GLVSRVDEOH WRUFK IXHO FDQLVWHU 7,., Š %UDQG 7UDGLWLRQDO 2XWGRRU 7RUFKHV VWDQG  IW WDOO FRPH ZLWK D VQXIIHU FDS DQG KDYH DQ DQJOH FXW ERWWRP IRU HDVH RI SODFLQJ LQ WKH JURXQG 7KH\ DUH KDQGFUDIWHG IURP PDWHULDOV OLNH EDPERR ZLFNHUDQGUDWWDQ 0RGHO'HVFULSWLRQ 7. ,VODQGHU2XWGRRU7RUFK+ 7. 0HGLWHUUDQHDQ2XWGRRU7RUFK+ 7. 5R\DO3RO\QHVLDQ2XWGRRU7RUFK+ 7. +HULWDJH3DWLR7RUFK'LD[+ 7. 7RUFK6WDQG'HHS&KDUFRDO[6TXDUH 7. 'HFN&ODPS8QLYHUVDO)LW 7+ &LWURQHOOD2LO)XHO+U&HOOV R]

7. &LWURQHOODZ/HPRQJUDVV7RUFK)XHOR] 7. %LWH)LJKWHU &LWURQHOOD &HGDU7RUFK)XHOR] $GGLWLRQDOPRGHOVDYDLODEOH

% %5HJLVW5ROOVŠ 6L]HG WR ILW PRVW IRRGVHUYLFH FDVK UHJLVWHUV DQG SULQWHUV 5HJLVW5ROOV Š UXQ  ORQJHU WKDQ PDQ\ PDLO RUGHU GHDOHU DQG RIILFH VXSSO\ EUDQGV (DV\ WR RSHQ²UROOV DUHVHDOHGZLWKDUHPRYDEOHWDE²QRWJOXHG &RQYHQLHQW GHOLYHU\ PHDQV OHVV WLPH ZDVWHG DW WKH VWRUH 0RGXODU DQG VSLOO SURRI SDFNDJLQJPDNHVLWHDV\WRGLVWULEXWH UROOV DPRQJ VWDWLRQV &DVK UHJLVWHU DQG FUHGLW FDUG PDFKLQH UROOV DUH D PXVW KDYH IRU HYHU\ RSHUDWLRQ 2QH3O\ 7ZR3O\ 7KHUPDO DQG 5LEERQ VW\OHV DYDLODEOH 0RGHOV636363VKRZQ $YDULHW\RIPRGHOVDYDLODEOH

Š

'

&

&&DIp6W\OH&OHDU6HZQ(GJH0HQX-DFNHWV 0DQXIDFWXUHGZLWKWRSTXDOLW\WHQJDXJHFU\VWDOFOHDU YLQ\O IRUPXODWHG WR UHVLVW VFUDWFKLQJ DQG FUDFNLQJ DQG D GRXEOH VWLWFKHG WXUQHG HGJH UHLQIRUFHG YLQ\O ELQGLQJ IRU PD[LPXP GXUDELOLW\ 0HWDO &RUQHUV FULPSHG RQ ZLWK VSHFLDOL]HG PDFKLQHU\ WR HQVXUH WKH\GRQRWIDOORII6L]HVDQGFRQILJXUDWLRQVPDUNHG ZLWK DQ  DUH ³,Q 6WRFN´ ZLWK EODFN EXUJXQG\ DQG JUHHQ YLQ\O ELQGLQJ JROG FRUQHUV DQG FOHDU YLQ\O SDQHOV 2WKHU FXVWRP VW\OHV FRORUV DQG VL]HV DUH DYDLODEOHLQFOXGLQJPDWWHQRQJODUHSDQHOV 0RGHO'HVFULSWLRQ 6LQJOH3RFNHW7RS/RDGLQJ 6(& )LWV[,QVHUW 6(' )LWV[,QVHUW 'RXEOH3RFNHW6LGH/RDGLQJ 6(& )LWV[,QVHUW 6(' )LWV[,QVHUW 7ULSOH3RFNHW*DWHIROG6LGH/RDGLQJ 6(& )LWV[,QVHUW HDSNW

6(' )LWV[,QVHUW HDSNW  7ULSOH3RFNHW6LGH/RDGLQJ 6(& )LWV[,QVHUW HDSNW

6(' )LWV[,QVHUW HDSNW

4XDG3RFNHW%RRNOHW6LGH/RDGLQJ 6(& )LWV[,QVHUW HDSNW  6(' )LWV[,QVHUW HDSNW

$GGLWLRQDOPRGHOVDYDLODEOH

'5HVWDXUDQW*8(67&+(&.Œ'XSOLFDWH ³0HQX3URPSW´IHDWXUHUHPLQGVVHUYHUVWRVXJJHVWH[WUDLWHPVEHYHUDJHV GHVVHUWV VDODGV DQG PRUH 7KH *XHVW&KHFNŒ RULJLQDWHV WKH RUGHU SURFHVVDQGKHOSVFRQWUROLQYHQWRU\DQGFDVKIORZ*UHDWWUDLQLQJGHYLFH² PHQXSURPSWVDQGWDEOHGLDJUDPVKHOSWKHVHUYHULPSURYHVHUYLFH6LQJOH &RS\3DSHU&KHFNVDQG:DLW53DGVPDGHZLWKUHF\FOHGILEHU$YDULHW\RI PRGHOVDYDLODEOH

(

(

0HQXV 7KH PHQX FRYHU LV RQH RI WKH ILUVW LWHPV WKDW D FXVWRPHU VHHV DQG LV LPSRUWDQW LQ HVWDEOLVKLQJ TXDOLW\ SULFH DQG WKH WKHPH RI \RXU UHVWDXUDQW $ ZHOO GHVLJQHG PHQX ZLOO JHW \RXU GLQ HUVLQWKHPRRGWRHDW 2SWLRQVWKDW\RXFDQLQFRUSRUDWHLQWR \RXU PHQX GHVLJQ LQFOXGH \RXU ORJR SKRWRV RI \RXU VLJQDWXUH GLVKHV SKRWRV RI SHRSOH HQMR\LQJ \RXU IRRG \RXU PLVVLRQ VWDWHPHQW SKRWRV RI VWDII 0DNHLWH\HFDWFKLQJDQGSURIHVVLRQDO

('LVSRVDEOH%LEV $GXOW ELEV DYDLODEOH LQ ZKLWH RU OREVWHU SULQW &KLOGUHQ¶V ELE DYDLODEOH LQ MXQJOH IDUP DQLPDO SULQW $OO SURGXFWV KDYH D FDWFK SRFNHW WR SURWHFW IURP DFFLGHQWDO VSLOOV 0RGHO'HVFULSWLRQ $ $GXOW%LE[ / /REVWHU%LE & 3ULQWHG&KLOGUHQ¶V%LE


%HYHUDJH%DU 6XSSOLHV

$

%DUZDUH %HYHUDJH6HUYHUV 3RXUHUV %DU6HUYLFH&KHFNOLVW %DUV  /RXQJHV5HVWDXUDQWV %OHQGHU   ,FH6FRRS   &RFNWDLO6KDNHUV   -LJJHUV   3RXUHUV G] G] &XWWLQJ%RDUG   7RZHO+ROGHUV   -XOHS6WUDLQHU   :LUH%DU6WUDLQHU   )UXLW.QLIH   )UXLW3HHOHU   0L[LQJ6SRRQV   0XGGOHU   6XJDU&DGG\   %DU)UXLW&DGG\   &RUN5HPRYHUV   6SHHG5DFNV   6WLUUHUV P P ,FH%XFNHWV   :DWHU3LWFKHUV   %HHU3LWFKHUV   $VVXPHVSHRSOHVHUYHG

$3RXUHUV 0HDVXUHG3RXUHU 3 SURYLGHVDIDVWHDV\DQGFRVWHIIHFWLYHZD\ WR FRQWURO \RXU LQYHQWRU\ E\ FKDQJLQJ WKH ZDVWH IURP IUHH SRXUHUV LQWR GULQN VDOHV 3DWHQWHG &KURPH 7DSHUHG 3RXUHU ZLWK IOLS WRS 03

DQG &KURPH 7DSHUHG 3RXUHU 03  JLYH \RX HDV\ SRXUV DQG ODVWLQJGXUDELOLW\7KHLQH[SHQVLYH)UHH3RXUHUV 23 23 DUH H[FHOOHQW EXON SRXUHUV 7KH &KURPH 3ODWHG 6FUHHQ 3RXUHU %3  LV SDWHQWSHQGLQJDQGDWRSVHOOHU3RXUHUVDYDLODEOHLQYDULHW\RIVL]HVDQG FRORUV %%DU6XSSOLHV :RRG &RQGLPHQW +ROGHU DQG %DU &DGG\ &+  %5  FRPH LQ KD]HO EORQG EODFN RU FKURPH SODWHG +ROGHU DOVR DYDLODEOH LQ D  SLQW YHUVLRQ9LQ\O&RDWHG%RWWOH2SHQHUV &295UHG DQGSDWHQWHG9LQ\O &RDWHG6WDLQOHVV6WHHO6KDNHUVFRPHLQFRORUVRUDQJHUHGJUHHQEOXH RUEODFNRUFDQEHPDWFKHGWRDQ\306FRORUDVDFXVWRPRUGHU6KDNHUV DYDLODEOH LQ  R] &6 9%/.  RU  R] VL]HV &XVWRP LPSULQWLQJ DYDLODEOH

%

%HYHUDJH6HUYHU&DSDFLWLHV RXQFHVHUYHU FXSV OLWHUVHUYHU FXSV  OLWHUVHUYHU FXSV OLWHUVHUYHU FXSV

7HPSHUDWXUH5HWHQWLRQIRU+RW%HYHUDJHV )RU 3ODVWLF ,QVXODWHG 6HUYHUV WHPSHUDWXUH ZLOO GURS DSSUR[LPDWHO\ƒ)LQWKHILUVWKRXUƒ)LQWKHVHFRQGKRXU DQGƒ)LQWKHWKLUGKRXU

&%DU(VVHQWLDOV 7RROVGHVLJQHGWRLQFUHDVHSURILWVDQGNHHSFXVWRPHUVFRPLQJEDFN2XU QHZHVWOLQHRIEDUQHFHVVLWLHVLQFOXGH 3UHPLXP 3RXUHUV 2XU ³WKUHH EDOO´ PHDVXUHG SRXUHUV KDYH D SDWHQWHG GHVLJQ WKDW HQVXUHV DFFXUDWH SRXUV ORQJ OLIH DQG PRUH SURILW SHU ERWWOH )RXU VL]HV DYDLODEOH LQ EOXH FOHDU JUHHQ DQG UHG FROODUQR FROODU ZLGH FRUNDQGIOLSWRSGHVLJQV %HWWHUZD\3RXUHUV (FRQRPLFDORQHSLHFHSRXUHULQYDULRXVFRORUV .RYHU$OO'XVW&DSV8QLYHUVDOGHVLJQILWVPRVWSRXUHUV 6FRRSV +HDY\GXW\SRO\FDUERQDWHDQGSRO\VW\UHQHVRPH16)DSSURYHG 3RZHU %RPE &XS  R] LQQHU DQG  R] RXWHU FXS 6WDFNDEOH GLVKZDVKHUVDIHDQGUHXVHDEOH8VHVOHVVHQHUJ\GULQNSHUVKRW

)RU *ODVV ,QVXODWHG 6HUYHUV WHPSHUDWXUH ZLOO GURS DSSUR[LPDWHO\ ƒ) WR ƒ) HYHU\ KRXU 5HVXOWV DUH EDVHG RQ SUHKHDWLQJVHUYHUVZLWKERLOLQJZDWHUSULRUWRXVH 8UQ&DSDFLWLHV 8UQ6L]H &XS &XS &XS

*URXS6L]H *XHVWV *XHVWV *XHVWV

&


%HYHUDJH%DU6XSSOLHV_ $

$3URSHU3RXUŒ0HDVXUHG3RXUHUV $FFXUDWH SRXU IRU FRQVLVWHQW GULQNV HYHU\ WLPH 0HDVXUHG SRXUHUV HOLPLQDWH RYHU SRXUV DQG ERRVW SURILWV &RORUFRGHG GLS WXEH LQGLFDWHV PHDVXUHPHQWIURP R]WRR] 0RGHO'HVFULSWLRQ $ 5HG&ROODU%ODFN'LS7XEH R] $ 5HG&ROODU*UHHQ'LS7XEH R] $ 5HG&ROODU%OXH'LS7XEH R] $ 5HG&ROODU5HG'LS7XEHR] $ 5HG&ROODU3XUSOH'LS7XEH R] $ 5HG&ROODU&OHDU'LS7XEH R] $ 5HG&ROODU<HOORZ'LS7XEH R] $ 5HG&ROODU:KLWH'LS7XEHR] $ 6PRNH&ROODU%ODFN'LS7XEH R] $ 6PRNH&ROODU*UHHQ'LS7XEH R] $ 6PRNH&ROODU%OXH'LS7XEH R] $ 6PRNH&ROODU5HG'LS7XEHR] $GGLWLRQDOPRGHOVDYDLODEOH

0RGHO'HVFULSWLRQ %DU0DW[[ 90%. %ODFN 90&/ &OHDU 905' 5HG 90:1 :LQH 6WULS[['LVKZDVKHU6DIH 90%. %ODFN2QO\

*

(

, + . / 0

' '&RPPHUFLDO-XLFH3UHVVHV 1RWKLQJ WDVWHV OLNH IUHVK VTXHH]HG MXLFH :KHWKHU LW V D JODVV RI RUDQJH MXLFH RU OLPH MXLFH IRU D UHIUHVKLQJPDUJDULWD)RFXVMXLFHSUHVVHVSURGXFH WKHVZHHWHVWMXLFHSRVVLEOH²IUHHRIELWWHUVNLQRLOV -XSLWHUŒ DQG WKH H[WUD ODUJH 2O\PSXVŒ MXLFHUV SURYLGH PD[LPXP SUHVVXUH ZLWK PLQLPDO HIIRUW ,WV XOWUDVWURQJ DQG GXUDEOH FDVW LURQ FRQVWUXFWLRQ ZLWKVWDQGV WKH ULJRUV RI FRPPHUFLDO IRRGVHUYLFH RSHUDWLRQV (QDPHO ILQLVK UHVLVWV FLWUXV DFLGV SLWWLQJDQGFRUURVLRQ6XUHJULSUXEEHUKDQGOHVDUH HUJRQRPLF DQG HDV\ WR KROG DQG XVH 5XEEHU VXFWLRQ FXS IHHW IRU VDIH RSHUDWLRQ $YDLODEOH LQ EODFNRUZKLWHWRPDWFKDQ\GHFRU16)FHUWLILHG 0RGHO'HVFULSWLRQ  -XSLWHU:KLWH  -XSLWHU%ODFN  2O\PSXV:KLWH  2O\PSXV%ODFN

(3$VVRUWHG%DUZDUH 0DQXIDFWXUHUV RI WKH RULJLQDO %DQ0Š VFUHHQHG SRXUHUV DQG WKH &KURPH 7DSHUHG PHWDO SRXUHUV 6SLOO6WRS RIIHUV D FRPSOHWH OLQH RI EDU VXSSOLHV VSHFLDOL]LQJ LQ ³KDQG WRROV IRU WKH EDUWHQGHU´ ([WHQVLYHSURGXFWOLQHLQFOXGHVSODVWLFDQGPHWDOOLTXRUSRXUHUVFRQWUROSRXUHUVEDUUDLOPDWVEDU DLGH FDGGLHV VWDLQOHVV EDU DFFHVVRULHV LQFOXGLQJ FRFNWDLO VKDNHUV VWUDLQHUV LFH VFRRSV ERWWOH VSHHGUDLOVFRUNVFUHZVEDUJODVVEUXVKHVEDUVKHOIOLQHUJODVVULPPHUVHUYLQJDQGWLSWUD\VEHHU SLWFKHUVFRQGLPHQWFRQWDLQHUVFRFNWDLOSLFNVDQGRWKHUEDUDFFHVVRULHV

)

3

%

&9HUVD0DWŠ ,QWHUORFNLQJ EDU PDWWLQJ WKDW FDQ EH XVHG LQ D YDULHW\ RI ORFDWLRQV 3HUIHFW IRU OLQLQJ \RXU EDU DQG GLQQHUZDUH VKHOYLQJ/LJKWZHLJKWDQGFDQEHHDVLO\ FXW WR ILW LQWR DQ\ FRQWRXU VKDSH ,WV XQLTXH GHVLJQ DOORZV IRU VXSHULRU DLUIORZDQGPRLVWXUHGUDLQDJHIRUIDVWHU GU\LQJ ,WV UDLVHG QRQVOLS VXUIDFH SUHYHQWV JODVVZDUH FKLSSLQJ DQG FRQWDPLQDWLRQ $YDLODEOH LQ D YDULHW\ RI FRORUVWRPDWFKDQ\GHFRU1HZ³VWULSV´ DUH WKH ILUVW LQWHUORFNLQJ PDW GHVLJQHG IRUGUDLQDEOHEDUUDLOV

&

-

%6DIHU)RRG6ROXWLRQVŒ3RXU0DVWHUŠ 6HULHV 3DWHQWHG 6DIHU)RRG 6ROXWLRQVŒ 3RXU0DVWHUŠ 6HULHV LV 16) FHUWLILHG &RORUFRGHG IRU HDV\ VWRUDJH DQG LGHQWLILFDWLRQ 8OWLPDWH LQ IRRG SUHS VWRUDJH DQG VDIHW\ LQ WKH NLWFKHQ RU EHKLQG WKH EDU (DV\ WR FOHDQ²DVVXUHG VDQLWDWLRQ 'LVKZDVKHU VDIH 0RGHOV VKRZQ²1$ WRS OHIW  1/3$ WRSULJKW 160$ ERWWRP  0RGHO'HVFULSWLRQ HDFRORULQFOXGHV&RQWDLQHU7RS&DS 1$ /RQJ1HFN7RSŒ4XDUW$VV G&RORUV 1/3$ /RZ3URILOH7RSŒ4XDUW$VV G&RORUV 160$ 4XDUW$VV G&RORUV

1 2

0RGHO'HVFULSWLRQ (  7ULSOH*ODVV%UXVK )  66&RFNWDLO6KDNHUR] *  %DU$LGH2UJDQL]HU +  66,FH6FRRS ,  *ODVV5LPPHU -  &RFNWDLO6WUDLQHU3URQJ

0RGHO'HVFULSWLRQ . 7. %DU6SRRQZ7ZLVWHG+GO  .QRE /  :LQJHG&RUNVFUHZ 0  :DLWHU¶V&RUNVFUHZ 1  &KURPH7DSHUHG3RXUHUZ3RO\.RUN 2  %DQ0Š 3RXUHU 3  [%DU0DW%ODFNRU%URZQ


%HYHUDJH%DU6XSSOLHV_

$&DPVHUYHUV,QVXODWHG%HYHUDJH6HUYHUV .HHS EHYHUDJHV KRW ZLWKRXW KHDWLQJ IXHO RU HOHFWULFLW\²QR FRPEXVWLEOH RU IODPPDEOH PDWHULDOV WR LJQLWH )XOO\ LQVXODWHG LQQHU FRUH DQG WLJKW VHDO JDVNHWV SURYLGH WHPSHUDWXUH PDLQWHQDQFH ,QWHUFKDQJHDEOH GHFRUDWLYH EUDVV EHYHUDJH SODWHV LQFOXGHG IRU DQ XSVFDOH DSSHDUDQFH &RQYHQLHQW UHILOO FDS RSHQV ZLWK RQH KDQG +LJK VSLJRW SRVLWLRQ HDVLO\ ILOOV JODVVHV RU FDUDIHVQR ULVHUV QHHGHG &RORUV 7DXSH%ODFNDQG*UDQLWH*UH\0RGHOV&65 DQG&65VKRZQ 0RGHO'HVFULSWLRQ &65 *DO&DS&XSV &65 *DO&DS&XSV

$

&

%

%&DPWDLQHUV +ROG WUDQVSRUW DQG VHUYH KRW RU FROG EHYHUDJHV 9HUWLFDO GHVLJQ RIIHUV WKH EHVW WHPSHUDWXUH UHWHQWLRQ &RUURVLRQIUHHGHQWDQGVFUDWFKUHVLVWDQWGHVLJQ2QH SLHFH SRO\HWK\OHQH RXWHU VKHOO FRPELQHG ZLWK WKLFN IRDP FRUH LQVXODWHV DJDLQVW KHDW ORVV IRU KRXUV 6HOI DGKHVLYH ODEHO VHW LQFOXGHG +DQGZDVKLQJ VWDWLRQ DWWDFKHV HDVLO\ WR &DPWDLQHUV RU 8OWUD &DPWDLQHU %HYHUDJH 6HUYHUV &KRRVH IURP D YDULHW\ RI FRORUV DQGRSWLRQV 0RGHO'HVFULSWLRQ /&' JDO /&'  JDO /&' JDO /&' JDO /&' 6RXS JDO 8& 8OWUD JDO 8& 8OWUDJDO 8& 8OWUDJDO $GGLWLRQDOPRGHOVDYDLODEOH

