Page 1

Free Copy

Autumn 2012 Issue No.37

Smiling through Sightloss Sightline V ision (Northwest) Ltd

School Buzzing!

The Quality Lifestyle Magazine supporting your local Community


Old Christ Church Waterloo Road Waterloo L22 1RE

200+

Sponsored by

REAL ALES and CIDERS

Lagers & Continental Beers Food by Peninsula Pies & Liverpool Cheese Co. Entertainment at every session. Saturday afternoon the fantastic South London Jazz Orchestra. Music all day Sunday. Thurs Evening Fri Afternoon Fri Evening Sat Afternoon Sat Evening Sunday

22nd 6:00pm - 10:30pm 23rd 12:00pm - 4:30pm 23rd 6:00pm - 10:30pm 24th 12:00pm - 4:30pm 24th 6:00pm - 10:30pm 25th 12:00pm - 8:00pm

Tickets available online. For further details of the festival visit www.waterloobeerfestival.com


+20(2:1(56 $*(' 

<RX FDQ OHJDOO\ SURWHFW \RXU KRPH IURP IXWXUH &DUH +RPH )HHV


Inspirational Ladies, the launch of a new Art Club & the meaning of Luxury!

Dear Reader, l. Well hasn’t it Welcome to the Autumn Edition of Your Local Journa I seem to than earlier on ng creepi been has g heatin gone chilly! My about it Daisy from aints compl no get remember it being last year. I Hopefully we can walk. rainy er anoth yet from return we when h thoug crisp sunny days.... look forward to some drier weather now and some a Waterloo based The Front Cover feature in this edition is all about te a free Charity, Sightline Vision (Northwest) Ltd who opera onset and the at people rt suppo to e servic e helplin confidential y impaired visuall of team e helplin progression of loss of sight. The from their homes. e helplin g evenin free the staff to help eers, volunt on page 6. You can read all about these inspirational people Creative Balance, Club, Art local new brand Featured on page 32 is a and Kathryn recently established by local artists Sarah McLaughlin eutic and fun therap , tional educa offer to up d teame have Wilson who s. One of isation organ and ls schoo art workshops to the community, r with was work on familia very be may you which ts projec recent their loo, so they are a the giant mural overlooking the Marina Lake in Water unity. comm very exciting new addition to the local is looking a bit tired Now to the meaning of luxury. If your bathroom no avail, you really to it ing scrubb of up fed are you and and grubby s & fittings! Total fixture new for out don’t need to replace it or pay to its former glory. om bathro your e restor can ation Restor om Bathro 27. & 26 pages on them You can read all about some time out Unfortunately Lois on the Allotment has had to take writer for the recently following an operation so we have a guest of his Desert Island gardening feature in this edition (page 18) who tells forward to look I and ry recove Disc Plants! Lois is making a good n. editio next the for back her ming welco like to share with the If you have any interesting news or stories you’d don’t forget to let me and touch in get to te Journal please don’t hesita few months. You know about any events you may have over the next caljournal.com. yourlo sally@ e-mail or 8 15675 07531 on can call me And finally, as always please don’t forget to mention the Journal when responding to adverts; as without our advertisers there wouldn’t be a Journal!

Sally x


Free Copy

Autumn 2012 Issue No.37

AUTUMN 2012 Published & Edited by: Sally Mills

Graphic Design & Layout: www.yourlocaljournal.com Advertising & Editorial: Tel: 07531 156758 Distribution:

Contents 6-7 Smiling through Sightloss

Winter Edition - 22nd November

20 Scottish themed Beer Festival

Whilst every care has been taken to ensure that the data in this publication is accurate, neither the publisher nor its editorial contributions can accept and hereby disclaim any liability to any party to loss or damage caused by errors or omissions resulting from negligence, accident or any other cause.

Your Local Journal does not officially endorse any advertising material included within this publication.

All rights reserved. No part of this publication may be reproduced, stored in any retrieval system or transmitted in any form electronic, mechanical, photocopying, recording or otherwise without prior permission of the publisher.

Your Local Journal

JDI Business Centre (Box N) 3-11 Mersey View Waterloo Liverpool L22 6QA E-mail: sally@yourlocaljournal.com

School Buzzing!

The Quality Lifestyle Magazine supporting your local Community

Features

Your Local Journal is delivered to 10,000 homes and businesses in Blundellsands, Crosby & Waterloo

Booking Deadline:

Smiling through Sightloss

Sightline V ision (Northwest) Ltd

Sightline Vision (Northwest) Ltd

10 The Seaglam Project

Gladstone Memorial to be Unveiled

P.20-21 Rotary Beer Fest

Crosby Rotaryâ&#x20AC;&#x2122;s 5th Annual Festival

28 Pupils Buzzing!

Research to save the Honey Bee

30 Happy, Safe & Stimulating

Early Days Childrens Day Nursery

32 Launch of New Art Club

P.28 Pupils Buzzing!

Creative Balance

Regulars

P.32 Creative Balance

8 Down Memory Lane Coronation Road, Crosby

12 Health & Well-Being

Movember! Mens Health Campaign

13 B-Fit Personal Training

Count Nutrients...Not Calories

P.8 Coronation Road

14 Style

The Hat is Hot!

16 Travel

The Fairytale of New York

18 Gardening

My Desert Island Disc Plants

19 Recipe

Pan Roast Trout

P.16 Fairytale of New York

22 House & Home

Is the Housing Market set to take off?

33 Film Review

The Sweeney (15)

34 Whatâ&#x20AC;&#x2122;s On Guide 36 Useful Telephone Numbers

P.33 The Sweeney


CAN YOU HELP THIS VITAL LOCAL CHARITY? Sightline Vision (Northwest) Ltd

Local lady Eileen Green was diagnosed 12 years ago with macular degeneration, an eye condition that can result in total sight loss. Eileen refused to sit down and feel sorry for herself. Instead, she not only faced up bravely to the new daily challenges but, feeling lonely and afraid herself, she also thought about how many other people in the same situation must be experiencing similar emotions. She decided to set up a free helpline, and to establish the charity Sightline Vision (Northwest) Ltd. Sightline now helps people all over Merseyside, North Wales and Cheshire by offering a confidential phone-line, funded by the charity. Eileen has worked tirelessly to recruit a team of visually impaired volunteers, who are given training in listening skills. They help to staff the free evening helpline from their homes. Evenings are a time when people may be feeling at their most lonely or disheartened. Because they have varying degrees of sight loss themselves, the volunteers are able to empathise with the callers’ feelings and worries. Sudden, progressive or long term loss of sight can be very traumatic to the person as well as to family and friends. Visual impairment may combine with other disabilities / mobility problems or bereavement and loss of independence. Sightline’s main beneficiary group are

6

individuals (and their families) that have experienced a sudden or progressive sight loss and are experiencing difficulties in their daily living. They can help to alleviate these difficulties by signposting service users to the appropriate services and support groups. Sightline provides essential emotional support and a practical guide to support people at the onset and progression of loss of sight. Volunteers will offer a listening ear and befriending service, dealing with a range of enquiries from people coming to terms with their sight loss/visual impairment. The volunteers are trained in listening skills. Sightline continues to build on its comprehensive directory of services that have been checked for suitability by them to signpost and refer enquiries received based on issues that arise during telephone helpline calls. Sightline aims to be a link to specialist services for those facing the trauma of sight loss. The Service currently operates five evenings per week 6pm to 10pm, every Monday Thursday, Friday, Saturday, and Sunday. Anyone can call them including the carers, family or friends of those affected and every call is treated with confidentiality and respect. Sightline is now implementing its expansion plans after being awarded £190,000 over three years from the Big Lottery Fund’s Reaching Communities programme. This funding will enable the charity to operate its helpline from 6pm to 10pm every evening, rather than from Thursday to Monday evening only as it has done in the past. New volunteers are needed to cover the additional evenings. Sightline would love to hear from visually impaired volunteers living within the Merseyside and Greater Manchester areas, who can spare two evenings a month. Training in listening and telephonic skills and any necessary equipment will be provided. Please contact them for more information on 0151 285 4038 (this is an Admin number only). Company Limited by Guarantee Registered No. 4620457 Registered Charity No 1096452

www.sightlinevnw.co.uk

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


Sightline Vision (North West) Ltd

Sightline Vision is a charity which provides emotional Suranna with her parents Mark and Kerry support and practical advice for those dealing with sight loss, their families and friends. • FREE CALLS

5 nights a week 6 - 10pm Thurs-Mon.

• UNIQUE

evening telephone support

• ONLY ONE OF ITS KIND in the region

• VITAL

to those who are experiencing sight loss and their family

• STAFFED BY DEDICATED TEAM of visually impaired volunteers

• SPECIALLY TRAINED

to listen and to offer their support from personal experience

• CONFIDENTIALITY RESPECTED at all times

If you would like to speak to someone, our friendly volunteers will be waiting for your call.

CAN YOU HELP ?

We are looking for visually impaired volunteers living within the Merseyside and Greater Manchester areas, who can spare two evenings a month. Contact us for more information on 0151 285 4038 (this is an Admin number only).

Training in listening and telephonic skills and any other necessary equipment will be provided.

Sightline Vision (North West) Ltd. 1st Floor 3tc House, 16 Crosby Road North, Waterloo,Liverpool L22 ONY Direct Line : 0151 285 4038 (Admin only)

Helpline: 0800 587 2252

Please mention Your Local Journal when responding to adverts

7


Journal Down Memory Lane

CORONATION RD

Crosby Coronation Road was once known As Thorp or Thorp’s Lane since the early 1800’s. Who Mr Thorp was it isn’t known, although Thorpe’s dwelling and small holding was on the site of Halsall School in Cooks Road. It was a grassy track leading from part of Crosby Village out towards the sea. On several maps of the 1840’s it was called Harp’s Lane, but this likely as not was a printing error, the 1841 census refers to it as Thorp Lane. In the mid 1880’s there was very little in the way of buildings on this stretch of road, just a few humble cottages near the Islington junction. The road initially stopped near Regent Road, but by 1890 it wound its way along what is now Carnegie Avenue and across to Mersey Road. There are several roads leading off what is now Coronation Road. Shaftesbury Road for instance this side road was built about 1890 followed by Florence Terrace in 1899, which is a block of small terraced houses which stands opposite Shaftesbury Road. A little further towards Crosby passing Coronation Park is Harrington Road, this road dates to 1900. In the same year the road was improved considerably and extended along the side of the council headquarters in the Assembly Rooms in order to improve the area’s civic pretensions, and to line up with Mersey Road as a direct line to the railway.

