Issuu on Google+

 

 

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2   ALL-­TIME REAL SALT LAKE POSTSEASON RESULTS / SCHEDULE ============================================================  

2008      DATE              OPPONENT                    RESULT                ATT.    W-­L-­T    RD.     11/01/2008        Chivas  USA                W  1-­0              14,719    1-­0-­0    WCSF     11/08/2008        at  Chivas  USA          T  2-­2              19,265    1-­0-­1    WCSF     RSL  wins  series  3-­2  on  aggregate             11/15/2008        New  York                    L  0-­1              20,008    1-­1-­1    WCF    

NOTES:           RSL:  Movsisyan  (90)   RSL:  Kovalenko  (39)  Morales  (77);;     CHV:  Kljestan  (30)  Braun  (83)   NY:  van  den  Bergh  (28)  

 

 

 

2009      DATE              OPPONENT                    RESULT                ATT.    W-­L-­T    RD.       10/31/2009        Columbus                    W  1-­0              11,499    1-­0-­0    ECSF     11/05/2009        at  Columbus              W  3-­2              10,109    2-­0-­0    ECSF     RSL  wins  series  4-­2  on  aggregate       11/14/2009        at  Chicago                T  0-­0  (OT)    21,723    2-­0-­1    ECF   RSL  advances  5-­4  on  PKs   11/22/2009        vs  Los  Angeles        T  1-­1  (OT)    46,011    2-­0-­2    CUP         56/ZLQV0/6&XS¶-­4  on  PKs  

SCORERS:             RSL:  Findley  (88)   RSL:  Morales  (37)  Findley  (45)  Williams  (74);;     CLB:  Barros  Schelotto  (19,35)     RSL:  Findley  (64);;  LA:  Magee  (41)  

2010      DATE              OPPONENT                    RESULT                ATT.    W-­L-­T    RD.     10/30/2010        at  FC  Dallas            L  1-­2              11,003    0-­1-­0    WCSF     11/06/2010        FC  Dallas                  T  1-­1              19,324    0-­1-­1    WCSF    

SCORERS:             RSL:  Espindola  (5);;  DAL:  Cunningham  (44)  Avila  (88)   RSL:  Findley  (80);;  DAL:  McCarty  (17)  

2011      DATE              OPPONENT                    RESULT                ATT.    W-­L-­T    RD.     NOTES:       10/29/2011        Seattle                                                                            WCSF   11/02/2011        at  Seattle                                                                      WCSF   11/06/2011        Western  Conference  Final   11/20/2011        MLS  Cup  2011  @  The  Home  Depot  Center  ±  Carson,  CA  ±  7:00  p.m.  MT  (ESPN)

 

 

 

vs.  Team                  Series      W-­L        GP      W-­L-­T        OT          ShO      GF    GA      Mtg.    Round                          Series  Result     Seattle  Sounders  FC  1                                                                                                2011    Quarterfinals   Chivas  USA                    1          1-­0          2      1-­0-­1                                    3      2      2008    Quarterfinals          Won  1  games  to  0   New  York                        1          0-­1          1      0-­1-­0                                    0      1      2008    Semifinals                Lost  1  games  to  0   Columbus  Crew              1          1-­0          2      2-­0-­0                                    4      2      2009    Quarterfinals          Won  2  games  to  0   Chicago  Fire                1          1-­0          1      0-­0-­1      1-­0-­0      1-­0        0      0      2009    Semifinals                Won  1  games  to  0   Los  Angeles                  1          1-­0          1      0-­0-­1      1-­0-­0      1-­0        1      1      2009    MLS  Cup  '09              Won  MLS  Cup  '09   FC  Dallas                      1          0-­1          2      0-­1-­1                                    2      3      2010    Quarterfinals          Lost  1  games  to  0     TOTALS                            6          4-­2          9      3-­2-­4      2-­0-­0      2-­0      10      9    

 

REAL SALT LAKE ² MLS CUP PLAYOFF HISTORY                                                Last

 

 

 

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

 

REAL SALT LAKE ² MLS REGULAR SEASON HISTORY                    -­-­-­-­-­  OVERALL  -­-­-­-­-­                    -­-­-­  HOME  GAMES  -­-­-­                  -­-­-­  ROAD  GAMES  -­-­-­                  -­-­-­-­-­  FORM  GUIDE  (reverse  order)  -­-­-­-­-­   vs.          GP      W-­  L-­T      GF    GA  +/-­        GP      W-­L-­T      GF    GA  +/-­        GP      W-­  L-­T      GF    GA    +/-­            2011      10      09      08      07        06        05   COL          22      7-­  8-­7      22    22    =          11      5-­3-­3      12      8    -­4        11      2-­  5-­4      10    14    -­4                  TW      TT      WTL    TWL    WWTL    LWLT    LLLW   CHV          20      7-­  9-­4      22    29    -­7          9      4-­2-­3      15      9    +6        11      3-­  7-­1        7    20    -­13                WW      TW      WL      LWL    LLL      TTTL    WLWL   DAL          20      7-­11-­2      26    30    -­4        11      7-­3-­1      21    12    +9          9      0-­  8-­1        5    18    -­13                WT      WL      LW      WLW    LLT      LWLL    LWLL   LA            19      7-­  7-­5      31    28    +3          9      4-­1-­4      17    12    +5        10      3-­  6-­1      14    16    -­2                  LW      WL      WT      TT      TWL      WLWL    TLWL   HOU          16      3-­  8-­5      22    25    -­3          8      3-­1-­4        8      4    +4          8      0-­  7-­1      14    21    -­7                  LT      WL      LTT    LT      LLW      TWLL     NE            14      6-­  4-­4      28    18  +10          7      3-­2-­2      17      7    +10        7      3-­  2-­2      11    11      =                  TW      WW      LW      TW      LT        WT        LL   KC            14      5-­  6-­3      19    20    -­1          7      4-­2-­1      12      9    +3          7      1-­  4-­2        7    11    -­4                  WL      TW      WL      LT      WL        TW        LL   CLB          14      4-­  9-­1      13    20    -­7          7      3-­3-­1        9      6    +3          7      1-­  6-­0        4    14    -­10                LL      WL      LW      LW      LT        WL        LL   NY            14      4-­  3-­7      19    20    -­1          7      3-­0-­4      13      7    +6          7      1-­  3-­3        6    13    -­7                  WW      TW      WL      TL      TT        LT        TT   DC            14      5-­  5-­4      20    23    -­3          7      5-­1-­1      15      7    +8          7      0-­  4-­3        5    16    -­11                LT      WT      TW      LW      LW        TW        LL   CHI          14      3-­  6-­5        9    17    -­8          7      2-­3-­2        6    11    -­5          7      1-­  3-­3        3      6    -­3                  LT      WW      TL      TT      LT        LW        LL   SJ            13      5-­  3-­5      20    14    +6          7      2-­1-­4      10      5    +5          6      3-­  2-­1      10      9    +1                  WW      TW      TL      WTW                            TLLT   TOR          10      4-­  4-­2      11      8    +3          5      4-­1-­0      11      5    +6          5      0-­  3-­2        0      3    -­3                  LW      TW      LW      WL      TL         SEA            6      2-­  2-­2        6      7    -­1          3      1-­1-­1        4      4    =            3      1-­  1-­1        2      3    -­1                  WL      TT      WL           PHI            4      2-­  0-­2        7      3    +4          2      2-­0-­0        5      1    +4          2      0-­  0-­2        2      2      =                  WT      TW           VAN            2      1-­  1-­0        2      3    -­1          1      1-­0-­0        2      0    +2          1      0-­  1-­0        0      3    -­1                  LW             POR            2      0-­  1-­1        1      2    -­1          1      0-­0-­1        1      1    =            1      0-­  1-­0        0      1    -­1                  TL             TOT.      218    72-­87-­59  278  289  -­11      109    53-­24-­32  178  108  +70    109    19-­63-­27  100  181  -­81  

REAL SALT LAKE ² CONCACAF CHAMPIONS LEAGUE HISTORY                      Last   vs.  Team                  Series      W-­L        GP      W-­L-­T        OT          ShO      GF    GA      Mtg.    Stage                          Series  Result     Arabe  Unido  (PAN)      -­          -­-­-­          2      2-­0-­0                                    5      3      2010    Group         Cruz  Azul  (MEX)          -­          -­-­-­          2      1-­1-­0                                    7      6      2010    Group       Toronto  FC  (CAN)        -­          -­-­-­          2      1-­0-­1                                    5      2      2010    Group       Columbus  Crew  (USA)  1          1-­0          2      1-­0-­1                                    4      1      2011    Quarter                      RSL  advance  4-­1  agg.   Saprissa  (CRC)            1          1-­0          2      1-­1-­0                                    3      2      2011    Semi                            RSL  advance  3-­2  agg.   Monterrey  (MEX)          1          0-­1          2      0-­1-­1                                    2      3      2011    FINAL                          RSL  loses  2-­3  agg.     TOTALS                                                      12      6-­3-­3                                  26    17    

 

 

REAL SALT LAKE ² US OPEN CUP HISTORY                                                          Last   vs.  Team                                                  GP      W-­L-­T        OT          ShO      GF    GA      Mtg.    Round                          Series  Result   Minnesota  Thunder  (USL)                      1      0-­1-­0      0-­1-­0                    4      6      2005    Rd  of  16   Virginia  Beach  (USL)                            1      1-­0-­0      1-­0-­0                    2      1      2006    Rd  of  16   Kansas  City  Wizards                              1      1-­0-­0                                    2      1      2007    Play-­in   Colorado  Rapids                                      2      0-­2-­0                                    1      3      2007    Quarterfinal   Columbus  Crew                                          1      0-­1-­0                                    0      2      2008    Play-­in   Seattle  Sounders  FC                              1      0-­1-­0                                    1      4      2009    Play-­in   San  Jose  Earthquakes                            2      1-­0-­1                      1-­0        7      3      2010    Play-­in   D.C.  United                                              2      0-­1-­0      0-­1-­0                    1      2      2010    Play-­in   Wilmington  (USL)                                    1      1-­0-­0                                    2      0      2011    Rd  of  16         FC  Dallas                                                  1      0-­1-­0                                    0      2      2011    Quarterfinal       TOTALS                                                      12      4-­7-­1      1-­2-­0      1-­0      20    24    

 

 

   

   

YEAR-­BY-­YEAR MLS RECORD                  -­-­-­-­-­-­  OVERALL  -­-­-­-­-­-­-­            -­-­  HOME  GAMES  -­-­            -­-­  ROAD  GAMES  -­-­        Conf.        Supporters   Year          W-­  L-­  T      PTS      GF    GA          W-­  L-­  T        GF    GA          W-­  L-­  T        GF    GA        Finish      Shield              Result   2005          5-­22-­  5        20      30    65          5-­  8-­  3        19    24          0-­14-­  2        11    41        West  5      11th  of  12        DNQ   2006        10-­13-­  9        39      45    49          6-­  4-­  6        23    19          4-­  9-­  3        22    30        West  5        9th  of  12        DNQ   2007          6-­15-­  9        27      31    45          4-­  7-­  4        18    22          2-­  8-­  5        13    23        West  6      12th  of  13        DNQ   2008        10-­10-­10        40      40    39          8-­  1-­  6        24    10          2-­  9-­  4        16    29        West  3        7th  of  14        Semifinals   2009        11-­12-­  7        40      43    35          9-­  1-­  5        34    11          2-­11-­  2          9    24        West  5        8th  of  15        Cup  Champion   2010        15-­  4-­11        56      45    20        11-­  0-­  4        31      7          4-­  4-­  7        14    13        West  2        2nd  of  16        Quarterfinals   2011        15-­11-­  8        53      44    36        10-­  3-­  4        29    15          5-­  8-­  4        15    21        West  3        3rd  of  18        ???       TOT.        72-­87-­59      275    278  289        53-­24-­32      178  108        19-­63-­27      100  181     REAL SALT LAKE ALL-­TIME COACHING HISTORY      -­-­-­  Regular  Season  -­-­-­          -­-­-­-­-­  MLS  Cup  Playoffs  -­-­-­-­-­                -­-­-­-­-­-­-­-­-­  USOC  -­-­-­-­-­-­-­-­-­                  -­-­-­-­-­-­  CCL  -­-­-­-­-­-­   Year    Coach                      W      L      T      PCT      PTS            W      L      T      PCT        OT          ShO              W      L      T        PCT      OT        ShO          W      L      T      PCT    PTS       2005    John  Ellinger      5    22      5    .234        20                                                                                    0      1      0      .000    0-­1-­0   2006    John  Ellinger    10    13      9    .453        39                                                                                    1      1      0      .500    1-­0-­0   2007    John  Ellinger      0      2      2    .250          2                                                                                    1      0      0    1.000                TOTAL                    15    37    16    .338        61                                                                                    2      2      0      .500    1-­1-­0             2007    Jason  Kreis          6    13      7    .365        25                                                                                    0      1      0      .000     2008    Jason  Kreis        10    10    10    .500        40            1      1      1    .500      0-­0-­0      0-­0              1      1      0      .500     2009    Jason  Kreis        11    12      7    .483        40            2      0      2    .750      0-­0-­2      2-­0              0      1      0      .000     2010    Jason  Kreis        15      4    11    .683        56            0      1      1    .250      0-­0-­0      0-­0              0      1      1      .250                  1-­0        4      1      1    .750        13   2011    Jason  Kreis        15    11      8    .559        53                                                                                    1      1      0      .500                                2      2      2    .500          8              TOTAL                    57    50    43    .523      214            3      2      4    .556      0-­0-­2      2-­0              2      5      1      .313                  1-­0        6      3      3    .625        21              ALL-­TIME              72    87    59    .461      275            3      2      4    .556      0-­0-­2      2-­0              4      7      1      .375                                6      3      3    .625        21  

 

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2  

Top 25 All-­Time REAL SALT LAKE Attendances Date     Opponent     Attendance     Aug.  12,  2006     Real  Madrid  (ESP)     45,511*     June  4,  2005     FC  Dallas     40,589     Sept.  20,  2008    Chivas  USA     26,391     May  3,  2008     Los  Angeles  Galaxy   25,571     April  16,  2005    Colorado  Rapids     25,287     Sep.  19,  2007     Los  Angeles  Galaxy   24,633     Oct.  7,  2006     Houston  Dynamo     22,515     Sept.  28,  2011   Chicago  Fire   20,762*   July  4,  2006     Chivas  USA     20,752     July  4,  2007     Toronto  FC     20,751     March  26,  2011   Los  Angeles  Galaxy   20,507*   Oct.  19,  2010     Cruz  Azul  (MEX)     20,463*     Oct.  22,  2011   Portland  Timbers   20,378*   April  27,  2011   Monterrey  (MEX)   20,378*   Oct.  16,  2010     FC  Dallas     20,236*     Oct.  29,  2011   Seattle  Sounders  FC      ???   July  29,  2009     MLS  All-­Star  Game     20,120*     Oct.  9,  2008     New  York  Red  Bulls   20,008*     Nov.  15,  2008     New  York  Red  Bulls   20,008*     Sept.  17,  2011   Sporting  Kansas  City   19,888**   June  6,  2009   Colorado  Rapids   19,546   July  24,  2010   CD  Chivas  USA   19,469**   July  23,  2011   San  Jose  Earthquakes   19,429**   Nov.  6,  2010   FC  Dallas   19,324   Aug.  6,  2011   New  York  Red  Bulls   19,081     *Sellout   6HOORXWZGLPLQLVKHG³FRQFHUWVWDJH´FDSDFLW\  

Notes                   Most  attended  soccer  match  in  Utah  history  sees  RSL  drop  0-­2  decision   Doubleheader  w/  USA  v.  Costa  Rica  WC  Qualifier   Rice-­Eccles  finale  marks  biggest  stand-­DORQHUHJVHDVRQFURZGORQHKRPHORVVRIµ   Beckham  thrills  masses  with  two  goals  to  equalize  in  2-­2  tie  v.  LA   Inaugural  RSL  Home  Game  at  Rice-­Eccles  decided  by  late  Dunseth  heroics     Even  without  Beckham,  teams  entertain  in  thrilling  2-­2  draw   Playoff  hopeVIDGHLQ¶5LFH-­Eccles  finale   Largest  crowd  in  RTS  history  witnesses  worst-­ever  home  defeat  (0-­3  v  Chicago)   ¶([SDQVLRQEUHWKUHQGXHOWRVFRUHOHVV,QGHSHQGHQFH'D\WLH   Canadian  club  makes  first  RES  visit  on  July  4th,  rides  late  PK  to  win  over  RSL   56/H[DFWV¶6XSS6KLHOGUHYHQJHZLWKGRPLQDWLQJSHUIRUPDQFH  in  4-­1  victory   Historic  3-­1  win  makes  RSL  first-­ever  MLS  squad  to  win  CCL  Group   Third  consecutive  sellout  closes  2011  reg.  season  with  1-­1  draw  vs.  expansion  Timbers   Trip  to  FIFA  Club  World  Cup  falls  one  step  short  in  0-­1  loss   2-­0  W  snaps  17-­game  Dallas  unbeaten  run,  extends  RSL  home  dominance     3UHPLHU/HDJXH¶s  Everton  dRZQV0/6¶EHVWLQ3.s  after  1-­1  draw   Massive  crowd  brings  festive  atmosphere  to  stadium-­opening  1-­1  draw   5HG%XOOV¶UHWXUQUXLQV:HVWHUQ&RQI)LQDOLQIURQWRIVHFRQGRTS  sellout   56/GRZQV(DVWOHDGHUZLWK%RUFKHUV¶JDPH-­winner  in  early  2nd  half       Stadium  dedication  by  Elder  Gonzalez  starts  with  David  Archuleta,  ends  with  1-­1  draw   Grabavoy  left-­footed  volley  from  distance  highlights  Pioneer  Day  1-­1  draw   4-­JRDORXWEXUVWIROORZLQJ¶UHGFDUGIRU6-SUHYLHZILUHZRUNVVKRZ   RSL  can  only  muster  a  1-­1  draw  in  must-­win  Playoff  game;;  DAL  advances   Dominant  3-­ZLQRYHU³1<'3V´VQDSV-­game  losing  streak  

Largest REAL SALT LAKE Crowds at Rio Tinto Stadium (opened October 2008) Date     Opponent     Attendance     Sept.  28,  2011   Chicago  Fire   20,762*   March  26,  2011   Los  Angeles  Galaxy   20,507*   Oct.  19,  2010     Cruz  Azul  (MEX)     20,463*     Oct.  22,  2011   Portland  Timbers   20,378*   April  27,  2011   Monterrey  (MEX)   20,378*   Oct.  16,  2010     FC  Dallas     20,236*     Oct.  29,  2011   Seattle  Sounders  FC      ???   July  29,  2009     MLS  All-­Star  Game     20,120*     Oct.  9,  2008     New  York  Red  Bulls   20,008*     Nov.  15,  2008     New  York  Red  Bulls   20,008*     Sept.  17,  2011   Sporting  Kansas  City   19,888**   May  16,  2009   Kansas  City  Wizards   19,340**   June  6,  2009   Colorado  Rapids   19,546**   July  24,  2010   CD  Chivas  USA   19,469**   July  23,  2011   San  Jose  Earthquakes   19,429**   Nov.  6,  2010   FC  Dallas   19,324   Aug.  6,  2011   New  York  Red  Bulls   19,081     *Sellout   6HOORXWZGLPLQLVKHG³FRQFHUWVWDJH´FDSDFLW\      

 

Notes                   Largest  crowd  in  RTS  history  witnesses  worst-­ever  home  defeat  (0-­3  v  Chicago)   RSL  cruises  to  2  goals  in  first  10  minutes  against  star-­studded  rival   CCL  Group  Stage  finale  sees  RSL  youngsters  win  3-­1  over  Mex.  power   Record-­breaking  third  consecutive  sellout  in  2011  reg.  season  finale   Trip  to  FIFA  Club  World  Cup  falls  one  step  short  in  0-­1  loss   2-­0  W  snaps  17-­game  Dallas  unbeaten  run,  extends  RSL  home  dominance   3UHPLHU/HDJXH¶V(YHUWRQGRZQV0/6¶EHVWLQ3.s  after  1-­1  draw   Massive  crowd  brings  festive  atmosphere  to  stadium-­opening  1-­1  draw   5HG%XOOV¶UHWXUQUXLQV:HVWHUQ&RQI)LQDOLQIURQWRIVHFRQGVHOORXW   56/GRZQV(DVWOHDGHUZLWK%RUFKHUV¶JDPH-­winner  early  2nd  half   0-­2  loss  last  prior  to  record  home  unbeaten  run   Stadium  dedication  with  Elder  Gonzalez  starts  with  David  Archuleta,  ends  with  1-­1  draw   Grabavoy  left-­footed  volley  from  distance  highlights  Pioneer  Day  1-­1  draw   4-­JRDORXWEXUVWIROORZLQJ¶UHGFDUGIRU6-SUHYLHZILUHZRUNVVKRZ   RSL  can  only  muster  a  draw  in  must-­win  Playoff  game   Dominant  3-­0  win  over  ³1<'3V´VQDSV-­game  losing  streak  

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

ALL-­TIME REAL SALT LAKE ATTENDANCE REGULAR SEASON            OVERALL        -­-­-­-­-­-­  AT  HOME  -­-­-­-­-­-­-­    -­-­-­-­  ON  THE  ROAD  -­-­-­-­-­      HOME              RECORD          GAMES      TOTAL    AVERAGE    GAMES      TOTAL    AVERAGE      RANK      LARGEST  HOME  CROWD       2005      5-­22-­  5          16      288,586    18,037        16      207,985    12,999        2d        40,589  (  6/04/05,  0-­2  L  vs.  DAL)   2006    10-­13-­  9          16      261,855    16,366        16      246,209    15,388        5th      22,515  (10/07/06,  1-­1  T  vs.  HOU)   2007      6-­15-­  9          15      239,395    15,960        15      236,047    15,736        7th      24,633  (  9/19/07,  2-­2  T  vs.  LA)   2008    10-­10-­10          15      242,690    16,179        15      231,367    15,424        7th      26,391  (  9/20/08,  0-­1  L  vs.  CHV)   2009    11-­12-­  7          15      245,628    16,375        15      217,799    14,520        5th      19,546  (  6/06/09,  1-­1  T  vs.  COL)   2010    15-­  4-­11          15      256,427    17,095        15      262,410    17,494        7th      20,236  (10/16/10,  2-­0  W  vs.  DAL)   2011    15-­11-­  8          17      299,047    17,591        17      292,465    17,204      10th      20,762  (  9/28/11,  0-­3  L  vs.  CHI)   TOT.    72-­87-­59        109  1,833,628    16,822      109  1,694,282    15,544        

PLAYOFFS            OVERALL        -­-­-­-­-­-­  AT  HOME  -­-­-­-­-­-­-­    -­-­-­-­  ON  THE  ROAD  -­-­-­-­-­      HOME              RECORD          GAMES      TOTAL    AVERAGE    GAMES      TOTAL    AVERAGE      RANK      LARGEST  HOME  CROWD       2008      1-­  1-­  1            2        34,727    17,364          1        19,265    19,265        3d        20,008  (11/15/08,  0-­1  L  vs.  NY)   2009      2-­  0-­  2            1        11,499    11,499          2        31,832    15,916        6th      11,499  (10/31/09,  1-­0  W  vs.  CLB)   2010      0-­  1-­  1            1        19,324    19,324          1        11,003    11,003        4th      19,324  (11/06/10,  1-­1  T  vs.  DAL)   2011                           TOT.      3-­  2-­  4            4        65,550    16,388          4        62,100    15,525    

CONCACAF CHAMPIONS LEAGUE            OVERALL        -­-­-­-­-­-­  AT  HOME  -­-­-­-­-­-­-­    -­-­-­-­  ON  THE  ROAD  -­-­-­-­-­      HOME             ��RECORD          GAMES      TOTAL    AVERAGE    GAMES      TOTAL    AVERAGE      RANK      LARGEST  HOME  CROWD       2010      4-­  1-­  1            3        42,668    14,223          3        14,481      4,827                      20,463  (10/19/10,  3-­1  W  vs.  CAZ)   2011      2-­  2-­  2            3        52,671    17,557          3        59,665    19,888                      20,378  (  4/27/11,  0-­1  L  vs.  MTY)   TOT.      6-­  3-­  3            6        95,339    15,890          6        74,146    12,358    

LAMAR HUNT U.S. OPEN CUP            OVERALL        -­-­-­-­-­-­  AT  HOME  -­-­-­-­-­-­-­    -­-­-­-­  ON  THE  ROAD  -­-­-­-­-­      HOME              RECORD          GAMES      TOTAL    AVERAGE    GAMES      TOTAL    AVERAGE      RANK      LARGEST  HOME  CROWD       2005      0-­  0-­  1                                                          1           2006      1-­  1-­  0            2        11,406      5,703                                                                      6,960  (  7/11/06,  2-­1  W  vs.  VB)   2007      1-­  0-­  1            1*        8,147      8,147        1            1,572      1,572                      8,147  (  4/18/07,  2-­1  W  vs.  KC)   2008      1-­  1-­  0            1        10,761    10,761        1            4,816      4,816                    10,761  (  4/30/08,  4-­0  W  vs.  SJ)   2009      0-­  1-­  0                                                          1            3,890      3,890                       2010      0-­  1-­  1                                                          2            5,792      2,896     2011      1-­  1-­  0            1          7,620      7,620        1            3,189      3,189                      7,620  (  6/28/09,  2-­0  W  vs.  WIL)   TOT.      4-­  5-­  3            5        37,934      7,587        7          19,259      2,751    

EXHIBITION            OVERALL        -­-­-­-­-­-­  AT  HOME  -­-­-­-­-­-­-­    -­-­-­-­  ON  THE  ROAD  -­-­-­-­-­      HOME              RECORD          GAMES      TOTAL    AVERAGE    GAMES      TOTAL    AVERAGE      RANK      LARGEST  HOME  CROWD       2005      2-­  0-­  1            3        24,391      8,130                                                                      8,044  (  6/08/05,  3-­2  W  vs.  CAT)   2006      0-­  2-­  0            2        56,226    28,113                                                                    45,511  (  8/12/06,  0-­2  L  vs.  RM)   2007      3-­  0-­  1            4*      47,865    11,966                                                                    16,378  (  7/24/07,  1-­1  T  vs.  BOC)   2008      1-­  2-­  0            3        34,863    11,621                                                                    12,333  (  7/09/08,  1-­4  L  vs.  SAN)   2009      1-­  0-­  1            2        33,858    16,929                                                                    17,212  (  7/11/09,  1-­0  W  vs.  AME)   TOT.      7-­  4-­  3          13      197,203    15,169            

ALL-­TIME RSL ATTENDANCE (by  competition)                              OVERALL        -­-­-­-­-­-­  AT  HOME  -­-­-­-­-­-­-­                -­-­-­-­  ON  THE  ROAD  -­-­-­-­-­        HOME                                  RECORD      GAMES          TOTAL      AVERAGE          GAMES        TOTAL      AVERAGE      RANK      LARGEST  HOME  CROWD   REG.  SEASON      72-­87-­59        109        1,833,628    16,822            109      1,694,282    15,544                      40,589  (  6/04/05,  0-­2  L  v.  DAL)   PLAYOFFS              3-­  2-­  4            4              65,550    16,388                4            62,100    15,525                      20,008  (11/15/08,  0-­1  L  v.  NY)   CONCACAF              6-­  3-­  3            6              95,339    15,890                6            74,146    12,358                      20,463  (10/19/10,  3-­1  W  v.  CAZ)   US  OPEN  CUP        4-­  5-­  3            5              37,934      7,587                7            19,259      2,751                      10,761  (  4/30/08,  4-­0  W  v.  SJ)   EXHIBITION          7-­  4-­  3          14            197,203    14,086                                                                                45,511  (  8/12/06,  0-­2  L  v.  RM)                              92-­101-­72      137*      2,229,114    16,276            126      1,849,787    14,681    

ALL-­TIME RSL ATTENDANCE (by  year)            OVERALL        -­-­-­-­-­-­  AT  HOME  -­-­-­-­-­-­-­    -­-­-­-­  ON  THE  ROAD  -­-­-­-­-­      HOME              RECORD          GAMES      TOTAL    AVERAGE    GAMES      TOTAL    AVERAGE      RANK      LARGEST  HOME  CROWD       2005      7-­22-­  6        19        312,977    16,472        16      207,985    12,999        2d        40,589  (  6/04/05,  0-­2  L  vs.  DAL)   2006    11-­16-­  9        20        329,487    16,474        16      246,209    15,388        5th      22,515  (10/07/06,  1-­1  T  vs.  HOU)   2007    10-­15-­11        20*      295,407    14,770        15      236,047    15,736        7th      24,633  (  9/19/07,  2-­2  T  vs.  LA)   2008    13-­14-­11        21        323,041    15,383        15      231,367    15,424        7th      26,391  (  9/20/08,  0-­1  L  vs.  CHV)   2009    14-­12-­10        18        290,985    16,166        15      217,799    14,520        5th      19,546  (  6/06/09,  1-­1  T  vs.  COL)   2010    19-­  6-­13        19        318,419    16,759        15      262,410    17,494        7th      20,236  (10/16/10,  2-­0  W  vs.  DAL)   2011    18-­13-­11        21        359,238    17,107        17      292,465    17,204      10th      20,762  (  9/28/11,  0-­3  L  vs.  CHI)            92-­101-­72      137*  2,229,114    16,276      126  1,849,787    14,681     *includes  2007  Open  Cup  /  Exhibition  doubleheader  vs  KC  /  Fiji  (att.  8,147)      

 

 

ET 2 PM SN 0 1 ,T 7, Kick 2 t t Oc irec D

Columbus Crew

Colorado Rapids

WILD CARD MATCH

e

1st

2nd

2nd

D ET 2 TB N2 PM SN e im TS 10 r, T , T N2, 9, cce 2 2 t o v P Oc X S No ES FO

Real Salt Lake

Seattle Sounders

1st

D ET 2 TB N2 PM SN m , TS i 1 1 ,T ,T 2 3, N2 30 SPN v P t Oc /E No ES N P ES

WC*

LA Galaxy

WESTERN CONFERENCE SEMIFINALS

9 PM ET NOVEMBER 20 ESPN / GALAVISION / TSN2

Nov. 6, Time TBD

EASTERN CONFERENCE CHAMPIONSHIP

WILD CARD SEEDS: 1. DAL 2. COL 3. CLB 4. NY

*Lower-seeded Wild Card (WC) winner faces the LA Galaxy in the Conference Semifinals; other Wild Card winner faces Sporting KC.

Nov. 6, Time TBD

WESTERN CONFERENCE CHAMPIONSHIP

BRACKET

2nd

WC*

Sporting Kansas City

Philadelphia Union

2nd Houston Dynamo

N O ES ov 3 ES ct 3 PN ,, PN 0, 2, 8:30 2 Tim TS P N2 M e TB ET D

1st

N O FO ov 3 ES ct 2 PN 9/ X ,1 So 1 /E 30 cc PM SP , T er ET N2 im ,T eT B SN D 2

1st

EASTERN CONFERENCE SEMIFINALS

O FO c t 2 X 6, So 9 cc PM er , T ET SN 2

New York Red Bulls

FC Dallas

WILD CARD MATCH

WESTERN CONFERENCE SEMIFINALS - 1L REAL SALT LAKE v SEATTLE SOUNDERS FC Sat., Oct. 29, Rio Tinto Stadium (8 p.m. MT; FOX Soccer; TSN2) 18

LEAGUE HEAD-TO-HEAD: RSL 2 wins, 5 GF … SEA 2 wins, 6 GF … Ties 2

Rimando

3 Russell

4

6

Olave

Borchers

17 Wingert

5 77

Beckerman

8

2011 HEAD-TO-HEAD: SEA 1 win, 3 GF … RSL 1 win, 3 GF … Ties 0 AT RIO TINTO STADIUM: 5/28: RSL 1, SEA 2 (Gonzalez 87 - Ianni 72; Neagle 84) MLS CUP PLAYOFFS: first meeting

Real Salt Lake come into the postseason not having won since Sept. 21, a 3-1 win against New York. “We got to win one soon, Morales eventually, so I guess the best time to do it is in the playoffs. For the most part, these past two weeks we’ve been playing our butts off," said 7 15 defender Chris Wingert. ... The six-game winless run followed a five-game Espindola Saborio winning streak, which included a 2-1 win at Seattle. “I don’t think we’ve played a good [full game] of soccer in quite a while,” defender Nat Borchers 17 2 said. “I think we put together about 93 minutes against Portland and then we Montero Fucito obviously gave that goal at the end. So I think really getting a full game in, being switched on and focused throughout is really crucial. In the playoffs, 24 15 one goal can hurt you, so we’re going to have to be prepared for anything 3 Levesque Fernandez that can happen.” ... A key to the RSL scheme will be the renewed partnerEvans ship of Kyle Beckerman and Javier Morales in the center of midfield. Since 6 Morales suffered a broken ankle in April, the pair have not played together. Morales has started the last four matches, but Beckerman has been susAlonso 7 12 pended. “In a lot of ways up until the suspension Kyle was our most consisRiley Gonzalez 34 31 tent performer this year, and was in talks for MVP consideration and I think Hurtado Parke he deserved that," said RSL head coach Jason Kreis. "He had taken a lot of 18 the burden of not having Javier on his own shoulders, and had stepped up Keller his game in how he was creating for us, and his play on dead-ball situations.” ... Will Johnson also returned to the lineup for the season finale after missing two games to a sprained ankle. “It was up and down for sure, REFEREE: Mark Geiger. with injuries and call-ups. We had our great streak, our worst streak, and I SAR (bench): Joe Fletcher; JAR (opposite): Steven Taylor; think right now we are almost where we want to be," said goalkeeper Nick 4th: Silviu Petrescu Rimando. "We’re getting some great players back just in time for the playoffs and all these streaks go away once you start the playoffs.” ... Kreis might INJURY REPORT: REAL SALT LAKE -- OUT: MF Nelson González (R foot fracture); DOUBTFUL: FW Cody Arnoux (L hamstring strain); also be able to call upon midfielder Ned Grabavoy and fullback Tony Beltran, who returned to full training ahead of the Portland game but did not figure. QUESTIONABLE: DF Tony Beltran (L adductor strain); MF Ned Williams

11

Johnson

Grabavoy (L adductor strain); PROBABLE: GK Kyle Reynish (R ankle bone spur) ... SEATTLE SOUNDERS FC -- OUT: GK Terry Boss (concussion); MF Michael Seamon (lateral ankle tendon); MF Steve Zakuani (R leg fracture); FW O’Brian White (leg surgery); DOUBTFUL: GK Josh Ford (knee pain); QUESTIONABLE: MF Mauro Rosales (MCL sprain); PROBABLE: MF Amadou Sanyang (knee sprain) SUSPENDED: none WARNINGS: none

1 2 10 12 13 14 19 20 21 22 23 24 25 26 27 28 30

REAL SALT LAKE

SEATTLE SOUNDERS FC

SUBSTITUTES FROM Melia GK Beltran DF A. Alvarez MF Alexandre MF Agorsor FW Y. Alvarez MF Wagner DF Grabavoy MF Gil MF Gonzalez MF Paulo Jr. FW Reynish GK Toia FW Warner MF Arnoux FW Schuler DF McKenzie DF

4 5 8 10 14 16 19 20 21 23 25 26 27 29 30 32 35

SUBSTITUTES FROM Ianni DF Wahl DF Friberg MF Rosales MF Tetteh DF Estrada MF Ochoa FW Scott DF Jaqua FW Carrasco MF Noonan FW Graham DF Neagle MF Ford GK Sanyang MF Montano MF Meredith GK

After suffering a knee injury in the season finale at Chivas USA, midfielder Mauro Rosales is not likely to be available for the first leg. “We have to let it calm down and then we can see how it proceeds from there,” said Sounders FC head coach Sigi Schmid. “For this weekend, it’s probably iffy. For [the second leg on Nov. 2 in Seattle], we’ll see.” ... The likely candidate to fill the position is Lamar Neagle, who started five of the last nine league games. “You can’t really replace Rosales, but I can just do the same thing I have been doing all year with my work ethic,” Neagle said. “I think that’s the main thing I bring to the game. I’m not as technically sound as Rosales, obviously, but just working as hard as I can. I feel like I have some speed, so hopefully I’ll be able to get in behind them and serve some good balls in and cause some trouble.” ... Schmid could also have a choice to make in attack. Mike Fucito started the last three games, and seven of the last nine. But Sammy Ochoa has scored coming off the bench in each of the last two games. “I thought Sammy played well. He’s been a good pickup for us; he knows how to play the game and he does a good job holding the ball up for us as well," Schmid said. "He’s courageous. He had to stick his head in there for the third goal, and he’s willing to do that kind of thing. He’s definitely been a very good addition to our team.” ... Since the middle of June, Sounders FC have not gone consecutive league games without a victory. "Everything goes out the window now. It doesn’t matter what we did today, three months ago or at the beginning of the season," said goalkeeper Kasey Keller. "It’s just two games now, and we have to come out and play the way we’re capable of playing and we’ll be all right.” ... In four games in the MLS Cup Playoffs all-time, Seattle has scored one goal -- from Steve Zakuani in a 2-1 loss to LA in the Western semifinal second leg last year. "We’ve told our team that if we play to zero we’ll find a way to score. We’ve shown that capability all year," said Schmid.

REAL SALT LAKE 2011 RECORD Real

GP 34

WHERE THE GOALS COME FROM W-L-T 15-11-8

PTS 53

GF 44

GA 36

RECORD at RIO TINTO STADIUM GP 17

W-L-T 10-3-4

PTS 34

GF 29

GA 15

PTS 19

GF 15

GA 21

RECORD on road GP 17

W-L-T 5-8-4

RECORD at the half W 8 7 0

LEADING TIED TRAILING

L 3 2 6

T 2 4 2

RECORD with the first goal W 15 0

SCORING CONCEDING

L 3 8

T 2 2

GOALS SCORED MINUTES PER GOAL

0 10

1 12

2 6

3 4

4+ 2

0 14

1 10

2 5

3 4

TOT AVG 44 1.29

18 6 9 1 5 1 3 1

16 6 2 1 5 2 3 1

12 26 6

7 20 9

15

7 Espindola 27/25; 10G/3A

11 4+ 1

TOT AVG 36 1.06

Morales 10/9; 2G/3A

8 Johnson 25/22; 2G/1A

GOALS BY INTERVALS TOT FOR 44 AGAINST 36

21 10 5 0

Saborio 23/22; 11G/2A

GOALS ALLOWED IN GAME GP 34

20 14 9 1

PRIMARY TEAM

AGAINST 1.06 (2nd) 11.03 (16th) 4.00 (13th) 36.3% (16th) 9.6% (14th) 12.08 (9th) 4.32 (12th) 1.94 (15th)

GOALS SCORED IN GAME GP 34

AGAINST 36 85

HOW SCORED RIGHT FOOT LEFT FOOT HEADERS OTHER TYPE OF PLAY OPEN PLAY CROSS CORNER REBOUND PENALTIES DIRECT FROM FREE KICK FREE KICK (INDIRECT) OWN GOALS DISTANCE INSIDE GOAL AREA INSIDE PENALTY AREA OUTSIDE PENALTY AREA

TEAM COMPARISONS FOR GOALS SCORED 1.29 (7th) TOTAL SHOTS 12.61 (9th) SHOTS ON GOAL 4.50 (3rd) SHOOTING ACCURACY 35.7% (6th) SCORING %AGE 10.3% (7th) FOULS 13.03 (3rd) CORNER KICKS 4.85 (4th) OFFSIDE 3.38 (4th)

FOR 44 70

77 Williams 31/20; 2G/1A

5

0-15 16-30 31-45+ 46-60 61-75 76-90+ 8 6 8 8 4 10 5 7 5 3 7 9

Beckerman 29/27; 3G/9A

17 Wingert 23/22; 0G/1A

6

4

Borchers 30/30; 3G/1A

Olave 24/24; 2G/1A

18 Rimando 33/33; 1.09/13SO 106

3 Russell 26/22; 0G/2A

REAL SALT LAKE 2011 No. Player Pos Ht Wt Birthdate Birthplace GP GS G 1 Tim Melia GK 6-1 195 05/15/1986 Great River, NY 0 0 0 In second season on RSL books. Has spent last four years on loan to NASL and USL First Division sides. 2 Tony Beltran DF 5-8 150 10/11/1987 Claremont, CA 22 19 0 First-round selection (No. 3 overall) in 2008 SuperDraft out of UCLA. 3 Robbie Russell DF 6-2 200 07/16/1979 Accra, Ghana 26 22 0 In fourth MLS season. Also played in Denmark, Norway and Iceland from 2000-08. 4 Jamison Olave DF 6-3 210 04/21/1981 Medellin, Colombia 24 24 2 2010 MLS Defender of the Year and Best XI honoree. In fourth MLS season; last with Deportivo Cali in Colombia. 5 Kyle Beckerman MF 5-11 165 04/23/1982 Crofton, MD 29 27 3 In his 12th MLS season, his fifth with Real. U.S. international. Also played with Colorado and Miami. 6 Nat Borchers DF 6-2 175 04/13/1981 Tucson, AZ 30 30 3 Returned to MLS from Odd Grenland in Norway for 2008 season. Spent three years with Colorado. In 2010 MLS Best XI. 7 Fabian Espindola FW 5-9 160 05/04/1985 Buenos Aires, Argentina 27 25 10 In fifth MLS season. Has also played with Boca Juniors and Talleres de Cordoba in Argentina, and Quito and Aucas in Ecuador. 8 Will Johnson MF 5-10 155 01/21/1987 Toronto, Ontario, Canada 25 22 2 Canadian International who returned to MLS in 2008 after a year in England and two in Holland. 10 Arturo Alvarez MF 5-9 170 06/28/1985 Houston, TX 16 8 0 Acquired before start of season. In ninth MLS season, also with San Jose and Dallas. El Salvador international. 11 Javier Morales MF 5-9 165 01/10/1980 Buenos Aires, Argentina 10 9 2 Named to 2010 MLS Best XI. Missed four months with a fractured ankle. In fifth MLS season after a decade in Argentina. 12 Jean Alexandre MF 5-11 185 08/24/1986 Verrettes, Haiti 19 9 1 Haitian international. Selected in first round of 2009 SuperDraft (No. 12 overall) out of Lynn University in Florida. 13 Chris Agorsor FW 5-9 145 01/09/1990 Severn, MD 1 0 0 Acquired in June after his release by Philadelphia. U.S. youth international. Played two seasons at Univ. of Virginia. 14 Yordany Alvarez MF 5-10 165 05/24/1985 Cienfuegos, Cuba 5 4 0 Left Cuban U-23 national team in 2008. Signed on loan from USL PRO Orlando City in September. 15 Alvaro Saborio FW 6-0 170 03/25/1982 San Carlos, Costa Rica 23 22 11 Costa Rican international in his second MLS season. Played in Switzerland and England as well as his homeland. 17 Chris Wingert DF 5-10 170 06/16/1982 Babylon, NY 23 22 0 In eighth MLS season, fourth with RSL. Won MAC Hermann Trophy at St. John's. Made U.S. debut in 2009. 18 Nick Rimando GK 5-9 184 06/17/1979 Montclair, CA 33 33 0 Set MLS record with 0.67 GAA in 2010. In 12th MLS season, also having played for Miami and D.C. United. 19 Blake Wagner DF 5-10 165 01/29/1988 Atlanta, GA 11 10 0 Signed as June after his release by Vancouver Whitecaps FC. Played four seasons with FC Dallas. 20 Ned Grabavoy MF 5-7 150 07/01/1983 Joliet, IL 25 21 0 In eighth MLS season, his third with Real. Also played with LA Galaxy, Columbus and San Jose. 21 Luis Gil MF 5-8 150 11/14/1993 Garden Grove, CA 25 14 2 Acquired from Kansas City Wizards in trade prior to 2010 season. U.S. youth international. 22 Nelson Gonzalez MF 5-6 154 09/22/1988 Buenos Aires, Argentina 6 2 1 In third MLS season, after he was acquired on loan from Argentina's Quilmes AC. 23 Paulo Araujo Jr. FW 5-7 158 01/23/1989 Teresina, Brazil 11 5 2 Acquired on loan late in 2010 season from USSF D-2 outfit Miami FC. Began pro career in 2008 in Brazil. 24 Kyle Reynish GK 6-3 193 11/03/1983 Valencia, CA 1 1 0 In fifth MLS season. Fourth-round selection in 2007 Supplemental Draft out of California-Santa Barbara. 25 Donny Toia FW 5-8 155 05/28/1992 Tucson, AZ 0 0 0 Signed as club's first Home Grown Player in May. Product of RSL Arizona scheme. 26 Collen Warner MF 5-10 170 06/24/1988 Denver, CO 24 15 0 First-round selection (No. 15 overall) in 2009 SuperDraft out of University of Portland. 27 Cody Arnoux FW 5-10 170 04/13/1988 Stony Brook, NY 2 0 0 Acquired by RSL through special lottery. Spent 2010 with USSF D-2 Vancouver, and one season with Everton. 28 Chris Schuler DF 6-4 185 09/09/1987 St. Louis, MO 20 16 2 Third-round selection in 2009 SuperDraft out of Creighton University. 30 Rauwshan McKenzie DF 6-1 185 11/19/1986 Hartford, CT 2 2 0 Signed by RSL prior to start of 2010 season. Fourth-round SuperDraft selection in 2008 out of Michigan State. 77 Andy Williams MF 5-8 171 09/23/1977 Toronto, Ontario, Canada 31 20 2 In his 13th MLS season. Lone "RSL Original" remaining. Sixth all-time in MLS games played. Former Jamaican international. HEAD COACH : Jason Kreis

12/29/1972

A 0

CAREER GP GS G 0 0 0

A 0

1

78

67

0

3

2

78

68

1

9

1

99

98

10

1

9

269 241

24

33

1

202 201

8

4

3

95

77

26

10

1

94

82

7

5

1

182 109

24

19

3

98

92

17

34

2

38

14

1

2

0

1

0

0

0

0

5

4

0

0

2

50

45

23

6

1

187 156

1

11

0

288 288

0

6

0

51

42

0

0

0

162 117

8

17

0

25

14

2

0

1

18

5

2

2

4

14

5

2

4

0

5

4

0

0

0

0

0

0

0

5

37

19

0

5

0

2

0

0

0

0

21

17

2

0

0

11

9

0

0

30

86

1

332 231

W57 L50 T42

107

REAL SALT LAKE  REAL SALT LAKE PLAYOFF HISTORY vs. Team Chicago Chivas USA Columbus FC Dallas Los Angeles New York TOTALS

No. of Series 1 1 1 1 1 1 6

Series W-L 1-0 1-0 1-0 0-1 1-0 0-1 4-2

GP 1 2 2 2 1 1 9

W-L-T 1-0-0 1-0-1 2-0-0 0-1-1 1-0-0 0-1-0 5-2-2

OT 1-0-0 0-0-0 0-0-0 0-0-0 1-0-0 0-0-0 2-0-0

ShO 1-0 0-0 0-0 0-0 1-0 0-0 2-0

GF 0 3 4 2 1 0 10

GA 0 2 2 3 1 1 9

Last Mtg. 2009 2008 2009 2010 2009 2008

Round Semifinals Quarterfinals Quarterfinals Quarterfinals MLS Cup '09 Semifinals

Series Result Won 1 games to 0 Won 1 games to 0 Won 2 games to 0 Lost 1 games to 0 Won MLS Cup '09 Lost 1 games to 0

REAL SALT LAKE - ALL-TIME POSTSEASON RESULTS DATE 11/01/2008 11/08/2008 11/15/2008

OPPONENT Chivas USA at Chivas USA New York

RESULT W 1-0 T 2-2 L 0-1

ATT. 14,719 19,265 20,008

W-L-T 1-0-0 1-0-1 1-1-1

RD. QTR QTR SEM

GOALS: RSL: Movsisyan (90) RSL: Kovalenko (39) Morales (77); CHV: Kljestan (30) Braun (83) NY: van den Bergh (28)

10/31/2009 11/05/2009

Columbus at Columbus

W 1-0 W 3-2

11,499 10,109

1-0-0 2-0-0

11/14/2009 11/22/2009

at Chicago at Los Angeles

W 0-0 (OT) W 1-1 (OT)

21,723 46,011

3-0-0 4-0-0

QTR RSL: Findley (88) QTR RSL: Morales (37) Findley (45) Williams (74); CLB: Barros Schelotto (19,35) SEM FIN RSL: Findley (64); LA: Magee (41)

10/30/2010 11/06/2010

at FC Dallas FC Dallas

L 1-2 T 1-1

11,003 19,324

0-1-0 0-1-1

QTR RSL: Espindola (5); DAL: Cunningham (44) Avila (88) QTR RSL: Findley (79); DAL: McCarty (17)

108

REAL SALT LAKE  CAREER POSTSEASON STATISTICS FOR CURRENT REAL SALT LAKE PLAYERS UNF 12 10 23 5 2 6 7 20 8 11 4 3 15 26 77 17

POS M M F M D D F M M M D D F M M D

PLAYER Jean Alexandre Arturo Alvarez Paulo Araujo Jr. Kyle Beckerman Tony Beltran Nat Borchers Fabian Espindola Ned Grabavoy Will Johnson Javier Morales Jamison Olave Robbie Russell Alvaro Saborio Collen Warner Andy Williams Chris Wingert

UNF POS GOALKEEPER 18 GK Nick Rimando

GP 2 5 1 19 2 13 8 8 9 8 9 9 2 1 20 13

GS 0 2 0 19 2 13 4 6 8 8 9 7 2 0 16 12

MIN 18 206 17 1784 169 1230 394 537 727 635 846 693 133 34 1345 1186

G 0 0 0 0 0 1 1 1 0 2 0 0 0 0 2 0

GP 21

GS MIN SHTS 21 1939 37

A 0 1 0 4 0 2 0 0 0 3 0 2 0 0 9 0

SHT 0 4 0 30 1 10 9 10 11 12 5 4 1 0 31 7

SV 84

SOG PKG PKA SKG SKA 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 0 0 2 3 0 0 0 0 0 3 0 0 0 0 4 0 0 0 1 4 0 0 2 2 3 0 0 1 1 3 0 0 0 1 1 0 0 0 0 2 0 0 1 1 1 0 0 0 0 0 0 0 0 0 14 0 0 0 2 1 0 0 1 1

GA GAA PKG PKA 27 1.25 4 4

109

FC 0 2 0 29 0 13 10 6 7 20 13 10 1 0 24 18

SKG SKA 11 20

FS OFF 0 0 2 2 0 0 20 1 3 0 6 0 6 8 10 0 10 1 14 0 11 2 6 0 1 1 1 0 40 5 7 0

W 9

L 6

CK 0 1 0 15 0 0 0 0 5 15 0 0 0 0 47 1

T 6

SO 8

C 0 0 0 7 0 2 0 1 2 2 2 0 0 0 4 2

E 0 1 0 0 0 0 0 0 0 1 0 0 0 0 0 0

REAL SALT LAKE  ALL-TIME REAL SALT LAKE POSTSEASON STATISTICS (3-2-4, 13 PTS.) PLAYER Robbie Findley Javier Morales Andy Williams Yura Movsisyan Fabian Espindola Dema Kovalenko Robbie Russell Kyle Beckerman Nat Borchers Jean Alexandre Paulo Araujo Jr. Tony Beltran Kenny Deuchar Ned Grabavoy Will Johnson Ian Joy Clint Mathis Jamison Olave Nick Rimando Alvaro Saborio Collen Warner Chris Wingert Team totals Opponent totals

GP 9 8 9 7 8 2 9 9 9 2 1 2 1 4 9 1 7 9 9 2 1 8 9 9

GS 4 8 7 5 4 2 7 9 9 0 0 2 0 2 8 1 3 9 9 2 0 8 9 9

MIN 539 635 622 457 394 149 693 870 870 18 17 169 1 239 727 63 423 846 870 133 34 780 870 870

G 4 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 9

A 2 3 2 1 0 0 2 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 12 7

REAL SALT LAKE INDIVIDUAL GOALKEEPING GOALKEEPER GP GS SV Nick Rimando 9 9 31 Team totals 9 9 31 Opponent totals 9 9 40

GA 9 9 10

GAA 0.93 0.93 1.03

SO 3 3 2

110

REAL SALT LAKE  REAL SALT LAKE INDIVIDUAL HIGH GAMES (2011)

TEAM HIGH GAMES (2011)

TEAM LOW GAMES (2011)

Goals 2 Javier 2 Alvaro 2 Alvaro 2 Fabian

Goals 4 03/26/2011 4 07/23/2011

Shots 4 10/14/2011

at

COL

T 0-0

Shots on Goal 1 05/14/2011 1 06/11/2011 1 10/14/2011

vs. HOU at PHI at COL

T 0-0 T 1-1 T 0-0

Morales Saborio Saborio Espindola

03/26/2011 06/25/2011 07/23/2011 09/21/2011

vs. vs. vs. at

LA TOR SJ NY

Assists 2 Collen Warner 2 Kyle Beckerman 2 Robbie Russell 2 Kyle Beckerman

04/09/2011 06/25/2011 06/25/2011 08/06/2011

at vs. vs. vs.

Shots 7 Andy Williams 7 Alvaro Saborio

07/04/2011 07/23/2011

vs. NE vs. SJ

Shots on Goal 4 Andy Williams 4 Alvaro Saborio 4 Fabian Espindola Fouls Committed 6 Yordany Alvarez 6 Yordany Alvarez

07/04/2011 07/23/2011 09/03/2011

10/01/2011 10/22/2011

NE TOR TOR NY

vs. NE vs. SJ vs. PHI

at LA vs. POR

W W W W

W W W W

4-1 3-1 4-0 3-1

2-0 3-1 3-1 3-0

T 3-3 W 4-0

T 3-3 W 4-0 W 2-1

L 1-2 T 1-1

Fouls Suffered 5 5 times Offside 7 Alvaro Saborio Saves 8 Nick Rimando Shots Faced 9 Nick Rimando Goals Allowed 4 Nick Rimando

Assists 4 03/26/2011 4 06/25/2011

03/19/2011

08/20/2011

09/24/2011

vs. CHV

at

at

at

SJ

HOU

DC

W 1-0

W 1-0

L 2-3

vs. LA vs. TOR

W 4-1 W 4-0

W 4-1 W 3-1

Shots 24 06/04/2011 24 07/23/2011

vs. VAN vs. SJ

W 2-0 W 4-0

Fouls Committed 7 05/07/2011 vs. CHV 7 05/28/2011 vs. SEA

W 1-0 L 1-2

Shots on Goal 13 07/23/2011

vs. SJ

W 4-0

Fouls Suffered 5 08/20/2011 at

HOU

L 2-3

Corner Kicks 1 10/14/2011 1 10/22/2011

at COL vs. POR

T 0-0 T 1-1

Offside 0 07/04/2011 0 09/03/2011 0 09/24/2011

vs. NE vs. PHI at DC

T 3-3 W 2-1 L 1-4

Saves 0 06/25/2011 0 07/04/2011

vs. TOR vs. NE

W 3-1 T 3-3

Shots Faced 1 05/07/2011 1 06/25/2011 1 07/23/2011 1 08/06/2011

vs. vs. vs. vs.

W W W W

Fouls Committed 24 10/01/2011 at 24 10/14/2011 at

LA COL

L 1-2 T 0-0

Fouls Suffered 19 04/09/2011

at

NE

W 2-0

Corner Kicks 10 04/30/2011 10 05/28/2011

at POR vs. SEA

Offside 12 05/07/2011 05/07/2011

vs. LA vs. SJ

Saves 8 03/19/2011 Shots Faced 10 08/20/2011 Goals Allowed 4 09/24/2011

vs. CHV

at

at

at

SJ

HOU

DC

L 0-1 L 1-2

W 1-0

W 1-0

CHV TOR SJ NY

1-0 3-1 4-0 3-0

L 2-3

L 1-4

L 1-4

REAL SALT LAKE INDIVIDUAL POSTSEASON HIGH GAMES (2005-10)

TEAM POSTSEASON HIGH GAMES (2005-10)

TEAM POSTSEASON LOW GAMES (2005-10)

Goals 1 10 times

Goals 3 11/05/2009

at

CLB

W 3-2

Shots 7 10/30/2010

at

DAL

L 1-2

Assists 1 12 times

Assists 3 11/08/2008 3 11/05/2009

at at

CHV CLB

T 2-2 W 3-2

Shots on Goal 2 10/31/2009

vs. CLB

W 1-0

Shots 5 Yura Movsisyan 5 Clint Mathis 5 Robbie Findley

11/08/2008 11/15/2008 11/22/2009

at CHV vs. NY at LA

T 2-2 L 0-1 W 1-1

Shots on Goal 9 11/01/2008

Shots on Goal 2 10 times Fouls Committed 6 Yura Movsisyan 6 Javier Morales 6 Chris Wingert Fouls Suffered 4 Jamison Olave 4 Javier Morales Offside 6 Robbie Findley Saves 8 Nick Rimando Shots Faced 10 Nick Rimando Goals Allowed 2 Nick Rimando 2 Nick Rimando 2 Nick Rimando

Shots 24 11/15/2008

vs. NY

vs. CHV

Fouls Committed 24 11/08/2008 at 11/01/2008 11/08/2008 11/14/2009

11/08/2008 11/15/2008

11/22/2009

11/05/2009

vs. CHV at CHV at CHI

at CHV vs. NY

at

at

LA

CLB

W 1-0 T 2-2 W 0-0

T 2-2 L 0-1

Fouls Suffered 22 11/22/2009 Corner Kicks 11 11/06/2010

11/08/2008 11/05/2009 10/30/2010

at

at at at

CLB

CHV CLB DAL

LA

vs. DAL

Saves 8 11/05/2009

at

CLB

W 3-2

W 3-2 W 3-2

W 3-2

111

at at at

CHV CLB DAL

Corner Kicks 0 11/08/2008

at

CHV

T 2-2

Offside 0 11/01/2008

vs. CHV

W 1-0

Saves 1 11/01/2008

vs. CHV

W 1-0

Shots Faced 1 11/01/2008

vs. CHV

W 1-0

T 1-1

W 1-1

T 2-2 W 3-2 L 1-2

W 0-0

W 1-1

W 1-1

Goals Allowed 2 11/08/2008 2 11/05/2009 2 10/30/2010

CHI

T 2-2

LA

CLB

Fouls Suffered 8 11/14/2009 at W 1-0

at

at

L 0-1

L 0-1

Offside 8 11/22/2009

Shots Faced 10 11/05/2009 11/05/2009

at

CHV

Fouls Committed 4 11/15/2008 vs. NY

T 2-2 W 3-2 L 1-2

REAL SALT LAKE  2011 REAL SALT LAKE STATISTICS (15-11-8, 53 pts.) UNF POS PLAYER 15 F Alvaro Saborio 7 F Fabian Espindola 5 M Kyle Beckerman 6 D Nat Borchers 23 F Paulo Araujo Jr. 11 M Javier Morales 8 M Will Johnson 4 D Jamison Olave 77 M Andy Williams 21 M Luis Gil 28 D Chris Schuler 12 M Jean Alexandre 22 M Nelson Gonzalez 26 M Collen Warner 3 D Robbie Russell 10 M Arturo Alvarez 2 D Tony Beltran 17 D Chris Wingert 14 F Artur Aghasyan 13 F Chris Agorsor (TOT) 13 F Chris Agorsor (RSL) 14 M Yordany Alvarez 27 F Cody Arnoux 20 M Ned Grabavoy 30 D Rauwshan McKenzie 24 G Kyle Reynish 18 G Nick Rimando 19 D Blake Wagner (TOT) 19 D Blake Wagner (RSL) 1 G Tim Melia 25 F Donny Toia Own-goals received Team totals Opponent totals

GP 23 27 29 30 11 10 25 24 31 25 20 19 6 24 26 16 22 23 4 1 1 5 2 25 2 1 33 11 2 0 0

GS 22 25 27 30 5 9 22 24 20 14 16 9 2 15 22 8 19 22 1 0 0 4 0 21 2 1 33 10 1 0 0

MIN 1928 2096 2423 2547 468 785 2059 2128 1970 1288 1638 703 174 1106 1809 724 1731 1915 98 10 10 419 69 1899 180 90 2970 841 63 0 0

34 34

34 34

3060 3060

G 11 10 3 3 2 2 2 2 2 2 2 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 44 36

A 2 3 9 1 4 3 1 1 1 0 0 2 1 5 2 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0

SHT 66 62 33 19 11 12 39 20 38 21 13 12 5 16 8 18 5 9 3 0 0 0 1 17 0 0 0 6 1 0 0

SOG 24 31 13 6 6 5 15 7 13 7 2 4 2 8 1 1 3 2 0 0 0 0 0 3 0 0 0 2 0 0 0

FC 43 39 36 14 6 10 20 30 33 16 16 19 4 28 17 12 14 32 5 0 0 21 1 25 2 0 0 11 0 0 0

FS 38 31 23 15 5 22 29 17 45 11 13 9 1 19 10 9 21 10 2 0 0 4 1 38 2 0 5 11 2 0 0

OFF 38 33 1 5 5 3 2 3 1 4 0 8 0 4 0 3 1 0 1 0 0 0 0 3 0 0 0 0 0 0 0

CK 0 1 42 0 0 35 13 0 40 2 0 0 13 12 0 3 0 3 0 0 0 0 0 1 0 0 0 4 0 0 0

C 3 6 6 1 0 3 6 3 2 0 2 3 0 3 4 0 1 5 0 0 0 4 0 3 0 0 1 0 0 0 0

E 0 0 1 2 0 0 1 1 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0

38 31

429 375

153 136

443 411

411 443

115 66

165 147

56 52

7 8

GAME-WINNING GOALS: Alvaro Saborio 4, Chris Schuler 2, Fabian Espindola 2, Nat Borchers 2 Andy Williams 1, Javier Morales 1, Will Johnson 1, Kyle Beckerman 1 Jean Alexandre 1 GAME-WINNING ASSISTS: Kyle Beckerman 6, Collen Warner 2, Robbie Russell 1, Javier Morales 1 Nat Borchers 1, Tony Beltran 1, Paulo Araujo Jr. 1 PENALTY KICK GOALS/ATTEMPTS: Alvaro Saborio 3-3, Javier Morales 1-1, Fabian Espindola 1-1 REAL SALT LAKE INDIVIDUAL GOALKEEPING UNF POS GOALKEEPER GP 24 G Kyle Reynish 1 18 G Nick Rimando 33 Team totals 34 Opponent totals 34

GS 1 33 34 34

MIN 90 2970 3060 3060

SHTS SV 2 2 134 95 136 97 153 109

GA 0 36 36 44

GAA 0.00 1.09 1.06 1.29

PG 0 5 5 5

PA 0 7 7 5

W 1 14 15 11

* = Played with other teams in 2011. Only Real Salt Lake statistics listed here.