&3UR6HUYHŒ,FH+DQGOLQJ6\VWHP ,PSURYHV SURGXFWLYLW\ ZKLOH SURPRWLQJ VDIH KDQGOLQJ RI LFH WR UHGXFH WKH ULVN RI FURVVFRQWDPLQDWLRQ DQG LPSURYHG HPSOR\HH VDIHW\ ,FH WRWH ZLWK ELQ DGDSWHU DWWDFKHV WR DOPRVW DQ\ LFH PDFKLQH WR NHHS ZHLJKW HOHYDWHG RII IORRU WR UHGXFH EDFN VWUDLQ ,FH WRWH KDV DQ HUJRQRPLF FRPIRUW JULS KDQGOH DQG DQJOHG WRS WR SUHYHQWVSLOOVZKHQSRXULQJ5HDUKDQJKRRNDOORZVWRWHWRKDQJXSVLGHGRZQWR GU\7KHR]6FRRSZLWK+DQG*XDUG +ROGHUKDVDQDQJOHGKDQGOHSRVLWLRQ WR LPSURYH OHYHUDJH DQG UHGXFH ZULVW VWUDLQ IUDPH KROGHU SURYLGHV VDIH GU\LQJ DQG HDV\ DFFHVV 7KH  R] 6FRYHO KDV WZR KDQGOHV WR SURYLGH PD[LPXP OHYHUDJHDQGFRQWUROIRUPRYLQJODUJHDPRXQWVRILFH'LVKZDVKHUVDIH16) 0RGHO'HVFULSWLRQ )*)7%/8( ,FH7RWH JDO '6OLGLQJ/LGŒ,FH&DGGLHV )*)7%/8( ,FH7RWHZ%LQ+RRN$GDSWHU JDO ,QGRRUVRURXWGRRUVLQKHDWRUKXPLGLW\WKHVH )*)7%/8( 6FRYHO7ZR+DQGOHG6KRYHOR] LFH FDGGLHV NHHS WKHLU FRRO DQG KROG LFH FROG )*)7%/8( 6FRRSZ+DQG*XDUG +ROGHUR] IRU GD\V 3RO\HWK\OHQH ERG\ DQG WKLFN IRDP )*)7%/8( 6FRRSZ+DQG*XDUGR] LQVXODWLRQSURYLGHRSWLPXPGXUDELOLW\DQGORQJ ODVWLQJLFHVWRUDJH6OLGLQJOLGKHOSVUHGXFHWKH ULVN RI FURVV FRQWDPLQDWLRQ 6OLGHV EDFN DQG (6DI7,FH7RWH *XDUGLDQ6\VWHPŒ XQGHU IRU TXLFN DQG HDV\ DFFHVV DQG VOLGHV ,FH 7RWHV IHDWXULQJ QHZ +$&&3 +DQJHU 7KH +$&&3 +DQJHU VKXW IRU VDIH DQG VDQLWDU\ VWRUDJH 5HFHVVHG DOORZVXVHUVWRKDQJWKH6DI7,FH7RWHRIIDQ\LFHELQ5DLVLQJ ZHOO DQG GUDLQ VKHOI NHHS LFH RXW RI ZDWHU WKH WRWH RII WKH JURXQG NHHSV WKH ERWWRP VXUIDFH FOHDQ DQG 5HFHVVHGKDQGOHRIIHUVVDIHUPRUHEDODQFHG HDVHV EDFN VWUDLQ E\ EULQJLQJ WKH WRWH XS WR ZDLVW OHYHO ZKLOH ' OLIWLQJE\WZRSHRSOH ILOOLQJ²DOO DW QR DGGLWLRQDO FRVW 7KH +$&&3 +DQJHU LV DYDLODEOH ZLWK WKH 6DI7,FH 7RWH DQG WKH GLVKZDVKHUVL]HG 6+257<,FH7RWH7KUHHVL]HVRI6DI7,FH6FRRS *XDUGLDQ 6\VWHPV DYDLODEOH² R]  R]  R] DQG  R]'LVKZDVKHUVDIH16) 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ *XDUGLDQ6\VWHPZ6FRRS+ROGHU 0RXQWLQJ+DUGZDUH ,&6/ OE);6:% 6, R] ,&6/% OE6:%%: 6, R] ,&67 OE6:% 6, R] ,&676 OE6:% 6, R] ,&6/ OE);6:% 6DI7,FH7RWH ,&6/% OE6:%%: 6, 6KRUW\*DO ,&67 OE);6:% 6, *DO ,&67% OE6:%%: 6, 6QDS7LJKW/LG ,&67% OE6:%: 6DI76FRRS ( 6, R] 6, R] 6, R] 6, R]


%HYHUDJH%DU6XSSOLHV_ $%HYHUDJH'LVSHQVHU (QKDQFH \RXU EHYHUDJH SUHVHQWDWLRQ ZLWK 7DEOHFUDIW¶V FROG EHYHUDJH GLVSHQVHUV 3HUIHFW IRU DOO MXLFHV DQG FKLOOHG QRQFDUERQDWHG EHYHUDJHV 7KH EDVH DQG FRYHU DUH FRQVWUXFWHG IURP VWDLQOHVV VWHHO ZKLOH WKH FOHDU %3$ IUHH SODVWLF UHVHUYRLU JLYHVDSHUIHFWYLHZRIZKDWLVLQVLGH7KHVHEHYHUDJHGLVSHQVHUVIHDWXUHDXQLTXH UHPRYDEOH LQIXVHU DQG FHQWHU LFH FRUH ZKLFK NHHSV WKH EHYHUDJH FROG ZLWKRXW ZDWHULQJLWGRZQ0RGHOVKRZQ 0RGHO'HVFULSWLRQ   JDOZ5HPRYDEOH,QIXVHU ,FH&RUH  JDOZ5HPRYDEOH,QIXVHU ,FH&RUH

$

%(OHFWULF-XLFH'LVSHQVHU 7KLV XQLTXH UHIULJHUDWHG HOHFWULF MXLFH GLVSHQVHU ZLOO NHHS FRQWHQWV DW D FRQVWDQW WHPSHUDWXUH1RQHHGIRULFHVRLWZRQ¶WGLOXWH \RXU MXLFHV 3RO\FDUERQDWH FRQWDLQHU ZLOO QRW EUHDNVFUDWFKRUVWDLQ0LUURUSROLVKVWDLQOHVV VWHHO FRQVWUXFWLRQ LV HOHJDQW DQG VWURQJ  JDOORQFDSDFLW\8/OLVWHG0RGHO(-'66

% &

'*ODVV/LQHG$LUSRWV .HHS \RXU FRIIHH KRW IRU KRXUV ZLWK WKHVH YDFXXP LQVXODWHG JODVV OLQHG DLUSRWV²SHUIHFW IRU DQ\ FRIIHH VKRSKRWHOFRQYHQLHQFHVWRUHRUUHVWDXUDQW)HDWXUHV D VPRRWK PDJQHWLF VWDLQOHVV VWHHO ILQLVK UHPRYDEOH OLG VZLYHO EDVH DQG EUXWKUX VWHP &KRRVH OHYHU RU SXVKEXWWRQWRSLQRURUOLWHUFDSDFLWLHV 0RGHO'HVFULSWLRQ 1/'%.6) /WU/HYHU%ODFN 1/'256) /WU/HYHU'HFDI 1/'%.6) /WU/HYHU%ODFN 1/'256) /WU/HYHU'HFDI 1/'%.6) /WU/HYHU%ODFN 1/'256) /WU/HYHU'HFDI 13'%.6) /WU3XVK%XWWRQ%ODFN 13'256) /WU3XVK%XWWRQ'HFDI 13'%.6) /WU3XVK%XWWRQ%ODFN 13'256) /WU3XVK%XWWRQ'HFDI 13'%.6) /WU3XVK%XWWRQ%ODFN 13'256) /WU3XVK%XWWRQ'HFDI

(

'

&7KH'RPHŠ *DUQLVK &RQGLPHQW&HQWHUV 7KH'RPHŠ IDPLO\RISURGXFWVSURYLGHVKLJKFDSDFLW\YHUVD WLOH DQG VDQLWDU\ VROXWLRQV LGHDO IRU DQ\ DSSOLFDWLRQ 7KH 'RPHŠ PDNHV IRRG SUHS DQG FRQGLPHQW RUJDQL]DWLRQ HDV\ 7DLORUHGWRILWRQVWDQGDUGPL[LQJUDLOVWKH'RPHŠ IHDWXUHVD SDWHQWHG GRPH OLG WKDW URWDWHV EDFN IRU HDV\ DFFHVV DQG LQFUHDVHG FDSDFLW\ ZKHQ FORVHG 7KH VPDOO IRRWSULQW RI WKH 0LQL'RPHŠ DVVXUHVLWZLOOILWDQ\DSSOLFDWLRQ'RPHŠ 6WDFNHUV DOORZIRUFXVWRPL]HGFRQILJXUDWLRQVLQDFRPSDFWIRRWSULQWWR ILWYLUWXDOO\DQ\VSDFH 0RGHO'HVFULSWLRQ 'RPHŠ &RQGLPHQW&HQWHUV %'  TW'HHS7UD\V  +DQGOHV %'  SW'HHS7UD\V  +DQGOHV %'   SW6WDQGDUG7UD\V  +DQGOHV 0LQL'RPHŠ &RQGLPHQW&HQWHUV ‡,QFOXGHV  &RQQHFWRU  (QG&DSV %'  TW'HHS7UD\ %'  TW6WDQGDUG7UD\ %'  SW6WDQGDUG7UD\V %'1/   SW'HHS7UD\VZ1RWFKHG/LG 'RPHŠ 6WDFNHUV&RQGLPHQW&HQWHUV %'6  SW6WDQGDUG7UD\V %RQXV  TW7UD\V %'6  SW6WDQGDUG7UD\V $GGLWLRQDOPRGHOVDYDLODEOH

(6TXDUH%HYHUDJH'LVSHQVHUV 6HUYHFKLOOHGUHIUHVKLQJEHYHUDJHV6KRZFDVH\RXUEHYHUDJHVZLWKWKLVHOHJDQWDQG VW\OLVK EHYHUDJH GLVSHQVHU 0DGH IURP FU\VWDO FOHDU JODVV RU DFU\OLF WKLV GLVSHQVHU EHDXWLIXOO\GLVSOD\VMXLFHVZDWHULFHGWHDDQGDQ\RWKHUGULQNRI\RXUFKRLFH&KRRVH IURP LFH RU LQIXVLRQ FKDPEHU PRGHOV LQ  JDOORQ RU  JDOORQ FDSDFLWLHV )HDWXUHV UHPRYDEOHLFHLQIXVLRQFKDPEHUDQGUHPRYDEOHVSLJRWIRUFOHDQLQJ%3$IUHH 0RGHO'HVFULSWLRQ  *ODVV *DO:['[+  *ODVV*DO:['[+ ,1) *ODVVZ,QIXVLRQ *DO:['[+ ,1) *ODVVZ,QIXVLRQ*DO:['[+ $ $FU\OLF JDO:['[+ $ $FU\OLFJDO:['[+ $,1) $FU\OLFZ,QIXVLRQ JDO:['[+ $,1) $FU\OLFZ,QIXVLRQJDO:['[+


.LWFKHQ6XSSOLHV

$

&RRNZDUH 8WHQVLOV 3UHS 6DIHW\ &KHI$SSDUHO &KRRVLQJWKH&RUUHFW.QLIH &XWWLQJLVTXLFNHUDQGHDVLHUZKHQ\RXXVHWKHFRUUHFWNQLIH IRU WKH MRE +HUH DUH VXJJHVWLRQV WR KHOS \RX FKRRVH WKH SURSHUW\SHRINQLIHIRUHDFKFXWWLQJMRE   ´7KH &KHI·V .QLIHµ² $OVR NQRZQ DV &RRN·V .QLIH RU )UHQFK.QLIH 8VHGIRUDOONLQGVRIKHDY\GXW\FXWWLQJDV ZHOO DV FKRSSLQJ GLFLQJ DQG VKUHGGLQJ 7KH XOWLPDWH LQ FXWOHU\IRUWKHJRXUPHWFRRN ´7KH6OLFHUµ²,GHDOIRUKDPDQGODUJHFXWVRIPHDW6OLFHV URDVWHGPHDWVFKLFNHQDQGWXUNH\

$&RQQRLVVHXUŠ &XWOHU\ 7KH ILQHVW SURIHVVLRQDO FXWOHU\ IRU WKH GLVFULPLQDWLQJ FKHI FRPELQLQJ PRGHUQ (XURSHDQ VW\OLQJ DQG WKH FXWWLQJ SHUIRUPDQFH RI $PHULFDQ FUDIWVPDQVKLS (DFK EODGH LV FUDIWHG IURP WKH KLJKHVW TXDOLW\ VWDLQIUHH KLJKFDUERQ VWHHO KHDWWUHDWHG WR SUHFLVH KDUGQHVV DQG HGJHV KDQGJURXQG WR XOWLPDWH VKDUSQHVV +DQGOHV DUH IDVKLRQHGZLWKWKHZDUPWKRIWUDGLWLRQDOURVHZRRG DQG VHFXUHG ZLWK ODUJH EUDVV FRPSUHVVLRQ ULYHWV DQG DUH LPSHUYLRXV WR VWDLQ KRW ZDWHU DQG IRRG DFLGV 0RGHO'HVFULSWLRQ 3&3 3DULQJ.QLIH )RUJHG3DULQJ.QLIH 3&3 3&3 )RUJHG%D\RQHW)RUN 3&3 +HDY\)RUJHG)RUN 13&3 1DUURZ%RQLQJ.QLIH 3&3 &XUYHG%RQLQJ.QLIH 3&3 &RRN¶V.QLIH 3&3 &RRN¶V.QLIH '3&3 'XR(GJH5RDVW6OLFHU 3&3 'XR(GJH5RDVW6OLFHU '3&3 'XR(GJH5RDVW6OLFHU ':3&3 :LGH'XR(GJH5RDVW6OLFHU  )RUJHG&KHI¶V6HWSF $GGLWLRQDOPRGHOVDYDLODEOH

  ´7KH %UHDG .QLIHµ²6OLFHV EUHDGV GHOLFDWH IUXLWV DQG YHJHWDEOHV&XWVWKURXJKKDUGFUXVWIRUXQLIRUPVOLFLQJ ´7KH)RUNµ²7KHSHUIHFWFRPSOHPHQWWRDQ\FDUYLQJRU VOLFLQJ NQLIH 3URYLGHV D PRUH VHFXUH KROG HVSHFLDOO\ RQ WKHWDLOHQGRIDMRLQWRIPHDW   ´7KH 6WHHOµ²5HDOLJQV WKH NQLIH HGJH 6KRXOG EH XVHG IUHTXHQWO\WRPDLQWDLQVKDUSQHVV   ´7KH 8WLOLW\ .QLIHµ²([FHOOHQW IRU IRRG SUHSDUDWLRQ RU DOPRVW DQ\ NLWFKHQ FKRUH IURP FXWWLQJ YHJHWDEOHV DQG PHDWVWRKDOYLQJVDQGZLFKHV ´7KH6WHDN.QLIHµ²)RULQGLYLGXDOWDEOHXVH&XWVPHDW ZLWKRXWWHDULQJ   ´7KH 3DUHUµ²7KH NQLIH XVHG PRVW IUHTXHQWO\ &XWV SHHOVDQGGLFHVIUXLWVYHJHWDEOHVFKHHVHVDQGPHDWV

%

%9LFWRULQR[&XWOHU\ 9LFWRULQR[&XWOHU\LV6ZLVV4XDOLW\0DQXIDFWXUHGVLQFHLQ,EDFK 6ZLW]HUODQG RXU KLJK FDUERQ QR VWDLQ EODGHV DUH WKH VWDQGDUG RI WKH PHDW SURFHVVLQJ DQG EXWFKHU LQGXVWULHV $ SURSULHWDU\ SURFHVV WKDW SURPRWHV PD[LPXP EODGH OLIH DQG UHGXFHG ³NQLIH VSHQG´ LQVXUHV RXU FODLPWKDW³DOOEODGHVDUHQRWFUHDWHGHTXDO´$YDLODEOHLQVOLSUHVLVWDQW )LEUR[ KDQGOHV 16)  DQG FODVVLF 5RVHZRRG KDQGOHV DOO 9LFWRULQR[ NQLYHVFDUU\DOLIHWLPHZDUUDQW\DJDLQVWPDQXIDFWXUHU¶VGHIHFWV 0RGHO'HVFULSWLRQ  0LQL&KHI.QLIH)LEUR[+DQGOH  :DY\0LQL&KHI.QLIH)LEUR[+DQGOH  :DY\&KHI.QLIH)LEUR[+DQGOH  &KHI.QLIH)LEUR[+DQGOH  %UHDG.QLIH)LEUR[+DQGOH  &KHI.QLIH)LEUR[+DQGOH  6DQGZLFK.QLIH)LEUR[+DQGOH  %UHDG.QLIH)LEUR[+DQGOH  6XSU6OLFHU)LEUR[+DQGOH  &KHI.QLIH)LEUR[+DQGOH  *UDQWRQ(GJH6OLFHU)LEUR[+DQGOH $GGLWLRQDOPRGHOVDYDLODEOH


.LWFKHQ6XSSOLHV_ $

$6DQL6DIHŠ .QLYHV $FFHVVRULHV $QLPSHUYLRXVEODGHWRKDQGOHVHDOSURYLGHVWKHXWPRVW LQVDQLWDU\TXDOLILFDWLRQ$WH[WXUHGVOLSUHVLVWDQWHDV\ WRFOHDQSRO\SURS\OHQHKDQGOHZLWKVWDQGVERWKKLJKDQG ORZ WHPSHUDWXUHV 6WDLQIUHH KLJKFDUERQ VWHHO EODGH ZLWK DQ LQGLYLGXDOO\ JURXQG DQG KRQHG HGJH ([FLWLQJ PXOWLSDFNDQGSRLQWRISXUFKDVHRSWLRQVDOVRDYDLODEOH 0DGHLQ86$16) 0RGHO'HVFULSWLRQ 63&3 &RRN¶V.QLIH 63&3 &RRN¶V.QLIH 63&3 [&DNH7XUQHU 66&3&3 6FDOORSHG2IIVHW6DQGZLFK.QLIH 3$3&3 3L]]D&XWWHU 63&3 6WDLQOHVV&OHDYHU 63&3 &ODP.QLIH 66&& 3F&XWOHU\6HW Additional models available.

&9ORŠ .QLYHV /HDGLQJ 3URIHVVLRQDO &KHIV 7RZDUG 7RPRUURZ 9OR Š NQLYHV RIIHU SDWHQWHG VWDWHRIWKHDUW KDQGOHGHVLJQXQLTXH'H[7H[Œ$UPDGLOORWH[WXUH DQG D FRPSRVLWH KDQGOH WKDW IXVHV VRIW FRPIRUW ZLWK ILUP FRQWURO :LWK LWV LQFUHGLEOH VRIW IHHO DQG JRWWRKDYH DWWUDFWLYHQHVV \RX ZLOO ORYH WKLV NQLIH 9OR DOVR IHDWXUHV WKH KDOOPDUNV RI 'H[WHU5XVVHOO FXWOHU\ LQFOXGLQJ WKH KLJKHVW TXDOLW\ VWDLQIUHH KLJKFDUERQ VWHHO EODGHV DQG XOWLPDWH ORQJ ODVWLQJ VKDUSHGJHV16)FHUWLILHG 0RGHO'HVFULSWLRQ 9*(3&3 'XR(GJH6DQWRNX&KHI¶V.QLIH 9*(3&3 'XR(GJH6DQWRNX&KHI¶V.QLIH 96&3&3 6FDOORSHG2IIVHW6DQGZLFK.QLIH 93&3 &RRN¶V.QLIH 93&3 &RRN¶V)RUN 9&3 3F&XWOHU\6HW 9&& 3F&XWOHU\6HW 9&& SF&XWOHU\6HW Additional models available.

&

%

%6RI*ULSŒ&XWOHU\ 7KHVRIWWRWKHWRXFKKDQGOHOLWHUDOO\PROGVWR\RXU KDQG DQG EHFRPHV LWV H[WHQVLRQ 6RI*ULSŒ FRPELQHV WKH ZRUOG¶V VKDUSHVW KDQGKRQHG HGJH LQ VWDLQIUHH KLJKFDUERQ VWHHO ZLWK WKH PRVW HUJRQRPLFDOO\ GHVLJQHG KDQGOH HYHU $YDLODEOH LQ ERWK EODFN DQG ZKLWH KDQGOHV &KLQHVH &KHI¶V NQLYHV QRZ DYDLODEOH LQ DQ XOWUDFRPIRUWDEOH 6RI*ULSŒKDQGOHDQGLQ&2/25616) 0RGHO'HVFULSWLRQ Black Handles 6*%3&3 &RRN¶V6W\OH3DUHU 6**(%3&3 'XR(GJH6DQWRNX.QLIH 6**(%3&3 'XR(GJH5RDVW6OLFHU 6*6&%3&3 6FDOORSHG5RDVW6OLFHU 6*%3&3 &RRN¶V.QLIH 6*6&%3&3 6FDOORSHG2IIVHW6DQG .QLIH Additional models available.

Giving Chefs the Edge

'

(

(.QLYHV 3URIHVVLRQDO FKHIV SUHIHU 0XQGLDO NQLYHV EHFDXVH RI WKHLU FRPIRUW EDODQFH DQG GXUDELOLW\ &RPSOHWH SURGXFWOLQHLQFOXGHVFRRN¶VDQGERQ LQJ NQLYHV DV ZHOO DV RWKHU HVVHQWLDO WRROV )HDWXUH KLJKFDUERQ VWDLQOHVV VWHHO EODGHV DV ZHOO DV QRQVOLS HUJRQRPLF KDQGOHV 0ROGHG ZKLWH SRO\SURS\OHQH KDQGOHV QRZ KDYH WKH H[WUD VDIHJXDUG RI 6DQLWL]HG Š DQWL PLFURELDO SURWHFWLRQ ZKLFK JXDUGV DJDLQVW EDFWHULDO JURZWK 6RPH LWHPV DYDLODEOH LQ IRRG VDIH FRORUV UHG EOXHJUHHQ\HOORZDQGEODFN16)

0RGHO'HVFULSWLRQ 6&: 3DULQJ&KHI¶V6W\OH WRDFDUG:KLWH

:( 3DULQJ6SHDU3RLQW SN

: )LOOHW1DUURZ6WLII :KLWH

: %XWFKHU :KLWH

: %RQLQJ1DUURZ6WLII :KLWH

%RQLQJ([:LGH6WLII : : 6DQWRNX :KLWH

:*( 6DQWRNX*UDQWRQ(GJH : %XWFKHU :KLWH

%UHDGZ6HUUDWHG(GJH :KLWH

: :( 2IIVHW6DQGZLFKZ6HUUDWHG(GJH : &KHI¶V : &KHI¶V :( 6OLFHUZ6HUUDWHG(GJH :KLWH

')XOO\)RUJHG.QLYHV $V DQ\ FKHI NQRZV D JUHDW NQLIH EHJLQV ZLWK D JUHDWEODGH0XQGLDO¶VIXOO\IRUJHGFXWOHU\PDNHV IRRG SUHSDUDWLRQ IDVWHU HDVLHU DQG PRUH FRPIRUWDEOH&UDIWHGIURPKLJKFDUERQVWDLQOHVV VWHHO HDFK EODGH LV IXOO\ IRUJHG WR HQVXUH JUHDWHU GXUDELOLW\ DQG LQFUHDVHG FXWWLQJ SUHFLVLRQ(UJRQRPLFULYHWHGKDQGOHVHQVXUH D FRPIRUWDEOH ILUP JULS KDQG ZDVK RQO\ /LIHWLPH ZDUUDQW\ $YDLODEOH LQ RSHQ VWRFN RU VROGLQDIXOOVHW16)0RGHOVKRZQ 0RGHO'HVFULSWLRQ  ([HFXWLYH&KHI6HWSF &RQWDLQV*( (6&:+FDVH

%3 &KHI¶V %3 3DULQJ %3 8WLOLW\ %3 &DUYLQJ Additional models available.