In 1902, the year of the coronation of Edward VII and Queen Alexandra, by way of celebration Thorp Lane was renamed Coronation Road and the Assembly Rooms were thus called Alexandra Hall. The area around the hall had been given by way of a gift to the Crosby people. Mr George Rodway, a prominent Blundellsands solicitor petitioned the local residents into utilising this land. The services of Mr Exton, who owned the garden centre called Victoria Nursery in Thorp Lane, were used to plan and lay out what is now Alexandra Park. The park was opened in 1902. Carnegie Avenue as it is now known was still called Thorp’s Lane at this time until it was changed in honour of the man who endowed the town’s public library in 1910. The Victoria Nursery is still in Carnegie Avenue, but nowadays is called Carnegie Café and Garden Centre. Further along on the corner of Regent Road is Florence Terrace built in 1899 a block of small terraced houses and further along another terrace of larger houses that overlook Coronation Park. A Drill Hall was built in 1911 for the 7th Battalion King's Liverpool Regiment and the Prince Of Wales’ Volunteers South Lancashire Regiment, 10th Reserve Battalion. These were formed in Crosby in October 1914. This is now Crosby Youth Centre. The Blundell family made a gift of land to the Crosby community which was situated on the

Bundellsands Evening Townswomen’s Guild The Guild meets at 8pm in Blundellsands Methodist Church Hall, Brompton Ave., Crosby on the 1st Tuesday and 3rd Wednesday of each month.

8

You are very welcome to join us for a cup of tea, a pleasant evening and to meet new friends. To find out more please call 0151 474 9285.

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


ARE YOU INTERESTED IN ART HISTORY, ART LECTURES, FINE ARTS, learning new skills, joining an arts society and meeting like minded people of all ages?

south side of Thorps Lane. The land was turned into park land with bowling greens and flower beds. It was given the name The Recreational Ground, but in 1906 it was changed and renamed Coronation Park. There have been many retailers in Coronation Road over the years, but there are 4 in particular that come to mind. Satterthwaites who arrived in the 1930's and who still have their craft bakery there today and Duckell's established in 1910 and closed in 1988 and of course Newsmag who reigned for many years, but since closed and last but not least Stanley Byron & Sons Ltd painting and decorating supplies who still trade today. Crosby Secondary Modern and Primary School was also part of Coronation Road along with Banner’s Stone Masons, they were demolished to make way for Sandalwood Retirement Home, which consists of 53 flats and was completed in 1989. Crosby Past and Present will be 2 years old in November and will be having a birthday luncheon at The Pioneer, Liverpool Road on Saturday 24th November starts at 12pm. All welcome. Please RSVP Contact Group leader. More details via the Facebook group or phone 07890 181233. Barbara Thomas - Crosby Past and Present www.facebook.com/groups/crosbyheritage

ST JOHN’S LOCAL HISTORY GROUP

The Group meets at 2pm on the 1st Tuesday of every month in St.John's Parish Centre. The Parish Centre is co-located with St. John's Primary School at the end of Denmark Street (off St. John's Road) Waterloo.

6TH NOVEMBER "Story of the Chinese Community" by Tony Kwok 4TH DECEMBER "Tudor Liverpool" by Jenet Hollinshead For more information please call Paul Baker, Secretary Tel: 07759 427644

Through a vibrant network of local societies, NADFAS National Association of Decorative and Fine Arts Societies opens up the world of arts to everyone. With monthly lectures on a broad range of topics as well as study days, educational visits and holidays at home and abroad, a NADFAS society is not just a great way to learn - it's a fun way of making new and lasting friendships.

CROSBY DECORATIVE & FINE ARTS SOCIETY JOIN US LOCALLY

We meet at 2pm on the 2nd Wednesday of every month at Crosby Civic Hall. There are also day visits to places of Interest. Lectures planned for the following months:

WEDNESDAY 14TH NOVEMBER 2012

Oliver Everett - King George III - The most cultured monarch, art collector and friend of America.

All Lectures commence at 2.pm in Crosby Civic Hall and we would warmly welcome new members.

Please contact the Membership Secretary on 0151 924 4254.

www.nadfas.org.uk

CROSBY AND DISTRICT HISTORICAL SOCIETY We meet in the Methodist Church Hall, Moor Lane at 7.30 p.m. generally on the fourth Monday of the month. Cost £2 per meeting or £13 for the year. 22ND OCTOBER 'Ships that will never return to Liverpool Bay'

26TH NOVEMBER 'Films of Liverpool in the last Century

3RD DECEMBER 'Crosby to The Dingle via the Overhead Railway'.

For more information please call: 924 7889 Our full programme, summaries of the content of some previous meetings, and the history of the Society may be found on our website:

www.crosbyhistorical.org.uk

Please mention Your Local Journal when responding to adverts

9


GOOD NEWS FROM SEAFORTH

The Seaglam Project (Seaforth Gladstone Memorial Group) was started by local Historian Brenda Murray to raise the profile of Seaforth Village by installing a memorial to William Ewart Gladstone, four times Prime Minister of Great Britain, who had lived there for 17 years from 1813 to 1830. Funds for the memorial were raised by voluntary effort and additional funding has been provided by the Heritage Lottery Fund. The project is drawing to a close in December when the Memorial will be erected and unveiled by Rt.Hon. Frank Field M.P. and pupils of two primary schools in Seaforth, Our Lady, Star of the Sea and Rimrose Hope Primary will perform a musical concert in Linacre Mission on Tuesday 20th November 2012 at 2pm. The title will be "SEAFORTH THE PAGEANT", telling the story of people who lived there in the past. The event will start with a ten minute talk by Brenda Murray about the history of Seaforth. Then the play will be acted with music and the event will conclude with a dance performance. Refreshments will be served and everyone from far and wide will be welcome as the hall holds 700 people! Brenda Murray, chairman of SEAGLAM was raised in Seaforth and said the statue will have the same effect as the Gormley statues do at Crosby beach. “Many people will be attracted to Crescent Road, in Seaforth, in the same way as the tourists flock to the Gormley statues on Crosby beach. I’m very excited about that. Seaforth is steeped in prestige and history because Gladstone was raised there, and he is the only man to have ever become Prime Minister of Britain on four separate occasions. He is one of the most famous British politicians of all time, and he lived in Seaforth for 17 years between 1813 to 1830”. For more information please contact Brenda Murray on 0151 924 2541.

www.gladstonememorial.blogspot.co.uk

10

TOENAIL CUTTING SERVICE Home Visits Just £10 Daytime Evening Weekends

Call us today on our local rate number:

0845 017 9959 * Our service is unsuitable for people with certain health conditions

PIANO SHOP

www.nailcarers.co.uk

Pianos & Musical Instruments Sales / Repair / Hire

WANTED Musical Instruments, Equipment and Speakers etc.

Desmond Fleet

Shop: 0151 920 2527 Mobile: 07896 080729

Email: thepianoshop@hotmail.co.uk

61 St.John’s Road,Waterloo L22 9QB

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


lcc

liverpool chiropractic care


Journal Health & Well-Being

ANNE RYAN COMPLIMENTARY THERAPIST Doula & Anti-Natal Educator

& Head Massage • Face Hot Stone Massage MOVEMBER! •• Hopi Ear Candles Help to raise awareness • Reflexology to treat health problems

Every treatment is tailored especially for you...

for men’s health

Men are generally more indifferent towards their health than women; they are more reluctant to openly discuss their personal health issues and less likely to see their GP. Movember's campaign objective is to raise awareness of men's health issues, specifically cancers affecting men. Prostate and testicular cancers are highly curable if caught in the early stages. Movember aims to increase early detection, diagnosis and effective treatment, as this will ultimately reduce the number of deaths from cancer.

The Movember campaign puts a fun twist on the serious issue of men’s health by encouraging men to grow a moustache during November. “Mo Bros” register at movember.com and then must begin on the 1st of Movember with a clean shaven face. There is to be no joining of the mo to the sideburns (that’s considered a beard), there’s to be no joining of the handlebars to the chin (that’s considered a

CHIROPODIST M r s L o r et o Si m e

BSc Podiatric Medicine, M.Inst.Ch.P., Reg.CH20173 Reflexologist, A.I.Y.S. (Dip. Reflex.)

BMI Sefton Hospital 1 Kenilworth Road, Crosby, Liverpool L23 3AD Hospital Receptionist:-

Tel: 0151 257 6700

R EDUCED RATES F OR O.A.P.’S

12

If you need any advice regarding pregnancy, post-natal and fertility, please call me, Anne for a friendly and confidential chat.