112

L 0 11 11 15

T 0 8 8 8

SO 1 13 14 10

REAL SALT LAKE  REAL SALT LAKE 2011 SCHEDULE DAY Sat. Sat. Sat. Wed. Sat. Sat. Sat. Sun. Sat. Sat. Wed. Sat. Sat. Wed. Sat. Mon.

DATE Mar. Mar. Apr. Apr. Apr. May May May May June June June June June June July

19 26 9 13 30 7 14 22 28 4 8 11 18 22 25 4

OPPONENT at San Jose Los Angeles at New England Colorado at Portland Chivas USA Houston at FC Dallas Seattle Vancouver at Columbus at Philadelphia D.C. United at Chicago Toronto FC New England

RESULT W 1-0 W 4-1 W 2-0 W 1-0 L 0-1 W 1-0 T 0-0 T 0-0 L 1-2 W 2-0 L 1-2 T 1-1 T 1-1 T 0-0 W 3-1 T 3-3

ATT. 10,525 20,507 7,970 15,513 18,627 14,313 16,301 10,550 14,674 15,174 9,650 18,728 16,841 14,972 15,077 16,139

Sat. Sat. Sat. Wed. Sat. Sat. Sat.

July July July Aug. Aug. Aug. Aug.

9 23 30 3 6 13 20

FC Dallas San Jose Columbus at Sporting KC New York at Toronto FC at Houston

W W L L W L L

2-0 4-0 0-2 0-2 3-0 0-1 2-3

17,734 19,429 18,516 18,467 19,081 21,644 16,247

Sat. Sat. Sat. Sat. Wed. Sat. Wed. Sat. Thu. Fri. Sat.

Aug. Sept. Sept. Sept. Sept. Sept. Sept. Oct. Oct. Oct. Oct.

27 3 10 17 21 24 28 1 6 14 22

at Chivas USA Philadelphia at Seattle Sporting KC at New York at D.C. United Chicago at Los Angeles at Vancouver at Colorado Portland

W W W W W L L L L T T

1-0 2-1 2-1 1-0 3-1 1-4 0-3 1-2 0-3 0-0 1-1

14,127 18,720 35,940 19,888 15,266 16,367 20,762 27,000 20,113 16,272 20,378

W-L-T POS. PTS NOTES: 1-0-0 T1 3 RSL: Beckerman (63) 2-0-0 T1 6 RSL: Williams (2) Morales (10,41) Araujo (68); LA: Angel (79) 3-0-0 T1 9 RSL: Schuler (27) Araujo (47) 4-0-0 1 12 RSL: Espindola (90) 4-1-0 T2 12 POR: Cooper (22) 5-1-0 2 15 RSL: Johnson (87) 5-1-1 3 16 5-1-2 T3 17 5-2-2 T5 17 RSL: Gonzalez (87); SEA: Ianni (72) Neagle (84) 6-2-2 4 20 RSL: Alexandre (32) Espindola (79) 6-3-2 4 20 RSL: Olave (7); CLB: Mendoza (76) Gardner (82) 6-3-3 0 21 RSL: Espindola (53); PHI: Daniel (24) 6-3-4 T4 22 RSL: Espindola (38); DC: Davies (85) 6-3-5 4 23 7-3-5 4 26 RSL: Borchers (39) Saborio (42,60); TOR: dos Santos (66) 7-3-6 4 27 RSL: Johnson (24) Saborio (56) Espindola (83); NE: Lekic (4) Tierney (16) Joseph (63) 8-3-6 4 30 RSL: Williams (47) Espindola (90) 9-3-6 4 33 RSL: Saborio (63,75) Beckerman (78) Olave (83) 9-4-6 5 33 CLB: Gaven (5) Heinemann (10) 9-5-6 5 33 KC: Espinoza (29) Bunbury (34) 10-5-6 5 36 RSL: Borchers (13) Gil (44) Saborio (77) 10-6-6 5 36 TOR: Plata (77) 10-7-6 5 36 RSL: Espindola (28) Gil (60); HOU: Ching (47) Boswell (69) Dixon (90) 11-7-6 5 39 RSL: Saborio (11) 12-7-6 4 42 RSL: Beckerman (18) Schuler (26); PHI: Le Toux (30) 13-7-6 0 45 RSL: own goal (12) Saborio (56); SEA: Montero (45) 14-7-6 3 48 RSL: Borchers (54) 15-7-6 T2 51 RSL: Saborio (7) Espindola (11,21); NY: Lindpere (69) 15-8-6 3 51 RSL: Saborio (86); DC: Najar (13) De Rosario (22,27,31) 15-9-6 3 51 CHI: Pappa (9,36,75) 15-10-6 3 51 RSL: Espindola (45); LA: Barrett (59) own goal (72) 15-11-6 0 51 VAN: Camilo (44,53) Khalfan (88) 15-11-7 3 52 15-11-8 3 53 RSL: Saborio (45); POR: Danso (90)

113

Player

Tim Melia Tony Beltran Robbie Russell Jamison Olave Kyle Beckerman Nat Borchers Fabian Espindola Will Johnson Arturo Alvarez Javier Morales Jean Alexandre Chris Agorsor Yordany Alvarez Artur Aghasyan Alvaro Saborio Chris Wingert Nick Rimando Blake Wagner Ned Grabavoy Luis Gil Nelson Gonzalez Paulo Araujo Jr. Kyle Reynish Donny Toia Collen Warner Cody Arnoux Chris Schuler Rauwshan McKenzie Andy Williams 90M

63M

54D 90D 90M 90D 65F 90M 36 45M

45M 25

9

90D 90D 33 10 57D 90D 90D 90M 90M 90M 90D 90D 90F 90F 90F

90D 5 90D 90M 90D 83F 24

62F 81F 80F 71F 90F

90D 90D 90D 76D 90D 90D 58D 90M 90M 90M 90D 90D 90D 90F 85M 90M 90M 74F 81F 16

5

24

90D 90D 72M 87M 23

60M 18

30

90D 90D 90D 90M 90D 7F 90M

90D 90D 90D 45D 90D 90D 90M 45 90D 3D 27 90M 90M

9

33

66M 84M 57M

90M 90M 21

7

REAL SALT LAKE 

70F

90D 90D 90D 61D 90D 90D 90M 90M 90M 90D 90D 24 90F 90F 90M 84M 90M 11 29 2

9 90D

18

29

90M 90D 90F 87M 8

90M 90D 90F 90M 14

5

68D 58 90D 90D 22 90D 81D 90D 90D 90D 90M 90M 90D 24D 62F 90F 90M 85M 32M 90M 90D 90F 90M 59M

3

65M 23

9

28

45M

82M 76M 45

5

90D 90D 90D 90D 90D 58 90M 81M 72M 61M 31

81

9M

90M 90M 90M 90M 90M 90M 90M 90M 90M 67M 90M 66M 79M 90M 3 9 31 83M 83 90F 63F 90F 6 20 25 14 67M 59M 6 23

79M

45

90D 90M 45

90D 90D

77F 90F 21 90G 21

69M

87M 66M

90D 89D 90D 90M 90F

35D 90D 90D 90M 90D 79F 90M

90D 90D 90M 90D 89F 90M

1

90D 90D

90D 90F 90M 22

7

90M

30

75

10

45F

90M 90M

90M 80M 90F 89M

25

90M 90M 84M

10 43M 45 90D 59D

90M 16

45

15M

90F 90F 90F 90F 60D 90D 90D 90D 90D 90G 90G 90G 90G 90G

74M

45D 31 90D 90D 90D 90D 90D 90D 90D 90M 11M 90D 90D 90D 90D 90D 90D 90F 65F 90F 90F 28 90M 90M 90M 62M 6 80M 90M 90M 90M 1

75F

68F 90F 83F 15 90D 90G 90G 90G 90G 62D 90M 28

22 31 45M 59M 13

90F

90D

77M 90M

90D 90D

90M 90M 90M 68M

73M 24 90D 45

66F 11

3 19 7 69F 69F 90F 90F 90F 90F 81F 90F 88F 90F 90F 90F 90F 90F 90F 90D 90D 90D 90D 90D 28 90D 90D 90D 85D 90D 90D 90D 90D 32D 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 1 17 67M 90M 90M 85M 90M

90D 27 90D 90D 70D 63D 90D 90D 90D 90M 27 90M 90M 90D 90D 90D 90F 90F 86M 45 90F 90F 90M 90M 45M

90D

6

77M 90M 90M 90M 20 13 11

84F 90D 90D 90G 90G

90M 90D 65F 90M 25 90M 13

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 SJ LA NE COL POR CHV HOU DAL SEA VAN CLB PHI DC CHI TOR NE DAL SJ CLB KC NY TOR HOU CHV PHI SEA KC NY DC CHI LA VAN COL POR 1-0 4-1 2-0 1-0 0-1 1-0 0-0 0-0 1-2 2-0 1-2 1-1 1-1 0-0 3-1 3-3 2-0 4-0 0-2 0-2 3-0 0-1 2-3 1-0 2-1 2-1 1-0 3-1 1-4 0-3 1-2 0-3 0-0 1-1

REAL SALT LAKE – GAME-BY-GAME #

1 2 3 4 5 6 7 8 10 11 12 13 14 14 15 17 18 19 20 21 22 23 24 25 26 27 28 30 77 "00" = 100 minutes played F/M/D/G = starting position Played for other teams: Blake Wagner played 778 minutes for VAN

114

04/09/2011 04/13/2011 04/30/2011 05/07/2011 05/14/2011 05/22/2011 05/28/2011 06/04/2011 06/08/2011 06/11/2011 06/18/2011 06/22/2011 06/25/2011 07/04/2011 07/09/2011 07/23/2011

03/19/2011 03/26/2011

RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL

RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL RSL 0 0 3 0 2 1 2 2 1 3 1 0 1 0 0 1

2 1 0 1 0 0 1 2 1 1 1 0 3 3 2 4 vs at vs at at at vs at vs at at vs at at at vs

at vs at vs vs at vs vs at at vs at vs vs vs vs CLB 2 KC 2 NY 0 TOR 1 HOU 3 CHV 0 PHI 1 SEA 1 KC 0 NY 1 DC 4 CHI 3 LA 2 VAN 3 COL 0 POR 1

NE 0 COL 0 POR 1 CHV 0 HOU 0 DAL 0 SEA 2 VAN 0 CLB 2 PHI 1 DC 1 CHI 0 TOR 1 NE 3 DAL 0 SJ 0

RSL 1 at SJ 0 RSL 4 vs LA 1

L L W L L W W W W W L L L L T T

W W L W T T L W L T T T W T W W Johnson 1 (Borchers 1, Warner 3)

87

REAL SALT LAKE 

Gonzalez 1 (unassisted) 87 Alexandre 1 (Beckerman 1) 32; Espindola 2 (Alexandre 1) Olave 1 (Gonzalez 1) 7 Espindola 3 (Alexandre 2) 53 Espindola 4 (penalty kick) 38

13; Gil 1 (Beckerman 7)

Saborio 11 (Espindola 3)

Espindola 10 (Morales 3)

45

45

44; Saborio 6 (penalty kick)

Espindola 7 (Warner 4) 28; Gil 2 (Espindola 2) 60 Saborio 7 (unassisted) 11 Beckerman 3 (Paulo Junior 3) 18; Schuler 2 (Beckerman 8) 26 own goal (Keller) 12; Saborio 8 (unassisted) 56 Borchers 3 (Beckerman 9) 54 Saborio 9 (Williams 1) 7; Espindola 8 (unassisted) 11; Espindola 9 (Warner 5) Saborio 10 (Paulo Junior 4) 86

Borchers 2 (Beckerman 6)

21

77

Borchers 1 (Beckerman 2) 39; Saborio 1 (Russell 1, Beckerman 3) 42; Saborio 2 (Russell 2) 60 Johnson 2 (unassisted) 24; Saborio 3 (penalty kick) 56; Espindola 5 (Saborio 1, Olave 1) 83 Williams 2 (Beckerman 4) 47; Espindola 6 (Johnson 1) 94+ Saborio 4 (penalty kick) 63; Saborio 5 (unassisted) 75; Beckerman 2 (Saborio 2) 78; Olave 2 (Alvarez 1, Beckerman 5) 83

79

Beckerman 1 (Morales 1, Beltran 1) 64 Williams 1 (Paulo Junior 1, Morales 2) 2; Morales 1 (penalty kick) 10; Morales 2 (Wingert 1) 41; Paulo Junior 1 (Espindola 1) 68 Schuler 1 (Warner 1) 27; Paulo Junior 2 (Warner 2) 47 Espindola 1 (Paulo Junior 2) 93+

REAL SALT LAKE – GAME-BY-GAME LOG

#3 #4 #5 #6 #7 #8 #9 #10 #11 #12 #13 #14 #15 #16 #17 #18 07/30/2011 08/03/2011 08/06/2011 08/13/2011 08/20/2011 08/27/2011 09/03/2011 09/10/2011 09/17/2011 09/21/2011 09/24/2011 09/28/2011 10/01/2011 10/06/2011 10/14/2011 10/22/2011

W W

Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game #19 #20 #21 #22 #23 #24 #25 #26 #27 #28 #29 #30 #31 #32 #33 #34

Game #1 Game #2

Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game

115

Player

90D 31 90D 90M 90D 59F 90M 90M 90F 90D 90G 81M

9

90D 90D 90M 85F 90M 87M 5 71F 90D 90G 3

19

90D

0 2 2 1

90M

CLB 0 CLB 1 SAPRSA SAPRSA MONTRY MONTRY

RSL 2 vs WILMTN 0 RSL 0 at DAL 2

CHAMPIONS LEAGUE 10/11 03/09/2011 RSL 0 at 03/16/2011 RSL 4 vs 03/22/2011 RSL 2 vs 04/05/2011 RSL 1 at 04/20/2011 RSL 2 at 04/27/2011 RSL 0 vs

Tim Melia Tony Beltran Robbie Russell Jamison Olave Kyle Beckerman Nat Borchers Fabian Espindola Will Johnson Arturo Alvarez Javier Morales Jean Alexandre Alvaro Saborio Chris Wingert Nick Rimando Ned Grabavoy Luis Gil Nelson Gonzalez Paulo Araujo Jr. Kyle Reynish Collen Warner Chris Schuler Rauwshan McKenzie Andy Williams 90D 90D 45D 90M 90D 87F 90M 3 90M 90F 90G 23

45

9 81D 90D 90M 90D 90F 90M 9 90M 90F 90D 90G 90M

90D 85F 90M 26 90M

45 45D 90D

90D 90D 90M 90D 79F 90M 11 90M 81F 90D 90G 60M

5

REAL SALT LAKE 

90M

32

58M 90F

58D

24

90D 90M 90D 66F 90M 32

90D

U.S. OPEN CUP R16 QF WILM DAL 2-0 0-2 90D 27 63M 90D 90M

90F

27 90F 16 90G 74M 63D 90D 90M

58M

64M

67M

Beltran (Alexandre) 40; Alexandre (Johnson) 44

Saborío (Morales) 23; Morales (Williams) 36; Morales (Paulo Junior) 77; Williams (unassisted) 95+ Saborio (Espindola) 9; Espindola (Williams) 57 Olave (unassisted) 60 Borchers (Johnson) 35; Morales (Alvarez) 89

W L

T W W L T L

30

90F 90D 90G 32

CONCACAF CHAMPIONS LEAGUE 10/11 QF1 QF2 SF1 SF2 F1 F2 CLB CLB SAP SAP MTR MTR 0-0 4-1 2-0 1-2 2-2 0-1

REAL SALT LAKE –CUP COMPETITIONS – GAME-BY-GAME #

1 2 3 4 5 6 7 8 10 11 12 15 17 18 20 21 22 23 24 26 28 30 77

CONCACAF QF1 QF2 SF1 SF2 F1 F2 U.S. OPEN CUP R16 06/28/2011 QF 07/12/2011

116

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011

 

Real Salt Lake

(15-­11-­8, 53 pts, 3rd in West)

vs. Seattle Sounders FC (18-­7-­9, 63 pts, 2nd in West)

6DWXUGD\2FWREHU±5LR7LQWR6WDGLXP±6DQG\87±SP07 79 )R[6RFFHU&KDQQHOZ-3'HOODFDPHUD %ULDQ'XQVHWK 5$',2 5RFN)0Z6SHQFHU:DUQH %ULDQ.DPOHU  $PHULFD)LUVW&UHGLW8QLRQ3UH*DPH6KRZ#SPZ6SHQFHU&KHFNHWWV 7UH\)LW]*HUDOG  -XDQ)0(631'HSRUWHV$0Z1HOVRQ0RUDQ )HUQDQGR+RUWDO 

PROBABLE STARTERS 10/29 v SEATTLE 56/ GLDPRQG5Î/  *.5LPDQGR ')5XVVHOO2ODYH%RUFKHUV:LQJHUW 0)%HFNHUPDQ:LOOLDPV-RKQVRQ0RUDOHV ):(VStQGROD6DERUtR 

FOURTH CONSECUTIVE POSTSEASON BERTH: 5HDO 6DOW /DNH ± ZLQOHVV VLQFH TXDOLI\LQJ IRU LWV IRXUWK FRQVHFXWLYHSRVWVHDVRQEDFNRQ6HSW±UHWXUQVWR5LR 7LQWR 6WDGLXP 6DWXUGD\ ZLWK D FOHDQ VODWH WR NLFN RII WKH 0/6&XS3OD\RIIV«2QWKHILQDOGD\RIWKHUHJXODU VHDVRQ 56/ FOLQFKHG WKH  RYHUDOO VHHG LQ WKH :HVW WR FRQILUP D :HVWHUQ &RQIHUHQFH 6HPLILQDO VHULHV ZLWK 6HDWWOH 6RXQGHUV )& « 7KH UHWXUQ OHJ RI WKH WZRJDPH PLQXWH DJJUHJDWHJRDO VHULHV WDNHV SODFH RQ :HG 1RY SP07 IURP&HQWXU\/LQN)LHOGLQ6HDWWOH« 7KHZLQQHURIWKH56/Y6($HLWKHUKRVWV1< RYHUDOO VHHG RUWUDYHOVWR/$ RYHUDOO RQ1RY«  5HDO 6DOW /DNH¶V  KRPH GUDZ DJDLQVW 3RUWODQG ODVW 6DWXUGD\SURYHGHQRXJKWRFOLQFKWKH RYHUDOOVHHGDV )&'DOODV±ZLWKZKRP56/HQWHUHGWKHZHHNHQGWLHGRQ  SRLQWV DIWHU  JDPHV ± VWXPEOHG DW 6DQ -RVH GURSSLQJDGHFLVLRQWRWKH(DUWKTXDNHV«  7KHGUDZY3RUWODQGPDUNHGWKHVHFRQGVXFFHVVLYHWLHIRU 56/ZKLFKHDUQHGDURDGUHVXOWWKHSHQXOWLPDWHZHHN RI WKH VHDVRQ DW ULYDO &RORUDGR 5DSLGV VHFXULQJ WKH WHDP¶V ILIWK FRQVHFXWLYH 5RFN\ 0RXQWDLQ &XS WLWOH LQ D EDWWOHEHWZHHQWKHODVWWZR0/6&XS&KDPSLRQV«  6DWXUGD\¶V PDWFK DW 5LR 7LQWR 6WDGLXP NLFNV RII DW  SP07ZLWKWKHPDWFKWHOHYLVHGOLYHQDWLRQZLGHYLD)R[ 6RFFHU « )DQV FDQ DOVR IROORZ RYHU WKH DLU RQ 56/¶V RIILFLDO UDGLR SDUWQHUV ZLWK 5RFN  )0 FDUU\LQJ WKH (631  6SRUWV IHHG DQG (631 'HSRUWHV  $0  -XDQ)0LQ6SDQLVK«



RSL INJURY REPORT (as of 10/25/11)

2870)1HOVRQ*RQ]iOH] 5IRRWIUDFWXUH  '28%7)8/*..\OH5H\QLVK 5DQNOHERQHVSXU ):&RG\$UQRX[ /KDPVWULQJVWUDLQ  48(67,21$%/(')7RQ\%HOWUDQ /DGGXFWRUVWUDLQ 0)1HG *UDEDYR\ /DGGXFWRUVWUDLQ  352%$%/(QD

YET ANOTHER RECORD-­SETTING SELLOUT?: 5HDO 6DOW /DNH H[SHFWV DQRWKHU FDSDFLW\ FURZG DW 5LR 7LQWR 6WDGLXP RQ 6DWXUGD\ QLJKW RI  DJDLQVW WKH YLVLWLQJ 6HDWWOH 6RXQGHUV « 7KH VHOORXW ZRXOG PDUN 56/¶V IRXUWK FRQVHFXWLYH IXOO EXLOGLQJ WR NLFN RII WKH 0/6&XS3OD\RIIVDQGWKHIUDQFKLVHKLJKVHYHQWKRI RQH VHDVRQ RQH 3OD\RII JDPH ILYH UHJXODUVHDVRQ 0/6 FRQWHVWVRQH&&/PDWFK «  56/ KDV SRVWHG D  PDUN DFURVV DOO FRPSHWLWLRQV LQ KRPH VHOORXW PDWFKHV « $ OLVW RI DOOWLPH 5LR 7LQWR 6WDGLXPVHOORXWVIRU56/0/6VLQFHWKHEXLOGLQJRSHQHG EDFNLQ2FWREHU  Date

Opponent

Att.

Result

Oct.  29,  2011   Seattle  Sounders  FC   ???   Oct.  22,  2011   Portland  Timbers   20,378*   T  1-­1   Sept.  28,  2011  Chicago  Fire   20,762*   L  0-­3   Sept.  17,  2011  Sporting  Kansas  City   19,888**   W  1-­0   July  23,  2011   San  Jose  Earthquakes   19,429**   W  4-­0   April  27,  2011  Monterrey  (MEX)   20,378*   L  0-­1   March  26,  2011  Los  Angeles  Galaxy   20,507*   W  4-­1   Oct.  19,  2010    Cruz  Azul  (MEX)     20,463*     W  3-­1   Oct.  16,  2010    FC  Dallas     20,236*     W  2-­0   July  24,  2010   CD  Chivas  USA   19,469**   T  1-­1   July  29,  2009    MLS  All-­Star  Game     20,120*     T  1-­1   June  6,  2009   Colorado  Rapids   19,546**   T  1-­1   May  16,  2009   Kansas  City  Wizards   19,340**   L  0-­2   Nov.  15,  2008    New  York  Red  Bulls   20,008*     L  0-­1   Oct.  9,  2008     New  York  Red  Bulls   20,008*     T  1-­1     *    Sellout  (includes  SRO  distribution)   **  6HOORXWZGLPLQLVKHG³FRQFHUWVWDJH´FDSDFLW\

 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 

THREE YEARS OF HISTORY v SEATTLE:

5HDO 6DOW /DNH KDV SRVWHG D  PDUN DJDLQVW 6HDWWOH DOO WLPHLQ0/6SOD\ ZLWKERWKWHDPV ZLQQLQJLQHQHP\ WHUULWRU\ WKLV VHDVRQ DIWHU KROGLQJ VHUYH DW KRPH LQ  DQGVSOLWWLQJWKHSRLQWVLQGUDZVLQ«  2XWVLGH RI OHDJXH FRPSHWLWLRQ 56/ GURSSHG D  86 2SHQ&XSPDWFKWRWKH6RXQGHUVHDUO\RQLQEHIRUH UHWXUQLQJ WR 6HDWWOH DQG HPHUJLQJ YLFWRULRXV LQ 0/6 &XS WKDW \HDU DJDLQVW /RV $QJHOHV FRPLQJ EDFN IURP DQ  GHILFLW DQG ZLQQLQJ D GUDPDWLF 3. VKRRWRXW DIWHU  PLQXWHVDWWKHQ4ZHVW)LHOG«  7KLV VHDVRQ¶V SDLU RI PHHWLQJV LQFOXGHG WKUHH UHG FDUGV 2ODYHRQ0D\LQ8WDK%HOWUDQ +XUWDGRIRXUPLQXWHV DSDUW RQ 6HSW  LQ 6HDWWOH  ZKLOH WKH 0D\  PDWFK DW 5LR 7LQWR 6WDGLXP VDZ WKH ILUVW FDUHHU JRDO E\ D \RXQJ SOD\HU ZKR JUHZ XS LQ WKH VKDGRZ RI KLV IXWXUH 0/6 VWDGLXP 1HDJOH  DQG WKH HQG RI DQ 0/6UHFRUG KRPH XQEHDWHQVWUHDNPRUHWKDQWZR \HDUVLQWKHPDNLQJ 5LR 7LQWR6WDGLXP «7KH6HSWHPEHUPHHWLQJDW&HQWXU\/LQN DOVRIHDWXUHGDEL]DUUHRZQJRDOE\D866RFFHUOHJHQG .HOOHU  D PLVVHG SHQDOW\ NLFN E\ DQ 0/6 093 FDQGLGDWH 5RVDOHV «  ,QWKHWHDPV¶ODVWPHHWLQJMXVWZHHNVDJRDGDQJHURXV FURVV IURP ): )DELDQ (VSLQGROD ZDV HQ URXWH WR ILQG SDUWQHU $OYDUR6DERULRIDUSRVWEXWWKHVSLQQLQJWXUIEDOO ZDVVKRYHOHGLQWRJRDODVSDUWRIDQXQFKDUDFWHULVWLFJDIIH E\6RXQGHUV*..DVH\.HOOHU«6HDWWOHSOD\PDNHU0DXUR 5RVDOHV KDG D FKDQFH WR NQRW WKH JDPH DW  IURP WKH SHQDOW\VSRWDIWHU56/')5REELH5XVVHOOZDVGHHPHGWR KDYH WULSSHG 0LNH )XFLWR LQ WKH ¶ \HW 5RVDOHV SXVKHG WKH DWWHPSW ZLGH OHIW « -XVW  PLQXWHV ODWHU KRZHYHU 5RVDOHV ZDV WDFNOHG E\ 56/ ') 7RQ\ %HOWUDQ RQ WKH WRXFKOLQHHDUQLQJKLVVHFRQG\HOORZRIWKHHDUO\JRLQJDQG UHGXFLQJ 56/ WR  PHQ « 2QO\  PLQXWHV DIWHU WKDW +XUWDGRHOERZHG6DERULRKLJKWRHYHQWKHVLGHVDWPHQ DSLHFH DQG LW ZDV 5RVDOHV VHWWLQJ XS )UHG\ 0RQWHUR DW WKHGHDWKRIWKHILUVWKDOIIRUWKHHTXDOL]HU«  7KH ¶ RI WKH PDWFK VDZ D VWHOODU OHIWIRRWHG ILQLVK E\ $OYDUR 6DERUtR ZKRVH LQLWLDO RIIHULQJ DIWHU DQ (VSLQGROD FURVV ZDV EORFNHG E\ 6RXQGHUV ') 7\VRQ :DKO EXW 6DER FRUUDOOHG WKH UHERXQG DQG VORWWHG WKH \DUG VKRW SDVW.HOOHUDQGLQWRWKHIDUVLGHQHWWLQJ«6HDWWOHKDG56/ XQGHUVLHJHIRUWKHILQDOPLQXWHVEXWDSRLQWEODQNVDYH E\ *. 1LFN 5LPDQGR¶V IDFH IURP LQVLGH WKH VL[ NHSW WKH VFRUHOLQH DW  HQDEOLQJ 56/ WR FHOHEUDWH WKH ZLQ LWV ILUVWHYHUUHJXODWLRQYLFWRU\DW&HQWXU\/LQN)LHOG«



SOUNDERS SNAP RSL STREAK: ,Q WKHLU SUHYLRXV YLVLW WR 5LR 7LQWR 6WDGLXP WKLV \HDU 6LJL 6FKPLG¶V 6HDWWOH WHDPZRQLQDJDPHPDUUHGE\D-DPLVRQ2ODYHUHG FDUG VQDSSLQJ 56/¶V JDPH KRPH XQEHDWHQ VWUHDN DJDLQVW 0/6 FRPSHWLWLRQ « *RDOV IURP 6RXQGHUV ') 3DWULFN ,DQQL DQG 0) /DPDU 1HDJOH JDYH 6HDWWOH D  OHDGDIWHUWKH2ODYHUHGLQWKH¶ZKLOH56/0)/XLV*LO QRWFKHGKLVILUVWFDUHHUDVVLVWRQD1HOVRQ*RQ]DOH]JRDO WK LQ WKH   PLQXWH IRU WKH ILQDO PDUJLQ « 7KH WZR JRDOV DOORZHG WKDW QLJKW PDWFKHG WKH WRWDO FRQFHGHG E\ 56/ LQ WKH SULRU  PDWFKHV ZKLOH ): Ã&#x2C6;OYDUR 6DERUtR &RVWD 5LFD DQG0) $UWXUR $OYDUH] (O6DOYDGRU HDFKPLVVHG WKDWPDWFKGXHWR&21&$&$)*ROG&XSGXW\«  2010 DRAMA BETWEEN RSL & SEATTLE:  DOVRVDZWKH:HVWHUQHOLWHVSOLWWKHSRLQWVLQHDFKPHHWLQJ « $W 5LR 7LQWR 6WDGLXP ODVW \HDU 56/ HDUQHG D FRPH IURPEHKLQGGUDZIRU56/LQLWV0DUFKKRPH RSHQHU DV WKH SOD\HUV UHFHLYHG WKHLU 0/6 &XS ULQJV DQG WKH FKDPSLRQVKLS EDQQHU ZDV UDLVHG « 6DERULR KHDGHG KRPH D FRUQHU NLFN IURP 0) 1HOVRQ *RQ]iOH] LQ WKH ZDQLQJ VHFRQGV RI VWRSSDJH WLPH ¶  IRU KLV ILUVW 0/6 JRDO VHFXULQJ D  GUDZ DV KLV QHZ VLGH IRXJKW EDFN WZLFH IURP RQHJRDO 6HDWWOH OHDGV FRXUWHV\ RI 6WHYH =DNXDQL ¶ DQG7\URQH0DUVKDOO ¶ «  WK 6DERUtR HQWHUHG WKH JDPH LQ WKH   PLQXWH IRU ): 5REELH)LQGOH\QHDUO\NQRWWLQJWKHJDPHZLWKDKHDGHULQ WK UG WKH PLQXWHWKDWZHQWLQFKHVZLGH«,QWKH PLQXWH 0) :LOO -RKQVRQ VWUXFN KRPH D VXSHUE FURVV IURP ') 5REELH 5XVVHOO KLV GLYLQJ KHDGHU DW WKH WRS RI WKH VL[ \DUGER[EHDWLQJ6RXQGHUV*..DVH\.HOOHUDQGNQRWWLQJ WKHVFRUHDW«  /DVW6HSWHPEHUDVWRXWGHIHQVLYHHIIRUWE\56/HDUQHGD KDUGIRXJKWURDGSRLQWIURPDGUDZLQIURQWRIDW 4ZHVW )LHOG ODVW 6HSWHPEHU « ,Q 56/¶V ILUVW YLVLW EDFN WR 6HDWWOH VLQFH LWV FKDPSLRQVKLS WULXPSK WKH YLVLWRUV FRQWLQXHG WKHLU UHFRUGVHWWLQJ GHIHQVLYH SDFH WKH WHDP WK FROOHFWLQJ LWV   VKXWRXW RI WKH VHDVRQ GHVSLWH PLVVLQJ IRXU UHJXODU VWDUWHUV GXH WR LQMXU\ RU VXVSHQVLRQ « 7KH JDPHPDUNHG WKH 0/6 GHEXW IRU ') &KULV 6FKXOHU ZKR SOD\HG D VWDQGRXW  PLQXWHV QH[W WR 1DW %RUFKHUV LQ SODFHRI2ODYHZKRPLVVHGKLVILUVWJDPHRIWKH\HDUGXH WRFDXWLRQDFFXPXODWLRQ«7KHPDWFKDOVRPDUNHGMXVWWKH VHFRQGFDUHHUVWDUWLQ/HDJXHSOD\IRU*..\OH5H\QLVK ZKR VWHSSHG LQ IRU UHJXODU VWDUWHU 5LPDQGR ZKR VDW RXW GXHWRDVOLJKW$FKLOOHVVWUDLQ«  .HOOHU¶V VDYH RQ ): 5REELH )LQGOH\¶V SHQDOW\ NLFN QG DWWHPSW LQ WKH   PLQXWH PDUNHG WKH ILUVW 3. PLVV LQ UHJXODWLRQ SOD\IRU56/VLQFH0D\  YV6DQ -RVH 0RUDOHV  VQDSSLQJ DQ IRU VWUHDN DFURVV DOO FRPSHWLWLRQV « 6LQFH .HOOHU VWRQHG )LQGOH\ 56/ KDV JRQHIRURQ3.VDFURVVDOOFRPSHWLWLRQVWKHRQO\PLVV E\IRUPHU):3DEOR&DPSRVLQD&&/JURXSZLQRYHU &UX]$]XO« 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 



LQ  LW ZDV 56/ *. 1LFN 5LPDQGR GRLQJ LW DOO LQ WKH $XJXVW  KRPH ZLQ RYHU 6HDWWOH QRWFKLQJ KLV ILIWK VKXWRXWRIWKHVHDVRQZKLOHDOVRFROOHFWLQJKLVVL[WKFDUHHU DVVLVW RQ )LQGOH\¶V JDPHZLQQHU W\LQJ KLP ZLWK 0DUFXV +DKQHPDQQIRUWKHPRVWE\DQHWPLQGHULQ0/6KLVWRU\«  56/ NLFNHG RII WKH \HDU ZLWK DQ  ORVV DW 6HDWWOH LQ WKH 6RXQGHUV¶ VHFRQGHYHU KRPH 0/6 PDWFK DV ): )UHG\ 0RQWHUR LFHG WKH ZLQ ZLWK D VXSHUE EODVW LQ WKH ¶ IURP  \DUGV RXW RQ D GLSSLQJ VKRW DIWHU 1DWH -DTXD VFRUHG ZKDWSURYHGWREHWKHJDPHZLQQHULQWKH¶« 

56/¶VYLFWRU\RQ6HSWLQ 6HDWWOH ZDVLWVILUVWHYHU FRPLQJLQDFULWLFDO³VL[SRLQW´PDWFKZLWKWKH6RXQGHUVDV SDUW RI D ILYHJDPH ZLQ VWUHDN WKDW YDXOWHG 56/ IURP WK QG  LQWKH:HVWWRDEULHIVSHOOLQ SODFHWKLVVHDVRQLW ZDV QRW 56/¶V PRVW JORULRXV SHUIRUPDQFH DW WKH IRUPHU 4ZHVW)LHOG«  7KDWKRQRULVUHVHUYHGIRU0/6&XSDV56/LQMXVW LWVILIWKHYHUVHDVRQHPHUJHGIURPWKH(DVWHUQVLGHRIWKH 0/6 &XS 3OD\RII EUDFNHW WR IDFH WKH KHDYLO\ IDYRUHG /RV $QJHOHV *DOD[\ « 7KH VWDUVWXGGHG OLQHXS WKDW LQFOXGHG 'RQRYDQ%HFNKDP5LFNHWWVHWDOIDFHG-DVRQ.UHLV¶VLGH ZKLFKDGKHUHGWRD³7HDPLVWKH6WDU´PDQWUD«(QURXWH WR DQ  KDOIWLPH GHILFLW FRXUWHV\ RI D 0LNH 0DJHH JRDO DVVLVWV WR ERWK 'RQRYDQ DQG %HFNKDP RQ WKH FRXQWHU  56/VDZLWVPRVWYDOXDEOHSOD\HU±0)-DYLHU0RUDOHV± NQRFNHG RXW RI WKH JDPH LQ WKH ¶ ZLWK D NQHH LQMXU\ VXIIHUHG LQ D ODWH FKDOOHQJH E\ %HFNKDP ZKLOH VWDOZDUW PLGILHOG HQJLQH :LOO -RKQVRQ ZDV UHSODFHG DW KDOIWLPH IROORZLQJ D ERXW ZLWK IRRG SRLVRQLQJ WKDW KDG PDGH KLV DELOLW\WRHYHQSOD\WKDWGD\DTXHVWLRQ«  7ZHQW\ PLQXWHV LQWR WKH VHFRQG KDOI D <XUD 0RYVLV\DQ GHIOHFWLRQ ERXQFHG ULJKW LQWR WKH SDWK RI ): 5REELH )LQGOH\ZKREHDW%HFNKDPWRWKHEDOODQGVORWWHGSDVW*. 'RQRYDQ 5LFNHWWV WR HYHQ WKH PDWFK DQG VHW XS DQRWKHU KRXURIQDLOELWLQJEXWXOWLPDWHO\VFRUHOHVVVRFFHUEULQJLQJ WKHSURFHHGLQJVWRSHQDOWLHV«  7KH3.VKRRWRXW LV ZKHUH 56/*.1LFN5LPDQGR ZRXOG HDUQ KLV 0/6 &XS 093 KRQRUV UHSHDWLQJ PDQ\ RI WKH KHURLFV RQ GLVSOD\ HLJKW GD\V HDUOLHU LQ &KLFDJR IRUFLQJ 'RQRYDQLQWRDPLVVDQGVDYLQJWZRRWKHUVKRWVLQFOXGLQJ ): (GVRQ %XGGOH¶V LQ WKH VHYHQWK URXQG « 2QFH DJDLQ WKH VHYHQWK URXQG ZDV WKH FKDUP WKLV WLPH DURXQG ') 5REELH 5XVVHOO EHLQJ FDOOHG XSRQ WR GHOLYHU « $IWHU VORWWLQJ D ORZ VKRW WKDW IRROHG *DOD[\ µNHHSHU -RVK 6DXQGHUVDQGVQXFNMXVWLQVLGHWKHEDVHRIWKHOHIWSRVWRQ ZKDW LV QRZ WKH &HQWXU\ /LQN )LHOG ³%URXJKDP (QG´ 5XVVHOO ZRXOG GURS WR KLV NQHHV VHWWLQJ RII D FHOHEUDWLRQ ILYHVHDVRQVLQWKHPDNLQJIRU5HDO6DOW/DNHDQGLWVIDQV ZKR WUDYHOHG WR 6HDWWOH E\ WKH WKRXVDQGV WR ZDWFK WKHLU WHDPPDNHKLVWRU\«  7KDW KLVWRULF WULXPSK PDUNHG WKH ILUVW PDMRUOHDJXH SURIHVVLRQDO VSRUWV WURSK\ WR EH FODLPHG E\ D 8WDK WHDP VLQFH WKH 8WDK 6WDU]] ZRQ WKH $%$¶V FKDPSLRQVKLS LQ EUHDNLQJDQHDUO\IRXUGHFDGHGURXJKWIRUWKHVWDWH¶V GHGLFDWHGIDQV«

2009 ALSO SAW RSL, SEA SPLIT POINTS: %DFN

LAST 12 MONTHS v SHARED CCL OPPONENTS:

%RWK 56/ DQG 6HDWWOH KDYH IDFHG UHJLRQDO SRZHUV 0RQWHUUH\ 0H[LFR  DQG 6DSULVVD &RVWD 5LFD  LQ WKH ODVW PRQWKVZLWKPL[HGVXFFHVV«56/HDUQHGDGUDZ LQ WKH ILUVW OHJ RI WKH  &21&$&$) &KDPSLRQV /HDJXH)LQDODW0RQWHUUH\JRDOVE\')1DW%RUFKHUVDQG 0) -DYLHU 0RUDOHV VHWWLQJ 56/ XS IRU WKH RSSRUWXQLW\ WR ZLQWKHFRQWLQHQWDOWLWOHDWKRPH«+RZHYHU56/GURSSHG DQ  GHFLVLRQ WR WKH 5D\DGRV GXH WR D ODWH ILUVW KDOI +XPEHUWR 6XD]R JRDO VQDSSLQJ 56/¶V RYHUDOO KRPH XQEHDWHQVWUHDNDWJDPHVLQDOOFRPSHWLWLRQV«  :HHNVHDUOLHU56/ZRQWKHVHULHVDJDLQVW6DSULVVDRQDQ DJJUHJDWH  VFRUHOLQH ZLQQLQJ  DW KRPH EHIRUH VXIIHULQJ D  ORVV LQ 6DQ -RVH DW 6DERULR¶V IRUPHU JURXQG (VWDGLR 5LFDUGR 6DSULVVD ± NQRZQ DV WKH 3XUSOH 0RQVWHU ± FOLQFKLQJ SDVVDJH ZLWK -DPLVRQ 2ODYH¶V ¶ HTXDOL]HU«  6LJL6FKPLG¶V6RXQGHUVIDFHGERWKFOXEVGXULQJWKHJURXS VWDJHRIWKHWRXUQH\WKDWVDZ56/DGYDQFHWRWKH )LQDO ORVLQJ  DW 6DSULVVD ODVW 6HSWHPEHU DIWHU JRLQJ GRZQ WR  PHQ /HR *RQ]DOH] UHG FDUG ¶  DQG DOVR GURSSLQJWKHKRPHOHJRQWKHILQDOPDWFKGD\RIJURXSSOD\  DV 6DSULVVD¶V -RVXH 0DUWLQH] WDOOLHG DQ ¶ JDPH ZLQQHU«  /DVW\HDUDJDLQVW0RQWHUUH\6HDWWOHGURSSHGDQJDPH DW KRPH GXULQJ PDWFKGD\  WKDW VDZ 1HUL &DUGR]R DQG $OGR GH 1LJULV HDFK VFRUH RQ HLWKHU VLGH RI KDOIWLPH« ,Q WKHUHWXUQOHJ6HDWWOHUDFHGWRDDZD\OHDGDWKDOIWLPH FRXUWHV\ RI D ¶ RZQ JRDO DQG D ¶ 0LNH )XFLWR VFRUH EXW DOORZHG WKUHH JRDOV LQ ILYH PLQXWHV GH 1LJULV ¶ 6XD]R ¶ DQG /XLV 3HUH] ¶  ODWH LQ WKH PDWFK ± D FROODSVH HHULO\ VLPLODU WR 56/¶V ODWH IDGH DW &UX] $]XO D PRQWKHDUOLHU«  6HDWWOH LPSURYHG WKHLU SHUIRUPDQFH DW ³7KH 7HF´ GXULQJ WKLV \HDU¶V JURXS VWDJH E\ ZLQQLQJ  DW 0RQWHUUH\ LQ $XJXVW GXULQJ 0DWFKGD\  RI WKH  &21&$&$) WRXUQH\EXWGURSSHGDKRPHGHFLVLRQLQWKHUHWXUQOHJ RQ 2FWREHU  WKDW DOORZHG 0RQWHUUH\ WR UHSHDW DV JURXS ZLQQHUV ZLWK 6HDWWOH KDYLQJ DOUHDG\ FOLQFKHG D 4XDUWHUILQDOEHUWK« 

SEATTLE SITE OF GREATEST RSL GLORY: :KLOH

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 



DQG6HDWWOHIHDWXUHKLJKO\WRXWHGSOD\HUVWKDWDUULYHGIURP &RORPELDQ SRZHUKRXVH VLGH 'HSRUWLYR &DOL « 56/ ') -DPLVRQ2ODYHDQG6HDWWOH):)UHG\0RQWHURZLOODJDLQ UHQHZ DFTXDLQWDQFHV DV ERWK SOD\HUV VSHQW WLPH ZLWK 'HSRUWLYR &DOL DFURVV WKH   DQG  VHDVRQV « $ WKLUG SOD\HU 6RXQGHUV )& ') -KRQ .HQQHG\ +XUWDGR DOVR MRLQHG WKH 0/6 UDQNV IURP WKH ³9HUGLEODQFRV´ DV WKH &RORPELDQ GHIHQGHU SOD\HG DORQJVLGH0RQWHURDW'HSRUWLYR&DOLGXULQJLWV&RSD 0XVWDQJVHDVRQ«

:LWK WKH UHWXUQ RI %HFNHUPDQ WR WKH OLQHXS 56/ DOVR DQ[LRXVO\DZDLWVWKHVWDWXVRI0)1HG*UDEDYR\ZKRKDV SOD\HG MXVW  PLQXWHV LQ VL[ DSSHDUDQFHV WKUHH VWDUWV  LQ WKH WHDP¶V  JDPHV VLQFH VXIIHULQJ D QDJJLQJ KDPVWULQJLQMXU\LQWKH-XO\KRPHORVVWR&ROXPEXV «0):LOO-RKQVRQKDVPLVVHGILYHRIWKHODVWJDPHV GXH WR &DQDGLDQ 1DWLRQDO 7HDP GXW\ DQG DQ DQNOH LQMXU\ VXIIHUHG RQ 2FW  MXVW  PLQXWHV LQWR DQ HYHQWXDO  0DSOH /HDI ZLQ RYHU 6W /XFLD « ') 7RQ\ %HOWUDQ¶V ODVW 0/6UHJXODUVHDVRQDSSHDUDQFHFDPHZLWKKLVPLQXWHV DW 6HDWWOH RQ 6HSW  SULRU WR WKH SDLU RI \HOORZV DV WKH IRXUWK\HDU RXWVLGH EDFN VXIIHUHG DQ DGGXFWRU VWUDLQ LQ D 6HSWUHVHUYHPDWFKY.&« 

EMERALD CITY CONNECTIONS: 5HDO 6DOW /DNH

(DFK WHDP ERDVWV $UJHQWLQH WDOLVPDQV SXOOLQJ WKH SOD\PDNLQJ VWULQJV \HW IHZ NQRZ WKDW -DYLHU 0RUDOHV 56/  DQG 0DXUR 5RVDOHV 6($  ZHUH RQFH WHDPPDWHV RQWKHVDPH1HZHOO¶V2OG%R\VFOXEEDFNLQSULRUWR WKHLU GLYHUJHQW SDWKV WR 0/6 « 6RXQGHUV )& 0) (ULN )ULEHUJ FDPH WR 0/6 HDUOLHU WKLV \HDU IURP 6ZHGLVK FOXE %. +DFNHQ DQG SOD\HG WKH IXOO  PLQXWHV LQ D  SUHVHDVRQ PDWFK DJDLQVW 56/ LQ )HEUXDU\ ¶ DW WKH 8QLYHUVLW\RI7DPSD«

FIRST LEG AT HOME BODES WELL FOR RSL: 56/¶V SRVWVHDVRQ DQG &21&$&$) &KDPSLRQV /HDJXH KLVWRU\LQGLFDWHVWKDW-DVRQ.UHLV¶WHDPDFWXDOO\SUHIHUVWR KRVW WKH ILUVW OHJ RI D WZRJDPH DJJUHJDWHJRDO  PLQXWHVHULHV«,QWKHVHVLWXDWLRQV56/LVDSHUIHFW DGYDQFLQJRYHU&KLYDV86$ 0/6 &ROXPEXV&UHZ  0/6  DQG 6DSULVVD  &&/  « :KHQ 56/ RZQVWKHKLJKHUVHHGRUE\GUDZKRVWVWKHVHFRQGOHJLW ERDVWVRQO\DPDUN VHULHVORVVHVDJDLQVW)&'DOODV  0/6  DQG 0RQWHUUH\  &&/  VDQGZLFKHG DURXQGDQRWKHUVHULHVZLQRYHU&ROXPEXV &&/ «  CAPTAIN KYLE BACK FOR PLAYOFFS: 56/ ZLOO EHHFVWDWLFWRZHOFRPHEDFNLWV&DSWDLQ.\OH%HFNHUPDQ WR WKH OLQHXS RQ 6DWXUGD\ DIWHU PLVVLQJ ³.%´ IRU WKH ODVW IRXU JDPHV GXH WR HLWKHU 86 0HQ¶V 1DWLRQDO 7HDP GXW\ RU WKH JDPH VXVSHQVLRQ DV D UHVXOW RI KLV ¶ UHG FDUG UHFHLYHG RQ 6HSW  DW KRPH YV &KLFDJR « 3OD\LQJ D PDQ GRZQ IRU  PLQXWHV DIWHU DOUHDG\ FRQFHGLQJ DQ  OHDG WR WKH )LUH 56/ VXIIHUHG LWV ZRUVW KRPH ORVV LQ WKH WHDP¶VVHYHQ\HDUKLVWRU\RQWKDWQLJKWWKHQSURFHHGHGWR ORVH  #/$ DQG  #9$1 ZLWKRXW %HFNHUPDQ EHIRUH PDQDJLQJ WR VHFXUH RQHSRLQW GUDZV RQ  #&2/ ± DOORZLQJ %HFNHUPDQ WR EHFRPH WKH RQO\ XQGHIHDWHG WLPH 5RFN\ 0RXQWDLQ &XS ZLQQHU ± DQG RQ Y325«(DUOLHULQ6HSWHPEHU%HFNHUPDQPLVVHG WKHWHDP¶VSRVWVHDVRQFOLQFKLQJYLFWRU\#1<VHUYLQJ D\HOORZFDUGDFFXPXODWLRQVXVSHQVLRQ«  $OO WROG 56/ PDQDJHG D  PDUN DFURVV 0/6 &&/ DQG 2SHQ &XS JDPHV QRW VWDUWHG E\ LWV &DSWDLQ ZKR ZDV IRUFHG LQ KHDUWEUHDNLQJ IDVKLRQ WR PLVV WKH VHFRQG KRPH OHJRIWKH&21&$&$)&KDPSLRQV /HDJXH )LQDO YV 0RQWHUUH\ EDFN LQ $SULO GXH WR \HOORZ FDUGDFFXPXODWLRQDVZHOO«

FIRST-­CHOICE XI (ALMOST) TOGETHER AGAIN:

KYLE & JAVI SHOW RETURNS TO AIR OCT. 29:

7KH ORQJHVW DQG PRVW GHYDVWDWLQJ DEVHQFH 56/ VDZ WKLV \HDU LQYROYHG 0) -DYLHU 0RUDOHV WKH WHDP¶V  093 DQG D  0/6 %HVW ;, VHOHFWLRQ « 0RUDOHV ± RXW IURP 0D\  WR 6HSW  GXH WR WKH DQNOH IUDFWXUH  GLVORFDWLRQ VXIIHUHG IROORZLQJ D EDG 0DUFR 0RQGDLQL WDFNOH DJDLQVW &KLYDV86$ ±PDGHKLVWKLUGFRQVHFXWLYHVWDUWDQGIRXUWK FRQVHFXWLYHDSSHDUDQFHODVW6DWXUGD\Y3RUWODQGSOD\LQJ RI56/¶VODVWPLQXWHVVHHNLQJWRUHPRYHWKHUXVW IURPKLVIRUPDQGJHWRQWKHVDPHSDJHDVKLVWHDPPDWHV HQWHULQJWKH0/6&XS3OD\RIIV«:KHQ0RUDOHVDQG %HFNHUPDQ ± WRJHWKHU IRU  JDPHV VLQFH DUULYLQJ RQ WKH :DVDWFK)URQWLQPLG±VHHWKHSLWFKWRJHWKHULWZLOO PDUN WKH ILUVW WLPH LQ 56/¶V ODVW  JDPHV   PLQXWHV VLQFH 0RQGDLQL¶V ODWH ILUVWKDOI WDFNOH VKDWWHUHG 0RUDOHV¶DQNOH«  DEPTH CONTINUALLY TESTED: 7KH UHWXUQ RI WDOLVPDQ0)-DYLHU0RUDOHV±WKHPDQZKRKDVPDGHWKH 56/ DWWDFN FOLFN VLQFH  ± FRXOG QRW FRPH DW D EHWWHU WLPHIRUWKH&ODUHWDQG&REDOW«7KLV\HDU¶VWLPHORVWGXH WRLQMXU\VXVSHQVLRQRULQW¶OGXW\ PLAYER

MIN. LOST

Javier  Morales   2430   Paulo  Junior   1880   Alvaro  Saborio   990   Arturo  Alvarez   990   Will  Johnson   990   Chris  Wingert   810   Fabian  Espindola   720   Jamison  Olave   540   Tony  Beltran   720   Ned  Grabavoy   540    

RECORD RETURN 12-­8-­6   5-­5-­6   3-­4-­3   4-­3-­3   2-­3-­3   6-­3-­2   1-­2-­2   1-­5-­0   2-­4-­2   1-­3-­2  

9/28  v  CHI   8/13  @  TOR     10/22  v  POR   9/24  @  DC     8/27  @  CHV   ???   ???  

7KH WRWDO QXPEHU RI JDPHV ORVW GXH WR LQMXU\ RU QDWLRQDO WHDP GXW\ WKLV VHDVRQ" « 0RUH WKDQ  JDPHV ZRUWK E\56/¶VWRSFRQWULEXWRUV«

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 

/,1(83&$5286(/&217,18(6«: 2QRQO\21( RFFDVLRQ LQ WKH ODVW  PRQWKV DFURVV 0/6 &21&$&$) DQG 2SHQ &XS FRPSHWLWLRQV KDV 5HDO 6DOW /DNH +HDG &RDFK-DVRQ.UHLVEHHQDEOHWRUROORXWWKHVDPHVWDUWLQJ ;, DV KH KDG WKH SUHYLRXV ZHHN WKDW ZRQGHUIXO IDWH KDSSHQLQJ RQ $XJ  RI WKLV VHDVRQ LQ 7RURQWR ± LQ WKH WK WHDP¶V   JDPH LQ DOO FRPSHWLWLRQV WKLV VHDVRQ « ,QMXULHVFDUGVVXVSHQVLRQVQDWLRQDOWHDPGXW\DQGIL[WXUH FRQJHVWLRQ KDG DOO FRQVSLUHG WR SUHYHQW D GXSOLFDWH OLQHXS LQ EDFNWREDFN PDWFKHV VRPHWKLQJ WKDW KDV KDSSHQHGMXVWRQFH RQ-XO\$XJ  ±LQDVSDQ RIWKHODVWJDPHVDFURVVDOOFRPSHWLWLRQV«

FRANCHISE-­HIGH 42 GAMES IN THE BOOKS: 'HVSLWH DOUHDG\ SOD\LQJ D IUDQFKLVHKLJK  JDPHV WKLV VHDVRQ 56/ KRSHV WKDW IRXU PRUH FRQWHVWV DUH SRVVLEOH RQWKHFDPSDLJQ«7KLV\HDU¶VJDPHV 0/6  &&/ DQG  2SHQ &XS  DUH HTXDO WR ODVW \HDU¶V LI \RX LQFOXGH WKH WZRJDPH :HVW 6HPL VHULHV ZLWK 'DOODV  0/6&&/2SHQ&XSH[KLELWLRQVDQG3OD\RII «  'XULQJ WKH  0/6 &XSZLQQLQJ VHDVRQ 56/ SOD\HG RQO\JDPHV UHJVHDVRQ2SHQ&XSH[KLELWLRQ DQG3OD\RII «$\HDUHDUOLHUZKHQ56/HPHUJHGDVWKH  :HVW VHHG GHIHDWHG &KLYDV DQG VDZ ZLOGFDUG 1< ERXQFH WRSVHHGHG +RXVWRQ DOORZLQJ 56/ WR KRVW WKH :HVW)LQDO 56/SOD\HGDWRWDORIJDPHV« 

ROLLERCOASTER YEAR PUT IN PERSPECTIVE:

2YHUDOO 56/ ZRQ  JDPHV LQ  PDWFKLQJ WKH RUJDQL]DWLRQ¶V 0/6 UHFRUG VHW LQ   ZKLOH WKH WHDP¶V  SRLQWV PDUNV WKH VHFRQGEHVW KDXO RYHU 5HDO 6DOW /DNH¶VVHYHQVHDVRQV«  56/¶V ILYHJDPH ZLQ VWUHDN LQ ODWH $XJXVW  HDUO\ 6HSWHPEHUHQGHGXSDVWKHORQJHVWUXQGXULQJWKHUHFRUG EUHDNLQJ0/6FDPSDLJQ\HWZDVVDQGZLFKHGE\GURXJKWV WKDWVDZ56/ORVHRI -XO\$XJ DQGGURSRI 6HSW±SUHVHQW «  7KH VHDVRQ NLFNHG RII ZLWK D &&/ 4XDUWHUILQDO VHULHV RQ )HE   0DUFK  DJDLQVW D IDPLOLDU RSSRQHQW LQ &ROXPEXV SRVWLQJ D  PDUN LQ DOO FRPSHWLWLRQV XS WR DQGLQFOXGLQJWKH0RUDOHVLQMXU\RQ0D\«7KHQH[W JDPHVVDZ56/ZLQRQO\DSDLUDVWKHWHDPZHQWDV WKH &&/ GLVDSSRLQWPHQW DQG 0RUDOHV GHVSDLU GRXEOH SXQFK UROOHG ULJKW LQWR ORVLQJ WKUHH NH\ SOD\HUV ± 6DERULR -RKQVRQ DQG $UWXUR $OYDUH] ± GXH WR &21&$&$) *ROG &XSGXW\«  7KDW WHVW RI GHSWK IRUFHG -DVRQ .UHLV WR XVH  SOD\HUV WKURXJKRXWWKHVHDVRQDV\RXQJSOD\HUV/XLV*LO&ROOHQ :DUQHU &KULV 6FKXOHU -HDQ $OH[DQGUH 1HOVRQ *RQ]DOH] $UWXU $JKDV\DQ &KULV $JRUVRU &RG\ $UQRX[DQG<RUGDQ\ $OYDUH]HDFKVDZDFWLRQ DWFULWLFDO MXQFWXUHVWKURXJKRXWWKH\HDUKRSLQJWKH³EDSWLVPE\ILUH´ H[SHULHQFHSD\VRIILIFDOOHGXSLQWKH3OD\RIIV«

#3 OVERALL SEED, RANGE OF IMPLICATIONS: :K\ LV WKH  VHHG VR FULWLFDO WR 56/" )LUVW ILQLVKLQJ LQ WKDW VORW JLYHV WKH &ODUHWDQG&REDOW D  FKDQFH RI UHWXUQLQJ WR QH[W \HDU¶V &21&$&$) &KDPSLRQV /HDJXH DV/RV$QJHOHV 6XSSRUWHUV6KLHOG DQG6HDWWOH 862SHQ &XS &KDPSLRQ  DUH DOUHDG\ TXDOLILHG « 6KRXOG RQH RI WKRVHWZRWHDPVDGYDQFHWR0/6&XSQH[WLQOLQHIRUWKH GXSOLFDWH  &&/ VSRW FUHDWHG E\ &XS SDUWLFLSDWLRQ LVWKHRYHUDOO0/6VHHG±5HDO6DOW/DNH«  PORTLAND REWIND: 56/¶V ILUVW KDOI ODVW 6DWXUGD\ DJDLQVWWKH7LPEHUVZDVGHHPHGE\PDQ\LQVLGHWKHWHDP WR EH WKH EHVW  PLQXWHV SOD\HG LQ WKUHH PRQWKV D ILUVW KDOI FXOPLQDWLQJ ZLWK HYHQWXDO 56/ *ROGHQ %RRW ZLQQHU WK $OYDUR6DERULR¶V JRDORIWKHVHDVRQ«$EDOOZRQDW PLGILHOGE\:LOO-RKQVRQZDVVHQWRXWZLGHWR):)DELDQ (VSLQGROD ZKR FXUOHG D ORIWHG EDOO LQWR WKH ER[ WR ILQG 6DERULR SHUIHFWO\ RQ VWULGH UHVXOWLQJ LQ WKH &RVWD 5LFDQ¶V FKLSRYHURQUXVKLQJ3RUWODQG*.7UR\3HUNLQV«  SABO SNAPS SCORELESS STREAK: 56/¶V ODWH ILUVW KDOI VWULNH E\ 6DERULR ODVW 6DWXUGD\ VQDSSHG D  PLQXWHVFRULQJGURXJKWIRU56/WKHJRDOWKHILUVWVLQFH): )DELDQ (VSLQGROD¶V ODWH ILUVWKDOI KHDGHU IURP D -DYLHU 0RUDOHV FRUQHU NLFN RQ 2FW  DW /RV $QJHOHV D VSDQ HTXDOLQJIXOOJDPHV« 

SABORIO SPECIAL FOR RSL STRIKE FORCE:

56/¶V SUHGDWRU\ VWULNHU Ã&#x2C6;OYDUR 6DERUtR PRYHG LQWR WKH WK WHDP¶VVFRULQJOHDGZLWKKLV JRDORIWKH\HDURQ 6HSW  DW '& FRPLQJ RII WKH EHQFK WR VFRUH KLV IRXUWK WK JRDO LQ KLV ODVW VL[ 0/6 JDPHV ± DQG KLV   VLQFH -XQH  ± WR SXW WRJHWKHU MXVW WKH IRXUWK GRXEOHGLJLW JRDO VHDVRQ LQ 56/¶V VHYHQ VHDVRQ KLVWRU\ -HII &XQQLQJKDP   6DERULR   )LQGOH\   VLQFH MRLQHGE\(VSLQGROD «  QG 7KHHDUO\ KDOIJDPHZLQQHURQ6HSWDW6HDWWOHZDV WK WKH   *:* IRU 6DERULR LQ KLV QRZ  0/6 JDPHV RYHU VW WKH ODVW WZR VHDVRQV ± SODFLQJ KLP LQ D   SODFH WLH ZLWK 5REELH)LQGOH\¶VJDPHZLQQHUVLQFDUHHU0/6JDPHV VW ± ZKLOH WKH SLQSRLQW KHDGHU DW 1< ZDV WKH   0/6 JRDO RYHUDOO IRU WKH &RVWD 5LFDQ LQWHUQDWLRQDO « ³6DER´ ZDV DOVR 56/¶V OHDGLQJ VFRUHU GXULQJ WKH KLVWRULF &21&$&$)&KDPSLRQV/HDJXHUXQVFRULQJJRDOVLQ JDPHV«  :KHQ 6DERUtR ± WKH ILUVW '3 LQ 56/¶V VHYHQVHDVRQ KLVWRU\ ±ILQGVWKHEDFN RIWKHQHW-DVRQ.UHLV¶WHDPLV D GRPLQDWLQJLQDOOFRPSHWLWLRQV RQO\ORVVSULRUWR  DW '& ZDV WKH UDLQVRDNHG  ORVV DW &UX] $]XO  FRPSDUHG WR WKH  PDUN ZKHQ KH SOD\V DQG GRHV QRW VFRUH DV ZHOO DV 56/¶V  UHFRUG ZKHQ 6DER LV XQDYDLODEOH« 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 ESPINDOLA MOVES INTO NEW TERRITORY:

DEFENSE THE BACKBONE OF RSL SUCCESS:

56/¶V ³RWKHU´ ): )DELDQ (VSLQGROD KHDGHG KRPH D WK -DYLHU 0RUDOHV FRUQHU NLFN LQ WKH   PLQXWH DW /$ RQ WK 2FWREHU  IRU KLV   JRDO RI WKH VHDVRQ PDWFKLQJ WKH RXWSXW RI KLV VWULNH SDUWQHU &RVWD 5LFDQ LQWHUQDWLRQDO $OYDUR 6DERULR « :LWK WKH GXR HDFK QRWFKLQJ  JRDOV WKLV VHDVRQ 56/ ERDVWV D SDLU RI GRXEOHGLJLW VFRUHUV IRU WKH ILUVW WLPH LQ LWV VHYHQVHDVRQ KLVWRU\ « (VSLQGROD¶V WK JRDOZDVWKH RIKLVILYH\HDU56/FDUHHUVSDQQLQJ 0/6 JDPHV « $ OLVW RI 56/¶V VLQJOHVHDVRQ GRXEOHGLJLW VFRUHUV

56/¶V RQFHYDXQWHG UHDUJXDUG KDV QRZ FRQFHGHG  JRDOVWKURXJK0/6JDPHVLQFOXGLQJWKHDOORZDQFHRI RQHJRDORUIHZHULQ RI0/6FRQWHVWV« 7KHWHDP ERDVWHG D OHDJXHORZ  *$$ SULRU WR WKH ILQDO VL[ PDWFKHV LQFOXGLQJ ILYH 3.V DPRQJ WKH  WRWDO JRDOV FRQFHGHG«  $PRQJ 56/¶V  ZLQV WKURXJK  JDPHV DUH ILYH YLFWRULHV E\ D  FRXQW HPSKDVL]LQJ WKH FULWLFDO QDWXUH RIWKHWHDP¶VFRPPLWPHQWWRGHIHQVH«7KHWRWDORI ILYHZLQVLVDVHDVRQUHFRUGDQGHTXDOVWKHFRPELQHG WRWDORI WKUHH DQG WZR «

SINGLE-­SEASON GOALS ² RSL YEAR PLAYER GP GOALS 2011    Alvaro  Saborio                                23        11              Fabian  Espindola                            27        10   2010    Alvaro  Saborio                                27        12   2009    Robbie  Findley                                27        12   2006    Jeff  Cunningham                              31        16    

ANOTHER PIECE OF HISTORY FOR RSL: /DVW 6DWXUGD\¶VWLHDJDLQVW3RUWODQGJDYH56/WKHGLVWLQFWLRQDV WKHWHDPZLWKWKHKLJKHVW+20(ZLQQLQJSHUFHQWDJHRYHU DQ\ IRXUVHDVRQ VSDQ « 56/ IHOO RQH YLFWRU\ VK\ RI &ROXPEXV¶ WRWDO RI  ZLQV IURP  EXW 56/ ZRXOG HQG WKH JDPH UXQ ZLWK KDOI DV PDQ\ ORVVHV   DV WKH &UHZ  «7KHOLVWFRXUWHV\(OLDV6SRUWV%XUHDX Fewest  HOME  losses  over  4  seasons  [since  elimination  of   OT  (2004±11)]:    5      2008-­2011    Real  Salt  Lake  (38-­5-­19,  .766)   8 2006-2009 Houston (35-­8-­19,  .718) 10 2008-2011 Columbus (39-­10-­13,  .734) 12 2004-2007 D.C. United (37-­12-­13,  .702) 12 2008-2011 Los Angeles (34-­12-­16,  .677)

CLEAN SHEET RETURN TO RSL REPETOIRE: 56/¶V FRPPLWPHQW WR GHIHQVH LQ WKH SHQXOWLPDWH UHJXODU VHDVRQ JDPH RQ  DW &RORUDGR UHZDUGHG *. 1LFN VW 5LPDQGR ZLWK KLV   FDUHHU VKXWRXW ZLWK WKH FOXE VQDSSLQJ D ILYHJDPH VSDQ ZLWKRXW D FOHDQ VKHHW WKH ORQJHVWHQGXUHGE\56/VLQFH$SULORI«7KH³]HUR´ WK WK ZDV5LPDQGR¶VOHDJXHKLJK RIWKHVHDVRQDQGWKH  RYHUDOO E\ 56/ 5H\QLVK $SULO   VHFRQG RQO\ WR /RV $QJHOHV¶ FROOHFWLRQ RI  FOHDQ VKHHWV E\ 5LFNHWWV DQG 6DXQGHUVWKLV\HDU«  56/¶V VHDVRQHQGLQJ VNLG ± ZLQOHVV LQ VL[ JDPHV VLQFH FOLQFKLQJD0/6&XS3OD\RIIEHUWKEDFNRQ6HSW ZLWK D  URDG: DW 1< ± VDZ WKH WHDP¶V GHIHQVH DOORZ JRDOVLQLWVODVWJDPHVDIWHUDOORZLQJMXVWJRDOVLQ WKHSUHYLRXV«  $ \HDU DJR 56/ VHW WKH PRGHUQGD\ PDUN ZLWK  JRDOV DOORZHGLQJDPHVHFOLSVLQJWKH+RXVWRQ'\QDPR PDUNRIJRDOVDOORZHGRYHUWKHVDPHVSDQ« 

WK

7KH VKXWRXW DW &RORUDGR ZDV 5LPDQGR¶V   RI WKH VW VHDVRQ 5H\QLVK#1( DQGWKH RIKLVJDPH WK 56/ FDUHHU DV ZHOO DV WKH   RI KLV  FDUHHU 0/6 JDPHV ZLWK 56/ SUHVHQW  '& 8QLWHG   DQG0LDPL  «2QO\FXUUHQW)&'DOODV*..HYLQ +DUWPDQ KDV PRUH FDUHHU ³GRQXWV´ WKDQ 5LPDQGR ZLWK  FOHDQ VKHHWV LQ  JDPHV  DGG¶O VKXWRXWV LQ  PRUH JDPHV  « (DFK RI WKH µNHHSHUV KDV D SDLU RI 0/6 &XSULQJV« 

UNFAMILIAR RUN OF FORM FOR KREIS, RSL:

:LWK WKH 2FWREHU  ORVV DW %& 3ODFH LQ 9DQFRXYHU 56/ VXIIHUHGLWVIRXUWK FRQVHFXWLYH0/6 ORVV ±VRPHWKLQJWKDW KDV KDSSHQHG MXVW RQFH VLQFH -DVRQ .UHLV EHFDPH KHDG FRDFK EDFN LQ -XO\ RI  « )RXU \HDUV DJR DIWHU MXVW  0/6 86 2SHQ &XS DQG H[KLELWLRQ JDPHV LQWR -DVRQà¯&#x2020;V FDUHHU GXULQJ DQ DFWLYH SHULRG RI SOD\HU PRYHPHQW LQ DQG RXW RI -DVRQ¶V V\VWHP 56/ VXIIHUHG D KRPHORVVWR7RURQWR)&RQ-XO\IROORZLQJWKDWXS ZLWK URDG ORVVHV DW &ROXPEXV DW .DQVDV &LW\ DQG DW 1HZ (QJODQG«  ,I \RX LQFOXGH DOO FRPSHWLWLRQV 56/ KDG QRW ORVW WKUHH FRQVHFXWLYHPDWFKHVVLQFH0D\RIZKHQURDGORVVHV DW &RORUDGR DQG 'DOODV ZHUH IROORZHG E\ DQ 2SHQ &XS ORVVDW&ROXPEXV±WKHRQO\SUHYLRXV WLPHLQ-DVRQ¶VIRXU IXOO VHDVRQV DW WKH KHOP ZLWK EDFNWREDFNWREDFN ORVVHV «  ROAD WARRIORS CONTINUE TO STUMBLE: 7KH GUDZ DW &RORUDGR RQ  ZDV 56/¶V IRXUWK FRQVHFXWLYH ZLQOHVV SHUIRUPDQFH RQ WKH URDG IROORZLQJ WKH WHDP¶V WKUHHJDPH URDG ZLQ VWUHDN IURP $XJ 6HSW  PDWFKLQJ WKH IUDQFKLVH KLJK VHW EDFN LQ $XJXVW  « 2QFHWKHZRUVWURDGWHDPLQWKHKLVWRU\RI0/65HDO6DOW /DNH VWHSV XS RQ WKH URDG ZKHQ FRPSHWLWLRQ LV ILHUFHVW ZLQQLQJ FULWLFDO SRVWVHDVRQ PDWFKHV LQ  RQ WKH URDG DQG SHUIRUPLQJ ZHOO DZD\ IURP KRPH LQ KRVWLOH &21&$&$) &KDPSLRQV /HDJXH WHUULWRU\ « $ UHFHQW DGYHQW RI URDG VXFFHVV SODFHV WKH VTXDG¶V DOOWLPH 0/6 UHJXODU VHDVRQ URDG PDUN DW    *)  WK  *$  IROORZLQJ WKH   URDG FRQWHVW LQ /HDJXH SOD\ ODVWZHHNDW&2/«

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 

MORE ROAD-­WEARY NUMBERS: 6LQFH .UHLV WRRN RYHU 56/¶V 0/6 URDG PDUN LV  ZLWK WKH QHZ WHDP PDUN RI ILYH URDG ZLQV WKLV \HDU H[FHHGLQJ WKH IRXU DFKLHYHGLQDQGPRUHWKDQGRXEOLQJWKHWZRHDUQHG LQHDFKRIWKHVHDVRQV«7KLV \HDU¶VURDG PDUN LV JRRG IRU  SRLQWV PDWFKLQJ ODVW \HDU¶V WHDP UHFRUGWRWDO LQ «6WDUWLQJEDFNRQ$XJDW 7RURQWRDQGIDFWRULQJLQWKHQHZ2FWGDWHQRUWKRIWKH ERUGHU WKH &ODUHWDQG&REDOW SOD\HG  RI LWV ILQDO  UHJXODU VHDVRQ FRQWHVWV ± DQG  RI WKH ODVW  ± DZD\ IURP WKH IULHQGO\ FRQILQHV RI 5LR 7LQWR 6WDGLXP « ³56/1DWLRQ´ZDVXQDEOHWRVFUDWFK&DQDGDRIIWKHOLVWRI SODFHV LWV EHORYHG &ODUHWDQG&REDOW KDYH QHYHU ZRQ 7H[DV&DQDGD3KLODGHOSKLD3RUWODQG «

HISTORIC HOME LOSS VS CHICAGO: 2Q 6HSWHPEHU  IRU WKH ILUVW WLPH LQ LWV \HDU KLVWRU\ 5HDO 6DOW/DNHORVWDKRPHJDPHE\DJRDOPDUJLQ «56/ DOVR VDZ D JRDO ORVV ODWH LQ LWV 0/6 &XS ZLQQLQJ VHDVRQ GURSSLQJ DQ  GHFLVLRQ DW 'DOODV DOPRVW WZR \HDUVDJRWRWKHGD\DV6DWXUGD\¶VORVVLQ'&«56/ ZHQW RQ WR ZLQ VL[ RI LWV ILQDO VHYHQ JDPHV WKDW \HDU LQFOXGLQJ WKH H[WUD WLPH VKRRWRXW ZLQ RYHU WKH *DOD[\ LQ 6HDWWOHWRUDLVHWKH&XS«$OLVWRIDOOWKHJRDOORVVHVRU JRDOVDOORZHGJDPHVLQ56/KLVWRU\EHORZ«   Jason  Kreis  (68-­47-­52):   DATE   OPP.   RESULT   10/06/2011   @VAN   L  0-­3   09/28/2011   vCHI   L  0-­3   09/24/2011   @DC   L  1-­4   08/25/2010   @CAZ   L  4-­5   09/26/2009   @DAL   L  0-­3   04/28/2009   @SEA   L  1-­4   08/23/2008   @CLB   L  0-­3   08/16/2008   @HOU   L  3-­4   04/26/2008   @DC   L  1-­4   09/08/2007   @HOU   L  3-­4  

John  Ellinger  (17-­39-­16):   DATE   OPP.   RESULT     08/26/2006   @NY   L  0-­6   04/02/2006   @CHV   L  0-­3   08/31/2005   @DC   L  1-­5   08/13/2005   @KC   L  2-­4   08/10/2005   @NE   L  1-­4   07/13/2005   @MIN   L  4-­6   07/09/2005   @CHV   L  1-­5   06/18/2005   @SJ   L  0-­3   05/28/2005   @CHI   L  0-­3   04/23/2005   @DAL   L  0-­3  



BACK-­TO-­BACK DEFENSIVE DEBACLES: 7KH)LUH  '& GHEDFOHV DOVR PDUN WKH ILUVW WLPH 56/ KDV HYHU GURSSHG EDFNWREDFN JDPHV E\  JRDOV DQG RQO\ WKH ILIWKWLPHLQWHDPKLVWRU\WKDWJRDOVKDYH EHHQDOORZHG LQPLQXWHV«7KHOLVW       DATE              OPPONENT                    RESULT   07/09/2005        at  Chivas  USA          L  1-­5   07/16/2005        at  Kansas  City        L  2-­3   08/10/2005        at  New  England        L  1-­4   08/13/2005        vs  Kansas  City        L  2-­4   08/19/2006        vs  Houston                W  3-­1   08/26/2006        at  New  York              L  0-­6   08/16/2008        at  Houston                L  3-­4   08/23/2008        at  Columbus              L  0-­3   09/24/2011        at  D.C.  United        L  1-­4   09/28/2011        vs  Chicago                L  0-­3  

 $GGLQJ LQVXOW WR LQMXU\ WKH EDFNWREDFN KDW WULFNV E\ '&¶V 'ZD\QH 'H5RVDULR DQG &KLFDJR¶V 0DUFR 3DSSD DJDLQVW 56/ PDUN RQO\ WKH VHFRQG RFFDVLRQ LQ WKH  \HDUKLVWRU\RI0DMRU/HDJXH6RFFHU±VSDQQLQJ JDPHV ±WKDWDWHDPKDVJLYHQXSFRQVHFXWLYHJRDO SHUIRUPDQFHVWRDQRSSRQHQW 1HZ(QJODQG « 

 7KH WUXO\ EL]DUUH SDUW WKDQNV WR (OLDV 6SRUWV %XUHDX  LV WKDW WKH ³KDW WULFN DQRPDO\´ FRPHV RQ WKH KHHOV RI 56/ VHWWLQJDQDOOWLPH0/6UHFRUGRIFRQVHFXWLYHJDPHV ZLWKRXWDOORZLQJDQRSSRVLQJSOD\HUWREDJHYHQ7:2 JRDOV LQ D JDPH « 7KH KDW WULFNV FRQFHGHG DUH WKH ILIWK DQG VL[WK DOORZHG E\ 56/ LQ LWV JDPH 0/6  &&/ KLVWRU\ « 7KH  JRDOV DOORZHG LQ EDFNWREDFN JDPHVPDUNVRQO\WKHILIWKVXFKRFFDVLRQLQWHDPKLVWRU\ DQGWKHILUVWVLQFH$XJXVW«

WHAT A DIFFERENCE A WEEK MAKES: 5HDO6DOW /DNH¶V  YLFWRU\ RQ 6HSWHPEHU  DW 1HZ <RUN DOORZHG 56/WRHTXDOLWVDOOWLPHKLJKIRUZLQVLQDVHDVRQ   PDWFKLQJLWVWRWDOLWDOVRJDYH56/DQHZVWDQGDUG IRU URDG ZLQV   LQ D VHDVRQ VXUSDVVLQJ WKH IRXU DZD\ YLFWRULHVFODLPHGLQDQG«  7KHWKUHHJRDOVLQWKHILUVWPLQXWHVPDUNHGWKHIDVWHVW VWDUW WR D  OHDG VXUSDVVLQJ WKH WULR RI ILUVWKDOI JRDOV VFRUHGLQPLQXWHV RQ-XO\  Y'$/  DQGLQ PLQXWHV RQ 0DUFK   Y /$  « 7KDW QLJKW DW 5HG %XOO $UHQD PDUNHG WKH ILUVW WLPH (9(5 WKDW 56/ VFRUHG WKUHHJRDOVLQDKDOIRQWKHURDG«  $QGIRUPLQXWHV DJDLQVWWKH5HG%XOOVSULRUWRWKH¶ FRQVRODWLRQ VFRUH E\ 1HZ <RUN¶V -RHO /LQGSHUH 56/ VDZ LWV DOOWLPH FOXE JRDO GLIIHUHQWLDO VWDQG DW (9(1 « $Q DPD]LQJ DFFRPSOLVKPHQW FRQVLGHULQJ WKH VHYHQ\HDU ROG FOXE ZDV  LWV ILUVW WZR VHDVRQV DQG  SULRU WR WKH QG -DVRQ .UHLV FRDFKLQJ HUD « 6LQFH WKH   )DELDQ (VSLQGRODJRDOJDYH56/DILUVWKDOIOHDG-DVRQ.UHLV KDV VHHQ KLV &ODUHWDQG&REDOW VLGH RXWVFRUHG  ZLWK RQO\ D ODWH $OYDUR 6DERULR VFRUH DW '& DQG )DELDQ¶V ILUVWKDOIKHDGHUDW/$ILQGLQJWKHEDFNRIWKHQHW«,Q DOOWLPH 0/6 PDWFKHV 56/ KDV QRZ VFRUHG  JRDOV ZKLOHDOORZLQJ« ´%25-­/$9(µ 3$,5,1* SUFFER RARE LOSSES:

:KHQ  %HVW ;, GHIHQGHUV 1DW %RUFKHUV DQG -DPLVRQ2ODYHVWDUWWRJHWKHUDQGSOD\PLQXWHV5HDO 6DOW /DNH KDG SRVWHG DQ  PDUN WKLV VHDVRQ SULRU WR WKH UHFHQW IRXUJDPH VNLG DOORZLQJ RQO\  JRDOV LQ WKH SULRU  JDPHV « :KHQ LQMXU\ VXVSHQVLRQ RU UHG FDUGV OLPLWWKHGXR¶VWLPHWRJHWKHUDQGFDXVHRQHRUERWKWRPLVV DFWLRQ 56/ LV RQO\  ZLWK  JRDOV FRQFHGHG « ,Q DGGLWLRQWRUHVWLQJRQ6HSWDW'&2ODYH±DQ0/6$OO 6WDU WKLV VHDVRQ ± KDV PLVVHG RQH JDPH GXH WR WKH UHG FDUG RQ 0D\  LQ WKH KRPH ORVV WR 6HDWWOH WZR URDG JDPHVRQWXUIWKDWIROORZHG&21&$&$)JDPHVKRXUV HDUOLHU DQG ILYH JDPHV GXH WR WKH NQHH LQMXU\ VXIIHUHG LQ WKH 0/6 $OO6WDU *DPH LQ ODWH -XO\ DJDLQVW 0DQFKHVWHU 8QLWHG« 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 BECKERMAN SEES MVP HOPES FADE: 56/

SEEING RED YET AGAIN: :LWK 0) &ROOHQ :DUQHU¶V

&DSWDLQ.\OH%HFNHUPDQ±RIWHQWKHKHURGXULQJWKHILYH PRQWKDEVHQFHRISOD\PDNHU-DYLHU0RUDOHVWKLVVHDVRQ± ZDVORVW DJDLQVW/RV$QJHOHVGXHWR UHGFDUGVXVSHQVLRQ WK IROORZLQJDPRPHQWDU\ORVVRIFRQWUROLQWKH PLQXWHRI WKH6HSWKRPHORVVYV&KLFDJR«+HDOVRPLVVHGODVW )ULGD\¶V 5RFN\ 0RXQWDLQ &XS GXHO DW &RORUDGR DQG WKH KRPH UHJXODUVHDVRQ ILQDOH DJDLQVW 3RUWODQG RQ 2FW  DIWHU WKH 0/6 'LVFLSOLQDU\ &RPPLWWHH KDQGHG KLP DQ DGGLWLRQDO WZRJDPH VXVSHQVLRQ IRU ³HQGDQJHULQJ WKH VDIHW\ RI DQ RSSRQHQW´ « -XVW DIWHU 56/ FRQFHGHG DQ HDUO\ 0DUFR 3DSSD VFRUH )LUH ') 'DQLHO 3DODGLQL FKDOOHQJHG %HFNHUPDQ IURP EHKLQG FDXVLQJ WKH \HDU YHWHUDQWRORVHKLVKHDGDQGWKURZKLVVKRXOGHUKHDGLQWR 3DODGLQL¶V MDZ « 5HIHUHH %DOGRPHUR 7ROHGR LPPHGLDWHO\ VHQW%HFNHUPDQRIIWKHILUVWUHGFDUGRI&DSWDLQ.%¶V JDPH 56/ FDUHHU DQG MXVW WKH VHFRQG RI KLV  JDPH0/6FDUHHUZLWK0LDPL&RORUDGRDQG56/«  ³,W¶VQRWOLNHPH´%HFNHUPDQVDLG³,W¶VQRWVRPHWKLQJ,¶YH GRQH LQ WKH SDVW ,W ZDV MXVW VRPHWKLQJ RXW RI QRZKHUH DQG,MXVWIHHOEDGDQGVRUU\WRQRWRQO\RXUIDQVKHUHEXW DOVRWRWKHOHDJXHEHFDXVH,IHHOWKDWZH¶UHUHDOO\WU\LQJWR JURZWKLVOHDJXHDQGLW¶VJURZQDWRQEXWWKDWW\SHRISOD\ KDVQRSODFHKHUHLQRXUJDPHVLQ0/6,PDGHDPLVWDNH DQG , MXVW VSOLWVHFRQG PDGH D GHFLVLRQ WKDW ZDV UHDOO\ KXUWIXO WR WKH WHDP $QG VR ,¶P VRUU\ IRU WKDW )RU PRVW RI P\ FDUHHU ,¶YH EHHQ DEOH WR QRW GR DQ\WKLQJ VWXSLG OLNH WKDW´%HFNHUPDQVDLG³/DVWQLJKW ZDVRQHRIWKRVHIUHDN PRPHQWV WKDW , OHW JHW DZD\ IURP PH ,¶P VRUU\ IRU WKDW DQG HPEDUUDVVHG ,¶OO GR HYHU\WKLQJ , FDQ WR QRW OHW LW KDSSHQDJDLQ´  7KH \HDUROG PLGILHOGHU OHDGV 56/ LQ DVVLVWV ZLWK WK QLQH±JRRGIRUD SODFHWLHLQWKH/HDJXHH[WHQGLQJ DFDUHHUKLJK±WRJRDORQJZLWKILYHJDPHZLQQLQJDVVLVWV GXULQJ 56/¶V ZLQ  VHDVRQ VHFRQG RQO\ WR WKDW RWKHU ³%HFNV´ /$ *DOD[\ PLGILHOGHU 'DYLG %HFNKDP « .%¶V FDUHHU WRWDO RI  JDPHZLQQLQJ DVVLVWV OHDGV 56/ DOOWLPH WKUHH DKHDG RI 0) -DYLHU 0RUDOHV   « 7KH 56/ &DSWDLQ KDV VWDUWHG DQG SOD\HG D IXOO  PLQXWHV LQ  RI 56/¶V  JDPHV WKLV \HDU  RXW RI  0/6 JDPHVDORQJZLWKRI&&/PDWFKHVDQGWKH2SHQ&XS 4XDUWHUILQDO DW 'DOODV  « 2XW RI WKH  JDPHV LQ DOO FRPSHWLWLRQV%HFNHUPDQKDVVDWRXWRQO\WKH&&/)LQDOY 0RQWHUUH\DQGDW1HZ<RUN VXVSHQGHGIRUERWKGXH WR\HOORZFDUGDFFXPXODWLRQ WKH2SHQ&XSKRPHZLQ Y:LOPLQJWRQ+DPPHUKHDGVDQGODVWZHHNDW9$1«  3ULRUWRWKHUHGFDUGDQGWKHUHVXOWDQWVXVSHQVLRQQDWLRQDO VRFFHU VFULEHV 6WHYH 'DYLV 6,FRP  *UDQW :DKO 6,FRP  DQGQRZ5LGJH 0DKRQH\ 6RFFHU$PHULFD  DQG ,YHV *DODUFHS )R[6RFFHUFRP  KDG HDFK PHQWLRQHG %HFNHUPDQ DV D GDUN KRUVH FDQGLGDWH LQ WKH  0/6 093 UDFH IRU KLV WLUHOHVV HIIRUWV WR DVVXPH 56/¶V SOD\PDNLQJPDQWOHLQSODFHRIWKHLQMXUHG -DYLHU0RUDOHV « 

ILUVWKDOI HMHFWLRQ 2FWREHU  DW 9DQFRXYHU 56/ KDV QRZ VHHQ  SOD\HUV HMHFWHG LQ LWV ODVW  JDPHV GDWLQJ EDFN WR WKH -DYLHU 0RUDOHV HMHFWLRQ DW 'DOODV LQ ODVW \HDU¶V SOD\RIIV«7KLVDIWHUVHHLQJMXVWRQHUHGFDUGIRUWKHEXON RI  RQO\ D EHQFK UHG WR (VSLQGROD LQ D &21&$&$) QG PDWFKLQ3DQDPD «')7RQ\%HOWUDQVDZUHG HDUO\   KDOI LQ 56/¶V ILUVW JDPH RI WKH \HDU DW &ROXPEXV LQ WKH )HE  &21&$&$) 4XDUWHUILQDO DQG DJDLQ 6HSW  LQ 6HDWWOH « ,Q EHWZHHQ ') 1DW %RUFKHUV KDV VHHQ  UHG FDUGV -DPLVRQ 2ODYH RQH DQG 0) :LOO -RKQVRQ RQH SULRU WR .\OH %HFNHUPDQ¶V HMHFWLRQ RQ 6HSW  DQG WKH &ROOHQ :DUQHU UHG « )LYH RI WKLV \HDU¶V VHYHQ 0/6 UHG FDUGV DJDLQVW 56/ KDYH FRPH LQ WKH ILUVW KDOI RI JDPHV ZLWK -DVRQ .UHLV¶ PDQ VLGHV SRVWLQJ D  PDUN LQ WKRVHPDWFKHV«  )ROORZLQJWKH6HSWHPEHUHMHFWLRQRI6RXQGHUV')-KRQ WK .HQQHG\ +XUWDGR LQ WKH   PLQXWH DW 6HDWWOH 56/ RSSRQHQWV KDYH QRZ EHHQ VXEMHFW WR HMHFWLRQ RQ  RFFDVLRQV JLYLQJ WKH &ODUHWDQG&REDOW D WRWDO RI  PLQXWHVZLWKDPDQDGYDQWDJH«'XULQJWKRVHPLQXWHV 56/KDVQRZVHHQDJRDOGLIIHUHQFHWKDQNVWRWKH JRDORXWEXUVWRQ-XO\YV6-«  $OOWLPH 56/ QRZ KDV EHHQ YLFWLP RI  UHG FDUGV VXFFXPELQJ WR D  JRDO GLIIHUHQFH LQ D WRWDO RI  PLQXWHVSOD\LQJDPDQGRZQ«,QFUHGLEO\6,;RIWKRVH QLQHJRDOVFDPHLQRQHJDPHWKHORVV#1<LQ$XJXVW WK  ZKHQ')-DFN6WHZDUWZDVWRVVHGLQWKH PLQXWH « 56/ KDV QHYHU SOD\HG ZLWK MXVW QLQH PHQ GXH WR GLVFLSOLQDU\ LVVXHV DQG KDV QRZ VFRUHG 6(9(1 VKRUW KDQGHG JRDOV -DVRQ .UHLV  Y 1< &KULV .OHLQ  .UHLVY'$/D&KULV/HLWFKRZQJRDORQY 6-1HOVRQ*RQ]DOH]ODWHJRDORQY6($DQGWKH -RKQVRQ6DERJRDOVRQ-XO\ «

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 R6/ ´%5$&,1*µ )25 SUCCESS: :LWK ): )DELDQ

NEW BLOOD JOINING RSL « : $W WKH GHDWK RI WKH

(VSLQGROD¶VWZRJRDOµEUDFH¶6HSWDW1<56/KDVQRZ VHHQRILWVDOOWLPHPXOWLJRDOSHUIRUPDQFHVRFFXURQ WKH URDG LQ LWV JDPH 0/6 UHJXODUVHDVRQ JDPH  JDPH&&/DQGJDPH2SHQ&XSKLVWRULHV«7KHPXOWL QG JRDO JDPH ZDV (VSLQGROD¶V   DFURVV DOO FRPSHWLWLRQV W\LQJKLPZLWK56/DWWDFNLQJOXPLQDULHV-DVRQ.UHLV   DQG<XUD0RYVLV\DQ  «  6DERULR RZQV  PXOWLJRDO SHUIRUPDQFHV DFURVV DOO FRPSHWLWLRQV DKHDG RI -HII &XQQLQJKDP   DQG -DYLHU 0RUDOHV¶ WLH ZLWK 5REELH )LQGOH\ ZLWK IRXU ³EUDFHV´ ZKLOH (VSLQGROD 0RYVLV\DQ DQG .UHLV HDFK KDYH  DKHDG RI 3DXOR -XQLRU :LOO -RKQVRQ .\OH %HFNHUPDQ $WLED +DUULV DQG &KULV %URZQ ZKR KDYH HDFK DOVR VFRUHG  RU PRUHWLPHVLQDJDPH«  :KHQ DQ 56/ SOD\HU VFRUHV  RU PRUH JRDOV LQ D JDPH WKH WHDP KDV SRVWHG D  DOOWLPH PDUN « %HVLGHV WKHORVVDW&UX] $]XO LQ&&/ SOD\ DQGWKH ORVVDW 0LQQHVRWD LQ 2SHQ &XS DFWLRQ ZKHQ ZDV WKH ORQH 0/6 ORVV"«-XQHZKHQ&KULV%URZQ¶VEUDFH#/$ ZDVZDVWHGLQDORVV

6HSW  0/6 URVWHU IUHH]H 56/ *0 *DUWK /DJHUZH\ DQQRXQFHGWKHDGGLWLRQRIWZRSOD\HUVWRWKHWHDP¶VURVWHU «-RLQLQJ56/RQORDQIURP86/352&KDPSLRQ2UODQGR &LW\)&0)<RUGDQ\$OYDUH]ZLOOZHDUIRUWKH&ODUHW DQG&REDOW « 1RZ  \HDUV ROG DQG UHFHQWO\ QDPHG WKH 093 RI WKH 'LYLVLRQ  86/ 352 OHDJXH $OYDUH] LV D &XEDQERUQ DV\OHH ZKR GHIHFWHG WR WKH 8QLWHG 6WDWHV GXULQJ WKH 2O\PSLF TXDOLI\LQJ WRXUQH\ LQ  « 7KH KROGLQJPLGILHOGHUSOD\HGDW5LR7LQWR6WDGLXPLQ0DUFKRI ZLWKWKH$XVWLQ$]WH[KLVVLGHLQDVZHOOSULRU WRWKHRUJDQL]DWLRQ¶VPRYHWR2UODQGRODVWZLQWHU«  <RUGDQ\¶V SHUIRUPDQFH 6HSW  DW 1HZ <RUN ZDV DPD]LQJ RQ VHYHUDO IURQWV WKH ILUVW SOD\HU LQ UHFHQW PHPRU\WREHVLJQHGE\WKH/DJHUZH\.UHLVUHJLPHDQG IRUFHG TXLFNO\ LQWR DFWLRQ « 7KH &XEDQ $OYDUH] KDG  WRXFKHV LQ KLV 0/6 GHEXW FRPSOHWLQJ  RI KLV SDVVHV DQGZLQQLQJRIGXHOVDFFRUGLQJWR2SWD« 



G Player

Date

Opponent Result

2    Fabian  Espindola                          09/21/2011   @  NY          W  3-­1   2    Álvaro  Saborío                              07/23/2011      vs.  SJ      W  4-­0   2    Álvaro  Saborío                              06/25/2011      vs.  TOR    W  3-­1   2    Javier  Morales                              03/26/2011   vs.  LA      W  4-­1   2    Javier  Morales                              03/01/2011      vs.  CLB    W  4-­1*   2    Álvaro  Saborío                              10/23/2010   @    COL      T  2-­2   2    Paulo  Junior                                  10/18/2010   vs.  CAZ    W  3-­1*   2    Will  Johnson                                  09/25/2010      @    AUO      W  3-­2*   2    Álvaro  Saborío                              08/25/2010   @    CAZ      L  4-­5*   2    Álvaro  Saborío                              08/18/2010   vs.  AUO    W  2-­1*   2    Javier  Morales                              08/14/2010   vs.  CLB    W  2-­0   2    Álvaro  Saborío                              07/02/2010   vs.  NE      W  5-­0   2    Álvaro  Saborío                              05/13/2010   vs.  HOU    W  3-­1   2    Javier  Morales                              03/27/2010   @    SJ        W  3-­0   3    Robbie  Findley                              04/02/2009   vs.  CLB    W  4-­1   2    Yura  Movsisyan                              07/24/2009   vs.  DAL    W  4-­2   2    Robbie  Findley                              08/26/2009   vs.  CHV    W  4-­0   2    Robbie  Findley                              10/24/2009   vs.  COL    W  3-­0   2    Yura  Movsisyan                              09/27/2008     @    SJ        W  3-­2   2    Fabian  Espindola                          08/29/2008   vs.  COL    W  2-­0   2    Kyle  Beckerman                              04/12/2008   vs.  DC      W  4-­0   2    Robbie  Findley                              06/23/2007   vs.  DC      W  2-­1   2    Chris  Brown                                    06/17/2007   @    LA        L  2-­3   2    Jeff  Cunningham                            04/07/2007   vs.  DAL    T  2-­2   2    Atiba  Harris                                  09/30/2006   @    KC        T  3-­3   2    Jeff  Cunningham                            08/09/2006   @    COL      W  4-­1   2    Jeff  Cunningham                            07/29/2006   vs.  DC      W  2-­1   2    Jeff  Cunningham                            06/03/2006   vs.  CHI    W  3-­1   2    Jeff  Cunningham                            05/13/2006   @    LA        W  3-­0   3    Jason  Kreis                                    07/13/2005      @    MIN      L  4-­6&   2    Jason  Kreis                                    04/30/2005   vs.  SJ      T  2-­2     *CONCACAF  Champions  League   &U.S.  Open  Cup  

« :+,/( 2/' %/22' 5(78516 72 +($/7+ 6WDOZDUW0)1HG*UDEDYR\KDVSOD\HGDQG DQG  PLQXWHV HDFK RI WKH ODVW ILYH JDPHV DIWHU PLVVLQJ DOORI$XJXVWZKLOH):&RG\$UQRX[ZDVRQHRIWZR56/ SOD\HUVWRPDNHKLVWHDPGHEXWDIHZZHHNVDJRDWKRPH YV3+,MRLQLQJ')%ODNH:DJQHU«  $UQRX[KDVPLVVHGPRVWRIGXHWRKLVUHFRYHU\IURP D VHULRXV NQHH LQMXU\ VXIIHUHG ODVW 1RYHPEHU ZKLOH ZLWK 9DQFRXYHU ZKLOH :DJQHU VLJQHG ZLWK 56/ RQ $XJXVW  DIWHU ') &KULV :LQJHUW ± ZKR KDV VWDUWHG QHDUO\ HYHU\ JDPH VLQFH  ± EURNH KLV ZULVW WKDW ZHHNHQG DW 7RURQWR « :LQJHUW KDV EHHQ FOHDUHG IRU DFWLRQ VWDUWLQJ DQG SOD\LQJ  PLQXWHV LQ WKH VDPH 6HSW  UHVHUYH JDPHORVVWR.DQVDV&LW\ WKDWNQRFNHG') 7RQ\%HOWUDQ RXWIRUWKHORQJKDXO«  $QRWKHU PLGVHDVRQ SLFNXS ± ): &KULV $JRUVRU ± PDGH KLV 0/6 GHEXW ODVW ZHHN DW 9DQFRXYHU DIWHU EUHDNLQJ KLV ULJKWKDQGLQDUHVHUYHJDPHDW+RXVWRQRQ$XJXVW«

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 MAYDAY, MAYDAY: 12-­MONTH RUN OF SUCCESS ON MULTIPLE FRONTS: 5HDO6DOW/DNH

SHUIRUPHG H[FHSWLRQDOO\ LQ WKH  JDPHV SOD\HG EHWZHHQ 0D\   DQG $SULO   ORVLQJ RQO\ VL[WLPHVLQWKDWVWUHWFKWKHURXJKHTXLYDOHQWRIDVHDVRQ DQGDKDOI « $FURVV 0/6 UHJ VHDVRQ 0/6 3OD\RII DQG &21&$&$) &KDPSLRQV /HDJXH JDPHV -DVRQ .UHLV¶ WHDP SRVWHG DQ LPSUHVVLYH PDUN RI  DQG RXWVFRUHG RSSRQHQWV  VLQFH 0D\   « 56/ ZRXOG KDYH HDUQHG  SRLQWV LQ WKLV VWUHWFK « 7KH 0/6 HTXLYDOHQWV UHJVHDVRQJDPHVRQO\    TEAM                                      GAME  1            GAME  45                PTS   Los  Angeles  Galaxy          7/04/1997      9/02/1998            95   Real  Salt  Lake                  5/01/2010      4/30/2011            91   D.C.  United                        5/21/2005      7/22/2006            91   Chicago  Fire                      6/04/2000      9/01/2001            90

 3ULRU WR $SULO  DW 3RUWODQG WKH ORQH 0/6 ORVVHV ERWK FDPH RQ WKH URDG DW 'DOODV RQ -XO\  DQG 2FW  VDQGZLFKHG DURXQG WKH EL]DUUH  ORVV DW &UX] $]XO « 7KH IRXUWK ORVV ZDV WKH  GHFLVLRQ DW 6DSULVVD ZKLFK HQDEOHG56/WRDGYDQFHWRWKH&&/)LQDO«

KREIS CONTRACT EXTENDED THRU 2013:  2Q 0DUFK  56/ 3UHVLGHQW %LOO 0DQQLQJ DQG *0 *DUWK /DJHUZH\ DQQRXQFHG WKDW WKH FOXE KDV H[WHQGHG E\ WZR \HDUV WKH FRQWUDFW RI FXUUHQW +HDG &RDFK -DVRQ .UHLV NHHSLQJ WKH \RXQJHVW 0/6 &XSZLQQLQJ PDQDJHU LQ /HDJXHKLVWRU\RQWKH56/VLGHOLQHWKURXJKWKHFRPSOHWLRQ RIWKHVHDVRQ«$OOWLPH.UHLVQRZRZQVD  PDUN LQ 0/6 UHJXODUVHDVRQ SOD\RII DQG &21&$&$) &KDPSLRQV /HDJXH SOD\ « 8QGHU .UHLV¶ OHDGHUVKLS 56/ EHFDPH WKH ILUVWHYHU 0/6 WHDP DQG RQH RI MXVW WKUHH QRQ0H[LFDQ WHDPV  WR ZLQ D &21&$&$) JURXS SRVWLQJ D  PDUN DQG EHFRPLQJ WKH ILUVWHYHU 0/6 VLGH WR DGYDQFH &&/ )LQDO « 7KH IRUPHU VWULNHU¶V  VLGH ZDV DOVR WKH VHFRQGKLJKHVW VFRULQJWHDPLQ&21&$&$)¶VJURXSVWDJH ZLWK  JRDOV LQVL[JDPHV JRDOVJDPH « 

MILESTONES ACHIEVED DURING KREIS ERA:  'XULQJ 0/6 SOD\ LQ  WKH IROORZLQJ QXPEHUV HVWDEOLVKHG E\ 56/ VHW RU WLHG QHZ VLQJOHVHDVRQ OHDJXH VWDQGDUGV x x x x

x

IHZHVWJRDOVDOORZHG   RYHUDOOJRDOGLIIHUHQWLDO   WRWDOKRPHSRLQWV   IHZHVWKRPHORVVHV   IHZHVWKRPHJRDOVDOORZHG  



,QDGGLWLRQWRWKRVHOHDJXHEHQFKPDUNVODVW\HDU¶VHGLWLRQVHWIUDQFKLVH KLJKUHFRUGVLQ x ZLQV   x JRDOV   x VFRULQJRXWSXW JDPH  x SRLQWV   x VKXWRXWV   x URDGSRLQWV 

x URDGJRDOGLIIHUHQWLDO  

LATE DRAMA PART OF RSL DNA: 0) :LOO -RKQVRQ¶V¶JDPHZLQQLQJJRDOYV&KLYDVZD\EDFNRQ WK 0D\PDUNHGWKH DOOWLPHJRDKHDGVFRUHGE\56/LQ WKH ILQDO  PLQXWHV RI D UHJXODUVHDVRQ 0/6 RU &&/ JDPH«7ZRRIWKHWKUHH56/JRDOVVFRUHGSULRUWRWKDW± (VSLQGROD¶V  JDPHZLQQHU Y &2/ DQG 0RUDOHV¶ ODWH HTXDOL]HUDW0RQWHUUH\±DOVRPHHWWKHGUDPDWLFFULWHULD« $OOWLPH OLVWV IRU HTXDOL]HUV DQG *:* DFWLYH SOD\HUV LQ EROG  

56/(48$/,=(56$)7(5·(18 total) 95+  ................  Saborío,  10/23/10  @  COL  (1-­1  T)   94+  ...............  Saborío,  04/10/10  v.  SEA  (2-­2  T)   93+  ..............  Borchers,  09/25/10  v.  COL  (1-­1  T)   92+  ................  Johnson,  8/25/10  @  CAZ*  (4-­5  L)   92+.................  C.  Brown,  5/05/07  v.  NY  (3-­3  T)   ¶/HLWFK 2* Y6- -­1  T)   ¶0RYVLV\DQ/15/08  @  COL  (1-­1  T)   ¶&XQQLQJKDPY'& -­1  W)   ¶.......  Kreis,  7/4/05  v.  NY  (2-­2  T)   ¶0RUDOHV#07<  -­2  T)   ¶6RWR#&+9 -­1  T)   ¶.Kreis,  4/15/06  v.  NY  (1-­1  T)   ¶.UHLVY&2/ -­2  T)   ¶0RUDOHVY/$ -­2  T)   ¶(VSLQGRODY1( -­3  T)   ¶......  Kreis,  9/30/06  @  KC  (3-­3  T)   ¶.....  Ballouchy,  5/20/06  v.  KC  (2-­1  W)   ¶.OHLQ#&/% -­1  W)     RSL GAME-­:,11(56$)7(5·(16 total) 93+..............  Espíndola,  04/13/11  v.  COL  (1-­0  W)   92+................  Saborío,  8/18/10  v.  DAU*  (2-­1  W)   92+  ..............  Cunningham,  7/29/06  v.  DC  (2-­1  W)   ¶7DOOH\#&/% -­1  W)   ¶(VStQGROD#&+9 -­1  W)   ¶Torres  (OG),  7/24/09  v.  DAL  (4-­2  W)   ¶-RKQVRQY&+9 -­0  W)   ¶..........  Findley,  7/28/08  v.  TOR  (2-­1  W)   ¶)LQGOH\#&2/ -­0  W)   ¶6DERUtR#1( -­1  W)   ¶)LQGOH\Y+28 -­0  W)   ¶...  Dunseth,  4/16/05  v.  COL  (1-­0  W)   8¶0RUDOHVY/$ -­0  W)   ¶:LOOLDPVY1< -­0  W)   ¶0RUDOHVY'& -­1  W)   ¶&XQQLQJKDPY.& -­1  W)  

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 

56/·6 ,17(51$7,21$/ +,6725<:  :LWK WKH ODWH $SULO  ORVV WR 0RQWHUUH\ LQ WKH  &21&$&$) )LQDO 56/ LV QRZ  DOOWLPH LQ LQWHUQDWLRQDO FRQWHVWVZLWKDSRVLWLYHJRDOGLIIHUHQWLDO JRDOVIRU JRDOV DJDLQVW  « ,Q PHDQLQJIXO LQW¶O FRPSHWLWLRQ 56/ LV QRZ *)*$ «,QWKH-DVRQ.UHLVHUD56/ IDOOV WR  YV YLVLWLQJ LQWHUQDWLRQDO VTXDGV GRHV 127 LQFOXGH 7RURQWR )& OHDJXH PDWFKHV KRZHYHU '2(6 LQFOXGH&&/JDPHVYV&ROXPEXV «

REAL  SALT  LAKE  ALL-­TIME  ,17¶/RESULTS     (12-­7-­6  ±  43  GF  /  33  GA)  'DWH  -XQH $XJXVW -XO\ $XJXVW $SULO -XQH -XO\ -XO\ -XO\ -XO\ 6HSW -XO\ 2FW -XQH $XJXVW $XJXVW 6HSW 6HSW 6HSW 2FW )HE 0DUFK 0DUFK $SULO $SULO $SULO

;DQ*R&XS &&/ 2SSRQHQW  6FRUH 5HVXOW 8QLYHUVLGDG&DWROLFD &KLOH   : +DUERXU9LHZ)& -DPDLFD  7 0RQDUFDV0RUHOLD 0H[LFR   / 5HDO0DGULG 6SDLQ   / )LML1DWLRQDO7HDP   : &KLQHVH1DWLRQDO7HDP  : (YHUWRQ)& (QJODQG   : %RFD-XQLRUV $UJHQWLQD   7 &OXE6DQWRV/DJXQD 0H[LFR   / 'HS6DSULVVD &RVWD5LFD   / 8$1/ 7LJUHV  0H[LFR   : &)$PpULFD 0H[LFR   : &'*XDGDODMDUD 0H[LFR   7 3XQWDUHQDV)& &RVWD5LFD   : Ã&#x2C6;UDEH8QLGR 3DQDPD   : #&UX]$]XO 0H[LFR   / 7RURQWR)& &DQDGD   : #$UDEH8QLGR 3DQDPD   : #7RURQWR)& &DQDGD   7 &UX]$]XO 0H[LFR   : #&ROXPEXV 86$   7 &ROXPEXV&UHZ 86$   : 'HS6DSULVVD &5&   : #'HS6DSULVVD &5&   /  #0RQWHUUH\ 0(;   7 0RQWHUUH\ 0(;   / 56/DGYDQFHVRQDJJUHJDWH

KHALFAN THE LATEST ² & FIRST IN AWHILE: 'XULQJ 5HDO 6DOW /DNH¶V HDUO\ \HDUV LW VHHPHG OLNH IDQV¶ KHDUWV ZHUH URXWLQHO\ EURNHQ E\ DQ RSSRVLQJ JRDO IURP D SOD\HU IHZ KDG HYHU KHDUG RI « %HWZHHQ  WKH FOXE¶V WXUPRLOILOOHG HDUO\ \HDUV  GLIIHUHQW SOD\HUV VFRUHG WKHLU ILUVWHYHU 0/6 JRDO DJDLQVW WKH KDSOHVV &ODUHWDQG&REDOW « ,Q WKH .UHLV HUD DV WKH WHDP PDWXUHGWKDWWUHQGVORZHGWRDWULFNOH±RQO\WKUHHSOD\HUV LQ  IRXQG WKH EDFN RI WKH QHW IRU WKH ILUVW WLPH YV 56/«(DUOLHUWKLV\HDU6HDWWOH¶V/DPDU1HDJOHEHFDPH WKH ILUVW SOD\HU LQ WZR \HDUV WR EXU\ KLV ILUVW FDUHHU WDOO\ DJDLQVW56/ZLWKKLVEHQGLQJ¶EODVWWKDWSURYHGWREH WKH JDPH ZLQQHU « 7ZR ZHHNV ODWHU 3KLODGHOSKLD PLGILHOGHU .HRQ'DQLHOVWUXFNZLWKKLVLQLWLDO 0/6 JRDO« 7KDW IHDW ZDV UHSHDWHG $XJ  LQ +RXVWRQ DV KRPHJURZQ SOD\HU $OH[ 'L[RQ RSHQHG KLV 0/6 DFFRXQW ZLWKDVWRSSDJHWLPHGDJJHUIRUWKH'\QDPRWRVHQG56/ WR D FUXVKLQJ GHIHDW « 2Q 2FW  DW 9DQFRXYHU 1L]DU .KDOIDQ EHFDPH WKH ODWHVW RI WKH  WR KDYH VFRUHG WKHLU ORQHFDUHHU0/6JRDO DVRI2FWLQGLFDWHGE\DQ «7KHOLVW DATE                OPP    Player   05/28/2005    CHI    Chad  Barrett   05/28/2005    CHI    Samuel  Caballero*   06/04/2005    DAL    Abe  Thompson   06/22/2005    LA      Ednaldo*     09/21/2005    COL    Dedi  Ben  Dayan   10/08/2005    SJ      Julian  Nash*   10/12/2005    COL    Fabrice  Noel   04/08/2006    DAL    Mark  Wilson*   05/06/2006    CLB    Jason  Garey   05/27/2006    COL    Daniel  Wasson*   06/03/2006    CHI    Brian  Plotkin*   07/08/2006    LA      Josh  Gardner*   08/19/2006    HOU    Adrian  Serioux   10/07/2006    HOU    Paul  Dalglish   10/15/2006    CHV    Brent  Whitfield*   04/21/2007    CHV    Maykel  Galindo   05/05/2007    NY      Dane  Richards   07/04/2007    TOR    Collin  Samuel   08/18/2007    CHI    Cuauhtemoc  Blanco   08/18/2007    CHI    Paulo  Wanchope   04/19/2008    TOR    Laurent  Robert*   09/06/2008    LA      Bryan  Jordan   05/02/2009    COL    Kosuke  Kimura   05/28/2011    SEA    Lamar  Neagle*   06/11/2011    PHI    Keon  Daniel*   08/20/2011    HOU    Alex  Dixon*   10/06/2011    VAN    Nizar  Khalfan*  

Result   L,  0-­3   L,  0-­3   L,  0-­2   T,  1-­1   L,  0-­2   T,  2-­2   L,  0-­1   L,  1-­2   L,  0-­1   T,  2-­2   L,  1-­3   L,  0-­2   W,  3-­1   T,  1-­1   T,  1-­1   L,  0-­4   T,  3-­3   L,  1-­2   L,  0-­2   L,  0-­2   L,  0-­1   T,  2-­2   L,  0-­2   L,  1-­2   T,  1-­1   L,  2-­3   L,  0-­3  

 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 

FORTRESS

STANDING

STRONG

²

BARELY:

'HVSLWHGURSSLQJIRXUKRPHJDPHVLQWKHODVWILYHPRQWKV 5LR 7LQWR 6WDGLXP DQG 8WDK VRLO UHPDLQV D ³)RUWUHVV´ IRU -DVRQ.UHLV¶WHDPDV56/KDVGURSSHGMXVWRILWVODVW KRPHJDPHV  DFURVV0/6UHJXODUVHDVRQ SOD\RII DQG &21&$&$)  2SHQ &XS SOD\ GDWLQJ EDFN WRWKHVWDUWRI«3ULRUWRWKDW56/ZDVRQ 8WDKVRLOLQ0/6FRPSHWLWLRQZLWKDJRDOGLIIHUHQWLDO  *)*$ IURP«7KH56/VLGHZDVMXVW QG WKH   0/6 WHDP WR UHPDLQ XQEHDWHQ DW KRPH LQ DQ HQWLUHVHDVRQMRLQLQJWKH6-(DUWKTXDNHV  « 7KDW IHDW ZDV HTXDOHG E\ WKH  /$ *DOD[\  « )URP -XQH ¶ WR 0D\ µ 56/ ZHQW  DW KRPH LQ UHJXODUVHDVRQ SOD\ WKH ORQJHVW VXFK UXQ LQ /HDJXH KLVWRU\ TEAM # START STOP -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­   Real  Salt  Lake      29          06/06/2009          05/28/2011   Columbus  Crew        22          06/28/2008          09/26/2009   San  Jose                  18          09/25/2004          10/08/2005   Three  teams  tied  with  17

 :LWK 56/¶V  ORVV DW KRPH 6HSW  YV &KLFDJR WKH WHDP VDZ LWV RQFHLPSHQHWUDEOH KRPH EUHDFKHG IRU WKH IRXUWKRFFDVLRQLQLQFOXGLQJWKHORVVRQ0D\ DJDLQVW 6HDWWOH ± ZKLFK VQDSSHG LWV 0/6 KRPH XQEHDWHQ VWUHDNDWJDPHV±DQGWKH&&/)LQDOORVVRQ$SULOWR 0RQWHUUH\ 0(;  VQDSSHG WKH FOXE¶V RYHUDOO KRPH XQEHDWHQ UXQ DW  JDPHV DFURVV 0/6 &&/ DQG H[KLELWLRQ SOD\ « 6LQFH -XQH   56/ LV  DW KRPH LQ &21&$&$) SOD\  LQ 0/6 UHJXODU VHDVRQ  SOD\RIIV DQG  LQ LQWHUQDWLRQDO H[KLELWLRQV « 7KH DJJUHJDWH VFRUHOLQH LQ WKRVH JDPHV"«  )RUP *XLGH WKH  DOO FRPSHWLWLRQV  PDUN IURP -XQH   ± SUHVHQW &&/ UHG 3OD\RII  EOXH IULHQGO\ JUHHQ2SHQ&XS XQGHUOLQH   7:7:::7:77::: 7::::::7:7::::::7::7 ::::/:7/:7::7::/:::/7  RMC TIES: 7KH -XQH   )R[ 6RFFHU &KDQQHO WHOHFDVW ZHQW WR PXOWLSOH FRPPHUFLDO EUHDNV GXULQJ (OGHU *RQ]DOH]¶ OHQJWK\ ³FRQVHFUDWLRQ´ RI WKH ILHOG PXFK WR WKH GLVGDLQRIFXUUHQW5DSLGV¶FRDFK*DU\6PLWK«56/¶VDOO WLPHKRPHPDUN35,25WR(OGHU*RQ]DOH] FRQVHFUDWLRQ ±MXVW«$)7(5(OGHU*RQ]DOH] -XQH SUD\HU DW 5LR 7LQWR 6WDGLXP ± QRZ  ZLQV  ORVVHV WLHV« 5HDO6DOW/DNH<HDUE\<HDU+RPH5HVXOWV 5HJXODU6HDVRQ      SWV *)*$ *'      SWV *)*$ *'      SWV *)*$ *'      SWV *)*$ *'      SWV *)*$ *'      SWV *)*$ *'       SWV *)*$ *'  &$5((5    *)*$ *' 

 

BREAKING DOWN THE STREAK: ,Q WKH WZR \HDUV ZLWKRXW ORVLQJ D KRPH 0/6 JDPH EHWZHHQ 0D\   .DQVDV &LW\  DQG 0D\   6HDWWOH  KHUH¶V WKH  JDPH 0/6  5LR 7LQWR 6WDGLXP XQEHDWHQ VWUHDN IRU 56/ UHJVHDVRQRQO\ E\WKHQXPEHUV    ±56/VKXWRXWVE\*.1LFN5LPDQGR ±QXPEHURI56/SOD\HUVWRVFRUHDWKRPH ±FURZGVRIRUPRUHDW5LR7LQWR6WDGLXP ±RSSRVLQJSOD\HUVWRHDFKVFRUHRQFHGXULQJVWUHDN QG ±WRWDO KDOIFRPHEDFNVIRU56/WRVDOYDJHWLHZLQ ±JRDOVE\):5REELH)LQGOH\WRSVDPRQJVFRUHUV ±JRDOVE\):Ã&#x2C6;OYDUR6DERUtRDOOFRPLQJLQ ±ZLQVDWKRPHGXULQJWKHVWUHDNIROORZLQJURDGORVVHV ±QXPEHURIRQHJRDOZLQV LQFOXGLQJILYHZLQV  ±ODUJHVWPDUJLQRIYLFWRU\ VHHEHORZ  ±QXPEHURIZLQVWKHPRVWFRPPRQUHVXOW ±FRPHIURPEHKLQGWLHV ±VFRUHOHVVGUDZV ±QXPEHURIWLPHVRSSRQHQWVFRUHGRUPRUHJRDOV ±:LQVDJDLQVW6XSS6KLHOGZLQQHU/$  %LJJHVW:LQ PDUJLQ Y1(±  %LJJHVW :LQ PHDQLQJ   Y &2/ ± 56/ ZLQV  RQ ILQDOGD\RIVHDVRQWRIRUFHSRVWVHDVRQWLHEUHDNHUVDQGHOLPLQDWH UG &RORUDGRIURPSOD\RIIVIRU FRQVHFXWLYHVHDVRQTXDOLI\LQJIRU 3OD\RIIV DQG HYHQWXDOO\ ZLQQLQJ 0/6 &XS DQG SDYLQJ ZD\ WR &&/SDUWLFLSDWLRQ  %LJJHVW &URZG  Y /$ ± D 5LR7 UHFRUG RI  VDZ 56/VFRUHWZLFHLQILUVWPLQXWHVHQURXWHWRDKDOIWLPHOHDG DQG DQ HYHQWXDO  ZLQ RYHU 'DYLG %HFNKDP DQG WKH /$ *DOD[\GHVSLWHWKH),)$GDWHDQGD-D]]KRPHJDPH  /RXGHVW &URZG  Y 6($ ±  ZHUH RQ KDQG DV QHZFRPHU Ã&#x2C6;OYDUR 6DERUtR KHDGHG KRPH D 1HOVRQ *RQ]DOH] QG FRUQHUNLFNWKUHHPLQXWHVLQWR KDOIVWRSSDJHWLPHWRVDOYDJHD  GUDZ LQ 56/¶V  KRPH RSHQHU D PDWFK WKDW LQFOXGHG D SUHJDPHEDQQHUUDLVLQJDQGULQJFHUHPRQ\WRFRPPHPRUDWHWKH WHDPV¶0/6&XSZLQ  &XWWLQJ LW FORVH  Y 6- ± VWRSSDJH WLPH 2* E\ (DUWKTXDNHV¶&KULV/HLWFKJLYHV56/DWLHY&2/ ± ¶JRDOE\)DELDQ(VSLQGRODJLYHV56/ZLQ  %HVW&RPHEDFNY'$/±)RXUVHFRQGKDOIJRDOVHUDVH  KDOIWLPH GHILFLW *. 1LFN 5LPDQGR VDYHV &XQQLQJKDP 3. .UHLVHMHFWHG  2XWVFRUHG RSSRQHQWV  ZLWK  GLIIHUHQW VFRUHUV )LQGOH\  6DERUtR  0RUDOHV  (VSLQGROD  0RYVLV\DQ  2ODYH  *UDEDYR\  :LOOLDPV  %HFNHUPDQ  -RKQVRQ  5XVVHOO &DPSRV *RQ]DOH] %RUFKHUV 0DWKLV 3DXOR -U 2ZQ *RDOV± 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011  

REAL  SALT  LAKE  2011  MISCELLANEOUS  STATS   0/65HJXODU6HDVRQ*DPHVWKURXJK  

56/*2$/ 6&25(56 ±6DERULR   ±(VStQGROD   ±0RUDOHV   ±3DXOR-U   ±-RKQVRQ   ±:LOOLDPV   ±%HFNHUPDQ   ±%RUFKHUV   ±2ODYH   ±*LO   ±6FKXOHU   ±*RQ]DOH]   ±$OH[DQGUH            

Penalty Kicks Morales  ± 3/26  v  LA Espindola  ± 6/18  v  DC Saborio  ± 7/4  v  NE Saborio  ± 7/23  v  SJ Saborio  ± 8/6  v  NY

12

15

7 15 15

7 7

6

28

21

11

8

4

7 21

15 8 7

5 7

5

Own Goals

23 7

15 4

6

23

.HOOHU¶± 9/10  @  SEA

22 6

15 7 15

7

15 77 7

77

5($/6$/7/$.(5(*8/$56($62167$76  6KRWV   7RWDO &DXWLRQV   56/    56/   2SS    2SS            7RWDO 62*   7RWDO (MHFWLRQV      56/    56/      2SS    2SS       7RWDO &RUQHUV   7RWDO 2IIVLGHV      56/    56/      2SS    2SS      3(1$/7<.,&.5(68/76 23321(17 5($/6$/7/$.( 3OD\HU 7HDP  56/*. 0LQ 5HVXOW 3OD\HU 2SS*. 0LQ 5HVXOW 'DWH  0HQGR]D &/%  5LPDQGR ¶ *RDO 0RUDOHV 6DXQGHUV ¶ *RDO Y/$ 'DYLHV '&  5LPDQGR ¶ *RDO (VStQGROD +DPLG ¶ *RDO Y'& /HNLF 1(  5LPDQGR ¶ *RDO 6DERUtR 5HLV ¶ *RDO Y1( 5RVDOHV 6($  5LPDQGR ¶ :LGH 6DERUtR %XVFK ¶ *RDO Y6- &DPLOR 9$1  5LPDQGR ¶ *RDO 6DERUtR &RXQGRXO ¶ *RDO Y1< &DPLOR 9$1  5LPDQGR ¶ *RDO  -HZVEXU\ 325  5LPDQGR ¶ +LJK *RDOV 56/ 2SS  $VVLVWV 56/ 2SS  )RXOV 56/ 2SS

  

  

7RWDO  

7RWDO   7RWDO   7RWDO  

'DWH        

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 5($/6$/7/$.(0,6&(//$1(28667$76 4XLFNHVW*RDOV6FRUHG   4XLFNHVW*RDOV$OORZHG   56/(TXDOL]HUVDIWHU   2SS(TXDOL]HUVDIWHU    56/*DPH:LQQHUVDIWHU    2SSRVLWLRQ*:*DIWHU      56/0XOWL*RDO*DPHV     2SS0XOWL*RDO*DPHV    56/0XOWL$VVLVW*DPHV     2SS0XOWL$VVLVW*DPHV   2SS+DW7ULFNV   2ZQ*RDOVIRU56/ 2ZQ*RDOVDJDLQVW56/  56/5HG&DUGV5HFHLYHG        2SS5HG&DUGV5HFHLYHG       