.LWFKHQ6XSSOLHV_ $ $+HOLRV.QLIH6WHULOL]HU&DELQHW 1HZ.QLIH6WHULOL]HU&DELQHWSURYLGHVXSHULRUVWHULOL]D WLRQ FRPSDUHG WR WKRVH XVLQJ PDJQHWLF EDUV RU PHWDO UDFNV ([FOXVLYH 3(7* QRQILOWHULQJ VORWWHG NQLIH KROGHUDQGPLUURUHGZDOOVHOLPLQDWHVKDGRZVHQVXULQJ VWHULOL]DWLRQ0HFKDQLFDOWLPHUPRGHOLV16)DQG ,3FHUWLILHGJDXJHVWDLQOHVVVWHHOFRQVWUXFWLRQ +HDY\ GXW\ ORFNLQJ KDQGOH SURYLGHV H[WUD VHFXULW\ +ROGV XS WR  NQLYHV QRW LQFOXGHG  /(' LQGLFDWRU OLJKWVKRZVZKHQF\FOHLVFRPSOHWH0RGHO.689 &2QH3LHFH7RQJV-DFRE¶V3ULGH 1RZ ZLWK $JLRQŠ²1DWXUH¶V DQWLPLFURELDO SURWHFWLRQ -DFRE¶V 3ULGH FRORUFRGHG WRQJV DLG LQ WKH SUHYHQWLRQ RI IRRGERUQH LOOQHVV UHVXOWLQJ IURP FURVV FRQWDPLQDWLRQ 8QLTXH VSULQJOHVV GHVLJQ HOLPLQDWHV EDFWHULD SURQH IRRG WUDSV 7KH SHUPDQHQWO\ ERQGHG .RRO 7RXFKŠ FRORUFRGHG KDQGOHV SURYLGH HDV\ LGHQWLILFDWLRQ+DQGOHVDUHKHDWUHVLVWDQWXS WRƒ)&KRRVHIURPFRORUFRGHGEODFNRU VWDLQOHVVVWHHO9HUVD*ULSŠ RU6FDOORSHG*ULS WRQJV 16) -DFRE¶V 3ULGHŠ OLPLWHG OLIHWLPH ZDUUDQW\ GRHV QRW FRYHU .RRO7RXFK Š FRDWLQJ6" tong now available. 0RGHO'HVFULSWLRQ  6FDOORSHG%ODFN  6FDOORSHG5HG  6FDOORSHG%ODFN  6FDOORSHG5HG  6FDOORSHG%OXH  6FDOORSHG<HOORZ  6FDOORSHG7DQ  6FDOORSHG6WDLQOHVV  9HUVD*ULS*UHHQ  9HUVD*ULS<HOORZ  9HUVD*ULS6WDLQOHVV Additional models available.

%

%6DI7.QLIHŒ6WDWLRQ 6DIH VDQLWDU\ DQG VHFXUH VWRUDJH IRU NLWFKHQ NQLYHV 6DQLWDU\FORVHGFRQWDLQHUSURWHFWVNQLYHVIURPFRQWDPLQDQWV DQG GDPDJH &OHDU VHHWKURXJK GRRU PDNHV FKRRVLQJ D NQLIHHDV\(DV\WRDVVHPEOHDQGGLVDVVHPEOHIRUWKRURXJK FOHDQLQJ +ROGV YDULHW\ RI NQLIH FRQILJXUDWLRQV LQFOXGLQJ D FOHDYHUDQGDNQLIHVKDUSHQHU'XUDEOHSODVWLFFRQVWUXFWLRQ 'LVKZDVKHU VDIH DQG 16) FHUWLILHG .QLYHV QRW LQFOXGHG 0RGHO67.

&

')RUJHG&XWOHU\.)36HULHV 2QH SLHFH IXOO WDQJ VWHHO IRUJHG IURP KLJK FDUERQ *HUPDQ VWHHO IRU WKH EHVWSHUIRUPDQFHLQSURIHVVLRQDONLWFKHQV8QLTXHVROLG(U*R320KDQGOH GHOLYHUV SHUIHFW ZHLJKW GLVWULEXWLRQ LQ RSHUDWLRQ $GGLWLRQDO VSRW VSHFLDO SROLVKLQJPDNHVWKHPRVWFRPIRUWDEOHJULSIRUXVHU

' 0RGHO'HVFULSWLRQ .)3 3DULQJ.QLIH .)3 8WLOLW\.QLIH .)3 &KHI.QLIH .)3 %RQLQJ.QLIH .)3 &DUYLQJ)RUN .)3 6DQWRNX.QLIH .)3 &KHI.QLIH .)3 6OLFHU .)3 %UHDG.QLIH .)3 2IIVHW%UHDG.QLIH .)3 &KHI.QLIH .)3 6OLFHU *UDQWRQ(GJH

.)3 )LVK5RDVW6OLFHU *UDQWRQ(GJH

.)3 &KHI.QLIH

(2QH3LHFH'LVKHUV-DFRE¶V3ULGH&ROOHFWLRQ 1RZIHDWXULQJ$JLRQŠ²1DWXUH¶VDQWLPLFURELDOSURWHFWLRQ6WDLQOHVV VWHHOZLWKRQHSLHFHFRORUFRGHGSODVWLFKDQGOHVIRUQRJXHVVVL]H VHOHFWLRQ 6XUH JULS FRORU KDQGOHV GLIIHUHQWLDWH VL]H :KLWH JUD\ LYRU\ JUHHQ GDUN EOXH \HOORZ UHG EODFN DQG RUFKLG -DFRE¶V 3ULGHŠ OLPLWHGOLIHWLPHZDUUDQW\0DGHLQWKH86$16)FHUWLILHG 0RGHO'HVFULSWLRQ  :KLWH R]  *UD\R]  ,YRU\ R] )2QH3LHFH/DGOHVZ.RRO7RXFKŠ +DQGOHV  *UHHQ R] 1RZ IHDWXULQJ $JLRQŠ²1DWXUH¶V DQWLPLFURELDO SURWHFWLRQ $YDLODEOH ZLWK VWDLQOHVV  'N%OXHR] VWHHOEODFNDQGFRORUFRGHG.RRO7RXFKŠ KDQGOHVDVZHOODVEODFN(UJR*ULSKDQ  <HOORZ R] GOH LQ  FDSDFLWLHV $FFXUDWH ERZO GLPHQVLRQV FOHDUO\ VWDPSHG IRU HDV\ LGHQWLILFD  5HG R] WLRQ+HDY\JDXJHVWDLQOHVVVWHHOVKDIWVDQGERZOV*URRYHGSODVWLFFRDWHGKDQGOH  %ODFNR] LVKHDWUHVLVWDQWXSWRƒ)0LUURUILQLVKERZOVVDWLQILQLVKKDQGOHV-DFRE¶V3ULGH  2UFKLG R] ODGOHVKDYHOLPLWHGOLIHWLPHZDUUDQW\-DFRE¶V3ULGHŠ ZDUUDQW\GRHVQRWLQFOXGH.RRO 7RXFKŠ FRDWLQJ 0RGHO'HVFULSWLRQ  R],YRU\16)-DFRE¶V3ULGH/DGOH  R]%ODFN16)-DFRE¶V3ULGH/DGOH  R]7HDO16)-DFRE¶V3ULGH/DGOH  R]6616)-DFRE¶V3ULGH/DGOH  R]%ODFN  R],YRU\  R]%ODFN  R]2UDQJH (  R](UJR*ULS  R](UJR*ULS ) Additional models available.


.LWFKHQ6XSSOLHV_ %:KLSV 7RQJV )UHQFKDQGSLDQRZKLSKDQGOHVDUHILOOHGZLWKDVSHFLDOO\IRUPXODWHG HSR[\WRNHHSWKHZLUHVILUPO\LQSODFHIRUHYHU)UHQFKZKLSVKDYH WKLFN ULJLG ZLUHV IRU KHDYLHU EDWWHUV DQG IRRGV 3LDQR ZKLSV DUH PDGH RI D WKLQQHU PRUH IOH[LEOH ZLUH IRU PRUH GHOLFDWH IRRGV DQG VDXFHV .HWWOH DQG PD\RQQDLVH ZKLSV DUH PDGH RI  VWDLQOHVV VWHHO ZLWK KHDY\  WXEXODU KDQGOHV DQG H[WUDKHDY\ JDXJH ZLUH 6WDLQOHVV XWLOLW\ WRQJV DUH DYDLODEOH LQ KHDY\ 78)  H[WUDKHDY\ ;+7  RU OLJKWZHLJKW /87  JDXJHV ³78)´ VHULHV KDYH D PLUURU SROLVKHG ILQLVK DQG IODW VSULQJ ³;+7´ GHOX[H VHULHV KDYH D EUXVKHG ILQLVKZLWKFRLOVSULQJ16) 0RGHO 'HVFULSWLRQ 0RGHO 'HVFULSWLRQ French Whips Piano Whips ):(  3:(  ):(  3:(  ):(  3:(  ):(  3:( 

$ $'HOX[H'LVKHUV &RQVWUXFWHGRIVWDLQOHVVVWHHOWRSUHYHQW FRUURVLRQ DQG HQVXUH ORQJODVWLQJ XVH 2QH SLHFH KDQGOH GHVLJQ LPSURYHV GXUDELOLW\ HDVHRIFOHDQLQJDQGNHHSVWKHKDQGOHDQG PHFKDQLVP IURP FRPLQJ DSDUW &RORUFRGHG KDQGOH IRU VLPSOH HIILFLHQW VL]H VHOHFWLRQ 'LVKZDVKHUVDIH16) 0RGHO'HVFULSWLRQ ,&23 6L]H:KLWH ,&23 6L]H*UD\ ,&23 6L]H,YRU\ ,&23 6L]H*UHHQ ,&23 6L]H%OXH ,&23 6L]H<HOORZ ,&23 6L]H5HG ,&23 6L]H%ODFN ,&23 6L]H3XUSOH

0RGHO 'HVFULSWLRQ 0RGHO 'HVFULSWLRQ X-Tra Hvy. Wt. Tongs Hvy. Wt. Tongs 78)  ;+7  ;+7  78)  ;+7  78)  Additional models available.

0RGHO 'HVFULSWLRQ Lt. Wt. Tongs /87  /87  /87 

&  1\ORQ +DQGOH :LUH :KLSV ² -DFRE¶V 3ULGH &ROOHFWLRQ -DFRE¶V 3ULGH RQHSLHFH Q\ORQ KDQGOH ZLWK FRPIRUW QXEV LV FRPSOHWHO\ VHDOHG 3DWHQWSHQGLQJ HUJRQRPLFZKLSZLWKILQHZLUHVIRUPL[LQJRUDHUDWLQJ WKLQQHUIRRGSURGXFWV+DQGOHLVKHDWUHVLVWDQWXSWR ƒ) &RORUFRGHG KDQGOHV IRU HDV\ LGHQWLILFDWLRQ $TXD IRU )UHQFK DQG 3XUSOH IRU 3LDQR &RUURVLRQ UHVLVWDQWVWDLQOHVVVWHHOZLUHV-DFRE¶V3ULGHOLPLWHG OLIHWLPHZDUUDQW\16) 0RGHO 'HVFULSWLRQ 0RGHO 'HVFULSWLRQ French Whips Piano Whips                          

&

' '&RRNLQJ$FFHVVRULHV 3URIHVVLRQDO FKHIV SUHIHU 0XQGLDO FRRNLQJDFFHVVRULHVEHFDXVHRIWKHLU FRPIRUW EDODQFH DQG GXUDELOLW\ &RPSOHWH SURGXFW OLQH LQFOXGHV WXUQHUV VFUDSHUV IRUNV DQG RWKHU HVVHQWLDO FRRNLQJ WRROV )HDWXUH KLJKFDUERQ VWDLQOHVV VWHHO EODGHV DV ZHOO DV QRQVOLS HUJRQRPLF KDQGOHV 0ROGHG ZKLWH SRO\SURS\OHQH KDQGOHV QRZ KDYH WKH H[WUD VDIHJXDUG RI 6DQLWL]HG Š DQWLPLFURELDO SURWHFWLRQ ZKLFK JXDUGV DJDLQVWEDFWHULDOJURZWK6RPHDFFHVVRULHVDYDLODEOHLQ IRRGVDIHFRORUVUHGDQG\HOORZ16) 0RGHO'HVFULSWLRQ : [3LH6HUYHU :KLWH+DQGOH  : *ULGGOH6FUDSHU :KLWH+DQGOH

: 3L]]D&XWWHU :KLWH+DQGOH

: [6WHDN7XUQHU :KLWH+DQGOH

: [7XUQHU :KLWH+DQGOH

 &OHDYHU :KLWH+DQGOH

: : %DNHU¶V,FLQJ6SDWXOD :KLWH+DQGOH

Additional models available.

%

(

(  2QH3LHFH +HDY\ 'XW\ 6SRRGOHVŠ DQG %DVWLQJ6SRRQVE\-DFRE¶V3ULGH 2XURQHSLHFHPLUURUILQLVKJDXJHVWDLQOHVV VWHHO 6SRRGOHŠ FRPELQHV WKH HDVH RI VHUYLQJ ZLWK D VSRRQ DQG WKH DFFXUDWH SRUWLRQ FRQWURO RI D ODGOH &RORU FRGLQJ DQG FDSDFLWLHV VWDPSHG RQ VKDIW (UJRQRPLF GHVLJQ EXLOWLQ VWRSSHU QRWFK KHDW UHVLVWDQW WR ƒ) +HDY\ GXW\ RQHSLHFH JDXJH VWDLQOHVV VWHHO EDVWLQJ VSRRQV DUH UHVLVWDQW WR FRUURVLRQ 16)-DFRE¶V3ULGHOLPLWHGOLIHWLPHZDUUDQW\ 0RGHO'HVFULSWLRQ Spoodles  6ROLG5RXQG%ODFNR]  6ROLG2YDO%OXHR]  6ROLG2YDO%ODFNR]  3HUIRUDWHG5RXQG%OXHR]  3HUIRUDWHG5RXQG%ODFNR]  3HUIRUDWHG2YDO*UD\R]  3HUIRUDWHG2YDO%ODFNR] Basting Spoons  6ROLG  3HUIRUDWHG  6ORWWHG Additional models available.


.LWFKHQ6XSSOLHV_

(GCVWTGF%JGH $

$:DOO0RXQWHG8WHQVLO5DFN 9HUVDWLOH UDFN FDQ EH LQVWDOOHG YLUWXDOO\ DQ\ZKHUH ZLWKLQ PLQXWHV +HDY\ JDXJH  VWDLQOHVV VWHHO FRQVWUXFWLRQ ,QFOXGHV  VWDLQOHVV VWHHO KRRNV WR KDQJ D YDULHW\ RI XWHQVLOV 0RXQWLQJ EUDFNHWV LQFOXGHG [[ 16) 0RGHO)85&+66VKRZQ 0RGHO'HVFULSWLRQ )85&+66 8WHQVLO5DFNZ66+RRNV )85+22.66 66+RRNVSNJ

%3UR*ULS.LWFKHQ8WHQVLOV 7KHVH SURIHVVLRQDO NLWFKHQ WRROV RIIHU DQ HUJRQRPLFQRQVOLSVRIWJULSIRUIDWLJXHIUHH XVH'LVKZDVKHUVDIH 0RGHO'HVFULSWLRQ (*8 7RPDWR&RUHU (*8 $SSOH&RUHU (*8 0HORQ&RUHU (*8 &KHHVH3ODQH (*8 6WUDLJKW3HHOHU (*8 0HGLXP+ROH*UDWHU (*8 .LWFKHQ6KHDUV (*8 <3HHOHU (*8 2\VWHU2SHQHU (*8 *DUOLF3UHVV (*8 +DQG+HOG&DQ2SHQHU

&KHI$QGUHDV6LQJHU +\DWW5HJHQF\&RFRQXW3RLQW5HVRUW 6SD %RQLWD6SULQJV)/ %DFRQ:UDSSHG*URXSHU %ODFN*URXSHU $SSOHZRRGVPRNHGEDFRQ 6SLQDFK 6KDOORWVILQHFKRSSHG

%

*DUOLFPLQFHG 5HG:LQH

&'XUD3DQŒ)RRG3DQV 'RXEOH UHLQIRUFHG FRUQHUV DQG XQLTXH LPSDFW UHVLVWDQW HGJHGHVLJQKHOSSDQVKROGVKDSHHYHQXQGHUWKHWRXJKHVW FRQGLWLRQV :LOO QRW MDP WRJHWKHU GXULQJ VWRUDJH 7DSHUHG SDQVILWVWDQGDUGIRRGSDQWHPSODWHVDQGZLOOVWDFNRUQHVW ZLWK PRVW RWKHU OHDGLQJ EUDQGV 9HUVDWLOH  VWDLQOHVV SDQV JR IURP IUHH]HU WR RYHQ WR VHUYLQJ OLQH $YDLODEOH LQ LQGXVWU\VWDQGDUGJDXJHRUHFRQRPLFDOJDXJH16) 0RGHO'HVFULSWLRQ  )XOO6L]H+HDY\*DXJH± TW

 )XOO6L]H+HDY\*DXJH± TW

 )XOO6L]H+HDY\*DXJH± TW

 2QH+DOI6L]H+HDY\*DXJH± TW

 2QH+DOI6L]H+HDY\*DXJH± TW

 2QH+DOI6L]H+HDY\*DXJH± TW

 2QH7KLUG6L]H+HDY\*DXJH± TW

 2QH6L[WK6L]H+HDY\*DXJH± TW

 2QH1LQWK6L]H+HDY\*DXJH± TW

 2QH1LQWK6L]H+HDY\*DXJH± TW

$GGLWLRQDOPRGHOVDYDLODEOH

'

:KLWH9HUPRXWK &UHDP 6HDVRQ JURXSHU ILOHW DQG ZUDS ZLWK WKLQ VOLFHG EDFRQVHWDVLGH 6DXWp VKDOORWV XQWLO VRIW EXW QRW EURZQ DQG JOD]H ZLWK UHG ZLQH UHGXFH XQWLO FRQVLVWHQF\ UHVHPEOHVFRQILWILQLVKZLWKFROGEXWWHU )RU WKH VDXFH UHGXFH YHUPRXWK ZLWK VKDOORWV DQG JDUOLF DGG FUHDP DQG OHWVLPPHUSXUHHLQ EOHQGHU

&

6DXWp UHVW RI VKDOORWV DQG JDUOLF DGG EDE\ VSLQDFKDQGDGGWRXFKRIZKLWHZLQH 6HDU EDFRQ ZUDSSHG JURXSHU RQ DOO VLGHV DQG EDNHWRGHVLUHGWHPSHUDWXUH 3ODFHJURXSHURQWRSRIZLOWHGVSLQDFKDQGSRXU VDXFH DURXQG ILQLVK ZLWK VKDOORW DQG UHG ZLQH FRQILW

'6XSHU3DQ6XSHU6KDSHV 1RZ DYDLODEOH LQ GHHSHU SDQV DQG QHZ VKDSHV $ FRVW HIIHFWLYH PHWKRG WR XSVFDOH SUHVHQWDWLRQ RI IRRG LQ FKDIHUV EXIIHW OLQHV DQG GLVSOD\ FDVHV %\ XVLQJ \RXU H[LVWLQJ LQYHQWRU\RIVWHDPWDEOHSDQVDQGUHSODFLQJDIHZSLHFHVRI WKH OLQH XS ZLWK WKH 6XSHU 6KDSHV SDQV \RXU ZKROH OLQHXS JHWVDQXSVFDOHSUHVHQWDWLRQ)XOODQGKDOIVL]HXQLWVILWZLWK 6XSHU 3DQ  Š FRYHUV DQG IOH[LEOH OLGV 1R LQYHVWPHQW LQ WHPSODWHV WLOHV RU RWKHU DFFHVVRULHV UHTXLUHG 5HLQIRUFHG HGJHV DQG FRUQHUV UHGXFH SRWHQWLDO IRU GHQWV GLQJV RU HQHUJ\ HVFDSLQJ IURP WKH ZHOO 3DQV VWDFN QHDWO\ IRU HDV\ VWRUDJH(DV\WRXVHDQGHDV\WRFKDQJH16)0DGHLQWKH 86$

0RGHO'HVFULSWLRQ  :LOG3DQ/RQJ  :LOG3DQ/RQJ  :LOG3DQ7KLUG,QQHU  2YDO)XOO  2YDO)XOO  .LGQH\)XOO  +H[DJRQ)XOO  +H[DJRQ)XOO $GGLWLRQDOPRGHOVDYDLODEOH


.LWFKHQ6XSSOLHV_

$ %

%0LUDPDUŠ 'HFRUDWLYH3ODQV 7HPSODWHV 6W\OLVKSDWHQWSHQGLQJHPERVVHGSDWWHUQRQVWDLQOHVVVWHHOSDQULPV DGGV HOHJDQFH DQG VW\OH WR \RXU EXIIHW SUHVHQWDWLRQ 9DULRXV VL]HG SDQV ILW LQ VWDQGDUG ZHOO RSHQLQJV RU LQ 0LUDPDU WKHUPRVHW UHVLQ WHPSODWHV7HPSODWHVDUHKHDWUHVLVWDQWWRƒ) DQGDUHDYDLODEOH LQ 1LJKW 6N\ RU 2\VWHU 3DQV DQG WHPSODWHV DUH GLVKZDVKHU VDIH DQG16)FHUWLILHG 0RGHO'HVFULSWLRQ  1LJKWVN\2YDO +DOI2YDOV  2\VWHU5HFWDQJOH 6L]H  1LJKWVN\7KUHH5RXQGV  2\VWHU7KUHH5RXQGV  &DVVHUROH'5LQJV  )XOO6L]H'5LQJV  +DOI6L]H/RQJ'  7KLUG6L]H' $GGLWLRQDOPRGHOVDYDLODEOH

$6XSHU3DQ9Œ6WHDPWDEOH3DQV 7KHEHVWMXVWJRWEHWWHU 6WXQQLQJ²6PRRWKFXUYHVDQGEULJKWILQLVKIRUDVKRZVWRSSLQJORRN(DV\ WR FOHDQ IXQFWLRQDOLW\ PHDQV 6XSHU 3DQ 9Œ SDQV ZLOO SUHVHQW \RXU IRRG EHDXWLIXOO\RYHUDORQJWLPH 6PDUW²(DV\ WR SRXU FRUQHUV DQG WUDGLWLRQDO ERG\ VL]H PDNH 6XSHU 3DQ 9Œ SDQV FRPSDWLEOH ZLWK DOO \RXU 6XSHU 3DQ ,, Š SDQV FRYHUV DQG DFFHVVRULHV 6WURQJ² JDXJH  VHULHV VWDLQOHVV VWHHO SDQV ZLWK QHZO\ GHVLJQHG SRXU FRUQHUV DUH XS WR  VWURQJHU :LOO UHVLVW GHQWV DQG GLQJV LQ WKH WRXJKHVWNLWFKHQHQYLURQPHQWV 0RGHO'HVFULSWLRQ  )XOO'HOL3DQ[[  )XOOTW[[  )XOOTW[[  )XOOTW[[  7ZR7KLUG'HOL3DQ[[  7ZR7KLUGTW[[ $GD\LQWKH  7ZR7KLUGTW[[ OLIHRI6XSHU  7ZR7KLUGTW[[ 3DQ9  +DOI6L]H'HOL3DQ[[     +DOI6L]HTW [ [  $GGLWLRQDOVL]HVDQGGHSWKVDYDLODEOH

&

&0HODPLQH)RRG3DQV )LQDOO\ PHODPLQH LQVHUW SDQV ZLWK WKH VDPH GLPHQVLRQV DV VWDLQOHVV VWHHO KRWHO SDQV 6R GXUDEOH VR SUDFWLFDO DQG VR LQH[SHQVLYH 3DQV FRQIRUP WR *DVWUR QRUP (XURSHDQ  VSHFV 'LVKZDVKHUVDIHVWDFNDEOHIRUVWRUDJHDQGWKH UXEEHU IHHW RQ WKH ERWWRP RI SDQV PDNH WKHP DWWUDFWLYH IRU EXIIHW VHUYLFHV $YDLODEOH LQ VL[WK VL]HDQGKDOIORQJVL]HSDQV,QDGGLWLRQWKHIXOO VL]H KDOI VL]H DQG WKLUG VL]H DUH DYDLODEOH LQ '&KRRVHIURP%ODFN,YRU\RU:KLWH 0RGHO'HVFULSWLRQ 0/ )XOO6L]H[' 0/ +DOI6L]H[' 0/ 7KLUG6L]H[' 0/ 7KLUG6L]H[' 0/ +DOI6L]H[' 0/ )XOO6L]H[' 0/ 7KLUG6L]H[' 0/ )XOO6L]H'LYLGHG &RPS '