Mobile: 07779 245 226

goatee) and each “Mo Bro” must conduct himself like a true gentleman! The average life expectancy for men is 4 years less than women. More than 1 in 3 people will be diagnosed with cancer in their lifetime and prostate cancer is the most commonly diagnosed cancer in men in the UK; over 40,000 men are diagnosed with it every year and there are 250,000 men currently living with the disease. 1 in 9 men in the UK are likely to face prostate cancer in their lifetime. 2,209 men in the UK were diagnosed with testicular cancer in 2009; 47% of testicular cancer cases occur in men under 35 years and over 90% occur in men under 55 years. 42% of men were classified as overweight in 2010 (in England); obese men are 5 times more likely to develop type 2 diabetes and 3 times more likely to develop cancer of the colon. Is it time you took your health seriously? Phoebe Hodge For more information or to donate to the cause, or to an individual or group of Mo Bros, visit

www.movember.com

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


COUNT NUTRIENTS NOT CALORIES by Gaynor Stobie at B-fit Personal Training

The primary goal of most of my clients is to lose weight and tone up. The first thing I focus on with my clients is their nutrition and lifestyle as that accounts for up to 80% of healthy sustainable fat loss. One of the key truths about fat loss is to COUNT NUTRIENTS NOT CALORIES! Many foods advertised as “Low Calorie”, “Low fat” or “Diet” can actually lead to long term fat storage due to the fact that the fat has been processed (hydrogenated) or removed from the products to lower calorific value or fat % and more damaging, artificial additives are put in to enhance the flavour and pro-long shelf life. Everything that we put into our body carries a message for our DNA, some messages provide good signals to our cells to produce a healthy environment and some messages provide bad, signals causing our cells to malfunction or create unhealthy conditions. The messages we give our bodies through our food can have a greater impact on fat loss than the caloric value of the food alone. For example, dietary fats are not all created equally. Despite all fats being high in calories, some actually promote fat loss while others promote fat storage. Essential fatty acids such as Omega-3 have a multitude of heath benefits such as reducing inflammation, blood pressure, bad cholesterol (LDL) and improving brain health. In addition Omega-3s from good quality fish oil, eggs and flaxseeds promote fat loss, by turning on fat burning enzymes and turning off fat storage enzymes. However, hydrogenated or trans fats are toxic to the body, and carry a number of negative messages including those that lead to inflammation, high cholesterol and abdominal weight gain. Low calorie margarines and spreads, processed “diet”/ low cal meals are still being endorsed by the media and national heart foundations across the western world and yet, the reality is that the hydrogenated fats used in these products to either replace natural saturated fats or to preserve the products shelf life, are incredibly dangerous fats and lead to increased fat stores around the abdomen and associated health conditions such as diabetes and heart disease. A study published in 2006 looked at two diets fed to male monkeys over 6 years. Each diet had

in Crosby, Formby & surrounding Highly effective bespoke fitness areas training programmes

Weightloss & nutritional advice Designed to help you achieve your goals quickly & safely, no matter what your current level of fitness For a free consultation call Gaynor on: Highly effective bespoke fitness training programmes

Tel: 07748 298 728 or visit www.b-fit.uk.com Weightloss & nutritional advice

Designed help you achieveVALUE but the types of exactly thetoSAME CALORIC yourmaking goals quickly & calories were very different. fats up those Group calories safely, 1noate matter whatfrom your Monounsaturated fats (found olive oil, seeds and nuts), where as Group currentin level of fitness 2 were fed their calories from trans fats (found in For a free consultation hydrogenated vegetable oils, margarines, crackers, call Gaynor cookies and on: snack foods). Unlike other fats, most trans fats are formed when food manufacturers turn liquid oils into solid fats such as margarine by adding hydrogen. The study concluded that over a period of 6 years, the consumption of trans fats caused a 30% increase in abdominal fat storage as compared to the same amount of CALORIES that came from monounsaturated fats. In summary the key is to focus on the nutritional density and the messages that your foods will give to your body. Good messages will lead to fat loss and long term health. Its quite simple– bombard your body with nutrients and the right fats, keep it natural and organic where possible and include lean proteins (mostly plant protein), 8 fruit and veg per day, nuts, seeds, eggs, and essential oils (eg hemp/olive oil and a good quality omega 3 supplement) to keep your system lean and balanced.

Tel: 07748 298 728 or visit www.b-fit.uk.com

FOR 15% OFF THE OMEGA 3 SUPPLEMENTS

that I use and recommend please go to my website www. b-fit.uk.com click on the Natures Sunshine logo/link and key in the discount code BF1 at the check-out.

For more information on weight loss, fitness and nutrition contact Gaynor Stobie at B-Fit Personal Training on 07748 298 728 or visit www.b-fit.uk.com Image by Jacqueline Kirkham

Please mention Your Local Journal when responding to adverts

13


Journal Style

rds a c g n i t e e r g

fantastic

THE HAT IS HOT!

Gift Wrap â&#x20AC;˘

Susie Boden

Want to stand out from the crowd? The hat is not just for practicality this autumn! Itâ&#x20AC;&#x2122;s a hot fashion accessory which will do more than protect your head from the elements. The right hat is the icing on the cake for your look this season. What type of hat will you be wearing? Add a touch of luxury to your outfit with a (preferably fake) fur hat â&#x20AC;&#x201C; thereâ&#x20AC;&#x2122;s a fabulous range of styles in the shops this year! Go for a huge mounted hat to really make a statement or choose a more elegant Russian style. The brighter and more outrageous the better! Perfect teamed with jeans, velvet or leather. Or how about a fedora? They go with any outfit and suit everyone. For a gorgeous, sophisticated, ultra-feminine look, a twenties inspired cloche hat really hits the spot! Perfect with a smart party dress and a pair of classic high heeled boots. Youâ&#x20AC;&#x2122;ll be the belle of the ball! Some of the autumn/winter fashions will be less easy to wear! Cowboy hat anyone? Team it with a cropped jacket, leather gloves and ankle boots and you could be onto a winner - though definitely not a look for the office. Top hats are also big news;

0151 931 3008 â&#x20AC;˘ 07717 570 380 susie.boden@ yahoo.co.uk www.phoenixtrading.com

Invitations

Quality stationery items for up to 50% less than high street prices. See Phoenix Trading's full range at: www.phoenixtrading.com or contact me for a brochure.

ADVERTISE HERE FOR ONLY ÂŁ30

Independent Phoenix Trader  

again, I donâ&#x20AC;&#x2122;t think Iâ&#x20AC;&#x2122;ll be wearing one but will you dare? Make it the star of the show by dressing down and you could pull it off! The clever fashionistas may choose a gaucho hat as a sassy, more wearable alternative - feminine, stylish and it works brilliantly with jeans, a strapless cocktail dress or anything in between. How will you wear your hat? Huge or tiny, plain or printed, velvet, fur or feathered, chic or attention grabbing splendour? Be bold and hold your head high this season â&#x20AC;&#x201C; you look hot in that hat! Sarah Hughes

CROSBY CLASSIC BENTLEYS Wedding Elegance

Web: www.LOV76.com E-mail: graham@LOV76.com Phone: 0151 924 2516

14

Smart, fully Uniformed Chauffeurs. Friendly, Personal Service from Viewing to Reception.

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


           

                        

                             Â?8Â&#x152;Â&#x152;a (8ÂąÂ&#x152;aÂ&#x2020;Â&#x2020; ~ Ă&#x2021;aÂą ¡ Ă&#x160;a8¹´ aĂ&#x2030;Â&#x153;aÂąaÂ&#x152;Oa Â&#x152; Ă&#x2C6;at|Âź Â&#x2020;Â?´´ OÂ?Ă Â&#x152;´aÂ&#x2020;Â&#x2020;Â&#x152;t ,aÂ&#x2020;aÂ&#x153;|Â?Â&#x152;a U Ă&#x17D;¡¡Ă&#x17D;r fĂ&#x17D;½ ff¡ Â&#x2030;8Â&#x2020; U Â&#x201E;Â?8Â&#x152;Â&#x152;aÂ&#x153;8ÂąÂ&#x152;aÂ&#x2020;Â&#x2020;O8Â&#x2030;FÂąXtaĂ&#x2C6;Â&#x153;DÂąÂ?OÂ&#x2026;aÂźÂ&#x2030;8Â&#x2020;ÂĄOÂ?Â&#x2030; Ă?Ă&#x2021;8Â&#x2020;8FÂ&#x2020;a mÂ?Âą Â&#x2014; ÂźÂ? Â&#x2014; Â?Âą tÂąÂ?Ă Â&#x153; Â&#x2030;aaÂźÂ&#x152;t´¥ mmOa´ Â&#x152; ÂąÂ?´FĂ&#x160; 8Â&#x152;X Ă&#x2021;aÂąÂ&#x153;Â?Â?Â&#x2020; ÂźĂ&#x160; aÂ&#x152;Ÿ¹aÂĄ Â?Â&#x2030;a Ă&#x2021;´Ÿ´ 8Â&#x2020;´Â? 8Ă&#x2021;8Â&#x2020;8FÂ&#x2020;aÂĄ

8Â&#x2020;Â&#x2020;V ,aĂ&#x2030;Âź Â?Âą aÂ&#x2030;8Â&#x2020;  3 mÂ?Âą 8 OÂ?Â&#x152;´à Â&#x2020;Âź8ÂźÂ?Â&#x152;ÂĄ 5Â?Ă 3 °, ÂąatÂąaÂź Âźk



Please mention Your Local Journal when responding to adverts

15


Journal Travel

The Fairytale of

NEW YORK

I’d like to fly to New York to indulge in a long weekend of pre-Christmas retail therapy every year, but I can’t afford to. Happily, last year was one of those years when I could and it was well worth every penny. I went with a couple of like-minded friends in November; December can be surprisingly cold and everywhere is more crowded and consequently more expensive. The key to a successful shopping trip is to do some research and plan it well in advance; you will save a lot of money and also get a good table in the better restaurants in the evening. We flew Virgin Atlantic from Heathrow, economy class because it’s perfectly civilised for a 7 hour flight and saves a lot of money. To make up for this bit of cost cutting I’d arranged for a limo to pick us up from the airport; at $45, equivalent to £10 per head, it would be rude not to. New York is home to some of the best hotels in the world, and probably some of the worst too, but, by judicious use of Trivago, I’d managed to get us rooms in Hotel Pennsylvania on 7th Avenue for about £110 per night. The Pennsylvania is not über luxurious, but it is classy and comfortable and located right in the heart of the action. New York is five hours behind the UK so it felt like 10.30 at night to us when we checked in, even though it was really early evening. I enjoyed a reviving soaky bath in the huge American size tub before meeting the girls in the bar for cocktails – Manhattans of course! Dinner was in an Italian just round the corner, nice food, laid back and remarkably cheap – just what you need after 11 hours of travelling. We went to bed early to sleep off the jetlag. In the morning I avoided the siren call of the American breakfast (they really do offer you steak and eggs to start the day) and contented myself with coffee and a croissant. Then we got down to some serious shopping. Planning your shopping trip(s) is essential; if you simply started at one end of 5th Avenue and worked your way along going into every shop, you’d be there for weeks. Instead we spent the day on Madison Avenue, which is a real designer paradise. Virtually every upmarket label you can think of has its own store there, from Calvin Klein to Versace and everything in between. Between them they took us up to 1.00pm when we became ladies who lunched. In the afternoon