¶±:LOOLDPVY/$ ¶±2ODYH#&/% ¶±6DERULR#1< ¶±/HNLFY1( ¶±*DYHQY&/%  ¶±(VSLQGRODY1( ¶±'DYLHVY'& 'DQVRY325 ¶±(VSLQGRODY&2/ ¶±-RKQVRQY&+9  'L[RQ#+28 ¶±1HDJOHY6($ ¶±*DUGQHU#&/% ¶±3ODWD#725  0RUDOHV  Y/$ 6DERULR  Y725 6DERULR  Y6- (VSLQGROD  #1< 'H5RVDULR  #'& 3DSSD  Y&+, &DPLOR  #9$1 :DUQHU  #1( 5XVVHOO  Y725 %HFNHUPDQ  Y725 %HFNHUPDQ  Y1< 5RJHUV  Y&/% 'DYLV  #+28  'H5RVDULR#'& 3DSSDY&+, .HOOHU6($#6($¶ %RUFKHUV#/$#/$¶ -RKQVRQ¶#1( 2ODYH¶Y6($ %RUFKHUV¶Y1( %RUFKHUV¶#&+9 %HOWUDQ¶#6($ %HFNHUPDQ¶Y&+, :DUQHU¶#9$1  -RVHSK¶#1( 3KHODQ¶#1( %R\HQV¶Y&+9 0RQGDLQL¶Y&+9 &RFKUDQH¶Y1( %XUOLQJ¶Y6- (VSLQR]D¶#.& +XUWDGR¶#6($



56/$:$5':,11(56 0/63OD\HURIWKH:HHN :HHN±0)-DYLHU0RUDOHV :HHN±):-HDQ$OH[DQGUH 0/6*RDORIWKH:HHN :HHN±0)/XLV*LO

0/65(*6($621&$7(*25,&$/:/7 *)*$   +RPH 5RDG 2YHUDOO 0/65HJXODU6HDVRQ         2QH*RDO*DPHV     YV(DVW         YV:HVW           )LUVWJDPHV           /DVWJDPHV          %HIRUH$OO6WDU            6LQFH$OO6WDU          6FRULQJ)LUVW    2SS6FRULQJ)LUVW      /HDGLQJDW+DOI    7LHGDW+DOI    7UDLOLQJDW+DOI     /HDGLQJDW     7LHGDW     7UDLOLQJDW      'D\*DPHV          1LJKW*DPHV          2Q*UDVV         2Q7XUI 1$        ,Q5HG         ,Q*ROG QD       ,Q:KLWH 1$          2Q.879.0<8         2Q(631          2Q7HOHIXWXUD    1$      2Q)R[6RFFHU          2SS/RFDO79          ,Q0DUFK          ,Q$SULO          ,Q0D\          ,Q-XQH            ,Q-XO\        ,Q$XJXVW          ,Q6HSW          ,Q2FW           0/65HJXODU6HDVRQ        0/65HVHUYH'LYLVLRQ          862SHQ&XS          &21&$&$)&/          )ULHQGOLHV 1$   1$   1$   727$/6       

 56/$:$5':,11(56  56/7HDP093±0).\OH%HFNHUPDQ %XGZHLVHU*ROGHQ%RRW±):$OYDUR6DERULR 'HIHQVLYH3OD\HURIWKH<HDU±')1DW%RUFKHUV +XPDQLWDULDQRIWKH<HDU±')-HDQ$OH[DQGUH 

:HHN±0).\OH%HFNHUPDQ 0/66DYHRIWKH:HHN :HHN±*.1LFN5LPDQGR :HHN±*.1LFN5LPDQGR 0/63OD\HURIWKH0RQWK 0DUFK±*.1LFN5LPDQGR



2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011

2011 REAL SALT LAKE PLAYER BIOS 

)25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV   ±&+5,6$*25625 ):  OEV  6HYHUQ0DU\ODQG /$670/60$7&+3OD\HGILQDOPLQXWHVRI56/¶VURDGORVV#9$1RQKLV0/6GHEXW 0/65(6(59(/($*8(7RWDO*3*6*$LQPLQXWHV56/*3*6*$LQPLQXWHV 127(6XIIHUHGDEURNHQ5KDQGLQ5HVHUYH/HDJXHDFWLRQRQ#+28VLGHOLQLQJWKH\RXQJDWWDFNHUIRUDPRQWK  7KH\HDUROGQDWLYHRI6HYHUQ0DU\ODQG VXEXUEDQ%DOWLPRUH HQWHUVWKH56/URVWHUZLWKDZRUOGRISRWHQWLDOWKHGLPLQXWLYHVWULNHUFRPLQJ WRWKH:DVDWFK)URQWIRUDWULDOLQODWH-XQHDIWHUEHLQJZDLYHGE\WKH3KLODGHOSKLD8QLRQHDUOLHULQWKHPRQWK«:LWKWKH56/IRUZDUGFRUSV UHWXUQLQJWRIXOOVWUHQJWKLQUHFHQWZHHNV$JRUVRUZLOOEHORRNHGXSRQWRSURYLGHYDOXDEOHGHSWKDVWKHVHFRQGKDOIRI56/¶VFDPSDLJQNLFNVLQWR JHDU«3KLODGHOSKLD8QLRQ  'LGQRWDSSHDUIRUWKHILUVWWHDPLQ3KLODGHOSKLDEXWGLGPDNHWKUHH0/65HVHUYH/HDJXHDSSHDUDQFHV« 6FRUHGWZRJRDOVLQFOXGLQJWKHJDPHZLQQHULQDSUHVHDVRQPDWFKDJDLQVW*UHHN7KLUG'LYLVLRQVLGH+HUVRQLVVRV)&RQ«3OD\HGIXOO PLQXWHVDQGWDOOLHGWKH8QLRQ¶VILUVWHYHU0/65HVHUYH/HDJXHJRDORQY1<KHOSLQJWKH8QLRQ5HVHUYHVLGHWRDZLQ«$OVR SOD\HGDOOPLQXWHVIRUWKH8QLRQ5HVHUYHVRQY'& / Y725 7 «:DVZDLYHGE\3KLODGHOSKLDRQDQGMRLQHG56/ FDPSDVDWULDOLVWLQODWH-XQH«8QLYHUVLW\RI9LUJLQLD  0DGHDSSHDUDQFHVDFURVVWZRVHDVRQVDWWKH8QLYHUVLW\RI9LUJLQLD DOWKRXJKERWK\HDUVZLWKWKH&DYDOLHUVHQGHGSUHPDWXUHO\GXHWRLQMXU\«$SSHDUHGLQVHYHQJDPHVDVDIUHVKPDQLQ&KDUORWWHVYLOOH VWDUWLQJILYHEHIRUHVXIIHULQJDVHDVRQHQGLQJNQHHLQMXU\RQYV&HQWUDO&RQQHFWLFXW6WDWH«7DOOLHGIRXUJRDOVLQFOXGLQJRQHJDPH ZLQQHU«6WDUWHGKLVFROOHJLDWHFDUHHURIIZLWKDEDQJVFRULQJLQWKUHHVWUDLJKWJDPHVDJDLQVW608  *HRUJH0DVRQ  DQG+RIVWUD  «$SSHDUHGLQJDPHVDVDVRSKRPRUHVWDUWLQJLQEHIRUHKLVVHDVRQHQGHGGXHWRDQDQNOHLQMXU\«6FRUHGWZRJRDOVDQG DGGHGWZRDVVLVWVHQURXWHWRWKH&DYVZLQQLQJWKH1&$$&ROOHJH&XSDOWKRXJKWKHDQNOHLQMXU\SUHYHQWHGKLPIURPSDUWLFLSDWLQJLQWKH SRVWVHDVRQ  <RXWK&DUHHU86<RXWK1DWLRQDO7HDPV:DVDPHPEHURIWKHSOD\HUSRROVIRUWKH868QGHU8QGHU 8QGHU0HQ¶V1DWLRQDO 7HDPV«&DOOHGLQWRWKH86$¶V8VLGHIRUWKH/LPRJHV7RXUQDPHQWLQ)UDQFHLQ2FW *3 DQGHDUQHGODVWVHFRQGFDOOXSWRWKH 868VIRUDWULSWR(QJODQGLQ0D\ JRDOY%ROWRQ:DQGHUHUV5HVHUYHVDQGVDZWLPHYV0DQFKHVWHU8QLWHG5HVHUYHV «&OXE &DUHHU3OD\HGFOXEVRFFHUIRUWKH%DOWLPRUH%D\VIURP«+HOSHGWKH%D\VZLQQXPHURXVFURZQVLQFOXGLQJWKH86<RXWK 6RFFHU81DWLRQDO&KDPSLRQVKLSWKH866RFFHU'HYHORSPHQW$FDGHP\81DWLRQDO&KDPSLRQVKLSDQGWKH86<RXWK 6RFFHU5HJLRQ,WLWOH«(QMR\HGDQDFFRODGHILOOHGFDPSDLJQDIWHUEHLQJQDPHGWKH*DWRUDGH1DWLRQDO3OD\HURIWKH<HDUWKH86 6RFFHU'HYHORSPHQW$FDGHP\83OD\HURIWKH<HDU 8)LUVW7HDPPHPEHUWKH16&$$3OD\HURIWKH<HDUDQG%DOWLPRUH6XQ¶V 0DOH$WKOHWHRIWKH<HDU«+LJK6FKRRO3OD\HGWKUHH\HDUVRIKLJKVFKRROEDOOIRU0F'RQRJK6FKRROLQ2ZLQJV0LOOV0'KHOSLQJWKHVTXDG WRWKH0DU\ODQG$WKOHWLF,QWHUVFKRODVWLF$VVRFLDWLRQµ$¶&RQIHUHQFHFKDPSLRQVKLS  0LVF%RUQRQ6HSWHPEHULQ6HYHUQ0DU\ODQG«)ROORZLQJKLVWZRLQMXU\ULGGOHGVHDVRQVDWWKH8QLYHUVLW\RI9LUJLQLDVSHQWWLPH WULDOLQJLQ(XURSHLQFOXGLQJWUDLQLQJVWLQWVZLWK(QJOLVK3UHPLHU/HDJXHSRZHU0DQFKHVWHU8QLWHGDQG3RUWXJXHVH)LUVW'LYLVLRQVLGH&'9 1DFLRQDO«&RPELQHGKLVMXQLRUDQGVHQLRU\HDUVDW0F'RQRJK6FKRROLQRUGHUWRDFFHOHUDWHKLVVRFFHUFDUHHU«:KLOHKHKDVVXLWHGXSIRU WKH8QLWHG6WDWHVDW\RXWKLQWHUQDWLRQDOOHYHOV$JRUVRULVDOVRHOLJLEOHWRVZLWFKKLVQDWLRQDOWHDPDOOHJLDQFHWR*KDQD    ±-($1$/(;$1'5( 0)  OEV  'HOUD\%HDFK)/ /$670/60$7&+3OD\HGILQDOPLQXWHRI56/¶VURDGGUDZ#&2/RQ /$670/6*2$/Y9$1 ¶ ±UHFHLYHGSDVVLQER[IURP%HFNHUPDQDQGMXNHGGHIHQGHUVWRVORWSDVW*. JDPHV  /$670/6$66,67Y3+, ¶ ±ZRQEDOODWPLGILHOGDQGJDLQHGSRVVHVVLRQEHIRUHVSULQJLQJ(VSLQGRODIRUQGFDUHHUDVVLVW  JDPHV

0/65(6(59(/($*8(*3*6*$LQPLQXWHV &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 127(1DPHG0/63OD\HURIWKH:HHNIRU:HHNDIWHUVFRULQJJRDODQGDGGLQJDVVLVWLQ56/:Y9$1RQ«7DOOLHGJDPH ZLQQLQJDVVLVWDQGDGGHGLQVXUDQFHJRDOLQKRPHZLQYV86/:LOPLQJWRQ+DPPHUKHDGVRQ«0LVVHG56/DFWLRQRQY3+,GXH WRLQW¶OGXW\ZLWK+DLWL1DWLRQDO7HDPVFRULQJWZLFHDQGSOD\LQJPLQXWHVLQZLQRYHU869LUJLQ,VODQGVRQDQGSOD\LQJIXOOLQZLQ RQRYHU&XUDFDRLQ&21&$&$):RUOG&XS4XDOLILHUV«0LVVHGDW9DQFRXYHUGXHWRLQW¶OGXW\IRU+DLWLVWDUWLQJDQGSOD\LQJILUVW RIZLQRYHUWKH869LUJLQ,VODQGV«+LVFUDIW\WXUQGULEEOH ILUHJRDOIURPY9$1PDGHWKHFXWDVD0/6*RDORIWKH<HDU FDQGLGDWH«6FRUHGLQVXUDQFHWDOO\IRU56/5HVHUYHVRQ#&2/LQVHDVRQHQGLQJZLQ

 ±$57852$/9$5(= 0)  OEV  +RXVWRQ7; /$670/60$7&+:DV56/¶VORQHVXERIIWKHEHQFKRQY325SOD\LQJILQDOPLQXWHVRIGUDZLQUHJXODUVHDVRQILQDOH /$670/6*2$/Y3+,  ±UDQOHQJWKRIILHOGDW33/3DUNLQZDQLQJVHFRQGVWRJLYH6-URDGZLQ JDPHV  /$670/6$66,67Y6- ¶ ±EURNHJDPHUXQRIIWKHVFRUHVKHHWZLWKORRSLQJSDVVWR2ODYH¶VKHDG JDPHV

&21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 0/66($621*3*6*$LQPLQZ6DQ-RVH(DUWKTXDNHV 127(0LVVHG56/DFWLRQRQY3+,GXHWRLQW¶OGXW\ZLWK(O6DOYDGRU1DWLRQDO7HDPSOD\LQJILQDOPLQXWHVLQZLQRYHU'RPLQLFDQ 5HSXEOLFDQGILQDOPLQXWHVLQZLQRYHU&D\PDQ,VODQGVLQ&21&$&$):RUOG&XS4XDOLILHUV«5HMHFWHG(O6DOYDGRUFDOOXSIRU 2FWREHU),)$GDWHLQRUGHUWRUHPDLQZLWK56/IRUJDPHDW9DQFRXYHUKRZHYHUZDVIRUFHGWROHDYHWHDPIURP&DQDGDGXHWRGHDWKLQ WKHIDPLO\«

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 )25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV   ±<25'$1<$/9$5(= 0)  OEV  &LHQIXHJRV&XED /$670/60$7&+:HQWWKHIXOOPLQXWHVRQY325LQ56/¶VUHJXODUVHDVRQHQGLQJGUDZDW5LR7LQWR6WDGLXP /$670/6*2$/+DV\HWWRVFRUHLQ0/6SOD\ JDPHV  /$670/6$66,67+DV\HWWRUHFRUGDQDVVLVWLQ0/6SOD\ JDPHV  0/65(6(59(/($*8(*3*6*$LQPLQXWHV 127(8QDEOHWRSOD\RQDW9DQFRXYHUGXHWRLPPLJUDWLRQVWDWXVDVDSROLWLFDODV\OHHIURP&XEDWKHUHE\XQDEOHWROHDYHWKH8QLWHG 6WDWHV«([SHFWVWREHDEOHWRWUDYHOWR&DQDGDLQLIQHFHVVDU\«6DYHIRUWKHPDWFK#9$1$OYDUH]ILOOHGLQIRU.\OH%HFNHUPDQDWWKH GHHSPLGILHOGVSRWGXULQJ56/FDSWDLQ¶VUHFHQWJDPHVXVSHQVLRQ«,QDGGLWLRQWRKLVIRXUOHDJXHVWDUWVDOVRORJJHGDPLQXWHVWLQWRQ Y&+,HQWHULQJLQSODFHRI*LODIWHU%HFNHUPDQ¶VHDUO\UHGFDUG  $FTXLUHG 56/6LJQHGRQORDQGHDOIURP2UODQGR&LW\6& 86/352 DVDQ,QWHUQDWLRQDO3OD\HURQ  0/63URIHVVLRQDO&DUHHU ±2UODQGR&LW\6& 86/352 0RYHGZLWKKLVIRUPHUFOXE $XVWLQ$]WH[ ZKHQWKHWHDPZDVSXUFKDVHGE\QHZRZQHUVDQGPRYHGWR 2UODQGRZKHUHWKH\FRPSHWHGLQWKH8QLWHG6RFFHU/HDJXHV3URIHVVLRQDO'LYLVLRQ 86/352 IRUWKHVHDVRQ«:DVQDPHGWKH86/ 3520RVW9DOXDEOH3OD\HUIRUKLVFRQWULEXWLRQVLQZKLFKLQFOXGHGWKUHHJRDOVLQKLVRYHUDOODSSHDUDQFHV VWDUWV EHWZHHQUHJXODU VHDVRQSOD\RIIDQG862SHQ&XSSOD\«+HOSHG2UODQGR&LW\WRWKHOHDJXH¶VWRSUHJXODUVHDVRQUHFRUG SWV DQGWKH86/352 WLWOH«$IWHUSOD\LQJDOOPLQXWHVRIUHJXODWLRQDQGRYHUWLPHRIWKH86/352&KDPSLRQVKLSRQY+DUULVEXUJ&LW\,VODQGHUV 7  FRQYHUWHG2UODQGR&LW\¶VVHFRQG3.GXULQJWKHLUSHQDOW\VKRRWRXWWULXPSKDWWKH&LWUXV%RZO«2SHQHGKLVJRDOVFRULQJDFFRXQWLQD YLFWRU\RQY1HZ<RUN«6FRUHGDVWRSSDJHWLPHHTXDOL]HUIURPGLVWDQFHRQ#)&'DOODVLQWKH/DPDU+XQW862SHQ&XS 7KLUG5RXQGRQO\WRVHHKLVVTXDGDOORZDQRWKHUVKRUWO\DIWHULQDKHDUWEUHDNLQJGHIHDWDW3L]]D+XW3DUN«6FRUHGZKDWZRXOGSURYHWR EHWKHJDPHZLQQLQJJRDORQY&KDUOHVWRQ%DWWHU\ :   ±$XVWLQ$]WH[ 86/)LUVW'LYLVLRQ 0DGHDSSHDUDQFHVIRUWKH$]WH[GXULQJWKHVTXDG¶VWZRVHDVRQVLQ$XVWLQ«$IWHUIDLOLQJWR ODWFKRQWRDQ0/6FOXEWKHSUHYLRXVVHDVRQDWWHQGHGRSHQWU\RXWVIRUWKHWKH$]WH[LQ&DOLIRUQLDLQ0DUFKLPSUHVVLQJHQRXJKWRHDUQD VSRWRQWKHVWDUWXS86/)LUVW'LYLVLRQVTXDG«6WDUWHGLQDOORIKLVDSSHDUDQFHVIRU$XVWLQGXULQJKLVILUVWVHDVRQLQWKH$PHULFDQVRFFHU UDQNVVFRULQJWKUHHWLPHVLQUHJXODUVHDVRQSOD\EHIRUHDIRRWLQMXU\FXWKLVVHDVRQVKRUW«0DGHKLVILUVWDSSHDUDQFHIRUWKH$]WH[LQWKH VTXDG¶VVHDVRQRSHQHURQY0LQQHVRWD7KXQGHU«5HQHZHGKLVFRQWUDFWZLWKWKH$]WH[RQVLJQLQJDWKUHH\HDUGHDO«:DV DVWDOZDUWIRU$XVWLQLQVWDUWLQJDOODSSHDUDQFHVDQGWDOO\LQJDSDLURIJRDOV«6KRUWO\DIWHUGHIHFWLQJWRWKH8QLWHG6WDWHVLQWKHVSULQJ RIZDVLQYLWHGWRWKH/$*DOD[\¶VSUHVHDVRQFDPSDVDWULDOLVWEXWIDLOHGWRODWFKRQWRWKH0/6RXWILW   )&&LHQIXHJRV±&DPSHRQDWR1DFLRQDOGH)~WEROGH&XED %HJDQKLVSURIHVVLRQDOFDUHHUZLWKDWKUHH\HDUVWLQWZLWKKLV KRPHWRZQVLGH)&&LHQIXHJRV  ,QWHUQDWLRQDO&DUHHU )URPVFRUHGWKUHHJRDOVIRU&XEDLQHLJKWFRQWHVWVEHWZHHQWKH8QGHUDQG6HQLRUWHDPOHYHOV«,Q0DUFK$OYDUH]DQGVL[ IHOORZ&XEDQWHDPPDWHVGHIHFWHGWRWKH8QLWHG6WDWHVZKLOHSOD\LQJZLWKWKH&XEDQ81DWLRQDO7HDPLQWKH&21&$&$)2O\PSLFTXDOLI\LQJ WRXUQDPHQWLQ7DPSD   ±&2'<$5128; ):  OEV  :LOPLQJWRQ1& /$670/60$7&+3OD\HGILQDOPLQXWHVRI56/¶VURDGORVV#9$1RQKLVQGHYHU0/6DSSHDUDQFH 0/65(6(59(/($*8(*3*6*$LQPLQXWHV 127(3OD\HGILQDOPLQXWHVRI56/¶VKRPHZLQY3+,RQPDNLQJKLV0/6GHEXWLQWKHSURFHVV«5HWXUQWRWKHILHOGIROORZLQJOHIW NQHHPLFURIUDFWXUHVXUJHU\ODVW1RYHPEHU ZKLOHZLWK9DQFRXYHU ZDVSXWRQKROGLQHDUO\VXPPHUDIWHUVXIIHULQJD50&/VSUDLQ«)LUVW PLQXWHVRIDQ\NLQGLQ56/XQLIRUPFDPHLQ5HVHUYH/HDJXHDFWLRQRQ$XJ#'$/«$OVRVXIIHUHGD5KDPVWULQJVWUDLQRYHUILQDOZHHNVRI VHDVRQ  9DQFRXYHU:KLWHFDSV)&±866)'3UR/HDJXH6LJQHGE\:KLWHFDSV)&RQ«0DGHKLVGHEXWDGD\ODWHULQDGUDZ# )&7DPSD%D\«6FRUHGKLVILUVW:KLWHFDSV)&JRDOLQWKHFOXE VUHJXODUVHDVRQILQDOHDV9DQFRXYHUGUHZY3RUWODQGRQ« (YHUWRQ)&±(QJOLVK3UHPLHU/HDJXH$IWHULPSUHVVLQJRQWULDOVLJQHGDRQH\HDUFRQWUDFWZLWK(YHUWRQ)&RQ«$VDPHPEHU RIWKH(YHUWRQUHVHUYHVTXDGWKHVWULNHUPDGHVHYHQDSSHDUDQFHVLQWKH(QJOLVK3UHPLHU5HVHUYH/HDJXH1RUWK«6FRUHGLQDKRPHZLQ RYHU%XUQOH\UHVHUYHVRQ«6WUXFNIRUWKHHTXDOL]HULQDGUDZY6XQGHUODQGUHVHUYHVRQ«'XULQJ(YHUWRQVWLQWWULDOHG ZLWK6FRWWLVK3UHPLHU/HDJXHFOXE0RWKHUZHOO)&LQ0DUFK«$IWHUEHLQJUHOHDVHGE\(YHUWRQDWWKHHQGRIWKHSUHYLRXVVHDVRQ$UQRX[ KDGDWULDOZLWK(QJOLVK/HDJXH2QHVLGH3O\PRXWK$UJ\OH)&LQ-XO\«&DUROLQD'\QDPR±86/3UHPLHU'HYHORSPHQW /HDJXH'XULQJKLVWLPHDW:DNH)RUHVW8QLYHUVLW\SOD\HGWKUHHVXPPHUVZLWK3'/FOXE&DUROLQD'\QDPR«7KHVWULNHUPDGHRQH DSSHDUDQFHIRUWKH'\QDPRWKRXJKLWSURYHGWREHDQHYHQWIXORQHDVKHVFRUHGWKHJDPHZLQQHUDQGWKHVTXDG¶VVL[WKJRDOLQDQ WURXQFLQJRI&RFRD([SRVRQ«6FRUHGIRXUJRDOVDQGWZRDVVLVWVLQHLJKWDSSHDUDQFHV«7KRVHJRDOVFDPHLQDZLQ# 1DVKYLOOH0HWURV  DGHIHDW#&DU\&ODUHWV  DGUDZY&HQWUDO)ORULGD.UD]H  DQGDGHIHDWY$WODQWD6LOYHUEDFNV 8 V  «:DVQDPHGWRWKH3'/ V$OO(DVWHUQ&RQIHUHQFH7HDPDIWHUVFRULQJHLJKWJRDOVDQGUHFRUGLQJWKUHHDVVLVWVLQVHYHQ DSSHDUDQFHVGXULQJKLVWKLUGVHDVRQZLWKWKH'\QDPR«6FRUHGWZLFHLQDZLQY:HVW9LUJLQLD&KDRVRQ«1RWFKHGDKDWWULFNLQD YLFWRU\#:HVW9LUJLQLD&KDRVRQ«$OVRVFRUHGWZRJRDOVLQDZLQY9LUJLQLD/HJDF\RQ« 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 )25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV   ±.</(%(&.(50$1±&$37$,1 0)  OEV  &URIWRQ0' /$670/60$7&+6WDUWHGDQGSOD\HGILUVWPLQXWHVRI56/¶VKRPHORVVY&+,RQEHIRUHHDUO\HMHFWLRQ /$670/6*2$/Y3+, ¶ ±WRRNVKRUWFRUQHUDQGGULEEOHGDURXQGWRSFRUQHURIER[ODXQFKLQJERPEIURP\DUGV JDPHV  /$670/6$66,67Y.& ¶ ±IRXQG%RUFKHUVRQ).IRUJDPHZLQQLQJKHDGHUKLVWK*:$RIWKHVHDVRQ JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 127(*DPHZLQQLQJDVVLVWRQY1<ZDVWKHWKRIKLV56/FDUHHUJLYLQJKLPWKHDOOWLPHOHDGLQWKHFDWHJRU\RYHU0RUDOHV«(QGHG VHDVRQZLWKDVVLVWVLQ56/XQLIRUP UGDOOWLPH DQG*:$ VWLQ56/KLVWRU\ «'HVSLWHQDWLRQDOWHDPFDOOXSVDQGGLVFLSOLQDU\ VXVSHQVLRQVHDVLO\OHG56/¶VPLGILHOGFRQWLQJHQWLQJDPHVSOD\HG  JDPHVVWDUWHG  DQGPLQXWHV  WKHODWWHUWZRPDUNVERWK SODFLQJQGRQWKHVTXDGDPRQJVWILHOGSOD\HUVEHKLQGRQO\%RUFKHUV«2QHRIHLJKW0/6SOD\HUVFDOOHGLQE\860HQ¶V1DWLRQDO7HDPFRDFK -XUJHQ.OLQVPDQQIRUUHFHQW86Y0H[LFRIULHQGO\LQ3KLODGHOSKLD GUDZ «.\OHUHSRUWHGWR86FDPSRQ$XJXVWDQGPHW56/LQ 7RURQWRRQ$XJXVWDOORZLQJKLPWRQRWPLVVDQ\0/6OHDJXHJDPHV«%HFNHUPDQDOVRVHOHFWHGE\.OLQVPDQQIRUWKHHDUO\6HSWHPEHU 86IULHQGOLHVEXWPLVVHGY&RVWD5LFD DOORZLQJKLPWRSOD\IRU56/DJDLQVW3+,RQ MRLQLQJWKH86017RQIRUWKH6HSWIULHQGO\ LQ%UXVVHOV%HOJLXP«3OD\HGILQDOPLQXWHVLQ86$ORVVDW%HOJLXPFRQQHFWLQJRQSDVVHVDQGVWDELOL]LQJ86GHIHQVH«%HFDPH 56/¶VILUVWFDXWLRQDFFXPXODWLRQYLFWLPRIIRUFLQJKLPWRPLVV56/¶VZLQDW1<RQ«+DVQHDUO\GRXEOHGKLVSUHYLRXVVLQJOH VHDVRQDVVLVWWRWDORIILYH &2/ «5HGHILQLQJRIGHHSPLGILHOGUROHUHVXOWHGLQKLPFROOHFWLQJDFDUHHUKLJKDVVLVWV 7WKLQ0/6LQ  LQFOXGLQJ*:$ 7QGLQ0/6ZLWK%UDG'DYLV «5HGFDUGY&+,ZDVILUVWRIJDPH56/FDUHHUDQGRQO\QGRIJDPH 0/6FDUHHU«6HUYHGDQDGGLWLRQDOWZRJDPHVXVSHQVLRQOHYLHGE\0/6'LVFLSOLQDU\&RPPLWWHHRQWRSRIUHGFDUGIRUKHDGEXWWLQJ LQFLGHQWLQYROYLQJ&+,¶V3DODGLQL«3OD\HGIXOOPLQXWHVLQERWK86017IULHQGOLHVLQ2FWREHUD:RYHU+RQGXUDV  DQGD/WR (FXDGRU  «+LVORQJGLVWDQFHVWULNHIURPY3+,PDGHWKH0/6*RDORIWKH<HDUSUHOLPLQDU\OLVW«   ±721<%(/75$1 ')  OEV  &ODUHPRQW&$ /$670/60$7&+6WDUWHGDQGSOD\HGPLQXWHVLQ56/¶VURDGZLQ#6($RQHMHFWHGIRUQG\HOORZDWWKDWWLPH /$670/6*2$/+DV\HWWRVFRUHLQ0/6 JDPHV  /$670/6$66,67#6- ¶ ±*RWGHHSLQWRRIIHQVLYHFRUQHUFXWWLQJEDOOEDFNWR0RUDOHVZKRVHWXS%HFNHUPDQ JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 127(7DOOLHGJDPHZLQQLQJJRDO±ILUVWHYHULQDQ56/XQLIRUP±LQ2SHQ&XSZLQYV86/:LOPLQJWRQ+DPPHUKHDGVRQ«6XIIHUHG DOHIWDGGXFWRUWHDULQUHVHUYHJDPHORVVY.&RQDPDVVLYHEORZWR56/¶VPRVWFRQVLVWHQWRXWVLGHEDFNLQ«5HWXUQHGWR WUDLQLQJRQ7KXUVGD\2FWREHU«'HVSLWHQRWEHLQJRQPDQURVWHUIRUY3RUWODQGVHDVRQILQDOHFRXOGEHLQOLQHWRUHWXUQGXULQJ SOD\RIIV«   ±1$7%25&+(56 ')  OEV  3XHEOR&2 /$670/60$7&+:HQWWKHIXOOPLQXWHVRQY325LQ56/¶VUHJXODUVHDVRQHQGLQJGUDZDW5LR7LQWR6WDGLXP /$670/6*2$/Y.& ¶ ±EURNHJDPHVFRUHOHVVVWUHDNZLWKSRZHUIXOKHDGHURQ%HFNHUPDQIUHHNLFN JDPHV  /$670/6$66,67Y&+9 ¶ ±$VVLVWHG-RKQVRQRQ56/*:*LQDZLQEUHDNLQJDQJDPHDVVLVWOHVVVWUHDN JDPHV  /$67&&/*2$/)ROORZLQJDFOHDUHGFRUQHUVWRUPHGEDFNLQWRER[WRJHWRQD:LOO-RKQVRQFURVVRQ#07< &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 127(0LVVHGJDPHY3+,GXHWRUHGFDUGSULRUZHHN#&+9KLVUGHMHFWLRQRIVHDVRQ &&/#&/%Y1( «&KDUJHGZLWKRZQ JRDORQ#/$56/¶VILUVW2*VLQFH-XQHDW.& %HOWUDQ DQG%RUFKHUV¶ILUVWVLQFH ZLWK&RORUDGR «0DGHWK0/6UHJXODU VHDVRQDSSHDUDQFHRQ#/$DQGIROORZHGZLWKWKUHJXODUVHDVRQVWDUWLQOHDJXHSOD\RQ#&2/DJDLQVWIRU5DSLGVVLGH«   ±)$%,Ã&#x2C6;1(63Ã&#x2039;1'2/$ ):  OEV  %XHQRV$LUHV$UJHQWLQD /$670/60$7&+5HJLVWHUHGDVVLVWGXULQJPLQXWHSHUIRUPDQFHRQY325KHOSLQJ56/DFKLHYHDGUDZLQUHJXODUVHDVRQ ILQDOH /$670/6*2$/#/$ ¶ ±6FRUHGRQKHDGHUWRIDUSRVWRQFRUQHUNLFNIURP0RUDOHV JDPH

/$670/6$66,67Y325 ¶ ±3URYLGHGSHUIHFWO\ZHLJKWHGWKURXJKEDOOUDQRQWRE\6DERULRIRUOREEHGRQHWRXFKILQLVK $&7,9(  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 127(+LVJRDOVSODFHGQGRQ56/LQ EHKLQG6DERULR HDVLO\VXUSDVVHGKLVSUHYLRXVFDUHHUKLJKRIVL[  DQGILQLVKHG7WK DFURVV0/6LQ«+LVDVVLVWVHTXDOHGFDUHHUEHVWWDOO\  «/HG56/LQVKRWVRQJRDOZLWK 7WKLQ0/6 DQGSODFHGQGEHKLQG 6DERULRLQVKRWVZLWK«$OVR7WKLQ0/6ZLWKDVKRWSHUFHQWDJH«0LVVHGDW9DQFRXYHUGXHWR\HOORZFDUGDFFXPXODWLRQ« 6FRUHGJRDOVLQFRQVHFXWLYHJDPHVWZLFHLQ #3+, Y'&:HQWRQDWHDULQHDUO\VXPPHUVFRULQJILYHJRDOVLQDVHYHQ JDPHVWUHWFK«1RWFKHGVHFRQGEUDFHRI0/6FDUHHURQ#1<SDFLQJ56/WRDURDGZLQ

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 )25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV   ±/8,6*,/ 0)  OEV  *DUGHQ*URYH&$ /$670/60$7&+6WDUWHGDQGSOD\HGPLQXWHVRI56/¶VURDGGUDZ#&2/RQ /$670/6*2$/#+28 ¶ ±WRRN%HFNHUPDQSDVVDQGODXQFKHGORZOLQHUIURP\DUGVRXW JDPHV  /$670/6$66,67+DV\HWWRSURYLGHDVVLVWLQFDUHHU0/6DSSHDUDQFHV &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 862&*3*6*$LQPLQ 8623(1&83*3*6*$LQPLQXWHV 0/65(6(59(/($*8(*3*6*$LQPLQXWHV 127(6FRUHGILUVWFDUHHU0/6JRDORQY1<«7KDWORQJGLVWDQFHODVHUDOVRHDUQHGDVSRWRQWKHSUHOLPLQDU\0/6*RDORIWKH<HDUOLVW «,QDGGLWLRQWRILUVWWHDPEUHDNWKURXJKLQPLGVHDVRQDOVRKHOSHGFDUU\WKHORDGLQ5HVHUYH/HDJXHSOD\GXULQJWKHIURQWKDOIRIWKHFDPSDLJQ «   ±1(/621*21=$/(= 0)  OEV  %XHQRV$LUHV$UJHQWLQD /$670/60$7&+3OD\HGILQDOPLQXWHVRI56/¶VKRPHZLQY725RQ /$670/6*2$/Y6($ ¶ ±6FRUHGODWHJRDOWRFXW6($OHDGLQKDOI JDPHV  /$670/6$66,67#&/% ¶ ±+LVFRUQHUNLFNLQWKHHDUO\JRLQJZDVFKLSSHGKRPHE\2ODYH JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 127(/RVWWRVHDVRQHQGLQJLQMXU\VXIIHUHGRQ EURNHQWKPHWDWDUVDORIULJKWIRRW «+RZHYHUZDVDEOHWRUHWXUQIRU0/65HVHUYH /HDJXHDFWLRQSXWWLQJLQDKDOIKRXURQY&+,DQGPLQXWHVLQWKHVHDVRQILQDOHRQ#&2/LQZKLFKKHVXSSOLHGDVVLVWVRQERWK 56/JRDOVLQDZLQ« 

 ±1('*5$%$92<0)  OEV  1HZ/HQR[,/ /$670/60$7&+6WDUWHGDQGSOD\HGIXOOPLQXWHVRI56/¶VURDGORVV#/$RQ /$670/6*2$/Y'$/ ¶ ±%URNHJDPHJRDOOHVVVWUHDNZLWKKHDGHURYHU'DOODVGHIHQVHIRU UGJRDORIVHDVRQ JDPHV  /$670/6$66,67Y'& ¶ ±%URNHJDPHVWUHDNZRDVVLVWE\VHWWLQJXS6DERULRLQWKHER[IRUJDPHZLQQHU JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 127('HVSLWHVXIIHULQJIURPQDJJLQJLQMXULHVGXULQJWKHODWWHUKDOIRIWKHVHDVRQ*UDEDYR\¶V0/6VWDUWVZHUHWKHWKLUGPRVWIRUDQ56/ PLGILHOGHUGXULQJWKHVTXDG¶VUROOHUFRDVWHUFDPSDLJQ«6XIIHUHGOHIWKDPVWULQJVWUDLQRQY&/%IRUFLQJKLPRXWIRUDVPXFKDVVL[ZHHNV «5HWXUQHGRQYV3+,«5HDJJUDYDWHGLQMXU\LQPLQXWHSHUIRUPDQFHRQDW9DQFRXYHUNQRFNLQJKLPRXWRIILQDOWZRUHJXODU VHDVRQDIIDLUV«+DVUHWXUQHGWRIXOOWUDLQLQJDQGZLOOEHLQFRQVLGHUDWLRQIRUJDPHGD\URVWHUIRURSHQLQJ:&66OHJYV6($RQ  

±:,//-2+1621 0)  OEV  7RURQWR2QWDULR&DQDGD /$670/60$7&+5HWXUQHGIURP5DQNOHVSUDLQRQY325ZLWKDVSLULWHGPLQXWHSHUIRUPDQFHLQVHDVRQHQGLQJGUDZ /$670/6*2$/Y1( ¶ ±6ODPPHGKRPHUHERXQGRIVDYHG:LOOLDPVIUHHNLFNWRFXW1(OHDGWRMXVWRQH JDPHV  /$670/6$66,67Y'$/  ±%URNHJDPH0/6DVVLVWOHVVVWUHDNZLWKKHOSHURQODWH(VSLQGRODJRDO JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 127(-RKQVRQUHSUHVHQWHG&DQDGDLQ*ROG&XSGXW\SOD\LQJPLQXWHVDFURVVWKHWULRRIJURXSVWDJHPDWFKHV«+HGHSDUWHG56/ RQDQGUHWXUQHGLQWLPHWRFRPHRIIWKHEHQFKLQWKHKRPHJDPHDJDLQVW'&«6HUYHG\HOORZFDUGDFFXPXODWLRQVXVSHQVLRQRQ #+28«0LVVHGY3+,GXHWR&DQDGLDQ1DWLRQDO7HDP:&4GXW\«6FRUHGILQDOJRDOLQ&DQDGD¶VZLQRQY6W/XFLDSOD\LQJ ILQDOPLQXWHVZKLOHNLFNLQJRII&21&$&$):RUOG&XS4XDOLI\LQJIRUWKH0DSOH/HDIV«6WDUWHGDQGSOD\HGIXOOLQ&DQDGD¶VZLQ RQDW3XHUWR5LFR«0LVVHG#9$1GXHWR&DQDGLDQ:&4GXW\EXWVXIIHUHGDQNOHLQMXU\PLQXWHVLQWRHYHQWXDOZLQDW6W /XFLD«0LVVHG#&2/GXHWRDQNOHEXWUHWXUQHGRQY325«VWDUWVPDUNHGWKHQGPRVWIRUDQ56/PLGILHOGHULQ EHKLQGRQ%HFNHUPDQ     ±5$8:6+$10&.(1=,( ')  OEV  +RIIPDQ(VWDWHV,/ /$670/60$7&+6WDUWHGDQGSOD\HGIXOOPLQXWHVRI56/¶VURDGORVV#'&RQKLVILUVWVWDUWVLQFH#1( /$670/6*2$/+DV\HWWRVFRUHDJRDOLQ0/6 JDPHV

/$670/6$66,67+DV\HWWRUHFRUGDQDVVLVWLQ0/6 JDPHV  /$67&&/0$7&+'UHVVHGEXWGLGQRWSOD\YV6DSULVVDRQ &21&$&$)&+$03,216/($*8(*3*6*$LQPLQ   8623(1&83*3*6*$LQPLQXWHV 0/65(6(59(/($*8(*3*6*$LQPLQXWHV 127(2QO\56/SOD\HUWRDSSHDULQDOO0/65HVHUYH/HDJXHJDPHVLQWKHFLUFXLW¶VUHWXUQLQDQGORJJHGDOOPLQXWHVRIDFWLRQDW FHQWHUEDFNIRUWKH56/VLGH 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 )25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV   ±7,00(/,$ *.  OEV  (DVW,VOLS1< 0/66($621'LGQRWVHHDQ\56/ILUVWWHDPDFWLRQ Z5RFKHVWHU5KLQRV 86/ 3RVWHGD*$$VKXWRXWVDQGVDYHVLQDSSHDUDQFHVIRU5RFKHVWHU PLQ «/HG 5KLQRVWR862SHQ&XS4XDUWHUILQDOVZLWKSDLURIZLQVLQWKHFRPSHWLWLRQ 127('UHVVHGDVSDUWRIWKHPDQJDPHGD\URVWHUIRUILUVWWLPHLQKLVPRQWKVZLWKFOXERQ6DW-XO\Y&/%DQG:HG$XJ#.& GXHWR5H\QLVKFRQFXVVLRQ«$OVRGUHVVHGRQY3+,GXHWR5H\QLVKDQNOHLQMXU\«*$$ *$LQPLQV LQ*3 VWDUWV LQ0/6 5HVHUYH/HDJXHSOD\«  ±-$9,(5025$/(6 )  OEV  %XHQRV$LUHV$UJHQWLQD /$670/60$7&+:HQWWKHIXOOPLQXWHVRQY325LQ56/¶VUHJXODUVHDVRQHQGLQJGUDZDW5LR7LQWR6WDGLXP /$670/6*2$/Y/$ ¶¶ ±6FRUHGRQHDUO\JDPHZLQQLQJ3.DQGERRPLQJ\DUGHUMXVWEHIRUHKDOIWRSDFH56/ JDPHV  /$670/6$66,67#/$ ¶ ±)RXQG(VSLQGRODRQFRUQHUIRUIDUSRVWKHDGHU JDPHV  /$67&&/0$7&+6WDUWHGDQGSOD\HGIXOOPLQXWHVRI56/¶VKRPHORVVWR07<RQ /$67&&/*2$/#07< ¶ ±6FRUHGHTXDOL]HUDWWKHGHDWKRQFXWEDFNSOD\LQFRUQHURIER[JRLQJIDUSRVWWRHDUQGUDZ &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 127($IWHUUHWXUQLQJWRIXOOWUDLQLQJLQHDUO\6HSWHPEHUKDVIHDWXUHGLQ56/¶VODVWILYHFRQWHVWVLQFOXGLQJVWDUWVLQHDFKRIWKHODVWIRXUJDPHV «'UHVVHGDQGVHOHFWHGE\-DVRQ.UHLVWRWKH56/PDQJDPHGD\URVWHURQ#'&IRUWKHILUVWWLPHVLQFHDQNOHLQMXU\«6WDUWDW /$RQILUVWVLQFHDQNOHLQMXU\YV&KLYDV«PLQXWHDSSHDUDQFHRQ#9$1ILUVWIXOOJDPHVLQFHDW3RUWODQG«   ±1,&208f,= 0)  OEV  $OEXTXHUTXH1HZ0H[LFR 0/65(6(59(/($*8(*3*6*$LQPLQ 127(%HFDPHWKHILUVW5HDO6DOW/DNH±$UL]RQD$FDGHP\PHPEHUWRMXPSVWUDLJKWWRWKH8WDKVLGH¶VILUVWWHDPIURP&DVD*UDQGHDIWHU VLJQLQJD+RPH*URZQSOD\HUFRQWUDFWRQWKDWZLOOWDNHHIIHFWLQ«0XQL]MRLQHGWKH56/VHQLRUVLGHXSRQVLJQLQJDQGZLOOWUDLQ ZLWKWKHVTXDGIRUWKHUHPDLQGHURIWKLVFDPSDLJQ«  56/$UL]RQD$FDGHP\ :DVDPDLQFRJLQWKH56/$UL]RQD$FDGHP\8QGHUVTXDGWKDWHQMR\HGSOHQW\RIVXFFHVVLQLWVILUVWVHDVRQLQWKH866RFFHU 'HYHORSPHQW$FDGHP\LQ 6HSW-XQH VFRULQJJRDOVZKLOHVWDUWLQJRIKLVUHJXODUVHDVRQDQGSOD\RII DSSHDUDQFHV«+HOSHGWKH56/$=8VWRDWKLUGSODFHILQLVK SWV EHKLQGHVWDEOLVKHGSRZHUV$UVHQDO)&DQG3DWHDGRUHVLQWKH 6R&DO'LYLVLRQ±WKH$UL]RQDVTXDGSODFLQJMXVWWKUHHSRLQWVEHKLQGWKHGXR±DQGDQRYHUDOOUHFRUGRI«6WDUWHGLQDOOWKUHHRI56/$= 8V¶DSSHDUDQFHVLQWKHRSHQLQJURXQGRIWKH866'$SRVWVHDVRQDW3L]]D+XW3DUNLQODWH-XQHKHOSLQJWKHVTXDGWRDPDUN DQGWKHFXVSRITXDOLILFDWLRQIRUWKH³)LQDOV:HHN´FKDPSLRQVKLSV«3OD\HGPLQRQY6RFNHUV)& ,/ LQZLQDQGPLQRQ LQDWULXPSKRYHU&DO2G\VVH\«:HQWIXOOPLQXWHVLQGHFLVLYHJURXSFRQWHVWY1<5HG%XOOVRQ / «+HOSHGUHSUHVHQW56/ $UL]RQD$FDGHP\LQWKH*RUGDQ-DJR6XSHU*URXSDWWKHSUHVWLJLRXV'DOODV&XS;;;,,DOVRDW3L]]D+XW3DUNLQ$SULOGXULQJZKLFKWKHVTXDG ZHQWLQFRQWHVWVDJDLQVW0H[LFDQVLGH7LJUHV / %UD]LO¶V6&&RULQWKLDQV / DQGIHOORZ0/6VLGH9DQFRXYHU :KLWHFDSV)&$FDGHP\ : «0LVF$VDPHPEHURIWKH(GX.LFNSURJUDPWUDLQHGZLWKWKH\RXWKVLGHRI6SDQLVKFOXE$' $OFREHQGDVLQ0DGULGIURP6HSW±-XQH«(GX.LFNLVDHGXFDWLRQERDUGLQJVFKRRODQGVRFFHUDFDGHP\FDPSSURJUDPWKDWIHDWXUHV SURJUDPVDFURVVWKHJOREHIRU\RXQJSOD\HUVDJHV«6HUYHGWULDOVZLWK$'&ROPHQDUDQG3R]XHORRIWKH6SDQLVK7KLUG'LYLVLRQ« 3OD\HGKLVFOXEVRFFHUIRU(OLWH)&LQKLVKRPHWRZQRI$OEXTXHUTXHIURPWKHDJHVRIKHOSLQJWKHVTXDGWRVWDWHFKDPSLRQVKLSVLQHDFK RIKLVILYH\HDUVXQGHUFRDFK*DEH1RVVHLU«3OD\HGLQWKH5HJLRQ,92O\PSLF'HYHORSPHQW3URJUDPWKURXJKWKHDJHRI«   ±-$0,6212/$9( ')  OEV  0HGHOOLQ&RORPELD /$670/60$7&+:HQWWKHIXOOPLQXWHVRQY325LQ56/¶VUHJXODUVHDVRQHQGLQJGUDZDW5LR7LQWR6WDGLXP /$670/6*2$/Y6- ¶ ±*RWRQWKHHQGRI$OYDUH]FURVVLQWRWKHVL[WREUHDNJDPHJRDOOHVVVWUHDN JDPHV  /$670/6$66,67Y1( ¶ ±5HFRUGHGILUVWDVVLVWRIJDPH0/6FDUHHUVORWWLQJWKURXJKWR6DERZKRVHWXS)DELDQ JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 127(6XIIHUHG*UDGH0&/VSUDLQLQ/HIW.QHHGXULQJ0/6$OO6WDU*DPHYV0DQFKHVWHU8QLWHGRQDW5HG%XOO$UHQDNHHSLQJ KLPRXWRIDFWLRQIRUDPRQWK Y&/%WKURXJK#+28 «5HWXUQHGWRDFWLRQRQ#&+9«DSSHDUDQFHDQGVWDUWVLQOHDJXH SOD\ERWKUDQNHGQGPRVWDPRQJVW56/GHIHQGHUVLQ«$VVLVWRQY1(PDUNHGUHLJQLQJ0/6'HIHQGHURIWKH<HDU¶VILUVWKHOSHU VLQFHMRLQLQJ56/SULRUWRWKHVWDUWRIWKHFDPSDLJQ«   ±3$8/2-81,25 ):  OEV  7HUHVLQD%UD]LO /$670/60$7&+6WDUWHGDQGSOD\HGILUVWPLQXWHVRI56/¶VURDGORVV#9$1RQ /$670/6*2$/#1( ¶ 6FRUHGRQHRQRQHZLWK*.DIWHUEHLQJVSUXQJDWPLGILHOGE\:DUQHUSDVV JDPHV  /$670/6$66,67#'& ¶ IRXQG6DERULRDWWRSRIER[IRUFRQVRODWLRQJRDO JDPHV  /$67&&/0$7&+3OD\HGILQDOPLQXWHVRI56/¶VKRPHORVVWR07<RQ /$67&&/*2$/Y&$= ¶¶ ±6FRUHGWZLFHLQVSHFWDFXODUIDVKLRQWRJLYH56/KRPHZLQDQG*URXS$WLWOHRYHU&UX]$]XO &21&$&$)&+$03,216/($*8(*3*6*$LQPLQ 127(6HULHVRIKDPVWULQJDQGKLSIOH[RULQMXULHV DQGVXEVHTXHQWUHDJJUDYDWLRQ FDXVHG3DXOR-XQLRUWRPLVVDOORI0D\-XQHDQG-XO\« 1LQHPLQXWHDSSHDUDQFHDW7RURQWRRQZDVILUVW0/6DFWLRQVLQFHDVSDQRIJDPHV« 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 )25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV    ±.</(5(<1,6+ *.  OEV  9DOHQFLD&$ /$670/60$7&+5HWXUQHGWRILHOGIURPLQMXU\LQ5HVHUYH/HDJXHDFWLRQRQ#&2/KHOSLQJWRFORVHRXWDVKXWRXWYLFWRU\LQSODFH RI7LP0HOLD /$670/6:,1#1( FDUHHUZLQ  /$670/66+87287#1(±QGFDUHHUFOHDQVKHHW /$67&&/0$7&+0DGHIRXUVDYHVLQ56/¶VKRPHZLQY&UX]$]XOHDUQLQJYLFWRU\LQ*URXS$FOLQFKHURQ &21&$&$)&+$03,216/($*8(*3*6 5(&25' *$$ 62 862& *3*6 5(&25' *$$ *$ 62 127(6LGHOLQHGIRUPXFKRI$XJXVWDQG6HSWHPEHUGXHWRVHSDUDWHLQMXULHV FRQFXVVLRQDQGORRVHERQHVSXULQ5DQNOH   ±1,&.5,0$1'2 *.   OEV    0RQWFODLU&$ /$670/60$7&+0DGHVDYHVRQY325EXWORVWFOHDQVKHHWLQZDQLQJPRPHQWVRIGUDZLQUHJXODUVHDVRQILQDOH /$670/6:,1DW1< FDUHHUZLQVZLWK56/ JDPHV  /$670/66+87287#&2/±WKFDUHHUVKXWRXW VWIRU56/ VROHSRVVHVVLRQRIQGSODFHRQ0/6FDUHHUFKDUW JDPH  &21&$&$)&+$03,216/($*8(*3*6 5(&25' *$$ 62 0/66($621 *3*6 5(&25' *$$ 62  127(6)LQLVKHGWLHGIRU0/6OHDGZLWKVKXWRXWV Z+DUWPDQ DQG UGLQ0/6LQZLWKZLQV«1RWFKHGWKORQJHVWVKXWRXW VWUHDNIRUDQ0/6JRDONHHSHULQDWPLQXWHV #325WKURXJKY6($ DQGILQLVKHGWKLQVDYHSHUFHQWDJH  «1RZ UDQNVQGDOOWLPHZLWKVKXWRXWV EHKLQGRQO\+DUWPDQ¶V DQG UGZLWKFDUHHUZLQVJDPHVSOD\HGLQJRDODQGVWDUWVLQJRDO «  ±52%%,(5866(// ')  OEV  $PKHUVW0$ /$670/60$7&+:HQWWKHIXOOPLQXWHVRQY325LQ56/¶VUHJXODUVHDVRQHQGLQJGUDZDW5LR7LQWR6WDGLXP /$670/6*2$/Y.& ¶ ±%URNHJDPHVFRUHOHVVVWUHDNE\VORWWLQJKRPHUHERXQGRIVDYHG0RUDOHVIUHHNLFN JDPHV  /$670/6$66,67Y725 ¶¶ ±3DLURIFURVVHVLQWRER[±VTXDUHWKURXJKGHIHQVHDQGORIWHGRYHUWRS±IRXQG6DERULR  JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV  ±$/9$526$%25Ã&#x2039;2 ):  OEV  6DQ&DUORV&RVWD5LFD /$670/60$7&+6FRUHGDQGSOD\HGIXOOPLQXWHVRQY325LQGUDZWKDWPDUNHGUHJXODUVHDVRQILQDOH /$670/6*2$/Y325 ¶ ±&KLSSHG325JRDOLH7UR\3HUNLQVLQVWKDOIVWRSSDJHWLPHIRU56/¶VRQO\VFRUHRIWKHJDPH $&7,9(  /$670/6$66,67Y6- ¶ ±WDOOLHGQGKHOSHULQJDPHVZLWKSDVVWR%HFNHUPDQIRUUGJRDOY6- JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 0/66($621*3*6*$LQPLQ 862&*3*6*$LQPLQ 127(&ORVHGRXWWKHUHJXODUVHDVRQDVWKHWHDP¶V*ROGHQ%RRWZLQQHUIRUWKHVHFRQGVWUDLJKW\HDUWKDQNVWRKLVWKJRDORIWKH FDPSDLJQLQVHDVRQILQDOHRQY325«*:*SDFHGVTXDGDQGILQLVKHG7WKDFURVV0/6 OHDGHUVRQ «%HFDPHWKHILUVWSOD\HUWR HYHUZLQWKHDZDUGLQEDFNWREDFNVHDVRQVIRU56/DQGEHFRPHVRQWKHVHFRQGSOD\HUWRHYHUZLQWKHDZDUGWZLFH 5REELH)LQGOH\   «$OVROHGWKHWHDPLQVKRWV  DQGILQLVKHGVHFRQGEHKLQG(VSLQGRODLQVKRWVRQJRDO  «+LVJRDOVSODFHG7WKRQWKH0/6 VFRULQJFKDUWZKLOHKLVJRDOVSHUJDPHRXWSXWZDVWKLQWKHOHDJXH«  ±&+5,66&+8/(5 ')  OEV  $XURUD,/ /$670/60$7&+6WDUWHGDQGSOD\HGILUVWPLQXWHVRI56/¶VURDGORVV#9$1RQ /$670/6*2$/Y3+, ¶ ±1RGGHGKRPHFRUQHUNLFNIURP0).\OH%HFNHUPDQIRUVHFRQGFDUHHU0/6JRDO JDPHV  /$670/6$66,67+DV\HWWRUHFRUGDQDVVLVWLQ0/6FDUHHU JDPHV  /$67&&/0$7&+3OD\HGILQDOPLQXWHVLQ56/¶VKRPHZLQYV6$3RQUHSODFLQJLQMXUHG-DPLVRQ2ODYH &21&$&$)&+$03,216/($*8(*3*6*$LQPLQ 8623(1&83*3*6*$LQPLQXWHV 0/65(6(59(/($*8(*3*6*$LQPLQ 127(6FKXOHUIROORZHGXSDURRNLHFDPSDLJQE\VHWWLQJDFDUHHUKLJKLQJDPHVSOD\HG  JDPHVVWDUHG  DQGPLQXWHV  LQKLV VHFRQG\HDULQ0/6«$OVRWDOOLHGWKHILUVWJRDOVRIKLVSURIHVVLRQDOFDUHHUZLWKKLVLQLWLDOSURIHVVLRQDOJRDORQ#1(VWDQGLQJDVWKH JDPHZLQQHULQDYLFWRU\«6HFRQGJRDORQY3+,DOVRVWRRGDVPDWFKZLQQHUW\LQJKLPZLWK%RUFKHUV (VSLQGRODIRUQGRQVTXDG LQ« 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 )25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV   ±'211<72,$ 0)  OEV  7XFVRQ$= 0/65(6(59(/($*8(*3*6*$LQPLQ  :DVVLJQHGDVWKHILUVW+RPH*URZQSOD\HULQ56/KLVWRU\RQ0D\«:DVDPHPEHURIWKH56/$UL]RQDEUDQFKRI56/¶V<RXWK 'HYHORSPHQWV\VWHPUXQRXWRIWKH3KRHQL[DUHDEHWZHHQ«&RPSHWHGDVSDUWRIWKH56/8VLGHWKDWUHSUHVHQWHG0/6DWWKH -56:RUOG&XS&RPXQLGDGGH0DGULG 8&OXE:RUOG&XS FRPSHWLWLRQLQ0DGULGLQ0D\DQGWKH8VLGHWKDWILQLVKHGXQGHIHDWHG DQGLQUGSODFHDWWKH680&XS«$WWHQGHG3LPD&RPPXQLW\&ROOHJHLQVFRULQJJRDOVDQGDGGLQJDVVLVWVGHVSLWHPLVVLQJ PXFKRIWKHVHDVRQGXHWRLQMXU\«+HOSHG&DQ\RQGHO2UR+6 2UR9DOOH\$= WREDFNWREDFN$$UL]RQD6WDWH&KDPSLRQVKLSVGXULQJKLV -XQLRUDQG6HQLRUVHDVRQVGXULQJZKLFKKHFROOHFWHGDQDVWRQLVKLQJJRDOV«6FRUHGDOORI&'2¶VIRXUJRDOVLQWKHILUVWKDOIRILWV FKDPSLRQVKLSZLQGXULQJKLVILQDOFRQWHVWLQKLJKVFKRRO  ±%/$.(:$*1(5 ')  OEV  7DPSD)/ /$670/60$7&+6WDUWHGDQGSOD\HGPLQXWHVRI56/¶VURDGORVV#'&RQKLVILUVW56/VWDUWDIWHUVLJQLQJRQ 0/65(6(59(/($*8(*3*6*$LQPLQ  0/6([SHULHQFHWK6HDVRQ   $FTXLUHG 56/6LJQHGWRDFRQWUDFWRQ 9$16LJQHGWRWKHQ866)'FRQWDFWRQ6LJQHGWR0/6FRQWUDFWRQ5HOHDVHGRQ  0/63URIHVVLRQDO&DUHHU  9DQFRXYHU:KLWHFDSV)&±0/6 0DGHKLVRIILFLDOUHWXUQWR0DMRU/HDJXH6RFFHUDIWHUZLQQLQJDVSRWZLWK9DQFRXYHU:KLWHFDSV)& GXULQJWKHSUHVHDVRQVLJQLQJZLWKWKHH[SDQVLRQVTXDGMXVWDZHHNEHIRUHWKHVHDVRQRSHQHURQ«6WDUWHGLQDOOQLQH DSSHDUDQFHVLQ0/6SOD\IRU9DQFRXYHUGXULQJLWVLQDXJXUDO0/6FDPSDLJQ PLQXWHV «$IWHUVLWWLQJRXWRI:KLWHFDSV)&¶VRSHQLQJGD\ ZLQRQY725VWDUWHGLQHLJKWRIWKHWHDP¶VQH[WFRQWHVWVLQFOXGLQJVL[VWUDLJKWPDWFKHVEHJLQQLQJZLWK#3+, / «/LQHG XSSULPDULO\DWOHIWEDFNIRU9DQFRXYHUVWDUWLQJVHYHQRIKLVQLQHDSSHDUDQFHVRQWKH:KLWHFDSV¶EDFNOLQH«$OVRPDGHDSDLURIDSSHDUDQFHV LQWKH1XWULOLWH&DQDGLDQ&KDPSLRQVKLSWRXUQDPHQWJRLQJWKHIXOOPLQXWHVRQ#0RQWUHDOLQWKHILUVWOHJRIWKH6HPLILQDOV : :RQDJJ DQGSOD\LQJPLQXWHVRIIWKHEHQFKRQ#725LQWKHVHFRQGOHJRIWKH)LQDOV //RQDJJ «:DJQHU¶VSOD\LQJWLPH GZLQGOHGDIWHU9DQFRXYHUUHSODFHGKHDGFRDFK7HLWXU7KRUGDUVRQZLWK7RP6RHKQLQODWH0D\:KLWHFDSV)&HYHQWXDOO\UHOHDVLQJKLPDORQJ ZLWKIHOORZGHIHQGHU0RXORXG$NORXORQ« 9DQFRXYHU:KLWHFDSV±866)' $IWHUEHJLQQLQJKLVFDUHHUZLWKIRXUVHDVRQVDW)& 'DOODVVLJQHGRQZLWK9DQFRXYHU:KLWHFDSVRIWKHWKHQ866)'/HDJXHRQ«6WDUWHGLQRIKLVUHJXODUVHDVRQDSSHDUDQFHV HQURXWHWRQRWFKLQJIRXUJRDOVDQGDQDVVLVWDFURVVPLQXWHVRISOD\« )&'DOODV±0/6 6WDUWHGHLJKWRIUHJXODUVHDVRQ DSSHDUDQFHVGXULQJWKHILQDORIKLVIRXUVHDVRQVZLWK)&'DOODVWRWDOLQJPLQXWHVRIDFWLRQ«$OOHLJKWRIKLVVWDUWVFDPHGXULQJWKHILUVWKDOI RIWKH\HDUIRU6FKHOODV+\QGPDQ¶VVLGHHQGLQJZLWKDPLQXWHVWLQWRQ#+28 / «0LQXWHVZRXOGEHFRPHVSRUDGLFVRRQDIWHU DV:DJQHU¶VODVWVHYHQDSSHDUDQFHVDFURVVWKHILQDOIRXUPRQWKVRIWKHVHDVRQFDPHRIIWKHVXEVWLWXWH¶VEHQFK« )&'DOODV±0/6  5HJLVWHUHGFDUHHUKLJKVLQJDPHVSOD\HG  JDPHVVWDUWHG  DQGPLQXWHVSOD\HG  GXULQJKLVWKLUGVHDVRQDVFRDFK6WHYH0RUURZ SOXJJHGLQWKHZLQJHURQWKHOHIWVLGHRIWKH+RRSV¶IRUPDWLRQSULPDULO\DWIXOOEDFN )&'DOODV±0/6 +LVORQHUHJXODUVHDVRQ DSSHDUDQFHIRU'DOODVZRXOGPDUNKLVRIILFLDO0/6GHEXWWKHWKHQ\HDUROGVWDUWLQJDQGSOD\LQJWKHIXOOPLQXWHVDWOHIWEDFNRQY +28 / «6DZSOHQW\RIDFWLRQLQ0/65HVHUYH'LYLVLRQDFWLRQVWDUWLQJRI'DOODV¶FRQWHVWVZKLOHWDOO\LQJPLQXWHVRISOD\DQG KHOSLQJWKH+RRSVWRDPDUN« )&'DOODV±0/6 $IWHURULJLQDOO\FRPPLWWLQJWRSOD\FROOHJLDWHO\DW$&&SRZHUKRXVH0DU\ODQG WDFNHGFRXUVHDQGVLJQHGD*HQHUDWLRQDGLGDVFRQWUDFWZLWK0DMRU/HDJXH6RFFHU«:DVGUDIWHGE\)&'DOODVLQWKH6HFRQG5RXQG WK RYHUDOO RIWKH0/66XSHU'UDIWLQ3KLODGHOSKLDRQ«86<RXWK1DWLRQDO7HDPV5HSUHVHQWHGWKH8QLWHG6WDWHVUHJXODUO\ EHWZHHQDWWKH88 8OHYHOV«868QGHUV:LWKWKH86$82O\PSLFVTXDGVWDUWHGDOOWKUHH*URXS%PDWFKHVDW WKH7RXORQ,QWHUQDWLRQDO7RXUQDPHQWLQ7RXORQ)UDQFH«$SSHDUHGLQFRQWHVWVRQY7XUNH\ / Y&{WHG¶,YRLUH /   Y,WDO\ / «868QGHUV8:DVLQYROYHGZLWKWKH86$8VTXDGWKURXJKRXWPXFKRI«0DGHURVWHUIRUD8FDPS LQ$UJHQWLQDLQ$SULOHDUQLQJDVWDUWLQDIULHQGO\GHIHDWWR$UJHQWLQD8¶VRQ«$WWHQGHGDQRWKHUWUDLQLQJFDPSLQ&DQDGDLQ -XO\EHIRUHSDUWLFLSDWLQJLQWKH0LON&XSWRXUQDPHQWLQ1RUWKHUQ,UHODQGDQGWKH%XVDQ,QWHUQDWLRQDO8)RXU1DWLRQV7RXUQDPHQW LQ6RXWK.RUHD«/DVW8DSSHDUDQFHFDPHDVDODWHVXEVWLWXWHDW3L]]D+XW3DUNKHOSLQJWKH86$WRDZLQRYHUWKH+DLWLDQVHQLRU VTXDGRQ«868QGHUV)URPWRZDVDPHPEHURIWKH8QLWHG6WDWHV81DWLRQDO7HDP5HVLGHQF\3URJUDPLQ %UDGHQWRQ)/«$VDPHPEHURIWKH86$8VTXDGWKHGHIHQGHUPLGILHOGHUPDGHDSSHDUDQFHVVFRULQJKLVILUVWHYHULQWHUQDWLRQDOJRDO LQDIULHQGO\GHIHDWWR8UXJXD\8¶VLQ3RUWH$OHJUH%UD]LORQ«6WDUWHGDQGZHQWWKHIXOOPLQXWHVLQDOOIRXURIWKH86$¶V PDWFKHVDWWKH),)$8:RUOG&XSLQ3HUXLQFOXGLQJFRQWHVWVRQY1RUWK.RUHD : Y,WDO\ : Y&{WH G¶,YRLUH 7 DQGWKHTXDUWHUILQDOGHIHDWWRWKH1HWKHUODQGVRQ«&OXE<RXWK:DJQHUDWWHQGHGDQGSOD\HGVRFFHUIRU3DXO5 :KDUWRQ+LJK6FKRROLQ7DPSD)/GXULQJKLVIUHVKPDQ\HDUEHIRUHPRYLQJWRWKH86$85HVLGHQF\3URJUDPLQ«,WZDVZLWKWKH 5HVLGHQF\3URJUDPWKDWWKHGHIHQGHUPLGILHOGHUILQLVKHGKLJKVFKRROD\HDUHDUO\DWWKH(GLVRQ$FDGHPLF&HQWHULQ%UDGHQWRQ)/«$VD \RXWKSOD\HUZRQWKUHH)ORULGD6WDWH&KDPSLRQVKLSVZLWK7DPSD¶V%ODFN:DWFK6RFFHU&OXE«$OVRSOD\HGRQH\HDUZLWK+LOOVERURXJK&RXQW\ 8QLWHG6RFFHU&OXE +&8QLWHG LQ7DPSD«,QLWLDOO\FRPPLWWHGWRSOD\LQJ1&$$'LYLVLRQ,VRFFHUZLWKGHIHQGLQJQDWLRQDOFKDPSLRQ0DU\ODQG EHIRUHRSWLQJWRVLJQD*HQHUDWLRQDGLGDVFRQWUDFWZLWK0/6LQ      