'&DPZHDU)RRG6WRUDJH3DQV &RYHUV $QLQQRYDWLYHZD\WRVWRUHKDQGOHDQGWUDQVSRUWIRRG8VH&:3DQVIRUVWRUDJHWUDQVSRUWDWLRQDQG VHUYLQJ GLVSOD\ +33DQV IRU PLFURZDYHV VWHDPHUV DQG RYHQV DQG 333DQV DUH DQ HFRQRPLFDO FKRLFHIRUVWRULQJIRRGDVZHOODVXVLQJRQSUHSWDEOHVDQGLQIRRGEDUV&:ZLWKVWDQGWHPSVƒ) WRƒ)+3DQVƒ)WRƒ)DQG333DQVƒ)WRƒ)$GG&:WRPRGHOQXPEHUIRUFROG SDQV+3IRUKRWSDQVDQG33IRUWUDQVOXFHQWSDQV&RYHUVW\OHVDYDLODEOH²VHDOIODWIOLSJULSZLWK KDQGOHDQGQRWFKHG16) 0RGHO'HVFULSWLRQ &: 7KLUG6L]H3DQ&: &: 6L[WK6L]H3DQ&: &: +DOI6L]H3DQ&: &: )XOO6L]H3DQ&: &: 6L[WK6L]H3DQ&: +3 7KLUG6L]H3DQ+3 +3 +DOI6L]H3DQ+3 +3 6L[WK6L]H3DQ+3 +3 +DOI6L]H3DQ+3 ' $GGLWLRQDOVL]HVDQGGHSWKVDYDLODEOH

$SSUR[LPDWH6HUYLQJVIRU 6WHDPWDEOH3DQV 'HSWK1XPEHURI6HUYLQJV ,Q  4WV R]R]R]R] )XOO6L]H²[                    

   

7ZR7KLUGV6L]H²[                         +DOI6L]H²[                

   

   

+DOI/RQJ6L]H²[                         7KLUG6L]H²[                

   

   

)RXUWK6L]H²[               

  

6L[WK6L]H²[               

  

1LQWK6L]H²[        

 

 


.LWFKHQ6XSSOLHV_

% $ $7RS1RWFKŠ )RRG3DQV ³(DV\ /LIW 6SRRQ 1RWFKHV´ DW HDFK HQG RI IRRG SDQ IRU HDV\ UHPRYDO IURPVWHDPWDEOHVDQGUHFHVVHGFRXQWHUV(DV\OLIWQRWFKUHGXFHVGLUHFW KDQGWRIRRGFRQWDFWIRUJUHDWHUIRRGVDIHW\0HHW(1(XUR1RUP VWDQGDUGV IRU LQWHUVWDFNLQJ ZLWK H[LVWLQJ SDQV 1HZ 8QLYHUVDO /LGV ILW 7RS 1RWFK )RRG 3DQV DV ZHOO DV RWKHU PDMRU EUDQGV $YDLODEOH LQ VWDQGDUG VL]HV 8QLYHUVDO /LGV ILW ERWK JDVWURQRUP DQG VWDQGDUG VL]H IRRGSDQV&DUOLVOHOLGVVWDFNZLWKWKHPVHOYHVIRUHDV\VWRUDJH$YDLODEOH LQSRO\FDUERQDWHRUKLJKKHDWPDWHULDO'LVKZDVKHUVDIH16) 0RGHO'HVFULSWLRQ  )XOO6L]H'3RO\FDUERQDWH  6L[WK6L]H'3RO\FDUERQDWH  +DOI6L]H'3RO\FDUERQDWH  4XDUWHU6L]H'3RO\FDUERQDWH  1LQWK6L]H'3RO\FDUERQDWH  7KLUG6L]H'3RO\FDUERQDWH  )XOO6L]H'+LJK+HDW  7KLUG6L]H'+LJK+HDW  6L[WK6L]H'+LJK+HDW  4XDUWHU6L]H'+LJK+HDW  +DOI6L]H'+LJK+HDW  )XOO6L]H6PDUW/LG $GGLWLRQDOPRGHOVDYDLODEOH

%%DNLQJ6KHHW3DQV ,GHDOO\VXLWHGIRUVSHFLDOSXUSRVHRSHUDWLRQV6HDPOHVVDOXPLQXP RQHSLHFHFRQVWUXFWLRQZLWKFORVHGVWHHOZLUHUHLQIRUFHGEHDG %DNLQJ VKHHW SDQV WDSHUHG FRUQHUV QHVW DQG VWDFN HDVLO\ DQG ILW DOO VWDQGDUG EDNHUV¶ UDFNV )XOO VL]H DQG KDOI VL]H SDQV DUH  JDXJH VWDQGDUG  JDXJH KHDY\ GXW\ IXOO VL]H SDQV DUH DOVR DYDLODEOH 0RGHO'HVFULSWLRQ $; )XOO6L]H[+HDY\'XW\JDXJH $; )XOO6L]H[6WDQGDUGJDXJH 3; )XOO6L]H[3HUIRUDWHGJDXJH $; +DOI6L]H[6WDQGDUGJDXJH

&3DQ3DOVŒ3DQ/LQHUV 2YHQ%DJV 3DQ3DOVŒ +LJK +HDW 3DQ /LQHUV DQG &RRNLQJ %DJVLPSURYHIRRGVDIHW\E\HQVXULQJIRRGVDUH DOZD\V SUHSDUHG RQ D FOHDQ FRRNLQJ VXUIDFH +\JLHQLF KLJK KHDW Q\ORQ OLQHUV VDYH WLPH DQG PRQH\ E\ UHGXFLQJ VFRUFKLQJ DQG VSHHGLQJ FOHDQXS &DQ ZLWKVWDQG FRRNLQJ WHPSHUDWXUHV XSWRƒ) 0RGHO'HVFULSWLRQ 2% [0HGLXP3DQ2YHQ%DJ 2% [0HGLXP3DQ2YHQ%DJ 2% [7XUNH\6L]H2YHQ%DJ 3/ [6L[WK3DQ/LQHU 3/ [DQGTW5RXQG/LQHU 3/ [DQGTW5RXQG/LQHU $GGLWLRQDOPRGHOVDYDLODEOH

&

( ' ':HDU(YHUŠ &ODVVLFŒDQG&ODVVLF6HOHFWŠ &RRNZDUH 0DQXIDFWXUHG LQ WKH 8QLWHG 6WDWHV :HDU(YHU FRRNZDUH LV EXLOW IRU FRPPHUFLDO NLWFKHQ XVH )HDWXUHV WZR JDXJH LPSDFW UHVLVWDQW  DOXPLQXPFRQVWUXFWLRQ'RXEOHWKLFNERWWRPIRUHYHQKHDWGLVWULEXWLRQ DQG HOLPLQDWLRQ RI KRW VSRWV 6WRFN SRWV VDXFH SRWV EUD]LHUV VDXWp SDQVDQGVWUDLJKWZDOOHGVDXFHSDQVDUHDYDLODEOHLQPDQ\VL]HVDQG FDSDFLWLHV6DXWp DQGVDXFHSDQVIHDWXUH7UL9HQWŠ VLOLFRQHDQGSODWHG KDQGOHV -DFRE¶V 3ULGH OLPLWHG OLIHWLPH ZDUUDQW\ 7UL9HQWŠ VLOLFRQH KDQGOHVFDUU\DGD\ZDUUDQW\16)0DGHLQ86$ 0RGHO'HVFULSWLRQ  %UD]LHUTW  6WRFN3RW+Y\'XW\TW  6WRFN3RW+Y\'XW\TW  6DXFH3DQ6WUDLJKW6LGHG TWZ3ODWHG+DQGOH  6DXFH3DQ6WUDLJKW6LGHG TWZ*DWRU*ULSŠ +DQGOH  6DXWH3DQTWZ*DWRU*ULSŠ +DQGOH  6DXFH3RW+Y\'XW\TW  6DXFH3RW+Y\'XW\TW  &RYHU )LWV DQG

(([FDOLEXUŠ )U\3DQV ([FDOLEXU¶V UHYROXWLRQDU\ QRQVWLFN FRDWLQJ LV VXSHULRU WR DQ\ VWDQGDUG FRDWLQJ 6WDLQOHVV VWHHO UHLQIRUFHG QRQVWLFN FRDWLQJ LV PLFURERQGHG WR WKH VXEVWUDWH RI WKH SDQ FUHDWLQJ D PXOWLOD\HU VXUIDFH WKDW HDVLO\ UHOHDVHV IRRG DQG UHVLVWV VFUDWFKLQJ EHWWHU WKDQ WUDGLWLRQDO QRQVWLFN VXUIDFHV &RRNV IRRG HYHQO\ ZLWKRXW WKHQHHGIRUDGGHGIDWRURLO+DUGDOXPLQXPERG\VWDQGV XSWRWKHWRXJKHVWIRRGVHUYLFHHQYLURQPHQW16) 0RGHO'HVFULSWLRQ ;56 3DQZ'XUD.RROŒ6OHHYH ;56 3DQZ'XUD.RROŒ6OHHYH ;56 3DQZ'XUD.RROŒ6OHHYH ;56 3DQZ'XUD.RROŒ6OHHYH ;56 3DQZ'XUD.RROŒ6OHHYH


.LWFKHQ6XSSOLHV_ $7LWDQ6HULHV3RWVDQG3DQV &RQVWUXFWHG RI SUHPLXP  VWDLQOHVV VWHHO WKLV FRRNZDUH KDV D WULSO\ ERWWRP FRQVLVWLQJRIWZROD\HUVRIVWDLQOHVVVWHHOVXUURXQGLQJDQDOXPLQXPFRUH7KHUHVXOW LV FRRNZDUH WKDW VSUHDGV KHDW UDSLGO\ DQG HYHQO\ SURYLGLQJ KLJKHU HIILFLHQF\ DQG UHGXFWLRQ RI KRW VSRWV ZKLFK FDQ FDXVH IRRG WR EXUQ RU FRRN XQHYHQO\ :LWK DWWUDFWLYHEUXVKHGVLGHVDQGDSROLVKHGEDQGDFURVVWKHWRSDQGERWWRPHDFKSLHFH PDNHVDVWULNLQJLPSUHVVLRQ,QGXFWLRQUHDG\FRRNZDUH16) 0RGHO'HVFULSWLRQ 663 TW6WRFN3RWZLWK&RYHU 663 TW6WRFN3RWZLWK&RYHU 663 TW6WRFN3RWZLWK&RYHU 663 TW6WRFN3RWZLWK&RYHU 663 TW6WRFN3RWZLWK&RYHU 663 TW6WRFN3RWZLWK&RYHU 636 TW6DXFH3DQZLWK&RYHU 636 TW6DXFH3DQZLWK&RYHU $GGLWLRQDOPRGHOVDUHDYDLODEOH

$ $ $

%&DUERQ6WHHO)U\LQJ3DQZLWK)ODW,URQ+DQGOH )HDWXUHVIODWLURQKDQGOHDIIL[HGZLWKULYHWV7KH WKLFNQHVVLVXQLIRUP WKURXJKRXW DQG LQFUHDVHV XS WR  RQ ODUJHU GLDPHWHUV +LJK GHQVLW\ PHWDOGRHVQ¶WUHWDLQRGRUV0XFKOLJKWHUWKDQFDVWLURQDVWHHOSDQODVWV IRUHYHU$IWHUEHLQJVHDVRQHGLWDFTXLUHVQDWXUDOQRQVWLFNSURSHUWLHVWKDW ZRQ¶WFKLSVFUDWFKRUSHHORII8QOLNHQRQVWLFNSDQVLWLVVDIHWRXVHDW KLJKWHPSHUDWXUHVDVZHOODVZLWKPHWDOREMHFWVVXFKDVNQLYHVIRUNVRU VSDWXODV &RPSDWLEOH ZLWK DOO KHDW VRXUFHV LQFOXGLQJ LQGXFWLRQ DQG LV RYHQSURRI$VWHHOSDQLVLQH[SHQVLYHDQGUHTXLUHVPLQLPDOFDUH/LPLWHG OLIHWLPHZDUUDQW\ 0RGHO'HVFULSWLRQ $ 'LD[+ $ 'LD[+ $ 'LD[+ $ 'LD[+ $ 'LD[+ $ 'LD[+ $ 'LD[+ $ 'LD[+ $ 'LD[+ $ 'LD[+

%

&&KDVVHXU(QDPHO&DVW,URQ'XWFK2YHQV 6ORZO\EUDLVHRUVLPPHUZLWK&KDVVHXU'XWFK2YHQV7KHDELOLW\ RI WKH GXWFK RYHQ WR HYHQO\ GLVWULEXWH KHDW PDNHV LW SHUIHFW IRU WHQGHUL]LQJDQ\FXWRIPHDWIRUVWHZVRUKHDY\FDVVRXOHWV7KHVH RYHQV DUH GXUDEOH DQG FRPSDWLEOH ZLWK VWDQGDUG VWRYHWRSV LQGXFWLRQ UDQJHV DQG FRQYHQWLRQDO RYHQV &RPHV ZLWK D PDWFKLQJ OLG WR NHHS LQ KHDW DQG PRLVWXUH 7KH ³&KDVVHXU´ FRRNZDUH OLQH KDV EHHQ HQDPHOHG WZLFH ,W LV ILUVW HQDPHOHG LQEODFNZKLFKVHDOVWKHHGJHVSURWHFWVDJDLQVWFRUURVLRQDQGLV D SULPHU IRU WKH FRORU 1H[W LW LV HQDPHOHG ZLWK D FRORU ZKLFK DGGV GXUDELOLW\ DQG HQVXUHV WKDW WKH RYHQ UHWDLQV LWV FRORU 7KH HQDPHO PDNHV WKH RYHQ HDV\ WR FOHDQ $OO OLG NQREV DUH KHDW UHVLVWDQWXSWRƒ) 0RGHO'HVFULSWLRQ $ 5RXQG'LD[+TW%ODFN $ 5RXQG'LD[+ TW%ODFN $ 5RXQG'LD[+TW%ODFN $ 5RXQG'LD[+ TW%ODFN $ 5RXQG'LD[+TW%ODFN $ 5RXQG'LD[+TW%ODFN $ 5RXQG'LD[+ TW%ODFN $ 5RXQG'LD[+ TW%ODFN $ 2YDO/[:[+ TW%ODFN $ 2YDO/[:[+ TW%ODFN $ 2YDO/[:[+ TW%ODFN $ 2YDO/[:[+ TW%ODFN $ 2YDO/[:[+TW%ODFN $GGLWLRQDOPRGHOVDUHDYDLODEOH

'

0RGHO'HVFULSWLRQ (=  (=  (=  (=  (= 

':HDU(YHUŠ &HUDPL*XDUGŠ,,)U\3DQV 1HZ,PSURYHG7RXJKFHUDPLFQRVWLFNILQLVK8VHG IRU KHDY\ GXW\ IU\LQJ )HDWXUHV H[WUD GHQW UHVLVWDQW  DOXPLQXP DOOR\ &HUDPL*XDUGŠ,, LV D FRDWLQJ V\VWHP WKDW RIIHUV ERWK VXSHULRU GXUDELOLW\ DQG UHOHDVHTXDOLWLHVHYHQLQKLJKKHDWDSSOLFDWLRQV7KH HQKDQFHG FRDWLQJ LV  PRUH GXUDEOH WKDQ WUDGLWLRQDO &HUDPL*XDUGŠ :LWKVWDQGV WKH DEXVH RI PHWDOXWHQVLOVEHWWHUWKDQDQ\RWKHUQRVWLFNFRDWLQJ ([FOXVLYH &RRO+DQGOHŠ LQFOXGHG 0DGH LQ WKH 86$ 3)2$IUHH16)

&


.LWFKHQ6XSSOLHV_ $7ULEXWHŠ &RRNZDUH )RU WKRVH FKHIV ZKR ZDQW WKH EHVW RI ERWK ZRUOGV²VWDLQOHVV VWHHO IRU QHXWUDOIODYRUVDQGDOXPLQXPIRUIDVWHYHQKHDWLQJ7ULEXWHŠ FRRNZDUHLV LGHDOIRUJDVHOHFWULFDQGLQGXFWLRQFRRNLQJ)HDWXUHVSO\FRQVWUXFWLRQ DQG VWDLQOHVV VWHHO LQWHULRU  DOXPLQXP FRUH SURYLGHV HYHQ KHDW RQ ERWWRP RI SDQ DQG VLGH ZDOOV VWDLQOHVV H[WHULRU LQGXFWLRQ UHDG\ DQG 7UL9HQWŠ VLOLFRQHRUSODWHGKDQGOHV5DWHGDWƒ)IRUVWRYHWRSRURYHQ XVHZLWK(YHU7LWHŒ5LYHWLQJ6\VWHP16)0DGHLQWKH86$ 0RGHO'HVFULSWLRQ  )U\3DQZ*DWRU*ULSŠ +DQGOH  )U\3DQZ*DWRU*ULSŠ +DQGOH  )U\3DQZ*DWRU*ULSŠ +DQGOH  )U\3DQZ*DWRU*ULSŠ +DQGOH  )U\3DQZ*DWRU*ULSŠ +DQGOH  66&RYHU ILWV

 66&RYHU ILWV

 66&RYHU ILWV

 66&RYHU ILWV

$GGLWLRQDOPRGHOVDYDLODEOH

% %3L]]D6FUHHQV 3L]]DVFUHHQVFDQKHOSSURGXFHDPRUH HYHQO\ EDNHG FUXVW RQ \RXU SL]]DV E\ DOORZLQJ DLU WR FLUFXODWH EHQHDWK WKH FUXVW &RQVWUXFWHG RI KHDY\ GXW\ H[SDQGHG DOXPLQXP $YDLODEOH LQ D YDULHW\RIVL]HV 0RGHO'HVFULSWLRQ                              

$

&:HDU(YHUŠ (YHU6PRRWKŒ)U\3DQV /RRN DJDLQ    IU\ SDQV ZLWKRXW ULYHWV &RPELQHV WKH KHDW FRQGXFWLYLW\ RI DOXPLQXPZLWKWKHULYHWOHVVIHDWXUHVRILQGXFWLRQUHDG\VWDLQOHVVVWHHOFRRNZDUH (OLPLQDWHV SRWHQWLDO IRRG DQG EDFWHULD FROOHFWLRQ DUHDV IURP WKH FRRNLQJ ]RQH )HDWXUHV VXSHULRU FROGGUDZ SURFHVVLQJ  DOXPLQXP GHWDLOHG ILQLVKLQJ RSHUDWLRQVDQGWKHLQGXVWU\¶VEHVWQRQVWLFNFRDWLQJV(YHU6PRRWKŒLVDYDLODEOH LQ DOO VWDQGDUG VL]HV LQ 1DWXUDO )LQLVK :HDU*XDUG Š 1RQ6WLFN )LQLVK DQG &HUDPL*XDUGŠ,,1RQ6WLFN)LQLVK 0RGHO'HVFULSWLRQ ( 1DWXUDO ( 1DWXUDO ( 1DWXUDO ( 1DWXUDO ( 1DWXUDO (6 :HDU*XDUGŠ (6 :HDU*XDUGŠ & (6 :HDU*XDUGŠ (6 :HDU*XDUGŠ (6 :HDU*XDUGŠ (= &HUDPL*XDUGŠ,, (= &HUDPL*XDUGŠ,, (= &HUDPL*XDUGŠ,, (= &HUDPL*XDUGŠ,, (= &HUDPL*XDUGŠ,,

( '&HQWXULRQŠ &RRNZDUH &UDIWHG RI ILQH VWDLQOHVV VWHHO LQ WKH (XURSHDQ WUDGLWLRQ WKH &HQWXULRQŠ DOXPLQXP ERWWRP SURYLGHVTXLFNHYHQKHDWGLVWULEXWLRQIRUFRQVLVWHQWO\JRRGFRRNLQJ$WKLQERWWRPZDIHURI VWDLQOHVVVWHHOSUHYHQWVGHQWLQJDQGVFUDWFKLQJDQGPDNHVDOO&HQWXULRQŠ FRRNZDUHZLWKD VXLWDEOH ERWWRP GLDPHWHU LQGXFWLRQUHDG\ &HQWXULRQŠ FRRNZDUH LV LPSHUYLRXV WR DFLGLF IRRGV DQG ZRQ¶W SLW GLVFRORU RU FDUU\ RYHU IODYRUV $ OLIHWLPH ZDUUDQW\ PDNHV &HQWXULRQŠ FRRNZDUHWKHFKRLFHRISURIHVVLRQDOV 0RGHO'HVFULSWLRQ  6WRFN3RW 4W  6DXWH3DQ 4W  6DXWH3DQ4W  6DXWH3DQ&XUYHG 4W  2PHOHW3DQ)UHQFK  6DXFH3RW4W  6DXFH3RW4W  6DXFH3RW 4W  6DXFH3RW 4W  6DXFH3DQ4W  &DVVHUROH4W '  )U\SDQ  )U\SDQ´ & &RYHU )LWV

$GGLWLRQDOPRGHOVDYDLODEOH

(3L]]D7UD\V 6HUYLQJXSWKHVOLFHVZLWKVW\OHDQGWDVWH :LGH ULP SDQV DUH FRQVWUXFWHG RI  JDXJHPPDOXPLQXP 0RGHO'HVFULSWLRQ 73  73  73  73  73  73  73  73  73  73  73  73  73  73 


.LWFKHQ6XSSOLHV_ %$OXPLQXP6WRFN3RWV )URPPDNLQJVWRFNEURWKDQGVWHZVWREUDLVLQJPHDWRU VWHDPLQJ OREVWHU RU FUDE 8SGDWH¶V DOXPLQXP VWRFN SRWV DUH GHVLJQHG IRU HDV\ FRRNLQJ HDV\ FOHDQXS DQG PD[LPXP SHUIRUPDQFH &RQVWUXFWHG RI KHDY\JDXJH UHLQIRUFHG DOXPLQXP DQG VSHFLILFDOO\ GHVLJQHG IRU KLJKYROXPHXVHWKHVH16)OLVWHGVWRFNSRWVZLOOSHUIRUP ZRQGHUIXOO\ HYHQ XQGHU WKH PRVW JUXHOLQJ RI NLWFKHQ FRQGLWLRQV $OXPLQXP FRQVWUXFWLRQ SURYLGHV H[FHOOHQW KHDW FRQGXFWLRQ $YDLODEOH LQ VWDQGDUG PP  RU KHDY\ ZHLJKW PP PRGHOV