16

we checked out Barneys, a must visit destination for all fashionistas. Our evening destination was 21 Club, an iconic New York bar and restaurant dating back to the prohibition era. The food is classic American cuisine and they have a fantastic wine list; the cocktails are sensational. We had a great evening, but take note: this is definitely a place that you need to book in advance. Our other dining adventure was to Aquavit which claims to be the number one Scandinavian restaurant in New York, rather too much pickled herring for my tastes but classy all the same. Saturday also saw us making our pilgrimage to Fifth Avenue, starting off with Bergdorfs, a department store that is mainly devoted to fashion. They have an entire floor given over to shoes and handbags; I thought I’d died and gone to heaven. Next up was Saks which is very much along the same lines – you can’t go to NY without going to Saks. We finished off at Century 21 off Broadway, a fabulous shop where you can buy all the designer clothes you looked at on Madison and Fifth Avenues but at half the price. We devoted Sunday to a long lie in, a lengthy lunch and a spot of sightseeing. Then it was back in the limo to JFK and the red eye home again. A weekend in New York is so uplifting they should provide it on the NHS. Frances Claiborne

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


Luxurious Accomodation

PRICES START FROM ONLY £55 PER NIGHT

in Blundellsands

• • • • • • • • •

One / Two Bedroom Apartments High Ceilings / Spacious Living Areas Modern, Fully Equipped Kitchens Luxury En-Suite Bathrooms 3 Piece Leather Suites Flat Screen T.V. DVD / CD Desk and Dining table Perfect for Meetings

www.thecroft.eu 10 Blundellsands Road East, Crosby

Tel: 07764 194491

E-mail: thecroftreservations@stagereel.co.uk. Bookings can also be made online at www.visitLiverpool.com

• Outstanding Traditional Greek Specialities/Mezzes • Lovely Atmosphere • Friendly Staff

• Special Events/Functions

• Secure Parking with CCTV

The ultimate Greek Dining Experience FREE BOTTLE OF WINE!

WHEN BOOKING A TABLE OF 4 on production of this advert

OPENING HOURS: 14 Waterloo Road, Liverpool L3 7BB

Mon - Sat 4.30-midnight Sun 2-10pm. www.bacchustaverna.co.uk

Tel: 0151 255 1661

Please mention Your Local Journal when responding to adverts

17


Travel

Journal Gardening

Thornton and Crosby Gardeners Club Monthly meetings are on the last Friday of each month (except December) at

ST LUKE’S CHURCH HALL, CROSBY VILLAGE at 7.45pm Membership is £10 per year (Visitors £1) and this includes tea and biscuits.

New members and visitors welcome

Interesting speakers, charity plant tables and raffle. Further information from Paul Lovelady - Tel. 0151 924 4901

My Desert Island Disc Plants...

I’ve always liked the Desert Island Disc concept, the one where you get to choose just eight pieces of music to ease the sense of isolation as you while away your days alone on an island in the Caribbean - but I’ve always felt that unless you were lucky enough to get stranded with Mrs Crusoe (or Nigella Lawson) you’d need a bit more than Vaughan Williams to keep you sane. Well here’s my choice of eight flowers to compliment the music; clearly these are purely personal and if you’d rather take along some nice King Edwards and a couple of grape vines instead, then I quite understand! First choice is the Nerine, a bulb which has fascinated me since I was a boy. The fact it has a summer rest with no water makes it easy to grow and it always flowers around my birthday September in case you’d forgotten! You don’t need desert island temperatures for the hardy Nerine bowdenii – try it, you won’t be sorry! Next up is the Azalea - not the most fashionable plant at the moment but one which is indelibly etched in my memory because many years ago I took a seed pod from a war grave in Germany. One of the resulting plants still flowers in my mother’s garden every spring and its powerful scent alone earns it a place on my list. The Iris family is vast but the big and bouncy tall Bearded Iris is my favourite. I have hundreds of varieties in my garden so the big problem would be selecting just one to take to the island! Like the Iris my next choice would relish the hot, dry desert island conditions – Coronilla glauca is one of those special plants I ‘discovered’ by accident a few

18

years ago. Now I can’t imagine a garden without finding a spot for this small growing shrub! Delightful! My next choice would not seem out of place on a desert island – the orchid – although the particular type I prefer would rather be stranded on top of a cool, moist hillside. The Pleione is a tiny little spring flowering species - another of my heirloom plants I have been growing forever and would hate to be without. Captivating! My last three choices I have grouped together as Marigolds, Sweet Peas and Roses. All of them are as indispensable to this stranded Yorkshireman as tripe and onions. And as for the choice of rose, it would have to be my dad’s favourite – Josephine Bruce - a gorgeous deep red colour with a fantastic scent. The next best thing to Mrs Crusoe! Jonathan Wild Garden Consultant and Up a Creek with no Paddle!

CROSBY PAST AND PRESENT (see page 8) have recently set up a Volunteer Gardening Group and have been given permission to maintain the walled garden in Moor Lane. If anyone would like to join them they will be most welcome. If you have one or two hours to spare on a Sunday or a Wednesday morning or afternoon then why not join them? Dates and times to be arranged and available on the Gardeners Journal on their website. www.localhistory.wix.com/cpapdhweedkillers

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


Pan Roast Trout with Spinach & Wild Mushrooms, Sweetcorn Puree & Fondant Potatoes

Ingredients

Serves 4

4 whole trout 50g butter 1 lemon 100g baby spinach 100g mixed wild mushrooms 20g butter 1 clove garlic 100g frozen Sweetcorn kernels 50ml cream 50ml milk 25g butter salt & pepper 4 large potatoes 1 sprig rosemary ½ bulb garlic 50g butter

Method

FONDANT POTATOES: Peel and slice the potatoes into an oval shape approximately 7cm across and 4 cm thick. Season a heavy bottomed pan, put the potatoes in and cover with water. Place the butter, rosemary and garlic in the pan and cook over a high heat until all the water has been absorbed; the potato will now fry in the butter until golden brown. Turn the potato over and cook for another 5 minutes until the other side is done. SWEETCORN PUREE: Put all the Sweetcorn, milk and cream in a pan with the butter and cook over a low heat until tender.

9th Nov â&#x20AC;˘ 14th Dec

Place into a bar blend and blend until smooth. Pass through a fine sieve and reheat when ready to serve. This may need a little milk to bring it back.

TROUT: Season the trout inside and out, heat a heavy bottomed frying pan until very hot, add a little olive oil and then carefully place the trout in the pan. Cook on one side for about 5 minutes then flip the fish over and cook for a further 5 minutes. Remove from the heat, add the 50g of butter and squeeze the juice from the lemon into the pan. Cover the trout with tin foil and allow it to rest in the butter for about 5 minutes. Remove from the bone and serve. SPINACH & WILD MUSHROOMS: Crush the garlic and cook in the butter with the mushrooms. Once the mushrooms have a nice colour, add the spinach and cover with a lid. Allow the spinach to wilt down, drain well and serve. Danny Jimminson -Restaurateur

Please mention Your Local Journal when responding to adverts

19


5TH ANNUAL Crosby Beerfest Rotary Club of Crosby

Yet again, sippers and swiggers the Annual Crosby Beerfest beckons!! As well as tasting some interesting beers, from far flung corners and some closer to home, you can do so safe in the knowledge that you are also helping local good causes. Hopefully, you have got Carte Blanche (Kelburn) to attend again this year, whether you take the Flying Scotsman (Caledonian), come under your own steam or let the Trade Winds (Cairngorm Brewery) carry you. Wild Cats (Cairngorm) shouldn’t keep you away from this popular event! There is a distinctive Scottish flavour to over 30 of the 40 beers on offer this year, and the cider drinkers aren’t forgotten with some tasty tipples from Herefordshire and Somerset. We have heard that Lord Kelvin (Strathaven), and the Three Sisters (Atlas Brewery) will be attending this year, with Peters Well arriving too, after having sown his Glencoe Wild Oats, perhaps somewhere in Pentland (Stewart). Doors open this year on Thursday 18th to Saturday 20th October at Crosby Civic Hall so make sure you have your Williams 80/- (William Brothers) ready in today’s money . For when you are peckish and to avoid the Skullsplitter (Orkney Brewery) and a severe

18th-20th October 2012

case of the Goldihops (Kelburn), food will be available with a range of tasty treats from the Pioneer Brasserie. You may need the Devil’s Advocate to decide who is driving but as always there will a FREE soft drinks bar for drivers that will hopefully stop them becoming too Bitter and Twisted (Harviestoun) before they have to take you home by the Sherpa Porter (Tryst) . We always get Mavericks (Fyne Ales) at our Beerfest, including people who drink WINE – and, yes, we’ll ensure the grape is available too! Crosby Civic Hall is only a few minutes’ walk from Waterloo station – so why not use the train and avoid ending up in the Bannockburn (Traditional Ales Stirling). A great time waits you for your £5 entry fee which includes a programme and tasting glass. Tokens bought for £1.25 will you give you a half pint tasting of any beer and cider of your choice.

www.crosbybeerfest.com


Images courtesy of Aidan McManus

You’ll have the chance to vote for your favourite – last year’s winner was Pipe Dream from the George Wright Brewery. Our thanks go to our sponsors and to members of Crosby Lions who will be helping with pouring. The festival could not survive without you, nor the generous sponsorship from many local businesses, organisations and individuals who support the event. We have many local businesses, organisations and individuals who sponsor a firkin of ale and generous support from our festival sponsors.

