Page 1

BOSTON 2013 JEA/NSPA Fall National High School Journalism Convention Nov. 14-17, 2013 • Boston Sheraton/Hynes Convention Center Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 1


PARK SCHOLAR PROGRAM A once-in-a-lifetime opportunity awaits outstanding high school seniors. A full scholarship for at least 10 exceptional communications students that covers the fouryear cost of attendance at Ithaca College.

Take a chance. Seize an opportunity. “The Park Scholar Program will challenge you to think analytically, to act and serve boldly, to sharpen your communications skills, and to broaden your horizons in ways you could never imagine.”

– Meghan Swope ’11

Communication Management and Design

Change your life. Study at one of the most prestigious communications schools in the country—Ithaca College’s Roy H. Park School of Communications. Join a group of bright, competitive, and energetic students who are committed to using mass communication to make a positive impact on the world.

To apply for this remarkable opportunity and to learn more about Ithaca College contact Matthew J. Fee, Ph.D., Ithaca College, Park Scholar Program, Ithaca, New York 14850-7002; call 607-274-3089; or email parkscholars@ithaca.edu.

ithaca.edu/parkscholars 2— JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


THE

BOSTON 2013

ABOVE: Faneuil Hall Marketplace at dusk: With 125 shops and 21 restaurants, Faneuil Hall has a festive atmosphere any time of day or night. (All photos courtesy of Greater Boston Convention & Visitors Bureau) ON THE COVER — Left: Customs House at night: The 16th-story tower of the Customs House was the first skyscraper in Boston when it was built in 1917. Top Right: Harborfest Drummers: One of the sights to see at the July 4 Harborfest is the Harborfest Drummers. LOWER RIGHT: Paul Revere statue: Fittingly behind Revere’s statue, at the end of the Mall, sits the Old North Church, “...one if by land, two if by sea ....”

Twitter: @nhsjc/#nhsjc

­Table of contents 2 Convention Officials 3 Exhibitors/Advertisers 4 Convention Sponsors 5 Keynote Speakers 6 Featured Speakers 9 Special Events 12 Awards 18 Thursday at a Glance 19 Thursday Sessions

24 Friday at a Glance 28 Write-off Contest 29 Friday Sessions 52 Saturday at a Glance 56 Saturday Sessions 74 Sunday 78 Speaker Biographies 96 Hynes CC Floor Plan IBC Sheraton Floor Plan JEA/NSPA Fall 2013 Convention/Boston — 3


national officials

Kelly Furnas

Jack Kennedy

Mark Newton

David Therkelsen

Lindsay Grome

Albert Tims

National Scholastic Press Association Headquarters Staff David Therkelsen, interim executive director Lindsay Grome, community engagement director Paul Schwarzkopf, communications and technology director Grace Christiansen, contest/critique coordinator Jackie Flaum, administrative assistant Kay Dawson, accountant

Journalism Education Association OFFICERS President: Mark Newton, MJE, Mountain Vista H.S., Highlands Ranch, Colo. Vice President: Sarah Nichols, MJE, Whitney H.S., Rocklin, Calif. Secretary: Mitch Eden, MJE, Kirkwood (Mo.) H.S. Past President: Jack Kennedy, MJE, Highlands Ranch, Colo. REGIONAL DIRECTORS Region 1/Northwest: Sandra Coyer, MJE, Puyallup (Wash.) H.S. Region 2/Southwest: Carrie Faust, MJE, Smoky Hill H.S., Aurora, Colo. Region 3/North Central: Gary Lindsay, MJE, Cedar Rapids, Iowa Region 4/South Central: Wayna C. Polk, MJE, Weatherford, Texas Region 5/Southeast: Brenda W. Gorsuch, MJE, West Henderson H.S., Hendersonville, N.C. Region 6/Mid-Atlantic and Great Lakes: Rod Satterthwaite, MJE, Dexter (Mich.) H.S. Region 7/Northeast: Jane Blystone, MJE, Mercyhurst College, Erie, Pa. COMMISSION CHAIRS Certification: Kim Green, MJE, Columbus (Ind.) North H.S. Scholastic Press Rights: John Bowen, MJE, Kent (Ohio) State University Junior High/Middle School: Anita Marie Wertz, MJE, Cesar Chavez H.S., Stockton, Calif.

Board of Directors Albert R. Tims, Ph.D., president, University of Minnesota, Minneapolis Christopher J. Ison, treasurer, University of Minnesota, Minneapolis Peter Bobkowski, Ph.D., University of Kansas, Lawrence, Kan. Timothy S. Dorway, Chanhassen (Minn.) H.S. Laura York Guy, Garden City (Kan.) Community College Monica Hill, CJE, North Carolina Scholastic Media Association, University of North Carolina, Chapel Hill Valerie Kibler, CJE, Harrisonburg (Va.) H.S. Seth C. Lewis, Ph.D., University of Minnesota, Minneapolis Ann Visser, MJE, Pella (Iowa) Community H.S. Alan Weintraut, CJE, Annandale (Va.) High School Laura Widmer, Iowa State University, Ames, Iowa LIAISONS NCTE Assembly: Brian Wilson, MJE, Waterford (Mich.) Kettering H.S. NSPA: David Therkelsen, Minneapolis SPLC: Frank LoMonte, Arlington, Va. COMMUNICATION: JOURNALISM EDUCATION TODAY Editor: Bradley Wilson, MJE, Midwestern State University, Wichita Falls, Texas Assistant Editor: Howard Spanogle, Asheville, N.C. STANDING COMMITTEES Awards: Jack Kennedy, MJE, Highlands Ranch, Colo. Digital Media: Aaron Manfull, MJE, Francis Howell North H.S., St. Charles, Mo. Educational Initiatives: Candace Perkins Bowen, MJE, Kent (Ohio) State University

4 — JEA/NSPA Fall 2013 Convention/Boston

Mentor Program: Linda Barrington, MJE, Mount Mary College, Milwaukee; and Peggy Gregory, Dysart USD, Surprise, Ariz. Outreach: Steve O’Donoghue, California Scholastic Journalism Initiative, Sacramento, Calif.; Linda Shockley, Dow Jones News Fund, Princeton, N.J.; and Stan Zoller, MJE, Buffalo Grove, Ill. Write-offs: Nancy Y. Smith, MJE, Lafayette H.S., Wildwood, Mo. JEA HEADQUARTERS STAFF Kelly Furnas, CJE, executive director Connie Fulkerson, administrative assistant/ bookstore manager Pam Boller, office manager/advertising manager Meredith Fey, bookkeeper Chris Cox, website/database intern Visit jea.org/eval to evaluate sessions


local team

Welcome to Boston

Brian Baron

Chair, Featured Speakers: Brian Baron, CJE, Newton South H.S., Newton Centre, Mass. Break with a Pro: Scott Aubrey, Andover (Mass.) H.S. Issue Seminars: Peter Billman-Golemme, CJE, South Hadley (Mass.) H.S. Media Tours: Mary Barber, Wayland (Mass.) H.S., and Janet Karman, Wayland (Mass.) H.S. Reception/Auction: Melissa Cecchi, Medway (Mass.) H.S. Student Volunteers: Julie Kuo, CJE, Lexington (Mass.) H.S. Trade Show/Ads: Carol Finley, Shelton (Conn.) H.S.,

Write-offs: Colleen Gacic Simpson, CJE, Scituate (Mass.) H.S., and Bretton Zinger, MJE, Robert Adams Middle School, Holliston, Mass. On-site Critiques: Nancy Olson, CJE, Putney, Vt. Swap Shops: Nina Scott, Phillips Academy, Andover, Mass. Scholarships: Helen Smith, New England Scholastic Press Association, Boston Entertainment, Shirts: Cortney Weisman, CJE, Ward Melville H.S., East Stauket, N.Y.

exhibitors and advertisers ASNE Youth Journalism Institute, Booth 332-330, Page 8 aPrintis, Booth 320 Balfour Publishing, Booth 400-407, Pages 48-49, back cover Ball State University Journalism Workshops, Booth 93-94, Page 32 Brooks Institute, Booth 326-328, Page 37 Connecticut Health I-Team, Booth 408, Page 85 Dow Jones News Fund, Page 11 Drake University, Booth 304 Environimental Industry Associations, Booth 321 Friesens, Booth 301-303, Page 68 Herff Jones, Booths 414-419, 315, Pages 76-77 Indiana University School of Journalism, Booth 233, Page 71 Iowa High School Press Association, Page 22 Ithaca College Park Scholar Program, Booth 310, Page 80, Inside front cover JEA 45words, Booth 306 iHigh.com, Booth 95 Jostens, Booth 200-205, Pages 40, 61 JS Printing, Page 51 Kansas Journalism Institute, Page 44 Kansas State University, Booth 316 Kent State University, Page 43 Lifetouch Yearbooks, Booth 305/307 Lindenwood University, Booth 97 Lousiana State University Manship School of Mass Communication, Booth 208 Missouri School of Journalism, Booth 302

Twitter: @nhsjc/#nhsjc

New England Center for Investigative Reporting/Boston College, Booth 420, Page 35 Newseum Institute, Booth 409-411, Pages 7, 30 Newsroom by the Bay, Booth 206, Page 93 Northwest College, Booth 221 Picaboo Yearbooks, Booth 231-233, Page 88 Quill and Scroll International Honor Society, Booth 229 RIT School of Media Sciences, Booth 314 Savannah College of Art & Design, Booth 318 School Paper Express, Booth 309 Simpson College Communication and Media, Booth 308 SNO, Booth 421, Page 47 Student Press Law Center, Booth to be assigned Temple University School of Media and Communication, Booth 96 Texas Tech University, Booth 410, Page 83 Thumb, Booth 215 UMass Amherst Journalism, Booth 211, Page 95 University of Kansas, Booth 231, Page 79 University of Miami, Booth 219 University of Mississippi, Booth 210, Page 59 University of Nebraska-Lincoln, Page 75 University of Oregon/Northwest Scholastic Press, Booth 92, Page 73 USC Annenberg School for Communication, Booth 311 University of South Carolina, Booth 111 Walsworth Publishing, Booths 426-433; 327, 329, 331, 333; Pages 21, 64 Washington Journalism and Media Conference, Booth 98 Wiley, Booth 300

JEA/NSPA Fall 2013 Convention/Boston — 5


abbreviations CJE — Certified Journalism Educator CSPA — Columbia Scholastic Press Association DJNF — Dow Jones News Fund JEA — Journalism Education Association MJE — Master Journalism Educator NBCT — National Board Certified Teacher NCTE — National Council of Teachers of English NSPA — National Scholastic Press Association SIPA — Southern Interscholastic Press Association SPLC — Student Press Law Center

guidelines

DIAMOND CONVENTION SPONSORS

GOLD SPONSORS

These guidelines are established to ensure that all convention participants have a safe and enjoyable stay in Boston. A midnight convention curfew will be in effect Wednesday through Saturday. Students should be in their rooms, making no excessive noise, at that time. The hotel reserves the right to remove any hotel guests who make excessive noise or create similar disruption. Advisers/chaperones will be responsible for enforcing the nightly convention curfew. No students will be admitted to the convention without a school-approved adviser/chaperone. At least one chaperone/adviser is required for every 12 students. It is understood that by the act of registering students for the convention, advisers assume responsibility for their students’ behavior and wellbeing during the convention. Chaperones should recognize that they and their schools will be held liable for any damage to hotel/ convention center facilities incurred by students under their supervision. Rudeness to hotel/convention center guests and employees; misuse of or reckless behavior on the elevators; excessive noise; destruction of property; or any other inappropriate behavior is not acceptable and can lead to expulsion from the hotel/convention center and/or criminal prosecution. Should individual students, advisers or delegations prove disruptive, JEA/NSPA officials reserve the right to declare all fees forfeited and to send delegates home at their own expense. Breaking convention rules may result in disqualification from all contests and forfeiture of any awards won. Drinking or possessing alcoholic beverages, or possession/use of illegal drugs is absolutely prohibited. All students are expected to wear their convention name badges at all times while in the convention hotel/ convention center. When outside the hotel/convention center, travel in groups. Your personal safety is our concern. Out of respect to instructors and the intellectual property of their sessions, please do not record presentations without first asking permission from the speaker(s) to do so. 4 — JEA/NSPA Fall 2013 Convention/Boston

SILVER SPONSORS

BRONZE SPONSORS

FRIENDS

Visit jea.org/eval to evaluate sessions


keynote speakers Juliette N. Kayyem columnist for The Boston Globe

Juliette N. Kayyem has been a columnist for The Boston Globe and on the faculty at Harvard’s Kennedy School of Government. After only a year writing for the Globe, she was named a Pulitzer Prize finalist in 2013. She most recently served President Barack Obama as assistant secretary for intergovernmental affairs at the Department of Homeland Security. She has spent more than 15 years in senior positions in state and federal government, including as Massachusetts Gov. Deval Patrick’s homeland security adviser and a legal adviser to U.S. Attorney General Janet Reno. Kayyem is the author of numerous books and articles on counterterrorism and national security. She is a national security analyst for CNN, and her column is distributed worldwide by The New York Times wire. Kayyem is a graduate of Harvard College and Harvard Law School.

7:30 p.m. Thursday Auditorium, Hynes Convention Center

Raney Aronson-Rath

deputy executive producer for PBS “Frontline” As deputy executive producer for PBS’ flagship public affairs documentary series “Frontline,” Raney Aronson-Rath guides the editorial development and execution of the series, from prime-time television broadcasts to multiplatform initiatives. Since joining “Frontline” in 2007, Aronson-Rath has expanded the series’ reach and reporting capabilities. Aronson-Rath also has developed and managed more than a dozen in-depth, cross-platform journalism partnerships with some of the nation’s premiere news outlets, including ProPublica, PBS’ “Newshour,” CBC Television and most recently ESPN. Before helping to manage the series, Aronson-Rath produced, directed and wrote several award-winning “Frontline” films, including “News War,” “The Last Abortion Clinic” and “The Jesus Factor.” Prior to joining “Frontline,” she worked on various award-winning series at ABC News, The Wall Street Journal and MSNBC. Early in her career, while living in Taipei, she was a newspaper reporter for The China Post.

1 p.m. Friday Auditorium, Hynes Convention Center

Aronson-Rath has a bachelor’s degree in South Asian studies and history from the University of Wisconsin. She received her master’s degree from the Columbia University Graduate School of Journalism Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 7


featured speakers Joe Bergantino Joe Bergantino is the executive director/ managing editor and co-founder of the New England Center for Investigative Reporting, a nonprofit watchdog reporting newsroom based at Boston University. He has been a national and local investigative reporter for 35 years, spending most of his career as the I-Team Reporter for WBZ-TV in Boston. He also was an ABC News correspondent for five years and has been a clinical professor of journalism at Boston University since 2009.

u Ethical challenges in investigative reporting — 10 a.m. Friday, Back Bay C, Sheraton

Lisa Chedekel is an award-winning reporter formerly with The Hartford Courant, where she was part of a Pulitzer Prizewinning team, and now is co-founder of the nonprofit investigative news service, the Conn Health I-Team. She specializes in health and safety stories that combine data with compelling storytelling. She also teaches journalism at Northeastern University and is a writer for the Boston University School of Public Health. u The new era of health reporting — 11 a.m. Friday, Back Bay C, Sheraton

Taylor Dobbs is a digital reporter for Vermont Public Radio. He recently completed his journalism degree at Northeastern University in Boston, where he covered the marathon bombings and the subsequent manhunt. u Covering marathon mayhem — 10 a.m. Saturday, Room 311, Hynes CC

Mark Feeney covers photography, film, and the arts for The Boston Globe. With the Globe since 1979, he was a finalist for a Pulitzer Prize in feature writing in 1994 and won a Pulitzer Prize for criticism in 2008. He is the author of “Nixon at the Movies: A Book About Belief.” u Arts criticism in an Internet age — 9 a.m. Friday, Room 312, Hynes CC

Bill Greene is the director of photography at The Boston Globe. He has been with the Globe as a staff photographer for 28 years. His awards include being named National Photographer of the Year twice. He has won Photographer of the Year honors from the Boston Press Photographers Association 13 times. Other honors include the Robert F. Kennedy International Photojournalism Award for his story of the Lost Boys of Sudan, as well as first place in the World Press Photo competition for his coverage of the Mississippi River flood of 1993. A Pulitzer Prize finalist, he also is a three-time Emmy award winner for his recent multimedia work for the Globe, including the Chappaquiddick video series on the fall and rise of Sen. Edward M. Kennedy. u The evolution of digital storytelling — 10 a.m. Friday, Auditorium, Hynes CC

Michelle Johnson, a former editor for The Boston Globe, was part of the team that launched boston. com, the Globe’s award-winning regional website. Johnson now teaches multimedia journalism at Boston University. She has received awards for excellence from the National Association of

8 — JEA/NSPA Fall 2013 Convention/Boston

Black Journalists and the National Lesbian and Gay Journalists Association.

u (Nearly) free tools for producing multimedia — 9 a.m. Saturday, Constitution A, Sheraton

Seth Mnookin is the co-director of MIT’s Graduate Program in Science Writing. His most recent book, “The Panic Virus: The True Story Behind the Vaccine-Autism Controversy,” won the National Association of Science Writers 2012 Science in Society Award and the New England chapter of the American Medical Writers Association’s Will Solimene Award for Excellence. He also is the author of the 2006 New York Times bestseller “Feeding the Monster: How Money, Smarts, and Nerve Took a Team to the Top,” which chronicles the John Henry-Tom Werner ownership group of the Boston Red Sox. His first book, “Hard News: The Scandals at The New York Times and Their Meaning for American Media,” was a Washington Post Best Book of the Year. u Covering marathon mayhem — 10 a.m. Saturday, Room 311, Hynes CC

Paul Niwa, the interim chair of the Emerson College journalism department, has launched two international television networks, six newscasts and a streaming media newscast for NBC, CNBC and StockHouse Media, Canada’s largest Internet company. His websites have earned national distinction for innovation, and his broadcast work has been aired on NBC, PBS, NPR and Pacifica. u Journalism beyond newsrooms — 11 a.m. Friday, Constitution A, Sheraton

Visit jea.org/eval to evaluate sessions


featured speakers Sacha Pfeiffer is a senior reporter at WBUR and host of NPR’s “All Things Considered.” Pfeiffer joined WBUR in 2008 after more than a decade at The Boston Globe, where she was on the Spotlight investigative team that won the 2003 Pulitzer Prize for Public Service for its stories on sexual abuse in the Catholic church. Pfeiffer has received numerous honors from The Associated Press and the Radio and Television News Directors Association, as well as a national Edward R. Murrow Award for broadcast reporting. u Print vs. broadcast — Noon Friday, Commonwealth, Sheraton

Dina Rudick is a three-time Emmy Award-winning photographer and videographer who has worked for The Boston Globe since 2002. During her tenure, she’s been around the world to cover stories ranging from the tsunami in Southeast Asia to women’s health in Haiti to presidential politics nationwide. In 2009, Dina founded Anthem Multimedia, a production company specializing in documentary storytelling for socially motivated nonprofits. u Telling stories on film — 2:30 p.m. Friday, Constitution A, Sheraton

Bob Ryan is a retired columnist for The Boston Globe’s sports section whose work appears in the section semiregularly. He has been writing for the Globe since 1968, covering all of Boston’s sports teams. Ryan is a regular panelist on ESPN’s Sunday morning roundtable, “The Sports Reporters.” He has been named the National Sportscasters and Sportswriters Association National Sportswriter of the Year four times. u A life in sports — 10 a.m. Friday, Room 311, Hynes CC

MAKE SOME

Flip Schulke

NOW OPEN!

Also see 1963: Civil Rights at 50, highlighting news coverage of key civil rights events from 1963.

Teachers! Visit newseum.org/digitalclassroom for free civil rights lesson plans, primary sources and more.

Washington, D.C. • newseum.org • #MakeSomeNoise Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 9


YOUR GO-TO SITE FOR SCHOLASTIC JOURNALISM RESOURCES FOR STUDENTS

FOR ADVISERS

Writing, photo & video contests

News & media literacy

College info Technology & learning resources Summer camp & workshop listings

Journalism & nonfiction writing tips Online tools & apps Citizen rights & r esponsibilities Lesson plans

Games & badges

Training opportunities

Advisory Board

MCT Campus Wire News Service

School News Hub

10 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


special events Sightseeing tour ticket pickup and media tour check-in

Those who have signed up for sightseeing tours through Boston Eventworks may pick up their tickets and sign in 15 minutes before departure time at the table marked “Sightseeing Tours” in the Sheraton Hotel lobby. If you have not signed up for a tour, stop in to see if there are spots still available. Media tour check-in also is located in the Sheraton Lobby. Please meet at the Media Tours table at the designated media tour time listed on the website and in the registration booklet. Media tours will depart from this location. Sightseeing Tours: 8 a.m.-1 p.m. Thursday, Sheraton Lobby Media Tours: 8:30 a.m.-3 p.m. Thursday, Sheraton Lobby

Convention check-in/registration

If you preregistered or still need to register, come to the Exhibit Hall C Thursday afternoon and Friday or Exhibit Hall C Foyer on Saturday to pick up your school’s registration packet. Tickets to preregistered events (except Write-offs) will be enclosed. Don’t forget to pick up a Convention Update, which will have information that didn’t make it into the program by press time. Come to this area to submit your media for Best of Show and to pick up speaker name badges. 1-7 p.m. Thursday and 8 a.m.-4 p.m. Friday, Exhibit Hall C, Hynes CC; 8 a.m.-1 p.m. Saturday, Exhibit Hall C Foyer, Hynes CC

Convention shirt distribution

If your school purchased the official Boston convention shirts through online registration, you may pick them up at the Exhibit Hall C. Large orders will be bundled together and should be picked up by the adviser. There may be extra shirts to buy if you did not pre-order. Quantities are limited. 1-7 p.m. Thursday and 8 a.m.-4 p.m. Friday, Exhibit Hall C, Hynes CC

NSPA Best of Show

See how your publication fares against others represented at the convention. High school publications are eligible if at least one student representative is attending the convention, and junior high publications can enter if the adviser is a registered delegate at the convention. Enter your newspaper, newsmagazine, literary arts magazine, broadcast, website or yearbook at the Best of Show desk. Winners will be announced at the awards ceremony Saturday. Desk open: 1-7 p.m. Thursday and 8 a.m. to 4 p.m. Friday, Exhibit Hall C, Hynes CC

Twitter: @nhsjc/#nhsjc

Trade show exhibits

Dozens of national and local vendors and colleges will educate and entertain during the trade show. Find out what’s new, chat with company representatives, pick up information and have some fun. 1-7 p.m. Thursday and 8 a.m. -4 p.m. Friday, Exhibit Hall C, Hynes CC

Lost and found

The convention check-in/registration desk will house the lost and found. If what you lost is not there, check to see whether someone turned it in to hotel or convention center security. Items not picked up by 1 p.m. Saturday will be turned in to the building’s security department. 1-7 p.m. Thursday and 8 a.m.-4 p.m. Friday, Exhibit Hall C, Hynes CC; 8 a.m.-1 p.m. Saturday, Exhibit Hall C Foyer, Hynes CC

Write-off contest check-in

If both your Write-off registration and JEA membership fees have been paid, your school’s Write-off packet containing student contest tickets, additional instructions and contest room assignments may be picked up at the Write-off desk. If you have not paid, you must do so at this time. Noon Friday is the deadline for substitutions in preregistered categories. No new entries will be accepted at the convention. Lost tickets will be replaced for $5. All broadcast or online news package contestants who meet early Friday must pick up their tickets before the meeting. See Page 28 for contest times and room assignments. Desk open: 1-7 p.m. Thursday, and 8 a.m. to 3 p.m. Friday, Exhibit Hall C, Hynes CC

JEA Bookstore

Check out the new books, as well as popular bestsellers, at the JEA Bookstore. Nearly 300 items relating to journalism are available, including textbooks, curriculum development, yearbook, newspaper, design, photography, writing, desktop publishing, new media, advertising and broadcast. Did you forget Writeoff supplies? Check here to buy dictionaries, thesauruses, stylebooks, paper, pens, pencils, pencil sharpeners and erasers. Supplies are limited, so shop early. 1-7 p.m. Thursday, 7:30 a.m.-5 p.m. Friday and 7:30 a.m.-2:30 p.m. Saturday, Room 210, Hynes CC

New adviser convention orientation

Advisers attending their first JEA/NSPA convention should consider attending a short orientation meeting to get a general overview and explanation of convention events and how to get the most out of them. 6:45-7:15 p.m. Thursday, Beacon B, Sheraton

Adviser kickoff reception

After the keynote speech, all advisers are welcome to attend this reception to socialize with new colleagues and relax with old friends. New and first-time attendee advisers will have a chance to meet the local convention team, plus JEA and NSPA board members and staffs. The sponsor for this event is ASNE Youth Journalism Institute. 9-10:30 p.m. Thursday, Fairfax, Sheraton

Adviser hospitality

Meet with your colleagues from across the country in the adviser hospitality suite, a hot spot for advisers. Local committee members will be available to recommend sightseeing, dining and entertainment options. Texas Tech University College of Media and Communication will provide Friday morning refreshments, and SNO will provide Saturday morning refreshments. 7:30 a.m.-5 p.m. Friday and 7:30 a.m.-noon Saturday, Room 210, Hynes CC

Hands-on computer sessions

If you are interested in getting hands-on computer experience, sign up and get a ticket at the desk in the Exhibit Hall C for one or more of the scheduled sessions. The Mac lab in Berkeley at the Sheraton has courses in InDesign, Photoshop and Illustrator software. There is a 36-person limit so it’s first-come, first served. No more than two people per school per session may sign up, and only those with tickets may sit at a computer. Get Tickets: Thursday and Friday, Exhibit Hall C, Hynes CC Sessions: Friday and Saturday, Berkeley, Sheraton

Journalism Quiz Bowl

A quiz bowl-style competition with questions related to current events, pop culture, journalism and civics are part of the learning and fun. Registered four-person teams will take a written qualifying test at 8 a.m. Friday. The list of qualifying teams will be posted by noon Friday in the JEA Bookstore in Room 210 and at the desk in the Exhibit Hall C at the Hynes. The test scores will be used to seed the top teams that will compete in the live buzzer rounds 8-10 a.m. Saturday. Convention delegates are invited to watch the Saturday rounds. Test: 8 a.m. Friday, Room 207, Hynes CC; Buzzer rounds: 8-9:50 a.m. Saturday, Grand Ballroom, Sheraton

Break with a Pro

If you preregistered for this career-exploration event with media professionals, please check your ticket for your assigned time and table number. Tickets will be in the school registration packet. Students are encouraged to develop questions on career preparation

JEA/NSPA Fall 2013 Convention/Boston — 11


special events requirements, nature of work, salary-level expectations and job availability. They also may inquire about how to handle issues or situations in their work as student journalists. 9 and 10 a.m. Friday, Grand Ballroom, Sheraton

On-site critiques

Advisers and staffs who signed up for critiques of newspapers, news magazines, yearbooks, videos, websites and literary magazines should check appointment times posted at the desk in the Exhibit Hall C in the Hynes Convention Center. Staffs will meet with the person doing the critique in Republic A. Since critiques are only 30 minutes, it is important to be on time. 9 a.m.-2 p.m. Friday and 8 a.m.-3 p.m. Saturday, Republic A, Sheraton

Advisers luncheon

Often the best adviser information and advice happens during informal conversations around a luncheon table. The convention planning team will be honored at this luncheon. Featured speaker will be Adrienne Lavidor-Berman, social media producer at Boston.com and BostonGlobe.com. Preregistration was required. Please bring your meal ticket. 11 a.m.-12:30 p.m. Friday, Republic B, Sheraton

Media Swap Shops

Newspaper, newsmagazine, yearbook, literary magazine, broadcast, junior high/middle

school and adviser swap shops are prime opportunities for preregistered students and advisers to share useful ideas and concepts with others. Bring at least nine samples of your newspaper, literary magazine or one copy of your yearbook or video/DVD to show at your table. Each delegate attending a Swap Shop must have a ticket, which will be in the school registration packet. Please check the ticket for your assigned table and time. 8 and 9 p.m. Friday, Republic A, Sheraton

Adviser reception and SPLC fundraiser

Save room for dessert. Advisers are invited to this social gathering featuring a fundraiser to benefit the Student Press Law Center. Visa, MasterCard, Discover, check or cash will be accepted as payment for auction items. Those who are judging Write-off competitions are especially encouraged to attend after they finish judging. This event is sponsored by the Newseum Institute. 8:30-11 p.m. Friday, Back Bay C, Sheraton

Student dance

A dance for students will have music provided by a DJ. This is a good time to socialize with other student journalists from other parts of the country. Students must present their convention name badge to be admitted to the dance. This event is sponsored by New England Center for Investigative Reporting. 9-11:30 p.m. Friday, Grand Ballroom, Sheraton

Adviser recognition luncheon

JEA, NSPA and Dow Jones News Fund will present awards at this special event. Honorees Linda Barrington, MJE, JEA’s Carl Towley Award winner, and Jim Streisel, MJE, Dow Jones Journalism Teacher of the Year, will speak. New and renewing Certified Journalism Educators and Master Journalism Educators also will be recognized. Preregistration was required for this event. Please bring your meal ticket. This event is sponsored by Herff Jones. Noon Saturday, Room 312, Hynes CC

NSPA Awards Ceremony

Winners of the NSPA Best of Show, Pacemaker and individual awards will be honored at this ceremony. JEA and NSPA encourage everyone to celebrate all winners. 3:30-5:30 p.m. Saturday, Auditorium, Hynes CC

JEA Awards Ceremony

Winners of JEA Write-off contests will be recognized during the closing ceremony. You also will get to see a slideshow of convention highlights and a preview of upcoming conventions. You may pick up Write-off entries after the ceremony. If you receive entries from other schools in your envelope, please contact JEA at jea@spub.ksu.edu to track where they need to go. 8:30-10:30 a.m. Sunday, Auditorium, Hynes CC

How to get the JEA/NSPA convention mobile app onto your device 1. Download the free Guidebook app

(available for iPhone, Android and other devices)

2. Search in the app for “JEA/NSPA Fall 2013” 3. That’s it! Picaboo Yearbooks is sponsor of the mobile app for this convention. 12 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


2013 Dow Jones News Fund National High School Journalism Teacher of the Year Previous National Journalism Teachers of the Year 2012 Ellen Austin, Palo Alto H.S. 2011 Aaron Manfull, Francis Howell North H.S. 2010 Valerie Kibler, Harrisonburg H.S. 2009 Paul Kandell, Palo Alto H.S. 2008 Karl Grubaugh, Granite Bay H.S. 2007 Jim McGonnell, Findlay H.S. 2006 Alan Weintraut, Annandale H.S. 2005 Linda Ballew, Great Falls H.S. 2004 Brenda Gorsuch, West Henderson H.S. 2003 Beth Fitts, Oxford H.S. 2002 Donald Bott, Amos Alonzo Stagg H.S. 2001 Terry Nelson, Muncie Central H.S. 2000 Robin Sawyer, Manteo H.S. 1999 Randy Swikle, Johnsburg H.S. 1998 Kathleen Zwiebel, Pottsville Area H.S. 1997 C. Dow Tate, Hillcrest H.S. 1996 Merle Dieleman, Pleasant Valley Community H.S. 1995 Pat S. Graff, La Cueva H.S. 1994 Nick Ferentinos, Homestead H.S. 1993 Jack Kennedy, City H.S. 1992 Gloria Grove Olman, Utica H.S. 1991 Carol Lange, Thomas Jefferson H.S. for Science and Technology 1990 Steve O’Donoghue, Fremont H.S. 1989 Candace Bowen, St. Charles H.S. 1988 Robert L. Button, Grosse Pointe South H.S. 1987 John Cutsinger, Westlake H.S. Jack Harkrider, Anderson H.S. 1986 Alyce Culpepper, South Plantation H.S. 1985 George Taylor, Tamaqua Area H.S. 1984 Rod Vahl, Central H.S. 1983 John Bowen, Lakewood H.S. 1982 Homer L. Hall, Kirkwood H.S. 1981 Wayne Brasler, University H.S. 1980 Dr. Regis Boyle, Walt Whitman H.S. 1979 Jackie Engel, McPherson H.S. 1978 Col. Charles Savedge, Augusta Military Academy 1977 Ron Clemons, Truman H.S. 1976 William Steinecke, Jr., Frontier Regional School 1975 Christina Beeson-Bailey, Colton H.S. 1974 Randy Stano, A.N. McCallum H.S. 1973 Ronnie Hayes, Lewiston H.S. 1972 J. Brent Norlem, Brooklyn Center H.S. 1971 Ann Heintz, St. Mary Center for Learning 1970 Elaine Pritchett, Memorial Senior H.S. 1969 Virginia Woodring, School District Springfield, Missouri 1968 Ruth Marie Griggs, Broad Ripple H.S. 1967 Mary Benedict, Arlington H.S. 1966 Ralph Chavez, Thomas Jefferson H.S. 1965 Dorry Coppoletta, Oakland Technical H.S. 1964 Jim Powell, Carlsbad Senior H.S. 1963 Opal Eckert, Maryville H.S. 1962 Dorothy Greer, Topeka H.S. 1961 Anthony L. Cassen, Blair Academy 1960 Dr. William Nolan, Harry Ellis H.S.

Twitter: @nhsjc/#nhsjc

JIM STREISEL

CARMEL HIGH SCHOOL Carmel, Indiana

Adviser to the award-winning HiLite and Acumen newsmagazines plus www.hilite.org 2012 DJNF Distinguished Adviser and NSPA Pioneer Award Winner

Distinguished Advisers Charla Harris, Pleasant Grove High School, Texarkana, Ark. Jonathan Rogers, City High School, Iowa City, Iowa Matthew Schott, Francis Howell Central High School, St. Charles, Mo. Jason Wallestad, Benilde-St. Margaret’s School, St. Louis Park, Minn.

Special Recognition Advisers Ana Rosenthal, The Hockaday School, Dallas, Texas Derek Smith, Renton High School, Renton, Wash. Michele Dunaway, Francis Howell High School, St. Charles, Mo.

Congratulations to winners of free WSJ.com subscriptions 2014 Teacher Awards Program nomination forms will be online in February

Thanks to Our Sponsors

Dow Jones News Fund, Inc.

P.O. Box 300

Princeton NJ 08543-0300

https://www.newsfund.org djnf@dowjones.com 609.452.2820

JEA/NSPA Fall 2013 Convention/Boston — 13


HONORS

Fall 2013

These honorees will be recognized during the Saturday adviser luncheon:

Carl Towley Award Linda Barrington, MJE, Mount Mary University, Milwaukee, Wis. Administrator of the Year Evans Bryant Branigan III, North Central High School, Indianapolis, Ind. Friend of Scholastic Journalism Jim A. Angele, Lincoln, Neb. The Boston Globe, Brian McGrory, editor Dann P. Gire, The Chicago Daily Herald Tim Taylor, Butte County Office of Education, Oroville, Calif. Lifetime Achievement Award Pat S. Graff, Albuquerque, N.M. Rod Howe, Omaha, Neb. Dianne Kuppig, Lincoln, Neb. Mary Luckenbill, CJE, Glendale, Ariz. Cheryl Pell, East Lansing, Mich. Ann Quinlan, Lincoln, Neb. Mark R. Sherwood, Orlando, Fla. Terry L. Sollazzo, Valrice, Fla. Darryl Stafford, Denver, Colo. Mark Thompson, CJE, Lake Villa, Ill. Kay H. Windsor, Clemmons, N.C. Medal of Merit Carrie Faust, MJE, Smoky Hill High School, Aurora, Colo. Karen Flowers, CJE, University of South Carolina, Columbia, S.C. Kim Green, MJE, Columbus (Ind.) North High School Cindy Todd, Westlake High School, Austin, Texas 14 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


Fall 2013 JEA Certification Recipients This is the certification list as of press time. These individuals will be recognized during the Saturday adviser luncheon:

New Certified Journalism Educators Karsten L. Barnes, Hayward (Calif.) High School Jill M. Burns, Robinson High School, Tampa, Fla. Stephen Chae, Harvard-Westlake Middle School, Los Angeles Ada R. Clark, Mooresville (Ind.) High School Megan A. Cleveland, Staley High School, Kansas City, Mo. Stephenie L. Conley, Bellevue (Neb. ) East High School Maureen D. Farry, West Forsyth High School, Cumming, Ga. Adrienne L. Forgette, Martha’s Vineyard Regional High School, Oak Bluffs, Mass. Edwin M. Ganze, Herff Jones of Utah, South Jordan, Utah Anne M. Hayman, Arlington (Wash.) High School Denita M. Hines, Bowling Green (Ky.) High School Heather Howard, Norman (Okla.) High School David M. Massy, Walsworth Publishing Co., Overland Park, Kan. Alejandro A. Navarro, J.M. Hanks High School, El Paso, Texas Abrianna R. Nelson, Pleasant Ridge High School, Easton, Kan. Melissa A. Nieves, Coral Gables (Fla.) Senior High School Jon C. Reese, Decatur (Ga.) High School Lindsey D. Ross, Turner High School, Kansas City, Kan. Sara E. Sausker, Jostens, Bloomington, Minn. Valerie T. Tanke, Walsworth Publishing Co., Niles, Mich. Christina M. Tolisano, Saugus (Calif.) High School Ana M. Rodriguez, Coral Gables (Fla.) Senior High School

Renewed Certified Journalism Educators Robert Ahlersmeyer, Carroll High School, Fort Wayne, Ind. William B. Allen, East Mecklenburg High School, Charlotte, N.C. Gerry Appel, Abraham Lincoln High School, Council Bluffs, Iowa Jessica A. Augustine-Stegman, Rock Creek Jr./Sr. High School, St. George, Kan.

Twitter: @nhsjc/#nhsjc

Carole B. Babineaux, Liberty High School, Frisco, Texas Michelle L. Balmeo, Monta Vista High School, Cupertino, Calif. Rachel Braham, St. Pius X Catholic High School, Atlanta Susanna E. Coleman, Greenfield-Central High School, Greenfield, Ind. Erin M. Daniels-Bangle, On Track Academy, Spokane, Wash. Susan M. Dougherty, Edison, N.J. Susan R. Holihan, Mount Si High School, Snoqualmie, Wash. Valerie P. Kibler, Harrisonburg (Va.) High School Jeffrey P. Kocur, Hopkins High School, Minnetonka, Minn. Rod D. Kuhn, Fort Wayne, Ind. Carol D. Lange, Reston, Va. Sharon K. Martin, Wichita (Kan.) East High School April M. Moss, Pike High School, Indianapolis, Ind. Joyce H. Nyberg, Custer County District High School, Miles City, Mont. Glenn Morehouse Olson, St. Francis (Minn.) High School Rebecca K. Pollard, Heritage High School, Frisco, Texas Brenda M. Smith, Grayslake (Ill.) North High School Kendra L. Manuel Smith, Berrien Springs (Mich.) High School Cortney J. Weisman, Ward Melville High School, East Setauket, N.Y. Joshua A. Wikler, Liberty High School, Henderson, Nev. Kathleen D. Zwiebel, Pottsville, Pa.

Renewed Master Journalism Educators Susan Y. Colyer, Southside High School, Fort Smith, Ark. Brenda W. Gorsuch, West Henderson High School, Hendersonville, N.C. Kathy H. Habiger, Mill Valley High School, Shawnee, Kan. Marsha A. Kalkowski, Marian High School, Omaha, Neb. Susan G. Newell, Northridge High School, Tuscaloosa, Ala. Rebecca S. Sipos, Charter Education Partnership, Washington, D.C. Bretton E. Zinger, Robert Adams Middle School, Hollistan, Mass.

JEA/NSPA Fall 2013 Convention/Boston — 15


NSPA congratulates the finalists & winners The Pacemaker has recognized outstanding student journalism for more than 80 years. Entries in the contest are judged on coverage and content, quality of writing and reporting, layout/design and photography, art and graphics. The Pacemaker recognizes the best in scholastic journalism. Pacemaker finalists break new ground in student journalism and truly set the pace for other publications to emulate.

2012 Yearbook Pacemakers presented on Saturday, April 27, 2013

Pacemakers

Details

Bryant HS Bryant, Ark.

Prowler

Hornet

Whitney HS Rocklin, Calif.

Titanium

Pioneer MS Tustin, Calif.

Nugget

Walnut HS Walnut, Calif.

Antelope HS Antelope, Calif. Cupertino HS Cupertino, Calif.

Lion’s Den

Hyde MS Cupertino, Calif.

Decamhian

Del Campo HS Fair Oaks, Calif.

Wingspan

James C. Enochs HS Modesto, Calif.

Rampages

Casa Roble HS Orangevale, Calif.

The Patriot

Harvest Park MS Pleasanton, Calif.

Wings

Arrowhead Christian Academy Redlands, Calif.

Cayuse

The Prowl

Powell MS Littleton, Colo.

Log

Columbus North HS Columbus, Ind.

Indian

Shawnee Mission North HS Overland Park, Kan.

Hauberk

Shawnee Mission East HS Prairie Village, Kan.

Lair

Shawnee Mission Northwest HS Shawnee, Kan.

Excalibur

Francis Howell North HS St. Charles, Mo.

Tonitrus

Skjöld

Corning Painted Post West HS Painted Post, N.Y.

Westwind

West Henderson HS Hendersonville, N.C.

El Paisano

Westlake HS Austin, Texas

Marksmen

St. Mark’s School of Texas Dallas, Texas

Belltower

St. Thomas’ Episcopal School Houston, Texas

Belltower

St. Thomas’ Episcopal School Houston, Texas

Replay

Rouse HS Leander, Texas

The Lion

McKinney HS McKinney, Texas

The Hawk

Pleasant Grove HS Texarkana, Texas

Rocklin HS Rocklin, Calif.

presented on Saturday, April 27, 2013

Vibrato

Connotations

Hockaday School Dallas, Texas

Threshold

Copper Hills HS West Jordan, Utah

Spectator

Rapier

The WORKS

New Pennies

Fayetteville HS Fayetteville, Ark. North Forsyth HS Cumming, Ga. Walter Johnson HS Bethesda, Md Clayton HS Clayton, Mo.

Altavista Combined School Altavista, Va.

The Clan

McLean HS McLean, Va.

Finalists Sunset

Corona del Sol HS Tempe, Ariz.

Pilot

Redondo Union HS Redondo Beach, Calif.

The Carillon

Bellarmine College Preparatory School San Jose, Calif.

Titanian

San Marino HS San Marino, Calif.

Teleios

Hoofbeats

Glenbrook South HS Glenview, Ill.

Triune

Etruscan Quiver

Lake Central HS St. John, Ind.

Reflections

Blue Valley HS Stilwell, Kan. Maize South MS Wichita, Kan.

Crimson

duPont Manual HS Louisville, Ky.

Fentonian

The Cavalier

George Washington HS Danville, Va.

Saga

Loudoun Valley HS Purcellville, Va.

Theogony

Hidden Valley HS Roanoke, Va.

Laconian

Fenton HS Fenton, Mich.

Eagle Eye View

Teresian

Marquee

Roundup

Dreyfoos School of the Arts West Palm Beach, Fla.

Trinity HS Euless, Texas

Brookville HS Lynchburg, Va.

Stampede

Esprit de Corps

Sierra MS Parker, Colo.

Burges HS El Paso, Texas

The Buzzer

Summit

Smoky Hill HS Aurora, Colo.

Mauldin, S.C.

Mount Paran Christian School Kennesaw, Ga.

Eisenhower HS Township, Mich.

St. Teresa’s Academy Kansas City, Mo. Great Falls HS Great Falls, Mont.

Reflections

Salem HS Salem, Va.

Aquila

Freedom HS South Riding, Va.

Paragon

Oakton HS Vienna, Va.

The Edge

Glacier Peak HS Snohomish, Wash.

Mauldin HS

2012 Magazine Pacemakers Pacemakers

Nuntius

Chasms

Finalists Marist School Atlanta, Ga. De Kalb HS Kalb, Ill.

Indian Lore

Shawnee Mission North HS Overland Park, Kan.

Colophon

Towson HS Towson, Md.

The Final Draft Westlake HS Austin, Texas

The Marque

St. Mark’s School of Texas Dallas, Texas

16 — JEA/NSPA Fall 2013 Convention/Boston

2013 Broadcast Pacemaker Finalists

presented on Saturday, Nov. 16, 2013; national winners announced at that time

Mustang Morning News

Channel 97 News

WPHS

Titan TV

Southside Scoop/PHS-TV

Frisco ISD-TV

Mira Costa HS Manhattan Beach, Calif. Pace HS Pace, Fla. Park Hill South HS Riverside, Mo.

Central Intelligence Central HS Springfield, Mo.

Oakville Sr. HS St. Louis, Mo. Centennial HS Frisco, Texas

Frisco ISD Career & Technical Education Center Frisco, Texas

MHS1

McKinney HS McKinney, Texas

Visit jea.org/eval to evaluate sessions


in its annual Pacemaker competitions 2013 Newspaper Pacemaker Finalists presented on Saturday, Nov. 16, 2013; national winners announced at that time

The CS Press

High Tide

Redondo Union HS Redondo Beach, Calif.

Cactus Shadows HS Cave Creek, Ariz.

The Roundup

The Octagon

Sacramento Country Day School Sacramento, Calif.

Brophy College Preparatory School Phoenix, Ariz.

The Broadview

The Prospective

Convent of the Sacred Heart HS San Francisco, Calif.

Bryant HS Bryant, Ark.

The Hub

Crossfire

Davis Sr. HS Davis, Calif.

Crossroads School For Arts and Sciences Santa Monica, Calif.

Accolade

Sunny Hills HS Fullerton, Calif.

The Bruin Voice Bear Creek HS Stockton, Calif.

The Gazette

Granite Bay HS Granite Bay, Calif.

The Lancer

Thousand Oaks HS Thousand Oaks, Calif.

The Spectrum

Harvard-Westlake MS Los Angeles, Calif.

Eagle Eye

Mountain Vista HS Highlands Ranch, Colo.

Ultra-Violet

Marlborough School Los Angeles, Calif.

Inklings

Staples HS Westport, Conn.

The Town Crier

Paul Revere Charter MS Los Angeles, Calif.

The Scroll

American School in London London, England

The Tam News Tamalpais HS Mill Valley, Calif.

Lightning Strike

Dr. Michael Krop HS Miami, Fla.

The Oracle

Henry M. Gunn HS Palo Alto, Calif.

J. Hop Times

John Hopkins MS St. Petersburg, Fla.

Spartan News Network

Lakewood HS St. Petersburg, Fla.

Predator

Wharton HS Tampa, Fla.

The Muse

The Spartana

Homestead HS Fort Wayne, Ind.