$6KHHW3DQ&RYHUV 6WRUH DQG WUDQVSRUW IRRG ZLWKRXW WKH ULVN RI JHUPV GLUW RU GXVW WRXFKLQJ IRRG SURGXFWV .HHS FRQWHQWV IUHVK DQG VDQLWDU\ 6QDSRQ ILW 7KUHH FRQYHQLHQW VL]HV WR FKRRVH IURP 'LVKZDVKHU VDIH SRO\SURS\OHQH FRQVWUXFWLRQ 1RW IRU XVH LQ RYHQV RU ZLWK KRW SDQV )XOO VL]H ZLWK FRYHU ZLOO ILW LQ HQGORDG UDFN )LW LV QRW DLUWLJKW 0RGHOV 363&+) DQG 363&)/ VKRZQ 0RGHO'HVFULSWLRQ $ 363&)/ )XOO6L]H 363&+) +DOI6L]H 363&47 4XDUWHU6L]H

% 0RGHO'HVFULSWLRQ &%DNHZDUH 6SHFLDOW\3DQV $37 4W PP

7KHVH SDQV DUH PDQXIDFWXUHG WR PHHW WKH H[DFWLQJ VWDQGDUGV $37 4W PP

RI WKH WRXJKHVW FRPPHUFLDO EDNHULHV DQG IRRGVHUYLFH $37 4W PP

HVWDEOLVKPHQWV )RFXV RIIHUV DQ H[WHQVLYH OLQH RI KHDY\ DQG & $37 4W PP

PHGLXPGXW\ EDNHZDUH DQG VSHFLDOW\ SDQV GHYHORSHG WR JLYH $37+' 4W PP

XVHUV WKH YHU\ EHVW LQ SHUIRUPDQFH &RQVWUXFWHG IURP  $37 4W PP

+DOXPLQXPIRUVXSHULRUVWUHQJWKDQGHYHQKHDWGLVWULEXWLRQ $37 4W PP

&KRRVH IURP 6SULQJ )RUP 3DQV &DNH DQG 3LH 3DQV 0XIILQ $GGLWLRQDOPRGHOVDYDLODEOH 3DQV KDYH D VLOLFRQH FRDWLQJ WKDW SURYLGHV DQ HDV\ UHOHDVH RI EDNHG SURGXFWV 0RGHOV $&3   DQG VKRZQZLWKPXIILQSDQV 0RGHO'HVFULSWLRQ $&3 &DNH3DQ[  6SULQJ)RUP3DQ  )OXWHG&DNH3DQ&XS&DS &KHI3URSULHWRU  3LH3DQ -RKQGHV5RVLHUV $GGLWLRQDOPRGHOVDYDLODEOH LQRYDVL /DNH%OXII,/ Š ':HDU(YHU +HDY\'XW\6KHHW3DQV Š :HDU(YHU VKHHW SDQV DUH LGHDO LQ WKH SURIHVVLRQDO NLWFKHQ IRU PXOWLSOH SDQ XVHV +HDY\ GXW\ FRQVWUXFWLRQ HQVXUHV UXJJHGGXUDELOLW\IRUHYHU\GD\XVHDQGWKHJDOYDQL]HGEHDG 3HUIHFW)DOO6RXS ZLUH NHHSV WKH SDQ¶V VKDSH ZKLOH JXDUGLQJ DJDLQVW UXVW 6ZHHWRQLRQVFKRSSHG 3HUIRUDWHG SDQ IRU RYHQ EURLOLQJ DQG EDNLQJ 6DQLWDU\ RSHQ VPDOOGLFH EHDG $YDLODEOH LQ WKUHH ILQLVKHV 1DWXUDO ZLWK :HDU*XDUG ([WUDYLUJLQROLYHRLO QRQVWLFN FRDWLQJ DQG +DUG&RDW DQRGL]HG IRU UHGXFHG EDNH 6ZHHWFRUQFXWRIIRIFRE WLPHVDQGVFUDWFKUHVLVWDQFH 0RGHO'HVFULSWLRQ )UHVKWRPDWRHVFKRSSHGURXJKO\  2SHQ%HDG16))XOO6L]HJD 6SDQLVKPRQDVWUHOOZLQH 6 2SHQ%HDG16))XOO6L]HJD1RQ6WLFN $YDLODEOHVTXDVKHVFKRSSHGPHGLXPGLFH ' 1 &ORVHG%HDG)XOO6L]HJD $YDLODEOHSRWDWRHVFKRSSHGPHGLXPGLFH  &ORVHG%HDG)XOO6L]HJD  &ORVHG%HDG)XOO6L]HJD 2UJDQLFKHDY\FUHDP  &ORVHG%HDG)XOO6L]HJD )UHVKKHUEVLHEDVLOWK\PHRUIORZHUV 3 3HUIRUDWHG)XOO6L]HJD 6HDVDOW $GGLWLRQDOPRGHOVDYDLODEOH )UHVKSHSSHU

(GCVWTGF%JGH

($OXPLQXP6KHHW3DQV :LQFR 6KHHW 3DQV DUH D QHFHVVLW\ IRU UHVWDXUDQW FDWHUHU DQGEDNHU\VXSSOLHUVHYHU\ZKHUH(DV\WRVWDFNDQGZDVK 7KHFOHDQHGJHVSURYLGHHDV\DQGVDQLWDU\FOHDQLQJ([WUD KHDY\GXW\  DOXPLQXP WKH\ DUH FORVHG EHDG ZLWK JDOYDQL]HG ZLUH IRU UXVW UHVLVWDQFH DQG UHLQIRUFHPHQW H[FHSW$/;3ZKLFKLVRSHQEHDG$SHUIHFWEOHQGRI YDOXHDQGSHUIRUPDQFH16)DSSURYHG0RGHO$/;3 VKRZQ 0RGHO'HVFULSWLRQ $/;3 )XOO6L]H*D

[

$/;3+ )XOO6L]H*D

[

 $/;3 )XOO6L]H*D

[

$/;33 )XOO6L]H*D

[

3HUIRUDWHG $/;3 4XDUWHU6L]H*D

[

$/;3 +DOI6L]H*D

[

$/;33 +DOI6L]H*D

[

3HUIRUDWHG $/;3 7KLUG6L]H*D[

/RFDODJHGKDUGFKHHVHVKDYHG 6DXWp WKHRQLRQVRQKLJKKHDWLQWKHROLYHRLODGG WKH FRUQ UHG ZLQH DQG WRPDWRHV &RRN XQWLO WKH ZLQHUHGXFHVE\

(

7KHQ DGG WKH VTXDVK DQG SRWDWRHV DQG DGG ZDWHUWRMXVWFRYHUWKHLQJUHGLHQWV1RZDGGWKH FUHDP DERXW  RI WKH YROXPH RI WKH SRW 6LPPHUIRUPLQXWHVJLYHRUWDNHXQWLOVTXDVK DQGSRWDWRHVDUHDOPRVWWHQGHUEXWVWLOODOGHQWH 6HDVRQZLWKVDOWDQGSHSSHU$GGWKHKHUEVDQG VLPPHUIRUDIHZPLQXWHVORQJHU 6HUYHDQGJDUQLVKZLWKWKHFKHHVHDQGPD\EHD OLWWOHIUHVKEODFNSHSSHU


.LWFKHQ6XSSOLHV_

$ $6WDLQOHVV6WHHO0HDVXULQJ&XSV (YHU\NLWFKHQVKRXOGKDYHDVHWRIWKHVHVWDLQOHVV VWHHO PHDVXULQJ FXSV $YDLODEOH LQ D VHW ZKLFK LQFOXGHV FXS FXSFXSDQGFXSVL]HV 0RGHO'HVFULSWLRQ 0&: :LUH+DQGOH6HWRI 0&: :LUH+DQGOH &XS 0&: :LUH+DQGOH &XS 0&: :LUH+DQGOH &XS 0&: :LUH+DQGOH &XS 0&: :LUH+DQGOH&XS 0&: :LUH+DQGOH &XS 0&: :LUH+DQGOH &XS 0&: :LUH+DQGOH &XS 0&: :LUH+DQGOH&XS

')RUVFKVKLHOGŒ&XW5HVLVWDQW*ORYHV 1HZDQG,PSURYHG2IIHULQJ/HYHODQG/HYHO FXW UHVLVWDQFH IRU VDIHW\ DQG GXUDELOLW\ )RXU JORYHV WR FKRRVH IURP WR ILW WKH WDVN DW KDQG (DFK RIIHUV RXWVWDQGLQJ FXW SURWHFWLRQ DQG DPD]LQJGH[WHULW\IRUWKHXOWLPDWHZHDUDELOLW\DQG IRU WKH VDIHW\ RI \RXU ZRUNHUV $PELGH[WURXV &RQVWUXFWHG RI )'$ DQG 86'$ PDWHULDOV WKDW DUH ZDVKDEOH EOHDFK VDIH DQG FRQWDLQ DQWL PLFURELDO SURSHUWLHV IRU DGGHG VDIHW\ 3/86  3HUIRUPDQFH),7 LV QRZ DYDLODEOH LQ IRXU ³RQH VL]H ILWV PRVW´ H[FLWLQJ QHRQ FRORUV (DV\ WR ' VSRWIURPDQ\ZKHUHLQWKHNLWFKHQ 0RGHO'HVFULSWLRQ  3HUIRUPDQFH6KLHOG;6PDOO &ODPVKHOO

 3HUIRUPDQFH6KLHOG6PDOO &ODPVKHOO

 3HUIRUPDQFH6KLHOG0HGLXP &ODPVKHOO

 3HUIRUPDQFH6KLHOG/DUJH &ODPVKHOO

 3HUIRUPDQFH6KLHOG;/DUJH &ODPVKHOO

$GGLWLRQDOVL]HVDQGVW\OHDYDLODEOH

($5&Œ)UXLW 9HJHWDEOH6OLFHUV $5&Œ²WKHILUVWVOLFHUWKDWFDQFXWWKURXJKDQ RQLRQRUSRWDWRZLWKHDVHDQGVOLFHDYHU\ULSH WRPDWR HYHQ EHWWHU 3OXV ZLWK WKH H[FOXVLYH SDWHQWSHQGLQJGHVLJQ\RXQHYHUKDYHWRSODFH WKH SURGXFW GLUHFWO\ RQ WKH EODGHV 7KH XQLTXH SXVKHUKRSSHU DOORZV VDIH DQG SHUIHFW SRVLWLRQLQJ RI WKH SURGXFW WR EH VOLFHG DV ZHOO DV IRU ORDGLQJ VPDOOHU VRIW SURGXFWV OLNH VWUDZEHUULHV IRU IDVWHU EXON VOLFLQJ 7KH TXLFN FKDQJH EODGH FDUWULGJH ZLWK ZDVK JXDUG HQVXUHV VDIH KDQGOLQJ DQG WKH DOO VWDLQOHVV VWHHO FRQVWUXFWLRQ RI WKH $5& ZLOO ZHDWKHU DQ\VWRUP 0RGHO'HVFULSWLRQ  $5& EODGHV  EODGHV $5&  $5& EODGHV

(

%5HGFRŠ ,QVWD6OLFHŒ 3RSLQ SRSRXW EODGH DVVHPEO\ IRU HDV\ FOHDQLQJ DQG PDLQWHQDQFH 7KHUPRVHW EODGH IUDPHV QHYHU QHHG DGMXVWPHQW DQG ZLOO QRW FRUURGH &RUURVLRQUHVLVWDQW SRO\XUHWKDQH IRRG FDUULHU +DUGFRDWŒ SXVKHU KHDG ILQJHUV UHVLVW FRUURVLRQ IURP WRPDWR DFLGV DQG RWKHU KDUVK IRRGV 'HWDFKDEOH WDEOH VWRS DVVXUHV SURFHVVRU ZLOO VWD\ LQ SODFH $YDLODEOH ZLWK VWUDLJKW RU VFDOORSHG EODGHV DOORZLQJ VOLFLQJ RIWRPDWRHVZLWKRXWµSUHVFRULQJ¶WKHVNLQ16) 0RGHO'HVFULSWLRQ   6FDOORSHG %   6FDOORSHG  6FDOORSHG    6FDOORSHG  6WUDLJKW    6WUDLJKW   6WUDLJKW  &5HGFRŠ ,QVWD&XWŒ 6WUDLJKW  7KUHH WLPHV IDVWHU WKDQ FXWWLQJ E\ KDQG 6OLFH GLFH ZHGJH DQG FRUH ZLWK VLPSOH SRSLQ SRSRXW EODGH DFFHVVRULHV WKDW PDNH VZLWFKLQJ IURP GLFLQJ RQLRQV WR FRULQJ DSSOHV D IDVW DQG HIILFLHQW SURFHVV LQ \RXU NLWFKHQ ,WV WDOO EDVH ILWV FRQWDLQHUV XS WR + 6OHGOHJ EDVH GHVLJQ RIIHUV VXSHULRU UHVLVWDQFH WR EUHDNDJH 7KHUPRVHW EODGH IUDPHV QHYHU QHHG DGMXVWPHQW DQG ZLOO QRW FRUURGH )XOO  VTXDUH FXWWLQJ DUHD ILWV ODUJH IUXLWV DQG YHJHWDEOHV &OHDQ & TXLFNFXWVUHGXFHEUXLVLQJDQGUDLVHWKHTXDOLW\OHYHO RIIRRGSUHVHQWDWLRQ7ZR\HDUZDUUDQW\0RGHO VKRZQ 0RGHO'HVFULSWLRQ   'LFH 7DEOHWRS

  'LFH 7DEOHWRS

 'LFH 7DEOHWRS

   6OLFH 7DEOHWRS

 6OLFH 7DEOHWRS

   6OLFH 7DEOHWRS

  'LFH%ODGH$VVHPEO\  'LFH%ODGH$VVHPEO\    6OLFH%ODGH$VVHPEO\ $GGLWLRQDOPRGHOVDYDLODEOH

)

)7RPDWR/DVHUŒ6OLFHU 6XUH \RX¶YH EHHQ VOLFLQJ WRPDWRHV ZLWK WKRVH ¶V VW\OH DOXPLQXP WRPDWR VOLFHUV IRU D ORQJ WLPH EXW \RX¶YH QHYHU UHDOO\ EHHQ KDSS\ ZLWK WKHLU SHUIRUPDQFHRQUHDOO\ULSHWRPDWRHVRUKRZGLIILFXOW WKH\DUHWRFOHDQRUWRFKDQJHWKHEODGHVRUZKHUH WKH WRPDWRHV HQG XS :HOO (GOXQG LQWURGXFHV WKH /DVHU WKH HDVLHVW IDVWHVW DQG PRVW DGYDQFHG PDQXDOWRPDWRVOLFHUHYHUVHHQ7KHSDWHQWSHQGLQJ VOLFHULV16)FHUWLILHGDOOVWDLQOHVVVWHHODQGILWVLQD VWDQGDUG GLVK UDFN IRU WKRURXJK GLVKZDVKHU VDIH FOHDQLQJ 7KH H[FOXVLYH VWDJJHUHG EODGH FDUWULGJH HQVXUHVDSHUIHFWO\VOLFHGWRPDWRHYHU\WLPH+HDY\ GXW\VXFWLRQFXSIHHWNHHSWKHVOLFHULQSODFH 0RGHO'HVFULSWLRQ  (7/ EODGHV  EODGHV (7/  (7/ EODGHV


.LWFKHQ6XSSOLHV_ %&DPZHDUŠ 6FRRSV &DPEUR¶V VFRRSV DUH PDGH RI &DPZHDU SRO\FDUERQDWH VR WKH\ DUH MXVW WKDW VWURQJ )RU\RXWKDWPHDQVWKHKDQGOHZLOOQRWEUHDN RIIDQGWKHVFRRSVZLOOQRWGHQWUXVWRUFKLS 7KH\ ZLOO FRQWLQXH WR ORRN JRRG DQG SHUIRUP ZHOOZDVKDIWHUZDVK 0RGHO'HVFULSWLRQ 6&3&: R] 6&3&: R] 6&3&: R] 6&3&: R]

$

$+HDY\'XW\0L[LQJ%RZOV 8SGDWH RIIHUV D JUHDW VHOHFWLRQ RI  VWDLQOHVV VWHHO KHDY\GXW\PL[LQJERZOV7KHVHERZOVDUHHDV\WRFOHDQ DQGFDQEHXVHGIRUPL[LQJMXVWDERXWDQ\WKLQJ$VWDSOH IRU DQ\ FRPPHUFLDO NLWFKHQ FDWHULQJ FRPSDQ\ KRWHO EDNHU\VFKRROFDIHWHULDRUKRVSLWDO'LVKZDVKHUVDIH 0RGHO'HVFULSWLRQ0RGHO  'HVFULSWLRQ  4W 0%+' 0%+' 4W 0%+' 4W 0%+'  4W 0%+' 4W 0%+' 4W 0%+' 4W 0%+' 4W 0%+' 4W 0%+' 4W

& '

'3DVWU\%DVWLQJ%UXVKHV &KHI 6HULHVŒ EUXVKHV ZLWK JHQXLQH ERDU EULVWOHV IRU JHQWO\ WUHDWLQJ GHOLFDFLHV 3HUIHFW IRU EDVWLQJ ZKHUH KHDWLVDIDFWRU*DOD[\ŒEUXVKHVKDYHQ\ORQEULVWOHV IRU SUHSDULQJ SDVWU\ SDQV EXWWHULQJ WRDVW EDVWLQJ PHDWV$YDLODEOHLQZKLWHUHGRUEOXHEULVWOHV6LOLFRQH EUXVKHV ZLWK XQLTXH EULVWOH GHVLJQ FDUU\ DQG VSUHDG OLTXLG EHWWHU WKDQ RUGLQDU\ VLOLFRQH EUXVKHV :LWKVWDQGV WHPSHUDWXUHV XS WR ƒ) 0ROGHGLQ KDQJLQJ KRRN JUDEV SDQ HGJHV WR NHHS EUXVK IURP VOLGLQJLQ'LVKZDVKHUVDIH 0RGHO'HVFULSWLRQ  &KHI6HULHVŒZ%RDU%ULVWOHV  &KHI6HULHVŒ)ODWZ%RDU%ULVWOHV  *DOD[\ŒZ1\ORQ%ULVWOHV  *DOD[\ŒZ1\ORQ%ULVWOHV  6LOLFRQH  6LOLFRQH $GGLWLRQDOPRGHOVDYDLODEOH

%

&)LOPDQG)RLO'LVSHQVHU 1HZ +HDY\ 'XW\ )LOP DQG )RLO 'LVSHQVHU UHSODFHV WKRVH IOLPV\ FDUGERDUG FDUWRQV 6WXUG\ VWDLQOHVV VWHHOGLVSHQVHUZLWKVXFWLRQFXSIHHWKROGLWVHFXUHO\ LQSRVLWLRQRU\RXFDQPRXQWLWRQWKHZDOODQGVDYH SUHFLRXV FRXQWHU VSDFH :HOGHG KDQGOHV PDNH LW HDV\WRFDUU\ZKHQORDGHGZLWKDIXOOUROO$GMXVWDEOH GLVSHQVLQJ WXEH ILWV ERWK  DQG  UROOV :KHWKHU \RX¶UH XVLQJ WKH VOLGH FXWWHU IRU ILOP RU WKH LQWHUFKDQJHDEOHPHWDOFXWWHUIRUIRLO\RXJHWDFOHDQ FXW WKDW HOLPLQDWHV ZDVWH DQG VDYHV \RX PRQH\ 16)0RGHO))'

(GCVWTGF%JGH &KHI$GDP7UDFKWHQEHUJ ( $+RWHO5HVWDXUDQW6XSSO\ 3ODLQILHOG1&KHI·V7LSV %DNLQJ3RZGHU 2XWRIEDNLQJSRZGHUIRU\RXUUHFLSH" 0DNHLW\RXUVHOIWHDVSRRQEDNLQJVRGD ELFDUERQDWH   WHDVSRRQV FUHDP RI WDUWHU 0L[ WRJHWKHU DQG ³XVH LPPHGLDWHO\´<LHOGVWDEOHVSRRQRIEDNLQJSRZGHU 6WRUH%DNLQJ3RZGHU $GGDOHYHOWHDVSRRQRIFRUQVWDUFKWRHYHU\R]RIEDNLQJSRZGHU WRDEVRUEPRLVWXUHIURPWKHDLU7KLVZLOOSUHYHQWWKHEDNLQJSRZGHUIURPUHDFWLQJEHIRUH\RX QHHGWRXVHLW0XVWVWRUHEDNLQJSRZGHULQDQDLUWLJKWFRQWDLQHU %DNLQJ3RZGHU7HVWLQJIRU4XDOLW\ 3XWWHDVSRRQEDNLQJSRZGHULQDERZORIKRWZDWHU ,ILWEXEEOHVLW¶VJRRGDQGSRWHQW,IWKHUHDUHQREXEEOHVLW¶VEDGDQGWKURZLWDZD\ (JJ4XDOLW\7HVW 6XEPHUJHUDZHJJVLQFROGZDWHU,IWKH\VWD\RQWKHERWWRPWKH\DUH VWLOOJRRG,IWKHHJJVIORDWWRWKHWRSWKH\KDYHDLUSRFNHWVLQVLGHWKHVKHOODQGDUHROG

()ODW%RWWRP 6WHDN:HLJKWV 9ROOUDWK¶V XQLTXH SDWHQWHG GHVLJQ LV ( DYDLODEOH LQ D  RU  SRXQG YHUVLRQ WR SURYLGH WKH SHUIHFW ZHLJKW IRU \RXU JULOOLQJ QHHGV 6WDLQOHVV VWHHO FRQVWUXFWLRQ IRU ORQJ OLIH 1R FUHYLFHV WR FROOHFW IRRG 6LOLFRQH KDQGOH SURYLGHV KHDW UHVLVWDQFH &RORUFRGLQJ LV DYDLODEOH WR KHOS SUHYHQW FURVV FRQWDPLQDWLRQ 16) 6KRZQ ZLWK RSWLRQDO\HOORZVOHHYH 0RGHO'HVFULSWLRQ  OE[Z5HG6LOLFRQH+DQGOH  OE[Z5HG6LOLFRQH+DQGOH  <HOORZ6LOLFRQH5HSODFHPHQW6OHHYH  5HG6LOLFRQH5HSODFHPHQW6OHHYH

(JJ4XDOLW\7HVW &UDFNDQHJJRQDIODWSODWHLILWVSUHDGVRXWDQGWKH\RONLVIODWRUORZ WKH\DUHROGDQGGRQRWXVH,IWKH\RONLVKLJKDQGURXQGHGDQGWKHZKLWHGRHVQRWVSUHDG RXWWKH\DUHJRRGDQGIUHVK 6WRS&U\LQJ:KLOH6OLFLQJRU3HHOLQJ2QLRQV 3ODFHZKROHRQLRQVZLWKWKHVNLQVRQLQWKH IUHH]HUIRUDERXWPLQXWHV GRQRWIUHH]H 2USHHORQLRQVXQGHUFROGUXQQLQJZDWHUZKLFK FDQEHWULFN\EXWZRUNV %XWWHUPLON 1HHG%XWWHUPLON"%XWGRQ¶WKDYHLW"0DNHLW\RXUVHOIóFXSZKROHPLONDQGô FXSSODLQ\RJXUW<LHOGVFXS 0RVW,PSRUWDQW/HVVRQLQ&RRNLQJ $OZD\VXVHWKHEHVWDQGIUHVKHVWLQJUHGLHQWV\RXFDQ JHW :DWHU LV WKH PDLQ LQJUHGLHQW LQ DOO FRRNLQJ ZKHWKHU LW¶V LQ EDNLQJ SURGXFWV VDXFHV VRXSV RU ERLOLQJ SDVWD HWF 8VH ILOWHUHG RU ERWWOHG ZDWHU DOZD\V 7KH PLQHUDOV DQG RWKHU GHSRVLWV DUH FRQFHQWUDWHG DQG PDGH VWURQJHU LQ WDVWH DV WKH\ UHGXFH &DOFLXP /LPH 0DJQHVLXPDQG,URQDUHDOOFRPPRQO\IRXQGPLQHUDOVLQFLW\WDSZDWHU