FESTIVAL SPONSORS

• A Gillion (Cooked Meats) Ltd • Alexander Myerson • Batten Hughes & Co • Bennett Safetywear Ltd • Campion Lawn Tennis Club • College Cycles • Coyne Learmonth • Crescent Pharmacy • David & Pam McKee • George & Angelas • Glenns Opticians Crosby Civic Hall is located on Crosby Road North in • Gordon Short Chemist Ltd Waterloo, Liverpool L22 0LQ. The nearest railway • Houseproud DIY station is Waterloo which is on the Northern Line • Little Pizza Kitchen heading towards Southport from Hunts Cross and • Mawdsley Brooks & Co Ltd Liverpool. • Minards Pavlou Solicitors Last trains from Waterloo • Park House Guest House To Liverpool 23.43 To Southport 23.54 • Phoenix Healthcare Distribution Ltd Crosby Civic Hall is only a 5 minute walk from • Saffron Waterloo station. Exiting the station onto South • Sandstone Brewery Road, cross straight over using the pedestrian crossing directly outside the station. Then turn right • Stanley Byron & Sons Ltd • Stone Financial Consultants Ltd and head a few hundred yards to the traffic lights marking the junction with Crosby Road North. • The Crows Nest Crosby Civic Hall is on the opposite side of the road, • Tony Almond to the left of the junction and facing the Plaza • Wales Log Cabins cinema. • W T Jenkins Ltd • Your Local Journal

HOW TO GET THERE

HOURS OF OPENING:

Thurs 18th Oct 5-11pm Fri 19th Oct 5-11pm Sat 20th Oct 1-11pm

www.crosbybeerfest.com


Journal House & Home

ALL WHITE METAL CURTAIN TRACKS FITTED BY SPECIALIST (GSB)

IS THE HOUSING MARKET SET FOR TAKE-OFF? The latest house price figures for August show a 1.4% rise over the past year. In real terms that’s actually a 2% drop but it sums up the housing market over the last 3 years – broadly flat. But could there be some light at the end of the tunnel? Anyone who’s sold their house recently and taken an offer well below the asking price would probably disagree, but I see some hopeful signs. Mortgage availability figures have jumped strongly in the last month while the typical deposit demanded by lenders is slipping slowly down towards the 10% mark. Even better news comes in the form of the Funding for Lending scheme. This allows banks and building societies to borrow 5% of their loan book from the Bank of England to fund new lending. The initial evidence suggests that most of this new lending has been in the way of mortgages. More good news comes in the form of forecasts for economic growth. Most economists are united in their belief that the economy will return to growth in the third quarter of this year, which should give a welcome boost to optimism among the housebuying public. Most estate agents I speak to are already confident; once again they are looking at investing in their businesses instead of cutting overheads. The biggest thing, though, is the sheer level of undersupply. In the past five years it is estimated

Basic Tracks • Custom Made Bay Tracks • Plus Auto • Pull Cord • Hospital Cubicle Poles Roman • Tracks Repaired

CURTAINS & NETS Made to Measure

Fabric off the roll £3 - £6 per metre Large Fabric Book Selection

Tel: 0151 924 3322 Mob: 07832 344522 Dowhills Road, Blundellsands

www.curtaintracksliverpool.co.uk

that, as a country, we should have been building between 200,000 and 300,000 new houses per year. In reality we have been building between 100,000 and 140,000. This situation shows no signs of improving in the immediate future. That means that there is a lot of pent up demand already in the system and the situation is only going to get worse year on year as we continue to build less houses than we need to. All this adds up to one thing, rising house prices; maybe not tomorrow or next month, but certainly next year. Craig Brown Estate Agent

SEAN JAMES

HEATING AND PLUMBING SERVICES GAS & OIL HEATING SYSTEMS FULL HEATING INSTALLATION & BOILER BREAKDOWNS

22

ADVERTISE HERE FOR ONLY £30

BATHROOMS,COOKERS GENERAL PLUMBING REPAIRS

Prompt Reliable Service

NO CALL OUT FEE

Gas Safe and Oftec Reg.

LITTLE CROSBY LIVERPOOL

Tel: 0151 924 3768 Mob: 07701 095673

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


Please mention Your Local Journal when responding to adverts

23


QUICK Crossword 1

2

3

4

CROSSWORD Clues 5

Across SPONSORED BY 1 Smacked (6)

6

Blundellsands Ward Conservatives 4 Riches (6)

7 8

8 Foundation (12)

9 10

11

13

12

Please16contact: Services (10) Cllr Peter Papworth 17 Advanced society (12) Tel: 0151 924 2950

14 15

9 Meticulous (10)

ANY LOCAL ISSUES 12 Wanted (6) Like better (6) OR13CONCERNS?

16

18 Hint (6) E-mail: peter.papworth@councillors.sefton.gov.uk 19 Revolves (6)

17

18

Cllr Sean Dorgan Tel: 07813 696488

19

Down

5 Uncommon (13)

E-mail: sureties@aol.com 11 Gifts (8)

1 Purchases (8)

6 Male vocalist (5)

Across 14 Stiff (5)

2 Contemplated (8)

7 Contention (5)

3 Deliberation (13)

10 Legitimate (8)

THE WATERLOO BLIND COMPANY LTD Est 1987

Manufacturers & Suppliers

Domestic • Industrial • Trade We measure, supply and fit so that the finished blind is perfect- every time.

Maintenance/Repair Service

• Venetian Visit us at our showroom, • Vertical • Wood or we can visit your home • Roller FREE of charge. • Roman • Pleated • Velux • Conservatory BBSA Members work to a strict • Sliding Panels

Tel: 928 2418

Code of Practice offering a high standard of service, quality, safety, integrity and reliability.

Blinds House, 40 Dean Street, Waterloo. L22 5NY

Email: sales@waterlooblinds.co.uk

24

www.waterlooblinds.co.uk

1. Smacked (6) relative (5) 15 Male 4. Riches (6) 8. Foundation (12) 9. Meticulous (10) 12. Wanted (6) 13. Like better (6) 16. Services (10) 17. Advanced society (12) 18. Hint (6) 19. Revolves (6)

Down

1. Purchases (8) 2. Contemplated (8) 3. Deliberation (13) 5. Uncommon (13) 6. Male vocalist (5) 7. Contention (5) 10. Legitimate (8) 11. Gifts (8) 14. Stiff (5) 15. Male relative (5)

Solution on Page 38

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


R.W. Almond based in Formby, Merseyside for over 30 years supplies a huge variety of product lines for both trade and DIY including bricks, timber, plasterboard, plumbing materials, drainage, heating, flagging, decorating and ironmongery.

Visit the shop where you can view decorative paving from Bradstone, Marshalls, Plaspave and Lakeland. We also stock huge quantities of natural stone paving in a variety of colours at a very competitive price.

Stephensons Way Industrial Estate â&#x20AC;˘ Formby â&#x20AC;˘ Liverpool â&#x20AC;˘ L37 8EG


This is what our latest customer had

to say…

“My sister saw my new bathroom makeover and said how she wish es hers was so clean because her shower cubicle was black with mould and the old silico ne was coming away. I decided to give my sister a bath room makeover for Christmas, Ian was very friendly and informative, looked at the job and agreed a date and time. He and his team cleaned out all the old mouldy silicone and grout; they worked very professionally and expe rtly with all the correct tools and materials. Every single detail was scoured and by the end of the day the shower cubicle had been transformed and my sister and her husband were amazed!” Mr Murphy of Rainhill


3

Sudoku SUDOKU 1

7

3 5 9 2 3

1 9

8 5 6 7 3 2 1 5 5 9

4 1 6 2 4

8

PUPILS BUZZING Research to save the British Honey Bee yields some sticky results!

Pupils at St Mary’s College, Crosby have discovered how raw honeycomb, fresh from the beehives of Knowsley Safari, becomes the tasty treat that they put on their toast. The budding environmentalists took part in an interactive honey extraction workshop, as part of groundbreaking three year research project ‘Plastic Fantastic’ which is hosted at the Safari Reserve and the Queensway Allotments in Crosby. ‘Plastic Fantastic’ was established this summer with the aim of uncovering the most effective way to protect and nurture the British honey bee. In May, 20 nucleuses of bees made their homes in both National Cedar hives and Beehaus hives at the Knowsley Safari and Crosby sites. Despite the worst weather on record for bees in thirty years, and the bees arriving mid-season, project leaders discovered a surplus of honey at this early stage in the project. These surplus honeycombs were

28

collected from the Knowsley Safari site and pupils rolled up their sleeves to help extract the honey. John Moran, project leader and teacher at St Mary’s comments: “Pupils from St Mary’s College, Crosby High School and St. Thomas C of E Primary have been enjoying learning outside of the classroom and uncovering the best way to cultivate the British Honey Bee. “They have been on regular trips to Knowsley Safari and the Queensway allotments where they have measured colony performance, the health of the bees and levels of honey production. “This harvest was unexpected and a fantastic opportunity to educate the children about how honey is made and the process of transforming raw honey into the cold pressed stuff that you find in jars.”

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com

H

It’s

Fi ea 3x nu wi

Yo ge us

W hig


New season savers

Upto Half price savings in-store now!

FIRST E H T BE E TO SEE & SAV

The Lugano Complete Limestone fireplace was now † £1299

SAVE 0

£899

£40

The Contemporary Arch

The Verdena

Light stone finish surround with marble back & hearth, FREE feature downlights

In Manila marble and smartsense downlights

was £899

was £799 SAVE 0

£20

599†

now

£

re fireplaces Plus many mo le prices! at unrepeatab

SAVE 0

£30

599†

now

£

Price excludes fire

® The UK’s hottest fireplace and heating centres 36-38 Liverpool Road, Birkdale Village, Southport PR8 4A 4AY Y Tel: 01704 565353 www.blazes.co.uk

Please mention Your Local Journal when responding to adverts

29


Journal Children & Education

Book Choice Point Blanc

by Antony Horowitz

Point Blanc is a thrilling adventure story about Alex Rider, a teenage spy who has been blackmailed into working for MI6. It is one of those books that, once you’ve picked it up, you really cannot put it down. From riding bikes to operating a crane, Alex is in constant action from the first page. I would definitely recommend this book to anybody, whether they’ve just started to read or just become a granddad. When you’ve finished this novel you will probably want to be a spy just like Alex. I think it is the best book of the series (there are nine of them – Point Blanc is the second in the series). The story starts when Alex sees an old friend buying drugs from a man called Skoda. He gets so angry that, without knowing what he’s doing, he sets off after the man. Everything goes pear shaped and he gets in trouble with the police and MI6 have to bail him out. It’s time for him to embark on his latest mission, investigating a mysterious school in the south of France. Armed with a collection of great gadgets and a false ID, he sets off to the house of Dr Hugo Greif, a freakish mad scientist working furiously on an experiment to take over the world, no less! My favourite part of the story is when Alex is snowboarding down a mountain with two snow mobiles in hot pursuit; naturally he comes out on top. My favourite character is Dr Greif’s second in command, Eve Stellenbosch. She is even more evil than Hugo Greif which is saying something as he is the evil genius that came up with the scheme to take over the world in the first place. I would suggest you read the first book of the series, Stormbreaker, beforehand to explain the storyline. Then you’ve got seven more brilliant novels to look forward to. Niall Barnes Age 9