The Royal Page

Blue & Gold

The Echo

Spark

Marquette Messenger

The Marshfield Times

Hopkins HS Minnetonka, Minn.

Cub Reporter

Lawrence Central HS Indianapolis, Ind.

The Little Hawk Iowa City HS Iowa City, Iowa

The Northwest Passage

Marquette HS Chesterfield, Mo.

The Kirkwood Call

The Southerner

Veritas

Central Focus

The Messenger

The Crane-Clarion

Henry W. Grady HS Atlanta, Ga. Northview HS Johns Creek, Ga.

Devils’ Advocate

Hinsdale Central HS Hinsdale, Ill.

North Star

Naperville North HS Naperville, Ill.

Torch

Glenbrook North HS Northbrook, Ill.

The Pacer

Rolling Meadows HS Rolling Meadows, Ill.

Nantucket HS Nantucket, Mass.

Lakota East HS Liberty Township, Ohio

St. Louis Park HS St. Louis Park, Minn.

Shawnee Mission Northwest HS Shawnee Kan.

Dreyfoos School of the Arts West Palm Beach, Fla.

FindlayHS Findlay, Ohio

Kirkwood HS Kirkwood, Mo.

Francis Howell Central HS St. Charles, Mo.

Marshfield HS Coos Bay, Ore.

Statesman

Lincoln Sr. HS Sioux Falls, S.D.

The Eagle’s Eye Akins HS Austin, Texas

Featherduster

Cranbrook Kingswood School Bloomfield Hills, Mich.

North Star

Westlake HS Austin, Texas

North Pointe

Image

St. Mark’s School of Texas Dallas, Texas

Grosse Pointe North HS Grosse Pointe Woods, Mich.

The Talon

Rochester HS Rochester Hills, Mich.

Viewer

Mounds View HS Arden Hills, Minn.

Francis Howell North HS St. Charles, Mo. Lafayette HS Wildwood, Mo.

Lance

Omaha Westside HS Omaha, Neb.

The Exonian

Phillips Exeter Academy Exeter, N.H.

Hi’s Eye

Westfield HS Westfield, N.J.

The HiLite

The ReMarker

The Warrior Ledger Taylorsville HS Salt Lake City, Utah

tjToday

Thomas Jefferson HS for Science & Technology Alexandria, Va.

Puma Press

Univ. Prep HS Seattle, Wash.

The Apple Leaf

Wenatchee HS Wenatchee, Wash.

Carmel HS Carmel, Ind.

2013 Online Pacemakers Pacemakers El Estoque

Monta Vista HS Cupertino, Calif.

The Feather Online Fresno Christian HS Fresno, Calif.

GraniteBayToday.org Granite Bay HS Granite Bay, Calif.

Roar

Milken Comm. HS Los Angeles, Calif.

Mustang Morning News

Mira Costa HS Manhattan Beach, Calif.

The Paly Voice Palo Alto HS Palo Alto, Calif.

The Foothill Dragon Press Foothill Technology HS Ventura, Calif.

ODYSSEY Online Clarke Central HS Athens, Ga.

presented on Saturday, April 27, 2013

The North Star

Naperville North HS Naperville, Ill.

OTHStoday

O’Fallon Township HS O’Fallon, Ill.

Clarion

Riverside-Brookfield HS Riverside, Ill.

Niles West News Niles West HS Skokie, Ill.

Knight Errant

Benilde-St. Margaret’s School St. Louis Park, Minn.

BearingNews

Rock Bridge Sr. HS Columbia, Mo.

FHNtoday.com

Francis Howell North HS St. Charles, Mo.

The Eye

Finalists

Inklings

Bryant HS Bryant, Ark.

The Muse

Prospective Online The Lancer Link Carlsbad HS Carlsbad, Calif.

Blue Devil HUB Bark

The Rider Online

Eye of the Tiger

Shawnee Mission East HS Prairie Village, Kan.

Edge Online

The Carillon

Denebola

TRNWIRED

HiLite Online Carmel HS Carmel, Ind.

Harbinger Online

Newton Sough HS Newton Centre, Mass.

Wayland Student Press Network Wayland HS Wayland, Mass.

Twitter: @nhsjc/#nhsjc

Legacy HS Mansfield, Texas

Pleasant Grove HS Texarkana, Texas Prince George HS Prince George, Va.

Hawkeye

Mountlake Terrace HS Mountlake Terrace, Wash.

Mill Valley HS Shawnee, Kan.

The Communicator Comm. HS Ann Arbor, Mich.

DartNewsOnline

Daniel Pearl Magnet HS Van Nuys, Calif.

Etched In Stone Fossil Ridge HS Fort Collins, Colo.

The Comet Student Press Network

Mill Valley News Online

Bellarmine College Preparatory School San Jose, Calif.

The Pearl Post

NCHS Live!

Iowa City HS Iowa City, Iowa

Roseville HS Roseville, Calif.

Southwest Career and Technical Academy Las Vegas, Nev.

Spark

The Little Hawk

Redwood HS Larkspur, Calif.

Southwest Shadow

Dreyfoos School of the Arts Palm Beach, Fla. North Central HS Indianapolis, Ind.

Davis Sr. HS Davis, Calif.

Singapore American School Singapore, Singapore

Staples HS Westport, Conn.

St. Teresa’s Academy Kansas City, Mo.

FHCtoday.com

Lakota East HS Liberty Township, Ohio.

William Mason HS Mason, Ohio

Stoganews

Conestoga HS Berwyn, Pa.

hockadayfourcast.org Hockaday School Dallas, Texas

The Red Ledger Lovejoy HS Lucas, Texas

Manestreamnews. com McKinney School McKinney, Texas

Francis Howell Central HS St. Charles, Mo.

The A-Blast

Westside Wired

Globe Online

Westside HS Omaha, Neb.

Annandale HS Annandale, Va. Clayton HS Clayton, Wash.

JEA/NSPA Fall 2013 Convention/Boston — 17


Congratulations to the finalists in the 2013 NSPA Picture of the Year Finalists co-sponsor: National Press Photographers Association

News Picture

Feature Picture

Sports Action

Sports Reaction

Environmental Portrait

The Beacon Woodrow Wilson Sr. HS Washington, D.C.

The Tiger Dawson County HS Dawsonville, Ga.

Spartan News Network Lakewood HS St. Petersburg, Fla.

Wildcat Los Gatos HS Prairie Village, Kan.

Realm Thomas Downey HS Modesto, Calif.

Shane Achenbach

Caroline Dickens

Hauberk Shawnee Mission East HS Prairie Village, Kan.

Savannah Kelly

Lair Shawnee Mission NW HS Shawnee, Kan.

Thomas Repasky Communicator Community HS Ann Arbor, Mich.

Miranda Abe

Anna Lam

The Dragon Johnston HS Johnston, Iowa

Kylene Hammer

Indian Shawnee Mission North HS Overland Park, Kan.

Laura Gilligan El Paisano Westlake HS Austin, Texas.

Parker Matthews

Marksmen St. Mark’s School of Texas

Dallas, Texas

Brianna Johnson

Ryan Young

The Little Hawk Iowa City HS Iowa City, Iowa

Matt Krieg

North Star Francis Howell North HS St. Charles, Mo.

Lilly Kim

The Knights Gyeonggi Suwon International Suwon Gyeonggi-do, S. Korea

Dakota James Craig Above & Beyond Robinson Secondary School Fairfax, Va.

Keats Iwanaga

Dylan Scott

The Echo St. Louis Park HS St. Louis Park, Minn.

Robbie Rexford Carillon Bellaire HS Bellaire, Texas

Kayla Hernandez The Tribute Heritage HS Frisco, Texas

Ian Mellor-Crummey The Review St. John’s School Houston, Texas

Blake Garcia

Junior High/ Middle School

Gabe Alejos

Imprints Mesa MS Castle Rock, Colo.

Indian Shawnee Mission North HS Overland Park, Kan.

Emily Coble

Teresian St. Teresa’s Academy Kansas City, Mo.

Cade Ritter Featherduster Westlake HS Austin, Texas

Anila Ademi

Mnemosyne Stratford HS Houston, Texas

Emily MacLean

Brina Sandoval

The Nighthawk Rocky Heights MS Littleon, Colo.

Annabelle Azoy

The Portfolio Bak MS of the Arts West Palm Beach, Fla.

Trevor Crupi The Scrapbook Westfield MS Westfield, Ind.

Lilly Kim

The Knights Gyeonggi Suwon International Suwon Gyeonggi-do, S. Korea

2013 NSPA Print & Multimedia Story of the Year Finalists co-sponsors: The Headline Club (Print), PBS NewsHour Extra (Multimedia)

News Story

Lisie Sabbag

Jacob Prothro

Kori Cooper

Courier Marjory Stoneman Douglas HS Parkland, Fla.

Josh Rosenblat

Peter Baugh

Diversity

Robbie Kravec

Zoe Shancer

The Oracle Glenbrook South HS Glenview, Ill.

Camille Douglas

The Talon Rochester HS Rochester Hills, Mich.

Staff

Spark Lakota East HS Liberty Township, Ohio

Alyyan Malick, Iman Charania The Review St. John’s School Houston, Texas

Feature Story

Billie Mandelbaum The Tam News Tamalpais HS Mill Valley, Calif.

Verde Palo Alto HS Palo Alto, Calif. Deerprints Deerfield HS Deerfield, Ill.

Kyle Rieger

The Kirkwood Call Kirkwood HS Kirkwood, Mo.

Monica Tan Featherduster Westalke HS Austin, Texas

Sports Story

Audrey De Bruine, Nora Rosati MavLife La Costa Canyon HS Carlsbad, Calif.

Ryanne Bruns Drops of Ink Libertyville HS Libertyville, Ill.

Julia Poe

Featherduster Westlake HS Austin Texas

Globe Clayton HS Clayton, Wash.

Editorial/ Opinion Francesca OteroVargas, Ximena Hasbach-Covian

The Muse Dreyfoos School of the Arts West Palm Beach, Fla.

Josh Rosenblat Deerprints Deerfield HS Deerfield, Ill.

Almado Doko

Vanguard Stevenson HS Sterling Heights, Mich.

Alexus Martin

The Rolling Stone Manlius Pebble Hill HS DeWitt, N.Y.

The Harbinger Shawnee Mission East HS Prairie Village, Kan.

18 — JEA/NSPA Fall 2013 Convention/Boston

Prowler Stony Point HS Round Rock, Texas.

Multimedia News Staff

Mae Puckett

Spartan News Network Lakewood HS St. Petersburg, Fla.

Sarah Novicoff

The Southerner Henry W. Grady HS Atlanta, Ga.

The Tam News Tamalpais HS Mill Valley, Calif. The Chronicle Harvard-Westlake School North Hollywood, Calif.

Jessica Cao, Nikita Dhesikan The Epic Lynbrook HS San Jose, Calif.

Chad Rhym, Aaron Holmes Odyssey Clarke Central HS Athens, Ga.

Danny Nett

Northwest Horizons Northwest Guilford HS Greensboro, N.C.

Staff

Staff

Multimedia Sports

Ashley Calvani, Erica Westley The Chronicle William Mason HS Mason, Ohio

Daniel Bodden

North Star Francis Howell North HS St. Charles, Mo.

The Spoke Conestoga HS Berwyn, Pa.

Multimedia Feature Staff

El Estoque Monta Vista HS Cupertino, Calif.

Staff

The Oracle Glenbrook South HS Glenview, Ill.

Lisseth Lopez, Madison Terrier The Odyssey Summer Creek HS Houston, Texas

Visit jea.org/eval to evaluate sessions


NSPA 2012-13 individual competitions 2013 NSPA Design of the Year Finalists

Newspaper Page One

Daniel Tutt, Henry Anker, Ben Baek The Hub Davis Sr. HS Davis, Calif.

News Magazine Cover

Jason Arnold, Nora Holman

Andrew McKittrick

The Little Hawk Iowa Cityt HS Iowa City, Iowa

Emily McCann

The Crimson Record duPont Manual HS Louisville, Ky.

The Harbinger Shawnee Mission East HS Prairie Village, Kan. Dart St. Teresa’s Academy Kansas City, Mo.

Derek Braun

The View Park Hill South HS Springfield, Mo.

Daniel Hersh

The ReMarker St. Mark’s School of Texas Dallas, Texas

Keevin Henley

Abby Mesaros, Jordan Romanowski The Squall Dexter HS Dexter, Mich.

Staff

Spark Lakota East HS Liberty Township, Ohio

co-sponsor: Adobe Systems

Newspaper Page/Spread Brittany Tholan, Alexa Addleman Redwood Bark Redwood HS Larkspur, Calif.

Anna Marie Boria Hi-Lights William R. Boone HS Orlando, Fla.

Chloe Stradinger, Morgan Twibell

The Harbinger Shawnee Mission East HS Prairie Village, Kan..

Natasha Raush

Spark Lakota East HS Liberty Township, Ohio

Staff

The Spoke Conestoga HS Berwyn, Pa.

Yearbook Page/Spread Sabrina Fani

Aerie Brentwood School Los Angeles, Calif.

Delilah Roberts, Malaika Nall Farrier Mirman School Los Angeles, Calif.

Grant Thayer

Wildcat Los Gatos HS Los Gatos, Calif.

Rachel Levine Pioneer Kirkwood HS Kirkwood, Mo.

Jessalynne Ku

Lord Loudoun Loudoun County HS Leesburg, Va.

2013 NSPA Broadcast Story of the Year Finalists

co-sponsors: SchoolTube / Radio Television Digital News Foundation

Infographic

Illustration

Hornet Bryant HS Bryant, Ark.

The Messenger Northview HS Johns Creek, Ga.

Amber Easterly

Sam Quinn

Selina Che

Bianca Vaughn

Renata Stewart

Dylan Scott

Miranda Gibbs

Derek Braun

Emily Beaman

Katelyn Marotzke

The Wildcat Brea Olinda HS Brea, Calif. The Little Hawk Iowa City HS Iowa City, Iowa

The Harbinger Shawnee Mission East HS Prairie Village, Kan. Hi-Herald Bismarck HS Bismarck, N.D.

One Blue Wall duPont Manual HS Louisville, Ky. The Echo St. Louis Park HS St. Louis Park, Minn. The View Park Hill South HS Riverside, Mo. Hi-Herald Bismarck HS Bismarck, N.D.

2013 NSPA Cartooning Award Finalists co-sponsor: Universal Uclick

Broadcast News

Broadcast Feature

Broadcast Sports

Editorial Cartoon

Comic Panel/Strip

Mustang Morning News Mira Costa HS Manhattan Beach, Calif.

Trojan TV News Park Hill HS Kansas City, Mo.

Mustang Morning News Mira Costa HS Manhattan Beach, Calif.

Tornado Times Hoover HS Glendale, Calif.

The Bruin Voice Bear Creek HS Stockton, Calif.

Staff

Paxton DiBlasi

Staff

Se Yeon Kim

Danielle Steward

Staff

Staff

Staff

Lauren Bertino

Milo Krimstein

Tess Jordan, Savannah Kutz

Caleb Bunselmeyer, Bailey Mittman

Jack Petrie, Dan Weyerich

Moira Blodgett

Rachel Chen

Staff

Sharon Lee, Emilia Cavero

Luci Pak, Aubrey Molica

Liane Yue

Carlton Reynolds

Mariya Amato

Guan Chen

PNN News Plymouth North HS Plymouth, Mass. Southside Scoop/PHS-TV Park Hill South HS Riverside, Mo. Central Intelligence Central HS Springfield, Mo.

Staff

Tribe Talk Wando HS Mt. Pleasant, S.C.

Twitter: @nhsjc/#nhsjc

STTV News Staley HS Kansas City, Mo. Central Intelligence Central HS Springfield, Mo. Central Intelligence Central HS Springfield, Mo.

Noe Garcia, Cole Murray MHS1 McKinney HS McKinney, Texas

EaglEye Apple Valley Sr. HS Apple Valley, Minn. KHTV Kirkwood HS Kirkwood, Mo.

Central Intelligence Central HS Springfield, Mo.

Staff

MHS1 McKinney HS McKinney, Texas

The Prowl Coral Glades HS Coral Springs, Fla.

The Central Times Naperville Central HS Naperville, Ill. The HiLite Carmel HS Carmel, Ind. The Liberty Tribune Liberty HS Henderson, Nev.

Evanstonian Evanston Township HS Evanston, Ill. The HiLite Carmel HS Carmel, Ind.

Vanguard Stevenson HS Sterling Heights, Mich. The Review St. John’s School Houston, Texas

JEA/NSPA Fall 2013 Convention/Boston — 19


THURSDAY at a glance ROOMS

8:30 a.m.

1 p.m.

5 p.m.

6 p.m.

Evening

SHERATON HOTEL Society for News Design quick course (1-5 p.m.)

Back Bay A Back Bay B

Redesign seminar (8:30 a.m.-5 p.m.)

Back Bay C

Team storytelling (8:30 a.m.-5 p.m.)

Back Bay D

Online boot camp (8:30 a.m.-5 p.m.)

Beacon A

JEA Outreach Academy (8:30 a.m.-4:30 p.m.) News literacy project meeting (3-5 p.m.)

Beacon B Beacon D Berkeley

Write-off headquarters Photoshop for beginners (8:30 a.m.-noon)

Advanced Photoshop (1-4:30 p.m.)

Boardroom Commonwealth

Scholarship mix and mingle (6-7 p.m.)

JEA board meeting (8 a.m.-3:30 p.m.) Leadership seminar (8:30 a.m.-4:30 p.m.)

Gardner

Intensive Journalistic Writing workshop (8:30 a.m.-5 p.m.)

Hampton

In-depth legal training (8:30 a.m.-4 p.m.) DSLR basics (8:30 a.m.-noon)

Kickoff reception; meet and greet (9-10:30 p.m.)

Lighting techniques (1-4:30 p.m.)

Writers’ workshop (8:30 a.m.-4 p.m.)

Liberty B

Broadcast and video boot camp (8:30 a.m.-5 p.m.)

Liberty C

Advanced broadcast and video boot camp (8:30 a.m.-5 p.m.)

Republic A

Middle school madness (6:30-7:20 p.m.) Broadcast judging

Fairfax

Independence East Independence West

New adviser orientation (6:45-7:15 p.m.)

Digital photography workshop (8:30 a.m.-5 p.m.)

HYNES CONVENTION CENTER Auditorium Exhibit Hall C

Opening/keynote (7:30-9 p.m.) Convention registration/check-in, trade show, Write-off check-in, shirt distribution, critique check-in, computer session signup (1-7 p.m.)

Room 210 n Advising/Teaching n Contest n DESIGN n EDITING

JEA Bookstore (1-7 p.m .) n ENTREPRENUERSHIP n Featured Speaker n General Audience n Law/Ethics

20 — JEA/NSPA Fall 2013 Convention/Boston

n LEADERSHIP/TEAM BUILDING n Meeting n MULtimedia broadcast n News GATHERING

n NEWS LITERACY n PhotoJOURNALISM n WEB n WRITING

Visit jea.org/eval to evaluate sessions


THURSDAY 8-8:30 a.m. 8 a.m. JEA board meeting

in groups of three to create real story packages. The workshop begins with instruction on planning packages with readers in mind, and then the students will go off-site to gather stories. Students will come back to the Sheraton to finish their packages. Students will need to bring any equipment they might need (cameras, laptops, card readers, etc.). Preregistration was required.

Event

Amy DeVault, MJE, Wichita (Kan.) State University, and Kelly Glasscock, Derby (Kan.) High School 8:30 a.m. Thursday, Back Bay C, Sheraton (340)

Meeting

JEA board members meet to discuss ongoing projects and other agenda items. Mark Newton, MJE, Mountain Vista High School, Highlands Ranch, Colo. 8 a.m. Thursday, Commonwealth, Sheraton (250)

Media and sightseeing tours check-in

Those who have signed up for sightseeing tours through Boston Eventworks may pick up their tickets and sign in at the table marked “Sightseeing Tours” in the Sheraton Lobby. If you have not signed up for a tour, stop in to see if there are spots still available. Media tour check-in also is located in the Sheraton Lobby. Please check in at the desk 15 minutes before the designated media tour time listed on the website and in the registration booklet. Media tours will depart from this location. 8 a.m. Thursday, Lobby, Sheraton Event

Publication exchange

Interested in seeing what kind of work other high schools are producing around the nation? Stop by the publication exchange tables to gander at the latest editions of high school news from coast to coast. Feel free to drop off a few copies of your publication. Thursday, Exhibit Hall C Foyer, Hynes CC

8:30 a.m. Design

Redesign seminar

Students in this intensive design seminar will study advanced packaging techniques including modular design, typography, marriage of elements, negative space and photo packaging. Laptop computers with InDesign are encouraged but not mandatory. Students also should bring some of their favorite magazines as well as supplies such as scissors, pencils, glue sticks, etc. Students also are encouraged to bring their own publications for sharing and critique. Preregistration was required. Evaluation code: 2065

Pete LeBlanc, Antelope (Calif.) High School 8:30 a.m. Thursday, Back Bay B, Sheraton (250) NEWS GATHERING

Team storytelling

Great storytelling combines strong writing, insightful photos and reader-friendly design. Behind it all is good planning. In this teambased reporting experience, students will work

Twitter: @nhsjc/#nhsjc

Evaluation code: 2064

Leadership and Team Building

Leadership seminar

Designed for publications editors, this all-day seminar will show participants more ways to effectively lead the way with their publications staffs. Editors will work to better understand their team and how to help individual members work together to solve problems and manage time. They also will discuss self-assessment, people interaction, project planning, project management, goal setting, teamwork and motivation. Preregistration was required. Evaluation code: 2066

Lori Keekley, MJE, St. Louis Park (Minn.) High School 8:30 a.m. Thursday, Fairfax, Sheraton (240)

Web

Online boot camp

Whether launching your website or just looking for ideas to revive your existing site, this all-day seminar will provide a look at best practices and provide you with easy tools to make your online publication shine. This workshop will cover everything from design and structure to multimedia and interactivity. Elements of WordPress will be covered, and participants may want to have login and password data available to use from their own site. Participants must bring a laptop. Preregistration was required.

Advising/Teaching

Intensive journalistic writing workshop

Evaluation code: 2803

Since 1988, the Intensive Journalistic Writing Institute has trained hundreds of English and journalism teachers around the country in new approaches to teaching writing and using real examples of contemporary and classic journalistic models. Teachers will read journalistic models, explore journalistic writing modes, learn teaching techniques and explore new unit plans to incorporate journalistic writing in your English curriculum. Preregistration was required.

Advising/Teaching

Carol Lange, Reston, Va., CJE, and Valerie Kibler, CJE, Harrisonburg (Va.) High School 8:30 a.m. Thursday, Gardner, Sheraton (120)

Chris Waugaman, MJE, Prince George (Va.) High School 8:30 a.m. Thursday, Back Bay D, Sheraton (225)

JEA Outreach Academy

This is a JEA initiative to promote diversity among the journalism teaching profession. The Outreach Academy is a free, intensive seminar for publication advisers who are new to the profession and need help to teach and advise students in journalism. The program is hands on and focuses on practical information new advisers need. It includes discussion of teaching journalism to highly diverse populations, effective instructional techniques, resources for teachers in and out of the classroom and organizations ready to help advisers. Preregistration was required. Evaluation code: 2068

Linda Shockley, Dow Jones News Fund, Princeton, N.J.; Steve O’Donoghue, California Scholastic Journalism Initiative, Sacramento, Calif.; and Stan Zoller, MJE, Buffalo Grove, Ill. 8:30 a.m. Thursday, Beacon A, Sheraton (60) Photojournalism

Photoshop for beginners

Learn to use Adobe Photoshop in this half-day workshop. This workshop will emphasize a basic workflow for preparing photographs for publication. Preregistration was required. Evaluation code: 2063

Evaluation code: 3294

Law and Ethics

In-depth legal training

Join the nation’s foremost expert on scholastic media law for this entertaining, engaging and hands-on workshop on the rights and regulations regarding your publication. You will learn all the legal tools at your disposal to take coverage of your community to the next level, as well as the pitfalls of liability you need to look out for. Preregistration was required.Evaluation code: 2735

Frank LoMonte, Student Press Law Center, Arlington, Va. 8:30 a.m. Thursday, Hampton, Sheraton (110) Photojournalism

DSLR basics

Get hands-on camera instruction you need. Bring your DSLR camera for a morning of oneon-one instruction. This course caters to novice photographers with instruction focusing on buttons, knobs, dials and so on, as well as some composition techniques. Preregistration was required. Evaluation code: 2737

Mike Simons, CJE, West High School, Painted Post, N.Y. 8:30 a.m. Thursday, Independence East, Sheraton (120)

Mark Murray, Arlington (Texas) ISD 8:30 a.m. Thursday, Berkeley, Sheraton (80)

JEA/NSPA Fall 2013 Convention/Boston — 21


thursday 8:30 a.m.-1 p.m. Writing

Writers’ workshop

If you’re looking for ways to sharpen and brighten your writing so others will be clamoring to read it, this daylong interactive seminar is for you. This seminar will entertain and inspire as well as give you a chance to analyze excellent writing and apply what you learn to your own work. You’ll discuss ledes, voice, narrative style and the use of literary devices to tighten and strengthen your writing. Preregistration was required. Evaluation code: 3280

Will Higgins, Dartmouth (Mass.) High School 8:30 a.m. Thursday, Independence West, Sheraton (220) Multimedia Broadcast

Broadcast and video boot camp

Beginning and intermediate students will learn the fundamentals of creating an effective news package from the ground up. This includes videography, sound recording, editing and story structure. Working in small teams, participants will spend the morning developing their videography skills and planning a story, and the afternoon shooting and editing that story. Participants must provide their own video cameras, tripods, microphones and laptops with editing software. Please test and become familiar with this equipment before attending the session. Preregistration was required. Evaluation code: 2858

Michael Hernandez, Mira Costa High School, Manhattan Beach, Calif., and Don Goble, Ladue Horton Watkins High School, St. Louis, Mo. 8:30 a.m. Thursday, Liberty B, Sheraton (60)

photo shoot, area professional photographers will critique students’ work and offer editing tips. Participants must bring a digital camera, and they are encouraged to bring a laptop computer with the photo-editing program they will use. Preregistration was required. Evaluation code: 3281

Andy Nelson, Kansas State University, Manhattan, Kan. 8:30 a.m. Thursday, Republic A, Sheraton (100)

1 p.m. Event

JEA Bookstore

Check out new books and popular bestsellers at the JEA Bookstore. Nearly 300 items relating to journalism are available, including textbooks and curriculum development guides. Did you forget Write-off supplies? Check here to buy stylebooks, paper, pens, pencils, pencil sharpeners and erasers. Supplies are limited. 1-7 p.m. Thursday, Room 210, Hynes CC Design

Society for News Design QuickCourse

SND brings its fast-paced workshop to JEA/ NSPA. In four fast hours, we start with the fundamentals of print design and move into tips and trends, with hundreds of ideas for designs, stories, photos, graphics and typography. Bring copies of your publications and your designs, either print or PDF, for our critique. We’ll make you better. Preregistration was required. Evaluation code: 3283

Ron Johnson, Indiana University, Bloomington, Ind. 1 p.m. Thursday, Back Bay A, Sheraton (250)

Multimedia Broadcast

Advanced broadcast and video boot camp

For students and advisers with experience creating broadcast news packages. The session will cover advanced tips and tricks, including how to find unique stories and angles, getting out of a writing rut (how to stay fresh), and ideas for dynamic videography and sound. Students will put their new knowledge to use by producing a short package during the session. Preregistration was required. Evaluation code: 3279

Dave Davis, Hillcrest High School, Springfield, Mo., and Brandon Goodwin, The Academy of Scholastic Broadcasting, Springfield, Mo. 8:30 a.m. Thursday, Liberty C, Sheraton (60) Photojournalism

Digital photography workshop

Designed for photographers who have at least one year’s experience shooting for their publications, this intensive workshop will cover composition, lighting, cropping and camera technique. Participants will receive instruction and go out on assignment. Following the

Photojournalism

Advanced Photoshop

For participants who are already familiar with Photoshop, this workshop will cover more advanced skills and tricks to take full advantage of this powerful software, including cutouts, layers, paths and other special effects. Preregistration was required. Evaluation code: 2525

Mark Murray, Arlington (Texas) ISD 1 p.m. Thursday, Berkeley, Sheraton (80) Photojournalism

Lighting techniques

One of the weakest areas of scholastic journalism photography is lighting. Learn how to find sweet spots at your school and use cheap solutions to make your pictures pop. Bring your DSLR camera and get practical exposure to some on- and off-camera lighting solutions. Preregistration was required. Evaluation code: 2738

Mike Simons, CJE, West High School, Painted Post, N.Y. 1 p.m. Thursday, Independence East, Sheraton

22 — JEA/NSPA Fall 2013 Convention/Boston

In the EXHIBIT HALL 1-7 p.m. Thursday, Exhibit Hall C, Hynes CC

Convention registration/check-in

In addition to the trade show and convention registration/check-in, turn in your Best of Show entries here. Also in the hall are lost-and-found, Write-off contest and on-site critique checkin, computer session sign-up and convention shirt distribution.

Trade show exhibits

Dozens of national and local vendors and colleges will educate and entertain during the trade show exhibits. Find out what’s new, chat with company representatives, pick up information and have some fun.

Write-off contest check-in

If both your Write-off registration and JEA membership fees have been paid, your school’s Write-off packet containing student contest tickets, additional instructions and contest room assignments may be picked up at the Write-off desk. If you have not paid, you must do so at this time. Noon Friday is the deadline for substitutions in preregistered categories. No new entries will be accepted at the convention. Participants in early broadcast contests Friday must have their tickets, so it’s best to pick them up by 7 p.m. Thursday.

Best of Show desk

Enter your newspaper, newsmagazine, literary arts magazine, broadcast, website or yearbook at the Best of Show desk. Winners will be announced at the NSPA awards ceremony Saturday.

On-site critique desk

If you sign up to get a critique, check in to see when you will meet with your evaluator.

Convention shirt distribution

Stop by this table to pick up the convention shirts your staff pre-ordered. It’s best if the adviser picks up the bundle of shirts. There may be some extras for sale if you did not pre-order.

Computer session signup

If you would like to attend hands-on computer sessions Friday and Saturday in the computer lab, sign up here and get a ticket. Limit two per school per session. Only those with tickets may sit at a shared computer.

Visit jea.org/eval to evaluate sessions


Bring your yearbook

to LIFE!

Your yearbook can include eye-popping animations and videos inside and out with Walsworth’s exclusive augmented reality Yearbook 3D platform.

Scan cover with

app Leap of Space

R`KP]PUN ^VYSKYLJVYKZI`Z \TNHY[ULYZL[UL^ K\YPUNOPZ +HYLKL]PS-LSP_)H TPSLZWLYOV\Y 3VVRV\[ILSV^ HJOPUNHZWLLKVM PJV Y[OÂťZZ\YMHJLHUKYL SHUKLKPU5L^4L_ TPSLZHIV]L[OL,H TIHSSVVUĂ…PNO[HUK TWLKMYVTHOLSP\ MHSS)H\TNHY[ULYQ\

L HIHTH^VU[O [OL0YPZOHZ(S  5VS\JRMVY [YL+HTL `KLMLH[PUN5V L UH[PVUHS[P[SLI TWPVUZOPWNHT IHSSÂťZ)*:JOH Z PUJVSSLNLMVV[ UMVY`HYK ,KKPL3HJ`YH [OL 9\UUPUNIHJR JOVZLUVULVM ^UHUK^HZ V\JOKV HUKH[  NHTLÂťZ4=7Z

most lar popu

toys

SLHWWHKÂ? NHTPUNJVUZVSL

TVUZ[LYOPNOÂŽKVSSZ

HPYOVNZÂŽYLTV[LJVU[YVSSLK OV]LYHZZH\S[JYHM[

M\YI`ÂŽ

WV^LY^OLLSZÂŽ K\ULYHJLY

SP[[SLWLVWSLÂŽKPZUL`ÂŽ WYPUJLZZZVUNZWHSHJL :V\YJL!*55

PHU[ZKPKP[HNHPU

7OV[V*YLKP[Z! 5L^ZJVT

ceBuzz16size8.indd 16

;OL:HU-YHUJPZJV. LZMVY[OLZLJVUK ^PUUPUN[OL>VYSK:LYP U-YHUJPZJVILH[ [PTLPU[OYLL`LHYZ:H \YZ[YHPNO[NHTLZ [OL+L[YVP[;PNLYZPUMV LOVTLY\UZPU 7HISV:HUKV]HSOP[[OYL U[OLZLYPLZ4VZ[ .HTLHUK^HZJOVZL =HS\HISL7SH`LY

SL*YV^U-VY[OL 1\Z[JHSSOPT4Y;YPW IHZLIHSSWSH`LY Ă„YZ[[PTLPU`LHYZH *YV^U^OLU ^VU[OLIH[[PUN;YPWSL YHSLK[OL(TLYPJHU +L[YVP[ÂťZ4PN\LS*HIYL NLOVTLY\UZ 3LHN\LPUIH[[PUNH]LYH HUK9)0

Scan page with

news entertainment

app

science & tech sports trends

2/25/13 9:19 AM

‹ Through our Partners in Education program with augmented-reality leader Aurasma, we’ll help you embed videos and more on your yearbook pages. ‹ With Walsworth’s Yearbook 3D mobile app, create a custom cover animation that will wow your students. Or watch the year’s news and trends jump off the page in our Year in Review or ceBuzz. To see these animations, download the Yearbook 3D app from the App Store or Google Play, and then scan.

We are the augmented reality experts in yearbook! Visit the Walsworth booth to learn more about the Yearbook 3D platform.

800.972.4968 walsworthyearbooks.com Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 23


University of Iowa Summer Journalism Workshops iowajournalism.com

July 27-Aug. 1, 2014 • Iowa City, Iowa • @iowajournalism • Instagram: iowajournalism For 62 years, the world’s most prestigious writing university has served the country’s best high school journalists. In 2014, we invite you to explore your creativity. Join us for one of 13 dynamic workshops:

Yearbook iPhoneography Editors-in-Chief Photojournalism Broadcast Journalism Advanced News Writers Social Media Revolution Advanced Graphic Design Sports Journalism on Steroids Complete 5-Day Journalism Workout Digital Journalism and Video Storytelling Culture Writing: Food, Fashion & Entertainment Opinion Writing: Editorials, Reviews & Columns

University of Iowa Summer Journalism Workshops 24 — JEA/NSPA Fall 2013 Convention/Boston

iowajournalism.com

Visit jea.org/eval to evaluate sessions


THURSDAY 3-9 p.m. 3 p.m. News Literacy

News literacy project meeting

Students selected for the Journalism Education Association / McCormick Foundation news literacy project will meet at this time to begin work on their projects.

9 p.m. Adviser Event

Adviser kickoff reception

Jesse Sutherland, CJE, Waterford (Mich.) Kettering High School, and Kristofer Doran, Trumbull Career & Technical Center, Warren, Ohio 3 p.m. Thursday, Beacon B, Sheraton (55)

After the keynote speech, all advisers are welcome to attend this reception to socialize with new colleagues and relax with old friends. New and first-time attendee advisers will have a chance to meet the local convention team, plus JEA and NSPA board members and staffs. This event is sponsored by ASNE Youth Journalism Institute. 9-10:30 p.m. Thursday, Fairfax, Sheraton (240)

6:30 p.m.

Regional meet, eat and greet

Evaluation code: 3330

Middle School

Middle madness

Junior high/middle school students, come meet other young journalists. Share your publications. Learn a few tips and tricks for InDesign and Photoshop. There will be games, prizes and, of course, fun.

Adviser Event

JEA invites teachers and advisers to introduce themselves to one of JEA’s seven regional directors during the Thursday kickoff reception.

Look for your region’s numbered table. It’s a great way to network with others in your region and offer suggestions on how JEA can better meet your needs as a journalism teacher. Feel free to stop by briefly even if you are unable to attend for the full length of the reception. Those attending a JEA/NSPA convention for the first time are especially encouraged to stop by, as tips for getting the most from a national convention will be shared if you ask. • Region 1/Northwest — Sandra Coyer, MJE • Region 2/Southwest — Carrie Faust, MJE • Region 3/North Central — Gary Lindsay, MJE • Region 4/South Central — Wayna Polk, MJE • Region 5/Southeast — Brenda Gorsuch, MJE • Region 6/Mid-Atlantic and Great Lakes — Rod Satterthwaite, CJE • Region 7/Northeast — Jane Blystone, MJE 9-10:30 p.m. Thursday, Fairfax, Sheraton (240)

Evaluation code: 3088

Anita Marie Wertz, MJE, Cesar Chavez High School, Stockton, Calif. 6:30 p.m. Thursday, Berkeley, Sheraton (80)

6:45 p.m. Adviser Event

New adviser convention orientation

Advisers attending their first JEA/NSPA convention should consider attending a short orientation meeting to get a general overview and explanation of convention events and how to get the most out of them. Evaluation code: 3282

Bob Bair, MJE, Blair High School, Blair, Neb. 6:45-7:15 p.m. Thursday, Beacon B, Sheraton (55)

7:30 p.m. Event

Opening ceremony/keynote

After an opening ceremony welcoming delegates to Boston, Pulitzer Prize finalist Juliette N. Kayyem will present the keynote address. Evaluation code: 2702

7:30-9 p.m. Thursday, Auditorium, Hynes CC (4,284)

Harborfest Red Coats are just one of hundreds of events during Boston’s annual week-long Fourth of July celebration — Harborfest. (Photo courtesy of Greater Boston Convention & Vistors Bureau) Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 25


friday at a glance ROOM

9 a.m.

10 a.m.

11 a.m.

Back Bay A, Sheraton

Managing the digital workflow

26 things staffs should be doing in 2013-14

Everybody loves a story

Back Bay B, Sheraton

14 by ‘14 — online edition

Get engaged

Advertising pop and pow!

Back Bay C, Sheraton

Dig a little, laugh a little

Ethical challenges in investigative reporting

The new era of health reporting

Back Bay D, Sheraton

5 steps of revision

Laugh responsibly

Yearbook: chronological style

Beacon A, Sheraton

Media advisers and the pursuit of happiness

Introduction to intensive journalistic writing

Defining moments help teach the basics

Beacon B, Sheraton

Advisers make all the difference

Ethics: making the tough calls

Deadline — a not-so-dirty word

Beacon C, Sheraton

Write-off contest: broadcast taping (8:30-11:30 a.m.)

Beacon D, Sheraton

8 a.m.

Beacon E, Sheraton Beacon F, Sheraton

Drop off in-camera feature entries by 11 a.m.

Photography contest judging Videography contest orientation meeting

Write-off contest: broadcast commentary (8:30-11:30 a.m.) At-risk advising: surviving journalism education

Beacon G, Sheraton Beacon H, Sheraton

Drop off videography contest entries by 10 a.m.

Write-off headquarters

In-camera feature (8 a.m.) Broadcast package (8:30 a.m.)

Berkeley, Sheraton

Literary magazine: good, bad and ugly

An internship in high school? It’s possible

Broadcast package editing (9:30 a.m.-noon) Illustrator for beginners

InDesign tips and tricks

Revolutionary Photoshop tools

CommonHealth

Why news literacy matters

Forum on news literacy

JEA state directors meeting

Power words

Magazine covers that rock

(Nearly) free tools for producing multimedia

If you build it, they will come

Journalism beyond newsrooms

Avoiding column chaos

It’s all about packaging

There’s no crying in baseball

Dalton, Sheraton

Loving the adviser role — almost always

I’m the adviser, not the editor!

So you want to teach?

Exeter, Sheraton

Journalism is journalism

From another perspective

Online first: making it work

Fairfax, Sheraton

ISSUE SEMINAR: Privacy in the Internet era: What are the implications for today’s teens (2 hours)

Using Google to manage your publication

Gardner, Sheraton

How to start a broadcast program (2 hours)

Our yearbook’s not worth $50

Clarendon, Sheraton Commonwealth, Sheraton Constitution A, Sheraton Constitution B, Sheraton

JEA general membership meeting

Hampton, Hampton 26 — JEA/NSPA Fall 2013 Convention/Boston

How editing video is like making a pizza

Audience/sound/pacing

Intro to videography

Visit jea.org/eval to evaluate sessions


n Advising/Teaching n Contest n DESIGN n EDITING

Noon

n ENTREPRENUERSHIP n Featured Speaker n General Audience n Law/Ethics

n LEADERSHIP/TEAM BUILDING n Meeting n MULtimedia broadcast n News GATHERING

1 p.m.

n NEWS LITERACY n PhotoJOURNALISM n WEB n WRITING

2:30 p.m.

4 -6 p.m.

Evening

We need your authentic personal voice

New writing for new media

Write-off contest: newspaper layout

Newspaper judging

Tell me no lies

Making ‘real pictures; Getting below the surface

Write-off contest: newsmagazine layout

Color smart Curious, fun traditions keep us strong

Please attend general session in Hynes Convention Center Auditorium

10 quick design fixes The latest from GlobeLab Designating your publication as a public forum

Role and history of media for advisers

Write-off contest: literary magazine illustration

Sharing a byline with the pros

Write-off contest: broadcast taping - 12:30-3:30 p.m. Write-off headquarters

Write-off moderators check in (1-3:30 p.m.)

Write-off headquarters

Broadcast contest judging Write-off contest: on-air reporter (12:30-3:30 p.m.) Building a staff of leaders Turn in broadcast package contest entries by noon

Building a broadcast studio and digital media lab Write-off contest: broadcast newswriting (1-3 p.m.)

Write-off contest: press law and ethics

Advanced InDesign

Beginning Illustrator

CJE/MJE certification testing (3:30-6 p.m.)

Connecting with readers 24/7

When breaking news breaks down: news literacy, social media

Write-off contest: literary magazine layout

Print vs. broadcast

Don’t get schooled by academics

We have a yearbook?

Telling stories on film

Adviser reception and SPLC benefit (8:30-11 p.m.)

The interview

Write-off judges’ dinner and judging (6-11:30 p.m.)

Photography portfolio 2.0

Please attend general session in Hynes Convention Center Auditorium

Journalism across the curriculum in grades K-12

Write-off contest: poetry

State laws protecting student press freedom

Litigate this

Write-off contest: graphic design logo, infographics

Info + Graphics = Infographics

I have to TALK to people?

Write-off contest: advertising

Using social media in the yearbook class

Covering the future

Write-off: sports play-by-play (4 p.m.), short documentary (5 p.m.)

Broadcast judging

Sound design for broadcast

Sit up straight!

Write-off contest: commercial/PSA (4 p.m.), feature story (5 p.m.)

Broadcast judging

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 27


friday at a glance ROOM

8 a.m.

9 a.m.

10 a.m.

11 a.m.

Grand Ballroom, Sheraton Independence East, Sheraton Independence West, Sheraton

Two spreads, five days

Struck a nerve (students)

10 social media tips

How to make a documentary film

How to videotape sequences

Come on in, the videos’ fine

Jefferson, Sheraton

Go hyperlocal

Surviving the first year (as yearbook adviser)

‘Leadia’

Design and graphics for advisers

Managing student media for advisers

Legal and ethical issues for advisers

Liberty B, Sheraton

5 ways to censor-proof your publication

Coverage, content and reporting for advisers

Why short writing works

Liberty C, Sheraton

That’s not plagiarism — or is it?

Open forum on press rights

Sound journalism begins with strong editorial policies

Break with a Pro (9 and 10 a.m.)

Kent, Sheraton

Republic A, Sheraton

Write-off: Online news package orientation meeting

On-site critiques

Republic B, Sheraton

Adviser luncheon The evolution of digital storytelling

Auditorium, Hynes Exhibit Hall C, Hynes Room 207, Hynes

Convention registration/check-in, trade show, Best of Show desk, lost and found, Write-off desk, shirt distribution, on-site critique desk, sign up for computer hands-on sessions (8 a.m.-4 p.m.) Journalism Quiz Bowl qualifying test

Quiz Bowl grading

Room 208, Hynes

Person to person: communication skills for the journalist

A free and healthy student voice

Investigative journalism: It’s time to dig deeper

Room 209, Hynes

Going pro

Great editor = effective leader

Why we need reporters who can count

Room 210, Hynes

JEA Bookstore and Adviser Hospitality (7:30 a.m.-5 p.m.) Rate byline status in JEA’s magazine (10:15-11:30 a.m.)

Room 308, Hynes

Small staffs rock and rule

Ask the lawyer

Creative coaching

Room 309, Hynes

Be an action hero

A good story gets better

Let’s make prom sparkle

Room 310, Hynes

News and feature writing

Writing reviews you can use

Make sports columns count

Room 311, Hynes

Add clout to your yearbook copy

A life in sports

Making the big bucks for your publication

Room 312, Hynes

Arts criticism in an Internet age

Staring at yogurt

Reporter, source or friend?

Room 313, Hynes

How technology is changing sports reporting

Nobody loves me —or my publication

Life Coaching 101

28 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


n Advising/Teaching n Contest n DESIGN n EDITING

Noon

n ENTREPRENUERSHIP n Featured Speaker n General Audience n Law/Ethics

1 p.m.

How to bring your yearbook online

n LEADERSHIP/TEAM BUILDING n Meeting n MULtimedia broadcast n News GATHERING

2:30 p.m.

n NEWS LITERACY n PhotoJOURNALISM n WEB n WRITING

4-6 p.m.

One extraordinary day: Boston Write-off contest: graphic design: art illustration, advertising bombings and social media

Why journalism matters

Broadcast story structure

Write-off: broadcast news story (4 p.m.), sports story (5 p.m.)

Grading for editors

How standards-based grading can improve your advising

Write-off contest: yearbook layout: theme

Are your stories V-I-Able? Associated Press style for advisers

Please attend general session in Hynes Convention Center Auditorium

Grading made easier

Evening

Student dance (9-11:30 p.m.)

Photojournalism for advisers CJE/MJE certification study session

Write-off contest: yearbook layout: inside pages

Who’s covering the school board? You are!

Write-off contest: yearbook layout: cover/endsheets

Write-off contest: online news package posting

Online new package judging

Adviser luncheon (until 12:30 p.m.) General session/keynote Raney Aronson-Rath

Media swap shops 8 and 9 p.m.

Write-off contest: photography (all)

Convention registration/check-in, trade show, Best of Show desk, lost and found, Write-off desk, shirt distribution, on-site critique desk, sign up for computer hands-on sessions (8 a.m.-4 p.m.) Please attend general session in Hynes Convention Center Auditorium

Write-off contest: yearbook copy/caption: sports, clubs Would you click? Content that spreads

Write-off contest: yearbook copy/caption: stu life, acad.