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 )25)8//3/$<(5%,2*5$3+,(63/($6('2:1/2$'7+(56/0(',$*8,'($7 KWWSZZZULRWLQWRVWDGLXPFRPGRFV56/0HGLD*XLGH ZHEYHUVLRQ SGI 255()(572ZZZ5($/6$/7/$.(FRP3OD\HUV   ±&2//(1:$51(5 0)  OEV  'HQYHU&2 /$670/60$7&+6WDUWHGDQGSOD\HGILUVWPLQXWHVRI56/¶VORVV#9$1RQVXIIHULQJUHGFDUGHMHFWLRQ /$670/6*2$/+DV\HWWRVFRUHLQ0/6FDUHHU JDPHV  /$670/6$66,67 ¶ ±$IWHUZRUNLQJDVXEOLPHZLWK6DERULRKLVWKURXJKEDOOVSUDQJ(VSLQGRODIRUEDFNEUHDNLQJWDOO\  JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQ 8623(1&83*3*6*$LQPLQXWHV 0/65(6(59(/($*8(*3*6*$LQPLQ 127()LQLVKHGVHFRQG0/6FDPSDLJQZLWKDVVLVWVJRRGIRUVHFRQGRQWKHVTXDGLQUHJXODUVHDVRQSOD\«3ODFHG WKDFURVV0/6ZLWK DVVLVWVSHUPLQXWHV«7ZRRIKLVILYHKHOSHUVZHUHJDPHZLQQLQJDVVLVWV #1(±6FKXOHUY&+9±-RKQVRQ «5HFRUGHGILUVW 0/6DVVLVWDQGPXOWLDVVLVWSHUIRUPDQFHLQFRQWHVW#1(   ±$1'<:,//,$06 0)  OEV  +HUULPDQ87 /$670/60$7&+6WDUWHG SOD\HGPLQVRQY325EHIRUHEHLQJVXEEHGRIIIRU$UWXUR$OYDUH]LQKRPHILQDOHGUDZ /$670/6*2$/Y'$/ ¶ ±%URNHJDPH0/6VFRUHOHVVVWUHDNZLWKORRSLQJIUHHNLFNRII+DUWPDQ¶VKDQGV JDPHV  /$670/6$66,67#1< ¶ ±&RUQHURQ6DERULRKHDGHUHQGHGPDWFKVWUHDNZLWKRXWDKHOSHUWKDVVLVWRI0/6FDUHHU  JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 8623(1&83*3*6*$LQPLQXWHV 1RWH'HVSLWHVWDUWLQJJDPHV:LOOLDPVWUDLOVRQO\*.1LFN5LPDQGRLQWRWDOJDPHVSOD\HGLQDSSHDULQJLQDWRWDORIFRQWHVWV   ±&+5,6:,1*(57   ') OEV    %DE\ORQ1< /$670/60$7&+6WDUWHGRQY325SOD\LQJIXOOPLQXWHVRI56/¶VUHJXODUVHDVRQILQDOHGUDZLQ6DQG\ /$670/6*2$/#&+9±+LVVROLGORZVKRWRII0RUDOHV¶VKRWRIIWKHSRVWJDYH:LQJHUWKLVILUVWFDUHHUJRDOLQ0/6SOD\  JDPHV  /$670/6$66,67Y&+9 ¶ ±+HOSHG56/SRXULWRQDJDLQVW&KLYDV86$DVVLVWLQJ)LQGOH\RQ56/¶VWKLUGLQDURXW  JDPHV  &21&$&$)&+$03,216/($*8(*3*6*$LQPLQXWHV 0/66($621*3*6*$LQPLQ 127(0LVVHGVL[ZHHNVDIWHU/ZULVWIUDFWXUHVXIIHUHGRQ#725«0DGHWULSIRU56/¶V(DVW&RDVWVZLQJLQODWH6HSWHPEHUDQGVDZ ILUVWDFWLRQLQVL[ZHHNVRQ#'&SOD\LQJIXOOPLQXWHV«

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2  

2011 REAL SALT LAKE LAMAR HUNT U.S. OPEN CUP STATS  

UNF  POS   12   MF   2   DF   8   MF   10   MF   5   MF   6   DF   7   FW   21   FW   22   MF   20   MF   30   DF   4   DF   24   GK   3   DF   28   DF   26   MF   77   MF   17   DF          

PLAYER   Jean  Alexandre   Tony  Beltran   Will  Johnson   Arturo  à lvarez   Kyle  Beckerman   Nat  Borchers   Fabiån  Espíndola   Luis  Gil   Nelson  Gonzåles   Ned  Grabavoy   Rauwshan  McKenzie   Jamison  Olave   Kyle  Reynish   Robbie  Russell   Chris  Schuler   Collen  Warner   Andy  Williams   Chris  Wingert   RSL  totals   Opponent  totals  

GP   2   2   2   1   2   2   1   2   1   2   1   1   2   1   1   2   2   1   2   2  

GS   1   2   2   0   2   2   1   2   0   1   1   1   2   0   1   1   2   1   2   2  

MIN   114   180   180   32   153   180   66   180   16   85   90   90   180   27   63   106   180   58   180   180  

G   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2   2  

A   1   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   2   1  

C   0   0   0   0   0   0   1   0   0   1   0   1   0   0   0   0   0   0   3   6  

E   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  

GAA   1.00   1.00   1.00  

PG   0   0   0  

PA   0   0   0  

    GAME-­WINNING  GOALS:  Tony  Beltran  1   GAME-­WINNING  ASSISTS:  Jean  Alexandre  1   PENALTY  KICKS:  None      

REAL SALT LAKE INDIVIDUAL GOALKEEPING UNF  POS   24   GK              

GOALKEEPER   Kyle  Reynish   RSL  Totals   Opponent  totals  

GP   2   2   2  

GS   2   2   2  

MIN   180   180   180  

GA   2   2   2  

W   1   1   1  

L   1   1   1  

T   0   0   0  

SO   1   1   1  

2011 REAL SALT LAKE LAMAR HUNT U.S. OPEN CUP RESULTS Date

Opponent

Result

Goals

Venue

6/28

vs. Wilmington Hammerheads (USL PRO)

2-0 W

RSL: %HOWUDQ Âś $OH[DQGUH Âś

Rio Tinto Stadium Sandy, Utah

7/12

at FC Dallas (MLS)

0-2 L

'$/%HQLWH] Âś -DFNVRQ Âś 

Pizza Hut Park Frisco, Texas

   

 

 

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011 2010/11 CONCACAF CHAMPIONS LEAGUE GROUP A STANDINGS

Team      Real  Salt  Lake*      Cruz  Azul*      Toronto  FC      Arabe  Unido    

RSL 2010 CONCACAF CHAMPIONS LEAGUE GROUP STAGE RESULTS ² GROUP A  :HG$XJXVW±5LR7LQWR6WDGLXP6DQG\8WDK 5HDO6DOW/DNHÃ&#x2C6;UDEH8QLGR 3$1  $  56/6DERULR '$8&RRSHU  :HG$XJXVW±(VWDGLR$]XO0H[LFR&LW\0H[LFR &UX]$]XO 0(; 5HDO6DOW/DNH 56/6DERUtR(VStQGROD-RKQVRQ &$=2UR]FR*LPHQH]  :HG6HSW±5LR7LQWR6WDGLXP6DQG\8WDK 5HDO6DOW/DNH7RURQWR)& &$1  $  56/%HFNHUPDQ2ODYH6DERULR3DXOR-U 7256DQWRV  :HG6HSW±(VWDGLR5RPPHO)HUQDQGH]3DQDPD&LW\ 3DQDPD Ã&#x2C6;UDEH8QLGR 3$1 5HDO6DOW/DNH 56/-RKQVRQ6DERULR '$8$JXLODU$QJXOR  7XHV6HSW±%02)LHOG7RURQWR&DQDGD 7RURQWR)& &$1 5HDO6DOW/DNH 56/0RUDOHV 7253HWHUVRQ  7XHV2FW±5LR7LQWR6WDGLXP6DQG\8WDK 5HDO6DOW/DNH&UX]$]XO 0(;  $  56/3DXOR-XQLRU:DUQHU &$=9LOODOX]   RSL 2010/11 CONCACAF CHAMPIONS LEAGUE QUARTERFINAL STAGE RESULTS  7XHV)HE±&ROXPEXV&UHZ6WDGLXP&ROXPEXV2KLR &ROXPEXV&UHZ 86$ 5HDO6DOW/DNH 86$  $  7XHV0DUFK±5LR7LQWR6WDGLXP6DQG\8WDK 5HDO6DOW/DNH 86$ &ROXPEXV&UHZ 86$  $  56/0RUDOHV6DERULR:LOOLDPV &/%0HQGR]D  56/DGYDQFHVRQDJJUHJDWH   SEMIFINAL STAGE RESULTS 7XHV0DUFK±5LR7LQWR6WDGLXP6DQG\8WDK 5HDO6DOW/DNH 86$ 'HS6DSULVVD &5&  $  56/6DERULR(VSLQGROD   7XHV$SULO±(VWDGLR5LFDUGR6DSULVVD6DQ-RVH&RVWD5LFD 'HS6DSULVVD &5& 5HDO6DOW/DNH 86$  $  56/2ODYH 6$3&RUGHUR6ROLV¶  56/DGYDQFHVRQDJJUHJDWH

GP   6   6   6   6  

W   4   3   2   1  

L   1   2   2   5  

D   1   1   2   0  

Pts   13   10   8   3  

GF/GA   17  /  11   15  /  9    5  /  7    4  /  14  

  $GYDQFHGWR4XDUWHUILQDO5RXQGRI&&/&KDPSLRQVKLS6WDJH )HE  0DU   56/ILUVWHYHU0/6WHDPWRZLQD&&/JURXSDQGRQO\QGQRQ0(; WHDP 2OLPSLDEHFDPHUGWZRGD\VODWHU    GROUP WINNERS: GROUP RUNNERS-­UP: 5HDO6DOW/DNH 86$  &UX]$]XO 0(;  6DQWRV/DJXQD 0(;  &ROXPEXV&UHZ 86$  0RQWHUUH\ 0(;  6DSULVVD &5&  2OLPSLD +21  7ROXFD 0(;    2010/11 CONCACAF CHAMPIONSHIP STAGE 4XDUWHUILQDOV KRPHWHDPVOLVWHGILUVW  )LUVW/HJ )HEUXDU\ &ROXPEXV 86$ 5HDO6DOW/DNH 86$  7ROXFD 0(; 0RQWHUUH\ 0(;  &UX]$]XO 0(; 6DQWRV/DJXQD 0(;  6DSULVVD &5& 2OLPSLD +21   6HFRQG/HJ 0DUFK 5HDO6DOW/DNH 86$ &ROXPEXV&UHZ 86$  0RQWHUUH\ 0(; 7ROXFD 0(;  6DQWRV/DJXQD 0(; &UX]$]XO 0(;  2OLPSLD +21 6DSULVVD &5&   6HPLILQDOV )LUVW/HJ 0DUFK 5HDO6DOW/DNH 86$ 6DSULVVD &5&  0RQWHUUH\ 0(; &UX]$]XO 0(;   6HFRQG/HJ $SULO 6DSULVVD 86$ 5HDO6DOW/DNH 86$  &UX]$]XO 0(; 0RQWHUUH\ 0(;  

&&/),1$/5(68/76  ),567/(* :HG$SULO±(VWDGLR7HFQRORJLFR0RQWHUUH\0H[LFR 0RQWHUUH\ 0(; 5HDO6DOW/DNH 86$  $  56/%RUFKHUV0RUDOHV¶ 07<GH1LJULV¶6XD]R SHQ ¶

 6(&21'/(* :HG$SULO±5LR7LQWR6WDGLXP6DQG\8WDK 5HDO6DOW/DNH0RQWHUUH\ 0(;  $  07<6XD]R

2011 MLS CUP PLAYOFFS ² WESTERN CONFERENCE SEMIFINALS ² LEG ONE REAL SALT LAKE v SEATTLE SOUNDERS FC ² SATURDAY, OCTOBER 29, 2011  

FINAL 2010/11 REAL SALT LAKE CONCACAF CHAMPIONS LEAGUE STATS

(6-­3-­3 overall;; 1st place Group A;; loses Final 2-­3 on aggregate)   UNF   15   11    8   23    7    4   77   26    5    6   20   10   17    2   22   30   10   18    3   28   12   24   19   21        

 

POS   FW   MF   MF   FW   FW   DF   MF   MF   MF   DF   MF   FW   DF   DF   MF   DF   FW   GK   DF   DF   MF   GK   FW   MF      

PLAYER   Alvaro  Saborío   Javier  Morales   Will  Johnson   Paulo  Junior   Fabián  Espíndola   Jamison  Olave   Andy  Williams   Collen  Warner   Kyle  Beckerman   Nat  Borchers   Ned  Grabavoy   Robbie  Findley   Chris  Wingert   Tony  Beltran   Nelson  González   Rauwshan  McKenzie   Arturo  Alvarez   Nick  Rimando   Robbie  Russell   Chris  Schuler   Jean  Alexandre   Kyle  Reynish   Pablo  Campos   Luis  Gil   RSL  totals   Opponent  totals  

GP   11   10   12   4   9   10   11   3   10   10   12   6   9   7   4   2   4   11   10   3   4   1   1   1   12   12  

GS   11   8   12   1   8   10   8   2   10   10   4   3   9   4   3   2   0   11   9   2   1   1   1   1   12   12  

MIN    924    759   1020    125    651    855    688    143    900    882    537    303    810    438    226    180      52    990    710    225    117      90      66      45   1080   1080  

G   8   4   3   3   2   2   1   1   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   26   17  

A   2   1   1   1   2   0   7   1   0   0   2   2   1   1   1   1   1   0   0   0   0   0   0   0   24   7  

C   1   1   0   0   2   1   2   2   3   0   0   1   1   0   2   0   0   0   2   0   2   0   0   0   22   25+  

E   0   0   0   0   1   0   0   0   0   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   3   4  

 

GAME-­WINNING  GOALS:  Álvaro  Saborío  2,  Will  Johnson  1,  Jamison  Olave  1,  Paulo  Junior  1,   Javier  Morales  1   GAME-­WINNING  ASSISTS:  Andy  Williams  4,  Fabian  Espíndola  2,  Nelson  Gonzalez  1,  Robbie   Findley  1,  Tony  Beltran  1   PENALTY  KICKS:  Álvaro  Saborío  3-­3,  Pablo  Campos  0-­1   REAL SALT LAKE INDIVIDUAL GOALKEEPING UNF   POS   GOALKEEPER   GP   GS   18   GK   Nick  Rimando   11   11   24   GK   Kyle  Reynish   1   1       RSL  Totals   12   12       Opponent  totals   12   12  

MIN   990   90   1080   1080  

GA   16   1   17   26  

GAA   1.45   1.00   1.45   2.31  

PG   3   0   3   3  

PA   3   0   3   4  

W   5   1   6   3  

  REAL SALT LAKE ² CONCACAF CHAMPIONS LEAGUE HISTORY                                  No.  of    Series                                                                            Last   vs.  Team                  Series      W-­L        GP      W-­L-­T        OT          ShO      GF    GA      Mtg.    Stage         Arabe  Unido  (PAN)      -­          -­-­-­          2      2-­0-­0        n/a        n/a        5      3      2010    Group         Cruz  Azul  (MEX)          -­          -­-­-­          2      1-­1-­0        n/a        n/a        7      6      2010    Group       Toronto  FC  (CAN)        -­          -­-­-­          2      1-­0-­1        n/a        n/a        5      2      2010    Group       Columbus  Crew  (USA)  1          1-­0          2      1-­0-­1        n/a        n/a        4      1      2011    Quarter     Saprissa  (CRC)            1          1-­0          2      1-­1-­0        n/a        n/a        3      2      2011    Semi           Monterrey  (MEX)          1          0-­1          2      0-­1-­1                                    2      3      2011    FINAL     TOTALS                                                      12      6-­3-­3        n/a        n/a      26    17    

L   3   0   3   6  

T   3   0   3   3  

SO   2   0   2   2  

Result    

 

RSL  advance  4-­1  agg.   RSL  advance  3-­2  agg.   RSL  loses  2-­3  agg.    



ZZZ5LR7LQWR6WDGLXPFRPZZZ5HDO6DOW/DNHFRPZZZ(631VSRUWVFRP

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2  

ALL-­TIME REAL SALT LAKE INDIVIDUAL PLAYOFF STATISTICS (3-­2-­4 overall)   UNF  POS  PLAYER                                          GP      GS      MIN        G        A    SHT    SOG      FC      FS    OFF      CK      C      E    10    F    Robbie  Findley                            9        4      539        4        2      21      10        9        9      11        1      0      0    11    M    Javier  Morales                            8        8      635        2        3      12        3      20      14        0      15      2      1    77    M    Andy  Williams                              9        7      622        1        2      10        5      10      11        1      10      2      0    14    F    Yura  Movsisyan                            7        5      457        1        1      20        8      16        4        3        0      0      0      7    F    Fabian  Espindola                        8        4      394        1        0        9        4      10        6        8        0      0      0    21    F    Dema  Kovalenko                            2        2      149        1        0        3        2        4        1        0        0      1      0      3    D    Robbie  Russell                            9        7      693        0        2        4        2      10        6        0        0      0      0      5    M    Kyle  Beckerman                            9        9      870        0        1      11        5      13        8        1        2      3      0      6    D    Nat  Borchers                                9        9      870        0        1        7        2      10        5        0        0      2      0    12    M    Jean  Alexandre                            2        0        18        0        0        0        0        0        0        0        0      0      0    23    F    Paulo  Araujo  Jr.                        1        0        17        0        0        0        0        0        0        0        0      0      0      2    D    Tony  Beltran                                2        2      169        0        0        1        0        0        3        0        0      0      0    16    F    Kenny  Deuchar                              1        0          1        0        0        1        0        0        0        0        0      0      0    20    M    Ned  Grabavoy                                4        2      239        0        0        4        1        3        4        0        0      1      0      8    M    Will  Johnson                                9        8      727        0        0      11        3        7      10        1        5      2      0    13    D    Ian  Joy                                          1        1        63        0        0        0        0        1        0        0        0      0      0    84    M    Clint  Mathis                                7        3      423        0        0      15        5        5        5        0        2      1      0      4    D    Jamison  Olave                              9        9      846        0        0        5        1      13      11        2        0      2      0    18    G    Nick  Rimando                                9        9      870        0        0        0        0        0        3        0        0      0      0    15    F    Alvaro  Saborio                            2        2      133        0        0        1        1        1        1        1        0      0      0    26    M    Collen  Warner                              1        0        34        0        0        0        0        0        1        0        0      0      0    17    D    Chris  Wingert                              8        8      780        0        0        3        0      14        3        0        1      1      0                  Team  totals                                  9        9      870      10      12    138      52    146    115      28      36    17      1                  Opponent  totals                          9        9      870        9        7      99      41    115    146      19      40    20      1     REAL SALT LAKE PLAYOFF GOALKEEPING OT            ShO   UNF  POS  GOALKEEPER                                  GP      GS      MIN    SHTS    SV      GA      GAA    PG    PA      W      L      T    SO  RECORD    RECORD    18    G    Nick  Rimando                                9        9      870      41      31        9    0.93      1      1      3      2      4      3    0-­0-­2      2-­0                  Team  totals                                  9        9      870      41      31        9    0.93      1      1      3      2      4      3    0-­0-­2      2-­0                  Opponent  totals                          9        9      870      52      40      10    1.03      1      1      2      3      4      2    0-­0-­2      0-­2      

 

 

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

ALL-­TIME REAL SALT LAKE TEAM & INDIVIDUAL PLAYOFF HIGHS (2005-­10) ======================================================================     PLAYOFF GAMES  Season:            4    in  2009    Season:            3    in  2008    Season:            2    in  2010     PLAYOFF MINUTES  Season:        420    in  2009    Season:        270    in  2008    Season:        180    in  2010    

CORNER KICKS  Season:          12    in  2008    Season:          12    in  2009    Season:          12    in  2010      Game:            11    11/06/2010  vs.  DAL        2-­Tms:        14    11/06/2010  vs.  DAL          Half:          8    11/06/2010  vs.  DAL  (2d)    

GOALS  Season:            5    in  2009      Game:              3    11/05/2009  at  CLB        2-­Tms:          5    11/05/2009  at  CLB          Half:          2    11/05/2009  at  CLB  (1st)    

CAUTIONS  Season:            7    in  2009      Game:              4    11/14/2009  at  CHI        2-­Tms:          7    11/08/2008  at  CHV        2-­Tms:          7    11/14/2009  at  CHI          Half:          3    11/08/2008  at  CHV  (1st)          Half:          3    11/06/2010  vs.  DAL  (1st)    

ASSISTS  Season:            5    in  2008      Game:              3    11/08/2008  at  CHV      Game:              3    11/05/2009  at  CLB        2-­Tms:          4    11/08/2008  at  CHV        2-­Tms:          4    11/05/2009  at  CLB        2-­Tms:          4    11/06/2010  vs.  DAL          Half:          2    4  times    

EJECTIONS  Season:            1    in  2010      Game:              1    10/30/2010  at  DAL        2-­Tms:          2    10/30/2010  at  DAL          Half:          1    10/30/2010  at  DAL  (2d)     WINS  Season:            2    in  2009    

SHOTS  Season:          61    in  2008      Game:            24    11/15/2008  vs.  NY        2-­Tms:        35    11/15/2008  vs.  NY          Half:        16    11/15/2008  vs.  NY  (2d)    

SHOOTOUT WINS  Season:            2    in  2009      

SHOTS ON GOAL  Season:          23    in  2008      Game:              9    11/01/2008  vs.  CHV        2-­Tms:        15    11/05/2009  at  CLB          Half:          7    11/01/2008  vs.  CHV  (2d)     FOULS COMMITTED  Season:          76    in  2009      Game:            24    11/08/2008  at  CHV        2-­Tms:        44    11/08/2008  at  CHV          Half:        13    11/08/2008  at  CHV  (1st)          Half:        13    11/05/2009  at  CLB  (2d)     FOULS SUFFERED  Season:          51    in  2009      Game:            22    11/22/2009  at  LA        2-­Tms:        44    11/08/2008  at  CHV          Half:        12    11/08/2008  at  CHV  (2d)     OFFSIDES  Season:          18    in  2009      Game:              8    11/22/2009  at  LA        2-­Tms:        13    11/22/2009  at  LA          Half:          4    10/31/2009  vs.  CLB  (2d)                

 

LOSSES  Season:            1    in  2008    Season:            1    in  2010     SHUTOUTS  Season:            2    in  2009     GOALS ALLOWED  Season:            3    in  2008    Season:            3    in  2009    Season:            3    in  2010      Game:              2    11/08/2008  at  CHV      Game:              2    11/05/2009  at  CLB      Game:              2    10/30/2010  at  DAL        2-­Tms:          5    11/05/2009  at  CLB          Half:          2    11/05/2009  at  CLB  (1st)     SAVES  Season:          18    in  2009      Game:              8    11/05/2009  at  CLB        2-­Tms:        14    11/14/2009  at  CHI          Half:          6    11/05/2009  at  CLB  (2d)  

 

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2  

ALL-­TIME REAL SALT LAKE TEAM PLAYOFF LOWS (2005-­10) ============================================================       PLAYOFF GAMES  Season:            2    in  2010     PLAYOFF MINUTES  Season:        180    in  2010     GOALS  Season:            2    in  2010      Game:              0    11/15/2008  vs.  NY      Game:              0    11/14/2009  at  CHI        2-­Tms:          0    11/14/2009  at  CHI          Half:          0    9  times     ASSISTS  Season:            3    in  2010      Game:              0    11/15/2008  vs.  NY      Game:              0    11/14/2009  at  CHI      Game:              0    11/22/2009  at  LA        2-­Tms:          0    11/15/2008  vs.  NY        2-­Tms:          0    11/14/2009  at  CHI          Half:          0    10  times    

CORNER KICKS  Season:          12    in  2008    Season:          12    in  2009    Season:          12    in  2010      Game:              0    11/08/2008  at  CHV        2-­Tms:          3    11/08/2008  at  CHV          Half:          0    4  times     CAUTIONS  Season:            5    in  2008    Season:            5    in  2010      Game:              0    11/15/2008  vs.  NY        2-­Tms:          2    10/31/2009  vs.  CLB        2-­Tms:          2    11/22/2009  at  LA          Half:          0    9  times     WINS  Season:            0    in  2010     LOSSES  Season:            0    in  2009    

SHOTS  Season:          22    in  2010      Game:              7    10/30/2010  at  DAL        2-­Tms:        15    10/31/2009  vs.  CLB          Half:          2    10/31/2009  vs.  CLB  (1st)          Half:          2    10/30/2010  at  DAL  (1st)    

TIES  Season:            1    in  2008    Season:            1    in  2010    

SHOTS ON GOAL  Season:          10    in  2010      Game:              2    10/31/2009  vs.  CLB        2-­Tms:          4    10/31/2009  vs.  CLB          Half:          1    4  times    

GOALS ALLOWED  Season:            3    in  2008    Season:            3    in  2009    Season:            3    in  2010      Game:              0    11/01/2008  vs.  CHV      Game:              0    10/31/2009  vs.  CLB      Game:              0    11/14/2009  at  CHI        2-­Tms:          0    11/14/2009  at  CHI          Half:          0    10  times    

FOULS COMMITTED  Season:          25    in  2010      Game:              4    11/15/2008  vs.  NY        2-­Tms:        13    11/15/2008  vs.  NY          Half:          1    11/15/2008  vs.  NY  (2d)     FOULS SUFFERED  Season:          26    in  2010      Game:              8    11/14/2009  at  CHI        2-­Tms:        13    11/15/2008  vs.  NY          Half:          2    11/14/2009  at  CHI  (2d)     OFFSIDES  Season:            4    in  2008      Game:              0    11/01/2008  vs.  CHV        2-­Tms:          1    11/01/2008  vs.  CHV          Half:          0    5  times      

 

SHUTOUTS  Season:            0    in  2010    

SAVES  Season:            4    in  2010      Game:              1    11/01/2008  vs.  CHV        2-­Tms:          3    10/31/2009  vs.  CLB          Half:          0    11/01/2008  vs.  CHV  (1st)          Half:          0    10/31/2009  vs.  CLB  (2d)          Half:          0    11/06/2010  vs.  DAL  (1st)  

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

 

ALL-­TIME REAL SALT LAKE INDIVIDUAL PLAYOFF HIGHS (2005-­10) ==================================================================     GAMES PLAYED Career:              9    8  players  have  appeared  in  all  9  RSL   postseason  games    Season:            4    13  times     MINUTES Career:          870    Kyle  Beckerman   Career:          870    Nat  Borchers   Career:          870    Nick  Rimando    Season:        420    6  times     GOALS Career:              4    Robbie  Findley    Season:            3    Robbie  Findley  (2009)      Game:              1    10  times          Half:          1    10  times     ASSISTS Career:              3    Javier  Morales    Season:            2    Javier  Morales  (2008)    Season:            2    Robbie  Russell  (2008)    Season:            2    Andy  Williams  (2010)      Game:              1    12  times          Half:          1    12  times     SHOTS Career:            21    Robbie  Findley    Season:          12    Yura  Movsisyan  (2008)    Season:          12    Robbie  Findley  (2009)      Game:              5    Yura  Movsisyan  (11/08/2008  at  CHV)      Game:              5    Clint  Mathis  (11/15/2008  vs.  NY)      Game:              5    Robbie  Findley  (11/22/2009  at  LA)          Half:          3    7  times     SHOTS ON GOAL Career:            10    Robbie  Findley    Season:            6    Yura  Movsisyan  (2008)    Season:            6    Robbie  Findley  (2009)      Game:              2    10  times          Half:          2    4  times     FOULS COMMITTED Career:            20    Javier  Morales    Season:          10    Yura  Movsisyan  (2008)    Season:          10    Chris  Wingert  (2009)      Game:              6    Yura  Movsisyan  (11/01/2008  vs.  CHV)      Game:              6    Javier  Morales  (11/08/2008  at  CHV)      Game:              6    Chris  Wingert  (11/14/2009  at  CHI)          Half:          5    Yura  Movsisyan  (11/01/2008  vs.  CHV,  2d)     FOULS SUFFERED Career:            14    Javier  Morales    Season:            8    Javier  Morales  (2008)      Game:              4    Jamison  Olave  (11/08/2008  at  CHV)      Game:              4    Javier  Morales  (11/15/2008  vs.  NY)          Half:          3    4  times     OFFSIDES Career:            11    Robbie  Findley    Season:          10    Robbie  Findley  (2009)      Game:              6    Robbie  Findley  (11/22/2009  at  LA)          Half:          3    Robbie  Findley  (11/22/2009  at  LA,  1st)  

 

CORNER KICKS Career:            15    Javier  Morales    Season:          10    Javier  Morales  (2008)      Game:              6    Javier  Morales  (11/01/2008  vs.  CHV)      Game:              6    Andy  Williams  (11/06/2010  vs.  DAL)          Half:          4    Javier  Morales  (11/01/2008  vs.  CHV,  1st)     CAUTIONS Career:              3    Kyle  Beckerman    Season:            2    Kyle  Beckerman  (2009)    Season:            2    Will  Johnson  (2009)      Game:              1    17  times          Half:          1    15  times     EJECTIONS Career:              1    Javier  Morales    Season:            1    Javier  Morales  (2010)      Game:              1    Javier  Morales  (10/30/2010  at  DAL)          Half:          1    Javier  Morales  (10/30/2010  at  DAL,  2d)     GAMES PLAYED IN GOAL Career:              9    Nick  Rimando    Season:            4    Nick  Rimando  (2009)     MINUTES IN GOAL Career:          870    Nick  Rimando    Season:        420    Nick  Rimando  (2009)     WINS Career:              3    Nick  Rimando    Season:            2    Nick  Rimando  (2009)     LOSSES Career:              2    Nick  Rimando    Season:            1    Nick  Rimando  (2008)    Season:            1    Nick  Rimando  (2010)     TIES / SHOOTOUT WINS Career:              4    Nick  Rimando    Season:            2    Nick  Rimando  (2009)     SHUTOUTS Career:              3    Nick  Rimando    Season:            2    Nick  Rimando  (2009)     GOALS ALLOWED Career:              9    Nick  Rimando    Season:            3    Nick  Rimando  (2008)    Season:            3    Nick  Rimando  (2009)    Season:            3    Nick  Rimando  (2010)      Game:              2    Nick  Rimando  (11/08/2008  at  CHV)      Game:              2    Nick  Rimando  (11/05/2009  at  CLB)      Game:              2    Nick  Rimando  (10/30/2010  at  DAL)          Half:          2    Nick  Rimando  (11/05/2009  at  CLB,  1st)     SAVES Career:            31    Nick  Rimando    Season:          18    Nick  Rimando  (2009)      Game:              8    Nick  Rimando  (11/05/2009  at  CLB)          Half:          6    Nick  Rimando  (11/05/2009  at  CLB,  2d)  

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2    

REAL SALT LAKE POSTSEASON AGE-­RELATED MILESTONES (2005-­10) =================================================================     Youngest  player  to  ...        play  in  a  game                      Yura  Movsisyan                              21  yrs.,  91  days            8/02/1987      11/01/2008  RSL  vs  CHV        start  a  game                          Yura  Movsisyan                              21  yrs.,  91  days            8/02/1987      11/01/2008  RSL  vs  CHV        play  a  complete  game          Yura  Movsisyan                              21  yrs.,  91  days            8/02/1987      11/01/2008  RSL  vs  CHV        score  a  goal                          Yura  Movsisyan                              21  yrs.,  91  days            8/02/1987      11/01/2008  RSL  vs  CHV        record  an  assist                  Yura  Movsisyan                              22  yrs.,  90  days            8/02/1987      10/31/2009  RSL  vs  CLB          play  a  game  as  GK                Nick  Rimando                                  29  yrs.,  137  days          6/17/1979      11/01/2008  RSL  vs  CHV        start  a  game  as  GK              Nick  Rimando                                  29  yrs.,  137  days          6/17/1979      11/01/2008  RSL  vs  CHV        play  a  CG  as  GK                    Nick  Rimando                                  29  yrs.,  137  days          6/17/1979      11/01/2008  RSL  vs  CHV        record  a  shutout                  Nick  Rimando                                  29  yrs.,  137  days          6/17/1979      11/01/2008  RSL  vs  CHV        record  a  win                          Nick  Rimando                                  29  yrs.,  137  days          6/17/1979      11/01/2008  RSL  vs  CHV       Oldest  player  to  ...        play  in  a  game                      Andy  Williams                                33  yrs.,  44  days            9/23/1977      11/06/2010  RSL  vs  DAL        start  a  game                          Andy  Williams                                33  yrs.,  44  days            9/23/1977      11/06/2010  RSL  vs  DAL        play  a  complete  game          Andy  Williams                                33  yrs.,  44  days            9/23/1977      11/06/2010  RSL  vs  DAL        score  a  goal                          Andy  Williams                                32  yrs.,  43  days            9/23/1977      11/05/2009  RSL  at  CLB        record  an  assist                  Andy  Williams                                33  yrs.,  44  days            9/23/1977      11/06/2010  RSL  vs  DAL          play  a  game  as  GK                Nick  Rimando                                  31  yrs.,  142  days          6/17/1979      11/06/2010  RSL  vs  DAL        start  a  game  as  GK              Nick  Rimando                                  31  yrs.,  142  days          6/17/1979      11/06/2010  RSL  vs  DAL        play  a  CG  as  GK                    Nick  Rimando                                  31  yrs.,  142  days          6/17/1979      11/06/2010  RSL  vs  DAL        record  a  shutout                  Nick  Rimando                                  30  yrs.,  150  days          6/17/1979      11/14/2009  RSL  at  CHI        record  a  win                          Nick  Rimando                                  30  yrs.,  141  days          6/17/1979      11/05/2009  RSL  at  CLB      

 

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

ALL-­TIME REAL SALT LAKE INDIVIDUAL PLAYOFF HIGH GAMES (2005-­10) =======================================================================     Goals                                  1    Yura  Movsisyan                              11/01/2008    vs.  CHV    W  1-­0                                              1    Dema  Kovalenko                              11/08/2008    at    CHV    T  2-­2                                              1    Javier  Morales                              11/08/2008    at    CHV    T  2-­2                                              1    Robbie  Findley                              10/31/2009    vs.  CLB    W  1-­0                                              1    Robbie  Findley                              11/05/2009    at    CLB    W  3-­2                                              1    Javier  Morales                              11/05/2009    at    CLB    W  3-­2                                              1    Andy  Williams                                11/05/2009    at    CLB    W  3-­2                                              1    Robbie  Findley                              11/22/2009    at    LA      T  1-­1                                              1    Fabian  Espindola                          10/30/2010    at    DAL    L  1-­2                                              1    Robbie  Findley                              11/06/2010    vs.  DAL    T  1-­1     Assists                              1    Javier  Morales                              11/01/2008    vs.  CHV    W  1-­0                                              1    Robbie  Russell                              11/01/2008    vs.  CHV    W  1-­0                                              1    Robbie  Findley                              11/08/2008    at    CHV    T  2-­2                                              1    Javier  Morales                              11/08/2008    at    CHV    T  2-­2                                              1    Robbie  Russell                              11/08/2008    at    CHV    T  2-­2                                              1    Yura  Movsisyan                              10/31/2009    vs.  CLB    W  1-­0                                              1    Kyle  Beckerman                              11/05/2009    at    CLB    W  3-­2                                              1    Robbie  Findley                              11/05/2009    at    CLB    W  3-­2                                              1    Javier  Morales                              11/05/2009    at    CLB    W  3-­2                                              1    Andy  Williams                                10/30/2010    at    DAL    L  1-­2                                              1    Nat  Borchers                                  11/06/2010    vs.  DAL    T  1-­1                                              1    Andy  Williams                                11/06/2010    vs.  DAL    T  1-­1     Shots                                  5    Yura  Movsisyan                              11/08/2008    at    CHV    T  2-­2                                              5    Clint  Mathis                                  11/15/2008    vs.  NY      L  0-­1                                              5    Robbie  Findley                              11/22/2009    at    LA      T  1-­1                                              4    Yura  Movsisyan                              11/01/2008    vs.  CHV    W  1-­0                                              4    Will  Johnson                                  11/15/2008    vs.  NY      L  0-­1                                              4    Yura  Movsisyan                              11/14/2009    at    CHI    T  0-­0                                              4    Clint  Mathis                                  11/22/2009    at    LA      T  1-­1     Shots  on  Goal                  2    Clint  Mathis                                  11/01/2008    vs.  CHV    W  1-­0                                              2    Yura  Movsisyan                              11/01/2008    vs.  CHV    W  1-­0                                              2    Robbie  Findley                              11/08/2008    at    CHV    T  2-­2                                              2    Yura  Movsisyan                              11/08/2008    at    CHV    T  2-­2                                              2    Clint  Mathis                                  11/15/2008    vs.  NY      L  0-­1                                              2    Yura  Movsisyan                              11/15/2008    vs.  NY      L  0-­1                                              2    Andy  Williams                                11/05/2009    at    CLB    W  3-­2                                              2    Kyle  Beckerman                              11/14/2009    at    CHI    T  0-­0                                              2    Robbie  Findley                              11/14/2009    at    CHI    T  0-­0                                              2    Robbie  Findley                              11/22/2009    at    LA      T  1-­1     Fouls  Committed              6    Yura  Movsisyan                              11/01/2008    vs.  CHV    W  1-­0                                              6    Javier  Morales                              11/08/2008    at    CHV    T  2-­2                                              6    Chris  Wingert                                11/14/2009    at    CHI    T  0-­0                                              5    Javier  Morales                              10/30/2010    at    DAL    L  1-­2                                              4    Dema  Kovalenko                              11/08/2008    at    CHV    T  2-­2                                              4    Robbie  Russell                              11/08/2008    at    CHV    T  2-­2                                              4    Javier  Morales                              11/05/2009    at    CLB    W  3-­2                                              4    Jamison  Olave                                11/05/2009    at    CLB    W  3-­2                                              4    Fabian  Espindola                          11/22/2009    at    LA      T  1-­1                                              4    Jamison  Olave                                11/06/2010    vs.  DAL    T  1-­1     Fouls  Suffered                4    Jamison  Olave                                11/08/2008    at    CHV    T  2-­2                                              4    Javier  Morales                              11/15/2008    vs.  NY      L  0-­1                                              3    Javier  Morales                              11/08/2008    at    CHV    T  2-­2                                              3    Robbie  Russell                              11/08/2008    at    CHV    T  2-­2                                              3    Andy  Williams                                10/31/2009    vs.  CLB    W  1-­0                                              3    Jamison  Olave                                11/05/2009    at    CLB    W  3-­2                                              3    Kyle  Beckerman                              11/22/2009    at    LA      T  1-­1                                              3    Ned  Grabavoy                                  11/22/2009    at    LA      T  1-­1                                              3    Clint  Mathis                                  11/22/2009    at    LA      T  1-­1                                              3    Javier  Morales                              10/30/2010    at    DAL    L  1-­2                                              3    Nick  Rimando                                  10/30/2010    at    DAL    L  1-­2                                              3    Andy  Williams                                10/30/2010    at    DAL    L  1-­2                                              3    Tony  Beltran                                  11/06/2010    vs.  DAL    T  1-­1                                              3    Will  Johnson                                  11/06/2010    vs.  DAL    T  1-­1     Corner  Kicks                    6    Javier  Morales                              11/01/2008    vs.  CHV    W  1-­0                                              6    Andy  Williams                                11/06/2010    vs.  DAL    T  1-­1                                              4    Javier  Morales                              11/15/2008    vs.  NY      L  0-­1                                              3    Javier  Morales                              11/05/2009    at    CLB    W  3-­2                                              3    Will  Johnson                                  11/06/2010    vs.  DAL    T  1-­1  

 

 

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2        

ALL-­TIME REAL SALT LAKE INDIVIDUAL PLAYOFF HIGH GAMES (2005-­10) FRQW·G

============================================================================     Offside                              6    Robbie  Findley                              11/22/2009    at    LA      T  1-­1                                              3    Robbie  Findley                              10/31/2009    vs.  CLB    W  1-­0                                              2    Yura  Movsisyan                              11/08/2008    at    CHV    T  2-­2                                              2    Jamison  Olave                                11/15/2008    vs.  NY      L  0-­1                                              2    Fabian  Espindola                          11/05/2009    at    CLB    W  3-­2                                              2    Fabian  Espindola                          10/30/2010    at    DAL    L  1-­2                                              2    Fabian  Espindola                          11/06/2010    vs.  DAL    T  1-­1     Saves                                  8    Nick  Rimando                                  11/05/2009    at    CLB    W  3-­2                                              6    Nick  Rimando                                  11/14/2009    at    CHI    T  0-­0                                              5    Nick  Rimando                                  11/15/2008    vs.  NY      L  0-­1                                              3    Nick  Rimando                                  11/08/2008    at    CHV    T  2-­2                                              2    Nick  Rimando                                  10/31/2009    vs.  CLB    W  1-­0                                              2    Nick  Rimando                                  11/22/2009    at    LA      T  1-­1                                              2    Nick  Rimando                                  10/30/2010    at    DAL    L  1-­2                                              2    Nick  Rimando                                  11/06/2010    vs.  DAL    T  1-­1     Shots  Faced                    10    Nick  Rimando                                  11/05/2009    at    CLB    W  3-­2                                              6    Nick  Rimando                                  11/15/2008    vs.  NY      L  0-­1                                              6    Nick  Rimando                                  11/14/2009    at    CHI    T  0-­0                                              5    Nick  Rimando                                  11/08/2008    at    CHV    T  2-­2                                              4    Nick  Rimando                                  10/30/2010    at    DAL    L  1-­2     Goals  Allowed                  2    Nick  Rimando                                  11/08/2008    at    CHV    T  2-­2                                              2    Nick  Rimando                                  11/05/2009    at    CLB    W  3-­2                                              2    Nick  Rimando                                  10/30/2010    at    DAL    L  1-­2                                              1    Nick  Rimando                                  11/15/2008    vs.  NY      L  0-­1                                              1    Nick  Rimando                                  11/22/2009    at    LA      T  1-­1                                              1    Nick  Rimando                                  11/06/2010    vs.  DAL    T  1-­1                

 

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

REAL SALT LAKE TEAM POSTSEASON HIGHS (2005-­10)

GOALS                                  3    11/05/2009    at    CLB    W  3-­2                                              2    11/08/2008    at    CHV    T  2-­2                                              1    11/01/2008    vs.  CHV    W  1-­0                                              1    10/31/2009    vs.  CLB    W  1-­0                                              1    11/22/2009    at    LA      T  1-­1                                              1    10/30/2010    at    DAL    L  1-­2                                              1    11/06/2010    vs.  DAL    T  1-­1     Assists                              3    11/08/2008    at    CHV    T  2-­2                                              3    11/05/2009    at    CLB    W  3-­2                                              2    11/01/2008    vs.  CHV    W  1-­0                                              2    11/06/2010    vs.  DAL    T  1-­1                                              1    10/31/2009    vs.  CLB    W  1-­0                                              1    10/30/2010    at    DAL    L  1-­2     Shots                                24    11/15/2008    vs.  NY      L  0-­1                                            21    11/01/2008    vs.  CHV    W  1-­0                                            19    11/22/2009    at    LA      T  1-­1                                            17    11/14/2009    at    CHI    T  0-­0                                            16    11/08/2008    at    CHV    T  2-­2     Shots  on  Goal                  9    11/01/2008    vs.  CHV    W  1-­0                                              8    11/15/2008    vs.  NY      L  0-­1                                              8    11/14/2009    at    CHI    T  0-­0                                              6    11/08/2008    at    CHV    T  2-­2                                              6    11/06/2010    vs.  DAL    T  1-­1     Fouls  Committed            24    11/08/2008    at    CHV    T  2-­2                                            23    11/14/2009    at    CHI    T  0-­0                                            19    11/05/2009    at    CLB    W  3-­2                                            19    11/22/2009    at    LA      T  1-­1                                            17    11/01/2008    vs.  CHV    W  1-­0     Fouls  Suffered              22    11/22/2009    at    LA      T  1-­1                                            20    11/08/2008    at    CHV    T  2-­2                                            16    10/30/2010    at    DAL    L  1-­2                                            11    10/31/2009    vs.  CLB    W  1-­0                                            10    11/05/2009    at    CLB    W  3-­2                                            10    11/06/2010    vs.  DAL    T  1-­1     Corner  Kicks                  11    11/06/2010    vs.  DAL    T  1-­1                                              6    11/01/2008    vs.  CHV    W  1-­0                                              6    11/15/2008    vs.  NY      L  0-­1                                              4    11/22/2009    at    LA      T  1-­1                                              3    11/05/2009    at    CLB    W  3-­2                                              3    11/14/2009    at    CHI    T  0-­0     Offside                              8    11/22/2009    at    LA      T  1-­1                                              6    10/31/2009    vs.  CLB    W  1-­0                                              3    10/30/2010    at    DAL    L  1-­2         ��                                    3    11/06/2010    vs.  DAL    T  1-­1     Saves                                  8    11/05/2009    at    CLB    W  3-­2                                              6    11/14/2009    at    CHI    T  0-­0                                              5    11/15/2008    vs.  NY      L  0-­1                                              3    11/08/2008    at    CHV    T  2-­2           Shots  Faced                    10    11/05/2009    at    CLB    W  3-­2                                              6    11/08/2008    at    CHV    T  2-­2                                              6    11/15/2008    vs.  NY      L  0-­1                                              6    11/14/2009    at    CHI    T  0-­0                                              4    10/30/2010    at    DAL    L  1-­2     Goals  Allowed                  2    11/08/2008    at    CHV    T  2-­2                                              2    11/05/2009    at    CLB    W  3-­2                                              2    10/30/2010    at    DAL    L  1-­2                                              1    11/15/2008    vs.  NY      L  0-­1                                              1    11/22/2009    at    LA      T  1-­1                                              1    11/06/2010    vs.  DAL    T  1-­1    

 

REAL SALT LAKE TEAM POSTSEASON LOWS (2005-­10)

 

Goals                                  0    11/15/2008    vs.  NY      L  0-­1                                              0    11/14/2009    at    CHI    T  0-­0                                              1    11/01/2008    vs.  CHV    W  1-­0                                              1    10/31/2009    vs.  CLB    W  1-­0                                              1    11/22/2009    at    LA      T  1-­1                                              1    10/30/2010    at    DAL    L  1-­2                                              1    11/06/2010    vs.  DAL    T  1-­1     Assists                              0    11/15/2008    vs.  NY      L  0-­1                                              0    11/14/2009    at    CHI    T  0-­0                                              0    11/22/2009    at    LA      T  1-­1                                              1    10/31/2009    vs.  CLB    W  1-­0                                              1    10/30/2010    at    DAL    L  1-­2       Shots                                  7    10/30/2010    at    DAL    L  1-­2                                              8    10/31/2009    vs.  CLB    W  1-­0                                            11    11/05/2009    at    CLB    W  3-­2                                            15    11/06/2010    vs.  DAL    T  1-­1                                            16    11/08/2008    at    CHV    T  2-­2     Shots  on  Goal                  2    10/31/2009    vs.  CLB    W  1-­0                                              4    11/22/2009    at    LA      T  1-­1                                              4    10/30/2010    at    DAL    L  1-­2                                              5    11/05/2009    at    CLB    W  3-­2                                              6    11/08/2008    at    CHV    T  2-­2                                              6    11/06/2010    vs.  DAL    T  1-­1   Fouls  Committed              4    11/15/2008    vs.  NY      L  0-­1                                              9    11/06/2010    vs.  DAL    T  1-­1                                            15    10/31/2009    vs.  CLB    W  1-­0                                            16    10/30/2010    at    DAL    L  1-­2                                            17    11/01/2008    vs.  CHV    W  1-­0     Fouls  Suffered                8    11/14/2009    at    CHI    T  0-­0                                              9    11/01/2008    vs.  CHV    W  1-­0                                              9    11/15/2008    vs.  NY      L  0-­1                                            10    11/05/2009    at    CLB    W  3-­2                                            10    11/06/2010    vs.  DAL    T  1-­1       Corner  Kicks                    0    11/08/2008    at    CHV    T  2-­2                                              1    10/30/2010    at    DAL    L  1-­2                                              2    10/31/2009    vs.  CLB    W  1-­0                                              3    11/05/2009    at    CLB    W  3-­2                                              3    11/14/2009    at    CHI    T  0-­0       Offside                              0    11/01/2008    vs.  CHV    W  1-­0                                              2    11/08/2008    at    CHV    T  2-­2                                              2    11/15/2008    vs.  NY      L  0-­1                                              2    11/05/2009    at    CLB    W  3-­2                                              2    11/14/2009    at    CHI    T  0-­0     Saves                                  1    11/01/2008    vs.  CHV    W  1-­0                                              2    10/31/2009    vs.  CLB    W  1-­0                                              2    11/22/2009    at    LA      T  1-­1                                              2    10/30/2010    at    DAL    L  1-­2                                              2    11/06/2010    vs.  DAL    T  1-­1     Shots  Faced                      1    11/01/2008    vs.  CHV    W  1-­0                                              2    10/31/2009    vs.  CLB    W  1-­0                                              3    11/22/2009    at    LA      T  1-­1                                              3    11/06/2010    vs.  DAL    T  1-­1                                              4    10/30/2010    at    DAL    L  1-­2     Goals  Allowed                  0    11/01/2008    vs.  CHV    W  1-­0                                              0    10/31/2009    vs.  CLB    W  1-­0                                              0    11/14/2009    at    CHI    T  0-­0                                              1    11/15/2008    vs.  NY      L  0-­1                                              1    11/22/2009    at    LA      T  1-­1   1 11/06/2010    vs.  DAL    T  1-­1      

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2  

ALL-­TIME REAL SALT LAKE INDIVIDUAL STATISTICS (72-­87-­59, 275 pts.)