30

HAPPY, SAFE & STIMULATING

Early Days Childrens Day Nursery

Early Days in Waterloo opened in 1984. There are 3 large playrooms which accommodate children aged 3 months to 5 years. The 0-2 room is a large playroom with a range of stimulating activities taking place following children’s likes and interests. The babies especially enjoy our daily messy activities which include sand, gloop and painting to name but a few. The 2-3 room is a spacious environment with 6 areas set up to encourage children’s development. Staff observe children at play to find out how to plan future activities they will enjoy. The 3-5 room consists of 2 rooms. A room where all the messy activities take place e.g. painting, sand, water and a room for building towers or making their friends some dinner in the play kitchen area. Pre-school children have internet access and are learning new things everyday. Our Officer in Charge is Gail Hall who qualified in 1996 and together with her deputy Carla Feeney and the excellent team work together with parents to provide your child with a safe and stimulating environment in which they develop their own individual potential. Each staff member is registered with Ofsted and all have to undergo a Criminal Record Check through the Criminal Record Bureau (CRB). The nursery is registered with Ofsted who inspect the nursery on a regular basis. Our last report is available on request or online. We have also achieved a Grade 5 Food Hygiene Rating. So come in and have a look for yourself at our wonderful nursery. (Contact details on page 31)

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


• 1 free week introductory period • We offer term time places * • Free nursery places available * • Shift working accommodated • 3 weeks free holiday (this includes Christmas week) * All staff are carefully selected, qualified and experienced Nursery Nurses who have been trained to work with young children. All have trained in First Aid techniques. All staff ratios comply with the guidelines set down by Ofsted.

To provide a happy, safe and stimulating environment in which your child can develop to his or her own individual potential.

Ofsted Approved

Fully Qualified Nursery Staff 3 months - 5 Years

* Terms & Conditions apply

EARLY DAYS UK LTD

6 Alexandra Road, Waterloo L22 1RJ

Tel: 0151 928 4422

www.early-days.co.uk

waterloo@early-days.co.uk

Please mention Your Local Journal when responding to adverts

31


LAUNCH OF NEW ART CLUB Creative Balance A brand new Community Interest Company has arrived in the North West. Creative Balance is a family run company with a strong passion for the arts. Our aim is to make a positive difference through creative expression and develop healthier and positive relationships within the wider community. Established by Design Graduates of Liverpool Hope and John Moores Universities, local artists Sarah McLaughlin and Kathryn Wilson have teamed up to offer educational, therapeutic and fun art workshops to the community, schools and organisations. Recent projects range from work on the Giant mural overlooking the Marina Lake in Waterloo, alongside school workshops in the local areas developing the knowledge of art and culture in the early 1900’s to local fundraising events. From textiles and ceramics to graphics and illustration, we have a vast amount of knowledge and professional freelance experience, including working in various creative settings with vulnerable children and families. This enables us to create a great range of topics that can be tailor made for all ages and abilities.

32

Images coutesy of Simon Speakman Photography & Design

WE CURRENTLY OFFER SIX SERVICES: • School Workshops • Holiday Workshops • One to one Support • Community Projects • Children’s parties and events • Art club

OCTOBERS ART CLUB

Fun project themes each month, including contemporary and classic art. Working with a variety of materials and media we develop and encourage your child's creative expression! Creative Balance hold biannual exhibitions showcasing children’s artwork.

AGES 3-7: TUESDAYS 4:30PM-5:30PM Waterloo Community Centre, Great Georges Road AGES 7-12: WEDNESDAYS 5.00- 6.00PM St Lukes Church Hall, 71 Liverpool Road, Crosby. For more details please call Sarah on Tel: 0151 538 8216 or Mob: 07594 154431

www.creativebalance.info

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


OLD CHRIST CHURCH FARMERS MARKETS

Film Review

The Sweeney (15) Dir: Nick Love

The Sweeney opens with the entire flying squad in a couple of cars exchanging some not especially witty banter. Moments later, they burst into a warehouse and take on a gang of blaggers, all tooled up with sawn off shotguns. Most people would approach such a scenario with some trepidation, but for the hard men (and women) of the Sweeney it’s all in a day’s work. Bizarrely, this is one of the more plausible scenes of the whole film. For a film based on a TV series that was so grittily realistic it was required viewing for trainee coppers, this is a problem. The normally impressive Ray Winstone is completely wasted as DI Jack Regan; his lines are so badly scripted that he can only emerge as a humourless thug, making it inconceivable that he would attract the attentions of love interest Nancy, delectably played by Hayley Atwell. Regan blunders around swearing a lot, assaulting villains, members of the public and fellow police officers with equal enthusiasm. Meanwhile, his sidekick DC George Carter (Ben Drew) makes a worthy attempt to win the award for most hopeless actor of the year. Homeland’s Damian Lewis delivers a laudable try at a Cockney accent in the role of Frank Haskins, Regan’s long suffering boss, but is hamstrung by the abysmally bad script. There is a plot, but it is terminally confusing and full of more holes than one of the baddies after Regan has finished with him. Every part of the film is so completely unbelievable that it becomes depressing after a while. Fans of hardcore actioners might take some solace in the lengthy fight scenes and car chases, but even they are a pale imitation of the slick sequences fans of Bourne and Bond have come to expect. It would be easy to excuse these failings as an attempt to slant the movie at the American market but, at the end of the day, it is simply evidence of a director so poor that the finest cast list and biggest budget in the world couldn’t save him. Howard Clemmow My Rating **

Fridays 12th October; 9th November; 14th December 10.30am to 3pm. Come for high quality food and other produce and at the same time support small local businesses and farmers that struggle to survive without our help.

FLEA MARKETS

Saturdays 3rd November; 1st December 9.30am to 1pm. One of most popular events with up to 80 stalls, all undercover inside our majestic Victorian masterpiece.

20th OCTOBER SEFTON’S BIG DRAW & CRAFT

WORKSHOPS – 10.30 to 4.30pm. This involves having a large variety of arts & crafts for people of any age to come and try. We will have pottery, painting, making pots, making cards and masks, face painting, glass painting, there will be caricatures and cartoons, artists doing workshops and a lot more with lots of fun for everyone. It’s FREE to enter and take part.

10th NOVEMBER – THE FAIR BEFORE CHRISTMAS

10am to 4pm. With all our usual high quality stalls selling lots of items for Christmas. Find the unusual, the unique and exclusive gift for all the family and friends. Beautiful and hand crafted products made by hand locally. There will be something for everyone.

17th & 18th NOVEMBER – EXHIBITION OF ART & PHOTOGRAPHY by students from HUGH BAIRD COLLEGE. 20th - 25th NOVEMBER – WATERLOO BEER FESTIVAL Full details on Inside Front Cover.

Please visit our website at

http://oldchristchurch.tripod.com

to learn more about us and what we do to develop Old Christ Church as a hub of activity for the local and wider communities of Sefton.

THANK YOU for your continued support during 2012 and with your help we feel confident that we shall exceed last year's record attendance of over 29,000 visitors.

Please mention Your Local Journal when responding to adverts

33


Journal What’s On Crosby / Waterloo

MONDAYS & THURSDAYS IN TERM TIME @ 7PM B-Fit Boot Camp

Mondays at Merchant Taylors Boys School Sports Centre, Crosby & Thursdays in Hightown, St Stephens Church hall (starts w/c 5th Nov). 12 progressive 1 hour sessions using 3D resistance & fat burning exercises designed to tone, streamline & improve general fitness, weight loss, nutrition & lifestyle advise with a Personal Trainer, your own programe - to do at home. All fitness levels welcome! Contact Gaynor on 07748 298 728 or go to www.b-fit.uk.com

EVERY TUESDAY IN TERM-TIME Crosby Capriol Singers Rehearsals

Come and join our friendly mixed voice choir with a wide repertoire for a free trial period! We meet at Christ Church, Waterloo from 19.45-21.45 hours. Contact: Dennis Morley (Secretary) 0151 931 2346 www.crosbycapriolsingers.co.uk

WEDNESDAY EVENINGS Opera Viva Weekly Rehearsals

Opera Viva hold their weekly rehearsals at 7.30pm at The Music House, St Mary's College, Crosby. If you would like to be involved in another successful year of taking Opera to locations across Merseyside and beyond come and join us. No experience necessary! Contact: 0151 920 5386 or email operaviva@ymail.com

THURSDAY 18TH - SATURDAY 20TH OCTOBER Crosby Rotary 5th Annual Beer Fest

See feature on the centre pages www.crosbybeerfest.com

FRIDAY 26TH OCTOBER Crosby RDA Quiz Night

Crosby Riding for the Disabled will be holding a quiz night at Little Crosby Village Hall - opposite St Marys Church in Little Crosby, this night is a very popular fun evening, bring your own drinks and nibbles, Just turn up on the night. £4 per person all proceeds to Crosby RDA. Contact: Vikki Finnigan 07905 048801

FRIDAY 26TH OCTOBER Comedy Night in aid of Kids with Cancer

Comedy night at Crosby Comrades Club with four comedians and a Band and a meal - £20. Contact: 07845 328267

SATURDAY 4TH NOVEMBER The Winter Ball

Crosby Riding for the Disabled are holding a charity Winter Ball at Formby Hall Golf Club & spa, tickets are £40 each, there is a 3 course meal and a full programme of entertainment, formal dress with a 1.00am bar. Contact either Nicky on 07526 983770 or Vikki on 07905 048801

WEDNESDAY 14TH NOVEMBER Christmas Shopping Evening

Jospice Christmas shopping evening at Sacred Heart Catholic College. Lots of stalls for you to browse. Wine & entertainment included. Contact: 932 6035

FRIDAY 16TH NOVEMBER The Priests in Concert for Jospice

See the world famous singing Priests joined by local mezzo soprano Danielle Thomas at the Metropolitan Cathedral. Still some tickets remaining. Contact: 924 3812

34

SATURDAY 17TH NOVEMBER Book Sale in Crosby Village

Crosby and District Lions Club are having a book sale for Children in Need in Crosby Village (in front of Boots) between 10am and 1pm. Pudsey will be there and all books may be purchased by donation. We'd be delighted to see you there!