You wrote this job description?

Write-off contest :newspaper editing/headline writing

JEA Bookstore and Adviser Hospitality (7:30 a.m.-5 p.m.) Tracking and increasing your website readership

Dropping the journalistic F-bomb

Write-off contest: editorial cartoon

Four levels of photography

Capturing ‘the shot’: sports photography

Write-off contest: commentary writing

Snooping for word crimes

Write-off contest: review writing

Turn financial woes into wins

Write-off contest: news writing, editorial writing

Make ‘em laugh; make ‘em ccry

Duct tape and high funkadelity

Write-off contest: feature writing

Making the best first impression

LIterary magazine tips from A to Z

Write-off contest: sports writing

Comprehensive sports writing

Twitter: @nhsjc/#nhsjc

Please attend general session in Hynes Convention Center Auditorium

JEA/NSPA Fall 2013 Convention/Boston — 29


write-off contestS Advisers: Check in at the Write-off desk in Exhibit Hall C, Hynes CC, to pick up students’ tickets and to make sure they have their tickets before their contests are scheduled to meet. Online News Package and some broadcast contests need tickets by 8 a.m. Students: Please note the assigned time and room for your contest. Broadcast contests and Online News Package will meet at various times throughout the day Friday. Bring required equipment and supplies, as explained in rules at jea.org, and contest ticket to the assigned room. Room assignments will be confirmed after the Write-off deadline and will be published in the Convention Update with noted room changes from what is published here. Most contests/critiques will last two hours. Note: As of press time, the Write-off deadline had not passed. Some contests may be canceled if there are too few entered. Write-off Desk is open 1-7 p.m. Thursday and 8 a.m.-3 p.m. Friday. Name substitutions must be made by noon Friday. Moderators: Pick up material for contests 1-27, 49 between 1-3:30 p.m. in the Beacon D, Sheraton. Photography Judges: 9 a.m., Beacon E, Sheraton. Write-off Judges’ Dinner/Judging: 6 p.m., Constitution B, Sheraton 01 Newswriting 4 p.m., Room 311, Hynes CC 02 Editorial Writing 4 p.m., Room 311, Hynes CC 03 Feature Writing 4 p.m., Room 312, Hynes CC 04 Sports Writing 4 p.m., Room 313, Hynes CC 05 Review Writing 4 p.m., Room 310, Hynes CC 06 Editorial Cartooning 4 p.m., Room 308, Hynes CC 07 Commentary Writing 4 p.m., Room 309, Hynes CC 08 News Editing/Headline Writing 4 p.m., Room 209, Hynes CC 09 Newspaper Layout (upload) 4 p.m., Back Bay A, Sheraton, stay for critique 10 Newsmagazine Layout (upload) 4 p.m., Back Bay B, Sheraton, stay for critique 11 Advertising 4 p.m., Fairfax, Sheraton 12 Yearbook Copy/Caption: Sports 4 p.m., Room 207, Hynes CC 13 Yearbook Copy/Caption: Academics 4 p.m., Room 208, Hynes CC 14 Yearbook Copy/Caption: Clubs 4 p.m., Room 207, Hynes CC 15 Yearbook Copy/Caption: Student Life 4 p.m., Room 208, Hynes CC 16 Yearbook Layout: Theme (upload) 4 p.m., Jefferson, Sheraton, stay for critique 17 Yearbook Layout: Inside Pages (upload) 4 p.m., Liberty B, Sheraton, stay for critique 18 Yearbook Cover/End Sheets (upload) 4 p.m., Liberty C, Sheraton, stay for critique 19 Literary Magazine Layout (upload) 4 p.m., Clarendon, Sheraton, stay for critique 20 Literary Magazine Poetry 4 p.m., Dalton, Sheraton 21 Literary Magazine Illustration 4 p.m., Beacon A, Sheraton 22 Press Law & Ethics (on-site) 4 p.m., Beacon H, Sheraton 23 Online News Package (on-site) 8 a.m., Republic A, Sheraton; return at 2:30 p.m. to upload to website 24 Graphic Design: Logo (online) 4 p.m., Exeter, Sheraton, stay for critique 25 Graphic Design: Infographics (online) 4 p.m., Exeter, Sheraton, stay for critique 26 Graphic Design: Advertising (online) 4 p.m., Independence East, Sheraton, stay for critique 27 Graphic Design: Photo Illustration (online) 4 p.m., Independence East, Sheraton, stay for critique 28 Yearbook Sports Photography (online) 4 p.m., Auditorium, Hynes CC, stay for critique 29 Newspaper Sports Photography (online) 4 p.m., Auditorium, Hynes CC, stay for critique 30 Yearbook Student Life Photography (online) 4 p.m., Auditorium, Hynes CC, stay for critique 31 Newspaper News/Feature Photography (online) 4 p.m., Auditorium, Hynes CC, stay for critique 32 Photo Story (online) 4 p.m., Auditorium, Hynes CC, stay for critique 33 Photography Portfolio (online) 4 p.m., Auditorium, Hynes CC, stay for critique 34 Photo Portrait (online) 4 p.m., Auditorium, Hynes CC, stay for critique 35 First-year Photo (online) 4 p.m., Auditorium, Hynes CC, stay for critique 36 Broadcast News Story (online) 4 p.m., Independence West, Sheraton, stay for critique 37 Broadcast Sports Story (online) 5 p.m., Independence West, Sheraton, stay for critique 38 Broadcast Feature Story ((online) 5 p.m., Hampton, Sheraton, stay for critique 39 Broadcast Commercial/PSA (online) 4 p.m., Hampton, Sheraton, stay for critique 40 In-Camera Feature (on-site) 8 a.m., Beacon H, Sheraton — Turn in entry at Beacon D by 11 a.m. 41 On-Air Reporter (on-site) 12:30 p.m., Beacon F, Sheraton 42 Broadcast Newswriting (on-site) 1 p.m., Beacon H, Sheraton 43 Broadcast Package (on-site) 8:30 a.m., Beacon H, Sheraton — Turn in entry at Beacon H by noon 44 Videography (on-site) 8 a.m., Beacon F, Sheraton — Turn in entry at Beacon D by 10 a.m. 45 Broadcast Commentary (on-site) 8:30 a.m., Beacon F, Sheraton 46 Short Documentary (online) 5 p.m., Gardner, Sheraton, stay for critique 47 Sports Play-by-Play (online) 4 p.m., Gardner, Sheraton, stay for critique 48 Jr. High/Middle School Newspaper Writing 4 p.m. (refer to categories 01-04 at left for rooms) 49 Jr. High/Middle School Yearbook Writing 4 p.m. (refer to categories 12-15 at left for rooms) 30 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


friday 7:30-8:30 a.m. 7:30 a.m. Event

Publication exchange

Interested in seeing what kind of work other high schools around the nation are producing? Stop by the publication exchange tables to gander at the latest editions of high school news from coast to coast. Feel free to drop off a few copies of your publication. Friday, Exhibit Hall C Foyer Event

JEA Bookstore

Nearly 300 items relating to journalism are available for purchase, including textbooks, curriculum development, yearbook, newspaper, design, photography, writing, desktop publishing, new media, advertising and broadcast. Write-off supplies are available in limited quantities. 7:30 a.m.-5 p.m. Friday, Room 210, Hynes CC Adviser Event

Adviser hospitality

Meet with your colleagues from across the country in the adviser hospitality suite, a hot spot for advisers. Local committee members will be available to recommend sightseeing, dining and entertainment options. Friday morning refreshments are provided by Texas Tech University College of Media and Communication. 7:30 a.m.-5 p.m. Friday, Room 210, Hynes CC

8 a.m.

Meeting

Journalism Education Association members and others interested in the organization are invited to attend this meeting. You’ll learn about recent JEA board action, hear concerns and discuss future plans and goals. A slate of candidates for the February 2014 board election will be announced. Mark Newton, MJE, Mountain Vista High School, Highlands Ranch, Colo. 8 a.m. Friday, Commonwealth, Sheraton (250) Contest

Online news package contest orientation meeting If you registered for this contest, bring your Write-off ticket so you can get your assignment. Read the rules so you’ll know what equipment to bring to prepare your entry. 8 a.m. Friday, Republic A, Sheraton (100)

Videography contest orientation meeting Students who are registered for this contest will meet to get their assignment. You must have your Write-off ticket to be admitted. Check the Write-off rules for the equipment you’ll need. 8 a.m. Friday, Beacon F, Sheraton (55) Contest

In-camera feature contest orientation meeting

Teams registered for this contest must attend to get their assignment. You must have your Write-off ticket to attend. Check the Write-off rules for the equipment you’ll need. 8 a.m. Friday, Beacon H, Sheraton (55)

Twitter: @nhsjc/#nhsjc

In addition to the trade show and convention registration and check-in, you’ll find the Best of Show desk, the lost-and-found area and speaker name badges. 8 a.m.-4 p.m. Friday, Exhibit Hall C, Hynes CC Contest

Write-off contest check-in

Pick up your school’s Write-off packet containing student contest tickets, additional instructions and contest room assignments may be picked up at the Write-off desk. If you have not paid, you must do so at this time. Noon Friday is the deadline for substitutions in preregistered categories. No new entries will be accepted at the convention. Lost tickets will be replaced for $5. 8 a.m. -3 p.m. Friday, Exhibit Hall C, Hynes CC Event

Journalism Quiz Bowl qualifying test

Registered four-person teams will take a written qualifying test at this time. The test scores will be used to seed the top teams that will compete in the live buzzer rounds Saturday morning. The list of qualifying teams will be posted by in the JEA Bookstore, Room 210, Hynes CC, and at the convention registration desk in Exhibit Hall C. Brenda Gorsuch, MJE, West Henderson High School, Hendersonville, N.C., and Marilyn Chapman, CJE, Florence, S.C. 8 a.m. Friday, Room 207, Hynes CC (310)

Contest

Contest

Convention registration/check-in, trade show

Best of Show desk

Student Event

Photography contest judging

JEA Write-off photography judges will meet at this time. Bradley Wilson, MJE, Midwestern State University, Wichita Falls, Texas 8 a.m.-noon Friday, Beacon E, Sheraton (55)

Event

JEA general membership meeting

Let us know how we’re doing. Visit jea.org/eval and tell us what you think. We want to know how helpful the sessions are during the JEA/NSPA Fall National High School Journalism Convention. For each session listed in this program, you’ll find an evaluation code listed under the session description. Please visit jea.org/eval on your computer or Web-enabled mobile device, enter that code and provide some feedback for each of the events you attend.

Enter your newspaper, newsmagazine, literary arts magazine, broadcast, website or yearbook at the Best of Show desk. Winners will be announced at the NSPA Awards Ceremony on Saturday. 8 a.m.-4 p.m. Friday, Exhibit Hall C, Hynes CC Event

Computer session signup

If you would like to attend hands-on computer sessions Friday and Saturday in the computer lab, sign up here and get a ticket. Limit two per school per session. Only those with tickets may sit at a shared computer. 8 a.m.-4 p.m. Friday, Exhibit Hall C, Hynes CC Event

Convention shirt distribution

Pick up your pre-ordered shirts here. The local committee may offer a limited quantity of extra shirts for sale. 8 a.m.-4 p.m. Friday, Exhibit Hall C, Hynes CC

8:30 a.m. Contest

Write-off contest: broadcast commentary

Those entered in the Broadcast Commentary will meet here to write and get a time for taping their commentary. 8:30 a.m. Friday, Beacon F, Sheraton (55) Contest

Broadcast package contest meeting

Students entered in this contest will meet. You must have your contest ticket and equipment as stated in the rules. 8:30 a.m. Friday, Beacon H, Sheraton (55)

JEA/NSPA Fall 2013 Convention/Boston — 31


HIgH SCHool JUNIorS: APPly NoW!

Al Neuharth Free Spirit and Journalism Conference June 21-26, 2014 Each summer, 51 rising high school seniors experience an extraordinary five-day, all-expenses-paid trip to Washington, D.C., as participants in the Al Neuharth Free Spirit and Journalism Conference, a program of the Newseum Institute. The conference promotes the vital role of the First Amendment as a cornerstone of democracy and inspires students to pursue journalism careers. Boys and girls from each U.S. state and the District of Columbia participate in a variety of learning experiences at the Newseum and elsewhere in Washington focusing on the three branches of government and how journalists cover them.

HIgH SCHool JUNIorS: APPly NoW For NExT yEAr’S CoNFErENCE! Deadline is Feb. 1, 2014. Visit freespirit.org for more information and to apply online.

Free Spirit 555 Pennsylvania Ave., N.W., Washington, DC 20001 202/292-6100 freespirit.org n

32 — JEA/NSPA Fall 2013 Convention/Boston

n

n

Visit jea.org/eval to evaluate sessions


friday 9 a.m. 9 a.m. Web

Managing the digital workflow online

Just as you begin to feel comfortable and organized with print, the digital revolution comes in throws everything off. This session will help you pick up the pieces of your broken workflow and turn into something that is bigger, better and more efficient. Evaluation code: 3430

Aaron Manfull, MJE, Francis Howell North High School, St. Charles, Mo. 9 a.m. Friday, Back Bay A, Sheraton (250) Web

14 in ‘14 — online edition

Fourteen things today’s online news staff should think about and do for 2014 (or before). Evaluation code: 3427

Logan Aimone, MJE, School Newspapers Online, Burnsville, Minn. 9 a.m. Friday, Back Bay B, Sheraton (250) Writing

Dig a little, laugh a little

In this feature writing session, be prepared to laugh and be prepared to shed a tear as you learn how to grab the reader by playing on their emotions. Learn how to dig for those anecdotal quotes that tell great stories. Evaluation code: 3288

H.L. Hall, MJE, Nashville, Tenn., and Kathy Craghead, MJE, Mexico, Mo. 9 a.m. Friday, Back Bay C, Sheraton (340) Editing

5 steps of revision

Feedback leads a student through the editing process to create a stronger piece, but the load of grading can interfere with the efficiency. These five steps of revision keep feedback immediate and monitored. We’ll go through the process step by step. Evaluation code: 2200

Lori Oglesbee, MJE, McKinney (Texas) High School 9 a.m. Friday, Back Bay D, Sheraton (225) Advising/Teaching

Media advisers and the pursuit of happiness Some thoughts on why we do what we do and how we can enjoy it for years to come. You might think of this as a therapy session in which we can talk about great teaching and coaching while challenging ourselves to become even better mentors to our students and peers. Evaluation code: 3307

Jack Kennedy, MJE, Colorado High School Press Association, Highlands Ranch, Colo. 9 a.m. Friday, Beacon A, Sheraton (60)

Twitter: @nhsjc/#nhsjc

Advising/Teaching

Meeting

Advisers make all the difference

JEA state directors meeting

If your yearbook/newspaper program is struggling, maybe it’s time to look up close and personal. Discover how changing just a few things can turn that struggle around.

All JEA state directors should attend this meeting to learn about upcoming events and get helpful hints on how to make others aware of the organization at the state level. Sarah Nichols, MJE, Whitney High School, Rocklin, Calif. 9 a.m. Friday, Commonwealth, Sheraton (250)

Evaluation code: 3277

Pam True Szaro, Herff Jones, Delray Beach, Fla. 9 a.m. Friday, Beacon B, Sheraton (55)

Web

(Nearly) free tools for producing multimedia

Advising/Teaching

At-risk advising: surviving journalism education

Creating dynamic, engaging multimedia packages doesn’t require a huge budget or a lot of technical knowledge. Learn how to use multimedia well, no matter your budget.

Evaluation code: 3475

Michelle Johnson, Boston University, Boston 9 a.m. Friday, Constitution A, Sheraton (300)

Stressed? Overworked? Join us for a discussion of the factors that lead to burnout and how to avoid them — for yourself and your peers. Steve O’Donoghue, California Scholastic Journalism Initiative, Sacramento, Calif. 9 a.m. Friday, Beacon G, Sheraton (55) Design

Illustrator for beginners

Get the most of your Creative Suite by incorporating Adobe Illustrator in your designs. Learn how to use the basic tools in the program to manipulate fonts and create vector images. The course will offer basic drawing techniques and practice. (Sign up and get ticket at the registration desk. Limit 36.) Evaluation code: 3536

Monica B. Rodriguez, Gulliver Preparatory School, Pinecrest, Fla. 9 a.m. Friday, Berkeley, Sheraton (80)

If you are a newspaper columnist, chances are you have struggled with an idea on deadline. This session, conducted by a former newspaper reporter who wrote more than 1,500 columns, will put many useful ideas into your collection of topics. Evaluation code: 3339

Mike Doyle, CJE, Belvidere North High School, Belvidere, Ill. 9 a.m. Friday, Constitution B, Sheraton (300) Advising/Teaching

WBUR’s CommonHealth blog aims to be the “go-to source for news, conversation and smart analysis” on health care and medical research. Host Carey Goldberg explains how they do it and how you can write health and medical stories for your own publications. Evaluation code: 3377

Writing

Avoiding column chaos

Loving the adviser role — almost always

News Gathering

CommonHealth

Evaluation code: 3405

In 33 years of advising high school newspapers, this adviser has dealt with almost every obstacle education has to offer. And the challenges keep coming. Attend this session to give you ideas on loving your job. Evaluation code: 3373

Janet Levin, MJE, John Hersey High School, Arlington Heights, Ill. 9 a.m. Friday, Dalton, Sheraton (50)

Carey Goldberg, WBUR, Boston 9 a.m. Friday, Clarendon, Sheraton (50)

‘Get certified’ sessions help prepare advisers FRIDAY Design and graphics for advisers — 9 a.m., Kent, Sheraton Managing student media for advisers —10 a.m., Kent, Sheraton Coverage, content and reporting for advisers — 10 a.m., Liberty B, Sheraton Legal and ethical issues for advisers — 11 a.m., Kent, Sheraton Role and history of media for advisers — noon, Kent, Sheraton Associated Press style for advisers — noon, Liberty B, Sheraton Photojournalism for advisers — 2:30 p.m., Kent, Sheraton SATURDAY Why consider JEA certification? — 9 a.m., Liberty B, Sheraton Presentation of MJE projects for advisers — 10 a.m., Liberty B, Sheraton MJE: Yes, you can! — 11 a.m., Liberty B, Sheraton

JEA/NSPA Fall 2013 Convention/Boston — 33


You don’t do things like you did in the ’70s.

Summer 1978

Summer workshops shouldn’t either.

Ball State: Redefining the workshop experience. Ball State University Journalism Workshops presents

2014 Summer Media Academy July 13-16 & 17-20

SFOFXFEDVSSJDVMVNtSFEVDFEDPTUTtOFXEBZTDIFEVMF DPMMBCPSBUJWFDMBTTFTtTUBòGPDVTFEtMFBEFSTIJQESJWFO OBUJPOBMBXBSEXJOOJOHGBDVMUZtUFBNUBVHIUt TQFDJBMCSFBLPVUTFTTJPOT

For more information, visit our booth or www.bsujournalismworkshops.com

34 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


friday 9 a.m. Leadership and Team Building

Multimedia Broadcast

Law and Ethics

Journalism is journalism

How editing video is like making a pizza

Evaluation code: 2488

Matt Rasgorshek, Westside High School, Omaha, Neb. 9 a.m. Friday, Hampton, Sheraton (110)

Why are we still working against each other? Yearbook and newspaper can be friends. Figure out how to brand your publications as the go-to place for information. In this session, you’ll learn to share photos, use social media and advertise as a media network. Rachel McCarver, MJE, Columbus (Ind.) North High School, and Nicole Wilson, MJE, Carmel (Ind.) High School 9 a.m. Friday, Exeter, Sheraton (50) ISSUE SEMINAR, GENERAL AUDIENCE

Privacy in the Internet era: What are the implications for today’s teens? (2 hours)

The sheer volume of life that is conducted online requires that those who grow up in the Internet age lose a certain amount of privacy. From Facebook and Instagram to government data mining, corporations and government agencies have unprecedented access to our private information – and, in many cases, they’ve used it to make our lives more convenient and efficient. How much of a problem is this surrender of privacy? How could student journalists write stories about these issues to help their readers understand them? A panel of experts will explore the implications of these questions. Evaluation code: 3454

César Hidalgo, MIT Media Lab, Cambridge, Mass., and Josh Golin, Campaign for Commercial-free Childhood, Boston 9 a.m. Friday, Fairfax, Sheraton (240) Multimedia Broadcast

How to start a broadcast program (2 hours)

For advisers and students who don’t know where to start, or for those wanting to grow their broadcast program, this session will cover the necessary class goals, organization, video equipment and budget to help your program succeed with broadcast journalism.

It’s all fine and good that you shot some great stuff and your writing is solid, but how do you put it all together in the editing room? It’s like making a pizza. Evaluation code: 3371

Student Event

Break with a Pro

Kick off your morning with tailored, small-group discussion sessions with journalism professionals in traditional and specialized areas. Media professionals will share information about their work and backgrounds. Preregistration was required. Please check ticket for your assigned time. 9 and 10 a.m. Friday, Grand Ballroom, Sheraton (1,100)

Twitter: @nhsjc/#nhsjc

It’s great to win a fight for your First Amendment rights, but even better to prevent a conflict. Practical tips for making your student medium censor-resistant and for surviving a censorship confrontation if you must. Bring your own “survival” stories to share. Evaluation code: 2801

Frank LoMonte, Student Press Law Center, Arlington, Va. 9 a.m. Friday, Liberty B, Sheraton (60)

News Gathering

Two spreads, five days

Creating yearbook spreads does not have to be an endless process. Check out a way to keep everyone actively involved in the process and manage spreads, not deadlines. Evaluation code: 3471

Larry Steinmetz, CJE, Bullitt East High School, Mount Washington, Ky. 9 a.m. Friday, Independence East, Sheraton (120) Multimedia Broadcast

How to make a documentary film

Law and Ethics

That’s not plagiarism — or is it?

The Internet provides journalists with tons of information, along with substantial legal and ethical dilemmas. Learn what you can use from the Web and how attribution is often the key. This session also will cover how organizations are cracking down on plagiarism in contests. Evaluation code: 2018

Learn the basic steps to produce a high school documentary film on a limited budget. Filmmaker Preston Randolph will outline the essentials with tips that have helped him in his career, including where to find a story and how to bring it to life on film.

Candace Perkins Bowen, MJE, Kent (Ohio) State University 9 a.m. Friday, Liberty C, Sheraton (60)

Evaluation code: 3338

Advisers and staffs who submitted publications or videos for a critique will meet at an assigned time with an evaluator. Since critiques are only 30 minutes, it is important for everyone to be on time. 9 a.m.-1 p.m. Friday, Republic A, Sheraton (100)

Mike Riley, Cody (Wyo.) High School, and Preston Randolph, Cactus Productions, Cody, Wyo. 9 a.m. Friday, Independence West, Sheraton (220) Entrepreneurship

Go hyperlocal

See how students produce content for the Boston University News Service, which is then picked up by professional publications such as The Boston Globe and Patch.com. Learn how you can write for these websites and how your publication can form hyperlocal partnerships. Evaluation code: 3397

Fred Bayles, Boston University, Boston 9 a.m. Friday, Jefferson, Sheraton (50)

Evaluation code: 3310

Don Goble, Ladue Horton Watkins High School, St. Louis, Mo. 9 a.m. Friday, Gardner, Sheraton (120)

5 ways to censor-proof your publication

Advising/Teaching

News Gathering

Person to person: communication skills for the journalist

Great interviews aren’t just about asking inspired questions. To get the real story, you have to communicate effectively, focusing on accuracy and establishing a solid relationship. Learn the basic communication skills that doctors, lawyers and therapists use to quickly establish in-depth connections. Evaluation code: 2252

Design and graphics for advisers

Whether you’re planning to take the CJE exam or just want to learn more about principles of design and graphic elements, this session is for you. Learn about contrast, emphasis, rhythm, balance, proportion, direction and unity with contemporary examples from a variety of media. We’ll also cover strategies for how to teach these concepts to your students. Evaluation code: 2292

Event

On-site critiques

Brian Hayes, MJE, Ball State University, Muncie, Ind. 9 a.m. Friday, Kent, Sheraton (40)

Tom Sivertsen, Redwood High School, Larkspur, Calif. 9 a.m. Friday, Room 208, Hynes CC (310) News Gathering

Going pro

Ventura’s High School Insider blog for the Boston Herald was the first of its kind in Massachusetts and remains the go-to high school site in the region. He explains how the pros cover high school sports and what you can learn from them. Evaluation code: 3395

Danny Ventura, Boston Herald, Boston 9 a.m. Friday, Room 209, Hynes CC (134)

JEA/NSPA Fall 2013 Convention/Boston — 35


friday 9-10 a.m. Photojournalism

Be an action hero

“With great power comes great responsibility.” You may not be Spider-Man, but that press pass does give you the power and the responsibility to capture images that transform your publications’ pages. Channel your inner Peter Parker as we reveal the secrets of taking compelling action photos while on assignment. Step out from behind that shadow and assume your true identity. Evaluation code: 2155

Cindy Todd, and Deanne Brown, Westlake High School, Austin, Texas 9 a.m. Friday, Room 309, Hynes CC (304) Writing

Contest

Broadcast package contest

Students will work on editing their entries. 9:30 a.m.-noon Friday, Beacon H, Sheraton (55)

10 a.m. Photojournalism

The evolution of digital storytelling

Bill Greene, the director of photography at The Boston Globe, describes the evolution of a still photographer into multimedia. In an everchanging world where there are increasing tools in the photojournalist’s arsenal, he shows how to enhance your ability to tell stories. Evaluation code: 3362

News and feature writing

Bill Greene, The Boston Globe 10 a.m. Friday, Auditorium, Hynes CC (3,084)

Evaluation code: 3351

26 things staffs should be doing in 2013-14

This session covers the fundamentals of writing accurate, clear, concise news and feature stories. Helen Smith, New England Scholastic Press Association, Boston 9 a.m. Friday, Room 310, Hynes CC (270) Writing

Add clout to your yearbook copy

If your copy makes everyone other than your grandma yawn, if you’re bored with it yourself, if you say, “Nobody reads it anyway,” come to this session where a veteran adviser will entice you to change your angle and wording to make the copy sparkle. Evaluation code: 3252

Mary Kay Downes, MJE, Chantilly (Va.) High School 9 a.m. Friday, Room 311, Hynes CC (435) Writing

Arts criticism in the Internet age

Pulitzer Prize-winning critic Mark Feeney covers photography, film and the arts for The Boston Globe. He will discuss the relationship between journalism and culture – and how the relationship between the two has, and hasn’t, changed in the age of the Internet. Evaluation code: 3357

Mark Feeney, The Boston Globe 9 a.m. Friday, Room 312, Hynes CC (500) Web

How technology is changing sports reporting

Media convergence has affected every aspect of the media landscape, and sports coverage is no exception. ESPN Boston’s Scott Barboza explains what tools you need to get started in this brave new world.

General Audience

In scholastic journalism programs today, it can’t be business as usual. While we need the strong traditional foundation, we can’t be content with sitting back and doing things as we’ve always done them. We need to rethink, reimagine and be proactive.

WRITING

Laugh responsibly

Real Southern women shouldn’t laugh out loud my mother reminds me. She’s not here, and if you promise not to tell her, we’ll laugh out loud as we examine satire and how to use it in your publication. Evaluation code: 2201

Lori Oglesbee, MJE, McKinney (Texas) High School 10 a.m. Friday, Back Bay D, Sheraton (225) Advising/Teaching

Introduction to intensive journalistic writing

Strengthen your school’s English and journalism programs by incorporating journalism models and approaches into your English class. The Intensive Journalistic Approach (approved through the Advanced Placement Audit) brings real experience into the academic setting. Meet with an IJW leader who will share activities and answer questions. Evaluation code: 3328

Carol Lange, CJE, Reston, Va. 10 a.m. Friday, Beacon A, Sheraton (60) Law and Ethics

Ethics: making the tough calls

Entrepreneurship

Plenty has been written about journalism ethics, but it is easier said than done. Journalists constantly find themselves in situations in which ethical behavior requires a lot of discipline and courage. This session will focus on those tough situations and how to handle them ethically.

The goal with online news isn’t just readers, it’s engagement. Discover what makes readers engage online and what you can do to increase engagement with your audience.

Joe Mirando, MJE, Kelsey Humble and Caroline Patrickis, Southeastern Louisiana University Hammond, La. 10 a.m. Friday, Beacon B, Sheraton (55)

Evaluation code: 3429

Aaron Manfull, MJE, Francis Howell North High School, St. Charles, Mo. 10 a.m. Friday, Back Bay A, Sheraton (250)

Get engaged

Evaluation code: 3298

Evaluation code: 3426

Logan Aimone, MJE, School Newspapers Online, Burnsville, Minn. 10 a.m. Friday, Back Bay B, Sheraton (250) News Gathering

Ethical challenges in investigative reporting

Is it ever acceptable to lie in the pursuit of a story? What’s the line between dogged reporting and violating someone’s privacy? Investigative reporting presents unique ethical challenges. This session will offer you a framework for ethical decision-making. Evaluation code: 3285

Joseph Bergantino, New England Center for Investigative Reporting, Boston 10 a.m. Friday, Back Bay C, Sheraton (340)

Evaluation code: 3417

Scott Barboza, ESPNBoston.com, Boston 9 a.m. Friday, Room 313, Hynes CC (227)

36 — JEA/NSPA Fall 2013 Convention/Boston

Writing

Literary magazine: Good, bad and ugly

This session addresses the complicated world of publishing a literary magazine. THE GOOD: Literary magazine provides an outlet for expression and creativity. THE BAD: Sometimes a publication class with deadlines and technical difficulties leads to many headaches. THE UGLY: Fundraising. Evaluation code: 3502

Renee Quaife, Sparkman High School, Harvest, Ala. 10 a.m. Friday, Beacon G, Sheraton (55) Design

InDesign tips and tricks

Learn how to be more creative and productive with InDesign software. (Sign up and get ticket at the registration area. Limit 36.) Evaluation code: 3085

Linda Drake, MJE, Chase County Junior-Senior High School, Cottonwood Falls, Kan. 10 a.m. Friday, Berkeley, Sheraton (80)

Visit jea.org/eval to evaluate sessions


friday 10 a.m. News Literacy

Web

Advising/Teaching

Why news literacy matters

If you build it, they will come

Evaluation code: 3365

Evelyn Lauer, CJE, Niles West High School, Skokie, Ill. 10 a.m. Friday, Clarendon, Sheraton (50)

Chris Waugaman, MJE, Prince George (Va.) High School 10 a.m. Friday, Constitution A, Sheraton (300)

Jon Reese, CJE, Decatur (Ga.) High School 10 a.m. Friday, Dalton, Sheraton (50)

Writing

Design

From another perspective

This session, made possible through a grant from the Robert R. McCormick Foundation, will cover the basic fundamentals of news literacy and explain why — and how — it should/ can be taught in your journalism (or English!) classroom. Specific lesson plans and class activities will be presented.

Sports fans want to see and hear highlights of their favorite teams right now. Broadcasting sports is now an essential element to your journalism coverage. Learn how to use video, audio, online and social media strategies for sports. Make the Web your “field of dreams.” Evaluation code: 3261

I’m the adviser, not the editor!

Come learn ways to create and maintain a strong editorial board. Your staff members should be making the important decisions, and a good editorial board facilitates that. We’ll share strategies for organizing your editors into a cohesive team of publication managers. Evaluation code: 2112

Leadership and Team Building

Power words

Unlock the secrets that will give you the power to create unforgettable images by discovering how to use compelling words and employing the mysterious elements of writing. You will then know how to capture the essence of people and events making them memorable in the copy you write. Evaluation code: 3480

Linda Ballew, MJE, Great Falls (Mont.) High School 10 a.m. Friday, Commonwealth, Sheraton (250)

It’s all about packaging

Mods, sidebars, collections are all names used in creating some sort of a package that will enhance a spread and drive readership and coverage. Find out what’s hot and when to use these special packages in your 2014 publication. Evaluation code: 3286

Martha Akers, Loudoun Valley High School, Purcellville, Va., and Mike Taylor, Walsworth Publishing Co., Mansfield, Texas 10 a.m. Friday, Constitution B, Sheraton (300)

Do you ever wonder how everyone else seems to have so much less (or more) work than you? Surprise — they don’t! Come prepared for interaction and a chance to get a taste of how “the other half” feels, works and leads. Evaluation code: 2487

Rachel McCarver, MJE, Columbus (Ind.) North High School, and Nicole Wilson, MJE, Carmel (Ind.) High School 10 a.m. Friday, Exeter, Sheraton (50)

DISCOVER New England Center for Investigative Reporting

Summer Investigative Journalism Workshop Set yourself apart by learning investigative

reporting at Boston University this summer. Learn from award-winning journalists and BU staff. Don’t wait, apply today!

Visit http://necir-bu.org/summer

Boston University is an equal opportunity, affirmative action institution.

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 37


friday 10 a.m. Multimedia Broadcast

Audience/sound/pacing

Three seemingly unrelated elements that can make your show so much better and give your stories more impact. Come see what we are talking about in this session designed for broadcast journalism students and teachers. Evaluation code: 3319

Dave Davis, Hillcrest High School, Springfield, Mo. 10 a.m. Friday, Hampton, Sheraton (110) General Audience

Struck a nerve (students)

We have compiled a list of things that bug us about student publications. Come see if you are guilty of any journalistic sins, and we will help you change your ways. Possible topics include using clichés, editorializing, using copyrighted photos, bad cutouts ... the possibilities are endless! Evaluation code: 3096

Kathy Habiger, MJE, Mill Valley High School, Shawnee, Kan., and Amy Morgan, MJE, Shawnee Mission West High School, Overland Park, Kan. 10 a.m. Friday, Independence East, Sheraton (120) Multimedia Broadcast

How to videotape sequences

Learn how to plan your story to tape it with interesting sequences: wide, medium and tight; low, eye-level and high angles; and timereducing cutaways to make editing easier and visually compelling. Evaluation code: 3337

Mike Riley, Cody (Wyo.) High School, and Preston Randolph, Cactus Productions, Cody, Wyo. 10 a.m. Friday, Independence West, Sheraton (220) Advising/Teaching

Surviving the first year as a yearbook adviser

You will leave this session with ideas to use Monday in class to improve your publication. Whether you are struggling with staff organization, time management, meeting deadlines, understanding the yearbook publication process or how to manage your digital photos. So much to share! Evaluation code: 3382

Francesca Branson, James Madison High School, Vienna, Va. 10 a.m. Friday, Jefferson, Sheraton (50) Advising/Teaching

Managing student media for advisers

Thinking about taking the CJE exam? This session is for anyone who wants to learn more about managing student media. Advisers not taking the CJE exam also are welcome. Online/ digital resources will be made available. Evaluation code: 2223

Jane Blystone, MJE, Mercyhurst University, Erie, Pa. 10 a.m. Friday, Kent, Sheraton (40)

Advising/Teaching

Coverage, content and reporting for advisers

This is a “Get Certified!” session helpful to those studying for the CJE exam but open to all advisers wanting to become more familiar with coverage, content and reporting issues in student media. Whether it’s learning how to improve coverage in your school, fine-tuning the content in your publications or improving the writing process, come find out what’s essential and how you can teach it. Evaluation code: 3296

Lizabeth Walsh, MJE, Reno (Nev.) High School 10 a.m. Friday, Liberty B, Sheraton (60) Law and Ethics

Open forum on press rights

Members of JEA’s Scholastic Press Rights Commission will field questions and discuss issues with students and advisers on everything from print press rights to those on the Internet. Evaluation code: 2019

John Bowen, MJE, Kent (Ohio) State University 10 a.m. Friday, Liberty C, Sheraton (60) General Audience

A free and healthy student voice

In 1978, California became the first state to protect students’ right to free speech and press, and other states followed. Why? They knew what you know: Allowing youth to practice their constitutional rights builds adults who value those rights. Focus: How to make the argument for a free press in your school and community. Evaluation code: 2248

Tom Sivertsen, Redwood High School, Larkspur, Calif. 10 a.m. Friday, Room 208, Hynes CC (310)

Law and Ethics

Ask the lawyer

Why pay an attorney $350/hour when a Student Press Law Center lawyer is available to provide help with your media law questions at this session (or anytime at www.splc.org) for free? This informal session is a good chance to talk about anything media law-related that’s been on your mind (censorship, copyright, libel, privacy, freedom of information law, etc.) Evaluation code: 3494

Mike Hiestand, Zenger Consulting, Ferndale, Wash. 10 a.m. Friday, Room 308, Hynes CC (103) Writing

A good story gets better

Why settle for average when your story can be great? No one wants to read an average story. Let’s talk what it takes to get a great story that everyone (including students) will want to read. Evaluation code: 3304

Jeanne Acton, UIL, University of Texas, Austin, Texas 10 a.m. Friday, Room 309, Hynes CC (304) Writing

Writing reviews you can use

This presentation will focus on pop culture reviews (film, TV, music, video games), school reviews (theater, dance, music) and local options (restaurants). This session will examine what a school newspaper should review and how to write interesting, useful critiques. Evaluation code: 3447

David Nathan, St. John’s School, Houston, Texas 10 a.m. Friday, Room 310, Hynes CC (270) Writing

A life in sports

Great editor = effective leader

Bob Ryan is a retired columnist for the Globe’s Sports section whose work appears in the section semi-regularly. He has been writing for the Globe since 1968, covering all of Boston’s sports teams. Ryan is a regular panelist on ESPN’s Sunday morning roundtable, “The Sports Reporters.”

Evaluation code: 3332

Bob Ryan, The Boston Globe 10 a.m. Friday, Room 311, Hynes CC (435)

Advising/Teaching

Staring at yogurt

Leadership and Team Building

Great editors must be great leaders. Get ideas and methods for leading your staffs. Learn how to motivate your staff to work for a common goal and avoid common pitfalls. Dan Mueller, Herff Jones, St. Louis, Mo. 10 a.m. Friday, Room 209, Hynes CC (134)

Evaluation code: 3403

News Gathering

Small staffs rock and rule

Have a small staff? Need to have one staff produce multiple publications without going crazy? Learn how the award-winning staff at Francis Howell High School manages to do it all, including meeting deadlines and hitting high targets with as few as 13 staff members. Evaluation code: 3472

We don’t play games in big-time high school journalism. Well, we do, and we’re pretty good at them. But they’re a waste of time if we’re not publishing/broadcasting stuff that matters. And doing it now. Evaluation code: 3284

Scott Winter, University of Nebraska-Lincoln, Neb. 10 a.m. Friday, Room 312, Hynes CC (500)

Michele Dunaway, MJE, and Alex Martin, Francis Howell High School, St. Charles, Mo. 10 a.m. Friday, Room 308, Hynes CC (103)

38 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


© RACHEL ETTER

INSPIRING VISUAL ARTISTS SINCE 1945 BACHELOR OF FINE ARTS FILM BACHELOR OF SCIENCE VISUAL JOURNALISM BACHELOR OF FINE ARTS GRAPHIC DESIGN BACHELOR OF FINE ARTS PROFESSIONAL PHOTOGRAPHY MASTER OF FINE ARTS PHOTOGRAPHY

Ventura, CA

brooks.edu Brooks Institute cannot guarantee employment or salary. Find disclosures on graduation rates, student financial obligations and more at www.brooks.edu/disclosures. REQ0522814 07/13

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 39


friday 10-11 a.m. General Audience

Nobody loves me — or my publication

Feeling down in the dumps? Not appreciated? Devalued by administration, colleagues and your own staff? Perk up and straighten your spine? YOU are wonderful, and so is your publication. Learn strategies to promote yourself and your work so that glory will be yours.

News Gathering

The new era of health reporting

The session will focus on ways students can access information about health care providers and trends, in an age of more government transparency and disclosure, and turn that information into stories that bring issues home to readers. Evaluation code: 3407

Photojournalism

Revolutionary Photoshop tools

These 10 virtually unknown features of Photoshop will save you hours, produce more consistent results and make you look like a genius. Both beginners and experts will learn something new. You will leave with powerful tools to make your Photoshop life much easier. Evaluation code: 3196

Evaluation code: 3253

Lisa Chedekel, Connecticut Health I-Team, New Haven, Conn. 11 a.m. Friday, Back Bay C, Sheraton (340)

Brynda Everman, Balfour Yearbooks, Azusa, Calif. 11 a.m. Friday, Berkeley, Sheraton (80)

10:15 a.m.

News Gathering

Forum on news literacy

Mary Kay Downes, MJE, Chantilly (Va.) High School 10 a.m. Friday, Room 313, Hynes CC (227)

News Literacy

Advising/Teaching

Rate byline status in JEA’s magazine

Sail your Yankee clipper to byline status in Communication: Journalism Education Today. Meet and munch with the assistant editor in the Advisers Hospitality Suite 10:15-11:30 a.m. As a writing captain, post future winds with inspired insights. Steer the way to journalistic excellence with a volunteer spirit. Evaluation code: 3306

Howard Spanogle, Asheville, N.C. 10:15 a.m. Friday, Room 210, Hynes CC (462)

Yearbook: chronological-style

Is your yearbook organized chronologically? Or are you thinking about changing your book to chronological order? We’ll look at organization strategies for the staff with rolling due date for assignments and maestro teams who work in three-week rotation cycles. Evaluation code: 3343

Mark Novom, Brentwood School, Los Angeles 11 a.m. Friday, Back Bay D, Sheraton (225) Advising/Teaching

Defining moments help teach the basics

Contest

This teaching unit for advisers incorporates the basics of interviewing, telling a story through quotes, following directions, especially in attention to details, style and editing, composing on the computer, use of sidebars and much more.

Deadline for turning in entries for In-camera feature contest is 11 a.m. 11 a.m. Friday, Beacon D, Sheraton (55)

Karen Flowers, CJE, University of South Carolina, Columbia, S.C. 11 a.m. Friday, Beacon A, Sheraton (60)

11 a.m. In-camera feature contest entry dropoff

Writing

Everybody loves a story

... and we need to find ways to tell them to diverse readers. Genuine curiosity about your community can lead to sharing the fascinating moments that make readers laugh and cry. It all starts with great reporting. Evaluation code: 3316

Jack Kennedy, MJE, Colorado High School Press Association, Highlands Ranch, Colo. 11 a.m. Friday, Back Bay A, Sheraton (250) Entrepreneurship

Advertising pop and pow!

Step into the real world of advertising and learn amazing techniques to double your ad sales. Then see easy new designs to make your ads pop off the page. Your advertisers will love you and will keep coming back. Evaluation code: 3192

Beth Fitts, MJE, Oxford, Miss. 11 a.m. Friday, Back Bay B, Sheraton (250)

Evaluation code: 2307

News literacy is a trendy topic that fits perfectly within journalism classrooms and Common Core State Standards. Whether you have already incorporated the subject into your teaching or are looking to get started, come get your questions answered about this essential critical thinking skill. This session is made possible through a grant from the Robert R. McCormick Foundation. Evaluation code: 3367

Evelyn Lauer, CJE, Niles West High School, Skokie, Ill. 11 a.m. Friday, Clarendon, Sheraton (50) Design

Magazine covers that rock

If the cover of your magazine leaves readers cold, chances are they will never see the terrific editorial/graphic design inside. We’ll look at great (and not so great) cover designs and talk about ways to make the cover a priority, not an afterthought. Evaluation code: 2871

Lori Blachford, Drake University, Des Moines, Iowa 11 a.m. Friday, Commonwealth, Sheraton (250)

Leadership and Team Building

Deadline — a not-so-dirty word

Learn several easy tips on how to make your deadlines less painful and easier to manage. Time will be provided for questions and answers. Evaluation code: 2467

Lori Keekley, MJE, St. Louis Park (Minn.) High School 11 a.m. Friday, Beacon B, Sheraton (55)

General Audience

Journalism beyond newsrooms

Broadcast and print newsrooms have not connected with younger generations. A decorated broadcast and multimedia journalist shows students how to do good journalism that speaks to their generation and not their grandparents’. Evaluation code: 3402

Leadership and Team Building

An internship in high school? It’s possible.

Learn how to secure the right internship, outshine your colleagues and be the indispensable journalist that every newsroom needs. If a journalism career is your goal, it’s not too early to get the internship experience. Evaluation code: 3522

Alexa Pence, duPont Manual High School, Louisville, Ky. 11 a.m. Friday, Beacon G, Sheraton (55)

Paul Niwa, Emerson College, Boston 11 a.m. Friday, Constitution A, Sheraton (300) Writing

There’s no crying in baseball!

Is your sports section full of boring game recaps that mean very little to your readers? Come discover how to bring emotion, impact and passion to great sports writing. You are guaranteed to leave inspired. And, yes, there may be some crying. Evaluation code: 3260

Chris Waugaman, MJE, Prince George (Va.) High School 11 a.m. Friday, Constitution B, Sheraton (300)

40 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


friday 11 a.m. Advising/Teaching

So you want to teach?

You will never have to work a day in your life! Being a high school journalism teacher is demanding, but probably the most rewarding experience you will ever have. Come to this session to learn more about how to join the journalism teaching ranks.

Law and Ethics

Entrepreneurship

10 social media tips

This session will go over 10 simple tips to help build your publication’s social media presence. Evaluation code: 3406

Beth Phillips, Francis Howell North High School, St. Charles, Mo. 11 a.m. Friday, Independence East, Sheraton (120)

Web

Online first: making it work

Learn to organize your digital newsroom to publish news updates online first. Develop a structure to manage the writing, editing and publishing workflow using collaborative tools. Evaluation code: 3425

Jason Wallestad, School Newspapers Online, Burnsville, Minn. 11 a.m. Friday, Exeter, Sheraton (50) Leadership and Team Building

Multimedia Broadcast

Come on in, the video’s fine

Are you a traditional print journalist? Start converging by learning how to produce video news stories for your print publication. We’ll discuss the differences between print and video, gear and equipment you’ll need, staffing, and how to post videos to your website. Evaluation code: 3315

Michelle Harmon, CJE, Borah High School, Boise, Idaho 11 a.m. Friday, Independence West, Sheraton (220) Advising/Teaching

‘Leadia’

Evaluation code: 3360

Learn what happens when your journalism and leadership/ASB programs work hand in hand to give all students a voice and improve school culture. STHS’ media journalism adviser and activities director will share strategies, insights, ideas and successes from joint projects in these powerhouse programs.