(active  RSL  players  in  BOLD)     UNF  POS  PLAYER                                          GP      GS      MIN        G        A    SHT    SOG      FC      FS    OFF      CK      C      E    10    F    Robbie  Findley                          96      59    5573      29      13    157      69      37      85      60        0      4      0      7    F    Fabian  Espindola                      95      77    6365      26      10    184      92    120      99      96        5    18      2    15    F    Alvaro  Saborio                          50      45    3916      23        6    117      46      73      68      59        0      6      0    90    F    Jeff  Cunningham                        38      33    3006      19      11      94      52      28      56      45        0      7      0    11    M    Javier  Morales                          98      92    7904      17      34    144      68    132    221      15    355    16      0      9    F    Jason  Kreis                                58      55    4952      17        9    132      57      68      72      44        3    10      1    14    F    Yura  Movsisyan                          53      36    3287      15        3    143      65      47      54      27        2      4      1    77    M    Andy  Williams                          189    122  11536      14      29    232      83    198    269      26    225    21      3      5    M    Kyle  Beckerman                        121    117  10459      13      17    167      67    161    127      10      57    29      1      4    D    Jamison  Olave                            99      98    8586      10        1      57      24    127      65        6        0    26      4    17    M    Chris  Klein                                43      43    3832        8        9      92      37      26      31      21      76      1      0      8    M    Chris  Brown                                60      40    3506        7        1      54      24      26      29        8        2      0      0      3    D    Carey  Talley                              60      58    5120        6        9      48      16      95      91        5        0    14      1      8    M    Will  Johnson                              88      81    7358        6        5    144      59      79      95      10      39    19      1      6    D    Nat  Borchers                            119    119  10509        6        2      54      17      86      48        7        0    14      2    84    M    Clint  Mathis                              66      57    4639        5      11      88      31      56      39        9      52    14      2      7    F    Atiba  Harris                              43      25    2405        4        2      32      19      92      58      32        0    13      1    20    M    Ned  Grabavoy                              68      47    4226        3        3      34      11      52      77        4        2      8      1    16    F    Kenny  Deuchar                            29      18    1557        3        2      41      18      29      30      18        0      4      0      6    F    Jordan  Cila                                12        8      646        3        1        6        4      10        9        4        1      1      0    23    F    Paulo  Araujo  Jr.                      14        5      533        2        4      14        7        6        6        5        0      0      0    19    F    Pablo  Campos                              27        8      834        2        4      22      12      26      10        6        0      3      0    10    M    Mehdi  Ballouchy                        46      40    3401        2        2      42      11      82      75        7      49      9      0    22    M    Nelson  Gonzalez                        18        5      504        2        2      10        5      16        5        0      22      1      0    22    F    Jamie  Watson                              38        6    1112        2        1      26      13      24      46      14        4      2      1      4    F    Kyle  Brown                                    8        3      286        2        0        7        4        6        1        3        0      0      0    13    D    Brian  Dunseth                            24      24    2011        2        0        8        5      34      22        3        0      3      1    21    M    Luis  Gil                                      25      14    1288        2        0      21        7      16      11        4        2      0      0    23    D    Eddie  Pope                                  69      69    5930        2        0      18        6      64      57        1        0      6      1    28    D    Chris  Schuler                            21      17    1728        2        0      13        2      17      14        0        0      2      0    24    M    Seth  Trembly                              22      11    1176        2        0      25      13      38      31        0        0      8      0      3    D    Robbie  Russell                          78      68    5959        1        9      38      12      52      28        1        0    10      1    17    D    Chris  Wingert                          122    112  10065        1        9      40      13    130      76        1      24    19      1    11    F    Alecko  Eskandarian                  17      17    1428        1        3      47      21      32      39      16      24      6      1    11    F    Freddy  Adu                                  11      10      899        1        2      24      12      11      25        6      22      1      0    12    M    Jean  Alexandre                          38      14    1296        1        2      18        7      35      11        8        0      5      0    21    F    Dema  Kovalenko                          22      19    1668        1        2      25        5      30      23        1        2      7      0    14    F    Melvin  Tarley                              9        9      729        1        1      22      12        9        6      18        0      0      0    23    M    Raphael  Cox                                  6        2      208        1        0        1        1        1        2        0        0      0      0    22    F    Luis  Miguel  Escalada                5        1      126        1        0        4        2        2        0        5        0      0      0    27    D    Matias  Mantilla                        17      15    1382        1        0        5        3      21        6        0        0      6      0    27    M    Kevin  Novak                                29      27    2250        1        0        7        3      29      20        2        0      3      0    25    F    Tino  Nunez                                  12        2      281        1        0        6        3      10        3        2        0      0      0    27    D    Douglas  Sequeira                      18      13    1246        1        0      16        4      29      14        3        0      3      1    25    M    Jafet  Soto                                    8        1      192        1        0        2        2        1        3        2        1      0      0    26    M    Collen  Warner                            37      19    1532        0        5      22      10      32      25        5      12      5      1      2    D    Tony  Beltran                              78      67    6020        0        3      19        6      65      56        2        0    10      1    12    M    Leslie  Fitzpatrick                  18        6      716        0        2        8        6      11      13        0        6      0      0    15    D    Robert  Scarlett                          9        8      720        0        2        8        3        7        5        3        5      0      0    10    M    Arturo  Alvarez                          16        8      724        0        1      18        1      12        9        3        3      0      0    25    D    Gustavo  Cabrera                          4        4      360        0        1        0        0        6        4        0        0      2      0    16    D    Willis  Forko                              38      38    3244        0        1        0        0      26      34        3        0      4      0    19    M    Luke  Kreamalmeyer                      6        2      249        0        1        6        2        0        7        0        3      0      0    16    D    Chris  Lancos                              14        8      811        0        1        3        1      11        5        0        5      3      0      3    D    Rusty  Pierce                              15      15    1200        0        1        3        1      20      24        0        1      3      0    18    G    Nick  Rimando                            143    143  12815        0        1        0        0        2      15        0        0      3      0    31    D    Jack  Stewart                              25      24    1993        0        1        6        0      20      11        1        0      2      1    99    F    Dante  Washington                        9        2      282        0        1        7        3        3        7        2        0      0      0    14    F    Artur  Aghasyan                            4        1        98        0        0        3        0        5        2        1        0      0      0    13    F    Chris  Agorsor                              1        0        10        0        0        0        0        0        0        0        0      0      0      2    D    Nelson  Akwari                            41      35    3195        0        0        7        2      39      21        1        0      7      0    14    M    Yordany  Alvarez                          5        4      419        0        0        0        0      21        4        0        0      4      0    27    F    Cody  Arnoux                                  2        0        69        0        0        1        0        1        1        0        0      0      0    16    M    Matt  Behncke                                8        7      587        0        0        6        2      12        5        0        0      0      0    20    M    Nikolas  Besagno                          8        4      440        0        0        1        0        9        8        0        0      2      0      4    M    Paul  Broome                                11      10      917        0        0        1        0      13      15        1        0      4      0      8    M    Matias  Cordoba                            7        2      173        0        0        3        0        4        0        0        1      0      0      1    G    D.J.  Countess                            27      27    2422        0        0        0        0        0        4        0        0      1      0    15    M    Kenny  Cutler                              47      35    3103        0        0      13        4      36        8        0        0      8      1    21    M    Rachid  El  Khalifi                      4        3      178        0        0        2        0        3        4        0        2      0      0      

 

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

ALL-­TIME REAL SALT LAKE INDIVIDUAL STATISTICS (72-­87-­SWV  FRQW·G

(active  RSL  players  in  BOLD)     UNF  POS  PLAYER                                          GP      GS      MIN        G        A    SHT    SOG      FC      FS    OFF      CK      C      E      1    G    Scott  Garlick                            31      31    2745        0        0        0        0        0        2        0        0      6      0      8    M    Adolfo  Gregorio                          6        4      359        0        0        4        2        5        7        1        4      0      0    33    D    David  Horst                                  3        2      176        0        0        0        0        1        6        0        0      0      0    21    M    Christian  Jimenez                      1        0          6        0        0        0        0        0        0        0        0      0      0    14    F    Ryan  Johnson                                7        1      154        0        0        1        1        3        5        0        0      0      0    13    D    Ian  Joy                                        20      18    1384        0        0        3        1      27        8        1        0      4      1      5    M    Brian  Kamler                              28      24    2028        0        0      11        3      22      38        0        0      3      0    25    D    Jean-­Martial  Kipre                  18      16    1427        0        0        7        2      24      14        2        0      4      0    28    D    Dustin  Kirby                                2        1        82        0        0        0        0        1        0        0        0      0      0      6    D    Cameron  Knowles                          4        3      346        0        0        0        0        6        2        0        0      1      0      6    M    Ritchie  Kotschau                      20      18    1664        0        0        3        0      19      10        1        0      3      1    31    D    Michael  Lookingland                  1        1        90        0        0        0        0        2        0        0        0      0      0    30    D    Rauwshan  McKenzie                      6        4      404        0        0        0        0        5        5        0        0      1      0    18    G    Jay  Nolly                                      7        6      585        0        0        0        0        1        1        0        0      1      0    15    M    Leighton  O'Brien                        6        1      236        0        0        2        1        2        3        0        4      1      0    24    G    Kyle  Reynish                                5        4      415        0        0        0        0        0        0        0        0      0      0      4    D    Marlon  Rojas                                7        6      507        0        0        0        0        8        5        1        0      1      0      1    G    Chris  Seitz                                  7        7      630        0        0        0        0        0        1        0        0      0      0    14    F    Dipsy  Selolwane                          8        4      401        0        0      10        4      10        9        0        0      0      0    12    D    Nathan  Sturgis                            8        7      491        0        0        5        0      12      10        0        0      1      0    18    F    Luis  Tejada                                  1        0          2        0        0        0        0        0        0        1        0      0      0      2    D    Daniel  Torres                            26      25    2188        0        0        5        2      21      18        0        0      2      0    19    D    Blake  Wagner                                2        1        63        0        0        1        0        0        2        0        0      0      0      8    D    Evan  Whitfield                            5        0      135        0        0        2        1        3        5        1        0      1      0            F    Joey  Worthen                                3        0        29        0        0        1        0        0        3        0        0      0      0                  Own-­goals  received                                                    8                              Team  totals                              218    218  19620    278    240  2673  1102  2793  2724    644  1015  410    34                  Opponent  totals                      218    218  19620    289    270  2583  1111  2740  2775    586  1050  373    29     ALL-­TIME REAL SALT LAKE INDIVIDUAL GOALKEEPING UNF  POS  GOALKEEPER                                  GP      GS      MIN    SHTS    SV      GA      GAA    PG    PA      W      L      T    SO    18    G    Nick  Rimando                            143    143  12815    673    488    159    1.12    17    23    55    48    40    51      1    G    Scott  Garlick                            31      31    2745    158    108      43    1.41      1      2    10    12      9      4      1    G    D.J.  Countess                            27      27    2422    170    112      54    2.01      3      3      4    19      4      4      1    G    Chris  Seitz                                  7        7      630      34      19      13    1.86      1      1      1      4      2      1    18    G    Jay  Nolly                                      7        6      585      59      41      17    2.62      1      1      1      4      1      0    24    G    Kyle  Reynish                                5        4      415      17      14        3    0.65      0      0      1      0      3      2      5    M    Brian  Kamler                                1        0          8        0        0        0    0.00      0      0      0      0      0      0                  Team  totals                              218    218  19620  1111    782    289    1.33    23    30    72    87    59    62                  Opponent  totals                      218    218  19620  1102    788    278    1.28    25    29    87    72    59    69      

 

 

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2  

REAL SALT LAKE INDIVIDUAL LEADERS (ALL-­TIME)   GAMES PLAYED GP Andy  Williams                                            189   Nick  Rimando                                              143   Chris  Wingert                                            122   Kyle  Beckerman                                          121   Nat  Borchers                                              119   Jamison  Olave                                              99   Javier  Morales                                            98   Robbie  Findley                                            96   Fabian  Espindola                                        95   Will  Johnson                                                88     GAMES STARTED GS Nick  Rimando                                              143   Andy  Williams                                            122   Nat  Borchers                                              119   Kyle  Beckerman                                          117   Chris  Wingert                                            112   Jamison  Olave                                              98   Javier  Morales                                            92   Will  Johnson                                                81   Fabian  Espindola                                        77   Eddie  Pope                                                    69     MINUTES PLAYED MIN Nick  Rimando                                          12815   Andy  Williams                                        11536   Nat  Borchers                                          10509   Kyle  Beckerman                                      10459   Chris  Wingert                                        10065   Jamison  Olave                                          8586   Javier  Morales                                        7904   Will  Johnson                                            7358   Fabian  Espindola                                    6365   Tony  Beltran                                            6020     GOALS GP GOALS Robbie  Findley                                            96        29   Fabian  Espindola                                        95        26   Alvaro  Saborio                                            50        23   Jeff  Cunningham                                          38        19   Jason  Kreis                                                  58        17   Javier  Morales                                            98        17   Yura  Movsisyan                                            53        15   Andy  Williams                                            189        14   Kyle  Beckerman                                          121        13   Jamison  Olave                                              99        10     ASSISTS GP ASTS Javier  Morales                                            98        34   Andy  Williams                                            189        29   Kyle  Beckerman                                          121        17   Robbie  Findley                                            96        13   Jeff  Cunningham                                          38        11   Clint  Mathis                                                66        11   Fabian  Espindola                                        95        10   Chris  Klein                                                  43          9   Jason  Kreis                                                  58          9   Robbie  Russell                                            78          9   Carey  Talley                                                60          9   Chris  Wingert                                            122          9     SHOTS GP SHOTS Andy  Williams                                            189      232   Fabian  Espindola                                        95      184   Kyle  Beckerman                                          121      167   Robbie  Findley                                            96      157   Will  Johnson                                                88      144   Javier  Morales                                            98      144   Yura  Movsisyan                                            53      143   Jason  Kreis                                                  58      132   Alvaro  Saborio                                            50      117   Jeff  Cunningham                                          38        94  

 

SHOTS ON GOAL GP SOG Fabian  Espindola                                        95        92   Andy  Williams                                            189        83   Robbie  Findley                                            96        69   Javier  Morales                                            98        68   Kyle  Beckerman                                          121        67   Yura  Movsisyan                                            53        65   Will  Johnson                                                88        59   Jason  Kreis                                                  58        57   Jeff  Cunningham                                          38        52   Alvaro  Saborio                                            50        46     FOULS COMMITTED GP FC Andy  Williams                                            189      198   Kyle  Beckerman                                          121      161   Javier  Morales                                            98      132   Chris  Wingert                                            122      130   Jamison  Olave                                              99      127   Fabian  Espindola                                        95      120   Carey  Talley                                                60        95   Atiba  Harris                                                43        92   Nat  Borchers                                              119        86   Mehdi  Ballouchy                                          46        82     FOULS SUFFERED GP FS Andy  Williams                                            189      269   Javier  Morales                                            98      221   Kyle  Beckerman                                          121      127   Fabian  Espindola                                        95        99   Will  Johnson                                                88        95   Carey  Talley                                                60        91   Robbie  Findley                                            96        85   Ned  Grabavoy                                                68        77   Chris  Wingert                                            122        76   Mehdi  Ballouchy                                          46        75     CAUTIONS (YELLOWS) GP CAUT Kyle  Beckerman                                          121        29   Jamison  Olave                                              99        26   Andy  Williams                                            189        21   Will  Johnson                                                88        19   Chris  Wingert                                            122        19   Fabian  Espindola                                        95        18   Javier  Morales                                            98        16   Nat  Borchers                                              119        14   Clint  Mathis                                                66        14   Carey  Talley                                                60        14     EJECTIONS (RED CARDS) GP EJECT Jamison  Olave                                              99          4   Andy  Williams                                            189          3   Nat  Borchers                                              119          2   Fabian  Espindola                                        95          2   Clint  Mathis                                                66          2   20  players  tied  with  1     CORNER KICKS GP CK Javier  Morales                                            98      355   Andy  Williams                                            189      225   Chris  Klein                                                  43        76   Kyle  Beckerman                                          121        57   Clint  Mathis                                                66        52   Mehdi  Ballouchy                                          46        49   Will  Johnson                                                88        39   Alecko  Eskandarian                                    17        24   Chris  Wingert                                            122        24   Freddy  Adu                                                    11        22   Nelson  Gonzalez                                          18        22    

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

OFFSIDES GP OFF Fabian  Espindola                                        95        96   Robbie  Findley                                            96        60   Alvaro  Saborio                                            50        59   Jeff  Cunningham                                          38        45   Jason  Kreis                                                  58        44   Atiba  Harris                                                43        32   Yura  Movsisyan                                            53        27   Andy  Williams                                            189        26   Chris  Klein                                                  43        21   Kenny  Deuchar                                              29        18   Melvin  Tarley                                                9        18     GAME-­WINNING GOALS GP GWG Robbie  Findley                                            96          9   Alvaro  Saborio                                            50          9   Javier  Morales                                            98          8   Fabian  Espindola                                        95          7   Kyle  Beckerman                                          121          4   Jeff  Cunningham                                          38          4   Andy  Williams                                            189          4   Jason  Kreis                                                  58          3   6  players  tied  with  2     GAME-­WINNING ASSISTS GP GWA Kyle  Beckerman                                          121        10   Javier  Morales                                            98          7   Robbie  Findley                                            96          5   Andy  Williams                                            189          5   Fabian  Espindola                                        95          4   Clint  Mathis                                                66          4   Robbie  Russell                                            78          4   Jeff  Cunningham                                          38          3   5  players  tied  with  2     HAT TRICKS GP HATS Robbie  Findley                                            96          1     MULTI-­GOAL GAMES GP GAMES Jeff  Cunningham                                          38          5   Alvaro  Saborio                                            50          5   Robbie  Findley                                            96          4   Javier  Morales                                            98          3   Fabian  Espindola                                        95          2   Yura  Movsisyan                                            53          2   Kyle  Beckerman                                          121          1   Chris  Brown                                                  60          1   Atiba  Harris                                                43          1   Jason  Kreis                                                  58          1     PENALTY-­KICK GOALS GP PKG Jeff  Cunningham                                          38          5   Alvaro  Saborio                                            50          5   Jason  Kreis                                                  58          4   Robbie  Findley                                            96          2   Carey  Talley                                                60          2   Freddy  Adu                                                    11          1   Alecko  Eskandarian                                    17          1   Fabian  Espindola                                        95          1   Will  Johnson                                                88          1   Dema  Kovalenko                                            22          1   Javier  Morales                                            98          1   Andy  Williams                                            189          1    

 

 

GAMES PLAYED IN GOAL GP Nick  Rimando                                              143   Scott  Garlick                                              31   D.J.  Countess                                              27   Jay  Nolly                                                        7   Chris  Seitz                                                    7   Kyle  Reynish                                                  5   Brian  Kamler                                                  1     GAMES STARTED IN GOAL GS Nick  Rimando                                              143   Scott  Garlick                                              31   D.J.  Countess                                              27   Chris  Seitz                                                    7   Jay  Nolly                                                        6   Kyle  Reynish                                                  4   MINUTES PLAYED IN GOAL MIN Nick  Rimando                                          12815   Scott  Garlick                                          2745   D.J.  Countess                                          2422   Chris  Seitz                                                630   Jay  Nolly                                                    585   Kyle  Reynish                                              415   Brian  Kamler                                                  8     GAA GP MIN SHTS SVS GA GAA W-­L-­T SHO Rimando    143  12815    647    488    159    1.12  55-­48-­40    51   Minimum:  4000  minutes  played     WINNING PCT. GP WON LOST TIED PCT Nick  Rimando                            143        55        48        40  .524   Minimum:  20  wins     WINS GP WON Nick  Rimando                                              143        55   Scott  Garlick                                              31        10   D.J.  Countess                                              27          4   Jay  Nolly                                                        7          1   Kyle  Reynish                                                  5          1   Chris  Seitz                                                    7          1     LOSSES GP LOST Nick  Rimando                                              143        48   D.J.  Countess                                              27        19   Scott  Garlick                                              31        12   Jay  Nolly                                                        7          4   Chris  Seitz                                                    7          4     SAVES GP SVS Nick  Rimando                                              143      488   D.J.  Countess                                              27      112   Scott  Garlick                                              31      108   Jay  Nolly                                                        7        41   Chris  Seitz                                                    7        19   Kyle  Reynish                                                  5        14     SHUTOUTS GP SHO Nick  Rimando                                              143        51   D.J.  Countess                                              27          4   Scott  Garlick                                              31          4   Kyle  Reynish                                                  5          2   Chris  Seitz                                                    7          1     SAVE PERCENTAGE GP SAVES SOG PCT Nick  Rimando                                    143      488      673    72.5   Minimum:  175  saves          

LEG ONE ² OCT. 29 @ RSL ² FOX SOCCER / LEG TWO ² NOV. 2 @ SEATTLE ² ESPN2  

REAL SALT LAKE INDIVIDUAL YEAR-­BY-­YEAR LEADERS (2005-­2011) GAMES PLAYED GP 2011    Nick  Rimando                                    33   2010    Nat  Borchers                                    30              Andy  Williams                                  30   2009    Nat  Borchers                                    30              Chris  Wingert                                  30   2008    Kyle  Beckerman                                30              Nick  Rimando                                    30   2007    Eddie  Pope                                        27              Nick  Rimando                                    27   2006    Mehdi  Ballouchy                              32              Chris  Klein                                      32   2005    Chris  Brown                                      29     GAMES STARTED GS 2011    Nick  Rimando                                    33   2010    Nat  Borchers                                    30   2009    Nat  Borchers                                    30   2008    Kyle  Beckerman                                30              Nick  Rimando                                    30   2007    Eddie  Pope                                        27              Nick  Rimando                                    27   2006    Chris  Klein                                      32   2005    D.J.  Countess                                  27              Clint  Mathis                                    27     MINUTES PLAYED MIN 2011    Nick  Rimando                                2970   2010    Nat  Borchers                                2673   2009    Nat  Borchers                                2679   2008    Nick  Rimando                                2700   2007    Nick  Rimando                                2430   2006    Chris  Klein                                  2842   2005    D.J.  Countess                              2422     GOALS GP GOALS 2011    Alvaro  Saborio                                23        11   2010    Alvaro  Saborio                                27        12   2009    Robbie  Findley                                27        12   2008    Yura  Movsisyan                                22          7   2007    Robbie  Findley                                16          6   2006    Jeff  Cunningham                              31        16   2005    Jason  Kreis                                      24          9     ASSISTS GP ASTS 2011    Kyle  Beckerman                                29          9   2010    Javier  Morales                                26          9   2009    Clint  Mathis                                    28          7   2008    Javier  Morales                                29        15   2007    Alecko  Eskandarian                        17          3              Andy  Williams                                  24          3   2006    Jeff  Cunningham                              31        11   2005    Jason  Kreis                                      24          4              Clint  Mathis                                    27          4     GAME-­WINNING GOALS GP GWG 2011    Alvaro  Saborio                                23          4   2010    Alvaro  Saborio                                27          5   2009    Robbie  Findley                                27          3   2008    Javier  Morales                                29          3   2007    Robbie  Findley                                16          3   2006    Jeff  Cunningham                              31          4   2005    Brian  Dunseth                                  24          2              Jason  Kreis                                      24          2     GAME-­WINNING ASSISTS GP GWA 2011    Kyle  Beckerman                                29          6   2010    Javier  Morales                                26          3   2009    4  players  tied  with  2   2008    Javier  Morales                                29          2              Andy  Williams                                  26          2   2007    Alecko  Eskandarian                        17          2   2006    Jeff  Cunningham                              31          3   2005    Clint  Mathis                                    27          3  

 

  PENALTY-­KICK GOALS GP PKG 2011    Alvaro  Saborio                                23          3   2010    Alvaro  Saborio                                27          2   2009    Robbie  Findley                                27          1              Will  Johnson                                    26          1   2008    Dema  Kovalenko                                22          1   2007    Carey  Talley                                    26          2   2006    Jeff  Cunningham                              31          4   2005    Jason  Kreis                                      24          3     SHOTS GP SHOTS 2011    Alvaro  Saborio                                23        66   2010    Alvaro  Saborio                                27        51   2009    Yura  Movsisyan                                26        64   2008    Yura  Movsisyan                                22        69   2007    Alecko  Eskandarian                        17        47   2006    Jeff  Cunningham                              31        83   2005    Jason  Kreis                                      24        65     SHOTS ON GOAL GP SOG 2011    Fabian  Espindola                            27        31   2010    Alvaro  Saborio                                27        22   2009    Yura  Movsisyan                                26        29   2008    Yura  Movsisyan                                22        33   2007    Alecko  Eskandarian                        17        21   2006    Jeff  Cunningham                              31        45   2005    Jason  Kreis                                      24        31     FOULS COMMITTED GP FC 2011    Alvaro  Saborio                                23        43   2010    Javier  Morales                                26        35   2009    Kyle  Beckerman                                25        42   2008    Javier  Morales                                29        49   2007    Atiba  Harris                                    21        45   2006    Carey  Talley                                    30        53   2005    Andy  Williams                                  26        41     FOULS SUFFERED GP FS 2011    Andy  Williams                                  31        45   2010    Javier  Morales                                26        76   2009    Javier  Morales                                26        55   2008    Javier  Morales                                29        59   2007    Alecko  Eskandarian                        17        39   2006    Andy  Williams                                  29        52   2005    Andy  Williams                                  26        79     CAUTIONS (YELLOWS) GP CAUT 2011    Kyle  Beckerman                                29          6              Fabian  Espindola                            27          6              Will  Johnson                                    25          6   2010    Jamison  Olave                                  27          8   2009    Kyle  Beckerman                                25        10   2008    Jamison  Olave                                  23          9   2007    Alecko  Eskandarian                        17          6              Matias  Mantilla                              10          6              Carey  Talley                                    26          6   2006    Atiba  Harris                                    22          8   2005    Seth  Trembly                                    22          8     EJECTIONS (RED CARDS) GP EJECT 2011    Nat  Borchers                                    30          2   2009    Jamison  Olave                                  25          3   2008    Ian  Joy                                              19          1              Andy  Williams                                  26          1              Chris  Wingert                                  29          1   2007    5  players  tied  with  1   2006    5  players  tied  with  1   2005    6  players  tied  with  1    

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES

CORNER KICKS GP CK 2011    Kyle  Beckerman                                29        42   2010    Javier  Morales                                26        80   2009    Javier  Morales                                26      113   2008    Javier  Morales                                29      112   2007    Mehdi  Ballouchy                              14        40   2006    Chris  Klein                                      32        75   2005    Andy  Williams                                  26        73     OFFSIDES GP OFF 2011    Alvaro  Saborio                                23        38   2010    Fabian  Espindola                            22        29   2009    Fabian  Espindola                            22        21   2008    Kenny  Deuchar                                  29        18   2007    Alecko  Eskandarian                        17        16   2006    Jeff  Cunningham                              31        35   2005    Jason  Kreis                                      24        23     SCORING PCT. GP SHOTS GOALS PCT 2011    Alvaro  Saborio                23        66        11      16.7   2010    Alvaro  Saborio                27        51        12      23.5   2009    Robbie  Findley                27        60        12      20.0   2008    Fabian  Espindola            12        25          5      20.0   2007    Robbie  Findley                16        20          6      30.0   2006    Jeff  Cunningham              31        83        16      19.3   2005    Jason  Kreis                      24        65          9      13.8   Minimum:  5  goals     SHOTS ON GOAL PCT. GP SHOTS SOG PCT 2011    Fabian  Espindola                  27        62        31      50.0   2010    Javier  Morales                      26        42        21      50.0   2009    Will  Johnson                          26        48        22      45.8   2008    Kyle  Beckerman                      30        45        22      48.9   2007    Alecko  Eskandarian              17        47        21      44.7   2006    Jeff  Cunningham                    31        83        45      54.2   2005    Jason  Kreis                            24        65        31      47.7   Minimum:  20  shots  on  goal     GAMES PLAYED IN GOAL GP 2011    Nick  Rimando                                    33   2010    Nick  Rimando                                    27   2009    Nick  Rimando                                    26   2008    Nick  Rimando                                    30   2007    Nick  Rimando                                    27   2006    Scott  Garlick                                  31   2005    D.J.  Countess                                  27     GAMES STARTED IN GOAL GS 2011    Nick  Rimando                                    33   2010    Nick  Rimando                                    27   2009    Nick  Rimando                                    26   2008    Nick  Rimando                                    30   2007    Nick  Rimando                                    27   2006    Scott  Garlick                                  31   2005    D.J.  Countess                                  27     MINUTES PLAYED IN GOAL MIN 2011    Nick  Rimando                                2970   2010    Nick  Rimando                                2430   2009    Nick  Rimando                                2285   2008    Nick  Rimando                                2700   2007    Nick  Rimando                                2430   2006    Scott  Garlick                              2745   2005    D.J.  Countess                              2422        

 

 

 

GOALS AGAINST AVG. GP MIN GA GAA 2011    Nick  Rimando                          33    2970        36    1.09   2010    Nick  Rimando                          27    2430        18    0.67   2009    Nick  Rimando                          26    2285        29    1.14   2008    Nick  Rimando                          30    2700        39    1.30   2007    Nick  Rimando                          27    2430        37    1.37   2006    Scott  Garlick                        31    2745        43    1.41   2005    D.J.  Countess                        27    2422        54    2.01   Minimum:  1000  minutes  played     WINNING PCT. GP WON LOST TIED PCT 2011    Nick  Rimando                33        14        11          8    .545   2010    Nick  Rimando                27        15          4          8    .704   2009    Nick  Rimando                26        10        10          6    .500   2008    Nick  Rimando                30        10        10        10    .500   2007    Nick  Rimando                27          6        13          8    .370   2006    Scott  Garlick              31        10        12          9    .468   Minimum:  5  wins     WINS GP WON 2011    Nick  Rimando                                    33        14   2010    Nick  Rimando                                    27        15   2009    Nick  Rimando                                    26        10   2008    Nick  Rimando                                    30        10   2007    Nick  Rimando                                    27          6   2006    Scott  Garlick                                  31        10   2005    D.J.  Countess                                  27          4     LOSSES GP LOST 2011    Nick  Rimando                                    33        11   2010    Nick  Rimando                                    27          4   2009    Nick  Rimando                                    26        10   2008    Nick  Rimando                                    30        10   2007    Nick  Rimando                                    27        13   2006    Scott  Garlick                                  31        12   2005    D.J.  Countess                                  27        19     SAVES GP SVS 2011    Nick  Rimando                                    33        95   2010    Nick  Rimando                                    27        78   2009    Nick  Rimando                                    26        73   2008    Nick  Rimando                                    30        96   2007    Nick  Rimando                                    27      146   2006    Scott  Garlick                                  31      108   2005    D.J.  Countess                                  27      112     SHUTOUTS GP SHO 2011    Nick  Rimando                                    33        13   2010    Nick  Rimando                                    27        14   2009    Nick  Rimando                                    26          9   2008    Nick  Rimando                                    30          8   2007    Nick  Rimando                                    27          7   2006    Scott  Garlick                                  31          4   2005    D.J.  Countess                                  27          4     SAVES PERCENTAGE GP SAVES SOG PCT 2011    Nick  Rimando                          33        95      134    70.9   2010    Nick  Rimando                          27        78      100    78.0   2009    Nick  Rimando                          26        73      108    67.6   2008    Nick  Rimando                          30        96      140    68.6   2007    Nick  Rimando                          27      146      191    76.4   2006    Scott  Garlick                        31      108      158    68.4   2005    D.J.  Countess                        27      112      170    65.9   Minimum:  40  saves  

 SEATTLE SOUNDERS FC vs REAL SALT LAKE – 2011 LEAGUE BOXSCORES REAL SALT LAKE 1, SEATTLE SOUNDERS FC 2

SEATTLE SOUNDERS FC 1, REAL SALT LAKE 2

May 28, 2011 -- Rio Tinto Stadium

September 10, 2011 -- CenturyLink Field

Scoring Summary: SEA--Ianni 1 (Montero 4, Jaqua 1) 71 SEA--Neagle 1 (Wahl 2) 84 RSL--Gonzalez 1 (unassisted) 87

Scoring Summary: RSL--own goal (Keller) 12 SEA--Montero 7 (Rosales 10) 47+ RSL--Saborio 8 (unassisted) 56

x

x

x

x

x

The match turned just before the hour mark, when RSL defender Jamison Olave was shown a straight red card by referee Mark Kadlecik after bringing down Sounders FC striker Mike Fucito. Seattle capitalized in the 72nd minute. Nate Jaqua knocked down a corner onto the foot of Fredy Montero, who slipped to defender Patrick Ianni and he easily finished from almost on the goal line. Sounders FC then doubled the lead in the 84th minute as Lamar Neagle received the ball near the edge of the 18-yard box and curled in a stunning shot over RSL 'keeper Nick Rimando and off the underside of the bar. RSL pulled one back just four minutes later when Nelson Gonzalez received a throw-in in the box, turned a defender and ran towards the middle of the area, striking a left-footer past Kasey Keller. It was Real’s first league loss in Sandy in more than two years.

SEATTLE SOUNDERS FC (4-1-3-2): Kasey Keller – James Riley, Jeff Parke, Patrick Ianni, Tyson Wahl – Osvaldo Alonso – Brad Evans, Erik Friberg (Roger Levesque 80), Alvaro Fernandez (Lamar Neagle 18) – Mike Fucito (Fredy Montero 70), Nate Jaqua. TOTAL SHOTS: 17 (Alonso 4, Neagle 4);SHOTS ON GOAL: 6 (Neagle 2);FOULS: 12 (Wahl 4);OFFSIDE: 2;CORNER KICKS: 4;SAVES: Keller 5;CAUTIONS: Riley 81, Wahl 90;EJECTIONS: None. REAL SALT LAKE (4-3-1-2): Nick Rimando - Robbie Russell (Nelson Gonzalez 76), Jamison Olave (sent off 58), Nat Borchers, Tony Beltran Andy Williams (Luis Gil 87), Kyle Beckerman, Will Johnson - Ned Grabavoy - Jean Alexandre (Chris Wingert 62), Fabian Espindola. TOTAL SHOTS: 16 (Johnson 4);SHOTS ON GOAL: 6 (Johnson 2);FOULS: 7 (Alexandre 2, Olave 2);OFFSIDE: 2;CORNER KICKS: 10;SAVES: Rimando 3;CAUTIONS: Johnson 28, Wingert 66;EJECTIONS: Olave 58. Referee: Mark Kadlecik Referee's Assistants: Rob Fereday, Colin Arblaster 4th Official: Yader Reyes. Attendance: 14,674. Temperature: 57 and Cloudy.

x

x

x

x

x

x

Real Salt Lake were handed a stunning lead after 13 minutes. RSL’s Fabián Espíndola sent in a seemingly harmless cross from the left, but Keller all but through it into his goal while looking to put it over the line for a corner. Sounders FC had a chance to pull level in the 16th minute, but Mauro Rosales put his penalty kick wide after striker Mike Fucito was taken down in the box by RSL defender Jámison Olave. Both teams then went a man down in the space of four minutes. RSL’s Tony Beltran received a second yellow card for a challenge against Rosales in the 35th minute, but Seattle's Jhon Kennedy Hurtado saw a straight red in the 39th minute after a foul on Alvaro Saborío. Yet the home side were able to hit for the equalizer in first-half stoppage time. Rosales turned the corner on the left and sent a return pass back across for Fredy Montero, who converted from close range. But after the break RSL again took the lead. Alvaro Saborio took a pass in the area, and after his first attempt was blocked and Sounders FC defender Tyson Wahl failed to clear, he again latched onto the ball and sent it to the back of the net. In six all-time league meetings between the clubs, each team has won at home once. Each team has also won once in the series on the road – in the two meetings this year.

REAL SALT LAKE (4-3-1-2): Nick Rimando - Robbie Russell, Jamison Olave, Nat Borchers, Tony Beltran (sent off 35) - Andy Williams, Kyle Beckerman, Will Johnson - Luis Gil (Chris Schuler 46) - Fabian Espindola (Paulo Jr. 79), Alvaro Saborio (Ned Grabavoy 68). TOTAL SHOTS: 10 (Espindola 3, Saborio 3);SHOTS ON GOAL: 4 (Johnson 2);FOULS: 12 (Beltran 4);OFFSIDE: 2;CORNER KICKS: 2;SAVES: Rimando 2;CAUTIONS: Beltran 20, Williams 68;EJECTIONS: Beltran 35. SEATTLE SOUNDERS FC (4-1-3-2): Kasey Keller - James Riley, Jeff Parke, Jhon Kennedy Hurtado (sent off 39), Tyson Wahl - Osvaldo Alonso - Mauro Rosales, Erik Friberg (Servando Carrasco 31), Alvaro Fernandez (Lamar Neagle 65) - Fredy Montero, Mike Fucito (Pat Noonan 73). TOTAL SHOTS: 20 (Montero 6);SHOTS ON GOAL: 3 (3 tied with 1);FOULS: 10 (3 tied with 2);OFFSIDE: 3;CORNER KICKS: 11;SAVES: Keller 3;CAUTIONS: Carrasco 38, Alonso 94+;EJECTIONS: Hurtado 39. Referee: Mark Kadlecik Referee's Assistants: Mike Kampmeinert, James Conlee 4th Official: Edvin Jurisevic. Attendance: 35,940. Temperature: 73 and Clear.

 2011 REAL SALT LAKE VS. SEATTLE SOUNDERS FC (1-1-0) UNF 22 15 12 23 5 2 6 7 21 20 8 4 18 3 28 77 17

POS MID FWD MID FWD MID DEF DEF FWD MID MID MID DEF GK DEF DEF MID DEF

PLAYER Nelson Gonzalez Alvaro Saborio Jean Alexandre Paulo Araujo Jr. Kyle Beckerman Tony Beltran Nat Borchers Fabian Espindola Luis Gil Ned Grabavoy Will Johnson Jamison Olave Nick Rimando Robbie Russell Chris Schuler Andy Williams Chris Wingert ----------Team totals Opponent totals

GP 1 1 1 1 2 2 2 2 2 2 2 2 2 2 1 2 1

GS 0 1 1 0 2 2 2 2 1 1 2 2 2 2 0 2 0

MIN 14 68 62 11 180 125 180 169 48 112 180 148 180 166 45 177 28

G 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

A 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

SHT 1 3 2 0 1 0 3 5 1 2 6 2 0 0 0 0 0

SOG 1 1 1 0 0 0 0 2 0 0 4 1 0 0 0 0 0

FC 0 1 2 0 2 4 0 1 0 1 2 2 0 1 0 2 1

FS 0 2 0 0 2 1 1 2 0 0 4 2 0 1 0 5 0

OFF 0 0 0 1 0 0 0 2 0 0 1 0 0 0 0 0 0

CK 2 0 0 0 2 0 0 1 0 0 1 0 0 0 0 6 0

C 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 1 1

E 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 0 0

CP 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

2 2

2 2

180 180

3 3

0 4

26 37

10 9

19 22

22 19

4 5

12 15

4 4

2 1

0 0

GP 2

GS 2

MIN 180

SHTS 9

SV 5

GA 3

GAA 1.50

PG 0

PA 1

W 1

L 1

T 0

2 2

2 2

180 180

9 10

5 8

3 3

1.50 1.50

0 0

1 0

1 1

1 1

0 0

GAME-WINNING GOALS: Alvaro Saborio 1 GAME-WINNING ASSISTS: None PENALTY KICK GOALS/ATTEMPTS: None UNF POS GOALKEEPER 18 GK Nick Rimando ----------Team totals Opponent totals

SO O'TIME 0 0-0-0 0 0

0-0-0 0-0-0

2011 SEATTLE SOUNDERS FC VS. REAL SALT LAKE (1-1-0) UNF 17 4 27 21 10 5 6 23 3 15 8 2 34 18 24 25 31 7

POS FWD D/M MID FWD MID DEF MID MID MID MID MID FWD DEF GK FWD FWD DEF D/F

PLAYER Fredy Montero Patrick Ianni Lamar Neagle Nate Jaqua Mauro Rosales Tyson Wahl Osvaldo Alonso Servando Carrasco Brad Evans Alvaro Fernandez Erik Friberg Mike Fucito Jhon Kennedy Hurtado Kasey Keller Roger Levesque Pat Noonan Jeff Parke James Riley ----------Team totals Opponent totals

GP 2 1 2 1 1 2 2 1 1 2 2 2 1 2 1 1 2 2

GS 1 1 0 1 1 2 2 0 1 2 2 2 1 2 0 0 2 2

MIN 110 90 97 90 90 180 180 59 90 83 111 143 39 180 10 17 180 180

G 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

A 1 0 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0

SHT 8 1 7 3 1 1 5 1 0 1 0 5 0 0 0 0 2 2

SOG 2 1 2 0 0 1 1 0 0 0 0 1 0 0 0 0 1 0

FC 0 0 0 3 1 4 2 1 0 1 0 5 2 0 0 0 1 2

FS 1 1 1 1 5 0 2 1 0 1 0 2 0 0 0 0 0 2

OFF 2 0 0 2 1 0 0 0 0 0 0 0 0 0 0 0 0 0

CK 0 0 0 0 10 4 0 0 0 0 0 1 0 0 0 0 0 0

C 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 0 0 1

E 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0

CP 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

2 2

2 2

180 180

3 3

4 0

37 26

9 10

22 19

19 22

5 4

15 12

4 4

1 2

0 0

GAME-WINNING GOALS: Lamar Neagle 1 GAME-WINNING ASSISTS: Tyson Wahl 1 PENALTY KICK GOALS/ATTEMPTS: Mauro Rosales 0-1 UNF POS GOALKEEPER 18 GK Kasey Keller ----------Team totals Opponent totals

GP 2

GS 2

MIN 180

SHTS 10

SV 8

GA 3

GAA 1.50

PG 0

PA 0

W 1

L 1

T 0

2 2

2 2

180 180

10 9

8 5

3 3

1.50 1.50

0 0

0 1

1 1

1 1

0 0

SO O'TIME 0 0-0-0 0 0

0-0-0 0-0-0

 REAL SALT LAKE CAREER STATISTICS VS. SEATTLE SOUNDERS FC (2-2-2) PLAYER Alvaro Saborio Robbie Findley Nelson Gonzalez Will Johnson Nick Rimando Robbie Russell Jean Alexandre Paulo Araujo Jr. Kyle Beckerman Tony Beltran Nat Borchers Pablo Campos Raphael Cox Rachid El Khalifi Fabian Espindola Luis Gil Ned Grabavoy Clint Mathis Javier Morales Yura Movsisyan Jamison Olave Kyle Reynish Chris Schuler Andy Williams Chris Wingert Team totals Opponent totals

GP 3 4 3 6 5 3 2 1 6 5 6 2 1 1 4 2 3 2 4 1 5 1 2 5 5 6 6

GS 2 4 1 5 5 3 1 0 6 5 6 0 0 0 4 1 2 2 4 1 5 1 1 3 4 6 6

MIN 170 331 124 475 450 256 64 11 540 388 540 2 7 23 348 48 157 155 309 90 418 90 135 334 388 540 540

G 2 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6 7

A 0 1 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 10

SHT 7 9 1 10 0 1 2 0 4 1 4 0 0 1 5 1 2 4 2 4 4 0 0 1 1 64 71

GOALKEEPER Kyle Reynish Nick Rimando ----------Team totals Opponent totals

GP 1 5

MIN 90 450

SHTS 2 17

SV 2 9

GAA 0.00 1.40

PG 0 0

6 6

540 540

19 25

11 20

1.17 1.00

0 0

 SEATTLE SOUNDERS FC CAREER STATISTICS VS. REAL SALT LAKE (2-2-2) PLAYER Fredy Montero Nate Jaqua Steve Zakuani Patrick Ianni Tyrone Marshall Lamar Neagle Osvaldo Alonso Freddie Ljungberg James Riley Mauro Rosales Tyson Wahl Servando Carrasco Brad Evans Alvaro Fernandez Erik Friberg Mike Fucito Leo Gonzalez Jhon Kennedy Hurtado Kasey Keller Sebastien Le Toux Roger Levesque Pat Noonan Sanna Nyassi Jeff Parke Zach Scott Mike Seamon Nathan Sturgis Peter Vagenas Team totals Opponent totals

GP 6 4 4 2 3 2 6 3 4 1 3 1 4 3 2 3 3 4 6 1 4 2 2 3 2 1 4 1 6 6

GS 5 4 4 2 3 0 6 2 4 1 2 0 4 3 2 2 3 4 6 1 0 1 0 3 2 0 1 1 6 6

MIN 453 300 319 180 270 97 531 209 360 90 222 59 360 157 111 163 219 309 540 89 44 107 25 270 180 5 130 90 540 540

G 2 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7 6

A 2 1 1 0 0 0 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 4

SHT 18 9 4 1 1 7 11 0 3 1 1 1 1 1 0 6 0 1 0 1 1 0 0 2 1 0 0 0 71 64

GOALKEEPER Kasey Keller ----------Team totals Opponent totals

GP 6

MIN 540

SHTS 25

SV 20

GAA 1.00

PG 0

6 6

540 540

25 19

20 11

1.00 1.17

0 0

 CURRENT REAL SALT LAKE PLAYERS CAREER STATISTICS VS. SEATTLE SOUNDERS (2-2-2)

CURRENT SEATTLE SOUNDERS FC PLAYERS CAREER STATISTICS VS. REAL SALT LAKE (2-2-2)

PLAYER Alvaro Saborio Nelson Gonzalez Will Johnson Nick Rimando Robbie Russell Jean Alexandre Arturo Alvarez Paulo Araujo Jr. Kyle Beckerman Tony Beltran Nat Borchers Fabian Espindola Luis Gil Ned Grabavoy Javier Morales Jamison Olave Kyle Reynish Chris Schuler Andy Williams Chris Wingert Team totals Opponent totals

GP 3 3 6 5 3 2 3 1 6 5 6 4 2 3 4 5 1 2 5 5 6 6

GS 2 1 5 5 3 1 2 0 6 5 6 4 1 2 4 5 1 1 3 4 6 6

MIN 170 124 475 450 256 64 225 11 540 388 540 348 48 157 309 418 90 135 334 388 540 540

G 2 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6 7

A 0 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 10

SHT 7 1 10 0 1 2 3 0 4 1 4 5 1 2 2 4 0 0 1 1 64 71

GOALKEEPER Kyle Reynish Nick Rimando ----------Team totals Opponent totals

GP 1 5

MIN 90 450

SHTS 2 17

SV 2 9

GAA 0.00 1.40

PG 0 0

PLAYER Nate Jaqua Fredy Montero Steve Zakuani Brad Evans Patrick Ianni Lamar Neagle Pat Noonan Osvaldo Alonso James Riley Mauro Rosales Tyson Wahl Servando Carrasco Alvaro Fernandez Erik Friberg Mike Fucito Leo Gonzalez Taylor Graham Jhon Kennedy Hurtado Kasey Keller Roger Levesque Jeff Parke Amadou Sanyang Zach Scott Mike Seamon O'Brian White Team totals Opponent totals

GP 13 6 4 6 6 2 8 6 11 1 5 1 3 2 3 3 1 4 6 5 11 2 2 1 3 6 6

GS 11 5 4 6 3 0 4 6 8 1 3 0 3 2 2 3 1 4 6 0 11 1 2 0 1 6 6

MIN 941 453 319 533 283 97 419 531 778 90 316 59 157 111 163 219 90 309 540 56 953 62 180 5 179 540 540

G 6 2 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7 6

A 2 2 1 0 0 0 0 2 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 4

SHT 24 18 4 3 1 7 7 11 4 1 1 1 1 0 6 0 0 1 0 1 2 0 1 0 1 71 64

6 6

540 540

19 25

11 20

1.17 1.00

0 0

GOALKEEPER Kasey Keller ----------Team totals Opponent totals

GP 6

MIN 540

SHTS 25

SV 20

GAA 1.00

PG 0

6 6

540 540

25 19

20 11

1.00 1.17

0 0

SEATTLE SOUNDERS FC 2011 RECORD GP Sounders 34

WHERE THE GOALS COME FROM W-L-T 18-7-9

PTS 63

GF 56

GA 37

RECORD at CENTURYLINK FIELD GP 17

W-L-T 9-4-4

PTS 31

GF 32

GA 2-

PTS 32

GF 24

GA 17

RECORD on road GP 17

W-L-T 9-3-5

RECORD at the half W 8 7 3

LEADING TIED TRAILING

L 0 4 3

T 2 4 3

RECORD with the first goal W 11 7

SCORING CONCEDING

L 0 7

T 3 3

GOALS SCORED MINUTES PER GOAL

0 7

1 11

2 8

3 5

4+ 3

TOT AVG 56 1.65

4+ 0

TOT AVG 37 1.09

GOALS ALLOWED IN GAME GP 34

0 9

1 15

2 8

3 2

21 10 5 1

27 9 7 2 6 3 0 2

15 9 3 1 3 2 1 3

13 35 8

12 17 8

17

2

Montero 30/27; 12G/9A

Fucito 19/13; 2G/2A

15

10

Fernandez 29/23; 9G/0A

Rosales 26/22; 5G/13A

3 Evans 20/17; 5G/5A

GOALS BY INTERVALS TOT FOR 56 AGAINST 37

34 13 9 0

PRIMARY TEAM

AGAINST 1.09 (4th) 11.74 (14th) 3.79 (16th) 32.3% (13th) 10.0% (12th) 12.27 (8th) 4.15 (14th) 2.29 (13th)

GOALS SCORED IN GAME GP 34

AGAINST 37 83

HOW SCORED RIGHT FOOT LEFT FOOT HEADERS OTHER TYPE OF PLAY OPEN PLAY CROSS CORNER REBOUND PENALTIES DIRECT FROM FREE KICK FREE KICK (INDIRECT) OWN GOALS DISTANCE INSIDE GOAL AREA INSIDE PENALTY AREA OUTSIDE PENALTY AREA

TEAM COMPARISONS FOR GOALS SCORED 1.65 (1st) TOTAL SHOTS 14.35 (1st) SHOTS ON GOAL 4.67 (2nd) SHOOTING ACCURACY 32.6% (16th) SCORING %AGE 10.3% (8th) FOULS 12.50 (5th) CORNER KICKS 4.73 (7th) OFFSIDE 2.09 (16th)

FOR 56 55

0-15 16-30 31-45+ 46-60 61-75 76-90+ 7 6 10 7 11 15 5 6 7 8 7 4

6 Alonso 33/32; 3G/3A

5 Wahl 23/22; 1G/2A

7

34

31

Hurtado 23/23; 0G/1A

Parke 28/28; 0G/1A

18

Keller 34/34; 1.09/9SO 117

Riley 29/29; 0G/2A

SEATTLE SOUNDERS FC 2011 No. Player Pos Ht Wt Birthdate Birthplace GP GS G 2 Mike Fucito FW 5-9 165 03/29/1986 Westford, MA 19 13 2 Fourth-round selection in 2009 SuperDraft out of Harvard University. 3 Brad Evans MF 6-1 160 04/20/1985 Phoenix, AZ 20 17 5 Selected from Columbus in 2008 expansion draft. Made U.S. international debut in 2009. 4 Patrick Ianni DF 6-1 175 06/15/1985 Lodi, CA 16 12 1 Acquired in trade with Houston Dynamo before start of 2009 season. In sixth MLS season. 5 Tyson Wahl DF 6-2 185 02/23/1984 Newport Beach, CA 23 22 1 Selected in 2009 expansion draft. Played three seasons with Kansas City. 6 Osvaldo Alonso MF 5-11 165 11/11/1985 San Cristobal, Cuba 33 32 3 In his third MLS season. Defected from Cuba while playing with national team in 2007 CONCACAF Gold Cup. 7 James Riley DF 5-10 150 10/27/1982 Colorado Springs, CO 29 29 0 Selected from San Jose in expansion draft. In seventh MLS season. 8 Erik Friberg MF 5-11 154 02/10/1986 Lindome, Sweden 26 23 1 Acquired prior to start of 2011 season. Played with Vastra Frolunda IF and BK Hacken in his native Sweden. 10 Mauro Rosales MF 5-8 160 02/24/1981 Villa Maria, Argentina 26 22 5 Signed before start of season. Last with Argentina's River Plate; also played with Ajax and Newell's Old Boys. 11 Steve Zakuani MF 6-0 160 02/09/1988 Kinshasa, Congo DR 6 6 2 No. 1 overall pick in 2009 SuperDraft out of University of Akron. Made full international debut in 2010. 12 Leo Gonzalez DF 6-1 174 11/21/1980 San Jose, Costa Rica 14 12 0 Played in 2006 FIFA World Cup for Costa Rica. Acquired from Municipal Liberia in homeland during 2009 season. 13 O'Brian White FW 6-1 175 12/14/1985 Ocho Rios, Jamaica 7 7 2 Acquired from Toronto FC. MAC Hermann Trophy winner at University of Connecticut. Made Jamaica debut in 2010. 14 Michael Tetteh DF 5-8 155 01/16/1989 Accra, Ghana 0 0 0 Second-round selection in 2011 SuperDraft out of University of California-Santa Barbara. 15 Alvaro Fernandez MF 6-1 159 10/11/1985 Soriano, Uruguay 29 23 9 Signed as Designated Player in 2010. Member of Uruguay national team in 2010 FIFA World Cup. 16 David Estrada MF 5-8 160 02/04/1988 Salinas, CA 3 1 0 First-round selection (No. 11 overall) in 2010 SuperDraft out of UCLA. 17 Fredy Montero FW 5-9 160 07/26/1987 Campo de la Cruz, Colombia 30 27 12 2009 MLS Newcomer of the Year. Double digits in goals in all three MLS seasons. 18 Kasey Keller GK 6-2 190 11/29/1969 Olympia, WA 34 34 0 Came to MLS with birth of Sounders FC after 14 years in Europe, in England, Germany and Spain. 19 Sammy Ochoa FW 6-0 0 09/04/1986 Morelia, Mexico 4 0 2 Acquired by Sounders FC in August after five seasons with Mexico's Estudiantes Tecos. 20 Zach Scott DF 5-11 175 07/02/1980 Wailukur, HI 12 9 0 Played seven seasons with USL-1 Sounders before signing with MLS club before inaugural season. 21 Nate Jaqua FW 6-4 205 10/28/1981 Eugene, OR 23 7 0 Selected from Houston in expansion draft. In second stint in MLS after playing one season in Austria. 22 Mike Seamon MF 6-1 175 08/30/1988 Rahway, NJ 0 0 0 Second-round selection in 2010 SuperDraft out of Villanova University. 23 Servando Carrasco MF 5-10 170 08/13/1988 Coronado, CA 12 7 0 Second-round selection (No. 27 overall) in 2011 SuperDraft out of University of California. 24 Roger Levesque FW 6-2 174 01/22/1981 Portland, ME 19 9 3 "Graduated" from USL-1 Sounders to MLS club in 2009. Also played two seasons for San Jose. 25 Pat Noonan FW 6-0 170 08/02/1980 St. Louis, MO 9 2 0 Signed by Sounders FC before start of 2010 season. In his ninth MLS season. Also played in Norway. 26 Taylor Graham DF 6-4 190 06/03/1980 Fair Oaks, CA 0 0 0 In his seventh MLS season. Also played with Kansas City (2003-04) and New York (2006-07). 27 Lamar Neagle MF 5-11 165 05/07/1987 Tacoma, WA 23 9 5 Local product in second stint with Sounders FC after playing 2010-11 season in Finland. 28 Terry Boss GK 6-3 205 09/01/1981 Philomath, OR 0 0 0 In fourth MLS season, third with Sounders FC. Puerto Rico international. 29 Josh Ford GK 6-2 175 11/06/1987 Liverpool, NY 0 0 0 Product of University of Connecticut selected in first round of 2011 Supplemental Draft. 30 Amadou Sanyang MF 6-0 165 08/01/1991 Bakau, Gambia 1 0 0 Acquired from Toronto FC earlier this season. 31 Jeff Parke DF 6-1 185 03/23/1982 Abington, PA 28 28 1 In second season with Sounders FC. Also played five seasons for New York Red Bulls (2004-08). 32 Miguel Montano MF 5-11 160 06/25/1991 Palmira, Colombia 2 0 0 Signed early in 2010 season. Played in Argentina (Quilmes AC) and Colombia (Envigado FC). 34 Jhon Kennedy Hurtado DF 6-0 183 05/16/1984 Florida, Colombia 23 23 0 Acquired on loan from Deportivo Cali in Colombia in 2009. Finalist for MLS Defender of the Year in 2009. 35 Bryan Meredith GK 6-2 195 08/02/1989 Scotch Plains, NJ 0 0 0 Second-round selection in 2011 SuperDraft out of Monmouth University. HEAD COACH : Sigi Schmid

03/20/1953

A 2

CAREER GP GS G 23 13 3

A 2

5

89

72

14

12

0

93

65

3

3

2

71

59

1

3

3

83

79

5

9

2

178 160

2

14

2

26

23

1

2

13

26

22

5

13

2

64

57

16

12

1

52

50

1

2

2

40

21

6

6

0

0

0

0

0

0

41

27

11

1

0

6

2

0

0

9

86

81

34

26

0

93

93

0

1

0

4

0

2

0

0

25

19

0

0

2

197 130

41

29

0

8

3

0

1

0

12

7

0

0

2

53

16

6

2

0

173 127

41

33

0

35

16

1

1

2

23

9

5

2

0

1

0

0

0

0

0

0

0

0

0

21

15

0

0

0

180 174

2

4

0

8

1

0

0

1

59

58

1

2

0

0

0

0

0

W155 L110 T83

118

SEATTLE SOUNDERS FC  SEATTLE SOUNDERS FC PLAYOFF HISTORY vs. Team Los Angeles Houston TOTALS

No. of Series 1 1 2

Series W-L 0-1 0-1 0-2

GP 2 2 4

W-L-T 0-2-0 0-1-1 0-3-1

OT 0-0-0 0-1-0 0-1-0

ShO 0-0 0-0 0-0

GF 1 0 1

GA 3 1 4

Last Mtg. 2010 2009

Round Quarterfinals Quarterfinals

Series Result Lost 2 games to 0 Lost 1 games to 0

SEATTLE SOUNDERS FC – ALL-TIME POSTSEASON RESULTS DATE 10/29/2009 11/08/2009

OPPONENT Houston at Houston

RESULT T 0-0 L 0-1 (OT)

ATT. 35,807 27,465

W-L-T 0-0-1 0-1-1

RD. GOALS: QTR QTR HOU: Ching (96)

10/31/2010 11/07/2010

Los Angeles at Los Angeles

L 0-1 L 1-2

35,521 27,000

0-1-0 0-2-0

QTR LA: Buddle (38) QTR SEA: Zakuani (86); LA: Buddle (19) Gonzalez (27)

119

SEATTLE SOUNDERS FC  CAREER POSTSEASON STATISTICS FOR CURRENT SEATTLE SOUNDERS FC PLAYERS UNF 6 3 15 2 12 26 34 4 21 24 17 25 31 7 5 11

POS M M M F D D D D-M F F F F D D-F D M

PLAYER Osvaldo Alonso Brad Evans Alvaro Fernandez Mike Fucito Leo Gonzalez Taylor Graham Jhon Kennedy Hurtado Patrick Ianni Nate Jaqua Roger Levesque Fredy Montero Pat Noonan Jeff Parke James Riley Tyson Wahl Steve Zakuani

UNF POS GOALKEEPER 18 GK Kasey Keller

GP 4 6 2 1 4 4 2 3 18 2 4 17 7 11 2 4

GS MIN 4 390 6 570 0 61 0 26 4 390 0 34 2 210 3 257 10 986 0 80 4 333 16 1538 7 605 7 715 2 158 4 329

GP 4

GS 4

G 0 1 0 0 0 0 0 0 2 0 0 5 0 0 0 1

MIN SHTS 390 0

A 0 0 0 0 0 0 0 0 2 0 0 1 0 0 0 0

SHT 5 6 0 1 3 0 0 3 26 2 12 40 4 1 0 6

SV 14

SOG PKG PKA SKG SKA 2 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 11 0 0 0 0 0 0 0 0 0 4 0 0 0 0 17 0 0 1 2 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0

GA GAA PKG PKA 4 0.92 0 0

120

FC 5 4 2 0 9 1 1 2 25 0 6 24 3 8 4 1

SKG SKA 0 0

FS OFF 4 0 3 0 1 0 0 0 5 0 0 0 3 0 1 0 18 4 0 0 10 0 23 17 5 0 5 0 0 0 6 3

W 0

L 3

CK 2 0 2 0 0 0 0 0 0 0 1 0 0 0 0 1

T 1

SO 1

C 1 2 0 0 0 0 0 1 3 0 2 0 1 1 1 0

E 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0

SEATTLE SOUNDERS FC  ALL-TIME SEATTLE SOUNDERS FC POSTSEASON STATISTICS (0-3-1, 1 PT.) PLAYER Steve Zakuani Nate Jaqua Osvaldo Alonso Brad Evans Alvaro Fernandez Michael Fucito Leo Gonzalez Jhon Kennedy Hurtado Patrick Ianni Kasey Keller Sebastien Le Toux Roger Levesque Freddie Ljungberg Tyrone Marshall Fredy Montero Blaise Nkufo Sanna Nyassi Jeff Parke James Riley Nathan Sturgis Team totals Opponent totals

GP 4 4 4 2 2 1 4 2 3 4 2 2 2 3 4 2 3 1 4 2 4 4

GS 4 2 4 2 0 0 4 2 3 4 0 0 2 2 4 2 2 1 4 2 4 4

MIN 329 232 390 210 61 26 390 210 257 390 38 80 210 219 333 180 135 65 390 145 390 390

G 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 4

A 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 3

SOUNDERS FC INDIVIDUAL GOALKEEPING GOALKEEPER GP GS Kasey Keller 4 4 Team totals 4 4 Opponent totals 4 4

SV 14 14 16

GA 4 4 1

GAA 0.92 0.92 0.23

SO 1 1 3

121

SEATTLE SOUNDERS FC  SEATTLE SOUNDERS FC INDIVIDUAL HIGH GAMES (2011)

TEAM HIGH GAMES (2011)

TEAM LOW GAMES (2011)

Goals 3 Lamar Neagle

08/27/2011

vs. CLB

W 6-2

Goals 6 08/27/2011

vs. CLB

W 6-2

Shots 6 05/07/2011

at

CLB

T 1-1

Assists 2 Osvaldo Alonso 2 Mauro Rosales 2 Mauro Rosales

07/16/2011 08/27/2011 09/17/2011

vs. COL vs. CLB vs. DC

W 4-3 W 6-2 W 3-0

Assists 6 08/27/2011

vs. CLB

W 6-2

Shots on Goal 1 05/07/2011

at

CLB

T 1-1

Fouls Committed 4 05/25/2011 vs. DAL

L 0-1

Fouls Suffered 4 04/02/2011 at

SJ

T 2-2

Corner Kicks 0 03/19/2011

at

NY

L 0-1

Offside 0 06/18/2011 0 07/10/2011

at at

TOR POR

W 1-0 W 3-2

Saves 1 03/15/2011 1 03/25/2011 1 05/25/2011 1 07/16/2011 1 10/22/2011

vs. vs. vs. vs. at

LA HOU DAL COL CHV

L T L W W

Shots 8 Fredy Montero Shots on Goal 5 Fredy Montero 5 Fredy Montero Fouls Committed 5 Osvaldo Alonso Fouls Suffered 5 Mauro Rosales 5 Mauro Rosales Offside 3 Steve Zakuani 3 Mike Fucito 3 Fredy Montero Saves 7 Kasey Keller

07/10/2011

07/10/2011 09/24/2011

04/16/2011

06/26/2011 09/10/2011

at

at at

at

POR

POR VAN

PHI

vs. NE vs. RSL

W 3-2

W 3-2 W 3-1

Shots 26 03/25/2011 Shots on Goal 9 04/30/2011 9 07/16/2011

10/15/2011

vs. HOU vs. DC at CHV

vs. SJ

vs. TOR vs. COL

Fouls Committed 22 05/07/2011 at 22 08/20/2011 at

CLB DAL

T 1-1

W 3-0 W 4-3

T 1-1 W 1-0

T 1-1

W 2-1 L 1-2

Fouls Suffered 19 08/20/2011 19 10/15/2011 Corner Kicks 12 03/25/2011

03/25/2011 09/17/2011 10/22/2011

vs. HOU

T 1-1 W 3-0 W 3-1

W 2-1

at DAL vs. SJ

vs. HOU

W 1-0 W 2-1

T 1-1

Offside 6 06/23/2011 6 07/04/2011

vs. NY at LA

W 4-2 T 0-0

Saves 7 10/15/2011

vs. SJ

W 2-1

Shots Faced 8 Kasey Keller 8 Kasey Keller

07/30/2011 10/15/2011

at HOU vs. SJ

L 1-3 W 2-1

Shots Faced 8 07/30/2011 8 10/15/2011

at HOU vs. SJ

L 1-3 W 2-1

Goals Allowed 3 Kasey Keller 3 Kasey Keller

07/16/2011 07/30/2011

vs. COL at HOU

W 4-3 L 1-3

Goals Allowed 3 07/16/2011 3 07/30/2011

vs. COL at HOU

W 4-3 L 1-3

0-1 1-1 0-1 4-3 3-1

Shots Faced 2 8 times

SEATTLE SOUNDERS FC INDIVIDUAL POSTSEASON HIGH GAMES (2009-10)

TEAM POSTSEASON HIGH GAMES (2009-10)

TEAM POSTSEASON LOW GAMES (2009-10)

Goals 1 Steve Zakuani

11/07/2010

at

LA

L 1-2

Goals 1 11/07/2010

at

LA

L 1-2

Shots 10 11/08/2009

Assists 1 Nate Jaqua

11/07/2010

at

LA

L 1-2

Assists 1 11/07/2010

at

LA

L 1-2

Shots 4 Fredy Montero 4 Blaise Nkufo 4 Fredy Montero

11/08/2009 10/31/2010 11/07/2010

at HOU vs. LA at LA

L 0-1 L 0-1 L 1-2

Shots on Goal 2 5 times Fouls Committed 5 Nate Jaqua Fouls Suffered 7 Freddie Ljungberg

Shots 15 10/31/2010 Shots on Goal 8 10/31/2010

vs. LA

vs. LA

Fouls Committed 16 11/08/2009 at 11/08/2009

11/08/2009

at

at

HOU

HOU

L 0-1

L 0-1

Fouls Suffered 18 10/29/2009

HOU

vs. HOU

L 0-1

L 0-1

L 0-1

HOU

vs. HOU at HOU

T 0-0 L 0-1

Fouls Committed 6 10/29/2009 vs. HOU

T 0-0

Fouls Suffered 12 11/07/2010

at

LA

L 1-2

Corner Kicks 5 11/08/2009 5 11/07/2010

at at

HOU LA

L 0-1 L 1-2

at at

HOU LA

L 0-1 L 1-2

LA

L 1-2

Corner Kicks 9 10/29/2009

vs. HOU

T 0-0

Offside 0 11/08/2009 0 11/07/2010 Saves 2 11/07/2010

at

Shots Faced 4 10/29/2009 4 11/07/2010

vs. HOU at LA

10/31/2010

vs. LA

L 0-1

Offside 3 10/31/2010

vs. LA

L 0-1

Saves 4 Kasey Keller 4 Kasey Keller 4 Kasey Keller

10/29/2009 11/08/2009 10/31/2010

vs. HOU at HOU vs. LA

T 0-0 L 0-1 L 0-1

Saves 4 10/29/2009 4 11/08/2009 4 10/31/2010

vs. HOU at HOU vs. LA

T 0-0 L 0-1 L 0-1

Shots Faced 5 Kasey Keller 5 Kasey Keller

11/08/2009 10/31/2010

at HOU vs. LA

L 0-1 L 0-1

Shots Faced 5 11/08/2009 2 10/31/2010

at HOU vs. LA

L 0-1 L 0-1

Goals Allowed 2 Kasey Keller

11/07/2010

at

L 1-2

Goals Allowed 2 10/31/2010

vs. LA

L 0-1

122

L 0-1

T 0-0

Offside 2 Steve Zakuani

LA

Shots on Goal 3 10/29/2009 3 11/08/2009

at

T 0-0 L 1-2

SEATTLE SOUNDERS FC  2011 SEATTLE SOUNDERS FC STATISTICS (18-7-9, 63 pts.) UNF POS PLAYER 17 F Fredy Montero 15 M Alvaro Fernandez 10 M Mauro Rosales 3 M Brad Evans 27 M Lamar Neagle 6 M Osvaldo Alonso 24 F Roger Levesque 2 F Mike Fucito 13 F O'Brian White 11 M Steve Zakuani 19 F Sammy Ochoa 8 M Erik Friberg 5 D Tyson Wahl 4 D Patrick Ianni 31 D Jeff Parke 21 F Nate Jaqua 7 D James Riley 12 D Leo Gonzalez 34 D Jhon Kennedy Hurtado 23 M Servando Carrasco 16 M David Estrada 18 G Kasey Keller 32 M Miguel Montano 25 F Pat Noonan 30 M Amadou Sanyang 20 D Zach Scott 28 G Terry Boss 29 G Josh Ford 26 D Taylor Graham 35 G Bryan Meredith 14 D Michael Tetteh Own-goals received Team totals Opponent totals

GP 30 29 26 20 23 33 19 19 7 6 4 26 23 16 28 23 29 14 23 12 3 34 2 9 1 12 0 0 0 0 0

GS 27 23 22 17 9 32 9 13 7 6 0 23 22 12 28 7 29 12 23 7 1 34 0 2 0 9 0 0 0 0 0

MIN 2304 1849 1870 1509 1008 2891 1062 1045 517 453 100 1897 1989 1232 2387 843 2579 1069 1945 689 108 3060 31 259 8 864 0 0 0 0 0

34 34

34 34

3060 3060

G 12 9 5 5 5 3 3 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 56 37

A 9 0 13 5 2 3 2 2 2 2 0 2 2 0 0 2 2 1 1 0 0 0 0 0 0 0 0 0 0 0 0

SHT 108 42 18 32 32 54 13 23 15 12 6 9 7 5 10 16 7 4 10 7 3 0 0 6 0 3 0 0 0 0 0

SOG 42 21 9 9 12 11 6 7 8 5 2 3 2 2 4 2 1 1 1 0 0 0 0 3 0 0 0 0 0 0 0

FC 55 16 18 13 10 50 16 21 9 6 0 30 22 14 17 29 26 22 30 11 1 0 1 2 0 11 0 0 0 0 0

FS 54 34 59 9 14 39 16 12 3 3 5 13 6 9 15 9 17 8 16 5 1 5 1 3 0 6 0 0 0 0 0

OFF 17 6 9 1 2 0 11 9 6 5 0 3 0 0 0 9 0 1 1 0 1 0 1 3 0 0 0 0 0 0 0

CK 8 3 66 0 8 5 0 8 0 0 0 27 31 0 0 0 0 1 0 7 0 0 0 0 0 0 0 0 0 0 0

C 7 3 2 2 1 7 3 2 0 0 0 4 5 2 2 2 3 5 4 5 0 0 0 0 0 3 0 0 0 0 0

E 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0

50 29

442 424

151 145

430 408

408 430

85 64

164 169

62 59

2 6

GAME-WINNING GOALS: Fredy Montero 5, Lamar Neagle 3, Alvaro Fernandez 3, Mauro Rosales 2 Steve Zakuani 1, Jeff Parke 1, Roger Levesque 1, Mike Fucito 1 Osvaldo Alonso 1 GAME-WINNING ASSISTS: Mauro Rosales 5, Brad Evans 4, O'Brian White 2, Tyson Wahl 2, James Riley 2 Fredy Montero 2, Lamar Neagle 1, Roger Levesque 1, Nate Jaqua 1, Leo Gonzalez 1 Mike Fucito 1 PENALTY KICK GOALS/ATTEMPTS: Brad Evans 3-3, Mauro Rosales 1-2, Alvaro Fernandez 1-2, Fredy Montero 0-1 Osvaldo Alonso 1-1 SEATTLE SOUNDERS FC INDIVIDUAL GOALKEEPING UNF POS GOALKEEPER GP GS 18 G Kasey Keller 34 34 Team totals 34 34 Opponent totals 34 34

MIN 3060 3060 3060

SHTS SV 145 110 145 110 151 92

GA 37 37 56

GAA 1.09 1.09 1.65

PG 3 3 6

PA 4 4 9

W 18 18 7

L 7 7 18

* = Played with other teams in 2011. Only Seattle Sounders FC statistics listed here.