THURSDAY 22ND - SUNDAY 25TH NOVEMBER Waterloo Beer Festival

See main ad inside front cover www.waterloobeerfestival.com

FRIDAY 23RD - SUNDAY 25TH NOVEMBER Art Fair at CHET

Friday November 23rd Open from 10am-8.30pm. Free wine & nibbles from 5.30pm. Saturday November 24th & Sunday November 25th Open from 10am-5pm at Crosby Hall Educational Trust, Back Lane, Little Crosby. Hundreds of pictures for sale, take away when you buy. Selection of exquisite crafts. Light lunches, sandwiches, home-made soup & cakes. Free parking. Contact: 0151 924 9099 www.chetcentre.co.uk Reg. Charity No: 700042

FRIDAY 30TH NOVEMBER Jospice Santa Dash

Join a group of Santas and get in the festive spirit to support Jospice and have fun at the same time. Contact: 924 6035

SATURDAY 8TH DECEMBER Opera Comique with Supper

An evening of Opera favourites,with a Comic flavour, presented by the successful Merseyside based company Opera Viva. 7pm for 7.30pm. Book early for this popular annual celebration of music and fine food, which will be held in the O'Halloran Hall at St Mary's College, Crosby Contact: 0151 920 5386 / 07970 938661 or email operaviva@ymail.com

SUNDAY 9TH DECEMBER Light up a Life Service at Jospice

Light up a Life service at Jospice starting with carols at 4pm followed by service at 4.30pm. The service offers an opportunity for everyone who wishes to remember a loved one who is no longer with them, especially in the weeks before Christmas. All welcome. Call 0151 924 3812 for further details

WEDNESDAY 12TH DECEMBER Christmas Coffee Morning at CHET

Christmas Coffee Morning at Crosby Hall Educational Trust, Back Lane, Little Crosby. 10.15-11.30a.m. Admission Free. Coffee & Mince Pie for everyone. Christmas Goodies. Raffle Contact: 0151 924 9099 www.chetcentre.co.uk

THURSDAY 13TH & FRIDAY 14TH DECEMBER Christmas Concerts at CHET

Christmas Concerts at Crosby Hall Educational Trust Back Lane, Little Crosby, featuring Anna Corcoran at 7.30pm. Tickets £9.50 with Mulled Wine & Mince Pies Contact: 0151 924 9099 www.chetcentre.co.uk

If you are a member of a local community group and you want to publicise your next event in Your Local Journal please fill in the event form on our website: www.yourlocaljournal.com

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


WATERLOO RUGBY CLUB The Pavilion, St. Anthony’s Road, Blundellsands, Liverpool L23 8TW

THE BEST KEPT SECRET IN BLUNDELLSANDS

FREE ROOM HIRE

ON ANY BOOKINGS IN OCTOBER, NOVEMBER & DECEMBER 2012

Please quote “Journal” to qualify For full details please contact the Club office Tel: 0151 924 4552 ext. 20 email: admin@waterloorugby.com

www.waterloorugby.com

WHAT’S ON at Waterloo Rugby

Friday 19th October

An evening with former Liverpool player Dean Saunders

Tickets £25. Includes 3 course dinner in the Waterloo Room. Dress Code: Lounge Suits. 7.30pm for 8pm

October Half Term

Disco Nights for Children in years 7, 8 & 9 (age 11,12,&13) Full details available from the Club

Thursday 1st November

Comedy Club @ Waterloo Rugby planned for the 1st Thursday of every month

Tickets £10 per head including a hot supper. These nights promise to be great fun so book early. Full details of comics appearing on the club website shortly. Please contact the club to book your seats asap. www.pitchero.com/clubs/waterloo

Saturday 3rd November Fireworks Display

Gates open at 6pm. Food available and Bars open from 6pm. Tickets on sale behind bar from Saturday 29.10.12. Family ticket 2 adults & 2 children (U16) £15 Adults £7 Children/OAPs £3 (children u16 must be accompanied by an adult). Tickets for all events will be on sale behind the bar which is open every weekday evening from 5.30pm and weekends from 12 noon. They will also be on sale from Monday 1st October from Gillions College Road, World of Flowers, St Johns Road and Pineapple Fruit and Veg South Road. For further details or to book please contact Andrea at the club: Tel: 0151 924 4552 x 20 Mob: 07842 229201 email: admin@waterloorugby.com

www.waterloorugby.com

Please mention Your Local Journal when responding to adverts

35


Useful Telephone Numbers Help Lines

Merseyside Police Childline Elder Abuse Response NHS Helpline N.S.P.C.C. Relate R.S.P.C.A. Samaritans Typetalk(RNID)Text: Typetalk(RNID)Voice:

0151 709 6010 0800 1111 0808 808 8141 0845 46 47 0808 800 5000 0300 100 1234 0300 1234 999 08457 90 90 90 0800 500 888 0800 731 1888

Floodline Gas Emergency Manweb(Power Loss) Sefton Council United Utilities (Supply) United Utilities (Leaks)

0845 988 1188 0800 111 999 0845 272 2424 0845 140 0845 0845 746 2200 0800 330 033

Alder Hey Hospital Aintree University Hospital Broadgreen Hospital Liverpool Women’s Hospital Ormskirk & District Hospital Royal Liverpool Hospital Southport & Formby Hospital Whiston Hospital Prince Street Health Centre Walk-in Treatment Centre Litherland Town Hall BMI Sefton Hospital

0151 228 4811 0151 525 5980 0151 282 6000 0151 708 9988 01695 577111 0151 706 2000 01704 547471 0151 426 1600 0151 928 2694 0151 475 4667

Mersey Travel National Rail Enquiries Liverpool John Lennon Airport General Enquiries Flight Information Manchester Airport General Enquires

0151 227 5181 08457 48 49 50

Utilities

Hospitals

Travel

Chemists

0151 257 6700

0871 521 8484 0906 108 8484 0871 271 0711

Alexanders Stuart Rd, Crosby Boots Liverpool Rd,Crosby Boots South Rd,Waterloo Cohens Bridge Rd, Blundellsands Gordon Short College Rd, Crosby Higgins Crosby Rd Nth, Waterloo Lloyds Crosby Rd Nth, Waterloo

928 1457 924 4338 928 3070 924 3209 924 3449 920 6803 928 3169

Crosby Library Carnegie Library

257 6400 924 5287

Libraries 36

CROSBY CAR VALETING Professional Mobile Car Valeting Established for over 10 Years

Commercial / Domestic Motability Valeting Friendly Efficient Service. We come to you at home or at work

www.crosbyvaleting.co.uk

0151 931 2933 Based in Crosby L23

DOOR 2 DOOR DISTRIBUTION

Leaflets • Brochures • Papers

Excellent Rates Friendly and Reliable

Tel : 01925 290814 Mob: 07590 828152

Email : mv51yts@yahoo.co.uk

P. B. Distribution UK Ltd

To advertise please call 07531 156758 or e-mail sally@yourlocaljournal.com


Journal What’s On Liverpool / Southport English Youth Ballet’s COPPELIA

Friday 9th 7.30pm & Saturday 10th November 2.30pm & 7.30pm A professionally produced, full length, classical ballet with international dancers backed up by young dancers drawn from the regional area. Tickets: £17.50-£24.50 Concessions and Group Prices available

DIRTY DANCING

The Classic Story on Stage Tue 9 – Sat 27 Oct Mon-Thu eves 7.30pm, Fri 5pm & 8.30pm, Sat 2.30pm & 7.30pm Dirty Dancing is an unprecedented live experience, the first ever national tour is LONELINESS OF THE exploding with heart pounding music, LONG DISTANCE RUNNER passionate romance and sensationally Tue 30 Oct to Sat 3 Nov sexy dancing. Tickets: £10- £75 From Pilot Theatre, Roy Williams's new English National ballet adaptation unlocks the biting realism of Sillitoe's classic novel while placing the THE SLEEPING BEAUTY drama firmly in a contemporary frame. Tue 30 Oct – Sat 3 Nov Tue & Sat eves Ticket info: £10 – £21 7.30pm, Thu 2pm, Sat mat 2.30pm The Sleeping Beauty reawakens the magic STEPTOE & SON of the world’s favourite fairy tale in an Thu 6 Nov to Sat 10 Nov enchanted world of castles and curses, Adapted from the legendary scripts of forests and fairies. Featuring the most Galton and Simpson, Kneehigh Theatre's luxurious staging, superb dance and new production charts the tender, cruel dazzling music including Tchaikovsky’s and surprising dance of father and son. much-loved Rose Adagio and Once Upon Ticket info: £10 – £21 a Dream used in Disney’s version of this HELD popular classic. Ticket info: £10 - £35 Thu 8 Nov to Sat 1 Dec (Playhouse Studio) 42ND STREET A captivating story of the weave and weft Tue 13 – Sat 17 Nov Tue – Sat eves of family life. This is the debut play by one 7.30pm, Wed & Sat mat 2.30pm of our Young Everyman and Playhouse 42nd Street, the timeless, inspiring tale of (YEP) Young Writers graduates – Joe Ward small town Peggy Sawyer’s rise from Monrow. Ticket info: £10 chorus line to Broadway star. And those JACK & THE BEANSTALK songs! Lullaby of Broadway, We’re In The Fri 30 Nov 2012 – Sat 19 Jan 2013 Money, Shuffle Off To Buffalo, Keep Young And Beautiful, I Only Have Eyes For Our Rock 'n' Roll panto promises music, mayhem, as writers Mark Chatterton and You.Ticket info: £10 - £35 Sarah Nixon conjure up a world of fairies, beanstalks and giants.Tickets: £10 – £23