Entrepreneurship

Cassandra Pereira and Amber Van Der Veen, Santa Teresa High School, San Jose, Calif. 11 a.m. Friday, Jefferson, Sheraton (50)

Using Google to manage your publication

Google is a great tool to organize everything your publication needs. Learn how it can help your publication run smoothly — from contact management to copy flow. Julie Kuo, CJE, Lexington (Mass.) High School 11 a.m. Friday, Fairfax, Sheraton (240)

Our yearbook is not worth $50

Having trouble getting people to buy your yearbook? Maybe it’s what you put in it and how you market your product. This session will focus on expanding coverage and content as well as ways to make yearbooks “cool” again. Evaluation code: 3295

Alan Swank, Balfour Publishing, Athens, Ohio 11 a.m. Friday, Gardner, Sheraton (120) Multimedia Broadcast

Intro to videography

This session will teach you the fundamentals of visual storytelling. From sequences, to composition, to shooting interviews, the speaker gives practical tips and a lot of visual examples. This session is for beginning videographers or instructors who want a fresh approach to teaching the material. Evaluation code: 3320

Brandon Goodwin, The Academy of Scholastic Broadcasting, Springfield, Mo. 11 a.m. Friday, Hampton, Sheraton (110)

Evaluation code: 3372

John Bowen, MJE, Kent (Ohio) State University, and Carrie Faust, MJE, Smoky Hill High School, Aurora, Colo. 11 a.m. Friday, Liberty C, Sheraton (60) Adviser Event

Adviser luncheon

Often the best adviser information and advice happens during informal conversations around a luncheon table. Join the convention planning committee at this luncheon. Guest speaker will be Adrienne Lavidor-Berman, social media producer at Boston.com and BostonGlobe.com, who will discuss the role of social media in news coverage. Preregistration was required. Please bring your ticket. 11 a.m. Friday, Republic B, Sheraton (300) News Gathering

Investigative journalism: It’s time to dig deeper

Student newspapers and broadcasts around the country do surprisingly little investigative reporting. But investigative stories have real impact — they bring new issues to light and can show the need for significant change. This is a quick how-to session to get you started on deeper, more important journalistic work. Evaluation code: 2251

Advising/Teaching

Tom Sivertsen, Redwood High School, Larkspur, Calif. 11 a.m. Friday, Room 208, Hynes CC (310)

Legal and ethical issues for advisers

Planning to take the CJE or MJE test? Or just wanting to be more familiar with legal and ethical student media issues? If you want to know vital cases or understand the importance of being a forum, find what is essential here.

General Audience

Why we need reporters who can count

Evaluation code: 2164

The need for reporting that pays attention to numbers and details is stronger than ever. Director Phil Hilts and fellows from the Knight Science Journalism Program at MIT explain how you can build this discipline and why it’s important.

Writing

Phil Hilts, Knight Science Journalism Program, MIT, Cambridge, Mass. 11 a.m. Friday, Room 209, Hynes CC (134)

Candace Perkins Bowen, MJE, Kent (Ohio) State University 11 a.m. Friday, Kent, Sheraton (40)

Why short writing works

Evaluation code: 3410

Tightly edited short writing and infographics can keep even reluctant readers involved in your publications, which helps to increase your readership and circulation as well as the strength of your writers and editing staff. Take a look at formats and editing tips to “write short” well. Evaluation code: 3297

Lizabeth Walsh, MJE, Reno (Nev.) High School 11 a.m. Friday, Liberty B, Sheraton (60)

Twitter: @nhsjc/#nhsjc

Sound editorial policies are more important than ever in this 25th anniversary of the Hazelwood decision. Learn how they can protect you, the school and the community. Evaluation code: 2000

Evaluation code: 3493

Brian Hayes, MJE, and Dan Waechter, Ball State University, Muncie, Ind., and Gerry Appel, Abraham Lincoln High School, Council Bluffs, Iowa 11 a.m. Friday, Dalton, Sheraton (50)

Sound journalism begins with strong editorial policies

Writing

Creative coaching

Helping students improve their writing can be a daunting task. Learn creative, nonconventional ways to encourage students to step up their writing skills and become an influential, positive writing force on your staff. Evaluation code: 3474

Sue Skalicky, CJE, Century High School, Bismarck, N.D. 11 a.m. Friday, Room 308, Hynes CC (103)

JEA/NSPA Fall 2013 Convention/Boston — 41


LOOK BOOK COMPANION

42 — JEA/NSPA Fall 2013 Convention/Boston

YEARBOOKER’S FIELD KIT

REPLAYIT

Visit jea.org/eval to evaluate sessions


I want to be confident my yearbook company is always working for me and Jostens moves

my yearbook forward with

I N N O VAT I V E TECH NOLOGY. MARGARET SORROWS // Bryant High School [AR]

ENERGIZED by technology. YEARBOOKLOVE.COM

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 43


Kent State University’s School of Journalism and Mass Communication has the degree that’s right for you. A cutting-edge facility where STUDENTS jump-start their media careers A WIDE RANGE OF BACHELOR’S DEGREES:

advertising digital media production journalism: > broadcast news > magazine > multimedia news > photojournalism > fashion media > visual journalism

public relations AWARD-WINNING STUDENT-RUN MEDIA YOU CAN JOIN AS A FRESHMAN: Daily Kent Stater KentWired.com TV2 Black Squirrel Radio Magazines: > The Burr > Fusion > Luna Negra > A > Uhuru MERIT SCHOLARSHIPS for both in-state and out-of-state students that make getting a quality education an affordable choice.

RESPECT RESPECTED. RELEVANT. REAL.

A master’s degree in journalism just for HIGH SCHOOL TEACHERS — and entirely online Credibility as a teacher in the journalism classroom or as an adviser for student media is vital. A master’s degree from an accredited journalism school offers that, plus the continuing education school districts demand. Kent State’s online master’s degree for journalism educators emphasizes skills and theory you can study today and use in your classroom tomorrow, no matter where you live or what your schedule. From coaching a novice writer or photographer to learning strategies for protecting students’ free press rights, the course content and our nationally known instructors cover what you need to know to be an effective journalism educator. Get a degree or take a few courses to further your education and your career.

WANT MORE INFORMATION? Contact: Candace Perkins Bowen cbowen@kent.edu csjkent.org

WANT TO KNOW MORE? Contact: Mark Goodman mgoodm10@kent.edu jmc.kent.edu

JMC at Kent State: Giving students the tools to excel

Eighth place university in the 2012-2013 Hearst Journalism Awards competition. College Media Association’s 2012 Pinnacle Award, Student Television Station of the Year for TV2.

Kent State University is home to the Center for Scholastic Journalism. Check us out online at csjkent.org

44 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


friday 11 a.m.-noon Writing

Let’s make prom sparkle

Prom. Not exactly the most exciting story. Especially when you do the typical after-prom wrap-up. With a little reporting, you can turn any boring story into one that sparkles. It’s all about good reporting and finding a face for every story. Evaluation code: 3303

Jeanne Acton, UIL, University of Texas, Austin, Texas 11 a.m. Friday, Room 309, Hynes CC (304) Writing

Make sports columns count

Often the most misunderstood or misused tool in the student publication tool bag, the sports column should demand thought and push for discussion. Learn to interpret issues like the columnists you love to read. Evaluation code: 2349

Dean Hume, Lakota East High School, Liberty Township, Ohio 11 a.m. Friday, Room 310, Hynes CC (270) Entrepreneurship

Making the big bucks for your publication

The winning attitude for sales of your yearbook, newspaper and magazine starts here. Learn how to sell advertising like a pro and raise the big bucks. This fun, educational session will give you the confidence to succeed at sales. Evaluation code: 2881

Nora Guiney, Walsworth Publishing Co, Riverview, Mich. 11 a.m. Friday, Room 311, Hynes CC (435) General Audience

Reporter, source or friend?

On the morning of April 19, Zolan KannoYoungs found out that Dzhokar Tsarnaev, his friend of four years, was the alleged Boston Marathon bomber. The next 48 hours would be the most tumultuous of his life and made him re-evaluate everything he knew about journalism. Evaluation code: 3400

Zolan Kanno-Youngs, Boston 11 a.m. Friday, Room 312, Hynes CC (500) General Audience

Life Coaching 101

Get in touch with your most powerful traits to play them or pull them down. Gain insight into how you can build upon your strengths in order to become the best you can be, to get the job of your dreams. This quick interactive session will give you tools to move forward and options for additional pursuits. Evaluation code: 2376

Marcia Meskiel-Macy, Balfour Yearbooks, Melbourne Beach, Fla. 11 a.m. Friday, Room 313, Hynes CC (227)

Twitter: @nhsjc/#nhsjc

Noon

Advising/Teaching

Building a staff of leaders

Writing

We need your authentic personal voice

This is a request from a guy who worries that K-20+ education has bled the passion from many American lives. Whether you are sharing your own story, your own strong opinions or the stories and opinions of school community members, your writing “voice” needs to be unleashed. Evaluation code: 3317

Evaluation code: 3532

Erin Castellano, Clayton (Mo.) High School Noon Friday, Beacon G, Sheraton (55) Design

Advanced InDesign

If you’re looking to move beyond the basics of using InDesign or looking for some tips and tricks, then this is the session for you. (Sign up and get ticket at registration desk. Limit 36.)

Jack Kennedy, MJE, Colorado High School Press Association, Highlands Ranch, Colo. Noon Friday, Back Bay A, Sheraton (250)

Evaluation code: 2006

News Literacy

Tell me no lies

In today’s digital media world, developing news literacy skills is essential for distinguishing truth from misinformation. Learn how teaching news literacy helps create wellrounded student journalists, satisfies Common Core requirements, and prepares young adults to be active citizens in a changing democracy. Evaluation code: 3388

Megan Fromm, Germany Noon Friday, Back Bay B, Sheraton (250) Design

Color smart

Just because your yearbook is all color, doesn’t mean you have to use all the colors. Learn to use color smartly to enhance your yearbook layouts. Evaluation code: 3442

Valerie Tanke, Walsworth Publishing Co, Niles, Mich. Noon Friday, Back Bay C, Sheraton (340) Leadership and Team Building

Curious, fun traditions keep us strong

The Correspondent staff is rich in traditions of work, fun and charity. These traditions bond us. The staff keeps traditions from the past 28 years and adds new ones each year. Hear our traditions’ paths and borrow ideas for yours. Evaluation code: 3374

Janet Levin, MJE, John Hersey High School, Arlington Heights, Ill. Noon Friday, Back Bay D, Sheraton (225) Advising/Teaching

Role and history of media for advisers

For teachers who are preparing for the CJE test, this session offers a brief review of the most important events and individuals in journalism history and the functions of the mass media in modern American society. Sample questions will be discussed. Evaluation code: 2178

Learn how to empower students to be leaders in your journalism program — from recruiting students to training them to be your editors allowing them to make the tough decisions.

Hal Schmidt, PS Graphics/Balfour Yearbooks, Houston, Texas Noon Friday, Berkeley, Sheraton (80) Entrepreneurship

Connecting with readers 24/7

A few years ago if students didn’t get their news in the newspaper they might be left out in the cold. Now, the high school news cycle is 24/7 — mostly thanks to the Internet and social media. Come take a look at how any staff can connect to its audience around the clock. There’s no excuse to not take advantage of the power of social media. Evaluation code: 3464

Tom Gayda, MJE, North Central High School, Indianapolis, Ind. Noon Friday, Clarendon, Sheraton (50) Multimedia Broadcast

Print vs. broadcast

Sacha Pfeiffer is host of WBUR’s “All Things Considered” and was part of the Globe’s team that won the Pulitzer for coverage of abuse in the Catholic church. She will talk about the differences between print and broadcast and how to transition between the two. Evaluation code: 3353

Sacha Pfeiffer, WBUR, Boston Noon Friday, Commonwealth, Sheraton (250) Entrepreneurship

We have a yearbook?

If you have been asked this question, then maybe your staff has not been doing the best job of marketing your yearbook. Learn how to create a sense of urgency to drive sales early and keep your publication’s name on the tip of their tongue. Evaluation code: 3272

Matthew LaPorte, CJE, Southwest Career and Technical Academy, Las Vegas, Nev. Noon Friday, Constitution A, Sheraton (300)

Joe Mirando, MJE, Southeastern Louisiana University Hammond, La. Noon Friday, Beacon B, Sheraton (55)

JEA/NSPA Fall 2013 Convention/Boston — 45


friday noon PhotoJOURNALISM

Photography portfolio 2.0

Recently updated for Web 2.0 environment, this session teaches how creating a photo portfolio is more than simply “collecting your 10 best pictures.” Know how a portfolio should look while gaining tips to improve your photography. Bridge the gap between high school photography and college photography. Evaluation code: 2265

Mark Murray, Arlington (Texas) ISD, and Bryan Farley, Pittsburg (Calif.) High School Noon Friday, Constitution B, Sheraton (300) Law and Ethics

State laws protecting student press freedom Seven state legislatures have enacted laws protecting student journalists’ rights. Lawmakers discuss ways to protect and limit your expression each year. See how the state laws work, where this effort is heading and how you can work toward a law in your state. Evaluation code: 3379

Mark Goodman, Kent (Ohio) State University Noon Friday, Exeter, Sheraton (50) Design

Info + Graphics = Infographics

Infographics have become increasingly

popular in the world of media. Whether or not you decide to use them can make the difference between a publication that flies and a publication that flops. Evaluation code: 3420

Nora Bollinger, Balfour, Richmond, Va. Noon Friday, Fairfax, Sheraton (240) Advising/Teaching

Using social media in the yearbook class

Social media provides good opportunities for communication, learning and marketing for your yearbook class. Gather ideas for using Facebook, Twitter, Pinterest and more in the classroom. Discussion will include how to manage account settings for intended use.

Michael Hernandez, Mira Costa High School, Manhattan Beach, Calif. Noon Friday, Hampton, Sheraton (110) Entrepreneurship

How to bring your yearbook online

Why are newspapers the only publications going online? Yearbooks create content daily. They also should have an online presence. Learn how to use interactive print and dive head first into convergent media. And make some money at the same time. Evaluation code: 3342

Ryan Demo, Bellarmine College Preparatory, San Jose, Calif. Noon Friday, Independence East, Sheraton (120)

Evaluation code: 3346

Christine Mooney, Monsignor Donovan High School, Toms River, N.J. Noon Friday, Gardner, Sheraton (120) Multimedia Broadcast

Sound design for broadcast

Learn how to use sound effectively for video news packages. We’ll cover the fundamentals of microphones, sound recording and editing, and see examples from professional and student news packages. Evaluation code: 3321

General Audience

Why journalism matters

The way we deliver journalism is always changing, but the nature of storytelling and truth telling are universally important and valued, especially in democratic societies. A Northeastern University professor explains how the next generation can carry on this tradition. Evaluation code: 3399

Jeff Howe, Northeastern University, Boston Noon Friday, Independence West, Sheraton (220)

KANSASJOURNALISMINSTITUTE.ORG

We can help you … Create multimedia packages, publish great photography, tell compelling stories, meet more deadlines and simply work better as a team. Join student journalists from around the country and some of the nation’s best instructors at the Kansas Journalism Institute.

get it

TOGETHER jea.org/eval to evaluate2014 sessions AT THE UNIVERSITY OF KANSAS,Visit JUNE 22-26,

46 — JEA/NSPA Fall 2013 Convention/Boston


friday noon-2:30 p.m. Advising/Teaching

Grading for editors

Struggling with how to grade and who should grade staffers? The Legacy staff has created a system of grading for editors that allows for better deadline and staff management. Grading templates will be provided. Evaluation code: 3423

Alyssa Sellors, Harrison High School, Kennesaw, Ga. Noon Friday, Jefferson, Sheraton (50) News Literacy

Are your stories V-I-Able?

Just how good of a reporter are you? This session will offer news literacy guidelines to ensure that your stories are Verifiable, Independent and your information is Accountable. That’s the V-I-A formula. Evaluation code: 2831

Stan Zoller, MJE, Buffalo Grove, Ill. Noon Friday, Kent, Sheraton (40) Advising/Teaching

Associated Press style for advisers

Preparing for your CJE exam or just want a refresher on Associated Press style? This session will offer a quick look at some of the more common style issues, such as numbers, abbreviations, courtesy titles and more. Evaluation code: 2715

Joe Humphrey, MJE, Hillsborough High School, Tampa, Fla. Noon Friday, Liberty B, Sheraton (60) Advising/Teaching

Grading made easier

Learn about one teacher’s quest to cut grading time while providing meaningful feedback. Get tips for using tools in Google Docs to automate your grading. Evaluation code: 3383

Barbara Tholen, Lawrence (Kan.) High School Noon Friday, Liberty C, Sheraton (60) Web

Tracking and increasing your website readership

Online audiences are a fickle bunch! In this session, you’ll learn how to appeal to Web audiences’ desire for easily digestible content, how to monitor your Web traffic and how to increase readership with several writing and design strategies. Evaluation code: 3499

Megan McNames, Ball State University, Muncie, Ind. Noon Friday, Room 308, Hynes CC (103) Photojournalism

Four levels of photography

Photography is a complex world of equipment and technique. This session will break it down to four simple levels of photography to understand the basic principle of what

Twitter: @nhsjc/#nhsjc

can make a photograph so powerful. Photographers: No matter how good you think you are, you can always get better and take it to the next level. Editors: Improve your publications by understanding what makes a good photograph. Advisers: Hold your staff accountable knowing the level of photography for each image published. Evaluation code: 2793

1 p.m. Event

General session/keynote

Raney Aronson-Rath, deputy executive producer for the PBS “Frontline” series, will be the keynote speaker at this general session. Evaluation code: 2703

1 p.m. Friday, Auditorium, Hynes CC (4,284)

Kelly Glasscock, Derby (Kan.) High School Noon Friday, Room 309, Hynes CC (304)

Contest

Write-off moderators check-in

Newspaper

Comprehensive sports writing

This session will deal with sports writing coverage and writing strategies that are designed to work regardless of your publication’s format or frequency. “Game” coverage, as well as feature writing, briefs coverage, opinion pieces and dealing with college and pro sports coverage will be discussed. Also, the session will devote time to obtaining professional credentials, training a staff and looking at major issues facing high school sports writers. Evaluation code: 2940 Dean Hume, Lakota East High School, Liberty Township, Ohio Noon Friday, Room 310, Hynes CC (270)

Those who have agreed to moderate JEA’s Write-off contests must check in between 1 and 3:30 p.m. to get instructions and supplies. 1-3:30 p.m. Friday, Beacon D, Sheraton (55) Contest

Write-off contest: broadcast newswriting

Students registered for this contest will meet at this time. Bring your contest ticket and necessary supplies as stated in the contest rules. 1-3 p.m. Friday, Beacon H, Sheraton (55)

2:30 p.m. Writing

New writing for new media

Design

Make ‘em laugh; make ‘em cry

... but most of all, make an impact! Be brave and throw out trite themes and copy. Instead, build a concept, coverage and plan to make the methods for telling the stories of your year both innovative and memorable.

Contrary to popular wisdom, print is not dead. But if we’re not careful, it can get lonely. This session will look at ways smart publications are using new forms of media to reach their intended audience and engage their readers. Evaluation code: 3335

Evaluation code: 2450

Rod Satterthwaite, MJE, Dexter (Mich.) High School 2:30 p.m. Friday, Back Bay A, Sheraton (250)

General Audience

Making ‘real’ pictures: getting below the surface

Linda Ballew, MJE, Great Falls (Mont.) High School Noon Friday, Room 312, Hynes CC (500)

Photojournalism

Making the best first impression

Whether you need to interview as part of an assignment for your publication or broadcast or as a part of your efforts to get a job or an internship, this is the one session that will give you the specific tools you need to stand out in the crowd. This interactive session will move you to the top of the list.

Your photography will stand out if you take time with people to get beyond the superficial. See some great examples and learn a few tricks to take it to another level. Evaluation code: 3469

Andy Nelson, Kansas State University, Manhattan, Kan. 2:30 p.m. Friday, Back Bay B, Sheraton (250)

Evaluation code: 2375

Marcia Meskiel-Macy, Balfour Yearbooks, Melbourne Beach, Fla. Noon Friday, Room 313, Hynes CC (227)

12:30 p.m. Contest

Write-off contest: on-air reporter

Students in this contest will spend time writing, then taping their entry. 12:30 p.m. Friday, Beacon F, Sheraton (55)

Design

10 quick design fixes

Pages looking dated? Working with old fonts and design furniture that doesn’t fit anymore? Does your grid need a shimmy? Join the sixtime editor of the “Best of Newspaper Design,” and learn how you can make immediate improvements to your newspaper’s design. Evaluation code: 2873

Ron Johnson, Indiana University, Bloomington, Ind. 2:30 p.m. Friday, Back Bay C, Sheraton (340)

JEA/NSPA Fall 2013 Convention/Boston — 47


friday 2:30 p.m. Web

The latest from GlobeLab

At GlobeLab, The Boston Globe’s R&D unit, they directly engage with emerging publishing technologies through hacking and constant demoing. A lab creative technologist will talk about the lab’s mission and demonstrate several recent news hacks. Evaluation code: 3350

Chris Marstall, The Boston Globe 2:30 p.m. Friday, Back Bay D, Sheraton (225) Law and Ethics

Designating your publication as a public forum

The courts say the forum status of each student publication makes the difference in your free press rights. Learn how to determine whether your publication qualifies — you may be surprised at the answer — and how to work toward a forum policy that matters. Evaluation code: 3378

Mark Goodman, Kent (Ohio) State University 2:30 p.m. Friday, Beacon A, Sheraton (60) Leadership and Team Building

Sharing a byline with the pros

Journalism students and teachers can benefit greatly from interaction with professional media. Find out how to get your students (and maybe even yourself ) published in your local press. Internships and how to get pros into your classroom will be discussed. Evaluation code: 3290

Kathleen Mills, Bloomington (Ind.) High School South 2:30 p.m. Friday, Beacon B, Sheraton (55) Advising/Teaching

Building a broadcast studio and digital media lab

Is your school planning to build or redesign a broadcast studio or digital media arts lab? If not, they should be. You can do a lot with a little. Come find out what two advisers have learned after two years of envisioning, research and implementation. Evaluation code: 3505

Adam Dawkins and Jason Ell, Regis Jesuit High School, Aurora, Colo. 2:30 p.m. Friday, Beacon G, Sheraton (55) Design

Beginning Illustrator

Get the most of your Creative Suite by incorporating Adobe Illustrator in your designs. Learn how to use the basic tools in the program to manipulate fonts and create vector images. The course will offer basic drawing techniques and practice. (Sign up and get ticket at the registration desk. Limit 36.) Evaluation code: 3536

Monica B. Rodriguez, Gulliver Preparatory School, Pinecrest, Fla. 2:30 p.m. Friday, Berkeley, Sheraton (80)

News Literacy

When breaking news breaks down: news literacy and social media

Building on the concept of news literacy, this session, made possible through a grant from the Robert R. McCormick Foundation, will draw on examples from social media to discuss bias, misinformation and the speed of news in a 24/7 world. It will focus on how to teach our students to become consumers of the news who engage and think critically. Evaluation code: 3366

Evelyn Lauer, CJE, Niles West High School, Skokie, Ill. 2:30 p.m. Friday, Clarendon, Sheraton (50) Photojournalism

Don’t get schooled by academics

Don’t settle for pictures of students staring at textbooks. There are great stories in your classrooms and telling them starts with fantastic photos. Two advisers discuss vibrant academics coverage through great photography and contemporary design. Evaluation code: 3300

Carrie Faust, MJE, Smoky Hill High School, Aurora, Colo., and Erinn Harris, CJE, Thomas Jefferson High School for Science and Technology, Alexandria, Va. 2:30 p.m. Friday, Commonwealth, Sheraton (250) Multimedia Broadcast

Telling stories on film

Documentary video journalism and cinematic narrative are based on the same principles. An Emmy Award-winning videographer and photographer uses “Game Of Thrones” excerpts and journalism clips to explain them and show how they can help you tell the stories around you. Evaluation code: 3408

Dina Rudick, The Boston Globe 2:30 p.m. Friday, Constitution A, Sheraton (300) News Gathering

The interview

Get a brief overview of the interview process — from conducting research, to preparing and conducting the interview. Learn what should happen after the interview. Evaluation code: 3347

Paul Lazarovich, CJE, Wentworth Institute of Technology, Boston 2:30 p.m. Friday, Constitution B, Sheraton (300) Advising/Teaching

Journalism across the K-12 curriculum

Journalism provides an organic crosscurricular enrichment suitable for students of any age, with academic, interpersonal and community-based benefits unmatched by any other after-school activity. And it’s free. Evaluation code: 3463

John Vitti, The Boston Globe 2:30 p.m. Friday, Dalton, Sheraton (50)

48 — JEA/NSPA Fall 2013 Convention/Boston

Law and Ethics

Litigate this

Confused on copyright? Fumbling over FERPA? Leery of libel? This session is a great primer for those who need to brush up on the most pressing legal issues student journalists face. Advisers and students alike will find it helpful. Evaluation code: 3387

Megan Fromm, Germany 2:30 p.m. Friday, Exeter, Sheraton (50) News Gathering

I have to TALK to people?

Students today are comfortable communicating electronically. Unfortunately, it’s virtually (no pun intended) impossible to get a quality interview from someone via text or email. Come learn ways to make yourself and your interviewees comfortable having a face-to-face conversation for your newspaper or yearbook stories. Evaluation code: 3135

Whitney Moore, Walsworth Publishing Co., Washington, D.C. 2:30 p.m. Friday, Fairfax, Sheraton (240) News Gathering

Covering the future

Most of us own cellphones with far more processing power than the rockets that went to the moon. Such rapid advances are exciting to cover, and we need journalists who can explain them to the public. Learn how from an award-winning documentary filmmaker. Evaluation code: 3394

Gino Del Guercio, Boston University, Boston 2:30 p.m. Friday, Gardner, Sheraton (120) Multimedia Broadcast

Sit up straight!

When you’re on TV, it matters how you look and sound. One wayward hair or rumpled collar can pull attention away from your message. A creaky voice might get you the wrong kind of attention. Get tips on on-air presence for reporting and anchoring. Evaluation code: 3287

Susan Houseman, MJE, Conestoga High School, Berwyn, Pa. 2:30 p.m. Friday, Hampton, Sheraton (110) News Literacy

One extraordinary day: Boston bombings and social media

Though the Boston bombings took place April 15, 2013, the real test came two days later with not one but five major breaking stories at the same time. Come and learn how social media got it wrong and right on one extraordinary news day. Evaluation code: 3431

Beatrice Motamedi, CJE, The Urban School, San Francisco 2:30 p.m. Friday, Independence East, Sheraton (120)

Visit jea.org/eval to evaluate sessions


friday 2:30 p.m. Multimedia Broadcast

Advising/Teaching

of education watchdog.

Whether you’re planning to take the CJE exam or just want to learn more about principles of photojournalism, this session is for you. Learn about composition, camera techniques, file formats, photo management and the strategies for teaching these concepts to your students so they can become more proficient at presenting the visual side of the story.

Frank LoMonte, Student Press Law Center, Arlington, Va. 2:30 p.m. Friday, Liberty C, Sheraton (60)

Photojournalism for advisers

Broadcast story structure

Get real, tangible ways to simply and easily incorporate broadcast stories into all of your school publications. In this session, we will cover sound bites, B-roll, natural (NAT) sound, and the basics of telling a solid broadcast story in 15 shots or fewer. Evaluation code: 3311

Don Goble, Ladue Horton Watkins High School, St. Louis, Mo. 2:30 p.m. Friday, Independence West, Sheraton (220)

Evaluation code: 2802

Evaluation code: 2276

Cathy Wall, MJE, Harrisburg (Ill.) High School 2:30 p.m. Friday, Kent, Sheraton (40)

Is your district implementing standards-based assessment? Are you wondering how to make it work for a media production class? One adviser takes you down her road to becoming a better teacher and a better adviser. Evaluation code: 3292

Sandra Coyer, MJE, Puyallup (Wash.) High School 2:30 p.m. Friday, Jefferson, Sheraton (50)

In the digital space, getting people to click is key. Learn how to repackage content with visuals, creative titles and unique writing techniques. Evaluation code: 3497

Kelsey Harris, The Heritage Foundation, Washington, D.C.

2:30 p.m. Friday, Room 208, Hynes CC (310)

Advising/Teaching

How standards-based grading can improve your advising

Web

Would you click? Content that spreads

Advising/Teaching

CJE/MJE certification study session

Leadership and Team Building

Those who will take a JEA certification test today are invited to this pre-test study session.

You wrote this job description?

Law and Ethics

I’d rather do it myself! Not the thing to say. As the editor boss, you must delegate, lead and teach by example. At this participation session, you share ideas about staff and job descriptions, photographers, advisers, deadlines and other issues. No advisers, please.

Most professional newspapers don’t have a full-time education beat reporter anymore. That means it’s your job. We’ll give you the basics to get started as the community’s board

Sheryl Fulton, Jostens, Topeka, Kan.; Bonnie Blackman, CJE, Jostens, Tinton Falls, N.J.; and Linda Chambers, Nashville, Tenn. 2:30 p.m. Friday, Room 209, Hynes CC (134)

Evaluation code: 2045

Kim Green, MJE, Columbus (Ind.) North High School 2:30 p.m. Friday, Liberty B, Sheraton (60)

Who’s covering the school board? You are!

Evaluation code: 3275

Online First

Scholastic Journalism Reinvented School Newspapers Online www.snosites.com 888.649.7784

Twitter: @nhsjc/#nhsjc

Powerful websites Reliable hosting Unlimited support

JEA/NSPA Fall 2013 Convention/Boston — 49


YEARBOOK. The Original Mash-Up

final bell.

50 — JEA/NSPA Fall 2013 Convention/Boston

locker room smell.

Visit jea.org/eval to evaluate sessions


curtain calls.

busy halls.

Bring the unexpected together in a Balfour yearbook. Stop by and see us in the Expo!

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 51


friday 2:30-9 p.m. Law and Ethics

Dropping the journalistic F bomb

You say your mother loves you — check it out. Sometimes that may require a lot of digging. This session will look at access to public records and freedom of information — including those dreaded four letters that begin with F — FOIA. Evaluation code: 3318

Stan Zoller, MJE, Buffalo Grove, Ill. 2:30 p.m. Friday, Room 308, Hynes CC (103) Photojournalism

Capturing ‘the shot’: sports photography

This is a presentation aimed at photographers of all skill sets and backgrounds to cover technical and artistic techniques used in covering sports. The presentation will delve into the artistic and storytelling aspects of sports photography and will discuss ways to get the game defining “shot.”

Design

Literary magazine tips from A to Z

Come learn a variety of tips on such topics as working with advisers, fundraising, submissions and zebras (OK, maybe not zebras, but you’ll learn a lot of other great stuff ). Evaluation code: 2570

Mark Murray, Arlington (Texas) ISD 2:30 p.m. Friday, Room 313, Hynes CC (227)

3:30 p.m. Advising/Teaching

CJE/MJE certification testing

8 p.m. Student Event

Media Swap Shops

Swap shops are prime opportunities for preregistered students to share useful ideas and concepts with others. Bring at least 10 samples of your newspaper, literary magazine or one copy of your yearbook or video DVD to show at your table. Each delegate attending a Swap Shop must have a ticket, which will be in the school registration packet. Please check the ticket for your assigned table and time. 8 and 9 p.m. Friday, Republic A-B, Sheraton

Those who have applied to take the CJE or MJE test will do so at this time. Kim Green, MJE, Columbus (Ind.) North High School 3:30 p.m. Friday, Berkeley, Sheraton (80)

8:30 p.m.

Evaluation code: 3289

4 p.m.

General Audience

Write-off contests

Save room for dessert. Advisers are invited to this social gathering featuring a fundraiser to benefit the Student Press Law Center. Those who are judging Write-off competitions are encouraged to attend after they finish judging. Sponsored by Newseum Institute. 8:30-11 p.m. Friday, Constitution A, Sheraton (300)

Graham Beck, Boston College, Chestnut Hill, Mass. 2:30 p.m. Friday, Room 309, Hynes CC (304)

Snooping for word crimes

Follow the trail to spot goofs on every page. Smell and taste clues to apprehend offenders. Transform yourself into a trendy licensed private eye for better words, from Associated Press style to originality. As a word sleuth, arrest word fraud 24/7. Turn copy into a magnet for readers. Evaluation code: 2267

Howard Spanogle, Asheville, N.C. 2:30 p.m. Friday, Room 310, Hynes CC (270) Entrepreneurship

Turn financial woes into wins

Do you wish you knew the secret to making a profit? Would you like to monitor your income and expenses? Come, listen and learn from an experienced business owner educating you how to make a profit in your yearbook program.

Contest

Check the list of contests on Page 28 for your contest time and room assignment, and the convention Update flier for additional changes. Please arrive 10 to 15 minutes early to the room. Latecomers may be disqualified. Don’t foget your contest ticket (label) and supplies your contest requires. 4 p.m. Friday, see Page 28, Convention Update for room assignments

6 p.m. Contest

Write-off judges dinner and judging

Those who have agreed to judge JEA’s Writeoff contests are invited to dinner before judging begins. Please check in at the door. 6 p.m. Friday, Constitution B, Sheraton (300)

Adviser Event

Adviser reception and SPLC fundraiser

9 p.m. Student Event

Student dance

A dance for students will have music provided by a DJ. This is a good time to enjoy the music and dancing with other student journalists from other parts of the country. Students must present their convention name badge to be admitted to the dance. The New England Center for Investigative Reporting is the sponsor of this event. 9-11:30 p.m. Friday, Grand and Independence Ballrooms, Sheraton

Evaluation code: 3515

Jeanne Unger, Balfour, Townson, Md. 2:30 p.m. Friday, Room 311, Hynes CC (435) Leadership and Team Building

Duct tape and high funkadelity

Journalists are smarter, better looking and more interesting than everybody else. That’s why the staff should have not only a goal of having an awesome publication, but also a goal of having the funkiest classroom/ newsroom experience. Get 758 ideas to make class unforgettable this year. Evaluation code: 2331

Scott Winter, University of Nebraska, Lincoln, Neb. 2:30 p.m. Friday, Room 312, Hynes CC (500)

Crew boats on Charles River: Crew teams practice year-round in preparation for the annual Head of the Charles Regatta and other rowing events. (Greater Boston Convention & Visitors Bureau)

52 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


Need Ideas?

Check out the Deserving Design section of our website at www.jsprinting.com. Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 53


saturday at a glance ROOM

8 a.m.

9 a.m.

10 a.m.

Back Bay A, Sheraton

That’s what YOU said!

Back Bay B, Sheraton

Photography crash course

Message matters

Photo packaging in the 21st century

A designer’s guide to what works

Back Bay C, Sheraton

Lights, camera, action

Get the scoop 007 style

Top 10 ways to be organized in yearbook

All things news magazine

Back Bay D, Sheraton

The rest of the story

13 tips for sophisticated design

Twitter, journalism and student media

Just hashtag it: social media and your publication

The editorial leadership experiment (2 hours)

Beacon A, Sheraton

Small school, small staff, big results

Beacon B, Sheraton

You can quote me on that

Beacon D, Sheraton

Shop ‘til you drop

Open discussion of prior review, censorship (2 hours) Got conflict?

Reelin’ them in

Write-off headquarters

Beacon E, Sheraton

Boot camp basics

Old school rules ... new yearbook cool

Beacon G, Sheraton

Scholastic Press Rights Commission meeting (7:30 a.m.)

Mentoring magic

Beacon H, Sheraton

Digital Media Committee meeting

Berkeley, Sheraton

11 a.m.

Ready ... set ... lede! (2 hours) Publication pride in the private school

Scholastic press association roundtable (2 hours)

Photoshop basics for advisers (2 hours)

Insantity NOT required for advisers Staff manuals: why and how

Unleash the fury: Photoshop 6

InDesign tricks and tips

Organization 101

Forum on news literacy

Explore a (free) digital age e-book

Struck a nerve (advisers only)

Confessions of a fontaholic

It’s the little things

Pinterest for everyone

How to write lame, boring stories

Junior High/Middle School Commission meeting

Development/Curriculum Commission meeting

Educational Initiatives Committee meeting

JEA Awards Commitee meeting

A little change will do you good

Building a social media plan

Really? Heard that one before!

Let’s go shopping

Take a look

Better by design

Now that’s a concept

Not the same old story

Exeter, Sheraton

The flipped/asynchronous journalism classroom

Creating portfolios for Aspiring Young Journalist Award

Teaching journalism for English credit

DIY: how to build successful publications

Fairfax, Sheraton

Journalism essentials for yearbook

How to ask the tough questions

DesignNOW

Humor me (please)

10 fingers to great videography

May the force be with you

What’s the BIG idea?

Taming the beast: grading in yearbook

Clarendon, Sheraton Commonwealth, Sheraton Conference Room, Sheraton Constitution A, Sheraton Constitution B, Sheraton

Gardner Grand Ballroom, Sheraton Hampton

Journalism Quiz Bowl final rounds Harry Potterize your book with Aurasma

54 — JEA/NSPA Fall 2013 Convention/Boston

News documentary and investigative reporting

Journalism Quiz Bowl (if needed) My producers can beat up your editors

Advanced story structure for broadcast

Visit jea.org/eval to evaluate sessions


n Advising/Teaching n Contest n DESIGN n EDITING

n ENTREPRENUERSHIP n Featured Speaker n General Audience n Law/Ethics

n LEADERSHIP/TEAM BUILDING n Meeting n MULtimedia broadcast n News GATHERING

Noon

1 p.m.

2:30 p.m.

Interview for the iceberg

Ads to be had

Graphic balancing acts

Yearbook ins and outs

All the small things

But wait! There’s more!

Mob reporting

Two-way journalism

Beyond the interviewing basics

Covering breaking news: two steps forward, one step back

Literary magazines from the ground up

Creating a positive First Amendment environment ...

3:30 p.m.

n NEWS LITERACY n PhotoJOURNALISM n WEB n WRITING

SUNDAY

It will all be worth it

Write-off headquarters Creative Commons: Set your content free

Discover the solutions

Final Cut Pro X basics (2 hours) Taking the dread out of deadlines

Mobile media and the cheap

Shooting with Speedlights

Write-off Headquarters

Write it tight, write it right

‘How do I ... ?” using InDesign Networking in 6 steps Going long online

Wow factor

Trauma reporing

Using social media to boost readership

Design on a dime

Funny speech, free speech, good citizenship

Finding your voice

Creating a teen news website

New kids on the block

Using news content as curriculum

Creating a better publication

Making design work

The iJournalist: using iPads, iPods and iPhones in journalism

Youth newspapering: teens in print

Strengthening your newsroom with social media

Secrets of a successful broadcast program

Intermediate videography for broadcast

Tips and tricks for sports broadcasting

News literacy project wrapup

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 55


saturday at a glance ROOM

8 a.m.

9 a.m.

10 a.m.

11 a.m.

Independence East, Sheraton

Taming the grading monster

Independence West, Sheraton

Take daily announcements to the next level

JEA Suite, Sheraton

JEA Certification Commission meeting (7:30 a.m.)

Jefferson, Sheraton

10 tips to save your tushy

TAO of Journalism: transparent, accountable, open

Producing a winning Journalist of the Year porfolio (2 hours)

Liberty B, Sheraton

Advising in the Common Core era

Why consider JEA certification?

Presentation of MJE projects for advisers

MJE: Yes, you can!

Liberty C, Sheraton

Boosting journalism with social media

Keys to a successful year

So it’s finished — now what?

Do it all

ISSUE SEMINAR — Off-campus speech: Where are the lines, and how are they being blurred? (2 hours) Lip service

How to be funny

Republic A, Sheraton Republic B, Sheraton

Yearbook writing: the chicken or the egg? Coverage that counts

On-site critiques Yearbook is journalism

The myth of the magical teacher

Team storytelling wrap-up

Where does the time go?

Auditorium, Hynes Hall C Foyer, Hynes Room 208, Hynes

Convention registration/check-in, lost and found (8 a.m.-1 p.m.) Learn from the pros

Trends in yearbook

Why not be awesome?

Color: use it; don’t abuse it

Room 209, Hynes

Best of Show judging

Room 210, Hynes

JEA Bookstore (7:30 a.m.-2:30 p.m.) and Adviser Hospitality (7:30 a.m.-noon)

Room 308, Hynes

Everyone has a story

Being in charge is easy?

Literary magazine roundtable

Photographic awesomeness

Good crop, bad crop

We regret the error

Room 310, Hynes

NSPA roundtable

So you want to be a columnist

Arts coverage in a new era

Room 311, Hynes

What judges look for in your yearbook

Covering marathon mayhem

Staff motivation

Writing about health and science

Room 309, Hynes

The magic of 3 a.m.

Room 312, Hynes Room 313, Hynes 56 — JEA/NSPA Fall 2013 Convention/Boston

How to sell advertising for news publications

Visit jea.org/eval to evaluate sessions


n Advising/Teaching n Contest n DESIGN n EDITING

n ENTREPRENUERSHIP n Featured Speaker n General Audience n Law/Ethics

n LEADERSHIP/TEAM BUILDING n Meeting n MULtimedia broadcast n News GATHERING

Noon

1 p.m.

2:30 p.m.

From convention to career

Photos in 5

Photographers: take control

Globe games for focus and fun

Crafting compelling multimedia stories

Produce news videos with PBS ‘NewsHour’

The law of social media

‘I found this great photo on Google Images, and ...’

Private school press rights roundtable

1 day, 1 story

Organized chaos: 1:1 in a multimedia classroom

Lit mags: clouds and silver linings

Gray areas: case studies in photo ethics

P21: The power of yearbook production

Trickle-down doesn’t work

n NEWS LITERACY n PhotoJOURNALISM n WEB n WRITING

3:30 p.m.

SUNDAY

NSPA Awards Ceremony (3:30-5:30 p.m.)

JEA Awards Ceremony (8:30-10:30 a.m.)

On-site critiques So you want to meet Anderson Cooper

Do the write thing

Chaos control: using Trello to manage a staff

Convention registration/ check-in Multimedia storytelling — the ‘My Life, My Town’ project

Picture speaks 1,000 words

Photography: basic to fantastic Mentor Program informational meeting

JEA Bookstore

Nailed it: media credentials and celebrity interviews

The next level

JEA board followup

Lightning ledes: strong story starters

Light it up

Adviser awards luncheon

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 57


saturday 7:30-8 a.m. 7:30 a.m. Meeting

Scholastic Press Rights Commission meeting

Members of this commission will meet to make plans and goals for the upcoming year. Other advisers who are interested in being part of the commission are invited to attend. John Bowen, MJE, Kent (Ohio) State University 7:30 a.m. Saturday, Beacon G, Sheraton (55) Meeting

JEA Certification Commission meeting

Commission members will meet to discuss JEA certification procedures. Kim Green, MJE, Columbus (Ind.) North High School 7:30 a.m. Saturday, JEA Suite, Sheraton Event

Publication exchange

Interested in seeing what kind of work other high schools around the nation are producing? Stop by the publication exchange tables to gander at the latest editions of high school news from coast to coast. Feel free to drop off a few copies of your publication. Saturday, Exhibit Hall C Foyer, Hynes Event

JEA Bookstore

Check out the new books, as well as popular bestsellers, at the JEA Bookstore. Nearly 300 items relating to journalism are available, including textbooks, curriculum development, yearbook, newspaper, design, photography, writing, desktop publishing, new media, advertising and broadcast. 7:30 a.m. -2:30 p.m. Saturday, Room 210, Hynes CC Adviser Event

Adviser hospitality

Meet with your colleagues from across the country in the adviser hospitality suite, a hot spot for advisers. Saturday morning refreshments are provided by SNO. 7:30 a.m.-2:30 p.m. Saturday, Room 210, Hynes CC

8 a.m. Event

Convention Registration/Check-in

Pick up your registration packet or check the lost and found here. 8 a.m. to 1 p.m. Saturday, Exhibit Hall C Foyer, Hynes CC Event

On-site critiques

If your staff has signed up for a publication critique, check the schedule outside this room for your appointment time. Since critiques are only 30 minutes, please be on time. 8 a.m. to 3 p.m. Saturday, Republic A, Sheraton

Writing

Meeting

That’s what YOU said!

Digital Media Committee meeting

Evaluation code: 3496

Photoshop basics for advisers (2 hours)

Is the op-ed section of your student publication the most exciting place for readers to be? Because it should be! Come to this session to learn some rhetorical techniques for writing more compelling op-ed pieces, and you’ll also hear excerpts from some of the masters doing the best work out there these days. Karl Grubaugh, CJE, Granite Bay (Calif.) High School 8 a.m. Saturday, Back Bay A, Sheraton (250) Photojournalism

Photography crash course

By the end of this session, you will understand how shutter, aperture, ISO and focal length affect your images. More importantly, you will feel confident enough to manipulate these settings on the go to achieve desired results.

This committee will meet to discuss goals and projects for the upcoming academic year. Aaron Manfull, MJE, Francis Howell North High School, St. Charles, Mo. 8 a.m. Saturday, Beacon H, Sheraton (55) Advising/Teaching

Come ask those questions you don’t want to ask in front of the students. Learn tips and tricks that will amaze your students. Walk out of the class with skills to improve your photographs for your publication. Teachers/advisers only. (Sign up and ticket at the convention registration desk. Limit 34.) Evaluation code: 2329

Mark Murray, Arlington (Texas) ISD 8 a.m. Saturday, Berkeley, Sheraton (80)

Evaluation code: 3495

Sarah Tricano, Holy Trinity Episcopal Academy, Melbourne, Fla. 8 a.m. Saturday, Back Bay B, Sheraton (250) Multimedia Broadcast

Lights, camera, action

There’s a reason why “lights” is first in that phrase. Lighting separates amateurs from professionals and box office hits from home movies. In this session, learn how to incorporate skills that will get you closer to true professional-quality videos.