.LWFKHQ6XSSOLHV_

$*ORYHV ,Q FRPELQDWLRQ ZLWK SURSHU KDQG ZDVKLQJWKHSURSHUXVHRIKLJKTXDOLW\ GLVSRVDEOH JORYHV IURP )RRG+DQGOHU SURYLGHV FRPSOHWH EDUULHU SURWHFWLRQ EHWZHHQ KDQGV DQG IRRG )XOO OLQH RI GLVSRVDEOH JORYHV DYDLODEOH IRU HYHU\ EDFN DQG IURQW RI KRXVH DSSOLFDWLRQ XVLQJWKHPDWHULDOVEHVWVXLWHGWRHDFK DSSOLFDWLRQ

$

0RGHO'HVFULSWLRQ )+&3 9LQ\O*ORYH0HG3N 6*&3 6DIHW\*ULS/DWH[*ORYH0HG3N )+ /DWH[*ORYH0HG%R[&V )+ 3RZGHU)UHH9LQ\O*ORYH0HG%R[&V )+&1 &RQWDFW3RZGHU)UHH9LQ\O*ORYH0HG%R[&V 714 7HNQLTXH3RZGHU)UHH6\QWK*ORYH6PO%R[&V $GGLWLRQDOVW\OHVVL]HVDQGFRQYHQLHQFHSDFNVDYDLODEOH

&4XLFN)LWŒ3RO\*ORYHV 3XW RQ JORYHV  VHFRQGV IDVWHU ZLWK RXU XQLTXH 4XLFN)LW 6\VWHP 3XQFWXUHUHVLVWDQW SRO\ JORYHV RIIHU ORQJFXIIVWKDWFRYHUWKHHQWLUHKDQGDQGSDUWRIWKHDUP SURYLGLQJ PXFK EHWWHU VDQLWDWLRQ WKDQ ZD[HG SDSHU VKHHWV%OXHLQFRORUWKHJORYHVDUHHDV\WRLGHQWLI\IRU WDVNVSHFLILFXVHDQGKHOSSUHYHQWFURVVFRQWDPLQDWLRQ 3OXV WKH\ DUH 16) FHUWLILHG WR DVVXUH WKH\ DUH VDIH IRU IRRG FRQWDFW :LWK D YDULHW\ RI GLVSHQVLQJ XQLWV WR FKRRVH IURP WKH V\VWHP DOORZV \RX WR SXW JORYHV & H[DFWO\ZKHUH\RXQHHGWKHP 0RGHO'HVFULSWLRQ )+4); ([WHQGHG/HQJWK%OXH60 )+4); ([WHQGHG/HQJWK%OXH/;/  +LQJHG%UDFNHWZ0RXQWLQJ6FUHZV 'RXEOH6WLFN7DSH

()RUP)OH[ 1HZ QLWULOH IRUP ILW JORYH KDV EHWWHU PHPRU\ WKDQ FRQYHQWLRQDO QLWULOH²WKH ORQJHU ODVWLQJ DQG PRVW GXUDEOH JORYH LQ IRRGVHUYLFH 5HVLVWDQW WR  DQLPDO IDWV VR WKH\ ZRQ¶W EUHDN GRZQ DV D UHVXOW RI FRQWDFW ZLWK UDZ PHDWV DQG VKHOOILVK (QKDQFHG GH[WHULW\ JULS DQG ILQJHUWLS VHQVLWLYLW\ /DVW ORQJHU DQG UHTXLUH IHZHU FKDQJHV WR VDYH WLPH DQGPRQH\0RGHO))&3

)

%&XWWLQJ%RDUGV6DQL7XIIŠ 5HYHUVLEOH 6DQL7XIIŠ FXWWLQJ ERDUGV DUH PDGH IURPDKLJKGHQVLW\UXEEHUFRPSRXQG WKDW ZRQ¶W FUDFN VSOLQWHU VZHOO RU DEVRUE OLTXLGV RU RGRUV /DVWV IDU ORQJHU WKDQ FXWWLQJ ERDUGV PDGH IURP ZRRG RU SODVWLF 7KH UXEEHU FRPSRXQG KDV D KLJK GHJUHH RI UHVLOLHQF\ SUHVHUYLQJ NQLIH HGJHV ORQJHU 0DGH ZLWK 0LFUR6WRSŒ² DQ DQWLPLFURELDO UXEEHU FRPSRXQG WKDW LQKLELWV WKH JURZWK RI EDFWHULD DQG IXQJL WR SURYLGH D KHDOWKLHU ZRUN HQYLURQPHQW$YDLODEOHLQDYDULHW\RI % VL]HV DQG WKLFNQHVVHV 6DQL7XII Š FXWWLQJ ERDUGV FDQ EH UHVXUIDFHG E\ VDQGLQJ WKHERDUGDVQHHGHG16) 0RGHO'HVFULSWLRQ  [  [  [ $GGLWLRQDOPRGHOVDYDLODEOH

'

(

'6DI7*ULSŠ &XWWLQJ%RDUGV ,QWHJUDWHG DQWLVOLS JULSV SURYLGH D VDIH FXWWLQJ VXUIDFH ZLWKRXWXVLQJWKHXQVDQLWDU\³ZHWWRZHO´PHWKRG+ROGV ERDUGV VHFXUHO\ LQ SODFH IRU HDVH RI XVH DQG KHOSV HOLPLQDWH FXW LQMXULHV 3DWHQWHG IRRG VDIHW\ KRRN SURYLGHV VDQLWDU\ WUDQVSRUW DQG VWRUDJH (PERVVHG UXOHU IHDWXUH PDNHV SRUWLRQLQJ HDV\ VDYLQJ FRVW 8QLTXH FRSRO\PHU PDWHULDO ZLWKVWDQGV FRQWLQXDO KLJK WHPSHUDWXUH FRPPHUFLDO ZDVKLQJ DQG ZLOO QRW ZDUS )RRG VDIHW\ KRRN SURYLGHV VDQLWDU\ KDQJLQJ DQG FDUU\LQJ 'LVKZDVKHU VDIH 16) $YDLODEOH LQ [ [[[DQG[ 0RGHO'HVFULSWLRQ &%*%. [%ODFN &%**1 [*UHHQ &%*</ [<HOORZ &%*5' [5HG &%*:+ [:KLWH $GGLWLRQDOPRGHOVDYDLODEOH

)(SLFŒ6\QWKHWLF*ORYHV ,QWURGXFLQJ D JURXQGEUHDNLQJ QHZ JORYH PDWHULDO H[FOXVLYH WR )RRG+DQGOHU ,QQRYDWLYH (SLFŒ JORYHV IHDWXUH D XQLTXH FRPELQDWLRQ RI VRIWQHVVDQGVWUHQJWKWKDWGHOLYHUVWKHSHUIRUPDQFHDQGIRUPILWWLQJFRPIRUW RIYLQ\OJORYHVDWDORZHUFRVW(DV\WRZHDUDQGUHOLDEOHRXUQHZJORYHV SURYLGHDQHFRQRPLFDOVROXWLRQIRUEDUULHUSURWHFWLRQ(IILFLHQWSDFN VL]H \LHOGV D  VPDOOHU FDVH FXEH DQG  VROLG ZDVWH UHGXFWLRQ YV VWDQGDUGSDFN0RGHO)+(3 0RGHO'HVFULSWLRQ )+(3 3)6PDOO )+(3 3)0HGLXP )+(3 3)/DUJH )+(3 3);/DUJH


.LWFKHQ6XSSOLHV_

(GCVWTGF%JGH $ $7LPHU3URGXFWV 7HPSHUDWXUH DQG WLPH LQ D IRRG VDIHW\ HQYLURQPHQW DUH WKH WZR PRVW LPSRUWDQW FRPSRQHQWVLQSUHYHQWLQJIRRGERUQHLOOQHVV2XUNLWFKHQWLPHUVDUHKLJKSHUIRUPLQJ DQG HDV\ WR RSHUDWH 'HVLJQHG WR EH GXUDEOH DQG ZDWHU UHVLVWDQW IRU DOO NLWFKHQ HQYLURQPHQWV&KRRVHIURPDZLGHYDULHW\RIWLPHUVWRPHHW\RXUHYHU\QHHGDQG KHOS DXWRPDWH \RXU PRQLWRULQJ SURWRFROV 0RGHOV VKRZQ OHIW WR ULJKW  '77 7)67:7&76)770 0RGHO'HVFULSWLRQ '77 'LJLWDO&RRNLQJ7KHUPR7LPHUƒWRƒ) 7)6 0XOWL6WDWLRQ'LJLWDO7LPHU 7: /DUJH'LJLWDO0XOWL)XQFWLRQ7LPHUZ0XOWL0RXQW  $&$GDSWHUIRU76) 7& %XWWRQ(OHFWURQLF7LPHU&ORFN6WRSZDWFK 76 7LPHU6WRSZDWFK )7 /J6LQJOH6WDWLRQ+U'LJLWDO7LPHUZ9ROXPH&RQWURO 70 /RQJ5LQJ0HFKDQLFDO0LQXWH7LPHU

-DPLH*RUH\ -LOO0HDQV 7ZR&KLFNVIURPWKH6WLFNV KWWSWZRFKLFNVIURPWKHVWLFNVFRPEORJV $QG\¶V)DYRULWH/HPRQ%DUV

%

%DVH 7RSSLQJ FXSVFUXVKHGJUDKDPFUDFNHUV DERXWFUDFNHUV

FXSDOOSXUSRVHIORXU 

FXSSDFNHGEURZQVXJDU



WHDVSRRQEDNLQJSRZGHU

WHDVSRRQVDOW

%7LPHUV 7KH )03 IDPLO\ RI WLPHUV LQFOXGHV WKH FRPPHUFLDOGXW\ PLQXWH 7LPHU WKH  PLQXWH0HFKDQLFDO%HOO7LPHUWKH0LQL'LJLWDO7LPHUWKH,QŒ'LJLWDO7LPHUDQG WKH EUDQG QHZ ,QŒ 3URJUDPPDEOH 'LJLWDO 7LPHU 7KH SURJUDPPDEOH WLPHU WLPHVDFWLYLWLHVDWRQFHDGMXVWDEOHE\WKHKRXUPLQXWHDQGVHFRQG(DFKDFWLYLW\ FDQEHODEHOHGZLWKXSWRFKDUDFWHUV)HDWXUHVVRIWWRXFKNH\SDGPHPRU\UHFDOO FRORUFRGHGOLJKWVFRXQWXSRUFRXQWGRZQDQGDKLJKORZYROXPHFRQWURO,QFOXGHV 9EDWWHU\ 0RGHO'HVFULSWLRQ  7LPHU,Q'LJLWDO FRXQWGRZQ

 &RPPHUFLDOGXW\0HFKDQLFDO7LPHU  0LQL'LJLWDO7LPHU  0HFKDQLFDO%HOO7LPHU  7LPHU,Q'LJLWDO FRXQWGRZQ

7KHUPRPHWHUV $JRRGWKHUPRPHWHULVRQHRIWKHPRVWXVHIXOWRROVIRUHQVXULQJIRRGVDIH W\ $ ZLGH YDULHW\ RI WKHUPRPHWHUV DUH DYDLODEOH IRU VSHFLILF DSSOLFDWLRQV VXFKDVHVSUHVVRJULOOVUHIULJHUDWRUVDQGSUREHWKHUPRPHWHUV(GXFDWH\RXU VWDII RQ WKH SURSHU XVH DQG DSSOLFDWLRQ IRU HDFK WKHUPRPHWHU ,W LV DOVR LPSRUWDQWWKH\NQRZKRZWRXVHDQGFDOLEUDWHSUREHWKHUPRPHWHUV

0HDVXULQJ3URGXFW7HPSHUDWXUHV %\KHDWLQJIRRGWRWKHSURSHUWHPSHUDWXUHDOOSDWKRJHQVFDQEHHOLPLQDWHGLQ SUHSDUDWLRQ 3URSHUO\ XVLQJ WKH FRUUHFW WKHUPRPHWHU LV FUXFLDO 1HYHU XVH FRORU DV DQ LQGLFDWLRQ RI WKH GRQHQHVV RI PHDW $OZD\V PHDVXUH DW WKH SURGXFW·VFHQWHUIURPWKHWKLFNHVWSRUWLRQ1HYHUPHDVXUHFRRNHGSURGXFW LPPHGLDWHO\DIWHUPHDVXULQJUDZSURGXFW3UREHVVKRXOGEHZDVKHGULQVHG DQG VDQLWL]HG DIWHU HDFK XVH 7KH 86'$ 'LUHFWLYH  RQ PHDW WHPSHUDWXUHV UHTXLUHV WKH WRWDO RI SUREH DQG LQVWUXPHQW DFFXUDF\ WR EH ZLWKLQƒ)



FXSEXWWHUPHOWHG

)LOOLQJ RXQFHFDQVZHHWHQHGFRQGHQVHGPLON 

FXSIUHVKO\VTXHH]HGOHPRQMXLFH OHPRQV

)LQHO\JUDWHGSHHORIRQHOHPRQ

3UHKHDW RYHQ ƒ ) *UHDVH D LQFK VTXDUH JODVV EDNLQJGLVKVHWDVLGH ,Q D PHGLXP ERZO FRPELQH FUXVKHG JUDKDP FUDFNHUV IORXUEURZQVXJDUEDNLQJSRZGHUDQGVDOW6WLULQWKH PHOWHG EXWWHU DQG PL[ XQWLO FUXPEO\ 3UHVV  RI WKH FUXPEPL[WXUHLQWRWKHSUHSDUHGEDNLQJGLVK ,Q D VPDOO JODVV ERZO ZKLVN WRJHWKHU VZHHWHQHG FRQGHQVHG PLON OHPRQ MXLFH DQG OHPRQ SHHO 6SUHDG RYHU WKH SUHVVHG FUXPE FUXVW DQG WRS ZLWK UHPDLQLQJ JUDKDPFUDFNHUPL[WXUH %DNHIRUPLQXWHVRUXQWLOOLJKWO\EURZQHG&RRORQD ZLUH UDFN  &XW LQWR  EDUV  6WRUH EDUV LQ WKH UHIULJHUDWRU


.LWFKHQ6XSSOLHV_

(GCVWTGF%JGH

$

&KHI*X\)LHUL 7KH)RRG1HWZRUN² *X\¶V%LJ%LWH *X\2IIWKH+RRN 'LQHUV'ULYH,QV  'LYHV &(2 -RKQQ\*DUOLF¶V,QF 6DQWD5RVD&$

)RRG6DIHW\LV%XVLQHVV6DIHW\ ,QWRGD\¶VLQGXVWU\ZHDUHIDFHGZLWKRXUILHUFHVWFRPSHWLWLRQ)RRG 6DIHW\ 2KLWLVQRWDERXWWKHEXUJHUMRLQWWKDWLVVHOOLQJEXUJHUVFKHDSHURU WKH PLQL PDUW ZLWK WKH „ KRW GRJV :KR FDUHV ZKDW FKDLQ UHVWDXUDQWLVPRYLQJLQRUZKDWWKHQHZIUR]HQIRRGVDUHDW&RVWFR 7KHVH ZHUH WKH SUHVVXUHV RI WKH SDVW RQHV WKDW ZH FRXOG VHH DQG WRXFK EXW WKHUH LV D PXFK GLIIHUHQW FDVH ZKHQ LW FRPHV WR IRRG VDIHW\ &RQVXPHUVWRGD\DUHEHFRPLQJPXFKPRUHDZDUHDQGVNHSWLFDORI IRRGHVWDEOLVKPHQWVDQGWKHLUSUDFWLFHVLQIRRGVDIHW\7KHUHDOGHDO DERXWIRRGVDIHW\LVQRWMXVWLQZKDWWKHJXHVWVFDQVHHLWLVDERXW WDNLQJ FDUH RI EXVLQHVV LQ IRRG VDIHW\ HYHU\ VWHS RI WKH ZD\ IURP UHFHLYLQJWRVHUYLQJ +HUHDUHDIHZUHFRPPHQGDWLRQVWKDWFDQVDYH\RXUEXVLQHVVDQG VHFXUH\RXUIXWXUH  6HUY6DIH &RXUVH (QFRXUDJH SHRSOH RQ \RXU WHDP WR WDNH DQG SDVVWKH6HUY6DIHFRXUVH  +DQG :DVKLQJ ,PSOHPHQW PDQGDWRU\ SUDFWLFHV IRU \RXU WHDP 7KLVLVWKHQXPEHURQHFDXVHRIFURVVFRQWDPLQDWLRQ  7KHUPRPHWHUV %X\ DQG XVH JRRG GLJLWDO WKHUPRPHWHUV« 7KLVPD\EHWKHVLQJOHPRVWLPSRUWDQWWRROLQ\RXUNLWFKHQ  6DQLWL]LQJ 6ROXWLRQ 6HW XS VWDWLRQV LQ \RXU NLWFKHQ EDU DQG VHUYLFHDUHD

$'LJLWDO3RFNHW7HVW7KHUPRPHWHUV 7KHVH TXLFNUHDGLQJ GLJLWDO WKHUPRPHWHUV VLPSOLI\ HYHU\RQH¶V MRE«IURP FRRNV WR WHFKQLFLDQV :LWK WKHLU UHGXFHG WLSV DQG IDVWHU UHVSRQVH WLPHV WKHVH FRPSDFW XQLWV KDYH HDV\WRUHDG GLVSOD\V DQG SURWHFWLYH DQWLPLFURELDO VKHDWKV 7KH\ DUH HDV\ WR XVH DQG KDYH EXLOWLQVKLUWFOLSVWRNHHSWKHPLQSODFHZKLOH\RXZRUN 0RGHO'HVFULSWLRQ ')3: ƒWRƒ):DWHUSURRI/LIHWLPH:DUUDQW\ '33: ƒƒ):DWHUSURRIZ-XPER/&'6WHP '33: ƒWRƒ)3HQ6W\OH:DWHUSURRI16) 770 ƒƒ):DWHUSURRI/LIHWLPH:DUUDQW\ '7 ƒWRƒ)2YDO2Q2II6ZLWFK %+$&&30DQDJHU.LW 6LPSOLI\ERWKWKHUHFRUGLQJRIIRRGSURGXFW WHPSHUDWXUHV DQG WKH PRQLWRULQJ RI DOO FRUUHFWLYH DFWLRQV LQ \RXU IRRGVHUYLFH RSHUDWLRQ .LW SURYLGHV WKH VRIWZDUH KDUGZDUH DQG 3& LQWHUIDFH GHVLJQHG IRU FROOHFWLQJ UHSRUWLQJ DQDO\]LQJ DQG VWRULQJ RI SURGXFW WHPSHUDWXUH UHFRUGV DQG FUHDWLQJ FXVWRP FKHFNOLVWV )HDWXULQJ D KLJK OHYHO RI DFFXUDF\ “ƒ)  DQG DQ H[WHQGHG WHPSHUDWXUH UDQJH RI ƒ) WR ƒ) WKLV PXOWLSXUSRVH WKHUPRFRXSOH DFFHSWV DOO 7\SH. WKHUPRFRXSOH SUREHV DQGVWRUHVDVPDQ\DVWHPSHUDWXUHV DQG  FKHFNOLVW UHFRUGV  TXHVWLRQV 

 5XEEHU *ORYHV 8VH ZKHQ SUHSDULQJ ³UHDG\ WR HDW´ IRRGV EXW UHPHPEHUWKLVGRHVQRWWDNHWKHSODFHRISURSHUKDQGZDVKLQJ  7KDZLQJ )RRG 5RRP WHPSHUDWXUH WKDZLQJ LV QRW RN 6XEPHUJH XQGHU UXQQLQJ ZDWHU RU WKH EHVW SUDFWLFH LV WR WKDZ XQGHU UHIULJHUDWLRQ  ,QWHUQDO&RRNLQJ7HPSHUDWXUHV3RVWWHPSHUDWXUHH[SHFWDWLRQVRI FRRNHGPHDWVIRU\RXUWHDPWRIROORZ0RVWGRQRWNQRZ  'LVKZDVKHU +DYH \RXU PDFKLQH FKHFNHG DQG FDOLEUDWHG UHJXODUO\WRRPXFKFKHPLFDOFDQEHGDQJHURXVDQGFRVWO\

'HGLFDWHGWR )RRG6DIHW\ 0DQDJHPHQW

% .LW LQFOXGHV +DQGKHOG   0LFUR1HHGOH 3UREH .  %DWWHU\ &KDUJHU   6RIWZDUH &'520   6RIW &DUU\LQJ 3RXFK   0RGHO

 &XWWLQJ%RDUGV0DNHVXUHWKH\DUHVPDOOHQRXJKWREHZDVKHG LQWKHGLVKZDVKHU  /HDG%\([DPSOH2ZQHUVDQGPDQDJHUVDUHVHWWLQJWKHWRQHIRU WKHUHVWRIWKHWHDPWRIROORZ 2XULQGXVWU\QHHGVHYHU\RQHWRVXSSRUWIRRGVDIHW\2WKHUZLVHWKH UHSXWDWLRQRIRXULQGXVWU\ZLOOVXIIHU

& &5HIULJHUDWRU)UHH]HU7KHUPRPHWHUV (QVXULQJSURSHUIRRGWHPSHUDWXUHLVWKHPRVWLPSRUWDQWFRPSRQHQWLQD IRRGVDIHW\V\VWHP7RKHOSPRQLWRUWKHWHPSHUDWXUHVRI\RXUHTXLSPHQW RU IRRG &RRSHU$WNLQV RIIHUV D YDULHW\ RI PRQLWRULQJ WKHUPRPHWHUV WR ILW \RXUVSHFLILFQHHGV'HVLJQHGWREHGXUDEOHDQGDFFXUDWHIRUDOONLWFKHQ HQYLURQPHQWV

0RGHO'HVFULSWLRQ  (FRQRP\5HIULJHUDWRU)UHH]HU7KHUPRPHWHUƒƒ)  +RUL]RQWDO5HIULJHUDWRU)UHH]HU7KHUPRPHWHUƒƒ) +3 5HIULJHUDWRU)UHH]HU'U\6WRUDJH7KHUPRPHWHUƒƒ)  &RROHU7KHUPRPHWHUƒƒ)  5HIULJHUDWRU)UHH]HU7KHUPRPHWHUZLWK0LQ0D[ƒƒ)