CINDERELLA

Fri 14 Dec – Sun 6 Jan Panto returns to the Liverpool Empire in 2012 from First Family Entertainment with an all-star cast! Cinderella stars Coleen Nolan as Fairy Godmother, Liz MaClarnon as Cinderella and Pete Price and Paul Daniels as the Ugly Sisters. See website for performance times £10 - £25. BOOKING DETAILS: Tickets are available online at www.atgtickets.com/liverpool or at the Liverpool Empire Box Office on 0844 871 3017

BOOKING DETAILS for all shows are either in person from the Everyman or Playhouse box office or - Box Office: 0151 709 4776 and for online bookings (24hrs): www.everymanplayhouse.com

THE MANFREDS

Wed 7th Nov 7.30pm Celebrating 50 years of music – 1962 to 2012. Original Manfred Mann members , are joined by Rob Townsend, Marcus Cliffe and Simon Currie as the exciting new line-up of The Manfreds, featuring both lead singers from the 1960’s band. Ticket info: £25

Please mention Your Local Journal when responding to adverts

JIMMY CARR-GAGGING ORDER

Wed 21st Nov 8pm (Over 16`s only) Brand new show, brand new jokes, same old Jimmy. The show will be packed with one-liners, stories & jokes. Ticket info: £26

CINDERELLA

Thurs 6th-Mon 31st Dec Various Times The rags to riches tale of Cinderella played by ex Atomic Kitten star Natasha Hamilton. Tickets start from £9.75. Concessions, Groups and Family Discounts BOOKINGS: Call our Ticket Centre 0844 871 3021* or book online www.atgtickets.com/southporttheatre* *subject to booking fee

MOTHER TO MOTHER

Sat 13 Oct 8pm A powerful and profound monologue about the murder of American Amy Biehl in South Africa with the mother of one of the killers trying to make sense of a senseless act. Tickets: £12/£10 concessions

THE ELVES AND THE SHOEMAKERS

Sat 3 Nov 11:30am & 2:30pm Live music, puppetry, physical storytelling and a sprinkling of Elf magic combine to tell this classic tale. Suitable for ages 3+ Ticket info: £8 adults / £6 children.

L.O.V.E

Thu 15 – Sat 17 Nov 8pm Volcano Theatre take Shakespeare’s sonnets and inject them with vigour, passion and tenderness. Three lovers wrestle breathlessly with the poetic language, and sweatily with one another. Ticket info: £12/£10 concessions

HANSEL AND GRETEL

Tue 4 Dec – Sat 12 Jan Expect the unexpected in this festive family treat, with songs, dance and laughs that are good enough to eat! Age 5+ Ticket info: Prices vary BOOK SECURELY ONLINE: www.unitytheatreliverpool.co.uk Box Office: 0844 873 2888 Email: tickets@unitytheatreliverpool.co.uk In person: 1 Hope Place Liverpool, L1 9BG

37


Advertisers Guide

Quickly find all your local services using our handy index Bathroom Restoration Total Bathroom Restoration...26-27 Blind Suppliers The Waterloo Blind Company...24 Builders Merchants R.W.Almond...25 Car Valeting Crosby Car Valeting...36 Children’s Nurseries Early Days UK Ltd...30-31 Chirpodists Loreto Sime...12 Chiropractors Dr.Rebecca Howell D.C.Mchiro...11 Clubs, Groups & Organisations CHET...34 Crosby & District Historical Society...9 Crosby Capriol Singers...34 Crosby Past and Present...8 Crosby Rotary Club...20-21 Friends of Old Christ Church...33,39 NADFAS...9 Opera Viva...34 Sightline Vision...6-7 St John’s Local History Group...9 Thornton & Crosby Gardeners Club...18 Councillors Blundellsands Ward Conservatives...24

Curtains & Soft Furnishings All White Metal Curtain Tracks...22 Decorator’s Merchants Stanley Byron & Sons Ltd...23 Dieting and Weight Control Cambridge Weight Plan...15 Fireplace & Heating Centres Blazes...29 Fitness Training B-Fit Personal Training...13 Function Room Hire Waterloo Rugby Club...35 Greetings Cards Phoenix Trading...14 Holiday Accommodation Holiday Anglesey...16 Holistic Therapies Anne Ryan Complimentary Therapy...12 Hotels and Accommodation The Croft...17 Leaflet Distribution P.B.Distribution...36 Legal Services Bespoke Legal Services...3

Piano Sales & Service The Piano Shop...10 Plumbing & Central Heating Sean James Heating & Plumbing...22 Restaurants & Bars Bacchus Taverna...17 Schools & Education Merchant Taylors’ Schools...40 Stationery Phoenix Trading...14 Theatres Liverpool Empire...37 Liverpool Playhouse...37 Southport Theatre...37 Unity Theatre...37 Toenail Cutting Services Nailcarers...10 Wedding Car Hire Crosby Classic Bentleys...14

PUZZLE SOLUTIONS S H O P P I N G

US H O A P P T I N D G

QUICK CROSSWORD

T R C K O E R G N I A S A R I C D D E E E D D R U N C F A C I T V LI L R E M

U C W KE AWLE TA HL XE I O XI A N I S A T I O S A T I O N S S R S R O T I C U L A R U L A R R D E O O E O O D E D P R E PF RP R RE FD E RF FR A CD I L F I T EI I TL I GT I N E SC V G I LN I Z CA T EI I OZ A DT I R O NA C Y C L I N D

T H E N O R P E R E E S E O N T E S

T R E R G A A R D E E D U N C I L O D R A T C Y C L E S R E M I N D The deadline for the

38

Solution to October Crossword

Solution to October Crossword

Solution to Mind benders 1. That’s beside the point

3 9 7 1 5 6 8 2 4

83 59 47 1 7 5 9 6 28 62 14 3

SUDOKU

18 21 42 46 67 75 59 65 36 83 87 72 24 41 24 12 51 59 98 86 63 7 4 9 6 2 3 8 4 9 6 2 3 8 5 9 3 4 1 8 6 2 3 4 1 8 6 2 7 2 8 5 7 3 1 9 86 59 77 33 41 59 14 91 77 38 94 55 41 32 73 85 96 25 14 93 76 1 9Sudoku 7 8 5Solution 6 2to October

9 1 3 5 7 4 2 6 8

to October Sudoku WinterSolution Thursday November REdition A G O A U is S K U L L S F L 22nd A T R I C K L O D A R K A D A L

O S O H T R IE CF K L NO PD GA HRO KU AL DC A L N

R A G please O A Ucall S 07531 K U L156758 L S ForLe-mail A To advertise sally@yourlocaljournal.com T Z L U F A M A S K T E T A E A N B T C D P Y C T S R C C T

E F O S N P G H O U L C O H N X P I M B M R O R P W A O U R A N B T C D P Y C T S R C C T I U N E U D H Y A I

I M B L N


Who will y ou find at the Farmers Mar ket at Old Christ Church?

HOME REARED BEEF Traditional Breeds Pork, Lamb & Mutton always available at Old Christ Church

ORDERS TAKEN Please call Carole on 01524 770574 or 07984 877164

carole@deepclough.plus.com

www.dalesbredfinestmeats.co.uk

PENINSULA LUXURY PIES

9th Nov • 14th Dec

Purveyors of a wide variety of Home Baked Pies and Pasties Specialising in

Aberdeen Angus Steak

T el : 0 1 5 1 6 4 9 0 4 0 1

The Farm Burscough

A delicious range of

HOME MADE CAKES

AWARD WINNING

by Sally Tel: 932 0207

Homegrown Vegetables & Homemade Preserves Potatoes, Spring Onions, Tomatoes, Cabbage and much more Delicious Chutney & Relish

Registered with Environmental Health

FREE RANGE EGGS

01704 894889

The Farm • Martin Lane • Burscough • Lancs • L40 0RT

A l oe A ng el

SPECIALIST AND ARTISAN CHEESES sourced from all over Britain & Europe

The complete range of Forever Living Products, the world's largest grower and producer of Aloe Vera.

matured in our Grade II listed Old Dairy in Liverpool's historic Woolton Village.

NEW!

Large Selection of Locally Brewed Beers

DISTRIBUTORS WANTED!

Tel: 07898 689004

Email: pauline@aloeangel.org.uk

www.aloeangel.org.uk

Come and sample what real, handmade cheese tastes like. You won't be disappointed!

29a Woolton Street, Woolton Village, Liverpool L25 5NH Phone: 0151 428 3942 www.liverpoolcheesecompany.co.uk

Please mention Your Local Journal when responding to adverts

39


2SHQ'D\HYHU\GD\ 2SHQ'D\HY HU \GD\ Att Mer A Merchant chant Taylorsâ&#x20AC;&#x2122; Taylorsâ&#x20AC;&#x2122; Schools we rrecognise Taylor ecognise that academic partt o off an all-r all-round achievement is only one par ound education. As well as gaining the top exam rresults esults on Merseyside Merseyside we pride ourselves our selves in offering offering the best extra curricular provision. provision.

7RĂ&#x20AC;QGRXWPRUHPDNHDQDSSRLQWPHQWWRYLVLWWKHVFKRROV 7 RĂ&#x20AC;QGRXWPRUHPDNHDQDSSRLQWPHQWWRYLVLWWKHVFKRROV GXULQJDQRUPDOZRUNLQJGD\ GXULQJDQRUPDOZRUNLQJGD\ GXULQJDQRUPDOZRUNLQJGD\

Senior Girls : 0151 932 2414

Senior Boys : 0151 949 9333

Junior Boys : 0151 949 9333

Mixed Mix ed Infants & Junior Girls : 0151 924 1506

The Mer Merchant chant Taylor T Taylorsâ&#x20AC;&#x2122; aylorsâ&#x20AC;&#x2122; Schools, Cr Crosby: osby: a comp company any limited limited by guarant guarantee ee Registered R egistered in England: Comp Company any Number Number:: 6654276 5HJLVWHUHGRIĂ&#x20AC;FH/LYHUSRRO5RDG&URVE\/LYHUSRRO/43 5 HJLVWHUHGRIĂ&#x20AC;FH/LYHUSRRO5RDG&URVE\/LYHUSRRO/43 Registered Registered Charity Number: Number : 1125485

www.merchanttaylors.com www.merchanttaylors.com 7KH%HVW(GXFDWLRQIRU/LIH

Autumn 2012  

Your Local Journal

Read more
Read more
Similar to
Popular now
Just for you