Advising/Teaching

Organization 101

Advisers and editors: You know how to write and design, but that’s only half the battle. Come learn techniques and strategies to help maintain your sanity and find peace in the process. Bring your thumb drives if you want awesome handouts. Evaluation code: 2275

Ronna Sparks Woodward, MJE, and Jennifer Higgins, Liberty (Mo.) North High School 8 a.m. Saturday, Clarendon, Sheraton (50)

Evaluation code: 3375

William Lewis, Kent (Ohio) State University, Kent 8 a.m. Saturday, Back Bay C, Sheraton (340) Writing

The rest of the story

See how you can tell the story of the year, engage your reader and have fun doing it. Captions are the most read text in the yearbook, but often we spend the least amount of time crafting them. Using storytelling captions helps you tell the story of the year and improves readership. Evaluation code: 3457

Linda Puntney, MJE, Herff Jones, Manhattan, Kan. 8 a.m. Saturday, Back Bay D, Sheraton (225) Leadership and Team Building

Boot camp basics

Tired of spending the first month of school talking about policy rather than creating a product? Learn from this adviser and her students about how to run a summer boot camp that is effective and energizing so you can hit the ground running in August. Evaluation code: 3336

Julieanne McClain, CJE, Rutherford B. Hayes High School, Delaware, Ohio 8 a.m. Saturday, Beacon E, Sheraton (55)

58 — JEA/NSPA Fall 2013 Convention/Boston

Design

Confessions of a fontaholic

With thousands of fonts available for use in our publications, it’s easy to become a font fanatic. Learn how to make the most of your fonts to strengthen your designs and avoid font faux pas. Check out the seven-step program to cure your font addictions. Evaluation code: 2397

Lynn Strause, Herff Jones, East Lansing, Mich. 8 a.m. Saturday, Commonwealth, Sheraton (250) Meeting

Junior High/Middle School Commission meeting

Join together with other junior high/middle school journalism advisers. Share ideas how to meet the needs of these young journalists and increase membership. Evaluation code: 2024

Anita Marie Wertz, MJE, Cesar Chavez High School, Stockton, Calif. 8 a.m. Saturday, Conference Room, Sheraton Design

A little change will do you good

Keeping your coverage, concept and design fresh just takes a change of perspective and a little effort. If you’re looking for ways to change

Visit jea.org/eval to evaluate sessions


saturday 8 a.m. things up, or if you need a complete overhaul, this session has lots of examples of suggestions. Evaluation code: 3396

Charla Harris, CJE, Pleasant Grove High School, Texarkana, Texas 8 a.m. Saturday, Constitution A, Sheraton (300) Design

Take a look

Hundreds of examples from books coast to coast showcase popular yearbook practices and introduce some fun, new twists. From coverage strategies and concept development to maximizing the power of your content, you’ll see how to make you book even more amazing. Evaluation code: 3404

Paul Ender, Herff Jones, Palm Springs, Calif., and Ann Akers, MJE, Herff Jones, Charlotte, N.C. 8 a.m. Saturday, Constitution B, Sheraton (300) Advising/Teaching

The flipped/asynchronous journalism classroom

Online tools allow teachers to deliver instruction asynchronously, leaving more class time for discussion and collaboration. Learn the dynamics of teaching journalism totally online (never physically meeting as a class) as well as how to augment your program with tutorials for frequently asked questions. Evaluation code: 3412

Tracy Anne Sena, Convent of the Sacred Heart High School, San Francisco 8 a.m. Saturday, Exeter, Sheraton (50)

Student Event

Advising/Teaching

Journalism Quiz Bowl (2 hours)

Four-person teams will compete in the live buzzer rounds. Come cheer on the finalists as a member of the audience. Evaluation code: 2861

Brenda Gorsuch, MJE, West Henderson High School, Hendersonville, N.C., and Marilyn Chapman, CJE, Florence, S.C. 8 -9:50 a.m. Saturday, Grand Ballroom, Sheraton (1,100)

Whether you are a first- or fourth-year yearbook staffer, come and get reminded of all the “mustknows” of journalism. Let’s talk about those details of interviewing, writing, design and photography that will help you produce your best book possible. Evaluation code: 3444

Ashley Brightwell, Walsworth Publishing Co., Woodstock, Ga. 8 a.m. Saturday, Fairfax, Sheraton (240) Multimedia Broadcast

10 fingers to great videography

This presentation is geared to novice videographers looking to get the most out of their videography. The speaker will explain 10 elements of effective videography. The session will be beneficial for beginning broadcast teachers. Evaluation code: 3268

Bobbi Templet, CJE, Oldham County High School, Buckner, Ky. 8 a.m. Saturday, Gardner, Sheraton (120)

Twitter: @nhsjc/#nhsjc

A majority of states have adopted the Common Core Standards for English Language Arts. And for many journalism programs this can be good news. Come to this session to see how programs in Michigan have aligned to the Common Core to help their programs survive. Evaluation code: 3334

Rod Satterthwaite, MJE, Dexter (Mich.) High School 8 a.m. Saturday, Liberty B, Sheraton (60)

Multimedia Broadcast

Harry Potterize your book with Aurasma

News Gathering

Add videos and pictures to your publication without the need for QR codes or any other printed marks. Add content AFTER publication, and add value with ease. It’s a chance for true convergence between media programs, with video making the content, and publications sharing it.

Boosting journalism with social media

Evaluation code: 3274

See how Facebook, Twitter, Storify, YouTube, and other sites can help young journalists approach reporting/other forms of journalism. Learn how this college student has used social media to report at school and in internships, and how young reporters can follow suit in high school.

Advising/Teaching

Jacob Freedman, University of Southern California, Los Angeles 8 a.m. Saturday, Liberty C, Sheraton (60)

John Dent, Dos Pueblos High School, Goleta, Calif. 8 a.m. Saturday, Hampton, Sheraton (110)

Evaluation code: 3462

Taming the grading monster

See one adviser’s approach to bringing some order out of chaos regarding the grading dilemma in a publication’s classroom. Discover some ways to evaluate every student on staff in a way that reflects individual responsibilities or assignments.

Advising/Teaching

Yearbook is journalism

Evaluation code: 2054

Why are there no Pacemaker Finalist yearbooks from New England? Does your school follow scholastic journalism standards for your yearbook program? If not, come and hear why they should and how to do it.

Broadcast

Adrienne Forgette, CJE, Martha’s Vineyard Regional High School, Oak Bluffs, Mass. 8 a.m. Saturday, Republic B, Sheraton (300)

Bill Flechtner, MJE, Milwaukie, Ore. 8 a.m. Saturday, Independence East, Sheraton (120)

General Audience

Journalism essentials for yearbook

Advising in the Common Core era

Take your daily announcements to the next level Learn how incorporating news packages in your newscast can build interest in and establish professionalism for your program. We’ll discuss different types of packages, crew assignments and scheduling, and how to balance entertainment with news. Evaluation code: 2312

Michael Hernandez, Mira Costa High School, Manhattan Beach, Calif. 8 a.m. Saturday, Independence West, Sheraton (220) Advising/Teaching

10 tips to save your tushy

Did you get stuck with yearbook and have no idea where to start? Learn 10 important yearbook tips and tricks from someone who was in your shoes a few years ago. These will help you stay organized, manage staff and get more accomplished. Evaluation code: 3194

Megan Read, Grand Junction (Colo.) High School 8 a.m. Saturday, Jefferson, Sheraton (50)

Evaluation code: 3492

Design

Learn from the pros

The professionals are highly paid to create beautiful designs. Learn how and why those designs are created and how to use those ideas in your student publications. Evaluation code: 3512

Laura Schaub, CJE, Lifetouch, Commerce City, Colo. 8 a.m. Saturday, Room 208, Hynes CC (153) Photojournalism

The magic of 3 a.m.

For photojournalists, covering spot news — events as large as the Boston Marathon to smaller house fires — means being prepared. Discuss how to be prepared for when it happens in your area and look at some of the winning news images. Evaluation code: 3199

Bradley Wilson, MJE, Midwestern State University, Wichita Falls, Texas 8 a.m. Saturday, Room 309, Hynes CC (304)

JEA/NSPA Fall 2013 Convention/Boston — 59


saturday 9 a.m. Leadership and Team Building

The editorial leadership experiment (2 hours)

Are you an editor or leader on your newspaper staff? This experiment is designed around sharing what you do with other experts in your area with experienced advisers as your facilitators. Come with problems and solutions. Evaluation code: 3291

News Gathering

You can quote me on that

Is getting good quotes a problem for your staff? The adviser of an award-winning yearbook shares some of her tricks for getting good quotes that can be used all through the book. Learn how to write questions so you can get the answers you want. Evaluation code: 3508

General Audience

It’s the little things

Come to this session to hear almost three dozen specific suggestions aimed at improving your reporting, design and staff dynamics. Adjusting some of the little things may be all it takes to transform your paper or newsmagazine. Evaluation code: 2111

Sandra Coyer, MJE, Puyallup (Wash.) High School, and Chris Grasseschi, Bishop Blanchet High School, Seattle 9 a.m. Saturday, Back Bay A, Sheraton (250)

Pat Hinman and Adrienne Forte, Robinson Secondary School, Fairfax, Va. 9 a.m. Saturday, Beacon B, Sheraton (55)

Jon Reese, CJE, Decatur (Ga. ) High School 9 a.m. Saturday, Commonwealth, Sheraton (250)

Writing

Advising/Teaching

Development/Curriculum Commission meeting

Message matters

The days of boring 400-word copy blocks spread after spread throughout your yearbook are gone. This session will catch you up on one of the latest trends: marrying message to concept. Discover new ways to pull your readers into your book. Evaluation code: 3458

Pete LeBlanc, Antelope (Calif.) High School 9 a.m. Saturday, Back Bay B, Sheraton (250) News Gathering

Get the scoop 007 style

Is your student body tired of reading the same old homecoming story? Come to this session to learn how to James Bond your way into finding great stories for your publication. Evaluation code: 3308

Erin Coggins, MJE, Sparkman High School, Harvest, Ala. 9 a.m. Saturday, Back Bay C, Sheraton (340) Design

13 tips for sophisticated design

Using examples from professional, college and high school publications, this session approaches design from a designer’s perspective. If you want freshen up your design with proven techniques, come join us.

Meeting

Old school rules ... new yearbook cool

This session for yearbook advisers covers it all — from concept/coverage and writing/ photography to graphic design and marketing. You will get the PowerPoint so you can teach the basics of the latest and greatest of all things yearbook. This is a great introduction for rookies and an inspiration for advanced staff members. Evaluation code: 3481

John Cutsinger, CJE, Jostens, Ocoee, Fla. 9 a.m. Saturday, Beacon E, Sheraton (55) Advising/Teaching

Mentoring magic

Advisers, are you tired of not getting the leadership results you are looking for from your editors? Learn how you can turn your editors’ weaknesses into strengths and see the whole staff benefit. Evaluation code: 2552

Sue Skalicky, CJE, Century High School, Bismarck, N.D. 9 a.m. Saturday, Beacon G, Sheraton (55)

Evaluation code: 3477

Design

Better by design

Evaluation code: 2187

Advising/Teaching

Bonnie Dodwell, Cary (N.C.) Academy 9 a.m. Saturday, Beacon A, Sheraton (60)

Evaluation code: 3393

Brian Heyman, CJE, Pattonville High School, Maryland Heights, Mo. 9 a.m. Saturday, Constitution A, Sheraton (300)

Paul Ender, Herff Jones, Palm Springs, Calif., and Ann Akers, MJE, Herff Jones, Charlotte, N.C. 9 a.m. Saturday, Constitution B, Sheraton (300)

Mark Newton, MJE, Mountain Vista High School, Highlands Ranch, Colo. 9 a.m. Saturday, Beacon H, Sheraton (55)

This session will address some of the challenges that staffs and advisers of small private schools face. Each school is unique, and many of broad “rules” simply don’t apply. Learn how to compromise and be creative in planning and creating your yearbook.

Get a social media presence started at your school. Students and advisers will learn how to create a strong mission statement that will get accepted by reluctant administrators. Examples will be shown and handouts will be provided.

Scholastic press association roundtable (2 hours)

Evaluation code: 2770

Small school, small staff, big results

Entrepreneurship

Building a social media plan

These principles of design make the difference between good yearbooks and great ones. See how knowing what subtle changes to make can create a drastically different look in terms of sophistication and polish.

Advising/Teaching

Join the discussion of scholastic press association directors and those involved in scholastic press organizations in their states.

Linda Puntney, MJE, Herff Jones, Manhattan, Kan. 9 a.m. Saturday, Back Bay D, Sheraton (225)

Join our semiannual commission meeting to discuss what we can do in the way of curriculum and development to further the missions of JEA. Sarah Nichols, MJE, Whitney High School, Rocklin, Calif. 9 a.m. Saturday, Conference Room, Sheraton

News Literacy

Forum on news literacy

News literacy is a trendy topic that fits perfectly within journalism classrooms and Common Core State Standards. Whether you have already incorporated the subject into your teaching or are looking to get started, come get your questions answered about this essential critical thinking skill. This session is made possible through a grant from the Robert R. McCormick Foundation. Evaluation code: 3368

Evelyn Lauer, CJE, Niles West High School, Skokie, Ill. 9 a.m. Saturday, Clarendon, Sheraton (50)

60 — JEA/NSPA Fall 2013 Convention/Boston

Evaluation code: 2207

Writing

Creating portfolios for Aspiring Young Journalist Award

Advisers and students are encouraged to attend this session to learn how to prepare a portfolio for the Aspiring Young Journalist Award. The session will highlight requirements and tips to create a top-notch portfolio. (Also makes a great end-of-year assignment for middle school students.) Evaluation code: 3089

Anita Marie Wertz, MJE, Cesar Chavez High School, Stockton, Calif. 9 a.m. Saturday, Exeter, Sheraton (50)

Visit jea.org/eval to evaluate sessions


get prepared to tell your story. At the Meek School of Journalism and New Media at Ole Miss, we’re offering exciting new courses in journalism and integrated marketing communications that incorporate print, broadcast, interactive and social media. Want to know how to blog? How to useTwitter to get ideas out there? How to brand a business? We can teach you how to master this dynamic field to get the job you need and the career you want. It’s a whole new newsroom. Check us out at http://meek.olemiss.edu/.

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 61


saturday 9 a.m. News Gathering

How to ask the tough questions

Are you ready to take your interviewing skills to the next level? This session will teach you how to conduct interviews for sensitive stories. Evaluation code: 3418

Melissa Deavers-Lowie, Portage (Ind.) High School 9 a.m. Saturday, Fairfax, Sheraton (240) Advising/Teaching

May the force be with you

Empower your staff! Staffs that share responsibility produce better yearbooks and happier people. We will discuss proven ways to delegate, develop confidence and teach others how to lead. Evaluation code: 3038

Heather Nagel, Christ Presbyterian Academy, Nashville, Tenn. 9 a.m. Saturday, Gardner, Sheraton (120) Multimedia Broadcast

News documentary and investigative reporting

How and why your students should produce long-format news stories. Covers differences between short, two-minute stories and long five- to six-minute stories, choice of topic, research, workflow and more. Evaluation code: 3326

Dave Davis, Hillcrest High School, Springfield, Mo. 9 a.m. Saturday, Hampton, Sheraton (110)

Law and Ethics

TAO of journalism: transparent, accountable, open Take the TAO pledge to be transparent, accountable and open in your practice of journalism. Professional journalists and student journalists around the world are doing it. Learn how to take the pledge and carry the TAO seal.

Off-campus speech: Where are the lines, and how are they being blurred? (2 hours)

When students are not in school, things they say or post online increasingly have implications for life within the school’s walls, and courts are struggling to define the parameters of free speech as technology changes with lightning speed. Hear from a First Amendment lawyer, an anti-bullying advocate, and others about current law and what resources are available as you produce stories for your own publications. Evaluation code: 3455

Jeffrey Pyle, Prince Lobel Tyle LLP, Boston; Elizabeth Englander, Massachusetts Agression Reduction Center, Bridgewater, Mass., and Rep. John Scibak, Massachusetts House of Representatives, Boston 9-10:50 a.m. Saturday, Independence East, Sheraton (120) Multimedia Broadcast

Lip service

Hear how we planned the most magical day ever when we made our first lip dub. We’ll talk about copyright, logistics and give advice.

Everyone has a story

Ever wonder how publications come up with great stories about people? Everyone has a story, and the devil is in the details — and in the interview process. Learn how to find a great story every time and everywhere in your school. Evaluation code: 3195

Evaluation code: 3448

Judith Murray, MJE, Parkview Arts/Science Magnet High School, Little Rock, Ark. 9 a.m. Saturday, Room 308, Hynes CC (103)

Advising/Teaching

Photographic awesomeness

Kathy Schrier, MJE, Washington News Council, Seattle, Wash. 9 a.m. Saturday, Jefferson, Sheraton (50)

Why consider JEA certification?

Advisers can demonstrate their professionalism by earning Certified Journalism Educator status and even become Master Journalism Educator. This session tells how the JEA certification works and how advisers can gain their CJE or MJE. Evaluation code: 2046

Kim Green, MJE, Columbus (Ind.) North High School 9 a.m. Saturday, Liberty B, Sheraton (60) Advising/Teaching

Keys to a successful year

Learn the value of an objective grade sheet, evidence folders and photo organization. This session will give you some helpful hints how a few minutes or organizing can save you time and prevent signs of premature aging. Evaluation code: 3414

ISSUE SEMINAR, GENERAL AUDIENCE

News Gathering

Renee Burke, MJE, Boone High School, Orlando, Fla. 9 a.m. Saturday, Liberty C, Sheraton (60) Advising/Teaching

The myth of the magical teacher

You know the story of one prominent myth already: New teacher gives entire life to teaching, makes great and lasting changes, and quits. How does this story affect our profession — and us? We’ll explore the myth of the magical teacher in books, television and films, 1960-present. Evaluation code: 3269

Derek Smith, Renton (Wash.) High School 9 a.m. Saturday, Republic B, Sheraton (300) Design

Trends in yearbook

From ads on the New York subway to displays in your local shopping mall, ideas for yearbook are everywhere. See how to take these ideas and apply them to your book in theme, design and coverage. Evaluation code: 3513

Laura Schaub, CJE, Lifetouch, Commerce City, Colo. 9 a.m. Saturday, Room 208, Hynes CC (153)

Evaluation code: 3401

Lori Oglesbee, MJE, and Alyssa Boehringer, McKinney High School, McKinney, Texas 9 a.m. Saturday, Independence West, Sheraton (220)

62 — JEA/NSPA Fall 2013 Convention/Boston

Photojournalism

This session will help young photojournalists develop a mental checklist of “must-have” images to capture at every assignment. Whether a first-year photographer or photo editor, you will learn new tips about combining light, composition and content into visual awesomeness. Evaluation code: 3087

Eric Thomas, MJE, St. Teresa’s Academy, Kansas City, Mo. 9 a.m. Saturday, Room 309, Hynes CC (304) General Audience

NSPA roundtable

New to NSPA or interested in discussing future programming ideas? Advisers are invited to join us for this roundtable discussion. You’ll also have the opportunity to meet with the new NSPA executive director. Evaluation code: 3498

Lindsay Grome, National Scholastic Press Association, Minneapolis, Minn. 9 a.m. Saturday, Room 310, Hynes CC (270) General Audience

What judges look for in your yearbook

Mystified by the critiques you receive for your book? Wondering exactly what the standards are for yearbook journalism? Curious about whether it is worth it to compete? Come to this session and learn tips from a veteran adviser who has judged over the years for five state, regional and national press associations. Evaluation code: 3476

Mary Kay Downes, MJE, Chantilly (Va.) High School 9 a.m. Saturday, Room 311, Hynes CC (435) Leadership and Team Building

Staff motivation

One of the most fascinating and challenging parts of managing a student news publication is staff motivation. After an introduction, there will be time for participants to raise questions, share challenges and consider possibilities. Evaluation code: 3473

Helen Smith, New England Scholastic Press Association, Boston 9 a.m. Saturday, Room 313, Hynes CC (227)

Visit jea.org/eval to evaluate sessions


ATTENTION like this never gets old. For the fourth time in five years, Jostens is honored to earn the prestigious “Benny” in the Premier Print Awards. Our work on the United States Naval Academy Lucky Bag yearbook is just the latest example of how Jostens is the absolute leader in printing excellence. As well as the biggest prize of the night, Jostens took home 12 additional honors in the School Yearbook category — more than any other company.

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 63


saturday 10 a.m. Design

Photo packaging in the 21st century

This session will introduce you to several tangible design tools and techniques you can use to bring your photo-packaging skills into the 21st century. That in turn will give your publication the contemporary look you and your audience deserve. Evaluation code: 3459

Pete LeBlanc, Antelope (Calif.) High School 10 a.m. Saturday, Back Bay B, Sheraton (250) Leadership and Team Building

Top 10 ways to be organized in yearbook

Ever lost a photo or used one twice? Sent your pages in and were several spreads short? Nothing is more frustrating than disorganization affecting the quality of your yearbook. This session will offer tips including photo organizing, developing a ladder and meeting deadlines.

Writing

Ready ... set ... lede! (2 hours)

This double session looks at effective lede writing. The first session will focus on types of ledes, lede tips while reviewing examples of ledes. Participants in the second session will practice lede writing. Participants should bring paper, pen or mobile device on which to write. Evaluation code: 2263

Stan Zoller, MJE, Buffalo Grove, Ill. 10 a.m. Saturday, Beacon E, Sheraton (55) General Audience

Publication pride in the private school

Here is a sharing session for those in parochial/ private schools who want to reach their potential and share their success stories. It also will provide a networking opportunity and sounding board for the trials and tribulations at these schools. Evaluation code: 3273

Mark Novom, Brentwood School, Los Angeles 10 a.m. Saturday, Back Bay C, Sheraton (340)

Marsha Kalkowski, MJE, Marian High School, Omaha, Neb. 10 a.m. Saturday, Beacon G, Sheraton (55)

Entrepreneurship

Design

Evaluation code: 3344

Twitter, journalism and student media

Twitter is becoming a powerhouse in the newsroom as a quick and easy way to tell stories and promote your student media outlet. This session will teach you how Twitter can enhance your media brand and tell stories live. Evaluation code: 3256

Patrick Johnson, CJE, Antioch (Ill.) Community High School 10 a.m. Saturday, Back Bay D, Sheraton (225) Law and Ethics

Open discussion of prior review, censorship (2 hours)

Tell us about your experiences with prior review and censorship. This session, open to all students, advisers and administrators, is only part of an ongoing investigation into the educationally unsound practice of prior review in scholastic media. Evaluation code: 2020

John Bowen, MJE, Kent (Ohio) State University 10-11:50 a.m. Saturday, Beacon A, Sheraton (60) Advising/Teaching

Got conflict?

Most everyone does, and while many may try to avoid it, there are some more practical ways to address it by applying effective conflictresolution skills. In this session, you’ll learn how administrators, advisers and student editors can work together to resolve conflict peaceably in win-win situations. Evaluation code: 3503

Nicole Sanders, Willow Springs Middle School, Lucas, Texas 10 a.m. Saturday, Beacon B, Sheraton (55)

Unleash the fury: Photoshop CS6

Come and learn about doing clean COBs (even with wispy hair) and how to automate and use lesser-known features. Also discover some useful new features of CS6. (Sign up and get ticket at registration desk. Limit 36.)

for 21st Century Skills and Career and Technical Education, will meet to discuss plans and projects for the upcoming year. Evaluation code: 2596 Candace Perkins Bowen, MJE, Kent (Ohio) State University; Gary Lindsay, MJE, Cedar Rapids, Iowa; Brian Wilson, MJE, Waterford (Mich.) Kettering High School; and Jon Reese, CJE, Decatur (Ga.) High School 10 a.m. Saturday, Conference Room, Sheraton Writing

Really? Heard that one before!

Tired of the same old coverage ideas? Heard that story before? Find out new ideas for coverage, packages and stories that will keep your readers’ attention. Evaluation code: 3439

Carolyn Henderson, Walsworth Publishing Co., Matthews, N.C., and Missy Green, Walsworth Publishing Co., Maitland, Fla. 10 a.m. Saturday, Constitution A, Sheraton (300) Design

Now that’s a concept

It’s more than a theme. It’s more than color, type, shapes, texture and “identifiable” elements ... don’t forget that the verbal message and coverage choices are important factors in anchoring and developing the ideas that set this year’s book apart from the others. Evaluation code: 2260

Evaluation code: 2912

Ann Akers, MJE, Herff Jones, Charlotte, N.C., and Ray Slye, Herff Jones, Fair Oaks, Calif. 10 a.m. Saturday, Constitution B, Sheraton (300)

News Literacy

Teaching journalism for English credit

John Dent, Dos Pueblos High School, Goleta, Calif. 10 a.m. Saturday, Berkeley, Sheraton (80)

Explore a (free) digital-age e-book

The book guides your students with more than 1,400 links to primary sources, teaching tools, activities and discussion questions – produced by the John S. and James L. Knight Foundation and the Donald W. Reynolds Journalism Institute at the Missouri School of Journalism. Evaluation code: 3460

Mark Goodman, Kent (Ohio) State University; Eric Newton, John S. & James L. Knight Foundation, Miami, Fla.; and Cathy Collins, Sharon (Mass.) High School 10 a.m. Saturday, Clarendon, Sheraton (50) General Audience

Pinterest for everyone

Pinterest is a pipeline of perfection for your publication. Prepare to be pleasantly pleased. Evaluation code: 3445

Mike Taylor, Walsworth Publishing Co., Mansfield, Texas 10 a.m. Saturday, Commonwealth, Sheraton (250) Meeting

Advising/Teaching

Tired of trying to convince your administration of the benefits of journalism? Come hear this adviser’s experience with teaching journalism as students’ primary English course, and take home some tips to develop your own Common Core-friendly program. Evaluation code: 3263

Julieanne McClain, CJE, Rutherford B. Hayes High School, Delaware, Ohio 10 a.m. Saturday, Exeter, Sheraton (50) Design

DesignNOW

While it usually takes a few years for graphic design trends to hit scholastic journalism, there is no reason you can’t use them now. Learn some hot trends and how to find inspiration from a variety of media to develop a fresh look for your publication. Evaluation code: 3416

Jennifer Freeman, Balfour Yearbooks, North Little Rock, Ark. 10 a.m. Saturday, Fairfax, Sheraton (240)

Educational Initiatives Committee meeting

This JEA committee, including subcommittees on Common Core State Standards, Partnership

64 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


saturday 10-11 a.m. Leadership and Team Building

What’s the BIG idea?

Come to this session to get ideas for infusing your program with energy and passion to help establish a culture of pushing others forward. Evaluation code: 3293

Mitch Eden, MJE, Kirkwood (Mo.) High School 10 a.m. Saturday, Gardner, Sheraton (120) Leadership and Team Building

My producers can beat up your editors

You know, they are like editors for broadcast, but different. Get help from two advisers who have explored what “producer” should truly mean. We’ll talk roles, responsibilities, expectations and workflow. And no, we won’t actually beat anyone up ... promise. Evaluation code: 3370

Matt Rasgorshek, Westside High School, Omaha, Neb., and Jesse Sutherland, CJE, Waterford (Mich.) Kettering High School 10 a.m. Saturday, Hampton, Sheraton (110) Multimedia Broadcast

How to be funny

Incorporate humor into your broadcast that won’t make your audience roll their eyes and your administrators cover their ears. Evaluation code: 2196

Alyssa Boehringer, McKinney (Texas) High School 10 a.m. Saturday, Independence West, Sheraton (220) General Audience

Producing a winning JOY portfolio (2 hours)

Examine winning portfolios in JEA’s Journalist of the Year scholarship competition and see how you can win money for your college education. This session will examine the scoring rubric and all aspects of the portfolio preparation and presentation. Evaluation code: 2171

Wayna Polk, MJE, Weatherford, Texas, and Lisa Van Etta, Duchesne Academy of the Sacred Heart, Houston, Texas 10 a.m. Saturday, Jefferson, Sheraton (50) Advising/Teaching

Presentation of MJE projects for advisers

Teachers who recently earned JEA’s Master Journalism Educator status will formally present their MJE projects, followed by a Q-and-A time. They will give hints on how to finish the project and join the ranks of an elite group of teachers who have completed the highest level of journalism teaching certification in the nation. Mentoring will be available for those ready to begin an MJE project. Evaluation code: 3299

Rod Satterthwaite, MJE, Dexter (Mich.) High School, and Joe Mirando, MJE, Southeastern Louisiana University Hammond, La. 10 a.m. Saturday, Liberty B, Sheraton (60)

Twitter: @nhsjc/#nhsjc

Advising/Teaching

Writing

So it’s finished — now what?

So the final pages of the yearbook have shipped and the last newspaper is at press. What will you do until the end of the year? Learn the value of a student portfolio and how to assign and grade it. Evaluation code: 3415

Renee Burke, MJE, Boone High School, Orlando, Fla. 10 a.m. Saturday, Liberty C, Sheraton (60)

So you want to be a columnist

Columnists — whether in print or online — need finely tuned perspectives, observations, voice and writing skills. Come learn how to capture and refine those skills in yourself to become a columnist/ blogger/ writer others can’t wait to read. Evaluation code: 3265

Pat Graff, Albuquerque, N.M. 10 a.m. Saturday, Room 310, Hynes CC (270)

General Audience

Team storytelling wrap-up

News Gathering

Students who participated in Thursday’s team storytelling workshop are invited to this special session to review the results of their efforts. Evaluation code: 2290

Amy DeVault, MJE, Wichita (Kan.) State University, and Kelly Glasscock, Derby (Kan.) High School 10 a.m. Saturday, Republic B, Sheraton (300) News Literacy

Change the world through your journalism. This session will show you how two school newspapers have covered stories that have had deep impacts on their school communities through the simple act of doing good journalism combined with service projects. Evaluation code: 3358

Jonathan Rogers, MJE, Iowa City (Iowa) High School, and Matthew Schott, CJE, Francis Howell Central High School, St. Charles, Mo. 10 a.m. Saturday, Room 208, Hynes CC (153) Leadership and Team Building

Not true! At this participation session you will learn what five things editors say frequently. Discuss and share comments about your daily routines of publications, staff organization, photography needs, deadlines and other concerns. You’re the editor! No advisers, please. Evaluation code: 3276

Sheryl Fulton, Jostens, Topeka, Kan.; Bonnie Blackman, CJE, Jostens, Tinton Falls, N.J., and Linda Chambers, Nashville, Tenn. 10 a.m. Saturday, Room 308, Hynes CC (103)

Writing

Writing about health and science

Health and science news is everywhere — that cool study about the possibility of life on other planets, a new required vaccine for teens, or the latest global warming worry. An experienced science writer explains how to tell these stories for your audience. Karen Weintraub, Boston University, Boston 10 a.m. Saturday, Room 313, Hynes CC (227)

11 a.m. Photojournalism

Shop ‘til you drop

With three bake sales and a few quarters you dug out of your mom’s couch, it’s time to buy! We’ll talk camera equipment for publication staffs: what to prioritize, how to invest in resources for a staff, and how to pay for it all. Evaluation code: 3421

Photojournalism

So many times, a good photo can become a great photo if the photographer takes just a few extra minutes to truly consider the crop before it’s placed on the page. Come to this session to learn how to crop to your advantage. Jill Chittum, MJE, Walsworth Publishing Co., Bella Vista, Ark. 10 a.m. Saturday, Room 309, Hynes CC (304)

Seth Mnookin, Massachusetts Institute of Technology, Cambridge, Mass., and Taylor Dobbs, Vermont Public Radio, Colchester, Vt. 10 a.m. Saturday, Room 311, Hynes CC (435)

Evaluation code: 3409

Being in charge is easy?

Evaluation code: 2159

Seth Mnookin, an MIT professor, and Taylor Dobbs, a Northeastern undergraduate, were among the first reporters on the scene as police chased the Marathon bombing suspects in April. They explain how they used whatever tools they had at their disposal to report timely, accurate information. Evaluation code: 3356

Why not be awesome?

Good crop, bad crop

Covering marathon mayhem

Mike Simons, CJE, West High School, Painted Post, N.Y. 11 a.m. Saturday, Back Bay A, Sheraton (250) Design

A designer’s guide to what works

See current trends in publications and from mass media from a designer’s perspective. Be inspired by the best-looking materials from the world of graphic design. Evaluation code: 2153

Rick Brooks, CJE, Jostens, Port Matilda, Pa. 11 a.m. Saturday, Back Bay B, Sheraton (250)

JEA/NSPA Fall 2013 Convention/Boston — 65


Use “A Simple Approach to Great Captions,” our complete video lesson with handouts and activities, in your classroom. Get photographers working quicker with our One Week to Better Photography Lessons. Come to Kansas City for training at our July Adviser Academy and leave prepared for the school year. Set up live training in your classroom with a Technology Learning Center webcast. Prepare your students with The Yearbook Suite curriculum guide, which covers every topic and reinforces lessons with handouts and quizzes. Find what you need to know in Idea File magazine, Idea File Extra and Idea File online, including our New Adviser Primer, Interviewing Primer, Copywriting Primer and Distribution Primer. Come by the Walsworth booth to learn all about these teaching tools, and more! 800-972-4968 walsworthyearbooks.com 66 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


saturday 11 a.m. Design

All things news magazine

Not a traditional newspaper nor a yearbook? Where should your staff turn for design and story inspiration? Nationally, magazine sales are booming. In order to refine your publication, we will analyze trends and provide resources for all things news magazine. Evaluation code: 3386

Paige Cox, Loudoun Valley High School, Purcellville, Va. 11 a.m. Saturday, Back Bay C, Sheraton (340) Entrepreneurship

Just hashtag it: social media and your publication

The advisers of Niles West News and the Tom Tom will show how their publications use social media such as Facebook, Twitter, Tumblr, Pinterest and Instagram to enhance content, gain readership, run contests and promote the publication’s brand. Evaluation code: 3381

Evelyn Lauer, CJE, Niles West High School, Skokie, Ill., and Patrick Johnson, CJE, Antioch (Ill.) Community High School 11 a.m. Saturday, Back Bay D, Sheraton (225) Advising/Teaching

Reelin’ them in

Two veteran advisers discuss some secrets to getting students to sign up and stay in journalism classes for the long haul. Evaluation code: 3509

Pat Hinman and Adrienne Forte, Robinson Secondary School, Fairfax, Va. 11 a.m. Saturday, Beacon B, Sheraton (55)

where to look. Uncover an easy secret to turn around your yearbook coverage.

Design

InDesign tricks and tips

Learn how to be more creative and productive with InDesign software. (Sign up and get ticket at the registration area. Limit 36.) Evaluation code: 3102

Linda Drake, MJE, Chase County Junior-Senior High School, Cottonwood Falls, Kan. 11 a.m. Saturday, Berkeley, Sheraton (80)

Advising/Teaching

DIY: how to build successful publications

Advising/Teaching

Struck a nerve (advisers only)

We have identified the most serious sins committed by our students, and we will tell you how we deal with them. Join us to discuss staff management and advising issues. We’ll do our best to solve your issues, or at least ease the pain. Evaluation code: 3095

Kathy Habiger, MJE, Mill Valley High School, Shawnee, Kan., and Amy Morgan, MJE, Shawnee Mission West High School, Overland Park, Kan. 11 a.m. Saturday, Clarendon, Sheraton (50) Writing

How to write lame, boring stories

“Why are we writing these stories? No one reads them, anyway.” If that question and statement have ever graced your lips or ears, you are already thinking of ways to enhance the writing in your yearbook. Evaluation code: 3446

Mike Taylor, Walsworth Publishing Co., Mansfield, Texas 11 a.m. Saturday, Commonwealth, Sheraton (250)

Insanity NOT required for advisers

This session will be helpful for new advisers, middle school advisers without journalism experience and those advisers who are losing their passion for advising yearbooks. Ideas will be offered for recruiting, motivating and training of staff. Advisers are often frustrated but new strategies can help. Evaluation code: 3501

Carole Babineaux, CJE, Liberty High School, Frisco, Texas 11 a.m. Saturday, Beacon G, Sheraton (55) Advising/Teaching

Advisers will discuss the rationale for creating a staff manual. They also will share strategies and resources for planning the contents of the manual. Evaluation code: 2222

Susan V. Everett, MJE, Jersey City, N.J. 11 a.m. Saturday, Beacon H, Sheraton (55)

Twitter: @nhsjc/#nhsjc

Writing

Humor me (please)

Learn about humor columns and what does — and does not — make them funny. The session will include topic selection and development and then what to do with those topics. Participants will laugh at least twice. Evaluation code: 3354

Greg Gagliardi, Cherry Hill (N.J.) High School East 11 a.m. Saturday, Fairfax, Sheraton (240)

We will present a grading system for yearbook that is aligned with contemporary assessment theory. We will talk about the philosophy of grading and offer practical approaches to ensure student success and confidence in grading. Rubrics and classroom examples will be shared.

JEA Awards Committee meeting

Committee members will meet to discuss award procedures. Jack Kennedy, MJE, Colorado High School Press Association, Highlands Ranch, Colo. 11 a.m. Saturday, Conference Room, Sheraton

Evaluation code: 3193

Kathy Smith, MJE, Downers Grove (Ill.) North High School, and John Waite, Community High School District 99, Downers Grove, Ill. 11 a.m. Saturday, Gardner, Sheraton (120)

Design

Let’s go shopping

Find out where to go shopping for those fabulous fonts, colors and ideas to make your yearbook spreads more exciting, consistent and award winning. Carolyn Henderson, Walsworth Publishing Co., Matthews, N.C., and Missy Green, Walsworth Publishing Co., Maitland, Fla. 11 a.m. Saturday, Constitution A, Sheraton (300)

Multimedia Broadcast

Advanced story structure for broadcast

You’ve mastered the basic news story but are looking for new ways to keep it fresh and dynamic. This session will use examples to discuss advanced techniques for organizing your information, how to get and use great sound bites, and how to play off b-roll. Evaluation code: 3325

News Gathering

Not the same old story

Evaluation code: 3392

Georgia Dunn, MJE, and Wayne Dunn, CJE, Well Dunn Images, Lebanon, Ohio, and Julieanne McClain, CJE, Rutherford B. Hayes High School, Delaware, Ohio 11 a.m. Saturday, Exeter, Sheraton (50)

Advising/Teaching

Evaluation code: 3438

Staff manuals: why and how

Trying to resurrect a publication? Beginning a publication/journalism program? Lost about how to begin? Wayne started a program from scratch, Julianne built up a struggling program, and Georgia restarted a dormant one. These three people share some ideas about how to be successful.

Taming the beast: grading in yearbook

Meeting

Advising/Teaching

Evaluation code: 3436

Nancy Hastings, MJE, Highland, Ind. 11 a.m. Saturday, Constitution B, Sheraton (300)

From fashion trends to dating, some yearbook staffs find themselves bogged down with the same overused story ideas year after year. Feature ideas lurk everywhere, if you know

Dave Davis, Hillcrest High School, Springfield, Mo., and Brandon Goodwin, The Academy of Scholastic Broadcasting, Springfield, Mo. 11 a.m. Saturday, Hampton, Sheraton (110)

JEA/NSPA Fall 2013 Convention/Boston — 67


saturday 11 a.m.-noon Writing

Yearbook writing: the chicken or the egg?

Wait. Let me guess. The students in your school don’t understand why you would even bother spending time on yearbook stories, because nobody reads them anyway. But maybe that’s because they’re, um, not very good. Join us to hatch some innovative and useful yearbook writing methods. Evaluation code: 3363 Brian Wilson, MJE, Waterford (Mich.) Kettering High School 11 a.m. Saturday, Independence East, Sheraton (120)

Design

Color: Use it; don’t abuse it

You’ve seen yearbook pages and magazine ads that are chaotic, busy, overwhelming and just over-designed. Sometimes too much color can give you a headache. Come learn how less is more and properly choosing color can enhance your readers’ experience. Evaluation code: 3441

Gina Cuccovia-Simoneau, Walsworth Publishing Co., Attleboro, Mass. 11 a.m. Saturday, Room 208, Hynes CC (153) General Audience

News Gathering

Coverage that counts

What’s the hot trend that every staff should work toward? More coverage. See how yearbooks use modular design and umbrella coverage to effectively expand beyond the traditional copy block, giving their readers more information, more angles and more appeal. Evaluation code: 2835

Literary magazine roundtable

Bring your questions about starting a magazine, getting submissions and working with reluctant writers. Discuss staff manuals, organization and expectations. Do you wonder how to promote, finance and sell? An adviser of 26 awarded literary-art magazines will focus on your concerns. Evaluation code: 3013

Lynn Strause, Herff Jones, East Lansing, Mich. 11 a.m. Saturday, Independence West, Sheraton (220)

Carol Lange, CJE, Reston, Va. 11 a.m. Saturday, Room 308, Hynes CC (103)

Advising/Teaching

Law and Ethics

MJE: Yes, you can!

This session is designed for advisers who are considering or engaged in obtaining their Master Journalism Educator certification. An overview of the process as well as an opportunity for asking questions will be available. Evaluation code: 3078

Cathy Wall, MJE, Harrisburg (Ill.) High School 11 a.m. Saturday, Liberty B, Sheraton (60) Advising/Teaching

Do it all

Mountain Vista High School in Highlands Ranch, Colo., has combined its news magazine, yearbook and broadcast media into a blended program, VISTAj. This session will explore the why and how of the comprehensive journalism program. Evaluation code: 3361

Mark Newton, MJE, Mountain Vista High School, Highlands Ranch, Colo. 11 a.m. Saturday, Liberty C, Sheraton (60) Leadership and Team Building

Where does the time go?

Managing a successful student media program involves more than just reporting and producing stories. This session will match philosophy to productivity strategies and examine how it affects our publications. We’ll discuss how to create time for effective training, focus groups, reflection, social media and more.

We regret the error

Mass media outlets, from newspapers to television to online media, are undergoing a crisis in credibility. And without credibility, true journalistic outlets might as well be armchair bloggers. Come discuss the importance of credibility in all legitimate media outlets and learn ways to enhance credibility.

Noon Writing

Interview for the iceberg

It’s all about the lede — that tip of the information iceberg that hooks your readers. Reels ‘em in. But first, you have to ask the right questions. Join in on this interactive session on interviewing and lede writing — don’t forget your pen and paper. Evaluation code: 3428

Sarah Lockwood, Balfour Publishing, Charlottesville, Va. Noon Saturday, Back Bay A, Sheraton (250) Design

Yearbook ins and outs

Trends are constantly changing, even in the world of yearbooks. See how current trends are taking over ideas, themes and concepts from high school and college yearbooks nationwide. Evaluation code: 3435

Shelby Brunk, Kansas State University, Manhattan, Kan. Noon Saturday, Back Bay B, Sheraton (250) News Gathering

Mob reporting

During a flash mob, people dance in synchronized fashion. Flash mobs take much coordination and planning, so why not use this approach to cover important events in your community? Learn how to use your entire publication staff to create in-depth coverage of a single event. Evaluation code: 3466

Evaluation code: 3198

Amy DeVault, MJE, Wichita (Kan.) State University, and Kristin Baker, CJE, Andover (Kan.) High School Noon Saturday, Back Bay C, Sheraton (340)

News Gathering

Covering breaking news: two steps forward, one step back

Bradley Wilson, MJE, Midwestern State University, Wichita Falls, Texas 11 a.m. Saturday, Room 309, Hynes CC (304)

Arts coverage in a new era

Arts reporter and former Boston Globe pop music critic Joan Anderman explains how technology and the rapidly evolving nature of the news business have changed arts coverage and music criticism — and how they haven’t. Evaluation code: 3355

Joan Anderman, Newton, Mass. 11 a.m. Saturday, Room 310, Hynes CC (270) Entrepreneurship

How to sell advertising for news publications This session is for print and digital publications and covers ways to find advertising leads, make sales and keep track of accounts. Evaluation code: 3490

Helen Smith, New England Scholastic Press Association, Boston 11 a.m. Saturday, Room 313, Hynes CC (227)

Evaluation code: 3271

Sarah Nichols, MJE, Whitney High School, Rocklin, Calif. 11 a.m. Saturday, Republic B, Sheraton (300)

68 — JEA/NSPA Fall 2013 Convention/Boston

News Gathering

At its best, breaking news coverage is exciting, relevant, challenging, informative and important. Last year was a big year for breaking news in New England, with weather catastrophes and national tragedies. But breaking news also poses a challenge: how to sustain professional, comprehensive coverage. Evaluation code: 3391

Julia McNamee, Sophie de Bruijn and Aaron Hendel, Staples High School, Westport, Conn. Noon Saturday, Back Bay D, Sheraton (225) Entrepreneurship

Creative Commons: Set your content free

The content you’re creating today is your calling card for future professional opportunities. Is it reaching the biggest audience possible? Learn how student journalists are using open licensing to collaborate with a global team and

Visit jea.org/eval to evaluate sessions


saturday noon amplify their exposure.

Photojournalism

Evaluation code: 3331

Elliot Harmon, Creative Commons, Mountain View, Calif. Noon Saturday, Beacon E, Sheraton (55) Multimedia Broadcast

Shooting with Speedlights

Learn the fundamentals of intermediate lighting for stunning portraits with or without a studio using Speedlights. Discover its creative potential in the photographic workflow. Evaluation code: 3500

Final Cut Pro X basics (2 hours)

In this two-hour hands-on session, learn the basics of this pro app. We will cover media management, timeline options, titles, transitions and more. (Sign up and get ticket in the registration area. Limit 36.) Evaluation code: 2839

Michael Hernandez, Mira Costa High School, Manhattan Beach, Calif. Noon Saturday, Berkeley, Sheraton (80) Advising/Teaching

Taking the dread out of deadlines

Blake Garcia, Academy of Art University, San Francisco Noon Saturday, Commonwealth, Sheraton (250) Design

Wow factor

When it comes to your newspaper, readers want a reason to come inside. Turn gray, textheavy pages into an eye-popping experience. You’ll get 60 new page designs and story ideas in this slick, fast-paced presentation. Come ready to go home with creative ideas and many ways to wow your students. Evaluation code: 2360

Evaluation code: 3440

Katie Krueger, Walsworth Publishing Co., Annapolis, Md. Noon Saturday, Constitution B, Sheraton (300) Web

Creating a teen news website

If teenagers could build their own news website, what would it look like? The Boston Globe is developing a website designed especially for teens with news content for them and by them. Students are invited to join the discussion and offer their ideas. Evaluation code: 3385

Christine Casatelli, The Boston Globe Noon Saturday, Exeter, Sheraton (50) Advising/Teaching

Creating a better publication

Have you ever been at a deadline night and wondered “how did this happen?” and “how can I avoid this happening again?” Come let us help you answer those questions. Bring your thumb drive if you want handouts.

Jim McGonnell, New Smyrna Beach, Fla. Noon Saturday, Constitution A, Sheraton (300)

Evaluation code: 2277

How do you take an idea from a magazine, website or yearbook sample and transform it to function in your yearbook? With a few simple guidelines, your yearbook can become

Ronna Sparks Woodward, MJE, and Jennifer Higgins, Liberty (Mo.) North High School Noon Saturday, Clarendon, Sheraton (50)

a designer’s dream come true. Learn how to painlessly design a yearbook that is clean, contemporary and creative.

Learn the tools for creating a better publication from the coordinator of a high school journalism program.

Design

Design on a dime

Evaluation code: 3341

Jessica J. Jensen, South Dakota State University, Brookings, S.D. Noon Saturday, Fairfax, Sheraton (240)

JEA/NSPA Spring National High School Journalism Convention

SAN DIEGO MAKING WAVES

April 10-13, 2014 • Hilton San Diego Bayfront

For more information: www.jea.org • nspa.studentpress.org • sandiego.journalismconvention.org Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 69


At Friesens, we believe High School Yearbooks create a better future. Friesens wants to partner with secondary schools that believe school yearbooks are important, a lasting legacy that preserves memories, educates students, develops tomorrow’s leaders, and creates a better future.