Kitchen Supplies | 169

B

A A. Probes and Wipes. To achieve the most accurate temperature reading possible, it is important to use a probe suitable for the intended application. Temperature measurement is critical in many areas, from maintaining optimum quality during a manufacturing process to ensuring safety of the food we eat. Probe wipes help meet HACCP guidelines and are an ideal way of cleaning and sanitizing probes between temperature checks to avoid cross contamination. Probe wipes contain 70% isopropyl alcohol and are available in single-use foil packets or new easy-to-use tub dispensers. Model Description 9150-0-8 Anti-bacterial Probe Wipes (10/bxs of 200 single-use wipes) 50306-K Air Probe 50012-K Surface Probe 50014-K Weighted Griddle Surface Probe 50143-K Heavy Duty Probe 50208-K Fryer Vat Probe 50336-K DuraNeedle Probe 9151-0-8 Probe Wipes in 70 Ct Dispenser 9152-0-8 Probe Wipes in 200 Ct Dispenser

C

B. Non-Contact Infrared Thermometers. A full line of non-contact infrared thermometers help operators and technicians across the foodservice and food processing industries. Measure surface temperatures fast and accurately, just point and shoot. Infrared thermometers have D:S (Distance to Spot) ratios that range from 12:1 to 1:1. The 412 comes with a thermocouple jack allowing any type-K thermocouple probe to be used to measure internal temperatures. Model Description 470-0-8 Mini w/Lanyard, -27° to 428°F 462-0-8 Slim-Line w/Laser -40° to 536°F 412-0-8 Gun w/Probe Jack & Laser, -76° to 932°F 481-0-8 Dual, -40° to 536°F Infrared; -40° to 392°F Probe 31901-K Economy Needle Probe (use with #412)

C. AquaTuff™ Thermocouples. Waterproof instruments stand up to the harsh environments in a kitchen or in food processing. Ergonomic thermocouple instruments with tenth degree resolution features rugged ABS plastic housing, large LCD screen and auto shut-off after 10 minutes. Uses any type-K probe with a standard mini-connector. Factory calibrated. Model 352 has hold and backlight. 5 year warranty. NSF. Model Description 35100 -100° to 999°F 35200 -100° to 999°F w/Hold Button & Backlight 31901-K Needle Probe 50306-K Air/Oven Probe w/Clip 50336-K DuraNeedle Probe 31907-K Surface Probe

D

D. Bi-Metal Pocket Thermometers. For all your foodservice needs! The 1246 Pocket Tests include an anti-microbial infused protective sheath that prevents bacteria growth, with a pocket clip, 1" dial, 5" stem and adjustment wrench. The 2237-04 Espresso Thermometer features a HACCP reference dial with preparation zones for milk, froth, tea, hot chocolate, espresso and coffee. Both the 2237-04 (0°F to 220°F) and 2238-06 Stem Test Thermometer (0° to 220°F) include adjustable stainless steel vessel clips. NSF certified. Model Description 1246-01-1 -40° to 180°F (Magnify Lens, 5" Shaft) 1246-02-1 0° to 220°F (Magnify Lens, 5" Shaft) 1246-03-1 50° to 550°F (Magnify Lens, 5" Shaft) 2238-06-3 0° to 220°F (2" Dial, 8" Stem w/Clip) 2237-04-8 0° to 220°F Espresso (13/4" Dial, 7" Stem w/Clip)

E E. EconoTemp™. EconoTemp Combo Pack includes the 32311-K Thermocouple with 50337-K Direct Connect DuraNeedle Probe. Incorporates a powerful micro-processor with a unique memory, that stores calibration settings, making adjustment unnecessary. A rubber boot protects the waterresistant ABS plastic housing. Direct Connect DuraNeedle Probe has a step-down, thin tip design that provides fast and accurate 1-second response time. Also includes lanyard and a wall-mount bracket option for safe storage of the instrument. Five year instrument warranty, one year probe. NSF. Model 94020K shown.


HACCP

Food safety compromises can be eliminated with a HACCP PLAN. 1. Identify potentially hazardous foods in recipes and describe preventive measures. 2. Specify all the critical control points in the process and establish a flow chart. 3. Establish standards that must be met at each critical control point. 4. Monitor critical control points and determine whether criteria is being met. 5. Establish corrective actions to eliminate the hazard immediately. 6. Set up an effective record-keeping process that documents the HACCP system. 7. Establish procedures for verification that the HACCP system is working correctly. Temperature and time in a food safety system are the two most important components in preventing foodborne illness. Protecting food through the process. All potentially hazardous foods should be prepared so that they spend less than 4 hours in the bacterial temperature danger zone of 41°F to 135°F (5°C to 57°C). Final cooking temperatures should never be guessed by visual assessment or touching; always test with a thermometer. For accurate temperature readings, test temperature in geometric center (which is usually the thickest part) of the food product. Holding: Hot foods should be held at 135°F (57°C) or above. Cold foods should be held at 41°F (5°C) or below. Always use thermometers to check the food temperature. Relying on the thermostat of warming or holding equipment is not enough. Temperatures should be checked at 2-hour intervals with a thermocouple or stem test thermometer. Cooling: Internal food temperatures must be brought below 41°F (5°C) within 4 hours. Acceptable Temperatures: Refrigerator: 38°F (3°C) or lower Freezer: 0°F (-17.7°C) or lower Dry Storage: 70°F (21°C) or lower with low humidity/adequate ventilation Dish Washing Rinse Temperature: 180°F (82.2°C) Check your local regulations on all required temperatures as they may vary. Alarming Facts There are 48,000,000 reported cases of foodborne illness each year. There are 128,000 reported hospitalizations from foodborne illness each year. There are 3,000 reported deaths from foodborne illness each year. On top of the cost of reputation, business, health and life, the average cost of a foodborne illness is $100,000 per case.


.LWFKHQ6XSSOLHV_ 0RGHO'HVFULSWLRQ &: /[:[+&: &: /[:[+&: &: /[:[+&: &: /[:[+&: &: /[:[+&: 3 /[:[+3RO\ 3 /[:[+3RO\ 3 /[:[+3RO\ 3 /[:[+3RO\ 3 /[:[+3RO\ $GGLWLRQDOPRGHOVDYDLODEOH

&

$

$7KHUPRPHWHUV 7KHUPRPHWHUV DUH WKH RQO\ ZD\ WR HQVXUH WKDW IRRG KDV UHDFKHG D VDIH PLQLPXP LQWHUQDO WHPSHUDWXUH DQG FRQVHTXHQWO\ SUHYHQW IRRG ERUQHLOOQHVV

%&DPZHDUŠ )RRG6WRUDJH%R[HV (OLPLQDWH WKH KD]DUG RI FURVV FRQWDPLQDWLRQ ZLWK &DPZHDU )RRG 6WRUDJH %R[HV 7KH VPRRWK VXUIDFH PDNHVWKHPHDV\WRFOHDQDQGWKHWH[WXUHRQWKHERWWRP UHGXFHVVFUDWFKLQJ6QDSWLJKWFRYHUVRU6OLGLQJ/LG VROG VHSDUDWHO\  ZRQ¶W FRPH RII GXULQJ WUDQVSRUWDWLRQ $YDLODEOH LQ WRXJK &DPZHDU FOHDU SRO\FDUERQDWH RU QDWXUDO ZKLWH SRO\HWK\OHQH &DPZHDU GUDLQ VKHOYHV DQG FRODQGHUV DUH DOVRDYDLODEOHDORQJZLWKFRODQGHUNLWVIRUGHIURVWLQJPHDWVILVKRUYHJHWDEOHV

)RU VDIHW\ LW¶V LPSRUWDQW WR YHULI\ WKH WHPSHUD WXUH RI UHIULJHUDWRUV DQG IUHH]HUV 5HIULJHUDWRUV VKRXOGPDLQWDLQDWHPSHUDWXUHRIƒ)RUEHORZ ZKLOH IUR]HQ IRRG ZLOO KROG LWV WRS TXDOLW\ ZKHQ WKHIUHH]HUPDLQWDLQVƒ)RUEHORZ&KRRVHIURP DZLGHYDULHW\RIWKHUPRPHWHUV 0RGHO'HVFULSWLRQ )'$ 7KHUPRFRXSOHZ)ROG2XW 3UREHƒ)ƒ) (35 3NW'LJLWDO:DWHUSURRI³$OOHUJ\´ 7KHUPRPHWHUƒ)ƒ)  *O\FRO5HIU)U]U7KHUPRPHWHU ƒ)ƒ)  'LJLWDO5HIU)U]U7KHUPRPHWHU ƒ)ƒ) $GGLWLRQDOPRGHOVDYDLODEOH

&&ROGIHVWŒ)RRG3DQVDQG&URFN &ROG)HVWŒ DOORZV \RX WR NHHS IRRGV FKLOOHG DW RU EHORZ +$&&3 JXLGHOLQHV RI ƒ) ZLWKRXW WKH XVH RI PHVV\ LFH 6LPSO\ IUHH]H RYHUQLJKW IRU  KRXUV DQG DGG SUHFKLOOHG SURGXFWV VXFK DV VDODGV FRQGLPHQWV RU YHJHWDEOHV 'HVLJQHG WR SHUIRUP ZLWK IUHTXHQW DQG KHDY\ XVH LQ IRRG VHUYLFHRSHUDWLRQV6WDFNDEOHWRVDYHVSDFHZKHQIUHH]LQJ VWRULQJRUWUDQVSRUWLQJ16) 0RGHO'HVFULSWLRQ  6L]HTW&DS &)  6L]H TW&DS &)  6L]H TW&DS &) &)5 &URFNTW&DS &)& )ODW&RYHUIRU 6L]H &)& )ODW&RYHUIRU 6L]H &)5& )ODW&RYHUIRU&)5 $GGLWLRQDOPRGHOVDYDLODEOH

&

( ' '6WRUH6DIH)RRG5RWDWLRQ/DEHOV  GLVVROYDEOH DQG ELRGHJUDGDEOH ODEHOV HOLPLQDWH VWLFN\UHVLGXHDQGSUHYHQWFURVVFRQWDPLQDWLRQ/DEHODQG DGKHVLYH GLVVROYH LQ OHVV WKDQ  VHFRQGV WKURXJK DQ\ GLVKZDVKHURUXQGHUKRWRUFROGUXQQLQJZDWHU6DIHIRUDOO VHZHU DQG VHSWLF V\VWHPV ZLWK QR EXLOG XS LQ GUDLQV 8VH SHQSHQFLORUPDUNHUWRZULWHLQFRQWHQWVDQGXVHE\GDWH EHIRUH DSSO\LQJ WR GU\ FRQWDLQHU :LWKVWDQGV KLJK KHDW WHPSHUDWXUHV XS WR ƒ) IRU  KRXUV 0LFURZDYH VDIH )'$DSSURYHGIRULQGLUHFWIRRGFRQWDFW 0RGHO'HVFULSWLRQ 6/ %OLVWHU3DFN [/DEHOVUROOVODEHOVSHUUROO 6/% %XON'LVSHQVHU3DFN [/DEHOVUROOVODEHOVSHUUROO 6/% %XON'LVSHQVHU3DFN [/DEHOVUROOVODEHOVSHUUROO 6/% +DOI6L]H%XON'LVSHQVHU3DFN [/DEHOVUROOVODEHOVSHUUROO

(&DPZHDUŠ

)RRG6WRUDJH&RQWDLQHUV 6TXDUH 5RXQG  )RRGVWRUDJHFRQWDLQHUVKHOS\RXPDNHWKHPRVWXVHRI\RXUVWRUDJHDUHD(DV\WR UHDG LPSULQWHG JUDGXDWLRQV RQ WKH RXWVLGH IRU LQYHQWRU\ DW D JODQFH &DPZHDU VTXDUHVZLWKVWDQGWHPSHUDWXUHVIURPƒ)WRƒ)6HDOFRYHUV VROGVHSDUDWHO\

ILWWLJKWO\\HWFDQEHHDVLO\UHPRYHGZLWKWKXPEWDE'XDOLQQHUDQGRXWHUVHDOSURYLGH H[FHOOHQWVSLOOUHVLVWDQFH1HZVHDOFRYHUVDYDLODEOHIRUSRO\FDUERQDWHVTXDUHVRQO\ 6HDO FRYHUV KDYH PROGHGLQ KROHV LQ WKH KDQGOHV IRU TXLFN DQG VDQLWDU\ GU\LQJ 7UDQVOXFHQW OLGV PDNH FRQWHQWV HDV\ WR LGHQWLI\ DQG ZLWKVWDQG WHPSHUDWXUHV IURP ƒ)WRƒ) 0RGHO'HVFULSWLRQ 6)6&: 6TXDUH&:TW .HOO\*UHHQ

6)6&: 6TXDUH&:TW :LQWHU5RVH

6)6&: 6TXDUH&:TW :LQWHU5RVH

6)6&: 6TXDUH&:TW 0LGQLJKW%OXH

6)6&: 6TXDUH&:TW 0LGQLJKW%OXH  5)6&: 5RXQG&:TW 5)6&: 5RXQG&:TW 5)6&: 5RXQG&:TW 5)6&: 5RXQG&:TW 5)6&: 5RXQG&:TW $GGLWLRQDOPRGHOVDYDLODEOH


.LWFKHQ6XSSOLHV_ $

$)RRG6WRUDJH 5RWDWLRQ%DJV )RRGVWRUDJHURWDWLRQDQGFRRNLQJEDJV VLPSOLI\ WKH SURFHVV RI IRRG SUHS DQG VWRUDJH ZKLOH PLQLPL]LQJ WKH ULVN RI VHUYLQJ RXW RI GDWH IRRGV +LJK GHQVLW\ SRO\HWK\OHQH VDGGOH SDFN EDJV DUH LGHDO IRU SUHSRUWLRQLQJ OHDNSURRI DQG JUHDVH SURRI EDJV DUH PLFURZDYH VDIH XS WR ƒ) 7KH\ FRPH LQ D YDULHW\ RI VL]HV DQG VW\OHV ERWK SULQWHG DQG XQSULQWHG WR DFFRPPRGDWHHYHU\QHHG)ODWSDFNIRRG WUDQVSRUW DQG VWRUDJH EDJV NHHS IRRGV IUHVK GXULQJ WUDQVSRUW DQG LQ WKH UHIULJHUDWRURUIUHH]HU

0RGHO'HVFULSWLRQ  6DQGZLFK%DJ[)E 0 6DQGZLFK%DJ[/LS)E  6LOYHUZDUH%DJ[/LS)E 0 6LOYHUZDUH%DJ[/LS)E  &OHDU6DQGZLFK%DJ[ )6 )UHH]HU6WRUDJH%DJZ7LHV[ )6 )UHH]HU6WRUDJH%DJZ7LHV[ )6 )UHH]HU6WRUDJH%DJZ7LHV[ )6 )UHH]HU6WRUDJH%DJZ7LHV[ )6 )UHH]HU6WRUDJH%DJZ7LHV[ $GGLWLRQDOPRGHOVDYDLODEOH

& &&ROGPDVWHUŠ

)RRG3DQV&ROGSDQV&URFNV ,FH&UHDP6HUYHU &ROGPDVWHUIRRGSDQVILWVWDQGDUGVL]HIRRGSDQWHPSODWHV$OORZIRRGWREHSODFHGGLUHFWO\ LQWRSDQVPDLQWDLQLQJƒ)RUOHVVIRRGWHPSHUDWXUHVIRUXSWRKRXUV2XWHUVKHOOLVPDGHRI GXUDEOH$%6PDWHULDO&ROGPDVWHUFROGSDQVKDYHVDPHFDSDFLW\DVWUDGLWLRQDOIRRGSDQVEXW DUHGHVLJQHGWREHXVHGZLWK'XUDSDQIRRGSDQVIRUVXSHULRUFROGUHWHQWLRQ&ROGPDVWHUFURFN KROGTWVOLGVROGVHSDUDWHO\&ROGPDVWHU,FH&UHDP6HUYHUKROGVDJDOWXEDWƒ)IRU WRKRXUV'LVKZDVKHUVDIH16) 0RGHO'HVFULSWLRQ 0RGHO'HVFULSWLRQ &0 &ROGFURFNTW LQFOXGHVFRDVWHU &0 &ROG%DWWHU3DQ &0 ')XOO6L]H)RRG3DQ &0 &OHDU6ROLG/LG 8VHZ&0

&0 '+DOI6L]H)RRG3DQ &0 &OHDU6ORW/LG 8VHZ&0

&0 '7KLUG6L]H)RRG3DQ &03 &OHDU3XPS/LG 8VHZ&0

&0 '7KLUG6L]H'LYLGHG)RRG3DQ &0 6WDQGDUG3XPS 8VHZ&0

&0 '6L[WK6L]H)RRG3DQ &0 0D[L3XPS 8VHZ&0

$GGLWLRQDOPRGHOVDYDLODEOH &0 ')XOO6L]H&ROGSDQ &0 ')XOO6L]H&ROGSDQ '6WRU3OXVŒ)RRG6WRUDJH&RQWDLQHUV 5HLQIRUFHGVWDFNLQJOXJVRQDOOFRUQHUVDGGVWUHQJWKULJLGLW\DQGKHOSSUHYHQWFRQWDLQHU ORFNXSRUMDPPLQJZKHQVWDFNHGWRJHWKHU:LGHUHFHVVHGKDQGOHVZLWKGUDLQKROHVIRU TXLFNHUGU\LQJSURYLGHPD[LPXPJULSZLWKRXWVDFULILFLQJVKHOIVSDFH&DSDFLW\LQGLFDWRUV OLVWHGLQJDOORQVDQGOLWHUVDQGDUHFRORUFRGHGWRPDWFKOLGVIRUTXLFNLGHQWLILFDWLRQ16) 'LVKZDVKHUVDIH 0RGHO'HVFULSWLRQ  TW&RQWDLQHU&OHDU 3RO\FDUERQDWH

 TW&RQWDLQHU&OHDU 3RO\FDUERQDWH

 TW&RQWDLQHU&OHDU 3RO\FDUERQDWH

 TW&RQWDLQHU&OHDU 3RO\FDUERQDWH

 TW&RQWDLQHU&OHDU 3RO\FDUERQDWH

 TW&RQWDLQHU&OHDU 3RO\FDUERQDWH

 TW&RQWDLQHU&OHDU 3RO\FDUERQDWH

 TW&RQWDLQHU:KLWH  TW&RQWDLQHU:KLWH  TW&RQWDLQHU:KLWH  TW&RQWDLQHU:KLWH '  TW&RQWDLQHU:KLWH  TW&RQWDLQHU:KLWH  TW&RQWDLQHU:KLWH  TW/LGTW  TW/LGTW  /LGTW

% %6WRUSOXVŒ)RRG6WRUDJH%R[HV 6WRUH IRRG SOXV PXFK PRUH 5HLQIRUFHG WRS DQG ERWWRP FRUQHUV RQ ERWK ER[ DQG OLG KHOS SUHYHQW FKLSSLQJ DQG FUDFNLQJ (DV\JULS KDQGOHV KDYH VWUXFWXUHGULEUHLQIRUFHPHQW'XUDEOHSRO\FDUERQDWH SURYLGHV HDV\ YLVLELOLW\ VXSHULRU UHVLVWDQFH WR IRRG DFLGV DQG RLOV DQG ZLWKVWDQGV WHPSHUDWXUHV IURP ƒ) WR ƒ) 2U FKRRVH ZKLWH SRO\HWK\OHQH ZKLFK RIIHUV DQ HFRQRPLFDO VWRUDJH DQG WUDQVSRUW VROXWLRQDQGZLWKVWDQGVWHPSHUDWXUHVIURPƒ)WR ƒ) 'LVKZDVKHU VDIH 16) &RORUFRGHG ER[HV DOVRDYDLODEOH 0RGHO'HVFULSWLRQ  [[%R[3RO\FDUERQDWH  [[%R[3RO\FDUERQDWH  [[%R[3RO\FDUERQDWH  [/RFN7LJKW/LG3RO\FDUERQDWH  [[%R[3RO\FDUERQDWH  [[%R[3RO\FDUERQDWH  [[%R[3RO\FDUERQDWH  [[%R[3RO\FDUERQDWH  [[%R[3RO\FDUERQDWH  [/RFN7LJKW/LG3RO\FDUERQDWH  [[&RODQGHU3RO\FDUERQDWH $GGLWLRQDOPRGHOVDYDLODEOH

( ('$7(,7Œ)RRG5RWDWLRQ/DEHOV 'DWH,WŒ )RRG 5RWDWLRQ /DEHOV 'LVSHQVHUV DQG 3RUWLRQ %DJV DUH DYDLODEOH LQ DQ LQWHUQDWLRQDOO\ UHFRJQL]HG FRORUFRGLQJ V\VWHP IRU IRRG VDIHW\ DQGLQYHQWRU\URWDWLRQ/DEHOVFRPHLQDYDULHW\ RIDGKHVLYHVLQFOXGLQJ3HUPDQHQW5HPRYDEOH 'LVVROYDEOH DQG 'XUD3HHOŒ DQG DUH DYDLODEOH E\WKHUROORUE\WKHFDVH6RRUGHUWKHTXDQWLW\ DQGVW\OHZKLFKEHVWILWV\RXUQHHGV

6WRUDJH 'R QRW XVH PDVNLQJ WDSH IRU ODEHOLQJ 6WLFN\ UHVLGXH KDUERUV KDUPIXO EDFWHULD DQG FDQ FURVV FRQWDPLQDWH IRRG FRQWDFW VXUIDFHV RI FOHDQ FRQWDLQHUVZKHQQHVWHGGXULQJVWRUDJH &RYHUODEHODQGGDWHDOOIRRGSURGXFWVVWRUHGLQ FRQWDLQHUV0RQLWRUDOO´XVHE\µGDWHVFORVHO\


.LWFKHQ6XSSOLHV_

$

$&RRO&UHZ)UHVK-DFNHWV $IUHVKLPDJHLVDVLPSRUWDQWDVIUHVKIRRG/LJKWZHLJKWSRO\FRWWRQ EOHQG PDWHULDO LV RIIHUHG LQ IUHVK IRRG FRORUV²7RPDWR 6SLFH DQG 0LQW &KRRVH VQDS RU IODW VW\OH EXWWRQV 6QDS MDFNHW IHDWXUHV D FURVVFROODUQHFNOLQHVKRUWVOHHYHVDQGKLGGHQVQDSVW\OHEXWWRQV 6LJQDWXUHMDFNHWIHDWXUHVDEODFNPDQGDULQFROODUVW\OLVK  OHQJWK VOHHYHVDQGIODWEODFNEXWWRQV$YDLODEOHLQVL]HVVPDOOWR; 0RGHO'HVFULSWLRQ -076 6QDS-DFNHW0LQW -070 6QDS-DFNHW0LQW -07/ 6QDS-DFNHW0LQW -07;/ 6QDS-DFNHW0LQW -07; 6QDS-DFNHW0LQW -07; 6QDS-DFNHW0LQW -07; 6QDS-DFNHW0LQW -07; 6QDS-DFNHW0LQW $GGLWLRQDOPRGHOVDQGFRORUVDYDLODEOH