123

T 9 9 9

SO 9 9 7

SEATTLE SOUNDERS FC  SEATTLE SOUNDERS FC 2011 SCHEDULE DAY Tue. Sat. Fri. Sat. Sat. Sat. Fri. Sat. Wed. Sat. Sat. Sat. Wed. Sat. Sat. Sat. Sat. Thu.

DATE Mar. Mar. Mar. Apr. Apr. Apr. Apr. Apr. May May May May May May June June June June

15 19 25 2 9 16 22 30 4 7 14 21 25 28 4 11 18 23

OPPONENT Los Angeles at New York Houston at San Jose Chicago at Philadelphia at Colorado Toronto FC at D.C. United at Columbus Portland Sporting KC FC Dallas at Real Salt Lake at Chicago Vancouver at Toronto FC New York

RESULT L 0-1 L 0-1 T 1-1 T 2-2 W 2-1 T 1-1 W 1-0 W 3-0 L 1-2 T 1-1 T 1-1 W 1-0 L 0-1 W 2-1 T 0-0 T 2-2 W 1-0 W 4-2

ATT. 36,433 20,982 36,204 10,276 36,233 15,149 14,185 36,287 11,254 7,148 36,593 36,098 36,026 14,674 13,839 36,502 21,839 46,065

Sun. June Mon. July Sun. July

26 New England 4 at Los Angeles 10 at Portland

W 2-1 T 0-0 W 3-2

36,212 27,000 18,627

Sat. July

16 Colorado

W 4-3

36,424

Sat. Sat. Sat. Sat. Sat.

July Aug. Aug. Aug. Aug.

30 6 13 20 27

at Houston at Sporting KC Chivas USA at FC Dallas Columbus

L W T W W

1-3 2-1 0-0 1-0 6-2

18,465 17,493 36,364 11,635 36,364

Sat. Sat. Sat. Sat. Sat. Sat. Sat.

Sept. Sept. Sept. Oct. Oct. Oct. Oct.

10 17 24 1 8 15 22

Real Salt Lake D.C. United at Vancouver at New England Philadelphia San Jose at Chivas USA

L W W W L W W

1-2 3-0 3-1 2-1 0-2 2-1 3-1

35,940 36,242 21,000 21,022 36,304 64,140 22,137

W-L-T POS. PTS GOALS: 0-1-0 T2 0 LA: Juninho (58) 0-2-0 T6 0 NY: Agudelo (70) 0-2-1 0 1 SEA: Zakuani (80); HOU: Cameron (42) 0-2-2 6 2 SEA: Evans (17) White (42); SJ: Dawkins (32) Stephenson (52) 1-2-2 T4 5 SEA: White (7) Zakuani (25); CHI: Chaves (8) 1-2-3 0 6 SEA: Fernandez (90); PHI: Ruiz (32) 2-2-3 0 9 SEA: Montero (19) 3-2-3 T2 12 SEA: Fernandez (9) Evans (52,75) 3-3-3 T4 12 SEA: Evans (71); DC: Wolff (31) Davies (52) 3-3-4 T4 13 SEA: Montero (7); CLB: Renteria (67) 3-3-5 T5 14 SEA: Fernandez (52); POR: Danso (65) 4-3-5 T2 17 SEA: Parke (90) 4-4-5 T3 17 DAL: Shea (18) 5-4-5 3 20 SEA: Ianni (72) Neagle (84); RSL: Gonzalez (87) 5-4-6 3 21 5-4-7 T3 22 SEA: Rosales (81) Alonso (84); VAN: Hassli (29,85) 6-4-7 5 25 SEA: Montero (90) 7-4-7 T2 28 SEA: Friberg (11) Alonso (12) Levesque (67,78); NY: Richards (31) own goal (58) 8-4-7 T2 31 SEA: Wahl (34) Fernandez (40); NE: Nyassi (3) 8-4-8 3 32 9-4-8 4 35 SEA: Montero (57,74) Alonso (83); POR: own goal (46) Perlaza (69) 10-4-8 2 38 SEA: Fernandez (7) Levesque (48) Montero (82) Rosales (84); COL: Thompson (1) Larentowicz (43) Folan (90) 10-5-8 3 38 SEA: Fernandez (37); HOU: Clark (7) Ching (23,70) 11-5-8 3 41 SEA: Rosales (90) Neagle (90); KC: Kamara (20) 11-5-9 3 42 12-5-9 2 45 SEA: Rosales (16) 13-5-9 2 48 SEA: Neagle (4,21,70) Rosales (16) Fucito (40) own goal (74); CLB: Cunningham (59) Gardner (73) 13-6-9 2 48 SEA: Montero (45); RSL: own goal (12) Saborio (56) 14-6-9 2 51 SEA: Fucito (35) Fernandez (45,60) 15-6-9 2 54 SEA: Evans (33) Montero (63,67); VAN: Camilo (22) 16-6-9 2 57 SEA: Montero (36,47); NE: Fagundez (35) 16-7-9 2 57 PHI: Adu (60) Carroll (70) 17-7-9 2 60 SEA: Ochoa (82) Montero (87); SJ: Wondolowski (24) 18-7-9 2 63 SEA: own goal (53) Fernandez (68) Ochoa (73); CHV: Estupinan (83)

124

Player

Mike Fucito Brad Evans Patrick Ianni Tyson Wahl Osvaldo Alonso James Riley Erik Friberg Blaise Nkufo Mauro Rosales Steve Zakuani Leo Gonzalez O'Brian White Michael Tetteh Alvaro Fernandez David Estrada Fredy Montero Kasey Keller Sammy Ochoa Zach Scott Nate Jaqua Mike Seamon Servando Carrasco Roger Levesque Pat Noonan Taylor Graham Lamar Neagle Terry Boss Josh Ford Amadou Sanyang Jeff Parke Miguel Montano Jhon Kennedy Hurtado Bryan Meredith 90M 74M 90M 9M 66D 8 67F 90F 90D

15 16 17 18 19 20 21 CHI VAN TOR NY NE LA POR 0-0 2-2 1-0 4-2 2-1 0-0 3-2 81F 65F 69F 58F 90M 90M 71M 29 73 33 90D 90D 90D 90D 90D 90D 90M 90M 90M 90M 90M 90M 90D 90D 90D 90D 90D 90D 90D 7 19 90M 90M 90M 90M

22 23 24 25 26 27 28 29 COL HOU KC CHV DAL CLB RSL DC 4-3 1-3 2-1 0-0 1-0 6-2 1-2 3-0 12 35 78F 78F 73F 68F 27 82M 90D 90D 90D 90D 90D 90D 90D 90M 90M 90M 90M 90M 90M 90M 90D 90D 90D 90D 90D 90D 90M 90M 63M 90M 31M 17 90D 90D 90M 90D 73M

SEATTLE SOUNDERS FC 

13 14 DAL RSL 0-1 2-1 90F 70F 90M 90D 90D 90M 90M 90D 90M 80M

9 23

90D

18 32

90D 9

1

1

33

90M 90M 90F 90F 90F 90F 57F 68F 21 19 1 23 35 69F 12

90D 90D 90D 15 21 12

90D

67M 83M 90M 90M 89F 89M 90M 90M 90M 90M 90M 90M 71M 90M 90M

38

10

90D 15 90F 54F 31

90D

69M 83M

9 10 11 12 DC CLB POR KC 1-2 1-1 1-1 1-0 6 21 42M 90D 90D 1 90D 90D 90M 90M 90M 90D 90D 90D 66M 90M 90D 90D 90M 59D 90M 31 14

79F 35

90M 90M 55M 90F 48 90F 26

72F 64F 24

1 2 3 4 5 6 7 8 LA NY HOU SJ CHI PHI COL TOR 0-1 0-1 1-1 2-2 2-1 1-1 1-0 3-0 23 90M 90D 90D 90M 90D 80M 64M 90M 90D 81F

23

26

59

12

30 VAN 3-1

90M

90M

90D

31 32 NE PHI 2-1 0-2 22 68F 90M 90D 45 90D 90D 11 90M 90D 79M 90M

90M 90D

62F

63M 68M 45 12 73 90M 76M 89M 90M 90M 64M 18M 21 72M 69M 71M 66M 71M 78M 55M 90M 22 19 65M 90M 79M 45M 7 11 90M 90F 90F 90F 24 90F 67F 90F 84F 90F 89F 75F 20 36 90F 90F 81F 61F 89F 89F 67F 55F 83F 68F 90F 90F 78F 90F 68F 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 90G 24 28 90D 90D 90D 22 66F 90F 22 26

9

10 18

90M

1

24

19

22

7

17

90M 90M 25

90M 45

33 SJ 2-1 64F 90M 90D 90D 90M 90D

10M

9 90M 90D

34 CHV 3-1 64F 90M

26

81D

68M 90M

90F 90F 90G 90G 22 26 1

90D

80

79M 17

90M 59M 52M

27

72

90M 89M

7

11

11

1

11

90D 90D 90D

45D

8 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 17D 90D 90D 90D 90D 90D 90D 90D 75D 90D 90D 90D 6 25 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 90D 49D 90D 90D 57D 90D 90D 39D 90D

90D 29 24

22 19 83M 84M 90M 90M 90D 90D 90D 90D 79F 73F 61F 66F

71M 90M 90M 90M 90M 90D 90D 90D 90D 90M 90M 90M 90M 90M 90M 90M 90D 90D 90D 90D 90D 90D 90M 90M 90M 45M 90M 78M 16

SEATTLE SOUNDERS FC – GAME-BY-GAME #

2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35 "00" = 100 minutes played F/M/D/G = starting position

125

Game Game Game Game Game

Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game Game

#28 #29 #30 #31 #32 #33 #34

#23 #24 #25 #26 #27

#1 #2 #3 #4 #5 #6 #7 #8 #9 #10 #11 #12 #13 #14 #15 #16 #17 #18 #19 #20 #21 #22

09/10/2011 09/17/2011 09/24/2011 10/01/2011 10/08/2011 10/15/2011 10/22/2011

07/30/2011 08/06/2011 08/13/2011 08/20/2011 08/27/2011

03/15/2011 03/19/2011 03/25/2011 04/02/2011 04/09/2011 04/16/2011 04/22/2011 04/30/2011 05/04/2011 05/07/2011 05/14/2011 05/21/2011 05/25/2011 05/28/2011 06/04/2011 06/11/2011 06/18/2011 06/23/2011 06/26/2011 07/04/2011 07/10/2011 07/16/2011

SEA SEA SEA SEA SEA SEA SEA

SEA SEA SEA SEA SEA

SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA SEA

1 3 3 2 0 2 3

1 2 0 1 6

0 0 1 2 2 1 1 3 1 1 1 1 0 2 0 2 1 4 2 0 3 4

vs vs at at vs vs at

at at vs at vs

vs at vs at vs at at vs at at vs vs vs at at vs at vs vs at at vs

RSL 2 DC 0 VAN 1 NE 1 PHI 2 SJ 1 CHV 1

HOU 3 KC 1 CHV 0 DAL 0 CLB 2

LA 1 NY 1 HOU 1 SJ 2 CHI 1 PHI 1 COL 0 TOR 0 DC 2 CLB 1 POR 1 KC 0 DAL 1 RSL 1 CHI 0 VAN 2 TOR 0 NY 2 NE 1 LA 0 POR 2 COL 3

L W W W L W W

L W T W W

L L T T W T W W L T T W L W T T W W W T W W

SEATTLE SOUNDERS FC 

72; Neagle 1 (Wahl 2)

84

52; Evans 3 (penalty kick)

(free kick) 57; Montero 5 (Rosales 5, Neagle 1) 74; Alonso 3 (penalty kick) 83 5 (Alonso 1) 7; Levesque 3 (Rosales 6, Alonso 2) 48; Montero 6 (unassisted) 82; (Montero 5) 84 6 (penalty kick) 37 (unassisted) 90; Neagle 2 (Fucito 1, Rosales 7) 92+

Ochoa 1 (Rosales 13) 82; Montero 12 (Neagle 2, Evans 4) 87 own goal (Boyens) 53; Fernandez 9 (Evans 5) 68; Ochoa 2 (Montero 9)

73

75

Rosales 4 (Montero 6) 16 Neagle 3 (Fucito 2) 4; Rosales 5 (penalty kick) 16; Neagle 4 (Riley 2, Rosales 8) 21; Fucito 1 (Rosales 9, Montero 7) 40; Neagle 5 (Alonso 3) 70; own goal (Gardner) 74 Montero 7 (Rosales 10) 47+ Fucito 2 (Rosales 11, Evans 2) 35; Fernandez 7 (Rosales 12, Montero 8) 47+; Fernandez 8 (unassisted) Evans 5 (penalty kick) 33; Montero 8 (unassisted) 63; Montero 9 (Evans 3) 67 Montero 10 (unassisted) 36; Montero 11 (Jaqua 2) 47

Montero 4 Fernandez Rosales 2 Fernandez Rosales 3

Rosales 1 (unassisted) 81; Alonso 1 (unassisted) 84 Montero 3 (free kick) 90 Friberg 1 (unassisted) 11; Alonso 2 (unassisted) 12; Levesque 1 (Gonzalez 1) 67; Levesque 2 (unassisted) 78 Wahl 1 (unassisted) 34; Fernandez 4 (Levesque 2, Rosales 4) 40

Ianni 1 (Montero 4, Jaqua 1)

Zakuani 1 (unassisted) 80 Evans 1 (Rosales 1, Friberg 1) 17; White 1 (Zakuani 1) 42 White 2 (Rosales 2) 7; Zakuani 2 (White 1) 25 Fernandez 1 (Montero 1, Zakuani 2) 91+ Montero 1 (Rosales 3, White 2) 19 Fernandez 2 (Evans 1, Riley 1) 9; Evans 2 (Montero 2, Hurtado 1) Evans 4 (penalty kick) 71 Montero 2 (Friberg 2) 7 Fernandez 3 (Montero 3, Levesque 1) 52 Parke 1 (Wahl 1) 93+

SEATTLE SOUNDERS FC – GAME-BY-GAME LOG

Game Game Game Game Game Game Game

60

126

Player

90M 1

PRd1 SFFC 0-1 31

120M 120D 112M 27

90D

14

90D 25 90D

90D

1

90D

34

90D

GrpD HERE 0-1

90F 90G 24 90D 1

90M

74M

90D 90M

GrpD COMU 2-2 66F

74F 90D

79M 90F

23 90D 90M 90D 90M

GrpD MTRY 1-2 16

SEATTLE SOUNDERS FC 

90M 90D 75M 120M 75D

CONCACAF CHAMPIONS LEAGUE PRnd2 GrpD GrpD GrpD SFFC COMU MTRY HERE 2-0 4-1 1-0 2-1 90F 90M 90M 84D 90D

90M 120D

90M

90D

90D

76M

90M 90D 45

F CHI 2-0 89F 90M

SEATTLE SOUNDERS FC –CUP COMPETITIONS – GAME-BY-GAME #

90D 90M 26 90M 90D

90M

90D

111M

90D

31

84M

45M

90M

63F

34 90G 16 74D 90F

16 90M

90M 56M 90F

11

90M 89M 17

89M

90G

90M

83M

56M

90D

67D

7

90D

90D 90D

90D 73F

90F 90G

120F 120G

90F 90G

90F 90G

89F 90G

6 90D

90G

90M 84M 90F

90D 65F

15

90D

55M 90G

90M 6

120D 52

68F

8 59M 15

120D

1

79F

66F

90D

9

90D

6

90D

59M

90D

19 64M 90M 90G

90D

Alonso 44; Alonso 89 Montero 42

Fernandez (Gonzalez) 41; Jaqua (Fernandez) 98 Evans (Fucito) 35; Fucito (Montero) 61; Fucito (Fernandez) 67; own goal (Gomez) 87 Fernandez (Noonan) 38 Montero (Jaqua) 3; Montero (Levesque) 54

Fucito (Jaqua) 39; Fucito (unassisted) 62 Jaqua (Noonan) 4; Montero (Jaqua) 25; Neagle (Fernandez) 74 Montero (Fernandez) 40 Montero (Parke) 78; Alonso (unassisted) 96+

90D

L W W W W L T W

90D

90M

90D 71F

W W W W

U.S. OPEN CUP R16 QF SF KTSP LA DAL 2-1 3-1 1-0 68F 11 24 90M

90M

90D 90D 54M

90D 90F 85M 5 36 90D 90G

22 90M

KITSAP 1 LA 1 DAL 0 CHI 0

Mike Fucito Brad Evans Patrick Ianni Tyson Wahl Osvaldo Alonso James Riley Erik Friberg Blaise Nkufo Mauro Rosales Steve Zakuani Leo Gonzalez O'Brian White Michael Tetteh Alvaro Fernandez David Estrada Fredy Montero Kasey Keller Sammy Ochoa Zach Scott Nate Jaqua Mike Seamon Servando Carrasco Roger Levesque Pat Noonan Taylor Graham Lamar Neagle Terry Boss Josh Ford Amadou Sanyang Jeff Parke Miguel Montano Jhon Kennedy Hurtado Bryan Meredith

vs vs vs vs

2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35

2 3 1 2

SNFRAN SNFRAN COMUNC MONTRY HERDNO HERDNO COMUNC MONTRY

SEA SEA SEA SEA

at vs vs at at vs at vs

CUP 06/28/2011 07/13/2011 08/30/2011 10/04/2011

U.S. OPEN R16 QF SF F

0 2 4 1 2 0 2 1

1 0 (OT) 1 0 1 1 2 2

CONCACAF CHAMPIONS LEAGUE PRnd1 07/26/2011 SEA PRnd2 08/03/2011 SEA GrpD 08/16/2011 SEA GrpD 08/23/2011 SEA GrpD 09/14/2011 SEA GrpD 09/20/2011 SEA GrpD 09/27/2011 SEA GrpD 10/18/2011 SEA

127

SEATTLE SOUNDERS FC GAME NOTES MLS CUP PLAYOFFS: SOUNDERS FC AT REAL SALT LAKE OCTOBER 29, 2011, 7:00 PM PT

2 0 11 S O U N D E R S F C S C H E D U L E

SOUNDERS FC

R E A L S ALT L AKE

2011 ALL COMPETITIONS RECORD: 26-10-10 (Home: 15-6-4 Away: 11-4-6) 2011 MLS RECORD: 18-7-9 (63 pts.) (Home: 9-4-4 Away: 9-3-5) DAY Tue. Sat. Fri. Sat. Sat. Sat. Fri. Sat. Wed. Sat. Sat. Sat. Wed. Sat. Sat. Sat. Sat. Thr. Sun. Tues. Mon. Sun. Weds. Sat. Wed. Tues. Sat. Wed. Sat. Sat. Tues. Sat. Tues. Sat. Tues. Sat. Weds. Sat. Tues. Sat. Tues. Sat. Tues. Sat. Sat. Tues. Sat. Sat. Wed.

DATE 3/15 3/19 3/25 4/2 4/9 4/16 4/22 4/30 5/4 5/7 5/14 5/21 5/25 5/28 6/4 6/11 6/18 6/23 6/26 6/28 7/4 7/10 7/13 7/16 7/20 7/26 7/30 8/3 8/6 8/13 8/16 8/20 8/23 8/27 8/30 9/10 9/14 9/17 9/20 9/24 9/27 10/1 10/4 10/8 10/15 10/18 10/22 10/29 11/2

OPPONENT TIME (PT)/RESULT TV LOS ANGELES L /0-1 ESPN/ESPN Deportes at New York L / 0-1 KONG HOUSTON D / 1-1 FOX Soccer at San Jose D / 2-2 KING/THIS-TV CHICAGO W / 2-1 KING/THIS-TV at Philadelphia D / 1-1 KONG/THIS-TV at Colorado W / 1-0 FOX Soccer TORONTO FC W / 3-0 KONG at D.C. United L /1-2 KONG* at Columbus D / 1-1 KONG/THIS-TV PORTLAND D / 1-1 ESPN2/ESPN Deportes KANSAS CITY W / 1-0 KONG FC DALLAS L / 0-1 KONG* at Real Salt Lake W / 2-1 KONG/THIS-TV at Chicago D / 0-0 KONG* VANCOUVER D / 2-2 FOX Soccer at Toronto FC W / 1-0 KONG/THIS-TV/TSN2* NEW YORK W / 4-2 ESPN2/ESPN Deportes NEW ENGLAND W / 2-1 KONG KITSAP PUMAS- W / 2-1 at Los Angeles D / 0-0 ESPN2/ESPN Deportes at Portland W / 3-2 ESPN/ESPN Deportes LOS ANGELES- W / 3-1 COLORADO W / 4-3 FOX Soccer FOX Soccer MAN UTD (Friendly) L / 0-7 at San Francisco FC^ L / 0-1 FOX Soccer at Houston L / 1-3 KONG* SAN FRANCISCO FC^ W / 2-0 FOX Soccer at Kansas City W / 2-1 KONG CHIVAS USA D / 0-0 KING/THIS-TV* COMUNICACIONES^ W / 4-1 FOX Soccer at FC Dallas W / 1-0 KONG/THIS-TV* at Monterrey^ W / 1-0 FOX Soccer COLUMBUS W / 6-2 KONG* FC DALLASW / 1-0 REAL SALT LAKE L / 1-2 KING at Herediano^ W / 2-1 FOX Soccer D.C. UNITED W / 3-0 KONG HEREDIANO^ L / 0-1 FOX Soccer at Vancouver W / 3-1 KONG/THIS-TV/TSN at Comunicaciones^ D / 2-2 FOX Soccer at New England W / 2-1 KING CHICAGOW / 2-0 FOX Soccer PHILADELPHIA L / 0-2 KING/THIS-TV SAN JOSE W / 2-1 FOX Soccer MONTERREY^ L / 1-2 FOX Soccer at Chivas USA W / 3-1 KONG at Real Salt Lake 7:00 p.m. FOX Soccer REAL SALT LAKE 7:00 p.m. ESPN2

- U.S. Open Cup ^ CONCACAF Champions League * Simulcast live outside of Seattle on ROOT Sports

AT

18-7-9, 63

PTS.

1 5 - 11 - 8 , 5 3

PTS.

M AT C H I N F O R M AT I O N MLS Cup Playoffs: Western Conference Semifinals - First Leg Date: October 29, 2011 Kickoff: 7:00 p.m. PT Location: Rio Tinto Stadium, Sandy, Utah Referee: Mark Geiger Referee’s Assistants: Joe Fletcher; Steven Taylor Fourth Official: Silviu Petrescu National TV: FOX Soccer Local Radio: KIRO 97.3 FM Talent: Arlo White Pregame Talent: Matt Johnson with Alan Hinton and Pete Fewing Spanish Radio: La Gran D 99.3 FM Talent: Rene Aleman, Victor Hernandez and Noe Menendez Sounders FC PR Contacts: Frank MacDonald (o: 425-203-8310, c: 425-457-0701) FrankM@SoundersFC.com Suzanne Lavender (o: 425-203-8024, c: 206-730-7549) SuzanneL@SeahawksSoundersFC.com Mike Ferris (o: 425-203-8313, c: 425-457-9001) MikeFe@SoundersFC.com Real Salt Lake PR Contacts: Trey Fitz-Gerald (o: 801-727-2717, c: 801-856-8877) TFitz@RealSaltLake.com John Koluder (o: 801-727-2716, c: 801-918-5050) JKoluder@RealSaltLake.com

SOUNDERS FC PROBABLE LINEUP

12

15 Fernandez

Gonzalez

2

34 18

Fucito

Hurtado

6

Keller

3

Alonso

Evans

31 17

Parke

Montero

24 7

Levesque

Riley

RESERVES GOALKEEPERS

DEFENDERS

MIDFIELDERS

FORWARDS

28 - Boss* 29 - Ford 35 - Meredith

4 - Ianni 5 - Wahl 14 - Tetteh 20 - Scott 26 - Graham

8 - Friberg 10 - Rosales 11 - Zakuani* 16 - Estrada 22 - Seamon* 23 - Carrasco 27 - Neagle 30 - Sanyang 32 - Montano^

13 - White 19 - Ochoa 21 - Jaqua 25 - Noonan

^Out on Loan *Disabled List

SOUNDERS FC ALPHABETICAL ROSTER No. 6 28 23 16 3 15 29 8 2 12 26 34 4 21 18 24 35 32 17 27 25 19 31 7 10 30 20 22 14 5 13 11

Name Pos. Alonso, Osvaldo M Boss, Terry G Carrasco, Servando M Estrada, David M/F Evans, Brad M Fernandez, Alvaro M Ford, Josh G Friberg, Erik M Fucito, Mike M/F Gonzalez, Leo D Graham, Taylor D Hurtado, Jhon Kennedy D Ianni, Patrick D Jaqua, Nate M/F Keller, Kasey G Levesque, Roger M/F Meredith, Bryan G Montano, Miguel* M Montero, Fredy F Neagle, Lamar M/F Noonan, Pat F Ochoa, Sammy F Parke, Jeff D Riley, James D Rosales, Mauro M Sanyang, Amadou M Scott, Zach D Seamon, Michael M/F Tetteh, Michael D/M Wahl, Tyson D White, O’Brian F Zakuani, Steve M

Ht. 5-11 6-3 5-10 5-8 6-1 6-1 6-0 5-11 5-9 6-1 6-4 6-0 6-1 6-4 6-2 6-2 6-2 5-11 5-9 5-11 6-0 6-0 6-1 5-10 5-8 6-0 5-11 6-1 5-8 6-2 6-1 6-0

Wt. 165 205 170 160 160 159 175 154 165 174 190 183 175 205 190 174 195 150 160 160 170 190 185 150 139 165 175 175 155 185 180 160

DOB 11/11/85 9/1/81 8/13/88 2/4/88 4/20/85 10/11/85 11/6/87 2/10/86 3/29/86 11/21/80 6/3/80 5/16/84 6/15/85 10/28/81 11/29/69 1/22/81 8/2/89 6/25/91 7/26/87 5/7/87 8/2/80 9/4/86 3/23/82 10/27/82 2/24/81 8/1/1991 7/2/80 8/30/88 1/16/89 2/23/84 12/14/85 2/9/88

Hometown San Cristobal, Cuba Philomath, Ore. Tijuana, Mex. Salinas, Calif. Phoenix, Ariz. Soriano, Uruguay Liverpool, N.Y. Goteberg, Sweden Westford, Mass. San Jose, Costa Rica Fair Oaks, Calif. Palmira, Colo. Lodi, Calif. Eugene, Ore. Olympia, Wash. Falmouth, Maine Scotch Plains, N.J. Palmira, Colo. Barranquilla, Colo. Federal Way, Wash. Ballwin, Missouri Riverside, Calif. Downingtown, Penn. Colorado Springs, Col. Villa Maria, Argentina Banjul, Gambia Haiku, Hawaii Rahway, N.J. Accra, Ghana Newport Beach, Calif. Ocho Rios, Jamaica London, England

Last Club Charleston (USL) New York California (NCAA) UCLA (NCAA) Columbus Universidad de Chile (Chile) Connecticut (NCAA) BK Hacken (Sweden) Harvard (NCAA) Liberia Mia (Costa Rica) Seattle (USL) Deportivo Cali (Colombia) Houston Houston Fulham (England) Seattle (USL) Kitsap (USL PDL) Quilmes (Argentina) Deportivo Cali (Colombia) IFK Mariehamn (Finland) Colorado Estudiantes Tecos (Mexico) New York San Jose River Plate (Argentina) Toronto FC Seattle (USL) Villanova (NCAA) UC Santa Barbara (NCAA) Kansas City Toronto Akron (NCAA)

SOUNDERS FC NUMERICAL ROSTER No. 2 3 4 5 6 7 8 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35

Name Mike Fucito Brad Evans Patrick Ianni Tyson Wahl Osvaldo Alonso James Riley Erik Friberg Mauro Rosales Steve Zakuani Leo Gonzalez O’Brian White Michael Tetteh Alvaro Fernandez David Estrada Fredy Montero Kasey Keller Sammy Ochoa Zach Scott Nate Jaqua Michael Seamon Servando Carrasco Roger Levesque Pat Noonan Taylor Graham Lamar Neagle Terry Boss Josh Ford Amadou Sanyang Jeff Parke Miguel Montano* Jhon Kennedy Hurtado Bryan Meredith

Pos. M/F M D D M D M M M D F D/M M M/F F G F D M/F M/F M M/F F D M/F G G M D M D G

Head Coach: Sigi Schmid Assistant Coach: Brian Schmetzer Assistant Coach: Ezra Hendrickson *Out on loan

Ht. 5-9 6-1 6-1 6-2 5-11 5-10 5-11 5-8 6-0 6-1 6-1 5-8 6-1 5-8 5-9 6-2 6-0 5-11 6-4 6-1 5-10 6-2 6-0 6-4 5-11 6-3 6-0 6-0 6-1 5-11 6-0 6-2

Wt. 165 160 175 185 165 150 154 139 160 174 180 155 159 160 160 190 190 175 205 175 170 174 170 190 160 205 175 165 185 150 183 195

DOB 3/29/86 4/20/85 6/15/85 2/23/84 11/11/85 10/27/82 2/10/86 2/24/81 2/9/88 11/21/80 12/14/85 1/16/89 10/11/85 2/4/88 7/26/87 11/29/69 9/4/86 7/2/80 10/28/81 8/30/88 8/13/88 1/22/81 8/2/80 6/3/80 5/7/87 9/1/81 11/6/87 8/1/1991 3/23/82 6/25/91 5/16/84 8/2/89

Pronunciation few-SEE-toe ee-AWN-ee WALL ahs-VAHL-doe FREE-burg MOU-ro Roh-SAH-les

zak-uh-WAH-nee TETT-tay AHL-bah-ro mon-TARE-oh

JAKE-wuh sir-VAWN-dough cuh-ROSS-coh luh-VECK

NAY-gull Ah-ma-DOO SAN-yang PARK mon-TAN-yo JON her-TOD-oh

Goalkeeper Coach: Tom Dutra Fitness Coach: David Tenney Scout/Assistant Coach: Kurt Schmid

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT M L S S T A N D I N G S ( 2 0 11 R E G U L A R S E A S O N ) Western Conference LA Galaxy Seattle Sounders FC Real Salt Lake FC Dallas Colorado Rapids Portland Timbers San Jose Earthquakes Chivas USA Vancouver Whitecaps FC

W-L-D, P 19-5-10, 67 18-7-9, 63 15-11-8, 53 15-12-7, 52 12-9-13, 49 11-14-9, 42 8-12-14, 38 8-14-12, 36 6-18-10, 28

Eastern Conference Sporting Kansas City Houston Dynamo Philadelphia Union Columbus Crew New York Red Bulls Chicago Fire D.C. United Toronto FC New England Revolution

W-L-D, P 13-9-12, 51 12-9-13, 49 11-8-15, 48 13-13-8, 47 10-8-16, 46 9-9-16, 43 9-13-12, 39 6-13-15, 33 5-16-13, 28

TEAM VITALS (2011 REGULAR SEASON)

Overall: 18-7-9 Last 5: WWLWW Home: 9-4-4 Away: 9-3-5 vs. East: 10-4-4 vs. West: 8-3-5 Goals For: 56 Goals Against: 37 +/-: 19

Overall: 15-11-8 Last 5: LLLTT Home: 10-3-4 Away: 5-8-4 vs. East: 6-7-5 vs. West: 9-4-3 Goals For: 44 Goals Against: 36 +/-: 8

HEAD COACHES (REGULAR SEASON) Years Coaching in MLS Career MLS Record Year with Team Record With Team Record vs. Opponent Head-to-Head

Sigi Schmid 12 157-110-83 3 44-24-26 5-4-3 4-3-3

Jason Kreis 5 57-50-43 5 57-50-43 2-2-2 3-4-3

T E A M C A T E G O R I E S ( 2 0 11 R E G U L A R S E A S O N ) Games Goals Scored Goals Avg. Goals Allowed Per Game Goal Differential Shots Shots on Goal Fouls Suffered Fouls Committed Yellow Card Cautions

SEA 34 56 (1st) 1.65 (1st) 1.09 (4th) 19 (2nd) 442 (6th) 151 (T-5th) 408 (10th) 430 (4th) 62 (3rd)

RSL 34 44 (T-8th) 1.29 (T-8th) 1.06 (3rd) 8 (T-4th) 429 (9th) 153 (T-3rd) 411 (9th) 443 (3rd) 56 (T-5th)

I N D I V I D U A L L E A D E R S (2011 R E G U L A R S E A S O N ) Goals Assists Shots Shots on Goal Game-Winning Goals Game-Winning Assists Fouls Suffered

SEA Montero (12; T-5th) Rosales (13; 3rd) Montero (108; 3rd) Montero (42; 3rd) Montero (5; T-1st) Rosales (5; 4th) Rosales (59; 5th)

RSL Saborio (T-9th) Beckerman (9; T-5th) Saborio (66) Espindola (31; T-8th) Saborio (4; T-5th) Beckerman (6; T-2nd) Williams (45)

Fouls Committed Yellow Card Cautions

Montero (55; 4th) Alonso (7; T-9th)

Saborio (43) 3 players (6)

G O A L K E E P E R L E A D E R S (2011 R E G U L A R S E A S O N ) Minutes Played Goals Against Average Wins Shutouts Saves

SEA Keller (3060; T-1st) Keller (1.09; T-5th) Keller (18; 1st) Keller (9; T-2nd) Keller (110; 3rd)

RSL Rimando (2970; T-4th) Rimando (1.09; T-5th) Rimando (14; 3rd) Rimando (13; T-1st) Rimando (95; 7th)

R ACE

FOR

MLS C UP B EGINS

IN

S ALT L AKE

A season consisting of three very successful campaigns for Seattle Sounders FC funnels down to a focus upon a single purpose. This week Sounders FC begin the quest for MLS Cup 2011 when their Western Conference Semifinal series versus Real Salt Lake opens on Saturday night. The first leg of the two-match, aggregate goals series will be played at Rio Tinto Stadium in Sandy, Utah. First kick is 7 p.m. PT and the match is being broadcast live on FOX Soccer. Seattle (18-7-9, 63 points) hosts the second leg on Wednesday, November 2 on the Xbox Pitch at CenturyLink Field. Kickoff time is set for 7 p.m. PT. The match will be televised live on ESPN2, ESPN Deportes and ESPN3.com. Seeded second in the West, the Rave Green enter the postseason having won their final two regular season matches and five of the last six. This is the third straight trip to the playoffs for Sounders FC who have yet to advance beyond the first round. The team that scores the most goals in the series advances to the single elimination Western Conference Championship. If the score is tied after 180 minutes, a 30-minute extra time period will be played, followed by kicks from the penalty spot, if necessary. Supporters' Shield winner L.A Galaxy is the West's top seed and will meet either Colorado, New York or Houston in the other Conference Semifinal. The team with the higher seed between the two Conference finalists will host the Conference Championship game on November 6. The MLS Cup 2011 final is November 20 at The Home Depot Center in Carson, Calif. Seattle has succeeded on three fronts in 2011, winning a third straight Lamar Hunt U.S. Open Cup, finishing runner-up to the L.A. Galaxy in the Supporters' Shield race and advancing to the quarterfinal stage of the CONCACAF Champions League. Real Salt Lake (15-11-8, 53 points) settled for draws in the last two outings and went winless in the last six yet still finished with the third-highest point total in MLS. RSL won MLS Cup 2009 in Seattle and returns to the playoffs for the fourth consecutive season. Last spring Real Salt Lake finished as runner-up in the 2010-11 Champions League. Sounders FC and Real split the season series with each side winning on the road. Overall the series is tied, 2-2-2. The Rave Green owned the best road record in MLS at 9-3-5 and snapped Salt Lake's MLS-record 29-match home unbeaten streak with 2-1 victory on May 28. Beginning with that win they went 8-1-2 in the final 11 away games, winning the last five in a row, punctuated by last week's 3-1 verdict at Chivas USA. Arlo White will call the matches on 97.3 KIRO FM. The pregame show begins at 6:30 p.m. PT with Matt Johnson, Alan Hinton and Pete Fewing. La Gran D 99.3 FM will also air the games. Tickets to Sounders FC home matches are available at www.SoundersFC.com or by calling 800-745-3000. Seattle has sold out 49 consecutive MLS regular season and playoff matches.

S O U N D E R S FC I N J U RY R E P O R T Probable: MF Amadou Sanyang (knee sprain) Questionable: MF Mauro Rosales (MCLsprain) Doubtful: GK Josh Ford (knee pain)

Out: GK Terry Boss (concussion) MF Michael Seamon (lateral ankle tendon) MF Steve Zakuani (leg fracture) FW Oâ&#x20AC;&#x2122;Brian White (leg surgery)

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT T HIRD T IME

WITH A

T WIST

This marks the first time that Sounders FC have entered a playoff series as the higher seed, and hopefully that will help push them on to their objective of advancing to the MLS Cup final. Seeded third, Seattle extended Houston to extra time of their 2009 Conference Semifinal. The two teams ended scoreless in Seattle after the first leg. The Dynamo punched through the only goal of the 210-minute series on Bring Ching's volley in the sixth minute of extra time of the second leg. In 2010 Sounders FC surged in the second half of the season to make the playoffs as a No. 4 seed. A long-distance wonder goal from Edson Buddle put the Galaxy in front after the first leg and David Beckham assisted on a air of set-piece scores in the first 27 minutes of the second game. Steve Zakuani netted the only goal in a 3-1 aggregate loss. The West's top seed has advanced to the MLS Cup final only once in the past five years. The No. 2 seed Houston win the MLS Cup final in both 2006 and 2007.

R OAD T ESTED The Rave Green have travelled more than any team in America during the past seven months, and it seems to suit them just fine. They have won their last five MLS away matches and with last week's win at Chivas USA became only the 10th team in league history to win nine (9-3-5) or more on the road. They also emerged undefeated (2-0-1) on the road during CONCACAF Champions League group play, becoming only the second MLS team to win in Mexico. Since their inception Sounders FC have proven solid on the road, going 20-14-13 these past three regular seasons. They ended league-record home unbeaten runs at Columbus (22 matches) in 2009 and Real Salt Lake (29) earlier this season. Altitude doesn't faze them either, having gone 3-0-1 in games at Colorado (elevation 5,164 feet), Salt Lake (4,226), San Jose, Costa Rica (3,839) and Guatemala City (4,921).

A R ICH V EIN

OF

F ORM

Seattle has settled into a groove of goodness since the end of July. It has won 10 (drawn once) of the last 13 encounters with MLS opposition while averaging 2.00 goals per game. Sounders FC finished the season as the top scoring team with 56 goals, averaging 2.17 (37 goals in 17 games) over the second half. They scored three or more goal in eight matches, four of those coming in the final eight. The Rave Green's character has been evident with an unrelenting drive since the loss of top scorers Steve Zakuani and O'Brien White to injury in mid-April. While they are unbeaten (11-0-3) when scoring first, seven of the 18 wins and three draws have come after allowing the first goal. Nine times the tying or winning goal has come in the 83rd minute or later.

C H A M P I O N S L E A G U E U P D AT E All four Mexican clubs were group winners while three MLS teams, including Sounders FC, also qualified for the quarterfinals in the 2011-12 CONCACAF Champions League. Joining Seattle from MLS are the L.A. Galaxy and Toronto FC. Mexican clubs Morelia, Santos, Pumas and defending champion Monterrey will be the top seeds. Rounding out the final eight of next March's knockout round is El Salvador's Metapan.

FREDYâ&#x20AC;&#x2122;S READY Fredy Montero rates as the hottest attacking player among the playoff field. The crafty young Colombian finished the regular season with eight consecutive games contributing either a goal or assist. Montero's ball work on the doorstep of the Chivas goal led to the opening score, a Goats own goal. He assisted on the third goal, skipping a cross into the crease for Sammy Ochoa to head home. Earlier in the week he delivered another beautiful free kick goal versus Monterrey in the final group stage game versus Monterrey. In Montero's last 12 games across all competitions since August 30 he has scored 11 goals, six of them game-winners. He set a club record for MLS total points (33), tying his record of 12 goals and assisting on nine. Each ties him for fifth in the league. He shares the MLS lead in game-winners with five. Altogether he totaled 16 goals and 11 assists in 38 games played.

F L A C O â&#x20AC;&#x2122; S XI Compared to the first two seasons, this time around Sounders FC features a multi-pronged attack. Alvaro Fernandez has emerged as a strike threat during the second half of the season, when he has scored eight of his 11 goals in all competitions. Fernandez scored his ninth MLS goal at Chivas USA. Flaco is among five players-Fredy Montero (12), Mauro Rosales (5), Lamar Neagle (5) and Brad Evans (5)-with five or more goals. In 2009 there were only two players with five or more goals and in 2010 there were three.

O CHOA , A GAIN One of the latest acquisitions for Seattle has already begun paying huge dividends. Sammy Ochoa's diving header at Chivas was his second goal as a substitute in as many matches. Ochoa was signed by MLS and Sounders FC acquired his rights via a trade with Chicago for allocation position. He made his competitive debut on September 20, his first start versus Monterrey last week. He now has a total of seven appearances. Ochoa came on in the second half on October 15 to score his first MLS goal, the equalizer versus San Jose.

K ELLER : F INALLY

A

Q UIET W EEK

A prime objective last week was to impose a defensive clamp-down going into the postseason, and Sounders FC responded by limiting Chivas USA to only two shots on goal (13 total), with Kasey Keller making only one save. It was the lowest SOG allowed in 14 matches and it came as a welcome relief for Keller, who had averaged 5.4 saves over the previous five outings, including a season-high seven versus San Jose. His two-save, two-stop effort in the 65th minute against the Earthquakes earned him his 14th MLS Save of the Week in his three seasons. Keller was also named to the MLS Team of the Week (along with Osvaldo Alonso) and was earlier voted Player of the Week. Keller finished the regular season as the league leader in goalkeeper wins (18), third in saves (110), tied for third in shutouts (9) and fifth in GAA (1.09). He was one of four players to play every (3,060) minute this season (41 games and 3,720 overall) and has started 89 consecutive matches-the longest such streak in MLS. Of Seattle's 128 competitive matches to date, Keller has started 117.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT MORE MASTERFUL MOVES

P OSTSEASON S QUEEZE

For the second time in as many weeks and the eighth time this season, Sigi Schmid's sense for who and when to substitute has proven sublime. Eight minutes after Schmid inserted Sammy Ochoa he scored. Players coming off the bench have combined to score seven goals and add five assists and the result has been a record of 8-0-2 in those matches. Roger Levesque has contributed two goals and one assist as a substitute while Lamar Neagle has two goals plus an assist while Sammy Ochoa has two goals. Fifteen players scored for Seattle in MLS play, and Sounders FC struck for goals 15 times in the final 15 minutes. Schmid is the MLS leader in both postseason (19) and regular season (157) victories, and he is the only coach to lead two different clubs to MLS Cup titles (L.A. in 2002, Columbus in 2008).

With a FIFA international date in the middle of November, all but the cup final has been squeezed into a period of 12 days between Wednesday's first wild card match and the Conference Finals on November 6. However the twice-weekly schedule is nothing new to the Rave Green, who have been operating on that regimen for nine of the last 12 weeks. When an MLS regular season match is preceded by a competitive match four or fewer days prior, Seattle's record is 18-8-2 over the past two seasons and 19-8-8 all-time.Sounders FC have gone 7-1-0 in their last three MLS matches on short rest and 10-2-0 since May.

W I L L S O U N D E R S FC F A N S O U T -D O T H E M S E LV E S ? The two largest crowds for MLS Cup Conference Semifinals or Finals have been produced by Sounders FC fans. However, there might be room for more. In 2009 Seattle attracted 35,807 for its first postseason match and last year, despite playing on Halloween, there was another sellout of 35,521 (the fourth-largest MLS Cup final crowd of 46,011 was also in Seattle in 2009). In 2011 Sounders FC set another season record for attendance, averaging 38,496. In the final home regular season game the crowd of 64,140 was the third-largest crowd for a single match in MLS history. The 2011 Lamar Hunt U.S. Open Cup final attendance of 35,615 set a record for the 98-year-old tournament. Seattle supporters accounted for two of the top three and four of the 13 biggest attendances in the CONCACAF Champions League preliminary and group stage matches.The crowd of 21,233 for the preliminary round win over Panama's San Francisco FC on August 3 was the largest of the tournament.

S O U N D E R S FC C O L L E G E C O M B I N E Sounders FC will hold its third annual invitational combine for top college seniors in Las Vegas from December 16-18.Sigi Schmid and his staff will be on hand to evaluate players. In the first two years of the combine nearly a hundred players have participated with 22 going on to sign MLS contracts. Four members of the current squad-David Estrada, Servando Carrasco, Bryan Meredith and Josh Ford-participated in the first two Sounders FC combines.

MLS S U P E R D R A F T S E T

FOR

J A N U A RY 12

The 2012 MLS SuperDraft presented by adidas has been confirmed for January 12 in Kansas City, Missouri. For the eighth consecutive year it will be held in conjunction with the National Soccer Coaches Association of America (NSCAA) Convention, and take place at the Kansas City Convention Center. The first round of the SuperDraft will be broadcast live on ESPN2 beginning at 9:00 AM PT. This year the MLS SuperDraft will include two rounds and 38 overall selections, with the league's 19th team, the Montreal Impact, selecting first overall. The next eight selections are currently held by clubs that did not qualify for the 2011 MLS Cup Playoffs, in reverse order of regular season finish. The remaining 10 positions currently belong to clubs that were eliminated in the same round of the 2011 MLS Cup Playoffs, in reverse order of regular season finish.

R OSALES S TATUS U NCERTAIN Seattle playmaker Mauro Rosales returned to the starting XI at Chivas USA only to be felled by an opponent's (yellow card) foul in the fifth minute. Rosales left the game on a stretcher after sustaining an injury to the same knee that he suffered a small MCL tear from a foul near the end of the September 17 D.C. United match. He missed the next three league games before returning to spark the comeback versus San Jose on October 15. Rosales set a club record with 13 assists (third in MLS) and added five goals. A candidate for Newcomer of the Year and MVP, he was named to MLSsoccer.com's Team of the Week on seven occasions.

M O N T R E A L E X PA N S I O N D R A F T P R O C E D U R E Major League Soccer will hold the 2012 MLS Expansion Draft via conference call on November 23,2011 at 11 a.m. PT. The League's 19th team, the Montreal Impact, will select 10 players during the 10-round draft. Each current MLS club will have the opportunity to protect 11 players from their 2011 roster. Generation adidas players (who will not graduate at the end of the 2011 season) and Homegrown Players on the team's Off-budget Roster are automatically protected and do not count against each team's 11 protected roster spots. Designated Players do not have to be protected unless the player has a no trade clause in his contract. Clubs must submit their protected roster to MLS on Monday, November 21. The protected rosters will be made public later that day.

THROW-INS With 26 total wins across MLS, Open Cup and the CCL, Sounders FC have equaled the final sum of Chicago in 2000 in all competitions. Four other teams, including the Galaxy this season, have totaled 24 victories...Midfielder Brad Evans finished the regular season with four assists and one goal in his last five matches...Seattle completed the season 10 outright series wins and another two on goal differential. There were two ties and three losses...Sounders FC are now 9-2-0 all-time in October regular season matches...James Riley celebrates his 29th birthday on Thursday, October 27. Nate Jaqua turns 30 on Friday, October 28...Two years ago, on October 24, 2009 Sigi Schmid became the MLS career coaching win leader, getting his 125th with a 2-1 home win over FC Dallas.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

R ECAP : S OUNDERS FC 3

AT

C HIVAS USA 1

Second half goals by Alvaro Fernandez and Sammy Ochoa propelled Sounders FC to a victory in their final regular season game of the season. A Chivas own goal in the 53rd minute broke a scoreless tie and got the momentum going for Seattle. The goal occurred after Fredy Montero played a ball down from Mike Fucito near the left side of the goal and it was inadvertently knocked in the net by retreating Chivas defender Andrew Boyens. In the 68th minute, Fernandez got behind the defense on the left side and received a well-placed pass from Brad Evans and finished in the top right corner of the net for his ninth goal of the season. Then five minutes later in the 73rd, Montero crossed the ball to a sprinting Ochoa, who finished with a diving header past keeper Dan Kennedy. It was the second goal of the season for Ochoa, who substituted in for Fucito in the 64th minute. Roger Levesque was also credited with an assist on the goal. Chivas USA scored in the 83rd minute when Victor Estupinan headed down a bouncing ball in front of the net for a score. Mauro Rosales made his first start since September 17 game against D.C. United when he sprained his MCL. He left the game in the seventh minute after suffering a right knee injury on a foul by Ben Zemanski and was replaced by Roger Levesque. Zemanski was issued a yellow card for the foul. Rosales picked up an assist in Seattle's comeback victory over San Jose on October 15 after entering the game as a substitute.

R E S E R V E S : S O U N D E R S FC 3

AT

C H I VA S USA 3

Pat Noonan scored twice and Lamar Neagle added another goal as Seattle erupted for three early goals before settling for a draw in their final MLS Reserve League match.Sounders FC had clinched the West Division with three games remaining and finished the season with a record of 8-1-1. Michael Seamon assisted on two Sounders FC goals in the first four minutes. Seamon dispossessed an opponent and promptly found Noonan lurking for a header at the far post for the opener. Two minutes later Neagle blasted his team-leading fifth goal of the season, doubling the lead. A cross from Michael Tetteh to Noonan made it 3-nil after 14 minutes. However the Goats (3-3-4) pulled back two goals before the break. In the 34th minute Estupi単an netted his fifth goal in Reserve League play off a corner kick. U18 academy player Ben Spencer struck in the 42nd minute and Greg Vanney's free kick in the 88th minute enabled Chivas to split the points and finish third in the West.

T H E RSL C O N N E C T I O N Both Leo Gonzalez (61 appearances) and Alvaro Saborio (54) began playing for the Costa Rica National Team in 2002. Saborio played for Gonzalez's rival club, Saprissa, for five seasons. Seattle's Mauro Rosales and Salt Lake's Javier Morales, Fabian Espindola and Nelson Gonzalez are from Argentina. Midfielder Collen Warner went to the University of Portland where he played all four seasons for the Pilots. Sigi Schmid coached midfielder Ned Grabavoy for one season at Los Angeles (2004). David Estrada and Tony Beltran played at UCLA together from 2006-07.

S ERIES N OTES Sounders FC is 2-2-2 all-time against Salt Lake in MLS play as both sides earned 2-1 road victories in the 2011 season series. Seattle snapped Salt Lake's MLS record 29-match home unbeaten streak on May 28 as Lamar Neagle scored the winner. Since the last meeting (a 2-1 RSL victory at CenturyLink Field on September 10), Seattle has gone 5-1-0 in league play while Salt Lake has gone 2-4-2. Salt Lake has not won in their past six matches, including a four-match losing streak before picking up draws in their final two regular season contests. Seattle boasts the league's best road record (9-3-5) while Salt Lake has dropped just three games at home this season (10-3-4), having outscored opponents 29-15 at Rio Tinto Stadium. Nine of the 13 goals scored by both teams in the series have come in the final 45 minutes, including all three goals in the final 20 minutes of Seattle's last visit to Salt Lake City. Six different Sounders have scored against RSL. Fredy Montero has two goals and two assists in five starts and Osvaldo Alonso is the only player to record two assists in a single match (3/28/09) in this series. Seattle has been shutout twice in six meetings but has tallied multiple goals on three occasions.

A BOUT S ALT L AKE Real Salt Lake finished the regular season with the thirdhighest point total in MLS (53). They enter the playoffs on a six-game winless streak, including a 1-1 draw last Saturday on a late Portland equalizer. They have scored 22 goals in each half and seem to start quickly with eight goals in the first 15 minutes of each half. They have also scored 10 goals in the final 15 minutes of the game but have allowed nine, the most that they allow in any 15-minute interval. Salt Lake is 15-3-2 when scoring first and have not won (0-8-2) when allowing the first goal (Seattle is 11-0-3 when scoring first). They are 8-3-2 when leading at the half and 0-6-2 when trailing going into the break. RSL ranks in the top ten in nearly every statistical category, including top five in shots on goal (153; 3rd), fouls committed (443; 3rd), offside (115; 4th), corner kicks (165; 4th) and cautions (56; T-5th). Salt Lake has one of the league's stingiest defenses, allowing just 1.06 goals per game (2nd in MLS).

RSL N OTABLES RSL has dealt with injuries to key performers and absences of international players throughout the season but, despite those challenges, the club has managed to finish top three in the league. Kyle Beckerman returns to the RSL lineup after missing the past four games due to suspension and international duty. He is tied fifth in MLS with nine assists, six game-winning (T-2nd). Alvaro Saborio is tied ninth with 11 goals this season, four game-winners (T-5th). Fabian Espindola is second on the club with 10 goals (his career-high) and is tied eighth in MLS with 31 shots on goal. Javier Morales went down with an injury on May 7 and returned to action on September 28. He has played 90 minutes in the past three matches, recording one assist since his return. Midfielder Andy Williams is seventh all-time with nine assists in the MLS Cup Playoffs. He has appeared in 31 matches this season. The backline has remained fairly consistent with the likes of Nat Borchers (30 games started), Jamison Olave (24), Robbie Russell (22) and Chris Wingert (22) helping to create one of the league's top defensive units. Keeper Nick Rimando is tied with Kasey Keller with a 1.09 goals against average (T-5th). Rimando is tied first with 13 shutouts and his 14 wins is third-most.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT MAURO ROSALES BIO #10 MAURO ROSALES Position: Midfielder Height: 5-8 Weight: 160 Born: February 24, 1981 Hometown: Villa Maria, Cordoba, Argentina Citizenship: Argentina Pronunciation: MOU-ro Roh-SAH-les

SAMMY OCHOA BIO #19 SAMMY OCHOA Position: Forward Height: 6-0 Weight: 190 Born: September 4, 1986 Hometown: Riverside, California Citizenship: United States/Mexico How Acquired: Signed on August 26, 2011

How Acquired: Signed on March 18, 2011 Previous Clubs: Estudiantes Tecos (Mexico, 2006-11) Previous Clubs: Newell’s Old Boys (1999-2004), Ajax (2004-07), River Plate (2007-10) • Played past four years for Buenos Aires giants River Plate • Has played nearly 400 matches over all competitions in South America and Europe • Capped 10 times by Argentina and won Olympic gold medal Professional Experience: 2007-10: Played past four years for River Plate. Made 64 appearances, scoring four goals. Won the 2008 Argentine Clausura with River Plate. Scored 39 goals in 234 league matches for Newell’s Old Boys, Ajax and River Plate. 2004-07: Member of two Ajax teams which twice won the Dutch Cup and Dutch Super Cup. Made 63 appearances with six goals. 1999-04: Began career with Newell’s Old Boys, making over 100 appearances with 30 goals. International Experience: Capped 10 times (one goal) by Argentina and was a member of the gold-medal winning team at the 2004 Olympic Games, the 2001 FIFA U20 World Cup and the 2004 Copa America runners-up.

A M A D O U S A N YA N G B I O #30 AMADOU SANYANG Position: Midfielder Height: 6-0 Weight: 165 Born: August 1, 1991 Hometown: Banjul, Gambia Citizenship: Gambia Pronunciation: Ah-ma-DOO SAN-yang How Acquired: Signed on July 31, 2011 Previous Clubs: Real de Banjul (2007-09), Toronto FC (2009-10) • Signed at age 17 by Toronto FC and made debut on 18th birthday (8/1/09) • Won Gambian 1st division championship in 2007 and named the league’s top midfielder • Represented Gambia internationally at the U-17 and U-20 levels Professional Experience: 2009-10: Made 20 appearances with 15 starts in 2 seasons with Toronto. Logged career-high 898 minutes last season. Played 90 minutes against Seattle (8/29/09). 2007-09: Began professional career in 2007 with Real de Banjul. Honored best mdifielder in Gambian League in 2007. International Experience: Made international debut in 2007 with Gambian U-17 team. Also played for U-20.

• Played past five seasons in Mexican first division • Member of Sigi Schmid’s U.S. team at the 2005 FIFA U-20 World Cup • Trained with Sounders FC in June, scoring winner in an MLS Reserve League game Professional Experience: 2006-11: Played past five seasons at Mexico’s Estudiantes Tecos in Guadalajara. Made over 20 appearances for club before signing with MLS on August 24, 2011. International Experience: Member of Sigi Schmid’s U.S. team at the 2005 FIFA U-20 World Cup, making four appearances. Later was part of the U.S. U-23 National Team in the friendlies played prior to the 2008 Olympic Games. Personal: Born in Mexico, Ochoa later moved to Riverside, Calif. and attended Riverside Poly High School. He is a U.S. citizen. Ochoa signed with Tecos in 2006. Jesus Ochoa, Sammy’s older brother, played for Schmid while with the Galaxy. He later played for Chivas USA.

A C A D E M Y U P D AT E The Seattle Sounders FC U16 and U18 academy teams both went 1-0-1 over the weekend, sweeping the San Diego Nomads on Friday night and drawing both games on Sunday against the San Diego Surf. Friday night, the U18's got out to a 3-0 lead and won 5-3 behind two goals from Ian Lange and two assists from Austin Sweeney. Lange scored off a Sweeney corner kick in the second minute, and Sweeney fed Dom Dismuke in the 29th to make it 2-0. The score was 5-1 before the Nomads picked up goals in the 75th and 85th minutes to narrow the gap. The U16's were equally impressive in a 2-0 win on Friday in which they outshot the Nomad U16's 25-4. They got on the board in the 40th minute when Isidro Prado-Huerta scored on a pass from Denis Kalamar. A Jalen Markey penalty made it 2-0 in the 60th minute after Michael Steele was fouled in the box. On Sunday, Sounders FC Academy faced one of their toughest challengers yet in the San Diego Surf. In the second straight game for the U18's, the Sweeney-toLange connection got Sounders FC on the board first, this time in the 26th minute. A Surf penalty in the 80th minute tied the game and forced a 1-1 draw in a game where both teams picked up constant fouls and multiple cautions. The U16 squad tied the Surf 0-0 in another physical, foulridden game.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT LAMAR NEAGLE BIO #27 LAMAR NEAGLE Position: Midfielder/Forward Height: 5-11 Weight: 160 Born: May 7, 1987 College: UNLV Hometown: Federal Way, Washington Citizenship: United States Pronunciation: NAY-gull How Acquired: Signed on March 2, 2011 Previous Clubs: Seattle Sounders FC (2009), Charleston Battery (2010), IFK Mariehamn (Finland, 2010-11) • Scored 12 goals in 19 games for Charleston to earn Golden Boot and MVP honors in USL-2 in 2010 • Three-time Mountain Pacific Sports Federation first team selection at UNLV • Native of nearby Federal Way where he played for Thomas Jefferson High School Professional Experience: 2010-11: Played for the first time internationally in Finland with IFK Mariehamn. Appeared in five league matches, scoring two goals. 2010: Joined the Charleston Battery of USL-2, the third tier of U.S. professional soccer. Scored 12 goals in 19 regular season matches, earning the Golden Boot and MVP honors in USL-2. The Battery went on to win the 2010 USL-2 championship. 2009-10: Signed with Sounders FC on June 10, 2009 but was limited to action in friendlies versus Chelsea and Barcelona. Waived after season and spent 2010 preseason as an invitee. College: Three-time Mountain Pacific Sports Federation first team selection at UNLV. Scored a league-high nine goals as a senior. Earned NCSSA Far-West Regional second-team and first-team honors. Scored two goals 29 seconds apart in 2-1 win at St. Mary’s. Played in every game as a sophomore and led the team with 11 points. Started every game as a freshman. Finished UNLV career ranked ninth in goals with 27 and tied for eighth place with 60 points. High School: Three-year starter for Federal Way’s Thomas Jefferson High School. Led team to state championship as a senior. Broke 31-year-old record by scoring six goals in one game. League and all-area MVP. Personal: Justin Lamar Neagle was born on May 7, 1987 in Tacoma, Wash. Has two brothers, Shedrick (26) and Jamaal (23) and three sisters, Tanisha (22), Daisia (11) and Jasmine (7).