Join the movement. Create a better future today. For more information, contact: Fred Perrin, General Manager 1.888.324.9725 fredp@friesens.com

yearbooks.friesens.com 70 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


saturday noon-1 p.m. General Audience

Youth newspapering: Teens in Print

The session will include a brief history of Teens in Print as a collaboration between WriteBoston and The Boston Globe, its emphasis on doing stories generated by young people, and a look at how it recruits and retains a staff of dedicated youth journalists. Evaluation code: 3411

Ric Kahn, Teens in Print, Roxbury, Mass. Noon Saturday, Gardner, Sheraton (120) Multimedia Broadcast

Intermediate videography for broadcast

Go beyond the rule of thirds and discover helpful videography techniques: seven camera angles, easy lighting solutions, creative framing and more professional techniques. You’ll get plenty of tips to move beyond video basics. Evaluation code: 3312

Don Goble, Ladue Horton Watkins High School, St. Louis, Mo. Noon Saturday, Hampton, Sheraton (110) General Audience

From convention to career

How does your experience on a high school publication turn into a career in journalism? Three reporters who spent their high school years going to JEA/NSPA conventions explain how they have grown their scholastic experiences into successful careers. Evaluation code: 3349

Ariel Wittenberg, New Bedford Standard Times, New Bedford, Mass.; Katie Sanders, Glamour, New York; and Jen Wieczner, Wall Street Journal, New York Noon Saturday, Independence East, Sheraton (120) Leadership and Team Building

Globe games for focus and fun

Need to learn some new team-building games? The ones in this session come from the Globe Theatre actors in London who use them as warm-ups to improve focus. Come play for a bit, and then teach your staff when you get home. Evaluation code: 3433

Bernadette Cranmer, MJE, Granite Bay (Calif.) High School Noon Saturday, Independence West, Sheraton (220) Law and Ethics

The law of social media

Can schools punish what students say on Twitter, even off-campus? Am I responsible if I retweet someone else’s libelous statement? Does Instagram really own my pictures? Learn what you need to know about the law of social media before you push “share.” Evaluation code: 3314

Frank LoMonte, Student Press Law Center, Arlington, Va. Noon Saturday, Jefferson, Sheraton (50)

News Gathering

News Gathering

1 day, 1 story

Seventy high school journalists made history this summer by reporting on a national event happening in their backyard. Newsroom by the Bay reported on the passing of California’s Prop 8 and the Defense of Marriage Act by creating a website. Evaluation code: 3491

Erica Goldhawk, Amador Valley High School, Pleasanton, Calif., and Jacob Cader, Ethical Culture Fieldston School, Bronx, N.Y. Noon Saturday, Liberty B, Sheraton (60)

Nailed it: media credentials and celebrity interviews

So you’re a teen and you want to get that big celebrity interview. It’s not going to happen unless you know some secrets. Find out how this high school student has done more than 300 celebrity interviews with credentials at red carpet events and top venues. Evaluation code: 3489

Pavlina Osta, Spruce Creek High School, Port Orange, Fla. Noon Saturday, Room 309, Hynes CC (304) Adviser Event

Adviser awards luncheon

Law and Ethics

Gray areas: case studies in photo ethics

Unfortunately, photographers have goofed up enough over the years to give us a lot of examples of what not to do in photojournalism ethics. This session will apply sound photo ethics to situations of sly manipulation, extreme cropping and outright deception. Are you a new photographer? Come for a first lesson in what to do and what not to do. Are you an experienced shooter? Come for new ways to persuade your photographers to be truthful.

JEA, NSPA and Dow Jones News Fund will present awards at this special event. New and renewing Certified Journalism Educators and Master Journalism Educators will be recognized. Linda Barrington, JEA’s Carl Towley Award winner and Jim Streisel, Dow Jones Teacher of the Year, will speak. Preregistration was required. Please bring your ticket. Herff Jones has underwritten this event. Noon Saturday, Room 312, Hynes CC (500)

Evaluation code: 3461

1 p.m.

Entrepreneurship

Ads to be had

Eric Thomas, MJE, St. Teresa’s Academy, Kansas City, Mo. Noon Saturday, Liberty C, Sheraton (60)

Entrepreneurship

Do the ‘write’ thing

PressFriends is an ideal community service project for high school publication groups (newspaper, yearbook, literary magazines, etc.). We run after-school newspaper clubs at lower income elementary schools and strive to make writing fun for student reporters. The program is cost effective and easy to implement. Learn how you can develop PressFriends in your community. Evaluation code: 3470

Luke Southwell, Palos Verdes Peninsula High School, Rolling Hills Estates, Calif. Noon Saturday, Republic B, Sheraton (300) General Audience

Multimedia storytelling: the ‘My Life, My Town’ project

Evaluation code: 3258

Jami Williams, Mexico (Mo.) High School 1 p.m. Saturday, Back Bay A, Sheraton (250) Writing

All the small things

Story is written ... layout is done ... now for the headline and captions. Help is on its way with practical tips and guidelines for writing meaningful and interesting headlines and captions. Evaluation code: 2353

Missouri School of Journalism professors will discuss multimedia storytelling and the best tools to fit almost every school budget. Use what you learn to document the lives of teens in your town and get ready to enter the “My Life, My Town” national contest in spring 2014. Evaluation code: 3534

Looking to increase ad sales revenue for your yearbook? With proven techniques, templates and a basic sales plan outline that can double as a marketing and business management unit, this speaker will give you everything you need to walk out the door and into success.

Brian Kratzer and Janet Saidi, University of Missouri, Columbia, Mo. Noon Saturday, Room 208, Hynes CC (153)

Crystal Kazmierski, Arrowhead Christian Academy, Redlands, Calif., and Susan Massy, Shawnee Mission Northwest High School, Shawnee, Kan. 1 p.m. Saturday, Back Bay B, Sheraton (250) Web

Two-way journalism

Today, everybody walks around with a camera and wants to report what they see. How can journalists work with citizen reporters to cover their communities? Evaluation code: 3348

Adam Gaffin, Universal Hub, Roslindale, Mass. 1 p.m. Saturday, Back Bay C, Sheraton (340)

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 71


saturday 1 p.m. Leadership and Team Building

Literary magazines from the ground up

Learn how to take a barely functioning or visible literary magazine and turn it into something treasured by students, faculty, parents and the community beyond the school walls. Learn how to make the magazine really matter to all while uplifting the arts in the community. Evaluation code: 3278

Susan Turner Jones, Sierra Canyon School, Chatsworth, Calif. 1 p.m. Saturday, Back Bay D, Sheraton (225) Entrepreneurship

It will all be worth it

Learn how three N’s — networking, nerves and never saying no — brought entrepreneurial journalists to create a new print magazine, Aberrance Quarterly. View the eye-dazzling pages and eye-opening exposés staffers gambled to investigate. Evaluation code: 3523

Alexa Pence, duPont Manual High School, Louisville, Ky. 1 p.m. Saturday, Beacon A, Sheraton (55)

Writing

Funny speech, free speech, good citizenship

From the Founding Fathers to the Supreme Court, our country’s philosophical leaders have asserted that critiquing authority is part of the American birthright. Since journalists are often those most knowledgeable, they play an important role in society in their editorial voice and leadership. Evaluation code: 3478

Tom Sivertsen, Redwood High School, Larkspur, Calif. 1 p.m. Saturday, Constitution B, Sheraton (300) Leadership and Team Building

New kids on the block

OK, you are on staff, now what? This mustattend session for all newbies will give you some tips to make your first year on staff go smoothly. Evaluation code: 3376

Mindy Gilman, Blue Valley North High School, Overland Park, Kan. 1 p.m. Saturday, Exeter, Sheraton (50) Design

Advising/Teaching

Discover the solutions

With our presentation and an encouraging discussion environment, let us help you discover the resources and solutions you need to overcome the obstacles you face in the yearbook classroom, such as staff management, grading and student accountability.

Making design work

Learn how design can work for you. Become more aware of the tricks and tips of design for your publication. Evaluation code: 3340

Photojournalism

Mobile media and the cheap

More and more newspapers are outfitting their journalists with smartphones with the expectation that they can transmit images/ video from the scene to be published right away on the Web. Learn how to use mobile devices, apps and equipment with a minimal amount of cost. Evaluation code: 2013

Greg A. Cooper, Brooks Institute, Ventura, Calif. 1 p.m. Saturday, Clarendon, Sheraton (50) News Gathering

Trauma reporting

This presentation will go over how to research and prepare for an article that involves victims of trauma. It will be a how-to on protecting sources, considerations before publication and dealing with the aftermath in the media, using a rape culture article for reference. Evaluation code: 3479

Lisie Sabbag, Emerson College, Boston 1 p.m. Saturday, Constitution A, Sheraton (300)

Evaluation code: 3390

Jed Palmer, Sierra Middle School, Parker, Colo. 1 p.m. Saturday, Independence East, Sheraton (120) Photojournalism

Crafting compelling multimedia stories

This session will help inspire you to make great multimedia projects for your publication, regardless of technology and skill level. Learn basic skills for making sense of multimedia and creating compelling stories. Evaluation code: 3264

David Foster, Kent (Ohio) State University 1 p.m. Saturday, Independence West, Sheraton (220) Law and Ethics

‘I found this great photo on Google Images, and ...’

When is it OK to help yourself to someone else’s photo, video or music that you find on the Web? You may have more — and fewer — rights than you think. We’ll look at common fair-use issues and how to stay on the right side of copyright. Evaluation code: 2796

Jessica J. Jensen, South Dakota State University, Brookings, S.D. 1 p.m. Saturday, Fairfax, Sheraton (240)

Frank LoMonte, Student Press Law Center, Arlington, Va. 1 p.m. Saturday, Jefferson, Sheraton (50)

Entrepreneurship

Organized chaos — 1:1 in a multimedia classroom

Evaluation code: 3437

Paula Adamek, Yoakum (Texas) High School, and Ryan Rinaldi, Walsworth Publishing Co., Austin, Texas 1 p.m. Saturday, Beacon E, Sheraton (55)

to arrive at an event prepared, shoot strong photos and tell the story through the five levels of photographs. Yearbook, newspaper and Web can all benefit from great storytelling photography.

Leadership and Team Building

Strengthening your newsroom with social media

With today’s technology, reporters are always on the clock. Find out how to use social media to not only improve your reporting, but also expand your coverage to reach a wider audience. Evaluation code: 3305

Melissa Warner and Casey Tedrow, Center Grove High School, Greenwood, Ind. 1 p.m. Saturday, Gardner, Sheraton (120)

Life in a multimedia classroom can seem out of control to an outsider. There are steps that can be taken to organize the chaos. Learn how to use technology, the Internet and various computer programs effectively in order to maintain a well-organized multimedia classroom. Evaluation code: 3364

Kim Isbell and Anna Setter, Humboldt (Kan.) High School 1 p.m. Saturday, Liberty B, Sheraton (60)

Multimedia Broadcast

Tips and tricks for sports broadcasting

“Why don’t you cover the (insert sport here) team more?” If you are tired of hearing this, we have some tips and tricks to covering more sports with fewer people, and how to use sports to increase viewership of your broadcast program. Evaluation code: 3468

Kyle Juntunen, Allen (Texas) High School 1 p.m. Saturday, Hampton, Sheraton (110) Photojournalism

Photos in 5

Advising/Teaching

P21: The power of yearbook production

Connecting 21st century skills into your classroom is not additional work. Advisers have been doing it for years. Learn the specifics and how to convey that message to administrators, parents and the community. Scholastic journalism is powerful and creates “learners who can make a living.” Evaluation code: 3443

Denise Nosbisch, Walsworth Publishing Co., Holly Springs, N.C. 1 p.m. Saturday, Liberty C, Sheraton (60)

Visual storytelling is critical regardless of the media you are working in. Come learn how

72 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


GET THE TRAINING Learn from the best Our faculty include awardwinning journalists and scholars who have a wide variety of experiences in the profession. They connect with students in small classes where they provide one-on-one instruction.

THE EXPERIENCES Beyond the classroom In addition to classes with experts, IU School of Journalism students: § Land media internships around the world § Connect with top journalists through our Speaker Series § Study abroad in our innovative travel courses § Network with professionals at conferences § Visit working pros at their workplaces

AND THE CONNECTIONS YOU NEED

k

Find out more at

journalism.indiana.edu. Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 73


saturday 1-2:30 pm Entrepreneurship

So you want to meet Anderson Cooper

It’s not what you know; it’s whom you know. It’s not what you say; it’s what they hear. Learn how to be credentialed for any event, cover any story, access any records, work anywhere, and meet anybody (yes, including Anderson Cooper). Evaluation code: 3105

Julian Wright, Columbia University, New York City, N.Y. 1 p.m. Saturday, Republic B, Sheraton (300) Photojournalism

Picture speaks 1,000 words

Wonder how professional photographers take those amazing photos for magazines and newspapers? Wonder how you can do the same for your yearbook and school publication? Learn all the little things you can do that will make a big difference and how to prepare to take great pictures that will help tell your stories. Evaluation code: 2603

Edmond Kwong, Homestead High School, Cupertino, Calif. 1 p.m. Saturday, Room 208, Hynes CC (153) General Audience

The next level

How do you continue your journalism career in college? Three editors of Boston-area college newspaper explore the promises and pitfalls of building a career in journalism at the next level. Evaluation code: 3398

Bobby Samuels, The Harvard Crimson, Cambridge, Mass.; and Chris Lisinski, Boston (Mass.) University; and Evan Sporer, The Berkeley Beacon, Boston 1 p.m. Saturday, Room 308, Hynes CC (103) Writing

Lightning ledes: strong story starters

It doesn’t matter how great your story is if no one makes it past the first few lines. This session will explore different ledes that will set your story apart and make the reader not only want but also need to keep reading. Evaluation code: 3313

Bailey McBride, Bishop Kelley High School, Tulsa, Okla. 1 p.m. Saturday, Room 309, Hynes CC (304)

2:30 p.m. Design

Graphic balancing acts

Yearbook designers must learn the art of juggling content-driven design to have the most impact on its readers. A careful balance of the verbal/visual elements, typography, color and space results in concept and coverage that creates the greatest storytelling on earth.

Design

But wait! There’s more!

Just when you thought you were finished, the forgotten parts of the book demand attention. This session will give you plenty of ideas for making the ads/senior tributes, index and group shots an integral part of the theme and design of your yearbook. Evaluation code: 2819

Computer Software

‘How do I ...?’ using InDesign

This question-and-answer session will show you how to create your designs and layouts using InDesign. A graphic designer will help you on the spot with techniques that may be puzzling you. (Sign up and get ticket at convention registration area. Limit 36) Evaluation code: 2956

Crystal Kazmierski, Arrowhead Christian Academy, Redlands, Calif., and Susan Massy, Shawnee Mission Northwest High School, Shawnee, Kan. 2:30 p.m. Saturday, Back Bay B, Sheraton (250)

Hal Schmidt, PS Graphics/Balfour Yearbooks, Houston, Texas 2:30 p.m. Saturday, Berkeley, Sheraton (80)

News Gathering

Networking in 6 steps

Leadership and Team Building

Beyond the interviewing basics

“Duh” questions get lifeless responses. Discover techniques that are sure to elicit powerful anecdotes, useful stats and charged reactions. You’ll also hear the best three words to start any interview. Bonus: Learn to decipher your interviewee’s body language!

Education is much more than just going to class. Internships, workshops, contests and peer interaction are vital parts of a student’s learning process. Six steps to maximize your education experience will assist the student in their approach to college life and beyond. Evaluation code: 3486

Evaluation code: 2113

Greg A. Cooper, Brooks Institute, Ventura, Calif. 2:30 p.m. Saturday, Clarendon, Sheraton (50)

Law/Ethics

Going long online

Jon Reese, CJE, Decatur (Ga.) High School 2:30 p.m. Saturday, Back Bay C, Sheraton (340)

Writing

Creating a positive First Amendment environment at your school

Members of JEA’s 45words student initiative will share advice and anecdotes about how to foster a positive school environment for all aspects of the First Amendment. Whether your school embraces press freedom or restricts it, you’ll be able to come away from this session with ideas and plans for how to make your school more First Amendment friendly. Evaluation code: 3504

Matthew Schott, CJE, Francis Howell Central High School, St. Charles, Mo.; Nikki Ferrera, Hillsborough High School, Tampa, Fla.; Eden Kreighbaum, St. Teresa’s Academy, Kansas City, Mo.; Sarah Heet, Kirkwood (Mo.) High School; Suproteem Sarkar, Conestoga High School, Berwyn, Pa.; Jacob Potash, Iowa City (Iowa) High School; Tyler Paley, Communications High School, Wall Township, N.J.; and Emily Aiken, Francis Howell High School, St. Charles, Mo. 2:30 p.m. Saturday, Back Bay D, Sheraton (225) Writing

Write it tight; write it right

This session will help make the writing in your publications snappier and stronger. How? By encouraging you to focus on a few copyediting guidelines that will help kill the clutter and confusion in your stories. Evaluation code: 2543

Karl Grubaugh, CJE, Granite Bay (Calif.) High School 2:30 p.m. Saturday, Beacon E, Sheraton (55)

Evaluation code: 3482

John Cutsinger, CJE, Jostens, Ocoee, Fla. 2:30 p.m. Saturday, Back Bay A, Sheraton (250)

74 — JEA/NSPA Fall 2013 Convention/Boston

Long-form journalism isn’t just for print. Gain strategies for finding ideas and writing indepth stories. See the best recent professional examples. Leave with advice to make it work within your WordPress website. Evaluation code: 3424

Jason Wallestad, School Newspapers Online, Burnsville, Minn. 2:30 p.m. Saturday, Commonwealth, Sheraton (250) Entrepreneurship

Using social media to boost readership

Learn about the benefits of using social media platforms such as Facebook and Twitter to extend your readership beyond the school walls and into your community. Topics include selecting a platform, writing for different platforms and using social media to tease stories and sell books. Evaluation code: 3309

Abrianna Nelson, CJE, Pleasant Ridge High School, Easton, Kan. 2:30 p.m. Saturday, Constitution A, Sheraton (300) Writing

Finding your voice

Learn strategies for developing a strong visual and verbal voice so your yearbook content will sing for the readers. From thorough analysis and preplanning your stories to making sure you don’t “lower the bar” once work begins, there’s a lot you can do to create an amazing volume. Evaluation code: 2208

Paul Ender, Herff Jones, Palm Springs, Calif., and Tamra McCarthy, CJE, James Enochs High School, Modesto, Calif. 2:30 p.m. Saturday, Constitution B, Sheraton (300)

Visit jea.org/eval to evaluate sessions


Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 75


saturday 2:30-3:30 p.m. / SUNDAY 8:30 a.m. Advising/Teaching

Using news content as curriculum

As part of its revamped News in Education program, The Boston Globe is working with local teachers to create lessons that use Globe news content to satisfy Massachusetts and Common Core State Standards. Evaluation code: 3384

Christine Casatelli, The Boston Globe 2:30 p.m. Saturday, Exeter, Sheraton (50) Web

The iJournalist: using iPads, iPods and iPhones in journalism

The advisers of The Little Hawk and Niles West News will share how their staffs use iPads, iPods and iPhones to create/enhance content, gain readership, run contests and market their publications. Presenters will share apps that work for their print and online publications. Evaluation code: 3380

Jonathan Rogers, MJE, Iowa City (Iowa) High School, and Evelyn Lauer, CJE, Niles West High School, Skokie, Ill. 2:30 p.m. Saturday, Fairfax, Sheraton (240) Multimedia Broadcast

Secrets of a successful broadcast program

Panel presentation about how to maintain a high-quality broadcast program. Covers workflow, working with administration, goals and expectations for students, and so on. Evaluation code: 3327

Michael Hernandez, Mira Costa High School, Manhattan Beach, Calif.; Don Goble, Ladue Horton Watkins High School, St. Louis, Mo.; and Matt Rasgorshek, Westside High School, Omaha, Neb. 2:30 p.m. Saturday, Gardner, Sheraton (120) News Literacy

News literacy project wrapup

Students selected for the Journalism Education Association / McCormick Foundation news literacy project will meet at this time to turn in and discuss their projects. Evaluation code: 3434

Jesse Sutherland, CJE, Waterford (Mich.) Kettering High School, and Kristofer Doran, Trumbull Career & Technical Center, Warren, Ohio 2:30 p.m. Saturday, Hampton, Sheraton (110) Photojournalism

Photographers: take control

Capturing great images is all about control. Learn about the three areas of a photo shoot that a photographer can control. With an understanding of staged, planned and spontaneous situations, you will capture better photos. Evaluation code: 3507

Jed Palmer, Sierra Middle School, Parker, Colo. 2:30 p.m. Saturday, Independence East, Sheraton (120)

Multimedia Broadcast

Produce news videos with PBS’ ‘NewsHour’

Come learn about the PBS “NewsHour” Student Reporting Labs, a video journalism program that links school programs to local PBS stations, provides professional development for teachers, a complete video journalism curriculum, and a national platform that enables your students to connect with schools around the country. Evaluation code: 3259

Leah Clapman, PBS “NewsHour,” Arlington, Va. 2:30 p.m. Saturday, Independence West, Sheraton (220) Law and Ethics

Private school press rights roundtable

Private school students are not guaranteed First Amendment protection, but they still can produce hard-hitting news, opinion and feature stories. Come prepared to discuss your issues and learn ways to build trust with your administration to grow your coverage of controversial, yet important, issues. Evaluation code: 3413

Tracy Anne Sena, Convent of the Sacred Heart High School, San Francisco 2:30 p.m. Saturday, Jefferson, Sheraton (50) Design

Literary magazines: clouds and silver linings

So I said to the magazine staff: “Two years ago your budget was reduced by 80 percent. Last year’s 100 percent free PDF magazine was read by nobody. What are you going to do?” Their reply? “We’ll produce something students want.” Stop by. See what they created. Evaluation code: 3419

Robert Hankes, Big Spring High School, Newville, Pa. 2:30 p.m. Saturday, Liberty B, Sheraton (60) Advising/Teaching

Trickle-down doesn’t work

Learn to set your Type A aside; leave the journalism to your staff. Meet a high school editor who also advises a budding middle school paper, and we’ll discuss the roles of writers, editors and advisers in creating a quality publication. Advisers and editors welcome. Evaluation code: 3333

Kelly Wisneski, Thousand Oaks High School, Thousand Oaks, Calif. 2:30 p.m. Saturday, Liberty C, Sheraton (60) Advising/Teaching

Chaos control: using Trello to manage a staff

Trello helps production cycles, grading and collaboration work better from the cloud. Hear from an adviser who has used this free software to help her publications staffs nail down the moving parts of a production cycle. Evaluation code: 3359

Barbara Tholen, Lawrence (Kan.) High School, and Laurie Folsom, Free State High School, Lawrence, Kan. 2:30 p.m. Saturday, Republic B, Sheraton (300)

76 — JEA/NSPA Fall 2013 Convention/Boston

Photojournalism

Photography: basic to fantastic

Understanding the exposure triangle and working with lighting will help you capture the moment with great-looking results. Learn how you can use photography basics to produce fantastic images for your publication with what you have in your camera bag. Evaluation code: 3533

Edmond Kwong, Homestead High School, Cupertino, Calif. 2:30 p.m. Saturday, Room 208, Hynes CC (153) Meeting

Mentor Program informational meeting

This meeting is for state scholastic press association representatives to ask questions and get updated about changes in the JEA Mentor Program. If you want to bring the program to your state, this meeting also is for you. Linda Barrington, MJE, Mount Mary College, Milwaukee, Wis., and Bill Flechtner, MJE, Milwaukie, Ore. 2:30 p.m. Saturday, Room 209, Hynes CC (134) Meeting

JEA board followup

The JEA board will meet briefly to discuss items needing resolution before the convention ends. Mark Newton, MJE, Mountain Vista High School, Highlands Ranch, Colo. 2:30 p.m. Saturday, Room 308, Hynes CC (103) Photojournalism

Light it up

Once you’ve built a solid foundation with your DSLR know-how, you can work with light to make your photos sing. This session offers tips and resources for publications on a shoestring budget and for those with more to spend. Evaluation code: 3422

Mike Simons, CJE, West High School, Painted Post, N.Y. 2:30 p.m. Saturday, Room 309, Hynes CC (304)

3:30 p.m. Event

NSPA awards ceremony

Winners of the NSPA Best of Show, NSPA Pacemakers and national individual awards will be honored at this ceremony. JEA and NSPA encourage everyone to celebrate all winners. 3:30-5:30 p.m. Saturday, Auditorium, Hynes CC (4,284)

8:30 a.m. SUNDAY Event

JEA awards ceremony

Winners of JEA Write-off contests will be recognized during the closing ceremony. You’ll also see a slideshow of convention highlights. Pick up Write-off entries after the ceremony. 8:30-10:30 a.m. Sunday, Auditorium, Hynes CC (3,084)

Visit jea.org/eval to evaluate sessions


COME HERE. GO EVERYWHERE.

The University of Nebraska–Lincoln is an equal opportunity educator and employer.

UNIVERSITY OF NEBRASKA–LINCOLN | COLLEGE OF JOURNALISM & MASS COMMUNICATIONS

In our College of Journalism and Mass Communications you won’t sit still. From day one you’ll be learning, traveling, discovering and doing. Giving your story incredible life. Come see where our students have been, where they plan to go and how you can join them. Check out our latest adventures.

go.unl.edu/everywhere Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 77


Whether your staff is looking for ideas and inspiration or support and education, Herff Jones will help you create the yearbooks of your dreams.

78 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


During the week of Sept. 2-6, post the following status using the hashtag #HJTogether. To prepare you for future challenges which will be delivered via our social media channels, your first task is to confirm that you are among our followers. We invite you to follow HERFF JONES YEARBOOKS on Facebook, Twitter, Google+ and Instagram and post the comment and hashtag below. Already a follower? Don’t worry, you can still play by completing the task below.

FOLLOW US! CHALLENGE #1

Check it out! We’re 11 weeks in to the Together We Can social media challenge, but it’s not too late to participate. Weekly challenges result in monthly winners and two grand prizes (Think cash!). Each week, Herff Jones Yearbooks posts a challenge via Facebook, Twitter, Google+ and Instagram. Complete the challenge by submitting either a photo, comment or video depending on the challenge. The more you engage by submitting different entries using #HJTogether, the better your chances are to win! Learn more at http://bit.ly/twcchallenge

#HJTOGETHER

Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 79


bios Jeanne Acton was an award-winning newspaper and yearbook adviser and not-somuch winning softball coach. Then she went to the dark side for three years as a high school assistant principal. For the past nine years, she has been the Texas scholastic press association director. 10 and 11 a.m. Friday, Room 309, Hynes CC Paula Adamek teaches journalism and English and is the yearbook and newspaper adviser at Yoakum (Texas) H.S. The publications and staff members have received top awards from the Interscholastic League Press Conference. Adamek has been a critique judge and convention presenter, and she has received ILPC’s Edith Fox King Award and Texas A&M University’s College of Education’s Dean Roundtable Award. 1 p.m. Saturday, Beacon E, Sheraton Emily Aiken is the Web editor of fhhstoday.com at Francis Howell H.S. in St. Charles, Mo. She has been on staff for two years and works as a reporter and editor. Aiken won a Superior award in student life for J-Day at Mizzou. She serves on 45words student initiative for the JEA Scholastic Press Rights Commission. 2:30 p.m. Saturday, Back Bay D, Sheraton Logan Aimone, MJE, works with the team at School Newspapers Online coordinating the Ad Network, SNO National Edition and other programs. Previously, he was executive director of NSPA and was a journalism teacher and media adviser in Washington state. He is a past DJNF Distinguished Adviser and Washington state journalism adviser of the year. He is co-author of two journalism textbooks. 9 and 10 a.m. Friday, Back Bay B, Sheraton Ann Akers, MJE, is Herff Jones Yearbooks’ educational products manager. Formerly NSPA’s associate director, Akers has done stints as journalism teacher/publications adviser and yearbook representative. She was the 2005 recipient of the Carl Towley Award, JEA’s highest honor, and has been awarded CSPA’s Gold Key and NSPA’s Pioneer Award. 8, 9 and 10 a.m. Saturday, Constitution B, Sheraton Martha Akers advises the yearbook at Loudoun Valley H.S. The Saga has received state, national awards including Pacemakers, Gold Crowns and VHSL Trophies. Akers, 2005 JEA Yearbook Adviser of the Year, has received CSPA’s Gold Key, NSPA’s Pioneer, VAJTA’s Lifetime Achievement and SIPA’s Distinguished Service Award and is in VHSL Hall of Fame and OIPA’s Scholastic Journalism Hall of Fame. 10 a.m. Friday, Constitution B, Sheraton Joan Anderman is an arts reporter and the former pop music critic at The Boston Globe. She is working on a book about creativity and aging, writes a related column, “The Creative Mid-Life,” for the New York Times and blogs at Middlemojo.com. 11 a.m. Saturday, Room 310, Hynes CC

Gerry Appel, an Indiana native who is proud to call Iowa home, advises the Echoes student newspaper and Crimson and Blue yearbook at Abraham Lincoln H.S. in Council Bluffs, Iowa. Prior to teaching, Appel gained professional experience working as a television producer and editor in Fort Wayne, Ind., and working for Ball State’s journalism department and admissions office as a publications editor. 11 a.m. Friday, Dalton, Sheraton Carole Babineaux, CJE, is a veteran yearbook adviser who knows the challenges of recruiting, training and motivating high school students. She’s crossed almost every stumbling block any adviser can face, and she’s still around, still advising and still enjoying every minute of it. 11 a.m. Saturday, Beacon G, Sheraton Bob Bair, MJE, has taught English and journalism at Blair (Neb.) H.S. since 1973. He has advised yearbook and newspaper since 1974. Bair has served JEA as vice president, North Central/ Region 3 director and Nebraska state director. He is a past president of the Nebraska High School Press Association and serves as NHSPA’s communications director. Bair has received NSPA’s Pioneer Award and JEA’s Medal of Merit. 6:45 p.m. Thursday, Beacon B, Sheraton Kristin Baker, CJE, advises yearbook, newsmagazine and a website at Andover (Kan.) H.S. She is proud of her students’ publication successes. She serves on the Kansas Scholastic Press Association board and is a proud founding member of Wichita Area Journalism Educators. In her free time she writes for Splurge! magazine in Wichita. Noon Saturday, Back Bay C, Sheraton Linda Ballew, MJE, is the 2005 DJNF national Newspaper Teacher of the Year and JEA’s 2006 Distinguished Yearbook Adviser. She works as a judge, speaker, Montana’s state director, MJEA’s executive board and the University of Montana School of Journalism’s Advisory Council. Ballew advises the award-winning newspaper, yearbook, online, video and social media publications at Great Falls H.S. in Montana. 10 a.m. Friday, Commonwealth, Sheraton; noon Friday, Room 312, Hynes CC Scott Barboza edits the high school section of ESPNBoston.com and has covered the Bruins and Red Sox for the site. A native of Fall River, Mass., and a graduate of Emerson College, he began his career at the Taunton (Mass.) Daily Gazette as a staff writer and has worked in the New England Patriots media relations department. 9 a.m. Friday, Room 313, Hynes CC Linda Barrington, MJE, is the graphics adviser for the student newspaper at Mount Mary University. Her passion is focused on mentoring new teachers. She is executive director of the Kettle Moraine Press association, a JEA mentor and co-chair of JEA’s Mentoring Committee. She has won DJNF special recognition, CSPA’s Gold Key, NSPA’s Pioneer Award and is receiving the JEA Carl Towley Award at this convention. Noon Saturday, Room 312, Hynes CC; 2:30 p.m. Saturday, Room 209, Hyness CC Fred Bayles came to Boston University with 30 years’ experience as a daily journalist, including 20 years as a national correspondent

80 — JEA/NSPA Fall 2013 Convention/Boston

with The Associated Press and USA TODAY. At BU, he has helped establish the Boston University News Service, which allows local professional publications to use student content on their hyperlocal sites. 9 a.m. Friday, Jefferson, Sheraton Graham Beck is a junior at Boston College and the photography editor of the independent student newspaper, The Heights. In addition to six years’ experience in sports photography, he has covered the Frozen Four and the NCAA East Regional Basketball Tournament, and was awarded fourth-place recognition in sports photography for Photo Excellence by the Associated Collegiate Press. 2:30 p.m. Friday, Room 309, Hynes CC Joe Bergantino — Featured speaker. See Page 6 for bio. 10 a.m. Friday, Back Bay C, Sheraton Lori Blachford is the chair of magazine journalism at Drake University, a job she has had for three years. Before starting her teaching career, Blachford spent 11 years working at Meredith Corp. on a variety of magazines, including Better Homes and Gardens Specials, Country Home and Midwest Living. Before that, she worked in the sports department at the Des Moines Register. 11 a.m. Friday, Commonweath, Sheraton Bonnie Blackman, CJE, was an art instructor, yearbook adviser and coach in the Boston Public Schools before joining Jostens as a publishing representative. She is a recipient of the CSPA Gold Key and the Garden State Scholastic Press Association Golden Quill. Blackman serves on the GSSPA executive board and the advisory board of the Pennsylvania Scholastic Press Association. 2:30 p.m. Friday, Room 209, Hynes CC; 10 a.m. Saturday, Room 308, Hynes CC Jane Blystone, Ph.D., MJE, serves as JEA’s Region 7/Northeast director, is a member of the Scholastic Press Rights and Certification commissions, and was the local chair for the JEA/ NSPA Philadelphia convention. Honors include JEA’s Medal of Merit, Special Recognition Yearbook Adviser; CSPA’s Gold Key and James F. Paschal awards; and NSPA Pioneer award. She directs graduate studies in secondary education at Mercyhurst University in Erie Pa. 9 p.m. Thursday, Fairfax, Sheraton; 10 a.m. Friday, Kent, Sheraton Alyssa Boehringer is in her ninth year of advising broadcast and online news at McKinney (Texas) H.S. Her students love national conventions. In fact, you may see them wearing ugly sweaters all over the place. You can view their work online at www.manestreamnews.com. 9 and 10 a.m. Saturday, Independence West, Sheraton Nora Bollinger is a graphic and Web designer who freelances from her hometown in Richmond, Va. She graduated from James Madison University in May with three years of experience designing and writing for her award-winning college yearbook, The Bluestone. Noon Friday, Fairfax, Sheraton Candace Perkins Bowen, MJE, is an associate professor at Kent State and directs the Center for Scholastic Journalism there. Previously

Visit jea.org/eval to evaluate sessions


academic

Lecturer/Executive Director of Kansas Scholastic Press Association University of Kansas School of Journalism and Mass Communications The School of Journalism is known nationally for its leadership in providing a multidisciplinary cross-platform GYVVMGYPYQXLEXVI¾IGXWXLIVIEPMXMIWSJXLIWXGIRXYV][SVOTPEGI8LI7GLSSPSJ.SYVREPMWQIQTS[IVW MXWWXYHIRXWXSFIWYGGIWWJYPPIEHIVWMRXLIIZIVGLERKMRK½IPHSJNSYVREPMWQ-J]SYEVITEWWMSREXIEFSYX NSYVREPMWQERH[ERXXSXIEGLXLIRI\XKIRIVEXMSRSJ.E]LE[O.SYVREPMWXW TPIEWIGSRWMHIVNSMRMRKYWEXXLI/97GLSSPSJ.SYVREPMWQ

Job Description: Lecturer to serve as executive director of the Kansas Scholastic Press Association, teach university journalism courses and direct the Summer Kansas Journalism Institute. Salary: Commensurate with experience. Start Date: August 18, 2014. 6IUYMVIH5YEPM½GEXMSRW1EWXIV´WHIKVIIMRNSYVREPMWQSVVIPEXIH½IPHXLVII]IEVWSJI\TIVMIRGIXIEGLMRKLMKLWGLSSP NSYVREPMWQEHZMWMRKLMKLWGLSSPQIHMESVGSQTEVEFPILMKLWGLSSPEHZMWMRKX[S]IEVWSJI\TIVMIRGIMRFYHKIXQEREKIQIRXERH two years of experience in planning workshops, events or programs. 4VIJIVVIH5YEPM½GEXMSRW4VSJIWWMSREPQIHMEI\TIVMIRGII\TIVMIRGIMRJYRHVEMWMRKYRMZIVWMX]PIZIPXIEGLMRKI\TIVMIRGI and supervisory experience. Application Instructions: Please attach a resume, a cover letter addressing how you meet or exceed the required and TVIJIVVIHUYEPM½GEXMSRWERHEPMWXSJXLVIITVSJIWWMSREPVIJIVIRGIWXSXLISRPMRIETTPMGEXMSR*MVWXGSRWMHIVEXMSR[MPPFIKMZIRXS complete applications received by the review date.

For complete position description and to apply go to: http://employment.ku.edu/jobs/3667 Contact Information for Applicants: journalismsearch@ku.edu Review of applications begins 12/1/2013. EOE M/F/D/V

www.journalism.ku.edu Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 81


bios

Brightwell is active in both JEA and CSPA. She has a passion for journalism and helping students produce their best yearbook. 8 a.m. Saturday, Fairfax, Sheraton

she was a high school journalism teacher and media adviser in Illinois and Virginia. She is a former DJNF High School Journalism Teacher of the Year. She started JEAHELP listserv when she was president of JEA. She serves on the Certification and Press Rights commissions. 9 a.m. Friday, Liberty C, Sheraton; 11 a.m. Friday, Kent, Sheraton; 10 a.m. Saturday, Conference Room, Sheraton

Rick Brooks, CJE, is the northeast creative design manager for Jostens. He has worked in the creative design and publishing fields since 1986. He works with and designs for numerous award-winning colleges and high schools, and he presents nationally. Brooks received the CSPA Gold Key and the PSPA Keystone Award for service to student journalism. He serves on the Pennsylvania School Press Association executive board. 11 a.m. Saturday, Back Bay B, Sheraton

John Bowen, MJE, is chair of JEA’s Scholastic Press Rights Commission. He is assistant director of the Center for Scholastic Journalism and teaches law and ethics at Kent State University. His personal honors include DJNF Journalism Teacher of the Year, JEA Carl Towley Award, NSPA Pioneer and CSPA Gold Key. 10 and 11 a.m. Friday, Liberty C, Sheraton; 7:30 a.m. Saturday, Beacon G, Sheraton; 10 a.m. Saturday, Beacon A, Sheraton Francesca Branson is in her sixth year advising the Montpelier yearbook at James Madison H.S. in Virginia. The Montpelier staff earned a Best of Show award at the 2012 San Antonio JEA/NSPA convention, as well as an NSPA mark of distinction for coverage and design for its 2012 publication. 10 a.m. Friday, Jefferson, Sheraton Ashley Brightwell has more than 12 years of yearbook experience. A former middle and high school teacher with a master’s degree in English,

Deanne Brown advises The Featherduster newsmagazine and teaches photojournalism at Westlake H.S. in Austin, Texas. Three of her students have been named both Texas and national high school journalists of the year. The newsmagazine has earned Pacemakers, Gold and Silver Crowns, Gold Stars and Best of Show awards. Brown received the Edith Fox King and a TAJE Trailblazer Award. She is president of Association of Texas Photography Instructors. 9 a.m. Friday, Room 309, Hynes CC Shelby Brunk is the editor-in-chief of the Royal Purple yearbook at Kansas State University. She is seeking a dual degree in broadcast journalism and secondary education. She has worked as an intern at a Kansas City news station as well as multiple news magazines and newspapers. Noon Saturday, Back Bay B, Sheraton Renee Burke, NBCT, MJE, advises the Legend yearbook and Hi-Lights newspaper at Boone H.S.

in Orlando, Fla. Burke was the 2012 OCPS Teacher of the Year, 2011 FSPA Journalism Teacher of the Year and a 2011 Gold Key recipient from CSPA. She teaches national yearbook workshops and coordinates Camp Orlando. Both publications have earned CSPA Crown awards and have been NSPA Pacemaker Finalists. 9 and 10 a.m. Saturday, Liberty C, Sheraton Jacob Cader is a 16-year-old journalist, filmmaker and technology enthusiast in his junior year at the Ethical Culture Fieldston School in Bronx, N.Y. He is an editor and webmaster of the Fieldston News. Noon Saturday, Liberty B, Sheraton Christine Casatelli is the manager of The Boston Globe’s News in Education program. A career journalist, Christine taught journalism full time at Northeastern University. She is an elected member of the Melrose School Committee. Noon and 2:30 p.m. Saturday, Exeter, Sheraton Linda Chambers advised the Falcon yearbook at Fairview (Tenn.) Middle School. Now retired, she advised both high school and middle school books. Her staffs’ books have won CSPA Gold and Silver Crowns. Chambers also taught English and history, is Tennessee affiliate director for Destination Imagination, and has served as a yearbook workshop speaker.

2:30 p.m .Friday, Room 209, Hynes CC; 10 a.m. Saturday, Room 308, Hynes CC

Marilyn Chapman, CJE, has retired after teaching her two passions of yearbook and newspaper journalism and American literature for 43 years in Missouri, Connecticut, New York,

THE ROY H. PARK SCHOOL OF COMMUNICATIONS WOULD LIKE TO CONGRATULATE THE 2013

S’Park Media Mentor Award Winners

Do you know of an outstanding high school media mentor? This award recognizes high school teachers and advisors who are committed to igniting a passion for media in their students. Visit ithaca.edu/rhp/community/sparkaward for more information.