&

% %.QLIH 6WHHO&KHI&RORU-DFNHWV 2XU .QLIH  6WHHO LV WKH WUXH ZRUNKRUVH LQ FKHI DSSDUHO QRZ DYDLODEOH LQ H[FLWLQJ IUHVK FRORUV²(JJSODQW (VSUHVVR DQG 2OLYH (OHJDQW ORRNLQJ \HW EXLOWWRODVWZLWKFRPIRUWDEOHDQGGXUDEOHSRO\FRWWRQPDWHULDODYDLODEOHLQ  OHQJWKVOHHYH7KLVMDFNHWZLOOZRUNDVKDUGDV\RXGRDQGNHHS\RXORRNLQJ JRRG GRLQJ LW QLJKW DIWHU QLJKW +LGGHQ VQDS EXWWRQV 7KHUPRPHWHUSHQ SRFNHW'URSVKRXOGHUDQGEDFN\RNHFRQVWUXFWLRQIRUDGGHGPRYHPHQWDQG FRPIRUW6L]HV;6WR; 0RGHO'HVFULSWLRQ -(37;6 3&%OHQG(JJSODQW -(376 3&%OHQG(JJSODQW -(370 3&%OHQG(JJSODQW -(37/ 3&%OHQG(JJSODQW -(37;/ 3&%OHQG(JJSODQW -(37; 3&%OHQG(JJSODQW -(37; 3&%OHQG(JJSODQW -(37; 3&%OHQG(JJSODQW -(37; 3&%OHQG(JJSODQW $GGLWLRQDOPRGHOVDQGFRORUVDYDLODEOH

&2YHQ0LWWV 0LWWVZLSHFOHDQZLWKDGDPSFORWK²RQHVL]HILWVDOO%HVW*XDUGŠ 2YHQ0LWWV DUHILUHUHWDUGDQWSURWHFWXSWRƒ)DQGDUHDYDLODEOHLQEODFNRUWDQ0LWWV IHDWXUH QHZ :HE*XDUGŒ JXVVHW IRU DGGHG SURWHFWLRQ EHWZHHQ \RXU WKXPE DQGIRUHILQJHU2XUHFRQRPLFDOO\SULFHGVLOYHUQRQVWLFNVLOLFRQHFRDWHGPLWWV ZRUNZHOOZLWKKRWRUFROGVXUIDFHV3URWHFWVXSWRƒ).HYODUVWLWFKLQJRQ DOOPLWWVIRUPD[LPXPGXUDELOLW\ 0RGHO'HVFULSWLRQ )*%. %HVW*XDUGŒ %ODFN

)*%. %HVW*XDUGΠ%ODFN

)*%. %HVW*XDUGΠ%ODFN

)*%. %HVW*XDUGΠ%ODFN

6* 6LOLFRQH 6* 6LOLFRQH 6* 6LOLFRQH

(%HVW*ULSŒ2YHQ0LWWV ‡ 3URYLGHVKHDWSURWHFWLRQXSWRƒ)IRUPLQXWH ‡ :HE*XDUGŒSURYLGHVH[WUDKHDWSURWHFWLRQEHWZHHQ WKXPEDQGIRUHILQJHU ‡ )LUHUHWDUGDQW ‡ 0DGHRIQRQVOLSWH[WXUHGPDWHULDO ‡:LSHVFOHDQHDVLO\ZLWKMXVWDGDPSFORWK ‡ ,QWHJUDWHGPDJQHWIRUTXLFNFRQYHQLHQWVWRUDJH 0RGHO'HVFULSWLRQ &0 &RQYHQWLRQDO &0 &RQYHQWLRQDO 30 3XSSHW 30 3XSSHW

(

'

'8OWL*ULSVŠ 2YHQ0LWWV 3URWHFWLQJXSWRƒ)8OWL*ULSVŠ SDWHQWHG PDWHULDO SURYLGHV D VHFXUH JULS DQG XQPDWFKHG GH[WHULW\ 0DWHULDO UHVLVWV VWDLQVDQGVSLOOVDQGFDQEHHDVLO\ZDVKHG LQ WKH GLVKZDVKHU RU SRW DQG SDQ VLQN² DOZD\VDFOHDQDQGVDQLWDU\DSSHDUDQFH 0RGHO'HVFULSWLRQ 830%. 3XSSHW0LWW 830%. 3XSSHW0LWW 8&0;%. &RQYHQWLRQDO0LWW 8&0;%. &RQYHQWLRQDO0LWW 8+3%. +RW3DG 8+3%. +RW3DG


)XUQLVKLQJV &URZG&RQWURO 6LJQDJH &KDQJLQJ6WDWLRQV

$ 6SDFLQJ&RQVLGHUDWLRQIRU)XUQLVKLQJV Â&#x2021;VTIWSHUSHUVRQIRUVSDFLRXVGLQLQJ Â&#x2021;VTIWSHUSHUVRQIRUFDIHWHULDRUUHVWDXUDQW Â&#x2021;VTIWSHUSHUVRQIRUEDQTXHWLQVWLWXWLRQDORUFORVHVHDWLQJ Â&#x2021;$OORZIRUSHUVRQVHDWLQJIURPHGJHRIWDEOHWREDFNRI FKDLU Â&#x2021;'LDJRQDOVHDWLQJVDYHVIORRUVSDFH'HXFHWDEOHVDQGZDOO VSDFLQJVDYHWKHPRVWVSDFH Â&#x2021;$OORZEHWZHHQVTXDUHGWDEOHVIRUFKDLUVEDFNWREDFN³ OHDYHVWRSXVKRXW Â&#x2021;$OORZEHWZHHQVTXDUHGWDEOHVIRUFKDLUVEDFNWREDFN³ OHDYHVVHUYLFHDLVOH Â&#x2021;$OORZEHWZHHQFRUQHUVRIGLDJRQDOWDEOHIRUFXVWRPHU DFFHVV³QRDLVOH Â&#x2021;$OORZEHWZHHQFRUQHUVRIGLDJRQDOWDEOHVIRUFXVWRPHU DFFHVV³QDUURZDLVOH 1RWH :KHUHVSDFHLVOLPLWHGERRWKVUHTXLUHRQO\ VTIWSHUSHUVRQLQFOXGLQJDLVOHDOORZDQFH

(VWLPDWLQJ6HDWLQJ&DSDFLW\SHU6TXDUH)RRW )RU %DQTXHW 6HDWLQJ  :KHQ XVLQJ REORQJ WDEOHV GLYLGH WKH URRP DUHD VT IW  E\  :KHQ XVLQJ URXQG WDEOHV GLYLGH WKH URRP DUHD VT IW  E\  7KHVH ILJXUHV DUH IRU PD[LPXP VHDWLQJ,IVSDFHLVDYDLODEOHIRUPRUHFRPIRUWDEOHVHDWLQJDOORZ DQDGGLWLRQDOVTIWSHUSHUVRQ

$)RUP$/LQH6\VWHP 'LYHUWWUDIILFZKHUH\RXQHHGLWZLWK5HWUDFWDEOH6LQJOHRU'XDO%HOW6\VWHP DYDLODEOHLQEUDVVVDWLQFKURPHRUEODFNZLWKEHOWFRORUVUHGJUHHQEOXHDQG EODFN 5HPRYDEOH 6LJQ )UDPHV HDVLO\ DWWDFK WR UHWUDFWDEOH EHOW SRVWV DQG DFFHSWPHGLDLQVHUWVXSWR WKLFN7KH7UDGLWLRQDO5RSH6\VWHPLVSHUIHFW IRU HOHJDQW FURZG FRQWURO LQ WKHDWHUV PXVHXPV FODVVLF UHVWDXUDQWV DQG PRUH$YDLODEOHLQEUDVVVDWLQDQGFKURPHZLWKURSHFRORUVEODFNDQGUHGLQ VL]HV  DQG OHQJWKV 0RGHO'HVFULSWLRQ +& 5HWUDFWDEOH%HOW6W\OH&KURPH +% 5HWUDFWDEOH%HOW6W\OH%UDVV +6 5HWUDFWDEOH%HOW6W\OH6DWLQ +%. 'XDO5HWUDFWDEOH%HOW6W\OH%ODFN +& 'XDO5HWUDFWDEOH%HOW6W\OH&KURPH +% 'XDO5HWUDFWDEOH%HOW6W\OH%UDVV 7U 5RSH %ODFNZ&KURPH+DUGZDUH 7U 5RSH %ODFNZ%UDVV+DUGZDUH 7U 5RSH 5HGZ6DWLQ+DUGZDUH 7U 5RSH %ODFNZ&KURPH+DUGZDUH 7U 5RSH %ODFNZ%UDVV+DUGZDUH 7U 5RSH %ODFNZ6DWLQ+DUGZDUH 7U 5RSH 5HGZ&KURPH+DUGZDUH $GGLWLRQDOPRGHOVDYDLODEOH

)RU6HPLQDU6HDWLQJ'LYLGH´DWWHQGHHµ VHDWLQJDUHD VTIW E\  7KLV IRUPXOD DOORZV IRU FKDLU DQG SDVVDJH DLVOH EXW QRW IRU ZLGHWUDIILFDLVOHVGRRUVH[LWVSRVWVRURWKHUREVWUXFWLRQV,WLV XVHIXOIRUDTXLFNDSSUR[LPDWLRQ :KHQ SODQQLQJ VHDWLQJ VHYHUDO IDFWRUV PXVW EH FRQVLGHUHG &RVW SHU VTXDUH IRRW SHU SHUVRQ $SSUR[LPDWH WDEOHV IRU EHVW XVDJHRIVSDFH(DVHRISURYLGLQJVHUYLFHWRWDEOHV

% %$)UDPH6LGHZDON%RDUGV %URDGFDVW \RXU PHVVDJH ZLWK $)UDPH 6LGHZDON %RDUGV )HDWXUHV LQFOXGH VWHHO UHLQIRUFHG FRUQHUV ZHDWKHUUHVLVWDQW KDUGZDUH XQLTXH SODVWLF FDPHO IORRUOHYHOLQJV\VWHPDQGIXOOZLGWKDOXPLQXPKLQJHV&KRRVHIURPWUDGLWLRQDO VROLG RDN ZRRG IUDPH ZLWK HLWKHU FOHDU ODFTXHU RU FKHUU\ ILQLVK RU PRGHUQ DOXPLQXP IUDPH ZLWK HLWKHU FOHDU DQRGL]HG RU EODFN SRZGHU FRDWHG ILQLVK )RXU ZULWLQJ VXUIDFHV WR FKRRVH IURP²ZKLWH RU EODFN PDUNHUERDUG EODFN DFU\OLFRUEODFNFKDONERDUG$YDLODEOHLQWZRVL]HV²+[:RU[: 0RGHO'HVFULSWLRQ $% %ODFN&KDONERDUG2DN+[: 0$% %ODFN&KDONERDUG&KHUU\+[: $ %ODFN0DUNHUERDUG2DN+[: 0$ %ODFN0DUNHUERDUG&KHUU\+[: %$ %ODFN0DUNHUERDUG%ODFN$OXPLQXP+[: 0$% %ODFN&KDONERDUG&KHUU\+[: $GGLWLRQDOPRGHOVDYDLODEOH


)XUQLVKLQJV_

$

&

%+LJK&KDLUV (DV\WRFOHDQFRPPHUFLDOJUDGH KLJK FKDLUV DOORZ FKLOGUHQ WR VDIHO\HQMR\WKHLUPHDOZLWKWKHLU SDUHQWV 7KUHH VW\OHV WR FKRRVH $6WXUG\&KDLUŒ<RXWK6HDW IURP $WWUDFWLYH FRQWHPSRUDU\ 0HHWVODWHVW$670DQG789VDIHW\VWDQGDUGV2QHSLHFH KHDY\ GXW\ SODVWLF KLJK FKDLU 7EDUDQGSRLQWDFWLYHKDUQHVVZLWKRQHKDQGHGUHOHDVH ZLWK ZKHHOV IHDWXUHV FRQYHQLHQW SURWHFWV FKLOG DQG UHGXFHV SLQFKLQJ 0LFUREDQŠ SURYLGHV KDQGOHIRUHDV\PDQHXYHUDELOLW\ DOORYHU SURWHFWLRQ IURP EDFWHULD JURZWK WKDW FDQ FDXVH 6WDFNLQJ KLJK FKDLUV FUDIWHG Š RGRUV DQG VWDLQLQJ &RQWHPSRUDU\ GHVLJQ ZLWK 0LUFUREDQ IURP KLJK TXDOLW\ UXEEHUZRRG WHFKQRORJ\PDNHVLWHDVLHUWRFOHDQWKDQZRRG DUH DYDLODEOH LQ QDWXUDO ZDOQXW 0RGHO'HVFULSWLRQ RU PDKRJDQ\ ZRRG ILQLVK 2XU )*%/$ 7UD\ 3ODWLQXP*UHHQ%ODFN5HG%OXH

QHZ VWDFNLQJ SXE VW\OH KLJK % )*%/$ &KDLUZ:KHHOV 3ODWLQXP*UHHQ%ODFN

FKDLULVLGHDOIRUEUHDNIDVWGLQHU )*%/$ &KDLUQRZKHHOV 3ODWLQXP*UHHQ%ODFN

FRXQWHUV DQG SXE KHLJKW WDEOHV )*%/$ &KDLUQRZKHHOV 5HDG\WR$VVHPEOH

0RGHO&++$VKRZQ 0RGHO'HVFULSWLRQ &++ 6WDFNLQJ1DWXUDO 1RQ$VVHPEOHG

&++$ 6WDFNLQJ1DWXUDO $VVHPEOHG

&++ 6WDFNLQJ:DOQXW 1RQ$VVHPEOHG

&++$ 6WDFNLQJ:DOQXW $VVHPEOHG

$GGLWLRQDOPRGHOVDYDLODEOH

&$QWL0LFURELDO%DE\&KDQJLQJ6WDWLRQ 6DIHDQGHUJRQRPLFGHVLJQPHHWVDOOJOREDO$670VDIHW\UHJXODWLRQV$QWL PLFURELDO SURWHFWLRQ LQKLELWV EDFWHULD JURZWK DQG RGRUV RQ DOO EDE\ FRQWDFW VXUIDFHV (DV\ DFFHVV KRRNV RQ ERWK VLGHV DOORZ SDUHQW HDV\ DFFHVV WR GLDSHU EDJ ZLWKRXW EHQGLQJ RYHU &RQYHQLHQW DFFHVVRU\ VKHOI LV LGHDO IRU SODFLQJ ERWWOH EDE\ SRZGHU DQG RWKHU LWHPV VDIHO\ RXW RI EDE\¶V UHDFK $YDLODEOH LQ YHUWLFDO DQG KRUL]RQWDO FRQILJXUDWLRQV &RQWDLQV /LTXLG %DUULHU /LQHUVZLWKDQHDV\WRVHUYLFHGLVSHQVHUWKDWKROGVXSWROLQHUV 0RGHO'HVFULSWLRQ )*:+7 3URWHFWLYH7DEOH/LQHUV FDUWRQ

)*/3/$7 &KDQJLQJ7DEOH+RUL]RQWDO )*/3/$7 &KDQJLQJ7DEOH9HUWLFDO

'&DVKLHU6WDQG 6WDWHRIWKHDUW GHVLJQ LV LGHDO IRU WKH ODWHVW DXWRPDWHG 326 SD\PHQW V\VWHPV $WWUDFWLYHO\ DQG SUDFWLFDOO\ GHVLJQHG PRGHO WR HQKDQFH DQ\ FDIHWHULD RSHUDWLRQ 6WDLQOHVVVWHHOZLWKODPLQDWHILQLVK7UD\VOLGHVIROGGRZQ RXW RI WKH ZD\ ZKHQ QRW LQ XVH 3HUIRUDWHG SDQHO SURYLGHV SURSHU YHQWLODWLRQ IRU 326 HTXLSPHQW 6KRZQ ZLWK RSWLRQDO FDVK GUDZHU 2YHUDOO GLPHQVLRQV :['[+ 0RGHO'HVFULSWLRQ  66ZLWK/DPLQDWH)LQLVK &DVK'UDZHU %XLOW,Q/RFNLQJ&DVK'UDZHU IRU

(

('LDSHU&KDQJLQJ6WDWLRQV 'LDSHU&KDQJLQJ6WDWLRQVDUH$'$FRPSOLDQWDQGDYDLODEOH LQ KRUL]RQWDO DQG YHUWLFDO  VW\OHV WR PHHW VL]H DQG VSDFH UHTXLUHPHQWV%DJKRRNVRQHLWKHUHQGDOORZIRUWKHFKLOG¶V GLDSHU EDJ WR EH VHFXUHO\ KXQJ IRU HDV\ DFFHVV ZKLOH WKH VHFRQG KRRN LV DYDLODEOH IRU D SXUVH RU VKRSSLQJ EDJV &RQFDYHVKHOIGHVLJQSURYLGHVDGHHSDUHDIRUWKHFKLOGWR OD\ SUHYHQWLQJ WKHP IURP UROOLQJ DURXQG ZKLOH WKH KHDY\ GXW\ VDIHW\ VWUDS SURYLGHV DQ DGGLWLRQDO OHYHO RI VHFXULW\ 0ROGHGLQGXDOOLQHUGLVSHQVHUVDFFRPPRGDWHEHGOLQHUV WKDWFUHDWHDEDUULHUEHWZHHQWKHFKLOGDQGWKHFKDQJHU 0RGHO'HVFULSWLRQ + +RUL]RQWDO 9 9HUWLFDO  &KLOG6DIHW\6HDW  %HG/LQHUV3ODVWLF/LQHG

'

)

)/DPLQDWH2SHQ6KHOI6HUYLQJ&DUW &RPSOHWH\RXUGLQLQJDUHDZLWKJUHDWGHVLJQ &RQWHPSRUDU\ VW\OLQJ ZLWK VSDFLRXV RYDO VKDSHG VKHOYHV $YDLODEOH LQ WHQ VWDQGDUG ODPLQDWH ILQLVKHV VKRZQ LQ *UD\ 6DQG   DOO VZLYHO FDVWHUV )XOO\ DVVHPEOHG 7RS VKHOI LV [ ORZHU VKHOYHV DUH [ RYHUDOOKHLJKW0RGHO


176

Metric Conversion Chart

General Equivalents 16 tablespoons 1 cup (standard measure) 2 cups 16 ounces 3 quarts (dry) 4 pecks 32 ounces 128 ounces 1 No. 10 can 1 pound margarine/butter 1 pound flour 1 teaspoon 1 pinch (few grains) 3 teaspoons 1 jigger 2 pints 4 quarts 16 ounces (liquid) 8 ounces (liquid) 1 ounce

= = = = = = = = = = = = = = = = = = = =

1 cup 1/2 pint (8 fluid ounces) 1 pint 1 pound 1 peck 1 bushel 1 fluid quart 1 fluid gallon 13 cups 2 cups 4 cups 60 drops 1/16 teaspoon 1 tablespoon 11/2 ounce 1 quart 1 gallon 1 pound or 1 pint (liquid) 1 cup (liquid) 2 tablespoons (approx.)

TAKE MULTIPLY BY: Length inches 25 feet 30 yards 0.9 miles 1.6 millimeters 0.04 centimeters 0.4 meters 1.1 kilometers 0.6 Surface or Area square inches 6.5 square feet 0.09 square yards 0.08 square miles 2.6 acres 0.4 square centimeters 0.16 square meters 1.2 square kilometers 0.4 hectares 2.5 Volume & Capacity ounces (fluid) 30 pints .047 quarts 0.95 gallons 3.8 milliliters 0.034 liters 2.1 liters 1.06 liters 0.26 Weight & Mass ounces 28 pounds 0.45 short tons 0.9 grams 0.035 kilograms 2.2 metric tons 1.1 Temperature 째Fahrenheit 0.55 (After subtracting 32) 째Celsius 1.8 (Then add 32)

Contents of Standard Cans Can Number 1 300 303 1 Tall 2 21/2 3 5 10

Weight 10-11 oz. 15 oz. 1 lb. 1 lb. 1 lb. 3 oz. 1 lb. 13 oz. 1 qt. 13 fl. oz. 3 lbs. 6 lbs. 8 oz.

Volume (Cups) 11/4 13/4 2 2 21/2 31/2 31/2 53/4 12 - 13

Common Utilities Conversions TAKE MULTIPLY BY: BTU 100000 Therm .00001 Therm 100 Cubic Foot (Nat. Gas) .01 Watt .001 Kilowatt 1000 Kilowatt Hour 1.341 Horsepower Hour .746 BTU .0003 Horsepower Hour 2545 BTU .0004

Units

Fluid gram

TO FIND Therm BTU Cubic Foot (Nat. Gas) Therm Kilowatt Watt Horsepower Hour Kilowatt Hour Kilowatt Hour BTU Horsepower Hour

TeaTablespoonful spoonful

TO FIND millimeters centimeters meters kilometers inches inches yards miles square centimeters square meters square meters square kilometers hectares square inches square yards square miles acres milliliters liters liters liters ounces (fluid) pints quarts gallons grams kilograms metric tons ounces pounds tons 째Celsius 째Fahrenheit

Fluid ounce

1/4 cupful

Gill (1/2 cupful)

Cupful

Liquid pint

Liquid quart

Milliliter

Liter

1 fluid dram

1

3/4

1 teaspoon

1/13

1

1/3

1/6

1/12

1/24

1/48

1/96

1/192

4.9

0.005

1 tablespoon

4

3

1

1/2

1/4

1/8

1/16

1/32

1/64

15

0.015

1 fluid ounce

8

6

2

1

1/2

1/4

1/8

1/16

1/32

30

0.030

1/4 cupful

16

12

4

2

1

1/2

1/4

1/8

1/16

59

0.059

1 gill (1/2 cupful)

32

24

8

4

2

1

1/2

1/4

1/8

118

0.118

1 cupful

64

48

16

8

4

2

1

1/2

1/4

237

0.237

1 liquid pint

128

96

32

16

8

4

2

1

1/2

473

0.473

1 liquid quart

256

192

64

32

16

8

4

2

1

946

0.946

1 milliliter

0.27

0.20

0.034

0.034

0.017

0.0084

0.0042

0.0021

0.0011

1

1/1000

1 liter

270

203

33.8

33.8

16.9

8.45

4.23

2.11

1.06

1000

1 liter

1/4

1/8

1/16

1/32

1/64

1/128

1/256

3.7

0.004


theRDstore.com

a division of Restaurant Depot

Order By PhOne

Order Online

Toll Free 866-761-3502 Fax 617-389-0033

www.theRDstore.com

24 24 77

Hours hours AaDay day Days days Week aAweek

1,000s

OF ITEMS AVAIL

at www.theRDs ABLE tore.com

866-761-3502

theRDstore .com

Foodservice Equipment & Supplies

2013-2014

BROWSE THROU GH

FOODSERVICE EQUIPMENT & SUPPLIES REFERENCE GUIDE 2013-2014

• Lay-Out Design Services Available • • Leasing Available • • Special Orders Accepted • • All Major Credit Cards Accepted •

Tabletop Catering Glassware Cookware Ovenware Food Safety Bar Supplies Kitchen Utensils Prep Equipment Beverage Equipment Cooking Equipment Storage & Transport Holding Equipment Refrigeration Furnishings Sanitation Textiles Janitorial Tabletop Catering Glassware Cookware Ovenware Food Safety Bar Supplies

a division of Restaurant Depot

“Revolutionizing the way you shop for Equipment & Supplies”

REFERENCE GUIDE

RDstore_Cover_v1_2013_Layout 1 4/2/13 10:55 AM Page 1