[LEFT TO RIGHT] KIM GREEN, Columbus North High School, Columbus, IN • NOAH C. KADY, Middletown High School, Middletown, MD • TODD J. LORSON, Loyalsock Township High School, Williamsport, PA • DON GOBLE, Ladue Horton Watkins High School, St. Louis, MO • DAVE RUBY, 82 — JEA/NSPAFairfax Fall 2013 Convention/Boston Academy for Communications and the Arts, Fairfax, VA

Visit jea.org/eval to evaluate sessions ithaca.edu/rhp


Georgia and South Carolina. She is a JEA mentor. 8 a.m. Friday, Room 207, Hynes CC; 8 a.m. Saturday, Grand Ballroom, Sheraton Lisa Chedekel — Featured speaker. See Page 6 for bio. 11 a.m. Friday, Back Bay C, Sheraton Jill Chittum, MJE, is a sales representative for Walsworth Yearbooks in northwest Arkansas and northeast Oklahoma. Chittum advised newspaper and yearbook at Derby (Kan.) H.S. for three years, then at Blue Valley H.S. in Stilwell, Kan., for five years. Before becoming a publications adviser, Chittum was a staff photographer and night photo editor at the Wichita (Kan.) Eagle. 10 a.m. Saturday, Room 309, Hynes CC Grace Christiansen is NSPA’s contest and critique coordinator. Prior to joining NSPA in April 2012, Christiansen managed an adult basic education program at the Washington Literacy Center in Washington, D.C. 8 a.m. Saturday, Room 209, Hynes CC; 3:30 p.m. Saturday, Auditorium, Hynes CC Leah Clapman oversees education for the PBS “NewsHour” and created Student Reporting Labs, a youth journalism program that connects middle and high school students to local PBS stations and mentors to produce youth-perspective news videos on important national issues. The site has a video journalism curriculum and collaborative space with badges to reflect student accomplishments. 2:30 p.m. Saturday, Independence West, Sheraton Erin Coggins, MJE, advises The Crimson Crier newspaper, Crimson Crier online and The Senator Yearbook at Sparkman H.S. in Harvest, Ala. She has been awarded the Alabama Scholastic Press Association’s Adviser of the Year four times, and she was named a DJNF Special Recognition Adviser and Distinguished Adviser. She also has a CSPA Gold Key. 9 a.m. Saturday, Back Bay C, Sheraton Cathy Collins has worked as a media specialist/librarian for 14 years. She recently returned to Massachusetts after seven years in the public schools of California and a six-month work experience at a private school in Kathmandu, Nepal. She began her career as a reporter for business, arts and education. She holds National Board Certification as a library/media teacher. 10 a.m. Saturday, Clarendon, Sheraton Greg A. Cooper teaches at Brooks Institute in Ventura, Calif. He graduated in May 1996 from Western Kentucky University with a double major in photojournalism and anthropology. After three years’ working as a picture editor in Ohio, Cooper returned once again to his native Ventura County, this time to pursue his master’s degree in photography at Brooks, where he graduated in December 2004. 1 and 2:30 p.m. Saturday, Clarendon, Sheraton Paige Cox teaches journalism and English at Loudoun Valley H.S., in Purcellville, Va., where she advises The Viking, a print and online news magazine. Her students have earned top national and state honors. Cox received the 2013 VAJTA Washington and Lee Award for excellence in scholastic journalism. 11 a.m. Saturday, Back Bay C, Sheraton

Twitter: @nhsjc/#nhsjc

Sandra Coyer, MJE, is the adviser of the Viking Vanguard newspaper in Puyallup, Wash. She is the JEA Region 1 director and has served on the WJEA board for eight years. She was the 2009-2010 WJEA Adviser of the Year. 9 p.m. Thursday, Fairfax, Sheraton; 2:30 p.m. Friday, Jefferson, Sheraton; 9 a.m. Saturday, Back Bay A, Sheraton Kathy Craghead, MJE, is the former adviser at Mexico (Mo.) H.S. and is now Newspapers In Education director for the Mexico Ledger. She is a former member of the JEA board of directors and a recipient of the NSPA Pioneer, JEA Medal of Merit and JEA Lifetime Achievement awards. She is the 2003 National Yearbook Adviser of the Year. 9 a.m. Friday, Back Bay C, Sheraton Bernadette Cranmer advises Ursus, the yearbook at Granite Bay (Calif.) H.S. She previously advised the yearbook and newsmagazines at Rancho Cotate and Redwood high schools. Her students have won Pacemakers, Best of Show rankings, state competitions, a Gold Crown and Write-off awards. She also is a 2012 Globe Theatre Education Academy Fellow through the UC DavisGlobe partnership. Noon Saturday, Independence West, Sheraton Gina Cuccovia-Simoneau, a key accounts specialist for Walsworth Yearbooks, has more than 18 years in the yearbook industry. An awardwinning graphic designer, she has worked with clients such as Disney/Pixar, Elizabeth Arden Red Door, the YMCA and the Worcester Art Museum. Cuccovia-Simoneau has a degree in graphic design and communications and has taught at yearbook workshops throughout New England for almost two decades. 11 a.m. Saturday, Room 208, Hynes CC John Cutsinger, CJE, self-confesses to being the ultimate yearbook nerd, having been associated with scholastic journalism for 38 years. He has gained recognition from JEA, NSPA, CSPA, FJA, SIPA, AHSPA, TAJE and ILPC for his work with journalism educators. He likes to think he is a popular workshop and convention speaker. He is the co-author of the new yearbook adviser companion guide with Sarah Nichols. 9 a.m. Saturday, Beacon E, Sheraton; 2:30 p.m. Saturday, Back Bay A, Sheraton Dave Davis founded HTV Magazine in the fall of 1989 at Hillcrest H.S. in Springfield, Mo. The program has earned 12 Broadcast Pacemaker Awards, six Robert F. Kennedy Awards, and is known for its in-depth coverage of teen issues. Davis also is the director of the Academy of Scholastic Broadcasting Workshop, which has trained scholastic broadcast teachers since the summer of 2000. 8:30 a.m. Thursday, Liberty C, Sheraton; 10 a.m. Friday, Hampton, Sheraton; 9 and 11 a.m. Saturday, Hampton, Sheraton Adam Dawkins advises the RJ Media journalism program at Regis Jesuit H.S. in Colorado. His students run a print newspaper, magazine, website and broadcast program. He is the vice president of the Colorado High School Press Association. He has been advising for five years but feels as if he is just getting started and excited for what is to come. 2:30 p.m. Friday, Beacon G, Sheraton

bios Sophie de Bruijn co-manages breaking news for Inklings at Staples H.S. in Westport, Conn. Before being promoted to breaking news managing editor as a junior, de Bruijn worked as a features editor for the Inklings website and served as a member of the editorial board. Noon Saturday, Back Bay D, Sheraton Melissa Deavers-Lowie is the journalism teacher at Portage (Ind.) H.S. and advises the newspaper, yearbook and broadcasting programs. 9 a.m. Saturday, Fairfax, Sheraton Gino Del Guercio is a documentary filmmaker specializing in science, medicine and technology. Trained at WGBH Boston, he has worked as a producer, writer and director for The Discovery Channel, PBS and A&E. He is executive producer at Boston Science Communications Inc. and is working on a 3D IMAX film on river dolphins with the Woods Hole Oceanographic Institute. 2:30 p.m. Friday, Gardner, Sheraton Ryan Demo is the two-year editor-in-chief of the award-winning Carillon yearbook. He manages a staff of more than 60 and helps maintain thecarillon.org, created in 2012. He has four years of design and writing experience and has interned at Adobe. Noon Friday, Independence East, Sheraton John Dent advises the daily broadcast, DPNews, and the yearbook, The Image, at Dos Pueblos H.S. in Goleta, Calif. He applies his math and marketing background to increase sales of the yearbook and double personal ad sales. He twice has been named Regional Occupational Program Outstanding Instructor for media. This Canadian national brought The Image national recognition with award-winning photography and design. 8 a.m. Saturday, Hampton, Sheraton; 10 a.m. Saturday, Berkeley, Sheraton Amy DeVault, MJE, teaches editing and visual communication at Wichita (Kan.) State University. After teaching high school journalism for three years, she spent nearly five years as a visual journalist at The Wichita Eagle, where she designed the front page. DeVault earned a Society of News Design award of excellence and helped The Eagle win Kansas Press Association’s best front page award. 8:30 a.m. Thursday, Back Bay C, Sheraton; 10 a.m. Saturday, Republic B, Sheraton; noon Saturday, Back Bay C, Sheraton Taylor Dobbs — Featured speaker. See Page 6 for bio. 10 a.m. Saturday, Room 311, Hynes CC Bonnie Dodwell moved to the United States and taught at Cary (N.C.) Academy for five years before becoming its yearbook adviser in 2006. In the past eight years, The Legacy has evolved from a basic memory book to an award-winning journalistic publication of 384 pages created by a staff of fewer than 10 students. 9 a.m. Saturday, Beacon A, Sheraton

JEA/NSPA Fall 2013 Convention/Boston — 83


bios KRIStofer P. DORAN is an interactive multimedia instructor for the Trumbull Career & Technical Center in Warren, Ohio. His work involves integrating broadcast techniques with new multimedia methods. Last year, his students won the Business Professionals of America national competition in broadcast news production. Previously, he worked as a promotion producer and assistant creative services director for WKBN and WYTV in Youngstown, Ohio, and producer for the Cleveland Indians. 3 p.m. Thursday, Beacon B, Sheraton; 2:30 p.m. Saturday, Hampton, Sheraton Mary Kay Downes, MJE, has advised the Odyssey yearbook at Chantilly (Va.) H.S. for 23 years. Her students have won numerous NSPA Pacemakers and CSPA Crown awards. She holds the JEA Medal of Merit, NSPA Pioneer, CSPA Gold Key, SIPA Elizabeth Dickey Awards. She is the 2007 JEA Yearbook Adviser of the Year. She is known for her humor and incredible passion for yearbooks. YB4L! 9 a.m. Friday, Room 311, Hynes CC; 10 a.m. Friday, Room 313, Hynes CC; 9 a.m. Saturday, Room 311, Hynes CC Mike Doyle, CJE and NBCT, advises the North View newspaper, thenorthview.com and the Equus yearbook at Belvidere (Ill.) North H.S. He is a former professional journalist who covered sports, news and features and was a newspaper columnist for 32 years. He has written two books and edited a third. He is the vice president of the Illinois Journalism Education Association. 9 a.m. Friday, Constitution B, Sheraton Linda Drake, MJE, is yearbook and newspaper adviser at Chase County Junior-Senior H.S. in Cottonwood Falls, Kan. Drake has received the Engel Award, the JEA Teacher Inspiration Award and Medal of Merit as well as a CSPA Gold Key Award and the NSPA Pioneer Award. She was named the 2008 National Yearbook Adviser of the Year. She has served on the KSPA, JEA and NSPA boards. 10 a.m. Friday, Berkeley, Sheraton; 11 a.m. Saturday, Berkeley, Sheraton

Wayne Dunn, CJE, is a retired adviser whose publications at Lebanon and Lakota West high schools in Ohio won top honors. Dunn is one of the original mentors in the JEA initiative, and he is a Gold Key and Lifetime Achievement recipient. He owns a photo studio, Well Dunn Images, with wife Georgia. 11 a.m. Saturday, Exeter, Sheraton

Bryan Farley teaches photography and yearbook at Pittsburg (Calif.) H.S. Previously, after working at Brooks Institute of Photography, he became a technology consultant and photographer. Farley also writes a blog advocating epilepsy research and awareness. He is a frequent presenter and judge at conventions. Noon Friday, Constitution B, Sheraton

Mitch Eden, MJE, advises the awardwinning Kirkwood Call newspaper, website (TheKirkwoodCall.com) and Pioneer yearbook at Kirkwood (Mo.) H.S. He was named Society of Professional Journalists 2011-12 Distinguished Teaching in Journalism Award winner. He has been teaching scholastic journalism 18 years and loves working with passionate young people to help them become better people and better journalists while creating the best publications possible. 10 a.m. Saturday, Gardner, Sheraton

Carrie Faust, MJE, advises the Summit yearbook and Express newspaper at Smoky Hill H.S. in Aurora, Colo. Her staffs have earned three CSPA Silver Crowns, an NSPA Pacemaker, Gold Medalist and All-American critiques, and many state and local awards. She was a JEA Rising Star in 2008, a JEA Distinguished Yearbook Adviser in 2009 and the CHSPA Teacher of the Year in 2011. 9 p.m. Thursday, Fairfax, Sheraton; 11 a.m. Friday, Liberty C, Sheraton; 2:30 p.m. Friday, Commonwealth, Sheraton

Jason Ell is the co-adviser for the RJ Media program at Regis Jesuit H.S. He is in his third year teaching world history and economics plus coaching football at Regis Jesuit. Ell also develops online curriculum for Edison Online. He wrote a complete junior high social studies program. He began advising last year and loves helping students bring events to the community, live. 2:30 p.m. Friday, Beacon G, Sheraton

Mark Feeney — Featured speaker. See Page 6 for bio. 9 a.m. Friday, Room 312, Hynes CC

Paul Ender was adviser to the award-winning American yearbook at Independence H.S. in San Jose, Calif., for more than 25 years. A longtime special consultant for Herff Jones, Ender’s honors include JEA Yearbook Adviser of the Year, Northern California Yearbook Adviser of the Year, CSPA Gold Key, JEA Lifetime Achievement Award, NSPA Pioneer Award and OIPA National Scholastic Journalism Hall of Fame. 8 a.m., 9 a.m. and 2:30 p.m. Saturday, Constitution B, Sheraton Aaron Engelman is the district media specialist for Geary County Schools USD 475 in Junction City and Fort Riley, Kan. His work takes him to all of the district’s 18 schools to cover 8,000 students as the eyes and ears of the parents, community and local media. He moonlights with K-StateHD.tv for live sports productions. 1 p.m. Thursday, Boardroom, Sheraton; 7:30 a.m. Friday, Beacon H, 8 a.m. Friday, Beacon F, Sheraton; 8:30 and 9:30 a.m. Friday, Beacon H, Sheraton

Michele Dunaway, MJE, advises the awardwinning publications at Francis Howell H.S. in St. Charles, Mo. Dunaway has received a JEA Medal of Merit, a CSPA Gold Key, Missouri Journalism Teacher of the Year honors, and she was a 2012 Distinguished Yearbook Adviser of the Year. In addition to advising, she is a published author of more than 23 novels. 10 a.m. Friday, Room 308, Hynes CC

Susan V. Everett, MJE, a JEA Lifetime Achievement Award recipient, retired after 30 years of advising student newspapers. She is on the board of the Garden State SPA, serves as conference coordinator for that organization, and judges newspapers and newsmagazines for several state and national organizations. She also is a JEA mentor. 11 a.m. Saturday, Beacon H, Sheraton

Georgia Dunn, MJE, advised yearbooks and newspapers for more than 20 years. She received the Williams Teaching Award from the Wilmington City Schools as an outstanding teacher. She retired from teaching in 2002 and became the Ohio state director. She serves as one of the original JEA mentors as well as presenting at conventions and yearbook workshops. She also serves on the Scholarship Committee. 11 a.m. Saturday, Exeter, Sheraton

Brynda Everman is a publishing representative for Balfour Yearbooks in Los Angeles. After more than 25 years of commercial printing and yearbook publishing experience, you’ll still find her at home in the classroom. As technology evolves, she helps her students maximize their production time with innovative ways of using commercial software. 11 a.m. Friday, Berkeley, Sheraton

84 — JEA/NSPA Fall 2013 Convention/Boston

Nikki Ferrera is the editor-in-chief for Red & Black newspaper at Hillsborough H.S. in Tampa, Fla. She has been on the newspaper staff for three years and a member of her school’s journalism program for four years. She won two All-Florida Awards at the 2013 FSPA convention. Ferrera serves as a 45words Student Partner. 2:30 p.m. Saturday, Back Bay D, Sheraton Beth Fitts, MJE, is the 2003 DJNF National High School Journalism Teacher of the Year. In 2008, she received the NSPA Pioneer Award and in 2011 a CSPA James F. Paschal Award. She is an NSPA AllAmerican Adviser and a SIPA Distinguished Service Award recipient. She is the Mississippi JEA director, is on the SIPA Executive Board and teaches at workshops around the country. 11 a.m. Friday, Back Bay B, Sheraton Bill Flechtner, MJE, advised publications in Oregon for 25 years. He is a DJNF Distinguished Adviser and a JEA Medal of Merit recipient. He serves on the JEA Mentor Program committee member and has mentored new advisers since the program began. 8 a.m. Saturday, Independence East, Sheraton Karen Flowers, CJE, is director of the South Carolina Scholastic Press Association and the Southern Interscholastic Press Association. She directs the Carolina Journalism Institute. Flowers advised for 28 years, the last 20 at Irmo H.S. in Columbia, S.C. Honors include South Carolina Adviser of the Year, CSPA’s Gold Key, NSPA’s Pioneer Award, distinguished service awards from SCSPA and SIPA, and DJNF Special Recognition and Distinguished Adviser. 11 a.m. Friday, Beacon A, Sheraton Laurie L. Folsom advises the Free Press newspaper, FS Free Press Online website and Talon yearbook at Lawrence (Kan.) Free State H.S. She is vice president of Journalism Educators of Metropolitan Kansas City and is an area representative for Kansas Scholastic Press Association. She has taught journalism for 16 years. 2:30 p.m. Saturday, Republic B, Sheraton Adrienne Forgette, CJE and NBCT, recently left a national award-winning yearbook program in Maryland to teach in Martha’s Vineyard, Mass.

Visit jea.org/eval to evaluate sessions


She was a 2013 ASU Reynolds Institute Fellow and enjoys judging yearbooks during the summer. 8 a.m. Saturday, Republic B, Sheraton Adrienne Forte is a teacher of journalism and creative writing at Robinson Secondary School in Fairfax, Va. She also is the adviser of the Medallion newspaper at Robinson Middle School. 9 and 11 a.m. Saturday, Beacon B, Sheraton David Foster is a multimedia and photography instructor at Kent State University and also is pursuing his master’s degree in journalism education. He received his undergraduate degree in photojournalism from Kent State in 2009, then attended the Salt Institute for Documentary Studies in Portland, Maine. While in college, he was named Ohio News Photographers Association Student Photographer of the Year, in 2006 and 2007. 1 p.m. Saturday, Independence West, Sheraton Jacob Freedman is a junior majoring in print and digital journalism at the University of Southern California. At USC, he is senior sports editor for the student media network, writes for the Daily Trojan, among other publications, and is always looking to find new and innovative ways to report on events around campus, especially sports. 8 a.m. Saturday, Liberty C, Sheraton Jennifer Freeman, a former magazine art director and winner of numerous industry awards, knows good design and she’s not afraid to share it. Freeman uses her 15 years of publication design experience as an account manager with Balfour Yearbooks and stays involved in state and national

journalism organizations as a speaker and judge. 10 a.m. Saturday, Fairfax, Sheraton Megan Fromm is an adjunct professor at Johns Hopkins University and faculty at the Salzburg Academy on Media & Global Change. She is a member of the JEA Scholastic Press Rights Commission and a former journalist and scholastic media adviser. Fromm has a doctorate in journalism and public communication and has worked at the Student Press Law Center and the Newseum in Washington, D.C. Noon Friday, Back Bay B, Sheraton; 2:30 p.m. Friday, Exeter, Sheraton Sheryl Fulton is Marketing Services manager for Jostens Printing and Publishing in Topeka, Kan. Fulton formerly taught at Fort Collins (Colo.) H.S., where she advised the Lambkin yearbook. She also advised the Archive yearbook at St. Louis University. Her books won awards from NSPA, CSPA and Colorado High School Press Association. She speaks at summer workshops and conventions. 2:30 p.m. Friday, Room 209, Hynes CC; 10 a.m. Saturday, Room 308, Hynes CC Kelly Furnas, CJE, is executive director of the national Journalism Education Association, as well as an assistant professor at Kansas State University and associate director of Student Publications Inc. Prior to arriving at K-State, he was the student media adviser at Virginia Tech. He also has worked at newspapers in Las Vegas and Tallahassee, Fla. 7:30 p.m. Thursday, Auditorium, Hynes CC; 9 p.m. Thursday, Fairfax, Sheraton; 1 p.m. Friday, Auditorium, Hynes CC; 8:30 a.m. Sunday, Auditorium, Hynes CC

bios Adam Gaffin is a lifelong reporter and editor who now runs a community news and information website for the Boston area. 1 p.m. Saturday, Back Bay C, Sheraton Greg Gagliardi advises Eastside, the New Jersey Distinguished Journalism Award winner since 2009, and has been teaching and advising at Cherry Hill East since 2000. He is a vice president of the Garden State Scholastic Press Association. His nationally recognized humor column, Progressive Revelations, (www.progressiverevelations.com) has been ongoing since 1998. A Boston College grad, he is happy to be back in Boston for this event. 11 a.m. Saturday, Fairfax, Sheraton Blake Garcia was a yearbook photographer for three years and photo editor in his senior year at Thomas Downey H.S. in Modesto, Calif. He now attends the Academy of Art University majoring in commercial photography. He is a finalist for Picture of the Year with three photos in the Environmental Portrait category. Noon Saturday, Commonwealth, Sheraton Tom Gayda, MJE, is director of student publications at North Central H.S. in Indianapolis. He is a former JEA curriculum commission chair and regional director. Gayda has been honored with awards from JEA, DJNF, Ball State University and the Indiana High School Press Association. Noon Friday, Clarendon, Sheraton

What is the most important quality of a storyteller? Tweet us @TTU_MCOM using #WeAreCOMC.

advertising / electronic media / journalism media strategies / public relations

mcom.ttu.edu facebook.com/TTUMCOM twitter.com/TTU_MCOM

Twitter: @nhsjc/#nhsjc

Journalism student Virginia Stille works as a news intern at Telemundo, Lubbock, Texas.

JEA/NSPA Fall 2013 Convention/Boston — 85


bios Mindy Gilman advises the yearbook and newspaper at Blue Valley Northwest High School in Overland Park, Kan. She also has advised in Missouri. Gilman continues to stamp out ignorance one student at a time. 1 p.m. Saturday, Exeter, Sheraton Kelly Glasscock is a journalism adviser at Derby (Kan.) H.S. as well as an accomplished freelance photographer. He has been published in national publications such as Time magazine, Sports Illustrated and USA Today. 8:30 a.m. Thursday, Back Bay C, Sheraton; noon Friday, Room 309, Hynes CC; 10 a.m. Saturday, Republic B, Sheraton Don Goble is in his eighth year teaching full time at Ladue Horton Watkins H.S. in St. Louis. Goble serves as the broadcast technology, film and multimedia Instructor, co-director of LHS-TV and Ladue School District video producer. He blogs for six national publications and was named an Apple Distinguished Educator and the GMLP Media Literacy Teacher of the Year in 2011. 8:30 a.m. Thursday, Liberty B, Sheraton; 9 a.m. Friday, Gardner, Sheraton; 2:30 p.m. Friday, Independence West, Sheraton; noon Saturday, Hampton, Sheraton; 2:30 p.m. Saturday, Gardner, Sheraton Carey Goldberg is the host of WBUR’s innovative CommonHealth blog. She has been the Boston bureau chief of The New York Times, a Moscow correspondent for The Los Angeles Times and a health/science reporter for The Boston Globe. She graduated summa cum laude from Yale and went to graduate school at Harvard. 9 a.m. Friday, Clarendon, Sheraton Erica Goldhawk is a senior at Amador Valley H.S. who will pursue broadcast journalism. She has been a part of her journalism staff since her freshman year. She is one of the editors-in-chief of her school newspaper, The Amadon, and the school website, amadorvalleytoday.org while helping produce the biweekly broadcast show “AVtv.” Noon Saturday, Liberty B, Sheraton Mark Goodman, professor and Knight chair in Scholastic Journalism, joined Kent State University School of Journalism and Mass Communication in January 2008 after serving 22 years as executive director of the Student Press Law Center. Goodman has his undergraduate journalism degree from the University of Missouri-Columbia and a law degree from Duke University. He holds the JEA’s Carl Towley Award and the CSPA’s Gold Key. Noon Friday, Exeter, Sheraton; 2:30 p.m. Friday, Beacon A, Sheraton; 10 a.m. Saturday, Clarendon, Sheraton Brandon Goodwin is director of resources for the Academy of Scholastic Broadcasting. He has been part of ASB Workshop in Springfield, Mo., for seven years, providing training in shooting, editing, writing and interviewing for broadcast journalism teacher and students. He also operates Goodwin Films, a creative video, film and animation agency.

Goodwin was director of photography and editor for the documentary “Linotype: The Film.” 8:30 a.m. Thursday, Liberty C, Sheraton; 11 a.m. Friday, Hampton, Sheraton; 11 a.m. Saturday, Hampton, Sheraton Brenda W. Gorsuch, MJE, advises the newspaper and yearbook at West Henderson H.S. in Hendersonville, N.C. The publications have won CSPA Crowns and NSPA Pacemakers. She is a past chair of the SIPA executive committee and a past president of the NCSMA. She was a JEA Distinguished Yearbook Adviser and a DJNF National High School Journalism Teacher of the Year. Gorsuch is JEA’s Southeast regional director. 9 p.m. Saturday, Fairfax, Sheraton; 8 a.m. Friday, Room 207, Hynes CC; 8 a.m. Saturday, Grand Ballroom, Sheraton Pat Graff, NBCT, taught journalism for 30 years in New Mexico before retiring recently. A frequent speaker and workshop presenter throughout the country, she has written for newspapers and magazines. In 1995, she was the DJNF’s National High School Journalism Teacher of the Year. She has worked extensively with principals’ organizations, NCTE and candidates for National Board certification. 10 a.m. Saturday, Room 310, Hynes CC Chris Grasseschi is the adviser of the Miter newspaper at Bishop Blanchet H.S. in Seattle. Grasseschi is president of the Washington Journalism Education Association and was the Washington State Adviser of the Year in 2008-2009. 9 a.m. Saturday, Back Bay A, Sheraton Kim Green, MJE, advises Log yearbook and The Triangle newsmagazine at Columbus (Ind.) North H.S. The publications have earned top national and state awards, including Gold Crowns and Pacemakers. She is JEA’s Certification Commission chair. Honors include JEA National Yearbook Adviser of the Year, the Edna V. Folger Outstanding Teacher of the Year, DJNF Distinguished Adviser and Indiana Journalism Teacher of the Year. 2:30 p.m. Friday, Liberty B, Sheraton; 3:30 p.m. Friday, Berkeley, Sheraton; 7:30 a.m. Saturday, JEA Suite, Sheraton; 9 a.m. Saturday, Liberty B, Sheraton; noon Saturday, Room 312, Hynes CC Missy Green, a University of South Carolina graduate with a degree in journalism, has 38 years of experience as a yearbook sales representative. Prior to that, she was a reporter for the Tampa Tribune and an advertising copywriter and special events director for a department store. She has been awarded JEA’s Friend of Scholastic Journalism and the Gold Medallion from the Florida Scholastic Press Association. 10 and 11 a.m. Saturday, Constitution A, Sheraton Bill Greene — Featured speaker. See Page 6 for bio. 10 a.m. Friday, Auditorium, Hynes CC Karl Grubaugh, CJE, advises the awardwinning Gazette newspaper and co-advises the GraniteBayToday.org website at Granite Bay (Calif.) H.S., where he teaches advanced placement economics. Grubaugh works occasionally as a copy editor at the Sacramento Bee. He was the 2008 DJNF National High School Journalism Teacher of the Year. 8 a.m. Saturday, Back Bay A, Sheraton; 2:30 p.m. Saturday, Beacon E, Sheraton

86 — JEA/NSPA Fall 2013 Convention/Boston

Nora Guiney has been working in the yearbook industry for more than 25 years. She believes enthusiasm creates momentum and students leave her session with a new energy for selling advertising. Guiney has been on TV shows such as “Oprah,” “The Bachelor,” “Good Morning, America” and “Regis and Kelly.” She tells stories regarding these experiences and ties it all into the sales experience.

11 a.m. Friday, Room 311, Hynes CC

Kathy Habiger, MJE, advises yearbook and newspaper and teaches photography and journalism at Mill Valley H.S. The publications earn consistent Best of Show placings and Pacemaker honors. Habiger was local co-chair of the 2010 Kansas City convention. She serves on the Kansas Scholastic Press Association executive board and is past president of the Journalism Educators of Metropolitan Kansas City. 10 a.m. Friday, Independence East, Sheraton; 11 a.m. Saturday, Clarendon, Sheraton H. L. Hall, MJE, advised the newspaper and yearbook at Kirkwood (Mo.) H.S. for 26 years. Both received Pacemaker and Gold Crown Awards. Personal honors include DJNF Journalism Teacher of the Year, JEA Yearbook Adviser of the Year, JEA Carl Towley Award, CSPA Gold Key and JEA’s first Teacher Inspiration Award. An adjunct professor at Kent State University, he teaches an online class in media management. 9 a.m. Friday, Back Bay C, Sheraton; 8:30 am. Sunday, Auditorium, Hynes CC Robert Hankes has advised the literary magazine at Big Spring H.S., Newville, Pa., for more than 20 years. He also is the president of the Pennsylvania School Press Association. 2:30 p.m. Saturday, Liberty B, Sheraton Elliot Harmon is the communications manager for Creative Commons, a global nonprofit organization dedicated to maximizing digital creativity, sharing and innovation. He manages Creative Commons’ communications strategy and outreach to creative communities. Noon Saturday, Beacon E, Sheraton Michelle Harmon is in her 10th year of advising The Borah Senator in Boise, Idaho. She is traditionally a print journalist and writer, but her experience with jeadigitalmedia.org has helped her teach her staff skills for digital journalism, including audio and video. 11 a.m. Friday, Independence West, Sheraton Charla Harris advises the newspaper, online newspaper, yearbook and broadcast program at Pleasant Grove H.S. in Texarkana, Texas. Her students have won numerous Pacemaker and Crown awards for their publications over the past 28 years. She is a JEA Distinguished Adviser and a Medal of Merit winner, and she was the Texas Journalism Teacher of the Year in 2009. 8 a.m. Saturday, Constitution A, Sheraton Erinn Harris, CJE, has been advising yearbook for seven years, and she is in her fifth year advising Techniques at Thomas Jefferson H.S. for Science and Technology in Alexandria, Va., where the staff recently celebrated its first CSPA Silver Crown. A 2010 JEA Rising Star and a yerd for the past 18 years, Harris enjoys the joy that comes with a visual-verbal design connection. 2:30 p.m. Saturday, Constitution A, Sheraton

Visit jea.org/eval to evaluate sessions


Kelsey Harris is a reporter/blogger at The Heritage Foundation in Washington, D.C. Her graphic design skills and ability to repackage boring content has transformed the researchdriven think tank into a respected digital presence in the political space. She focuses on digital advertising, creative blogging and social media campaigns. Her work has been featured on BuzzFeed, Fox News and in The Washington Post. 2:30 p.m. Friday, Room 208, Hynes CC Nancy Hastings, MJE advised the yearbook and newspaper at Munster H.S. in Indiana for 38 years. Both publications earned Pacemakers, Crowns, Hoosier Stars and Best of Shows. Honors include NSPA’s Pioneer, CSPA’s Gold Key, JEA’s Yearbook Adviser of the Year and JEA’s Lifetime Achievement Award. She serves as JEA’s Indiana state director. 11 a.m. Saturday, Constitution B, Sheraton Brian Hayes, MJE, is the director of secondary education in the Department of Journalism at Ball State University where he oversees the journalism education major and secondary outreach programs. Prior to joining Ball State’s faculty in 2005, Hayes was a high school journalism teacher in suburban Indianapolis and a professional newspaper designer in three cities. 9 a.m. Friday, Kent, Sheraton; 11 a.m. Friday, Dalton, Sheraton Sarah Heet is the visual managing editor of The Kirkwood (Mo.) Call newspaper and thekirkwoodcall.com. She also has served as photographer, designer, photo editor and visual

Twitter: @nhsjc/#nhsjc

editor. Her page designs have won an MIPA Show-Me Award and an SSP Superior. Staff awards include CSPA Gold Crown, NSPA Pacemaker and the First Amendment Press Freedom award. Heet is a part of the JEA’s 45words student initiative. 2:30 p.m. Saturday, Back Bay D, Sheraton Aaron Hendel is one of two breaking news managing editors for Inklings. His responsibilities include assigning and editing breaking news stories, as well as creating local spins on national breaking issues. His breaking news experiences include leading coverage of a townwide bus drivers’ strike, with interviews from the drivers union in addition to the COO of Daatco, one of the largest Connecticut transportation companies. Noon Saturday, Back Bay D, Sheraton Carolyn Henderson is a former awardwinning yearbook adviser turned Walsworth yearbook sales representative. With more than 25 years’ experience creating yearbooks, she pushes her staffs to always look for new ideas and never settle for doing it the way they did it last year. 10 and 11 a.m. Saturday, Constitution A, Sheraton Michael Hernandez has taught broadcast journalism at Mira Costa H.S. in Manhattan Beach, Calif., since 1999, where he advises the awardwinning Mustang Morning News. He is an Apple Distinguished Educator, Google Certified Teacher, and contributing editor to jeadigitalmedia.org. 8:30 a.m. Thursday, Liberty B, Sheraton; noon Friday, Hampton, Sheraton; 8 a.m. Saturday, Independence, Sheraton; noon Saturday, Berkeley, Sheraton; 2:30 p.m. Saturday, Gardner, Sheraton

bios Brian Heyman, CJE, advises the newspaper, yearbook and online programs at Pattonville H.S. in St. Louis, Mo. He is the vice president of the School Sponsored Publications of Greater St. Louis. 9 a.m. Saturday, Constitution A, Sheraton Mike Hiestand was the staff attorney for the Student Press Law Center between 1991 and 2003 and worked full time as the center’s sole consulting attorney until 2012. He continues to assist student media and work with the SPLC on special projects affecting the student press community. Currently, he and Mary Beth Tinker are on the Tinker Tour, visiting schools nationwide to promote youth voices, free speech and a free press. 10 a.m. Friday, Room 308, Hynes CC Jennifer Higgins has advised newsmagazines since 2004. Her current school, Liberty (Mo.) North H.S., opened its doors for the first time in 2010, and she embraced the challenge of starting a newsmagazine from scratch.

8 a.m. and noon Saturday, Clarendon, Sheraton

Will Higgins advises the Dartmouth (Mass.) H.S. Spectrum. He was selected as Massachusetts SouthCoast Teacher of the Year in 2008 and Dartmouth Distinguished Educator in 2010. He served for several years as a reader for the AP English Language and Composition Exam. Higgins

JEA/NSPA Fall 2013 Convention/Boston — 87


bios

Special Recognition Adviser, Houseman has a bachelor’s and a master’s degree in journalism. 2:30 p.m. Friday, Hampton, Sheraton

also is a part-time lecturer at the University of Massachusetts Dartmouth in the First Year English Program. 8:30 a.m. Thursday, Independence West, Sheraton Philip Hilts, the author of six books and a prize-winning health and science reporter for The New York Times and The Washington Post, is the director of the Knight Science Journalism Fellowships at MIT. Hilts, whose journalism career began in 1968, broke the story for the Times of the tobacco industry’s 40-year cover-up of its own research showing that tobacco was harmful and addictive. 11 a.m. Friday, Room 209, Hynes CC Pat Hinman is a journalism teacher and the adviser of both the Above & Beyond high school yearbook and the Sentry middle school yearbook at Robinson Secondary in Fairfax, Va. She has been advising for more than 20 years and her books have won numerous Pacemakers and Crowns during her tenure. 9 and 11 a.m. Saturday, Beacon B, Sheraton Susan Houseman, MJE, was a television reporter, anchor and producer at the ABC affiliate in northeastern Pennsylvania before becoming a teacher. She co-advises The Spoke newspaper and teaches broadcast journalism at Conestoga H.S. in Berwyn, Pa. Her TV students produce a live daily newscast for the school and community. A DJNF

Jeff Howe teaches multimedia journalism at Northeastern University and is a contributing editor at Wired magazine. He is the author of “Crowdsourcing: How the Power of Crowds is Driving the Future of Business.” In his 15 years as a journalist, Howe has written for U.S. News & World Report, The New York Times, The Washington Post and Time Magazine. Noon Friday, Independence West, Sheraton Kelsey Humble is a senior majoring in communication with a concentration in mass communication and journalism at Southeastern Louisiana University. She lives in Mandeville, La., is a veteran multimedia news reporter for her university’s campus online newspaper, The Southeastern U. Reporter, and she has had articles published in the Hammond (La.) Daily Star. 10 a.m. Friday, Beacon B, Sheraton Dean Hume, a former sportswriter, teaches journalism and advises the Spark newsmagazine at Lakota East H.S. Spark has earned Pacemaker, Best of Show and Gallup awards. It was named Best Student Publication in Ohio by SPJ and was recognized for excellence by Time magazine. Hume is a DJNF Distiguished Adviser, a NOSPA Adviser of the Year and a member of NOSPA Adviser Hall of Fame. 11 a.m. and noon Friday, Room 310, Hynes CC Joe Humphrey, MJE, is former president and evaluations coordinator for the Florida

Scholastic Press Association, a member of JEA’s Certification Commission and journalism adviser at Hillsborough H.S. in Tampa, Fla. He also serves as an adjunct journalism instructor at the University of Tampa. Noon Friday, Liberty B, Sheraton Kim Isbell advises the Cub Tracks newspaper, the Cub yearbook, Cub Tracks Online news website, Cub Prints Photography and C.U.B.S Channel 6 News in Humboldt, Kan. In her eight years of advising, Isbell has advised students to three All-Kansas newspaper awards and one AllKansas yearbook award, as well as five Kansas Scholastic Press Association State Sweepstakes championships. 1 p.m. Saturday, Liberty B Jessica J. Jensen is an instructor at South Dakota State University in the Journalism and Mass Communications Department, where she specializes in the teaching of design. She also is the South Dakota High School Press Association coordinator. Noon and 1 p.m. Saturday, Fairfax, Sheraton Michelle Johnson — Featured speaker. See Page 6 for bio. 9 a.m. Friday, Constitution A, Sheraton Patrick R. Johnson, CJE, is in his first year advising the award-winning Tom Tom newspaper of Antioch Community H.S. Previously, Johnson was an instructor in the Diederich College of Communication at Marquette University, where he taught digital journalism and visual communication. Johnson is the director of

JEA/NSPA Fall National High School Journalism Convention

Washington, D.C. Monumental Journalism

Nov. 6-9, 2014 • Washington Marriott Wardman Park

88 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions

For more information: www.jea.org • nspa.studentpress.org


summer and day workshops with the Kettle Moraine Press Association. 10 and 11 a.m. Saturday, Back Bay D, Sheraton Ron Johnson directs Indiana University Student Media and advises the Indiana Daily Student newspaper, Inside magazine and Arbutus yearbook. A frequent conference speaker, Johnson is incoming competition director for the Society for News Design, after editing six editions of “The Best of Newspaper Design.” He taught at Kansas State University for 19 years, 15 of them advising the Kansas State Collegian newspaper. 1 p.m. Thursday, Back Bay A, Sheraton; 2:30 p.m. Friday, Back Bay C, Sheraton Kyle Juntunen advises KGLE, the daily broadcast at Allen (Texas) H.S., and he directs live games at the new Eagle Stadium. He is a graduate of the University of North Texas radio, television and film program. This is his second year at Allen. 1 p.m. Saturday, Hampton, Sheraton Ric Kahn has been the coordinator of Teens in Print since 2009. It is the only citywide newspaper in Boston written by and for teens. Before this he was a staff reporter at The Boston Globe, The Boston Phoenix and Boston magazine. Noon Saturday, Gardner, Sheraton Marsha Kalkowski, MJE, has been advising yearbook, newspaper and a shoestring broadcasting program at an all-girls school in Omaha, Neb., for 20 years. Her students consistently do well at state, regional and national contests because she strives to empower them to own their publications. 10 a.m. Saturday, Beacon G, Sheraton Zolan Kanno-Youngs is a third-year journalism major at Northeastern University. He is the sports director of Northeastern’s radio station WRBB 104.9, a writer for the Huntington News and just finished a sports correspondent co-op for The Boston Globe. 11 a.m. Friday, Room 312, Hynes CC Crystal Kazmierski teaches graphic design, yearbook and drama at Arrowhead Christian Academy in Redlands, Calif. Her students have earned CSPA Crowns and NSPA Pacemakers for Wings. She was the 2000 JEA National Yearbook Adviser of the Year. She received CSPA’s Gold Key award in 2002 and NSPA’s Pioneer award in 2007. 1 and 2:30 p.m. Saturday, Back Bay B, Sheraton Lori Keekley, MJE, advises at St. Louis Park (Minn.) H.S. Previously she worked as the director of contests and critiques at NSPA. The Echo has been a Gold Crown and Pacemaker recipient, and her students have won state and national awards. Keekley is a DJNF Distinguished Adviser and a member JEA’s Scholastic Press Rights Commission. 8:30 a.m. Thursday, Fairfax, Sheraton; 11 a.m. Friday, Beacon B, Sheraton Jack Kennedy, MJE, advised high school newspaper and yearbook for 30 years. He now torments college students at Colorado State University and Metro State University of Denver, teaching technical writing and freshman composition. 9 a.m. Friday, Beacon A, Sheraton; 11 a.m. and noon Friday, Back Bay A, Sheraton; 11 a.m. Saturday, Conference Room, Sheraton; noon Saturday, Room 312, Hynes CC

Twitter: @nhsjc/#nhsjc

Valerie J. Kibler, CJE, teaches at Harrisonburg (Va.) H.S., where she advises the print and online newspaper. She was the local chair for the 2009 Washington, D.C., convention, and will chair the 2014 D.C. convention as well.

8:30 a.m. Thursday, Gardner, Sheraton

Brian Kratzer is an assistant professor at

the Missouri School of Journalism. He is director of photography for the Columbia Missourian, teaches photo editing and staff photojournalism and works with a multimedia team creating documentary videos. Kratzer has been on the faculty at the Missouri Photojournalism Workshop and attended The Kalish and the Eddie Adams workshops. His master’s degree project depicted families living on Missouri Century Farms. Noon Saturday, Room 208, Hynes CC Eden Kreighbaum is a managing editor for the Teresian yearbook at St. Teresa’s Academy in Kansas City, Mo. She is a junior, and this is her second year on staff. She serves on the 45words student initiative for the JEA Scholastic Press Rights Commission. 2:30 p.m. Saturday, Back Bay D, Sheraton Katie Krueger is a yearbook sales representative with Walsworth Yearbooks in Baltimore, Md. As editor-in-chief of her high school and college yearbooks, she understands all levels of the yearbook process. She brings nine years of experience to the yearbook industry and is a speaker at JEA and CSPA conventions. Noon Saturday, Constitution B, Sheraton Julie Kuo is in her fourth year of advising The Musket, the student newspaper at Lexington (Mass.) H.S., and teaches history, journalism and media studies. 11 a.m. Friday, Fairfax, Sheraton

Edmond Kwong, after many years in hightech marketing, decided to pursue opportunities to work with young artists and future business leaders. His first Pegasus yearbook staff at Homestead H.S. in Cupertino, Calif., earned a National Pacemaker and a Silver Crown. His passion for photography and design resulted in many published pieces in newspapers, magazines, brochures and websites. 1 and 2:30 p.m. Saturday, Room 208, Hynes, CC

Carol Lange, CJE, a former high school teacher and adviser, has participated in or directed Intensive Journalistic Writing Institutes since 1988. Lange writes monthly NIE online guides for The Washington Post and co-wrote a four-course radio curriculum available at www.hsj.org. In 2010 she trained teachers in Lanzhou, China, to begin journalism classes. 8:30 a.m. Thursday, Gardner, Sheraton; 10 a.m. Friday, Beacon A, Sheraton; 11 a.m. Saturday, Room 308, Hynes CC Matthew LaPorte, CJE, advises the Southwest Shadow online news site and The Howl yearbook. He is co-president of the Southern Nevada Society of Journalists. Follow us on Twitter @followsnsj. Noon Friday, Constitution A, Sheraton Evelyn Lauer, CJE, advises the online-only publication Niles West News. She teaches journalism and English at Niles West H.S. in Skokie, Ill. She was a 2012 JEA Rising Star. She writes for

bios jeadigitalmedia.org. 10 a.m., 11 a.m. and 2:30 p.m. Friday, Clarendon, Sheraton; 9 a.m. Saturday, Clarendon, Sheraton; 11 a.m. Saturday, Back Bay D, Sheraton; 2:30 p.m. Saturday, Fairfax, Sheraton Paul Lazarovich is a full-time associate professor who has developed and taught communications courses. He is a producer and host of radio and cable television programs, as well as a newspaper columnist for the Free Bird Times & Capeway News. 2:30 p.m. Friday, Constitution B, Sheraton Pete LeBlanc is in his 22nd year of teaching and sixth advising three programs at Antelope (Calif.) H.S., which opened in 2008. Students on Antelope’s Titanium yearbook, Titan Times newspaper and Channel 5 Titan TV News staffs have won CSPA Gold and Silver Crowns, NSPA Pacemakers and NSPA Best of Show awards. 8:30 a.m. Thursday, Back Bay B, Sheraton; 9 and 10 a.m. Saturday, Back Bay B, Sheraton Janet Levin, MJE, has taught journalism her entire career in education. She came to John Hersey H.S. in 1985, took on the role of adviser of The Correspondent newspaper and remains in that position. In 2009, Levin received a Medal of Merit and the Teacher Inspiration Award from JEA. She is a 2011 NSPA Pioneer. 9 a.m. Friday, Dalton, Sheraton; noon Friday, Back Bay D, Sheraton William Lewis is a junior at Kent State University working toward a degree in electronic media production. He hopes to pursue a career in filmmaking. He is an assistant to the director of the College of Communication and Information’s living/learning community, the CCI Commons. 8 a.m. Saturday, Back Bay C, Sheraton Gary Lindsay, MJE, recently retired after 40 years of teaching language arts and journalism at Kennedy H.S. in Cedar Rapids, Iowa. During his career he advised newspaper, yearbook and literary magazine, and his staffs earned numerous state and national awards. Lindsay is JEA’s North Central regional director, a JEA mentor for Iowa and a member of several JEA committees.

9 a.m. Thursday, Fairfax, Sheraton; 10 a.m. Saturday, Conference Room, Sheraton

Chris Lisinski is an English major at Boston University and the editor-in-chief of The Daily Free Press.

1 p.m. Saturday, Room 308, Sheraton

Sarah Lockwood is a Balfour yearbook representative in Virginia. She received her journalism degree from James Madison University in 2013. Lockwood been hooked on journalism and yearbooks since joining her middle school staff and recently completed her ninth book as editor-in-chief of JMU’s Bluestone.

Noon Saturday, Back Bay B, Sheraton

Frank LoMonte is a lawyer, journalist and executive director of the Student Press Law Center, www.splc.org, a nonprofit advocate for the rights

JEA/NSPA Fall 2013 Convention/Boston — 89


“A 21st Century Yearbook For 21st Century Learning” Antioch High School, located in Nashville, Tennessee, is partnering with Picaboo Yearbooks to implement a revolutionary 21st Century Yearbook Program. 21st Century Learning programs implement the essential skills for students to thrive in today’s global economy, including critical thinking, collaboration, problem solving, and communication. Jim Brown, teacher and photographer, saw the framework from Picaboo Yearbooks and realized he could incorporate the yearbook process into his 21st Century teaching methods.

How did Jim make this work for Antioch High School? Coming from a photography background, Jim approached the school to let the students take the class portraits and all respective pictures for the school yearbook. It was a big undertaking considering a professional had taken all the photos in previous years and Jim’s students only understood basic photography. The students were thus presented with a real world problem, and they were responsible for learning and producing a high quality product. During this phase, magic happened. As Jim describes it, “The students were engaged like no class assignment before. They knew this was real, that their work was going to be front and center for the entire school to see, and that it was a reflection of themselves.” What he discovered was when the students were truly invested in what they were doing, they were learning so much more in the process.

Jim Brown,

Digital Art & Design Teacher, Antioch High School, Nashville, TN

Moving forward to this year, Jim is now incorporating the 21st Century Yearbook Program™ from Picaboo Yearbooks to create various Activity Yearbooks throughout the school. By Thanksgiving of 2013, Antioch High School will have three different books available for purchase: one for Homecoming, one for the Band Program, and one for the Football Team.

Antioch High School is not the only school implementing the Picaboo Yearbooks program. The School of the Madeleine in Berkeley is doing the same. Ken Willers, Principal, believes that, “If you take away the areas where students have to learn how to use software or production tools, they will use all of their time to create, innovate, and design”.

How are Activity Yearbooks incorporated in Project-Based Learning?

Picaboo Yearbooks 21st Century Program not only helps the students, it helps the school as a whole. Educators spend more time engaging with the students and help them self-direct their learning. Principals and educators are seeing an increase in school spirit and collaboration among the students, creating a greater sense of community.

A student is given an assignment to create an Activity Yearbook for the football team at the school. The student will have to research the sport, the history of the school’s football team, conduct interviews, and take photos for the book, all while leading, assigning, collaborating and coordinating with a small group other students on this project. During the process, the student will experience various situations or problems that need to be address or overcome using her teacher as an advisor. Once the team finishes the book it’s ready to post on a turnkey storefront and ordered by other students who receive the book within 3-weeks, or they can download a free eYearbook version immediately. After the Activity Yearbook is put on the storefront for sale, the next task for the student is to market and sell the book. This whole process could take between 2-6 weeks to complete an Activity Yearbook. This allows students to evaluate their performance and learn from their accomplishments and mistakes, making adjustments to their next 21st Century Yearbook Project.

90 — JEA/NSPA Fall 2013 Convention/Boston

To learn more about Picaboo Yearbooks 21st Century Yearbook Program™ visit www.picabooyearbooks.com or email us at info@picabooyearbooks.com

“21st Century Yearbooks for 21st Century Learning™” No Boundaries. No Limits. Visit jea.org/eval to evaluate sessions


of student journalists nationwide.

8:30 a.m. Thursday, Hampton, Sheraton; 9 a.m. Friday, Liberty B, Sheraton; 2:30 p.m. Friday, Liberty C, Sheraton; noon and 1 p.m. Saturday, Jefferson, Sheraton Aaron Manfull, MJE, is the director of student media at Francis Howell North H.S. in St. Charles, Mo. He advises the newspaper, yearbook, Web and video programs. He is the JEA Digital Media chair and co-director of Media Now STL. He is a former DJNF National High School Journalism Teacher of the Year and NSPA Pioneer Award winner. 9 and 10 a.m. Friday, Back Bay A, Sheraton; 8 a.m. Saturday, Beacon H, Sheraton Chris Marstall is a creative technologist at the GlobeLab, the research and development unit of The Boston Globe. 2:30 p.m. Friday, Back Back Ballroom D, Sheraton Alex Martin is the editor-in-chief of FHHS Publications, the staff that oversees the publication of the award-winning Francis Howell H.S. yearbook, website and newspaper.

10 a.m. Friday, Room 308, Hynes CC

Susan Massy advises the Lair yearbook and the Northwest Passage newspaper at Shawnee Mission Northwest H.S. in Kansas, where she teaches newspaper, yearbook and photojournalism. Both publications have earned CSPA Crowns and NSPA Pacemakers. Massy was honored as the 1999 JEA National Yearbook Adviser of the Year.

1 and 2:30 p.m. Saturday, Back Bay B, Sheraton

Bailey McBride advises the BK Breezeway newspaper and Crest yearbook at Bishop Kelley H.S. in Tulsa, Okla. She was named the 2013 Oklahoma Scholastic Media Newspaper Adviser of the Year and worked as a reporter and designer/ copy editor at Northwest Arkansas Newspapers before she began teaching two years ago. McBride was the editor-in-chief of her college newspaper at the University of Arkansas. 1 p.m. Saturday, Room 309 Hynes CC Tamra McCarthy, CJE, teaches English and advises Wingspan, the yearbook publication from James Enochs H.S. in Modesto, Calif. She was recognized as a 2011 JEA Rising Star adviser and JEA 2012 Distinguished Yearbook Adviser. Her staff’s 2009 and 2010 editions of the yearbook were awarded Pacemaker and Crown awards. 2:30 p.m. Saturday, Constitution B, Sheraton Rachel McCarver, MJE, advises the Bull Dog News Network and a 2012 Pacemaker finalist and 2011 Pacemaker winner cnhsmedia.com at Columbus (Ind.) North H.S. McCarver also is the past president of the Indiana High School Press Association and a 2010 JEA Rising Star. 9 and 10 a.m. Friday, Exeter, Sheraton Julieanne McClain, CJE, teaches journalism and advises Talisman, the student newspaper at Rutherford B. Hayes H.S. in Delaware, Ohio. She developed sophomore journalism, a yearlong curriculum that functions as an alternative for sophomores to meet the English 10 standards. McClain earned a master’s in curriculum and instruction at the Missouri School of Journalism. 8 a.m. Saturday, Beacon E, Sheraton; 10 and 11 a.m. Saturday, Exeter, Sheraton

Twitter: @nhsjc/#nhsjc

JIM MCGONNELL advised the newspaper, TV broadcast and website at Findlay (Ohio) H.S. for 20 years. All three programs received Pacemaker and Crown awards. Personal honors include DJNF Journalism Teacher of the Year, CSPA Gold Key, GLIPA Hall of Fame and Master Teacher of Ohio. Retired after 35 years of teaching and advising journalism staffs, he recently was hired by Disney. Noon Saturday, Constitution A, Sheraton Julia McNamee co-advises Inklings, Staples H.S.’s newspaper in Connecticut. Before teaching, she covered politics, transportation and the courts for a daily newspaper; later, she reported on science and health for an online company. Noon Saturday, Back Bay D, Sheraton Megan McNames is a journalism and digital media instructor at Ball State University, where she teaches courses in human factors, interface design and graphic design theory. She has experience in print and Web writing and design and has been an instructor with Ball State’s high school journalism workshops. She is obsessed with WordPress. Noon Friday, Room 308, Hynes CC Marcia Meskiel-Macy, a senior sales representative for Balfour Yearbooks, works with staffs in Florida helping advisers build programs that meet the needs of the schools and challenge the students. A speaker at conventions since 1982, she combines her journalism expertise with her communication savvy in a fun environment. Meskiel-Macy recently took on life coaching as a challenge, and it works well for yearbook staffs. 11 a.m. and noon Friday, Room 313, Hynes CC Kathleen Mills is a teacher and freelance journalist who has published in The New York Times, Mademoiselle and the Indianapolis Star. She advises The Optimist at Bloomington (Ind.) H.S. South and spent 10 years as a journalist for daily newspapers. 2:30 p.m. Friday, Beacon B, Sheraton Joe Mirando, MJE and Ph.D., is Elizabeth Weeks Jones Endowed Professor of Humanities at Southeastern Louisiana University. He worked as a journalist for four daily newspapers and as a high school journalism teacher and newspaper and yearbook adviser for five years. He teaches a course in scholastic journalism for college students preparing to become teachers. Mirando serves on JEA’s Certification Commission. 10 a.m. and noon Friday, Beacon B, Sheraton Seth Mnookin — Featured speaker. See Page 6 for bio. 10 a.m. Saturday, Room 311, Hynes CC Christine Mooney has advised the yearbook staff at Monsignor Donovan H.S. in Toms River, N.J., for 14 years. She also teaches French, helps teachers integrate technology into their curriculum and serves as the school’s webmaster. Their book, Exemplar, has been consistently recognized with the All-New Jersey Awards from the Garden State Scholastic Press Association. Noon Friday, Gardner, Sheraton Whitney Moore has been a sales representative for Walsworth Yearbooks for more than six years. After graduating from the University of New Hampshire with a journalism degree, she knew she wanted to bring her experience and passion for yearbooks to as many high school

bios and middle school students as possible. She’s been with Walsworth ever since and teaching and judging at conventions since 2008. 2:30 p.m. Friday, Fairfax, Sheraton Amy Morgan, MJE, advises publications at Shawnee Mission West H.S. The newspaper and yearbook have earned Pacemaker finalist and Best of Show honors. Morgan was local co-chair of the 2010 JEA/NSPA convention in Kansas City, Mo. She serves on the Kansas Scholastic Press Association’s executive board and has been on the board of the Journalism Educators of Metropolitan Kansas City. 10 a.m. Friday, Independence East, Sheraton Beatrice Y. Motamedi, CJE, teaches journalism at The Urban School of San Francisco and is co-director of Newsroom by the Bay at Stanford. She is a DJNF Distinguished Adviser and was named Educator of the Year (high school division) by the California Journalism Education Coalition in 2012. She is JEA’s California state director. Prior to becoming a teacher, Motamedi worked as a staff writer for the San Francisco Chronicle, United Press International and WebMD. 2:30 p.m. Friday, Independence East, Sheraton Dan Mueller was the editor of his high school yearbook and newspaper, as well as his college yearbook. Since then, Mueller has been a Herff Jones yearbook representative in Missouri, working with yearbook staffs who consistently win local and national awards. He loves to help students learn how to use technology to enhance their books and design. 10 a.m. Friday, Room 209, Hynes CC Judith Murray, MJE and NBCT, has advised yearbook, newspaper, and literary magazine for 10 years. She has a bachelor’s degree in journalism and English and a master’s degree in secondary education. She is a former reporter and page designer for The Arkansas Democrat Gazette, where she won the statewide overall prize for the Best of Print and the Best of Feature Writing through Society of Professional Journalists. 9 a.m. Saturday, Room 308, Hynes CC Mark Murray is executive director of the Association of Texas Photography Instructors and coordinator of Technology Systems for Arlington ISD. He also is an Adobe Education Leader. Murray is the recipient of NSPA’s Pioneer Award, CSPA’s Gold Key Award, TAJE’s Trailblazer Award, JEA’s Medal of Merit and ATPI’s Star of Texas. 8:30 a.m. and 1 p.m. Thursday, Berkeley, Sheraton; noon Friday, Constitution B, Sheraton; 2:30 p.m. Friday, Room 313, Hynes CC; 8 a.m. Saturday, Berkeley, Sheraton Heather Nagel advises the Lion’s Roar at Christ Presbyterian Academy in Nashville, Tenn., serving as the Tennessee state director for JEA. The Lion’s Roar has won NSPA Best of Show, CSPA Gold Medal, CSPA Silver Crown and THSPA Best Overall Yearbook. Nagel received Special Recognition in 2012 in JEA’s H.L. Hall Yearbook Adviser of the Year competition, and she was named THSPA’s Bonnie Hufford Outstanding Adviser. 9 a.m. Saturday, Gardner, Sheraton

JEA/NSPA Fall 2013 Convention/Boston — 91


bios David Nathan advises The Review at St. John’s School in Houston. An English teacher, Nathan wrote movie reviews for his high school and college newspapers before working as an entertainment critic in Los Angeles and Houston. He also has published three books of baseball quotations (The McFarland Baseball Quotations Dictionary) and has written for national publications. 10 a.m. Friday, Room 310, Hynes CC Abrianna Nelson, CJE, advises The Ridge Online, The Ridge newspaper and The Rampage yearbook at Pleasant Ridge H.S. in Easton, Kan. She majored in journalism at Washington and Lee University and interned with the Fairfax County Times and USA Today. Her specialties include Webbased journalism, social media, curriculum design and the Common Core.

2:30 p.m. Saturday, Constitution A, Sheraton

Andy Nelson is the R.M. Seaton Professional Journalism Chair at Kansas State University. Previously, Nelson was an independent photojournalist and multimedia producer based in Bangkok, Thailand, with more than 20 years’ experience covering humanitarian issues, world affairs, U.S. politics and the environment. Fom 1997 to 2008 he was the Washington, D.C.-based staff photographer for The Christian Science Monitor, covering stories in more than 30 countries. 8:30 a.m. Thursday, Republic A, Sheraton; 2:30 p.m. Friday, Back Bay B, Sheraton Eric Newton is the senior adviser to the president at the John S. and James Knight Foundation. As program director and vice president, during the past decade Newton helped build the journalism and media innovation program from a department of one into a team of seven, overseeing the development of more than $300 million in grants. 10 a.m. Saturday, Clarendon, Sheraton Mark Newton, MJE, teaches journalism at Mountain Vista H.S. in Highlands Ranch, Colo., and advises VISTAj. The comprehensive media program includes the Eagle Eye news magazine, VistaNow. org, Eagle Vision TV and Aerie yearbook. Newton is JEA’s president. 8 a.m. Thursday, Commonwealth, Sheraton; 8 a.m. Friday, Commonwealth, Sheraton; 8 a.m. Saturday, Beacon H, Sheraton; 11 a.m. Saturday, Liberty C, Sheraton; 2:30 p.m. Saturday, Room 308, Hynes CC Sarah Nichols, MJE, advises student media at Whitney H.S. in Rocklin, Calif., where her students have been recognized with top national and state honors. Nichols is JEA’s vice president and serves on the Scholastic Press Rights Commission and Digital Media Committee. The 2010 National Yearbook Adviser of the Year, she has received JEA’s Medal of Merit and NSPA’s Pioneer Award. 9 a.m. Friday, Commonwealth, Sheraton; 9 a.m. Saturday, Conference Room; 11 a.m. Saturday, Republic B, Sheraton Paul Niwa — Featured speaker. See Page 6 for bio. 11 a.m. Friday, Constitution A, Sheraton

Denise Nosbisch is a sales representative for Walsworth Yearbooks in Raleigh, N.C. She was the 2010 Teacher of the Year for the Cumberland County School System, the 79th largest school district in the U.S. While teaching, Nosbisch advised the yearbook and served on the executive board of the North Carolina Scholastic Media Association. She has an English/journalism degree. 1 p.m. Saturday, Liberty C, Sheraton Mark Novom is the yearbook and newspaper adviser at Brentwood School in Los Angeles, and is particularly passionate about organization. His students use an organization notebook as the yearbook bible. In his first year, the Aerie yearbook won a Pacemaker from NSPA. He previously taught English and theater for eight years. 11 a.m. Friday, Back Bay D, Sheraton; 10 a.m. Saturday, Back Bay C, Sheraton Steve O’Donoghue is a former DJNF High School Journalism Teacher of the Year who taught 33 years in Oakland, Calif. Founder of The Media Academy and the California Scholastic Journalism Initiative, O’Donoghue coordinates scholastic journalism efforts with industry partners in Los Angeles, Sacramento and Contra Costa, Calif. 8:30 a.m. Thursday, Beacon A, Sheraton; 9 a.m. Friday, Beacon G, Sheraton Lori Oglesbee, MJE, advises the yearbook and media website at McKinney (Texas) H.S. The 2009 JEA Yearbook Adviser of the Year loves teaching kids who amaze her each year with their level of commitment to excellence. They’ve been rewarded with every top award at the state and national level. 9 and 10 a.m. Friday, Back Bay D, Sheraton; 9 a.m. Saturday, Independence West, Sheraton Pavlina Osta, a student at Spruce Creek H.S. in Port Orange, Fla., has more than four years’ experience as a radio personality. Since she was 11 years old, she has interviewed more than 300 celebrities on location and has been featured in national magazines such as Tiger Beat. Noon Saturday, Room 309, Hynes CC Tyler Paley is a senior at Communications H.S. in Wall Township, N.J. He is the managing editor for his school’s internationally award-winning independent newspaper, The Inkblot. Last year, Paley was the Web editor for the newspaper’s website. This is Paley’s third year on the staff. He hopes to become a professional sports journalist or play-by-play announcer. 2:30 p.m. Saturday, Back Bay D, Sheraton Jed Palmer advises the journalism program at Sierra Middle School in Parker, Colo. His yearbook has earned All-American and Pacemaker awards, and his students have earned numerous awards, including NSPA Picture of the Year. He is the middle school coordinator for the Colorado High School Press Association and has been an instructor at several journalism workshops. 1 and 2:30 p.m. Saturday, Independence East, Sheraton Caroline Patrickis is a senior majoring in communication with a concentration in electronic media at Southeastern Louisiana University. She lives in Mandeville, La., and is a veteran reporter for her university’s campus TV operation, Southeastern Channel 18. 10 a.m. Friday, Beacon B, Sheraton

92 — JEA/NSPA Fall 2013 Convention/Boston

ALEXA PENCE is editor-in-chief of Aberrance Quarterly, a women’s empowerment/local fashion magazine that tackles nationally relevant exposés. Pence interned for Nfocus Magazine her sophomore year of high school, progressed to staff photographer/writer and is on track to be editorial associate. She has covered New York Fashion Week, two Kentucky Derbys trackside, President Barack Obama’s election night rally and more than 60 local assignments. 11 a.m. Friday, Beacon G, Sheraton; 1 p.m. Saturday, Beacon A, Sheraton Cassandra Pereira advises the yearbook, daily television broadcast and online news site for Santa Teresa H.S. She is a Leading Edge Certified online and blended teacher and teaches three blended education courses. She is passionate about the power of technology to change both journalism and education. 11 a.m. Friday, Jefferson, Sheraton Sacha Pfeiffer — Featured speaker. See Page 7 for bio. Noon Friday, Commonwealth, Sheraton Beth Phillips is an adviser for the publications at Francis Howell North H.S. in St. Charles, Mo. 11 a.m. Friday, Independence East, Sheraton Wayna Polk, MJE, recently retired from Abilene (Texas) H.S. Her Flashlight yearbook staffs won Silver Crowns and Pacemakers, SIPA All Southern and ILPC Gold and Silver Star awards. An NSPA Pioneer recipient, Polk has received JEA’s Medal of Merit and been a JEA Distinguished Adviser and Special Recognition Adviser. She is JEA South Central Region director, the Scholarship Committee chair and a member of the JEA Awards Committee. 9 p.m. Thursday, Fairfax, Sheraton; 10 a.m. Saturday, Jefferson, Sheraton Jacob Potash is co-executive editor of The Little Hawk newspaper at Iowa City (Iowa) H.S. He won the first-place award for In-depth News in the Iowa High School Press Association’s 2013 spring competition and serves on 45words student initiative for the JEA Scholastic Press Rights Commission. Additionally, he edits the literary magazine City High Review. 2:30 p.m. Saturday, Back Bay D, Sheraton Linda Puntney, MJE, former JEA executive director, professor emeritus at Kansas State University, advised award-winning publications on the junior high, high school, community college, small university and Big 12 levels. Honors include CMA’s Distinguished Yearbook and Distinguished Magazine adviser, JEA Carl Towley, Teacher Inspiration, Lifetime Achievement, Medal of Merit, CSPA Gold Key and Charles O’Malley awards. She advised the Royal Purple yearbook at K-State. 8 and 9 a.m. Saturday, Back Bay D, Sheraton Renee Quaife advises Silhouette, the literary magazine at Sparkman H.S. in Harvest, Ala. She and her staff have received several state-level awards for the magazine including Superior three times. The magazine has also received multiple firstplace awards for literary and artistic works in the annual magazine. Silhouette is a student-centered, student-created publication that provides an outlet and opportunity for creative expression. 10 a.m. Friday, Beacon G, Sheraton

Visit jea.org/eval to evaluate sessions


Preston Randolph is an award-winning filmmaker and the owner of Cactus Productions, a video production company in Cody, Wyo. He has worked and collaborated with a prestigious group of Academy Award- and Grammy-winning filmmakers, artists and musicians. Recently he won the Wyoming Short Film Contest and is in the process of producing a series of short films and social issue documentaries. 9 and 10 a.m. Friday, Independence West, Sheraton Matt Rasgorshek is the adviser for Warrior Television and Westside Wired at Westside H.S. in Omaha, Neb. His publications have been recognized on state and national levels. Prior to teaching, Rasgorshek was a newscast director, producer and photographer/editor for stations in Omaha and Phoenix. 9 a.m. Friday Hampton, Sheraton; 10 a.m. Saturday, Hampton, Sheraton; 2:30 p.m. Gardner, Sheraton Megan Read teaches journalism at Grand Junction (Colo.) H.S. and advises the Orange and Black newspaper and website and Tiger yearbook. She previously taught composition and literature, Honors English 9 and ESL composition and literature at the school. 8 a.m. Saturday, Jefferson, Sheraton Jon Reese, CJE, advises Decatur (Ga.) H.S.’s newsmagazine Carpe Diem, broadcast program The Dec and website 3ten.org. He also coordinates the Senior Project and IB CAS program. Reese is Georgia’s JEA state director, and he serves on the advisory committee of the Georgia Scholastic Press Association and SIPA. He is a 2013 ASNE Reynolds Institute fellow and has advised student media for 21 years. 10 a.m. Friday, Dalton, Sheraton; 9 a.m. Saturday, Commonwealth, Sheraton; 10 a.m. Saturday, Conference Room, Sheraton; 2:30 p.m. Saturday, Back Back Ballroom C, Sheraton Mike Riley teaches broadcast journalism at Cody (Wyo.) H.S. He is in his 40th year as an educator, and he has taught in prison, the Marshall Islands, Blackfeet Community College, the University of Montana and the Texas School for the Deaf. His students have won numerous awards, and many have become outstanding professionals in their fields. 9 and 10 a.m. Saturday, Independence West, Sheraton Ryan Rinaldi is a Walsworth Yearbooks sales representative from central Texas with more than five years of experience in the yearbook world. Being a former high school journalism and broadcast teacher, Rinaldi believes scholastic journalism is an important part of the educational process, and he is dedicated to helping staffs reach their goals. 1 p.m. Saturday, Beacon E, Sheraton MONICA RODRIGUEZ, CJE, NBCT, teaches journalism/graphic design at Gulliver Preparatory School in Miami, Fla. She advises the nationally recognized The Raider yearbook, The Raider Voice newspaper and website, and Reflections literary magazine. In 15 years in scholastic journalism, Rodriguez worked for Walsworth Publishing Co., taught at local and regional conventions and organized networking and training opportunities for student editors and advisers. 9 a.m. and 2:30 p.m. Friday, Sheraton

Twitter: @nhsjc/#nhsjc

Jonathan Rogers, MJE, advises the award-winning The Little Hawk newspaper and website at Iowa City (Iowa) H.S. He worked as a sports reporter for daily newspapers and wrote environmental articles for E/The Environmental Magazine before advising. Rogers is the IHSPA president and writes for jeadigalmedia.org. 10 a.m. Saturday, Room 208, Hynes CC, Sheraton; 2:30 p.m. Saturday, Fairfax, Sheraton Dina Rudick — Featured speaker. See Page 7 for bio. 2:30 p.m. Friday, Constitution A, Sheraton Bob Ryan — Featured speaker. See Page 7 for bio. 10 a.m. Friday, Room 311, Hynes CC Lisie Sabbag is a double major in journalism and writing, literature and publishing at Emerson College in Boston. She previously wrote for the Verde magazine at Palo Alto (Calif.) H.S. 1 p.m. Saturday, Constitution A JANET SAIDI is on the faculty of the Missouri School of Journalism and serves as news director at KBIA FM. Saidi has contributed to NPR and the BBC, and co-produced a national PBS documentary on health care. Her writing has appeared in The Christian Science Monitor and the Los Angeles Times. Her public-radio work began with a nightly culture magazine on San Diego’s NPR affiliate. Noon Saturday, Room 208, Hynes CC Bobby Samuels is the president of The Harvard Crimson. After joining The Crimson’s Sports Board in the fall of 2010, Samuels was named sports chair in 2012 and in that role led the paper’s sports coverage. A native of Pasadena, Calif., Samuels is a senior at Harvard College and is pursuing a degree in economics and a secondary in statistics. 1 p.m. Saturday, Room 308, Hynes CC Katie Sanders is a contributing editor at Glamour in New York. She has worked as an editorial assistant at Vanity Fair and written for Seventeen, Philadelphia and Marie Claire. Her very first writing gig was reporting for Newton South H.S.’s student-run newspaper, The Lion’s Roar. She has attended three JEA/NSPA conventions and still regrets never going to the dances. Noon Saturday, Independence East, Sheraton Nicole Sanders advises the award-winning Rosette yearbook and LeopardLife newspaper at Willow Springs Middle School in Lucas, Texas. She holds a master’s of education degree in leadership with emphasis in conflict resolution and mediation. Sanders worked for the Amarillo Globe-News as an education editor, the Arkansas Democrat Gazette as a feature writer and the Mid Rivers NewsMagazine in St. Louis as a contributing editor. 10 a.m. Saturday, Beacon B, Sheraton Suproteem Sarkar, a junior at Conestoga H.S., is the news editor for The Spoke, an NSPA Pacemaker-winning newspaper. He also serves as the webmaster for the Pennsylvania School Press Association. Sarkar has won the top awards from the Student Keystone Press Awards and the PSPA, and is a finalist in the 2013 NSPA Multimedia News Story of the Year contest. 2:30 p.m. Saturday, Back Bay D, Sheraton

bios Rod Satterthwaite, MJE, is special projects chairperson for the Michigan Interscholastic Press Association and adviser of The Squall student newspaper at Dexter (Mich.) H.S. His students’ publication have won awards including The Spartan, NSPA Pacemaker and CSPA Crowns. In addition he is JEA’s Region 6 director. 9 p.m. Thursday, Fairfax, Sheraton; 2:30 p.m. Friday, Back Bay A, Sheraton; 8 and 10 a.m. Saturday, Liberty B, Sheraton Laura Schaub, CJE, is Lifetouch’s national key accounts manager. Previously, she directed the Oklahoma Interscholastic Press Association and served as a professor of journalism at the University of Oklahoma. She is past CSPAA president and has received the Gold Key, O’Malley, Paschal and Murphy Awards from CSPA.

8 and 9 a.m. Saturday, Room 208, Hynes CC

Hal Schmidt is an InDesign guru and a yearbook representative for Balfour Yearbooks. He has been working with yearbook staffs for more than 20 years and has taught sessions on computer programs at Texas and national conventions for more than 15 years. He is a recipient of the TAJE Friend of Journalism award. He is co-owner of PS Graphics in Kingwood, Texas. Noon Friday, Berkeley, Sheraton; 2:30 p.m. Saturday, Berkeley, Sheraton Matthew Schott, CJE, advises the newspaper, website, yearbook and broadcast at Francis Howell Central H.S. Each year, his staffs engage in a service project tied to coverage they are doing. In the past three years, publications staff members have raised more than $3,000 for students and community groups in the St. Louis area. 10 a.m. Saturday, Room 208, Hynes CC; 2:30 p.m. Saturday, Back Bay D, Sheraton Kathy Schrier, MJE, is executive director of the Washington Journalism Education Association. A former newspaper and yearbook adviser, she now serves as a JEA mentor to new advisers in the Seattle area. She is an NSPA Pioneer and a JEA Medal of Merit recipient. Schrier works part time for the Washington News Council. 9 a.m. Saturday, Jefferson, Sheraton Alyssa Sellors advises the yearbook, The Legacy, as well as the newspaper, The Tradition, at Harrison H.S. in Kennesaw, Ga. She has been teaching for five years; 3 1/2 years in the journalism program. She also is the recipient of Harrison H.S’s Adviser of the Year for 2011-2012. Noon Friday, Jefferson, Sheraton Tracy Anne Sena, CJE, advises The Broadview (2012 Pacemaker) at Convent of the Sacred Heart H.S. in San Francisco as well as a fledgling online news site at the Online School for Girls, comprised of students working collaboratively in two countries and 10 states. Sena holds the CSPA Gold Key, JEA Medal of Merit, DJNF Distinguished Adviser and NPSA Pioneer Awards. 8 a.m. Saturday, Exeter, Sheraton; 2:30 p.m. Saturday, Jefferson, Sheraton Anna Setter is a senior at Humboldt (Kan.) H.S. She is the editor-in-chief for the award-

JEA/NSPA Fall 2013 Convention/Boston — 93


bios winning Cub Tracks newspaper for the second year. Setter has been a member of two Kansas Scholastic Press Association State Sweepstakes championship staffs. She also has won regional and state individual awards in newspaper design, infographic design, theme and graphics, feature writing and editing. 1 p.m. Saturday, Liberty B, Sheraton Linda Shockley is deputy director of the Dow Jones News Fund and is a member of JEA’s Outreach Academy teaching cadre. 8:30 a.m. Thursday, Beacon A, Sheraton; noon Saturday, Room 312, Hynes CC Mike Simons, CJE, advises the Skjöld yearbook at West H.S. in upstate New York. Known for his high-energy teaching style and photography instruction, Simons was named a 2011 Special Recognition Yearbook Adviser by JEA. Skjöld has been named both a Pacemaker and Crown finalist in the past four years. 8:30 a.m. and 1 p.m. Thursday, Independence East, Sheraton; 11 a.m. Saturday, Back Bay A, Sheraton; 2:30 p.m. Saturday, Room 309, Hynes CC Tom Sivertsen has been advising high school journalists for 18 years and has degrees in journalism and educational psychology from University of Iowa and UC Santa Barbara. He advises the Bark newspaper at Redwood High in Larkspur, Calif. 9, 10 and 11 a.m. Friday, Room 208, Hynes CC; 1 p.m. Saturday, Constitution B, Sheraton Sue Skalicky, CJE, is an eighth-year English 10 and journalism teacher at Century H.S. in Bismarck, N.D. She advises the Century Star newsmagazine and Century Spirit yearbook and teaches an introductory journalism class. During the past 24 years, Skalicky has worked as a medical photographer, a section editor/writer/ photographer of a weekly newspaper, a leadership conference speaker and freelance writer. 11 a.m. Friday, Room 308, Hynes CC; 9 a.m. Saturday, Beacon G, Sheraton Ray Slye, sales and marketing resource consultant with Herff Jones Yearbooks, taught journalism and advised student publications in California and Arizona prior to becoming a yearbook representative in the Sacramento area. His own students and those at schools in his territory have earned numerous national, regional and state awards. A CSPA Gold Key winner, Slye teaches at workshops and conventions from coast to coast. 10 a.m. Saturday, Constitution B, Sheraton Derek Smith teaches language arts and advises the Arrow newsmagazine at Renton (Wash.) H.S. He edits and manages social media for magicalteaching.com, and he recently finished a book about his first year of teaching. 9 a.m. Saturday, Republic B, Sheraton Helen F. Smith is the executive director of the New England Scholastic Press Association and a past president of CSPAA. She advised the Newtonite at Newton North High School for 35

years. Publications she has edited include The Official CSPA Stylebook, Scholastic Newspaper Fundamentals and Scholastic Newspaper Critique. She has taught in Armenia, Hungary, Kyrgyzstan, Romania and Zambia. 9 a.m. Friday, Room 310, Hynes CC; 9 and 11 a.m. Saturday, Room 313, Hynes CC Kathy Smith, MJE, advises the Cauldron yearbook at Downers Grove (Ill.) North H.S. She has taught journalism classes at North High for eight years and is a reading specialist and literacy coach. 11 a.m. Saturday, Gardner, Sheraton Nancy Y. Smith, MJE, advises the newspaper, yearbook and DVD at Lafayette H.S. in Wildwood, Mo. She has been teaching journalism and advising publications for 25 years, and she frequently speaks at workshops and conferences across the country. Smith is the JEA national Writeoff chair. Honors include DJNF Special Recognition Adviser and Distinguished Adviser in the National Yearbook Adviser of the Year competition. 8 a.m. Friday, Republic A, Sheraton; 1 p.m. Friday, Beacon D, Sheraton; 6 p.m. Friday, Constitution B, Sheraton Luke Southwell is co-editor-in-chief of Peninsula H.S.’s La Pantera yearbook and president and co-founder of PressFriends. PressFriends was founded in 2008 when Southwell was in seventh grade. PressFriends has mentored more than 1,500 disadvantaged youth, published more than 80 newspapers. PressFriends’ student board was named a first-place winner in Scholastic’s 2012 Be Big in Your Community contest. Noon Saturday, Republic B, Sheraton Howard Spanogle, assistant editor of Communication: Journalism Education Today, formerly advised the Glenbard East H.S. Echo in Lombard, Ill., and the Highland Park H.S. Bagpipe in Texas. Now located in Asheville, N. C., he has edited books and curriculum projects for yearbook companies. Both Spanogle and his students have earned numerous state and national awards. 10:15 a.m. Friday, Room 210, Hynes CC; 2:30 p.m. Friday, Room 310, Hynes CC Ronna Sparks Woodward, MJE, has advised yearbooks since 1997. Her 2010 yearbook was a Pacemaker winner. Sparks Woodward finds inspiration in her students. 8 a.m. and noon Saturday, Clarendon, Sheraton Evan Sporer is a senior journalism major minoring in business studies at Emerson College, and is the editor-in-chief of the student newspaper, the Berkeley Beacon. A Brooklyn, New York, native, Sporer has written for the Boston Bruins, SportsGrid.com, The Boston Globe and a number of other media outlets. 1 p.m. Saturday, Room 308, Hynes CC Larry Steinmetz, CJE, has been a yearbook and newsmagazine adviser for 15 years at Bullitt East H.S. in Mount Washington, Ky. Both the Endeavor yearbook and Livewire newsmagazine have been recognized by state and national entities. He also serves as the school technology coordinator, school-based, decision-making council vice president and assistant soccer coach. 9 a.m. Friday, Independence East, Sheraton Lynn Strause advised 30 yearbooks before retiring, the last 13 at East Lansing (Mich.) H.S.

94 — JEA/NSPA Fall 2013 Convention/Boston

Strause continues to speak and judge for national, regional and state organizations. She was named Michigan’s Adviser of the Year, JEA National Yearbook Adviser of the Year, received a CSPA Gold Key, NSPA Pioneer Award and JEA Lifetime Achievement Award. She is a yearbook consultant. 8 a.m. Saturday, Commonwealth, Sheraton; 11 a.m. Saturday, Independence West, Sheraton Jesse Sutherland, CJE, advises WKHS-TV, a broadcast news program at Waterford Kettering H.S. She also helps advise the Drift (www. waterforddrift.com), Kettering’s new Journalism Department website. She is the JEA state director for Michigan and is the treasurer for the Michigan Interscholastic Press Association. She was a 2009 JEA Future Teacher Scholarship recipient. 3 p.m. Thursday, Beacon B, Sheraton; 10 a.m. and 2:30 p.m. Saturday, Hampton, Sheraton Alan Swank is the Midwest Regional vice president for Balfour yearbooks. A former yearbook representative, high school teacher and co-adviser and volleyball and track coach, Swank is known for his highly interactive sessions. A frequent speaker at state and national conventions, participants in his session have come to find that there is no safe seat in the house. 11 a.m. Friday, Gardner, Sheraton Valerie T. Tanke was a yearbook and newspaper adviser for 13 years before starting her 20-plus-year career as a sales representative for Walsworth Yearbooks. She has taught in city and suburban schools in Indiana and is a former Adviser of the Year and past president for the Indiana High School Press Association. Tanke is a frequent instructor at local, state and national workshops and conventions. Noon Friday, Back Bay C, Sheraton Mike Taylor is a journalism specialist/key accounts with Walsworth Publishing Co. He taught yearbook, newspaper and television production at Lecanto (Fla.) H.S. for 13 years. He has served as president of the Florida Scholastic Press Association and has received the FSPA Gold Medallion and JEA Medal of Merit. 10 a.m. Friday, Constitution B; 10 and 11 a.m. Saturday, Commonwealth, Sheraton Casey Tedrow is in her 14th year advising publications at Center Grove H.S. in Greenwood, Ind. For the past two years, she has co-advised in a converged newsroom sponsoring a news magazine, yearbook, website and broadcast. 1 p.m. Saturday, Gardner, Sheraton BOBBI TEMPLET, CJE, is broadcast journalism adviser at Oldham County H.S. outside Louisville, Ky. She started the program eight years ago. She earned her journalism and English degrees at Ball State University. She is a JEA state director. 8 a.m. Saturday, Gardner, Sheraton Barbara Tholen advises The Budget newspaper and Red & Black yearbook at Lawrence (Kan.) H.S. In a not-so-distant previous life she was a newspaper reporter. Noon Friday, Liberty C, Sheraton; 2:30 p.m. Saturday, Republic B, Sheraton Eric Thomas, MJE, advises newspaper (The Dart), online (DartNewsOnline) and yearbook (Teresian) at St. Teresa’s Academy, a private allgirls Catholic high school in Kansas City. He has

Visit jea.org/eval to evaluate sessions


been named a Special Recognition yearbook adviser, Missouri Journalism teacher of the year and is president of the Kansas City area scholastic journalism group, JEMKC. 9 a.m. Saturday, Room 309, Hynes CC; noon Saturday, Liberty C, Sheraton Cindy Todd advises the El Paisano yearbook and teaches photojournalism at Westlake H.S. in Austin, Texas. Her students’ publications have earned top awards from TAJE, ILPC, CSPA and NSPA. Todd was named 2012 Yearbook Adviser of the Year and a Distinguished Yearbook Adviser by JEA, and she is a recipient of the Edith Fox King and Max R. Haddick Teacher of the Year awards. 9 a.m. Friday, Room 309, Hynes CC Sarah Tricano advises Holy Trinity Episcopal Academy’s Tigrium, a Silver Crown and Pacemaker finalist, K-12 yearbook. She also teaches photography. Before becoming an adviser and teacher, Tricano worked as a design professional at multiple high-end interior design firms in New York. She earned her bachelor’s degree from Stony Brook University and master’s degree in industrial design from Rochester Institute of Technology. 8 a.m. Saturday, Back Bay B, Sheraton Pam True Szaro holds a Master of Education and is the yearbook specialist for Herff Jones in Palm Beach County, Fla. She has 18 years of experience advising yearbooks and using her knowledge to help other advisers. She has a great history with schools that have grown their yearbook programs to be profitable and more journalistically award winning. 9 a.m. Friday, Beacon B, Sheraton

Susan Turner Jones advises The Rambler literary magazine staff at Sierra Canyon School. Turner Jones has been advising magazine and newspaper publications for more than 20 years, since before Macintosh computers. She has built six publications from being rarely read to becoming widely read. 1 p.m. Saturday, Back Bay D, Sheraton Jeanne Unger is an experienced financial coach to teachers and administrators educating them how to have profitable yearbook programs. She offers clear and easy steps for managing the sale of books and ads and monitoring expenses as they occur. With experience helping schools turn a deficit-ridden program into a profitable one, she offers sound business advice that is easy to follow. 2:30 p.m. Friday, Room 311, Hynes CC Amber Van Der Veen is the activities director for Santa Teresa H.S. in San Jose, Calif. She believes in giving all students a voice and empowering them to facilitate schoolwide change. 11 a.m. Friday, Jefferson, Sheraton Lisa Van Etta taught journalism for 27 years, the last 17 at Cypress Falls H.S. in Houston before retiring from public education in June. She advised two print and two online publications plus broadcast journalism at CFHS. Five of the last eight Texas High School Journalists of the Year were her students. Two won the national JOY title. Van Etta now teaches journalism at Duchesne Academy of the Sacred Heart in Houston. 10 a.m. Saturday, Jefferson, Sheraton

bios Danny Ventura has made The Boston Herald one of the prime sources for high school sports for the past 20 years. His High School Insider blog was the first of its kind in Massachusetts and remains the go-to high school website in the region. 9 a.m. Friday, Room 209, Hynes CC John Vitti has worked in Boston newspapers — first the Herald, then the Globe — for 25 years as a reporter, copy editor and page designer. Since 1998, he has shepherded online school journalism programs in Watertown (Mass.) public schools, teaching classes, shaping curriculum and working with students from pre-K through 12th grade. 2:30 p.m. Friday, Dalton, Sheraton Dan Waechter is the assistant chairperson and academic adviser in the Department of Journalism at Ball State University. Having mentored and advised thousands of college students over the years, Waechter is an avid supporter of secondary media publications and programs because of the training they provide the next generation of news journalists. 11 a.m. Friday, Dalton, Sheraton John Waite teaches radio, television and English classes in Community High School District 99 in Downers Grove, Ill. He is a trainer in assessment literacy and acts as an assessment literacy coach. 11 a.m. Saturday, Gardner, Sheraton

NEW FOR SUMMER 2014 iPad reporting on:

SPORTS POLITICS CULTURE TECH ARTS and MORE SAN FRANCISCO REPORTING TRIP!

DIGITAL JOURNALISM CAMP

Find us on Facebook, Twitter: @newsroomBTB or on the Web at NEWSROOMBYTHEBAY.COM

SUMMER 2014 @ STANFORD UNIVERSITY Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 95


bios Cathy Wall, MJE, advises The Purple Clarion, the newspaper at Harrisburg (Ill.) H.S. Wall has a master’s degree from the University of Missouri with an emphasis in scholastic journalism. She is a member of JEA’s Certification Commission. 2:30 p.m. Friday, Kent, Sheraton; 11 a.m. Saturday, Liberty B, Sheraton Jason Wallestad is the adviser of the Knight Errant at Benilde-St. Margaret’s School in St. Louis Park, Minn. He has been a student media adviser for 17 years and is the 2013 Minnesota Journalism Educator of the Year. He also is the co-founder of School Newspapers Online. 11 a.m. Friday, Exeter, Sheraton; 2:30 p.m. Saturday, Commonwealth, Sheraton Lizabeth A. Walsh, MJE advises the Re-Wa-Ne yearbook staff at Reno (Nev.) H.S. She has advised publications for more than 20 years and is a judge and evaluator for CSPA, NSPA and several other organizations. She serves on JEA’s Development/ Curriculum and Certification commissions. She was named a JEA Distinguished Adviser in 2011 and received a CSPA Gold Key in 2012. 10 and 11 a.m. Friday, Liberty B, Sheraton Melissa Warner is in her 11th year advising publications at Center Grove H.S. in Greenwood, Ind. For the past two years, she has co-advised in a converged newsroom sponsoring a news magazine, yearbook, website and broadcast. 1 p.m. Saturday, Gardner, Sheraton Chris Waugaman, MJE, teaches journalism at Prince George (Va.) H.S., where he advises the newspaper, broadcast, online and magazine staffs. His staffs have won NSPA Pacemakers and CSPA Gold Crowns. He is the director of VAJTA and serves on the SIPA board. In 2011, he was named a DJNF Distinguished Adviser, and in 2012, a Lowell Milken Center Fellow. 8:30 a.m. Thursday, Back Bay D, Sheraton; 10 a.m. Friday, Constitution A, Sheraton; 11 a.m. Friday Constitution B, Sheraton

at Northwestern and writing for Boston, Fast Company, Marie Claire and Glamour — but landed online after media woes shuttered the WSJ’s SmartMoney. For the old-fashioned WSJ, she has covered music festivals, treadmill desks and celebrity parties, interviewing Jeremy Lin, Justin Bieber, Kevin Spacey and Swedish House Mafia. Noon Saturday, Independence East, Sheraton Jami Williams advises the The Bulldogs’ Growl newspaper and The Mascot yearbook at Mexico (Mo.) H.S. This is her fourth year teaching and advising. She is a two-time Gallery of Excellence award winner from Walsworth Publishing. She also works for Walsworth as a workshop presenter. 1 p.m. Saturday, Back Bay A, Sheraton Bradley Wilson, MJE, Ph.D., is an assistant professor and director of student media at Midwestern State University. Publications he has advised have received dozens of national, regional and state awards, including the Gold Crown and Pacemaker. He has been the editor of the JEA magazine, Communication: Journalism Education Today, for more than 15 years and has received both the Carl Towley and Pioneer awards. 8 a.m. Friday, Beacon E, Sheraton; 4 p.m. Friday, Auditorium; 8 and 11 a.m. Saturday, Room 309, Hynes CC Brian Wilson, MJE, advises the yearbook, print newspaper, and online newspaper at Kettering H.S. in Waterford, Mich. All three publications have won numerous state and national awards. He won the Golden Pen as Michigan’s top adviser in 2009 and was named a JEA Distinguished Yearbook Adviser in 2012. He is on the faculty at the MIPA summer workshop and Washington Journalism and Media Conference. 10 a.m. Saturday, Conference Room, Sheraton; 11 a.m. Saturday, Independence East, Sheraton Nicole Wilson, MJE, advises the Pinnacle yearbook at Carmel (Ind.) H.S. She is Indiana High School Press Association president and a 2010 Rising Star recipient. Wilson previously advised the student newspaper at New Albany (Ind.) H.S. 9 and 10 a.m. Friday, Exeter, Sheraton

Scott Winter has been a journalist and high school adviser to unmentionable acclaim. He’s the least distinguished professor at the College of Journalism and Mass Communications at the University of Nebraska-Lincoln. Yeah, he teaches Huskers. 10 a.m. and 2:30 p.m. Friday, Room 312, Hynes CC Kelly Wisneski, a senior at Thousand Oaks (Calif.) H.S., is editor-in-chief of the nationally ranked The Lancer newspaper. Additionally, she founded and is advising The Big Tree newspaper at Redwood Middle School. 2:30 p.m. Saturday, Liberty C, Sheraton Ariel Wittenberg is an environmental and transportation reporter at the New Bedford Standard-Times in southeastern Massachusetts. She spends her days learning the finer points of wind turbines, trains and toxic waste. She has previously worked at Pro Publica, an investigative journalism nonprofit organization. In her formative years, Ariel was editor of Newton South H.S.’s Lion’s Roar and has many fond memories of JEA/NSPA conventions. Noon Saturday, Independence East, Sheraton Julian E. Wright is a student at Columbia University, where he contributes to cross-platform school publications. He has interned for various national publications and is an oncoming reporter for Beast TV of Newsweek/The Daily Beast. He attended duPont Manual H.S. in Louisville, Ky. 1 p.m. Saturday, Republic B, Sheraton Stan Zoller, MJE, is an adjunct professor of journalism at Lake Forest (Ill.) College. He is in his 15th year of journalism education and is a member of JEA’s Multicultural Commission and Scholastic Press Rights Commission. He was DJNF special recognition adviser in 2010 and distinguished adviser in 2011. He is vice president/ Freedom of Information of the Chicago Headline Club, Chicago’s SPJ Chapter. 8:30 a.m. Thursday, Beacon A, Sheraton; noon Friday, Kent, Sheraton; 2:30 p.m. Friday, Room 308, Hynes CC; 10 a.m. Saturday, Beacon E, Sheraton

Karen Weintraub is an independent health and science journalist, journalism educator and book author. She writes for The Boston Globe, USA Today and BBC.com among others, teaches at Boston University and the Harvard Extension School, and has co-written two books on autism and ADHD. She edited her high school yearbook and worked at a magazine, two TV stations and two newspapers in college. 10 a.m. Saturday, Room 313, Hynes CC Anita Marie Wertz, MJE, advises the newspaper, yearbook and journalism programs at Cesar Chavez H.S. in Stockton, Calif. She is the JEA Junior High/Middle School Commission chair. She oversees the JEA Aspiring Young Journalist Award, which honors top middle school journalists. 6:30 p.m. Thursday, Berkeley, Sheraton; 8 a.m. Saturday, Conference Room, Sheraton; 9 a.m. Saturday, Exeter, Sheraton Jen Wieczner covers health care for MarketWatch and The Wall Street Journal. She started in magazines — majoring in them

The USS Constitution: The oldest commissioned warship afloat in the world, the USS Constitution was first launched in 1797. During the war of 1812, the ship earned its nickname, “Old Ironsides,” when cannonballs fired from British frigates bounced off its thick hull. (Greater Boston Convention & Visitors Bureau.)

96 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


UMass Journalism is a student-centered department that will move into a new state-of-the-art building in Fall 2014. We want you to join us. • The Journalism Department offers a forward-looking curriculum that includes classes in writing, video journalism, entrepreneurship, photojournalism, web design, international journalism, sports journalism, investigative journalism, ethics, law and much more. • Our alums include Audie Cornish, class of ‘01, who works as the co-host of NPR’s “All Things Considered.” Our students have recently interned at The Boston Globe, NBC, MTV and “Good Morning America.” • Starting in 2014, we’ll offer a broadcast journalism course sequence in a brand new digital studio. • Interested in more information? Visit umass.edu/journalism for more details and follow us on Facebook, Tumblr and Pinterest. Twitter: @nhsjc/#nhsjc

JEA/NSPA Fall 2013 Convention/Boston — 97


Hynes Convention Center 2nd Level

W

South Lobby M W

M

M

W

Show Office Exhibit Hall C

Exhibit Hall C

Exhibit Hall D

Veterans Memorial Auditorium

Pre-function Auditorium

Pre-function Hall C

M

207

208

209

210

200 201

202

203

204

205

W

206

M

W

Boylston Hallway

3rd Level W

South Lobby M

Ballroom Pre-function

Ballroom C

Veterans Memorial Auditorium (Below)

Ballroom A

Balcony

M

Exhibit Hall D

Ballroom B

310

W

311

M

Down

Ballroom Foyer

W

302

301

304

303

306

305

309

307

308

312

W

M

313

Boylston Hallway

98 — JEA/NSPA Fall 2013 Convention/Boston

Visit jea.org/eval to evaluate sessions


Sheraton Boston Hotel ENTRY

REPUBLIC FOYER

D

REPUBLIC BALLROOM B

A

REPUBLIC CORRID.

C BACK BAY BALLROOM

EAST EAST IND. FOYER INDP. WEST BLLRM

GRAND BALLROOM

WEST B

LIBERTY BALLROOM A B C GRAND BALLROOM PREFUNCTION

A

CONSTITUTION BALLROOM A B

Intersection of Dalton & Belvidere

SECOND FLOOR

C

COMMONWEALTH

BOARDROOM

H

B

G

A

F

BEACON COMPLEX A-H

E

KENT

D

JEFFERSON HAMPTON GARDNER

FAIRFAX

CONF.

EXETER CLARENDON DALTON BERKELEY Intersection of Dalton & Belvidere

Twitter: @nhsjc/#nhsjc

THIRD FLOOR

JEA/NSPA Fall 2013 Convention/Boston — 99


Your yearbook. Your new favorite app.

2013 Legacy High School

Bring everything you love about your book to life in an interactive edition. See eYearbooks in action at the Balfour booth.

100 — JEA/NSPA Fall 2013 Visit program. jea.org/eval to evaluate sessions BalfourConvention/Boston is proud to support journalism in schools by sponsoring the printing of the JEA/NSPA convention

Jea2013boston program  

2013 JEA/NSPA National High School Journalism Convention Boston, MA

Read more
Read more
Similar to
Popular now
Just for you