B RYAN M EREDITH B IO #35 BRYAN MEREDITH Position: Goalkeeper Height: 6-2 Weight: 195 Born: August 2, 1989 College: Monmouth Hometown: Scotch Plains, New Jersey Citizenship: United States How Acquired: Selected in second round (29th overall) of 2011 MLS SuperDraft and signed on September 12, 2011 Previous Clubs: Kitsap Pumas (2011) • Starting keeper for 2011 USL PDL champions Kitsap Pumas • Trained with Seattle in 2011 preseason and throughout regular season • Led nation in goals against average (0.306) as a junior at Monmouth Professional Experience: 2011: Started in net for the eventual 2011 USL PDL champions Kitsap Pumas in his first professional season. Trained with Seattle in preseason and throughout regular season. College: A MAC Hermann Trophy Preseason Watch List as a senior, Meredith made 61 appearences with 177 saves, 36 shutouts and just 33 goals allowed in his collegiate career. Earned NSCAA/adidas North Atlantic Region First Team accolades and also named to the All-Northeast Conference Second Team as a senior. Enjoyed one of the finest seasons for a keeper in Monmouth men's soccer history as a junior, leading the nation in goals against average, allowing 0.306 goals per game, while also ranking third in the nation in save percentage, stopping 88.9% of the shots he has faced. Led all NEC keepers in GAA, save percentage, shutouts (12) and shutout percentage (71%). Named to the 2008 NSCAA/adidas NCAA Division I All-North Atlantic Region Third Team as a sophomore. Made collegiate debut as a freshman against Manhattan (9/7/07). High School/Club: Played for Central Jersey PDL from 2001-07 and PDA Academy in 2010. NSCAA/adidas All-American in 2006 while at Scotch Plains-Fanwood H.S. Named NSCAA/adidas AllRegion in 2005. Named first-team all-state goalkeeper in 2004, 2005 and 2006. Holds high school record for shutouts (47). Team won conference titles all four seasons. Sectional champions in 2003. State runner-up in 2004 and 2005. Team won county titles in 2004 and 2005. Personal: Son of Tom and Beth Meredith. Captain of Monmouth University Peer Leader Program.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS REGULAR SEASON STATISTICS UNF POS 17 F 15 M 10 M 3 M 27 M 6 M 24 F 2 F 13 F 11 M 19 F 8 M 5 D 4 D 31 D 21 F 7 D 12 D 34 D 23 M 16 M 18 G 32 M 25 F 30 M 20 D 28 G 29 G 26 D 35 G 14 D

PLAYER GP Fredy Montero 30 Alvaro Fernandez 29 Mauro Rosales 26 Brad Evans 20 Lamar Neagle 23 Osvaldo Alonso 33 Roger Levesque 19 Mike Fucito 19 O'Brian White 7 Steve Zakuani 6 Sammy Ochoa 4 Erik Friberg 26 Tyson Wahl 23 Patrick Ianni 16 Jeff Parke 28 Nate Jaqua 23 James Riley 29 Leo Gonzalez 14 Jhon Kennedy Hurtado 23 Servando Carrasco 12 David Estrada 3 Kasey Keller 34 Miguel Montano 2 Pat Noonan 9 Amadou Sanyang 1 Zach Scott 12 Terry Boss 0 Josh Ford 0 Taylor Graham 0 Bryan Meredith 0 Michael Tetteh 0 Own goals received Own goals conceded Team totals 34 Opponent totals 34

GS 27 23 22 17 9 32 9 13 7 6 0 23 22 12 28 7 29 12 23 7 1 34 0 2 0 9 0 0 0 0 0

MIN 2304 1849 1870 1509 1008 2891 1062 1045 517 453 100 1897 1989 1232 2387 843 2579 1069 1945 689 108 3060 31 259 8 864 0 0 0 0 0

34 34

3060 3060

G 12 9 5 5 5 3 3 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 3 56 37

A 9 0 13 5 2 3 2 2 2 2 0 2 2 0 0 2 2 1 1 0 0 0 0 0 0 0 0 0 0 0 0

SHT 108 42 18 32 32 54 13 23 15 12 6 9 7 5 10 16 7 4 10 7 3 0 0 6 0 3 0 0 0 0 0

SOG 42 21 9 9 12 11 6 7 8 5 2 3 2 2 4 2 1 1 1 0 0 0 0 3 0 0 0 0 0 0 0

FC/FS 55/54 16/34 18/59 13/9 10/14 50/39 16/16 21/12 9/3 6/3 0/5 30/13 22/6 14/9 17/15 29/9 26/17 22/8 30/16 11/5 1/1 0/5 1/1 2/3 0/0 11/6 0/0 0/0 0/0 0/0 0/0

OFF 17 6 9 1 2 0 11 9 6 5 0 3 0 0 0 9 0 1 1 0 1 0 1 3 0 0 0 0 0 0 0

50 29

442 424

151 145

430/408 85 408/430 64

CK 8 3 66 0 8 5 0 8 0 0 0 27 31 0 0 0 0 1 0 7 0 0 0 0 0 0 0 0 0 0 0

C/E 7/0 3/0 2/0 2/0 1/0 7/0 3/0 2/0 0/0 0/0 0/0 4/0 5/0 2/0 2/0 2/0 3/0 5/0 4/2 5/0 0/0 0/0 0/0 0/0 0/0 3/0 0/0 0/0 0/0 0/0 0/0

164 169

62/2 59/6

GP-games played; GS-goals scored; MIN-minutes; G-goals; A-assists; SHTS-shots; SOG-shots on goal; FC-fouls committed; FS-fouls suffered; OFF-offside; CK-corner kicks; C/E-cards/ejections

GAME-WINNING GOALS: Fredy Montero 5, Lamar Neagle 3, Alvaro Fernandez 3, Mauro Rosales 2, Osvaldo Alonso 1, Mike Fucito 1, Roger Levesque 1, Jeff Parke 1, Steve Zakuani 1, GAME-WINNING ASSISTS: Mauro Rosales 5, Brad Evans 4, Fredy Montero 2, James Riley 2, Tyson Wahl 2, O'Brian White 2, Mike Fucito 1, Leo Gonzalez 1, Nate Jaqua 1, Roger Levesque 1, Lamar Neagle 1 PENALTY KICK GOALS/ATTEMPTS: Brad Evans 3-3, Alvaro Fernandez 1-2, Osvaldo Alonso 1-1, Mauro Rosales 1-2, Fredy Montero 0-1 SEATTLE SOUNDERS FC INDIVIDUAL GOALKEEPING UNF POS GOALKEEPER GP GS MIN 18 G Kasey Keller 34 34 3060 Team totals 34 34 3060 Opponent totals 34 34 3060

SHTS 145 145 151

SV 110 110 92

GA 37 37 56

GAA 1.09 1.09 1.65

PG 3 3 6

PA 4 4 9

W -L-T 18 -7 -9 18 -7 -9 7 -18 -9

SO 9 9 7

GP-games played;GS-goals scored;MIN-minutes;SHTS-shots;SV-saves;GA-goals allowed;GAA-goals against avg.;PG-penalty goals;PA-penalty attempts;W/L/T-wins/losses.ties;SO-shutouts

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS REGULAR SEASON RESULTS DayDate Tue.3/15 Sat. 3/19 Fri. 3/25 Sat. 4/2

Opponent vs. L.A. Galaxy (Seattle) at New York (Harrison, NJ) vs. Houston Dynamo (Seattle) at San Jose (Santa Clara, CA)

Result L L D D

Score 0-1 0-1 1-1 2-2

Attend. 36,433 20,982 36,204 10,276

Record 0-1-0 0-2-0 0-2-1 0-2-2

Pts. 0 0 1 2

Sat. 4/9 Sat. 4/16 Fri. 4/22 Sat.. 4/30 Wed. 5/4 Sat. 5/7 Sat. 5/14 Sat. 5/21 Wed.5/25 Sat. 5/28 Sat. 6/4 Sat. 6/11 Sat. 6/18 Thu.6/23

vs. Chicago Fire (Seattle) at Philadelphia (Chester, PA) at Colorado (Commerce City, CO) vs. Toronto FC (Seattle) at D.C. United (Washington, D.C.) at Columbus (Columbus, OH) vs. Portland Timbers (Seattle) vs. Sporting KC (Seattle) vs. FC Dallas (Seattle) at Real Salt Lake (Sandy, UT) at Chicago Fire (Bridgeview, IL) vs. Vancouver (Seattle) at Toronto FC (Toronto, ON) vs. New York (Seattle)

W D W W L D D W L W D D W W

2-1 1-1 1-0 3-0 1-2 1-1 1-1 1-0 0-1 2-1 0-0 2-2 1-0 4-2

36,233 15,149 14,185 36,287 11,254 7,148 36,593 36.098 36,026 14,674 13,839 36,502 21,839 46,065

1-2-2 1-2-3 2-2-3 3-2-3 3-3-3 3-3-4 3-3-5 4-3-5 4-4-5 5-4-5 5-4-6 5-4-7 6-4-7 7-4-7

5 6 9 12 12 13 14 17 17 20 21 22 25 28

Sun. 6/26 Mon. 7/4 Sun. 7/10

vs. New England (Seattle) W at L.A. Galaxy (Carson, CA) D at Portland Timbers (Portland, OR) W

2-1 0-0 3-2

36,212 27,000 18,627

8-4-7 8-4-8 9-4-8

31 32 35

Sat. 7/16

vs. Colorado Rapids (Seattle)

W

4-3

36,424

10-4-8

38

Sat. Sat. Sat. Sat. Sat.

at Houston Dynamo (Houston) L at Sporting Kansas City (Kansas City)W vs. Chivas USA (Seattle) D at FC Dallas (Frisco, Texas) W vs. Columbus Crew (Seattle) W

1-3 2-1 0-0 1-0 6-2

18,465 17,493 36,364 11,635 36,364

10-5-8 11-5-8 11-5-9 12-5-9 13-5-9

38 41 42 45 48

Sat. 9/10

vs. Real Salt Lake (Seattle)

L

1-2

35,940

13-6-9

48

Sat 9/17 Sat. 9/24

vs. D.C. United (Seattle) at Vancouver (Vancouver, BC)

W W

3-0 3-1

36,242 21,000

14-6-9 15-6-9

51 54

Sat 10/1

at New England (Foxborough, MA) W

2-1

21,022

16-6-9

57

Sat. 10/8 Sat. 10/15

vs. Philadelphia Union (Seattle) vs. San Jose (Seattle)

L W

0-2 2-1

36,304 64,140

16-7-9 17-7-9

57 60

Sat.10/22

at Chivas USA (Carson, CA)

W

3-1

22,137

18-7-9

63

7/30 8/6 8/13 8/20 8/27

Goal scorers LA: Juninho (58) NY: Agudelo (70) SEA: Zakuani (80); HOU; Cameron (42) SEA: Evans (17), White (42); SJ: Dawkins (32), Stephenson (50) SEA: White (7), Zakuani (25); CHI: Chaves (8) SEA: Fernandez (91); PHI: Ruiz (32) SEA: Montero (19) SEA: Fernandez (9), Evans (52, 75) SEA: Evans (71); DC: Wolff (31), Davies (52) SEA: Montero (7); CLB: Renteria (67) SEA: Fernandez (52); POR: Danso (65) SEA: Parke (93+) DAL: Shea (18) SEA: Ianni (72), Neagle (84); RSL: Gonzalez (87) None SEA: Rosales (81), Alonso (84); Hassli (29, 85) SEA: Montero (90) SEA: Friberg (11), Alonso (12), Levesque (67, 78); NY: Richards (31), Own Goal (58) SEA: Wahl (34), Fernandez (40); NE: Nyassi (3) None SEA: Montero (57, 74), Alonso (83); POR: Own Goal (46), Perlaza (69) SEA: Fernandez (7), Levesque (48), Montero (82), Rosales (84) COL: Thompson (1), Larentowicz (42), Folan (89) SEA: Fernandez (37); HOU: Clark (7), Ching (23, 70) SEA: Rosales (90), Neagle (92); KC: Kamara (20) None SEA: Rosales (16) SEA: Neagle (4, 21, 70), Rosales (16), Fucito (40), Own Goal (74); CLB: Cunningham (59), Gardner (73) SEA: Montero (47+); RSL: Own Goal (13), Saborio (56) SEA: Fucito (35), Fernandez (47+, 60) SEA: Evans (33), Montero (63, 67); VAN: Camilo (22) SEA: Montero (36, 47) NE: Fagundez (35) PHI: Adu (60), Carroll (70) SEA: Ochoa (82), Montero (87) SJ: Wondolowski (24) SEA: Own Goal (53), Fernandez (68), Ochoa (73) CHV: Estupinan (83)

ROAD TO MLS CUP 2011 WILD CARD MATCHES WC#1 FC DALLAS v WC#4 NEW YORK RED BULLS Wed., Oct. 26 – Pizza Hut Park, Frisco, Texas (8 p.m. CT; FOX Soccer; TSN2)

FC DALLAS

v

NEW YORK RED BULLS

WC#2 COLORADO RAPIDS v WC#3 COLUMBUS CREW Thurs., Oct. 27 – Dick’s Sporting Goods Park, Commerce City, Colo. (8 p.m. MT; DK; TSN2)

COLORADO RAPIDS

v

COLUMBUS CREW

WESTERN CONFERENCE SEMIFINALS #2 SEATTLE SOUNDERS FC v #3 REAL SALT LAKE Sat., Oct. 29 – Rio Tinto Stadium, Sandy, Utah (8 p.m. MT; FOX Soccer; TSN2)

REAL SALT LAKE

v

SEATTLE SOUNDERS FC

Wed., Nov. 2 – CenturyLink Field, Seattle, Wash. (TBD; ESPN2; ESPN Deportes; ESPN3.com; TSN2)

SEATTLE SOUNDERS FC

v

REAL SALT LAKE

#1 LA GALAXY v COLORADO/COLUMBUS/NEW YORK Sun., Oct. 30 – (TBD; ESPN or 2; ESPN Deportes; ESPN3.com; TSN2)

v

LA GALAXY

Thurs., Nov. 3 – The Home Depot Center, Carson, Calif. (8 p.m. PT; ESPN2; ESPN Deportes; ESPN3.com; TSN2)

LA GALAXY

v

EASTERN CONFERENCE SEMIFINALS #2 HOUSTON DYNAMO v #3 PHILADELPHIA UNION Sun., Oct. 30 – PPL Park, Chester, Pa. (TBD; ESPN2; ESPN Deportes; ESPN3.com)

PHILADELPHIA UNION

v

HOUSTON DYNAMO

Thurs., Nov. 3 – Robertson Stadium, Houston, Texas (7:30 p.m. ET; ESPN2; ESPN Deportes; ESPN3.com)

HOUSTON DYNAMO

v

PHILADELPHIA UNION

#1 SPORTING KANSAS CITY v DALLAS/COLUMBUS/COLORADO Sat., Oct. 29 or Sun., Oct. 30 (TBD; FOX Soccer; TSN)

v

SPORTING KANSAS CITY

Wed., Nov. 2 – Livestrong Sporting Park, Kansas City, Kan. (TBD; FOX Soccer)

SPORTING KANSAS CITY

v

CONFERENCE CHAMPIONSHIP

 v  Sun. Nov. 6 (5:30 p.m. ET; FOX Soccer) hosted by highest seed CONFERENCE CHAMPIONSHIP

 v  Sun. Nov. 6 (TBD; ESPN or 2; ESPN Deportes; ESPN3.com; TSN2) hosted by highest seed MLS CUP 2011 Sun., Nov. 20 – The Home Depot Center (6 p.m. PT; ESPN; Galavision; TSN)

v 3

RULES OF COMPETITION Playoff Qualifiers  

The top three finishers in each conference, based on regular season points (six automatic berths) The next best four clubs based on regular season points, irrespective of conference (four wild cards) o The four wild cards will play single elimination games against each other, with higher seeds hosting (1 vs. 4; 2 vs. 3). These play-in games are part of the MLS Cup Playoffs. o After the two play-in games conclude, the lowest remaining seed will face the Supporters’ Shield winner in the Conference Semifinals; the other will face the No. 1 seed in the opposite conference from the Supporters’ Shield winner.

Wild Card Matches  Should either of the two Wild Card matches be tied at the end of regulation (90 minutes), an additional 30 minutes (consisting of two 15-minute halves) will be played in its entirety. If the score is still tied at the end of the additional 30 minutes, the game will be decided by kicks from the penalty mark. Conference Semifinals (“CSF”)  All four CSF will be decided by a home-and-home, aggregate goal format (all goals scored are counted equally; there is no away goals preference).  The higher seed will host the second game of the home-and-home CSF.  If the score of the first game is tied at the end of regulation (90 minutes), the game will end in a tie with no overtime period being played.  Should there be a split in the results of the two matches at the end of regulation of the second game (i.e., each team records one win and one loss apiece), the team that has scored the most goals over the course of the two games will advance to the Conference Championship (second round).  Should there be a split in the results of the two games (i.e., each team records one win and one loss apiece, or there are two draws) AND an equal number of aggregate goals is scored by each team at the end of regulation of the second game, an additional 30 minutes (consisting of two 15-minute halves) will be played in its entirety.  If the score remains tied at the conclusion of the additional 30 minutes, the game and Conference Semifinal Series winner will be decided by kicks from the penalty mark. Eastern and Western Conference Championships (“CC”) In the Conference Championships (“CC”) of the 2011 MLS Cup Playoffs,, the four Clubs advancing from the first round will be matched up within their conference brackets and play one game for their respective CC. Each CC will be hosted by the higher-seeded team in the relevant conference bracket. The winner of each CC game will advance to MLS Cup 2011. Should either of the two Conference Championship games be tied at the end of regulation (90 minutes), an additional 30 minutes (consisting of two 15-minute halves) will be played in its entirety. If the score is still tied at the end of the additional 30 minutes, the game will be decided by kicks from the penalty mark.

4

MLS Cup 2011 In MLS Cup 2011, the two teams advancing from their respective Conference Championship will play one game. Should MLS Cup 2011 be tied at the end of regulation (90 minutes), an additional 30 minutes (consisting of two 15-minute halves) will be played in its entirety. If the score is still tied at the end of the additional 30 minutes, the game will be decided by kicks from the penalty mark. NOTE: Throughout the Playoffs, all extra time periods will be played in two (2) equal halves with a change of ends at intermission. Extra time will begin approximately three (3) minutes after regulation. Teams will have approximately one minute to switch ends at intermission. A toss of the coin will occur at the end of regulation and the team that wins the toss decides which goal it will attack in the first 15-minute extra time period. The other team takes the kick-off to start the first 15 minute interval. Substitutions Substitutions will be conducted in the same fashion as in the Regular Season. No additional substitutions over and above the regular THREE (3) substitutes per game will be permitted in ANY 30-minute series tiebreaker or kicks from the penalty mark even in the case of a goalkeeper injury during the kicks from the penalty mark as outlined in FIFA’s Laws of the Game: “A goalkeeper who is injured while kicks are being taken from the penalty mark and is unable to continue as goalkeeper may be replaced by a named substitute provided his team has not used the maximum number of substitutes permitted under the competition rules. With the exception of the foregoing case, only players who are on the field of play at the end of the match, which includes extra time where appropriate, are eligible to take kicks from the penalty mark.” Furthermore, once a player leaves the field as a substitute, he will not be permitted to re-enter as a substitute throughout the duration of the game (including any applicable 30-minute series tiebreaker or kicks from the penalty mark tiebreaker).

5

Suspensions for Caution Accumulation  Yellow Card accumulation thresholds are re-set entering MLS Cup Playoffs o A player who exceeds an accumulation threshold in the last Regular Season game (e.g., 5th, 8th , etc.) IS ELIGIBLE for the Playoffs and IS ELIGIBLE for the first Regular Season Match of 2012 o A player who receives a Red Card in his last Regular Season game IS SUSPENDED for the next match for which he is eligible including a Playoff Match or the first Regular Season Match of 2012 o A player sanctioned by the Disciplinary Committee will have any corresponding suspension applied to the next match(es) for which he is eligible including a Playoff Match(es) 

Once the Playoffs begin and up until MLS Cup (when Yellow Card accumulation for P layoffs will be re-set again), a player accumulating TWO (2) Yellow Cards will be suspended for the next match for which he is eligible (with one exception noted below) o A player who earns TWO (2) Yellow Cards in any of the following matches IS SUSPENDED for his next match: Wild Card, Conference Semi-Final Leg #1, Conference Semi-Final Leg #2 o EXCEPTION: A player who earns his second Yellow Card in the Conference Final IS ELIGIBLE to play in MLS Cup.  In other words, Playoff Yellow Card accumulation re-sets entering MLS Cup (or after the Conference Finals).

A player who earns TWO (2) Yellow Cards in the same match IS SUSPENDED for the next match for which he is eligible including MLS Cup o Also, in an instance where a player earns TWO (2) Yellow Cards in the same match, his first Yellow Card WILL NOT COUNT against his Playoff Yellow Card accumulation (as it normally does in the Regular Season).  In other words, if a player earns a Yellow Card in the Wild Card Match and then two Yellow Cards in his Conference Semi-Final #1, that player would be suspended for Conference Semi-Final #2 (due to the Red Card) but he would remain on ONE (1) Yellow Card for his accumulation total. (If his club does not advance, the Red Card suspension would carry to the 2012 Regular Season.)

A player who earns a STRAIGHT RED CARD in the same game in which he previously has earned his second cumulative Yellow Card MAY be suspended for his next TWO (2) Playoff Matches o For example, a player earns a Yellow Card in the Wild Card Match. He then earns a Yellow Card (his 2nd cumulatively) in Conference Semi-Final #1 AND a STRAIGHT RED CARD (different from earning a second Yellow Card) in the same match. The player IS SUSPENDED for Conference Semi-Final #2 (due to the Red Card) AND IS SUSPENDED for the Conference Final (due to Playoff Yellow Card accumulation). o However, if a player earns a Yellow Card in Conference Semi-Final #1 and then earns both a Yellow Card (his 2nd cumulatively) in Conference Semi-Final #2 AND a STRAIGHT RED CARD in the same game, then the player IS SUSPENDED for the Conference Final (due to the Red Card) but IS NOT SUSPENDED for MLS Cup as the Yellow Card accumulation resets entering MLS Cup.

A player who earns a Red Card in any Playoff Match, whether a straight Red Card or Two Yellow Cards, IS SUSPENDED for his next match (if this occurs in MLS Cup, then the suspension carries over to the first Regular Season Match of 2012). A player sanctioned by the Disciplinary Committee will have any corresponding suspension applied to the next match(es) for which he is eligible including a Playoff Match(es) and MLS Cup.

6

MLS CUP PLAYOFFS: 15-YEAR HISTORY 

While the MLS Cup championship game itself has remained a constant – a dramatic one-match finale at a venue announced well in advance of the postseason – the road to MLS Cup has varied slightly over the years: 1996 Who Qualified: The top four teams from both the Eastern and Western Conferences were seeded to start the conference semifinals, with the 1 seeds playing the number 4’s and the No. 2’s vs. No. 3’s. Format: Both the Conference Semifinals (first round) and Conference Finals (second round) were designed on a Best-of-Three format with the first game hosted by the lower-seeded team and the final two games (Game Three if necessary) at the home of the higher seeded team. The first team to win two games in regulation or via the shootout advanced to the next playoff round (since the shootout was in place from 1996-1999 no games ended in ties). Notes: D.C. United became the league’s first champion, coming from two goals down to defeat the Los Angeles Galaxy 3-2 in overtime at Foxboro Stadium. 1997 - 1999 Who Qualified: As in 1996, the top four teams in each conference advanced to the MLS Cup Playoffs. Format: As in 1996, a Best-of-Three format was utilized in the Conference Semifinals and Conference Finals (no games ended in ties due to the shootout). However, a change to the format allowed the higher seeded teams to host Game One and Game Three, unlike in 1996 when the higher seed played Games Two and Three (if necessary) at home. Notes: The D.C. United dynasty saw the team play in MLS Cup all three years, winning its second and third championships in 1997 and 1999. In 1998 the Chicago Fire became the only expansion team to win an MLS Cup in its first season, defeating D.C. United 2-0 before 51,000 fans at the Rose Bowl in Pasadena, Calif. 2000 - 2002 Who Qualified: Spurred by the introduction of a new three-division alignment in 2000, a single playoff table was established to determine postseason berths and seeds. Although a two-conference alignment was re-introduced in 2002 following the contraction of Miami and Tampa Bay, the system based on the single playoff table remained. The single playoff table ensured that only the League’s eight best teams during the regular season qualified for postseason play, eliminating situations like what occurred in 1999, when the San Jose Clash failed to qualify for the playoffs despite finishing with more points (37) than the No. 3 and No. 4 seeds in the Eastern Conference. The three division winners (2000-01) or two conference champions (2002) were given automatic top seeds entering the postseason. The rest of the field was seeded according to final regular season point totals regardless of conference affiliation. Format: During the first round, the seeding placed seed No. 1 vs. No. 8, No. 2 vs. No. 7, No. 3 vs. No. 6 and No. 4 vs. No. 5 in the MLS Cup Playoff Quarterfinals. In the semifinal round, the winner of the 1 vs. 8 series advanced to face the winner of the 4 vs. 5 series, while the victors of the 3 vs. 6 and 2 vs. 7 series played for the right to compete in MLS Cup. The team that advanced was based on a “first-to-five-points” format with a win earning three points and a tie one point (ties were first introduced in MLS in the 2000 regular season in conjunction with the elimination of the shootout). The first team to compile five points or more in three games advanced to the following round. If the series was tied in points after a Game Three, a 20-minute golden-goal Series Tiebreaker was played, followed by penalty kicks if necessary. As was the case from 1997-1999, the higher seed hosted Game One and Game Three in each series. Notes: Kansas City, San Jose, and Los Angeles each won their first MLS Cups, with Los Angeles’ long-due overtime victory coming before 61,000 fans in a packed Foxboro Stadium. 2003-2006 Who Qualified: As was the case between 1996 and 1999, the top four teams in each conference advance to the Conference Semifinals. Format: Conference Semifinal series are conducted under a home-and-home, aggregate-goal format. The aggregate goal format follows the lead of various international competitions, including Europe’s UEFA Champions League and South America’s Copa Libertadores club tournament. In the case that teams are tied on aggregate goals following the conclusion of Game 2 of the Conference Semifinal series, a 30-minute extra time period is played followed by penalty kicks if necessary. The two teams left standing in each conference after the Conference Semifinals will meet in the singlegame Conference Championship to be hosted by the higher seed. The winners of each Conference Championship advances to MLS Cup. Notes: In 2004 D.C. United became the first team to ever win a playoff series on penalty kicks, defeating New England in the Eastern Conference Championship en route to its record fourth MLS Cup victory. 2007-10 Who Qualified: In 2007, 2009 and 2010, the top two teams in each conference qualified and were seeded 1 & 2 in their respective four-team playoff conference brackets. The four MLS teams with the next most points, regardless of conference, received “wildcard” berths. The four wildcard teams were seeded according to conference first. If more than four teams qualified from one conference, those finishing lower than fourth in their conference shifted over to the other conference bracket. A team switching conference brackets was seeded below all other teams in its new conference playoff bracket. For 2008, the top three teams in each conference qualified, with the next two teams with the most points, regardless of conference, receiving “wildcard” berths. Format: Same as from 2003-2006. Notes:The Houston Dynamo became just the second team in league history, and first since D.C. United in the league’s first two seasons, to win back-toback MLS Cups.

7

2010 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

2009 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

EASTERN CONFERENCE SEMIFINALS

EASTERN CONFERENCE SEMIFINALS

New York Red Bulls (1E) vs. San Jose Earthquakes (4E) Oct. 30 New York at San Jose 1-0 10,525 Nov. 4 San Jose at New York 3-1 22,839 (San Jose Earthquakes win on aggregate 3-2)

Columbus Crew (1E) vs. Real Salt Lake (4E) Oct. 31 Columbus at Real Salt Lake 0-1 Nov. 5 Real Salt Lake at Columbus 3-2 (Real Salt Lake win on aggregate 4-2)

Columbus Crew (2E) vs. Colorado Rapids (3E) Oct. 28 Columbus at Colorado 0-1 11,872 Nov. 6 Colorado at Columbus 1-2 10,322 (aggregate 4-2; Rapids win 5-4 on penalty kicks)

Chicago Fire (2E) vs. New England Revolution (3E) Nov. 1 Chicago at New England 1-2 7,416 Nov. 7 New England at Chicago 0-2 21,528 (Chicago Fire win on aggregate 3-2)

WESTERN CONFERENCE SEMIFINALS

WESTERN CONFERENCE SEMIFINALS

Los Angeles Galaxy (1W) vs. Seattle Sounders FC (4W) Oct. 31 Los Angeles at Seattle 1-0 35,521 Nov. 7 Seattle at Los Angeles 1-2 27,000 (Los Angeles Galaxy win on aggregate 3-1)

Los Angeles Galaxy (1W) vs. Chivas USA (4W) Nov. 1 Los Angeles at Chivas USA 2-2 25,128 Nov. 8 Chivas USA at Los Angeles 0-1 27,000 (Los Angeles Galaxy win on aggregate 3-2)

Real Salt Lake (2W) vs. FC Dallas (3W) Oct. 30 Real Salt Lake at Dallas 1-2 Nov. 6 Dallas at Real Salt Lake 1-1 (FC Dallas win on aggregate 2-1)

11,003 19,324

Houston Dynamo (2W) vs. Seattle Sounders FC (3W) Oct. 29 Houston at Seattle 0-0 35,807 Nov. 8 Seattle at Houston 0-1 (OT) 27,465 (Houston Dynamo win on aggregate 1-0)

EASTERN CONFERENCE CHAMPIONSHIP Nov. 14 Dallas at Los Angeles 3-0

27,000

EASTERN CONFERENCE CHAMPIONSHIP Nov. 14 Real Salt Lake at Chicago 0-0 (OT) (Real win 5-4 on penalty kicks)

WESTERN CONFERENCE CHAMPIONSHIP Nov. 13 San Jose at Colorado 1-0

17,779

MLS CUP 2010 BMO Field – Toronto, Ont., Canada Nov. 21 Colorado vs. Dallas 2-1(OT)

WESTERN CONFERENCE CHAMPIONSHIP Nov. 13 Houston at Los Angeles 0-2 (OT)

11,499 10,109

21,723

25,373

MLS CUP 2009 Qwest Field – Seattle, Wash. Nov. 22 Real Salt Lake vs. LA Galaxy 1-1(OT) 46,011 Real win 5-4 on penalty kicks

21,700

8

2008 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

2007 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

EASTERN CONFERENCE SEMIFINALS

EASTERN CONFERENCE SEMIFINALS

Columbus Crew (1E) vs. Kansas City Wizards (4E) Nov. 1 Columbus at Kansas City 1-1 10,385 Nov. 8 Kansas City at Columbus 0-2 11,153 (Columbus Crew win on aggregate 3-1)

D.C. United (1E) vs. Chicago Fire (4E) Oct. 25 D.C. United at Chicago 0-1 Nov. 1 Chicago at D.C. United 2-2 (Chicago Fire win on aggregate 3-2)

Chicago Fire (2E) vs. New England Revolution (3E) Oct. 30 Chicago at New England 0-0 5,221 Nov. 6 New England at Chicago 0-3 17,312 (Chicago Fire win on aggregate 3-0)

New England Revolution (2E) vs. New York Red Bulls (3E) Oct. 27 New England at New York 0-0 14,165 Nov. 3 New York at New England 0-1 10,116 (New England Revolution win on aggregate 1-0)

WESTERN CONFERENCE SEMIFINALS

WESTERN CONFERENCE SEMIFINALS

Houston Dynamo (1W) vs. New York Red Bulls (4W) Nov. 1 Houston at New York 1-1 11,578 Nov. 9 New York at Houston 3-0 30,053 (New York Red Bulls win on aggregate 4-1)

Chivas USA (1W) vs. Kansas City Wizards (5E) Oct. 27 Chivas USA at Kansas City 0-1 12,442 Nov. 3 Kansas City at Chivas USA 0-0 19,711 (Kansas City Wizards win on aggregate 1-0)

Chivas USA (2W) vs. Real Salt Lake (3W) Nov. 1 Chivas USA at Real Salt Lake0-1 Nov. 8 Real Salt Lake at Chivas USA2-2 (Real Salt Lake win on aggregate 3-2)

Houston Dynamo (2W) vs. FC Dallas (3W) Oct. 27 Houston at FC Dallas 0-1 Nov. 2 FC Dallas at Houston 1-4 (OT) (Houston Dynamo win on aggregate 4-2)

14,791 19,265

17,834 19,438

12,537 30,088

EASTERN CONFERENCE CHAMPIONSHIP Nov. 13 Chicago at Columbus 1-2

14,688

EASTERN CONFERENCE CHAMPIONSHIP Nov. 8 Chicago at New England 0-1

10,317

WESTERN CONFERENCE CHAMPIONSHIP Nov. 15 New York at Real Salt Lake 1-0

20,008

WESTERN CONFERENCE CHAMPIONSHIP Nov. 10 Kansas City at Houston 0-2

30,972

27,000

MLS CUP 2007 RFK Memorial Stadium – Washington, D.C. Nov. 18 Houston vs. New England 2-1

39,859

MLS CUP 2008 The Home Depot Center – Carson, Calif. Nov. 23 Columbus vs. New York 3-1

9

2006 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

2005 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

EASTERN CONFERENCE SEMIFINALS

EASTERN CONFERENCE SEMIFINALS New England Revolution (1E) vs. MetroStars (4E) Oct. 22 New England at MetroStars 0-1 10,003 Oct. 29 MetroStars at New England 1-3 9,581 (Revolution win on aggregate 3-2)

D.C. United (1E) vs. New York Red Bulls (4E) Oct. 21 D.C. United at New York 1-0 Oct. 29 New York at D.C. United 1-1 (D.C. United win on aggregate 2-1)

8,630 21,455

D.C. United (2E) vs. Chicago Fire (3E) Oct. 21 D.C. United at Chicago Fire 0-0 Oct. 30 Chicago Fire at D.C. United 4-0 (Fire win on aggregate 4-0)

New England Revolution (2E) vs. Chicago Fire (3E) Oct. 22 New England at Chicago 0-1 10,217 Oct. 28 Chicago at New England 1-2 (OT) 9,372 (aggregate 2-2; Revolution win on penalty kicks 4-2)

WESTERN CONFERENCE SEMIFINALS S.J. Earthquakes (1W) vs. L.A. Galaxy (4W) Oct. 23 San Jose at Los Angeles 1-3 Oct. 29 Los Angeles at San Jose 1-1 (Galaxy win on aggregate 4-2)

WESTERN CONFERENCE SEMIFINALS FC Dallas (1W) vs. Colorado Rapids (4W) Oct. 21 FC Dallas at Colorado 2-1 4,176 Oct. 28 Colorado at FC Dallas 3-2 (OT) 15,486 (aggregate 4-4; Rapids win on penalty kicks 5-4) Houston Dynamo (2W) vs. Chivas USA (3W) Oct. 22 Houston at Chivas USA 1-2 Oct. 29 Chivas USA at Houston 0-2 (Dynamo win on aggregate 3-2) EASTERN CONFERENCE CHAMPIONSHIP Nov. 5 New England at D.C. United 1-0 WESTERN CONFERENCE CHAMPIONSHIP Nov. 5 Colorado at Houston 1-3 MLS CUP 2006 Pizza Hut Park – Frisco, Texas Nov. 12 Houston vs. New England 1-1 Houston Dynamo win on penalty kicks 4-3

11,463 20,089

17,466 17,824

FC Dallas (2W) vs. Colorado Rapids (3W) Oct. 22 FC Dallas at Colorado 0-0 9,625 Oct. 29 Colorado at FC Dallas 2-2 10,104 (aggregate 2-2; Rapids win on penalty kicks 5-4)

15,110 17,440

19,552

23,107

22,427

10

EASTERN CONFERENCE CHAMPIONSHIP Nov. 6 Chicago at New England 1-0

18,118

WESTERN CONFERENCE CHAMPIONSHIP Nov. 5 Los Angeles at Colorado 2-0

12,789

MLS CUP 2005 Pizza Hut Park – Frisco, Texas Nov. 13 Los Angeles vs. New England 1-0

21,193

2004 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

2003 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

EASTERN CONFERENCE SEMIFINALS Columbus Crew (1E) vs. New England Revolution (4E) Oct. 23 Columbus at New England 0-1 5,679 Oct. 31 New England at Columbus 1-1 15,224 (Revolution win on aggregate 2-1)

WESTERN CONFERENCE SEMIFINALS S.J. Earthquakes (1W) vs. L.A. Galaxy (4W) Nov. 1 San Jose at Los Angeles 0-2 Nov. 9 Los Angeles at San Jose 2-5 (OT) (Earthquakes win on aggregate 5-4)

D.C. United (2E) vs. MetroStars (3E) Oct. 23 D.C. United at MetroStars Oct. 30 MetroStars at D.C. United (United win on aggregate 4-0)

Kansas City Wizards (2W) vs. Colorado Rapids (3W) Nov. 4 Kansas City at Colorado 1-1 15,202 Nov. 8 Colorado at Kansas City 0-2 10,712 (Wizards win on aggregate 3-1)

2-0 0-2

WESTERN CONFERENCE SEMIFINALS K.C. Wizards (1W) vs S.J. Earthquakes (4W) Oct. 24 Kansas City at San Jose 0-2 Oct. 30 San Jose at Kansas City 0-3 (Wizards win on aggregate 3-2)

11,161 15,763

EASTERN CONFERENCE SEMIFINALS Chicago Fire (1E) vs. D.C. United (4E) Nov. 1 Chicago at D.C. United 2-0 Nov. 9 D.C. United at Chicago 0-2 (Fire win on aggregate 4-0)

8,659 10,022

20,201 14,145

15,202 15,312

Los Angeles Galaxy (2W) vs. Colorado Rapids (3W) Oct. 22 Los Angeles at Colorado 0-1 8,028 Oct. 30 Colorado at Los Angeles 0-2 20,026 (Galaxy win on aggregate 2-1)

New England Revolution (2E) vs. MetroStars (3E) Nov. 1 New England at MetroStars 2-0 10,211 Nov. 9 MetroStars at New England 1-1 14,823 (Revolution win on aggregate 3-1)

EASTERN CONFERENCE CHAMPIONSHIP Nov. 6 New England at D.C. United 3-3 (aet) 21,101 United win 4-3 on penalty kicks

EASTERN CONFERENCE FINAL Nov. 14 New England at Chicago 0-1 (OT)

14,610

WESTERN CONFERENCE FINAL Nov. 15 Kansas City at San Jose 2-3 (OT)

16,108

MLS CUP 2003 The Home Depot Center – Carson, Calif. Nov. 14 San Jose vs. Chicago 4-2

27,000

WESTERN CONFERENCE CHAMPIONSHIP Nov. 5 Los Angeles at Kansas City 0-2 MLS CUP 2004 The Home Depot Center – Carson, Calif. Nov. 14 D.C. United vs. Kansas City 3-2

11,931

25,797

11

2002 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

2001 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

MLS CUP PLAYOFF QUARTERFINALS

MLS CUP PLAYOFF QUARTERFINALS

Los Angeles Galaxy (1) vs. Kansas City Wizards (8) Sept. 25 Kansas City at Los Angeles 2-3 14,585 Sept. 28 Los Angeles at Kansas City 1-4 9,484 Oct. 2 Kansas City at Los Angeles 2-5 14,713 (Galaxy win series 6 points to 3)

Miami Fusion (No. 1) vs. Kansas City Wizards (No. 8) Sept. 22 Kansas City at Miami 0-2 6,281 Sept. 26 Miami at Kansas City 0-3 5,803 Sept. 29 Kansas City at Miami 1-2 8,119 (Miami wins series 6 points to 3)

New England Revolution (2) vs. Chicago Fire (7) Sept. 26 Chicago at New England 0-2 6,306 Sept. 29 New England at Chicago 1-2 9,434 Oct. 2 Chicago at New England 0-2 6,954 (Revolution win series 6 points to 3)

Chicago Fire (No. 2) vs. Dallas Burn (No. 7) Sept. 20 Dallas at Chicago 0-2 Sept. 23 Chicago at Dallas 1-1 (OT) Sept. 29 Dallas at Chicago 0-2 (Chicago wins series 7 points to 1)

San Jose Earthquakes (3) vs. Columbus Crew (6) Sept. 25 Columbus at San Jose 2-1 8,069 Sept. 28 San Jose at Columbus 1-2 13,004 (Crew win series 6 points to 0)

Los Angeles Galaxy (No. 3) vs. MetroStars (No. 6) Sept. 23 MetroStars at Los Angeles 1-1 (OT) 11,580 Sept. 26 Los Angeles at MetroStars 1-4 12,817 Sept. 29 MetroStars at Los Angeles 2-3 6,154 (Series tied 4-4 on points; Los Angeles wins series tiebreaker after Game Three)

Dallas Burn (4) vs. Colorado Rapids (5) Sept. 25 Colorado at Dallas 2-4 6,360 Sept. 28 Dallas at Colorado 0-1 9,637 Oct. 2 Colorado at Dallas 1-1 8,008 (Series tied 4-4 on points; Colorado wins series tiebreaker after Game Three)

Columbus Crew (No. 4) vs. S.J. Earthquakes (No. 5) Sept. 22 San Jose at Columbus 3-1 20,883 Sept. 26 Columbus at San Jose 0-3 10,419 (San Jose wins series 6 points to 0)

MLS CUP PLAYOFF SEMIFINALS Los Angeles (1) vs. Colorado Rapids (5) Oct. 5 Colorado at Los Angeles 0-4 Oct. 9 Los Angeles at Colorado 1-0 (Galaxy win series 6 points to 0)

8,314 17,149 12,811

MLS CUP PLAYOFF SEMIFINALS Chicago Fire (No. 2) vs. Los Angeles Galaxy (No. 3) Oct. 10 Los Angeles at Chicago 1-1 (OT) 10,388 Oct. 13 Chicago at Los Angeles 0-1 (OT) 10,100 Oct. 17 Los Angeles at Chicago 2-1 (OT) 8,320 (Los Angeles wins series 7 points to 1)

24,742 12,367

New England Revolution (2) vs. Columbus Crew (6) Oct. 6 Columbus at New England 0-0 11,387 Oct. 9 New England at Columbus 1-0 10,245 Oct. 12 Columbus at New England 2-2 9,216 (Revolution win series 5 points to 2)

Miami Fusion (No. 1) vs. San Jose (No. 5) Oct. 10 San Jose at Miami 0-1 Oct. 14 Miami at San Jose 0-4 Oct. 17 San Jose at Miami 1-0 (OT) (San Jose wins series 6 points to 3)

MLS CUP 2002 Gillette Stadium – Foxborough, Mass. Oct. 20 Los Angeles vs. New England1-0 (OT)61,216

9,236 16,119 11,242

MLS CUP 2001 Columbus Crew Stadium – Columbus, Ohio Oct. 21 San Jose vs. Los Angeles 2-1 (OT) 21,626

12

2000 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

1999 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

MLS CUP PLAYOFF QUARTERFINALS

EASTERN CONFERENCE SEMIFINALS

Los Angeles Galaxy vs. Tampa Bay Mutiny Sept. 14 Los Angeles at Tampa Bay 1-0 Sept. 20 Tampa Bay at Los Angeles 2-5 (Los Angeles wins series 6 points to 0)

5,583 13,851

D.C. United vs. Miami Fusion Oct. 16 Miami at D.C. United 0-2 18,011 Oct. 24 D.C. United at Miami 0-0 (SO 3-2) 8,446 (D.C. United win series 2 games to 0)

MetroStars vs. Dallas Burn Sept. 15 Dallas at MetroStars 1-2 (OT) Sept. 20 MetroStars at Dallas 2-1 (MetroStars win series 6 points to 0)

14,868 7,555

Tampa Bay Mutiny at Columbus Crew Sept. 17 Tampa Bay at Columbus 0-2 Sept. 22 Columbus at Tampa Bay 2-0 (Columbus win series 2 games to 0)

New England Revolution vs. Chicago Fire Sept. 15 New England at Chicago 1-2 Sept. 19 Chicago at New England 1-2 Sept. 22 New England at Chicago 0-6 (Chicago wins series 6 points to 3)

10,476 10,723 5,972

Colorado Rapids vs. Kansas City Wizards Sept. 16 Colorado at Kanas City 0-1 Sept. 20 Kansas City at Colorado 0-0 (OT) Sept. 24 Colorado at Kansas City 2-3 (Kansas City wins series 7 points to 1)

8,682 8,789 4,156

9,188 14,392

WESTERN CONFERENCE SEMIFINALS Colorado Rapids vs. Los Angeles Galaxy Oct. 17 Colorado at Los Angeles 0-3 Oct. 24 Los Angeles at Colorado 2-0 (Los Angeles win series 2 games to 1)

16,307 6,542

Chicago Fire vs. Dallas Burn Oct. 16 Chicago at Dallas Oct. 23 Dallas at Chicago Oct. 27 Chicago at Dallas (Dallas win series 2 games to 1)

1-2 0-4 2-3

10,980 13,197 9,795

D.C. United vs. Columbus Crew Oct. 31 Columbus at D.C. United 1-2 Nov. 7 D.C. United at Columbus 1-5 Nov. 13 Columbus at D.C. United 0-4 (D.C. United wins series 2 games to 1)

14,529 12,778 21,451

MLS CUP PLAYOFF SEMIFINALS EASTERN CONFERENCE FINALS Los Angeles Galaxy vs. Kansas City Wizards Sept. 29 Los Angeles at Kansas City 0-0 (OT) 11,815 Oct. 3 Kansas City at Los Angeles 1-2 (OT) 20,849 Oct. 6 Los Angeles at Kansas City 5-2 (0-1*) 8,320 (Kansas City wins series 5 points to 4 after overtime tiebreaker*) *After regulation, both teams were tied in the series at four points each and a 20-minute overtime period which KC won 1-0) MetroStars vs. Chicago Fire Sept. 26 MetroStars at Chicago Sept. 30 Chicago at MetroStars Oct. 6 MetroStars at Chicago (Chicago wins series 6 points to 3) MLS CUP 2000 RFK Stadium – Washington, D.C. Oct. 15 Kansas City vs. Chicago

0-3 0-2 2-3

WESTERN CONFERENCE FINALS Dallas Burn vs. Los Angeles Galaxy Sept. 31 Dallas at Los Angeles 1-2 17,372 Nov. 7 Los Angeles at Dallas 2-2 (3-4 SO) 13,816 Nov. 11 Dallas at Los Angeles 1-3 25,703 (Los Angeles win series 2 games to 1)

7,141 15,476 10,133

MLS CUP 1999 Foxboro Stadium – Foxborough, Mass. Nov. 21 D.C. United vs. Los Angeles 2-0 1-0

39,159

13

44,910

1998 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

1997 MAJOR LEAGUE SOCCER PLAYOFF RESULTS

EASTERN CONFERENCE SEMIFINALS

EASTERN CONFERENCE SEMIFINALS

Columbus Crew vs. MetroStars Sept. 30 MetroStars at Columbus 3-5 10,996 Oct. 3 Columbus at MetroStars1-1 (3-2 SO) 11,686 (Columbus win series 2 games to 0)

Columbus Crew vs. Tampa Bay Mutiny Oct. 5 Columbus at Tampa Bay 2-1 Oct. 8 Tampa Bay at Columbus 2-0 (Columbus wins series 2 games to 0)

D.C. United vs. Miami Fusion Sept. 30 Miami at D.C. United 1-2 15,187 Oct. 4 D.C. United at Miami 0-0 (3-2 SO) 13,128 (D.C. United win series 2 games to 0)

New England Revolution vs. D.C. United Oct. 5 New England at D.C. United 1-4 12,540 Oct. 8 D.C. United at New England 1-1 (4-3 SO) 16,233 (D.C. United win series 2 games to 0)

WESTERN CONFERENCE SEMIFINALS

WESTERN CONFERENCE SEMIFINALS

Colorado Rapids vs. Chicago Fire Oct. 1 Colorado at Chicago 1-1 (2-3 SO) 12,610 Oct. 4 Chicago at Colorado 1-0 6,582 (Chicago win series 2 games to 0)

Colorado Rapids vs. Kansas City Wizards Oct. 4 Colorado at Kansas City 3-0 Oct. 8 Kansas City at Colorado 2-3 (Colorado wins series 2 games to 0)

Los Angeles Galaxy vs. Dallas Burn Oct. 1 Dallas at Los Angeles 1-6 Oct. 4 Los Angeles at Dallas 3-2 (Los Angeles win series 2 games to 0)

Los Angeles Galaxy vs. Dallas Burn Oct. 5 Dallas at Los Angeles 0-0 (2-0 SO) 18,921 Oct. 8 Los Angeles at Dallas 0-3 11,248 (Dallas wins series 2 games to 0)

10,047 8,130

EASTERN CONFERENCE FINALS

8,272 13,102

10,174 13,117

EASTERN CONFERENCE FINALS

D.C. United vs. Columbus Crew Oct. 11 Columbus at D.C. United 0-2 Oct. 18 D.C. United at Columbus 2-4 Oct. 21 Columbus at D.C. United 0-3 (D.C. United win series 2 games to 1)

D.C. United vs. Columbus Crew Oct. 12 Columbus at D.C. United 2-3 Oct. 15 D.C. United at Columbus 1-0 (D.C. United wins series 2 games to 0)

17,755 13,193 21,453

WESTERN CONFERENCE FINALS

WESTERN CONFERENCE FINALS

Chicago Fire vs. Los Angeles Galaxy Oct. 10 Chicago at Los Angeles 1-0 25, 107 Oct. 16 Los Angeles at Chicago 1-1 (SO 1-2) 32,744 (Chicago win series 2 games to 0)

Colorado Rapids vs. Dallas Burn Oct. 12 Colorado at Dallas Oct. 15 Dallas at Colorado (Colorado wins series 2 games to 0)

MLS CUP 1998 Rose Bowl – Pasadena, Calif. Oct. 25 Chicago vs. D.C. United

MLS CUP 1997 RFK Stadium – Washington, D.C. Oct. 26 D.C. United vs. Colorado

2-0

51,530

14

11,820 9,506

1-0 1-2

7,376 18,452

2-1

57,431

1996 MAJOR LEAGUE SOCCER PLAYOFF RESULTS EASTERN CONFERENCE SEMIFINALS D.C. United vs. MetroStars Sept. 24 D.C. United at MetroStars2-2 (6-5 SO) 14,416 Sept. 27 MetroStars at D.C. United 0-1 21,442 Oct. 2 MetroStars at D.C. United 1-2 20,423 (D.C. United win series 2 games to 1) Tampa Bay Mutiny vs. Columbus Crew Sept. 25 Tampa Bay at Columbus 2-0 Sept. 28 Columbus at Tampa Bay 2-1 Oct. 2 Columbus at Tampa Bay 1-4 (Tampa Bay wins series 2 games to 1)

20,807 13,009 6,871

WESTERN CONFERENCE SEMIFINALS Dallas Burn vs. Kansas City Wiz Sept. 26 Dallas at Kansas City 2-3 4,466 Sept. 29 Kansas City at Dallas 1-2 10,125 Oct. 2 Kansas City at Dallas 2-2 (3-2 SO) 9,802 (Kansas City wins series 2 games to 1) Los Angeles Galaxy vs. San Jose Clash Sept. 26 Los Angeles at San Jose 0-1 Sept. 29 San Jose at Los Angeles 0-2 Oct. 2 San Jose at Los Angeles 0-2 (Los Angeles wins series 2 games to 1)

17,209 27,833 30,231

EASTERN CONFERENCE FINALS Tampa Bay Mutiny vs. D.C. United Oct. 10 Tampa Bay at D.C. United 1-4 Oct. 12 D.C. United at Tampa Bay 2-1 (D.C. United wins series 2 games to 0)

23,566 9,339

WESTERN CONFERENCE FINALS Kansas City Wiz vs. Los Angeles Galaxy Oct. 10 Kansas City at Los Angeles 1-2 25,212 Oct. 13 Los Angeles at Kansas City 1-1 (3-1 SO) 11,041 (Los Angeles wins series 2 games to 0) MLS CUP 1996 Foxboro Stadium â&#x20AC;&#x201C; Foxborough, Mass. Oct. 20 D.C. United vs. Los Angeles 3-2 (OT) 34,643

15

2011 MAJOR LEAGUE SOCCER SEASON NOTES   SUPPORTERS’ SHIELD WINNERS

DEFENSIVE RECORDS

The LA Galaxy won the Supporters’ Shield for the second consecutive year, and the fourth time in club history. The last three Supporters’ Shield winners have each won in back-to-back seasons: D.C. United in 2006 and 2007, and the Columbus Crew in 2008 and 2009. A look at how the Supporters’ Shield winners did in the MLS Cup Playoffs:

The LA Galaxy recorded the third-best defensive record in MLS history in 2011, allowing 28 goals in 34 games, an average of 0.82 goals per contest. Twelve times in MLS history teams have allowed less than a goal per game:

YEAR W-L-T

PTS

GF

TAMPA BAY MUTINY 1996 20-12-0 58 66 DC UNITED 1997 21-11-0 55 70 LOS ANGELES GALAXY 1998 24-8-0 68 85 DC UNITED 1999 23-9-0 57 65 KANSAS CITY WIZARDS 2000 16-7-9 57 47 MIAMI FUSION FC 2001 16-5-5 53 57 LOS ANGELES GALAXY 2002 16-9-3 51 44 CHICAGO FIRE 2003 15-7-8 53 53 COLUMBUS CREW 2004 12-5-13 49 40 SAN JOSE EARTHQUAKES 2005 18-4-10 64 53 D.C. UNITED 2006 15-7-10 55 52 2007 16-7-7 55 56 COLUMBUS CREW 2008 17-7-6 57 50 2009 13-7-10 49 41 LOS ANGELES GALAXY 2010 18-7-5 59 44 2011 19-5-10 67 48

GA

Playoff Result

51

East Finals

53

MLS Cup Champion

44

West Finals

43

MLS Cup Champion

29

MLS Cup Champion

36

Semifinals

33

MLS Cup Champion

43

MLS Cup Runner-up

32

Quarterfinals

31

Quarterfinals

38 34

Semifinals Quarterfinals

36 31

MLS Cup Champion Quarterfinals

26 28

Semifinals ?????

FEWEST YEAR 2010 2007 2011 2010 1999 2000 2010 2007 2010 2009 2009 2005

GOALS ALLOWED PER GAME TEAM Real Salt Lake Houston Dynamo LA Galaxy Los Angeles Galaxy Los Angeles Galaxy Kansas City Wizards FC Dallas Chivas USA New York Red Bulls Seattle Sounders FC Houston Dynamo San Jose Earthquakes

(SINGLE SEASON) GAMES GOALS GA/G 30 20 0.67 30 23 0.77 34 28 0.82 30 26 0.87 32 29 0.91 32 29 0.91 30 28 0.93 30 28 0.93 30 29 0.97 30 29 0.97 30 29 0.97 32 31 0.97

HOME-FIELD DOMINANCE The LA Galaxy became the third team in MLS history to go unbeaten at home over the course of a single season, and the second in as many years: YEAR 2010 2011 2005

TEAM Real Salt Lake LA Galaxy S.J. Earthquakes

W-L-T 11-0-4 12-0-5 9-0-7

PTS. 37 37 34

PCT. .867 .853 .781

The Galaxy also allowed just eight goals in their home contests, tied for the second-fewest allowed over a home campaign in league history: YEAR 2010 2011 2004 2007

TEAM Real Salt Lake LA Galaxy Colorado Rapids Chivas USA

GAMES 15 17 15 15

GOALS 7 8 8 8

GA/G 0.47 0.47 0.53 0.53

The Galaxy ended the year with a 18-game league unbeaten streak active, tied for third-longest in MLS history. Over the course of the 2011 season, they went 21 games unbeaten in home contests in all competitions, entering the MLS Cup Playoffs. TEAM # Real Salt Lake 29 Columbus Crew 22 LA Galaxy 18 S.J.Earthquakes 18 LA Galaxy 17 Colorado Rapids 16 Chivas USA 16

16

START 06/06/2009 06/28/2008 10/24/2010 09/25/2004 07/04/2004 05/31/2003 09/09/2006

STOP 05/14/2011 09/26/2009 current 10/15/2005 07/16/2005 05/22/2004 09/29/2007

HOME, SWEET, HOME-- FINALLY

EXPANSION TEAM HISTORY

Sporting Kansas City became the fourth team in MLS history to open the season with a long road swing while their new stadium was being completed – and all four teams have reached the MLS Cup Playoffs.

The Portland Timbers narrowly missed out on becoming the fourth expansion team in MLS history to qualify for the postseason, staying alive to the final weekend of the season.

While awaiting the opening of Livestrong Sporting Park – which they inaugurated June 9 with a scoreless draw vs. Chicago – SKC joined the Columbus Crew in 1999 (Columbus Crew Stadium), the Los Angeles Galaxy in 2003 (The Home Depot Center) and the Chicago Fire in 2006 (Toyota Park) with lengthy road trips.

The Timbers were joined by Vancouver Whitecaps FC as the Class of 2011; Whitecaps FC were 0-12-5 on their travels, the fourth team in MLS history to go winless away from home for an entire season. MLS grows to 19 clubs next season with the addition of L’Impact de Montréal. A look at how expansion teams have fared in their first season since the first MLS expansion in 1998:

COLUMBUS CREW, 1999 STARTED: WON 5, LOST 2 -- 11 pts. FINISHED: 19-13-0, 45 pts., 2nd East Lost in conference championship

1998 2009 2011 1998 2008 2010 2011 2007 2005 2005

LA GALAXY, 2003 STARTED: WON 0, LOST 4, TIED 4 -- 4 pts. FINISHED: 9-12-9, 36 pts., 4th West Lost in conference semifinals CHICAGO FIRE, 2006 STARTED: WON 2, LOST 3, TIED 4 -- 10 pts. FINISHED: 13-11-8, 47 pts., 3rd East Lost in conference semifinals

GP Chicago Fire 32 Seattle Sounders 30 Portland Timbers 34 Miami Fusion 32 S.J. Earthquakes 30 Philadelphia Union 30 Vancouver Whitecaps34 Toronto FC 30 Real Salt Lake 32 Chivas USA 32

W 20 12 11 15 8 8 6 6 5 4

L T PTS GF GA 12 0 56 62 45 7 11 47 38 29 14 9 42 40 48 17 0 35 46 68 13 9 33 32 38 15 7 31 35 49 18 10 28 35 55 17 7 25 25 49 22 5 20 30 65 22 6 18 31 67

A NEW GOALSCORING KING

SPORTING KANSAS CITY, 2011 STARTED: WON 1, LOST 6, TIED 3 -- 6 pts. FINISHED: 13-9-12, 51 pts., 1st East

With his penalty kick goal in a 6-2 loss at Seattle on Aug. 27, Jeff Cunningham became the all-time MLS goalscoring leader, passing Jaime Moreno with 134 league goals.

HIT FOR THREE, WIN HAT

The 2011 season ended with six members of the century goal club in MLS history; 2011 Golden Boot winner Dwayne De Rosario is next with 93.

Ten hat tricks were scored in Major League Soccer in 2011, the second-highest single season total in league history. The record is 13 hat tricks scored in 1998; they are the only two seasons with double-digits in triples.

MLS ALL-TIME GOAL LEADERS PLAYER TEAM Jeff Cunningham CLB/COL/RSL/TOR/DAL Jaime Moreno DC/MET Landon Donovan SJ/LA Ante Razov LA/CHI/MET/CHV Jason Kreis DAL/RSL Taylor Twellman NE

Eight different players scored hat tricks in 2011, with Justin Braun (Chivas USA) and Golden Boot winner Dwayne De Rosario (DC) each scoring two.

17

GP 344 340 232 262 305 174

GOALS 134 133 115 114 108 101

WINS IN ALL COMPETITIONS

A GOALS-AGAINST RECORD

Chasing trophies across four fronts this season, Seattle Sounders have recorded 26 wins in all competitions heading into the MLS Cup Playoffs – the fourth-most in league history, and tied for the most since the end of the shootout era.

Despite conceding three goals in the season finale, LA Galaxy goalkeeper Donovan Ricketts recorded the lowest single-season goals-against-average (minimum 1000 minutes played) in league history. FC Dallas went undefeated in league play from May 27 to Oct. 9 – a 19-game stretch that equaled the longest in MLS history, and was the record for the longest unbeaten run during a single season. Earlier in the season, the LA Galaxy had extended their unbeaten streak from the end of the 2009 season to 15 games, equaling the third-longest in league history:

The record is held by D.C. United, who won 32 games in 1998 across MLS, MLS Cup Playoffs, U.S. Open Cup, CONCACAF Champions Cup and InterAmerican Cup. Since the end of the shootout, only the Chicago Fire have won as many games, also recording 26 wins in 2000. Sounders FC won 18 games in league competition this year, four games on their way to a third consecutive U.S. Open Cup championship, and four games in qualifying for the quarterfinals of the CONCACAF Champions League. The most they can win this year is 30 games, including a winning run to MLS Cup.

GOALS AGAINST AVG. YEAR PLAYER TEAM 2011 Donovan Ricketts LA 2010 Kevin Hartman DAL 2010 Nick Rimando RSL 2007 Pat Onstad HOU 2009 Zach Thornton CHV Minimum: 1000 minutes played

MOST WINS, ONE YEAR, ALL COMPETITIONS DC, 1998: 32 DC, 1997: 30 DC, 1999: 29 SEA, 2011: 26 (current) CHI, 2000: 26 LA, 1998: 26

GP 14 20 27 27 27

MIN 1194 1755 2430 2418 2385

GA 8 12 18 22 23

GAA 0.60 0.62 0.67 0.82 0.87

A REMARKABLE COMEBACK When D.C. United allowed two goals in stoppage time in a 2-1 loss to Chicago on Oct. 15, it was the fifth time in MLS history a team had scored the game-tying and winning goals in second-half stoppage time – and it was the third time either D.C. or Chicago had been involved. United was on the winning end in a 3-2 win against the Fire, April 8, 2000, and also in a 4-2 win against New England on July 27, 2003.

BLANKING THE OPPOSITION The LA Galaxy tied for the most shutouts in one season, recording 17 in 34 league games, matching the mark of the 2000 Kansas City Wizards.

The first time a team scored the tying and winning goals in stoppage time also involved D.C. United and Chicago – April 8, 2000. The winning goalscorer that day? Current United head coach Ben Olsen.

Remarkably, four different goalkeepers contributed to the total. Josh Saunders recorded 11 clean sheets, Donovan Ricketts had seven, and Brian Perk had one in his only league start. The last one came in a combined effort between Ricketts (who suffered a broken arm), Saunders (who was sent off) and midfielder Mike Magee, in a scoreless draw June 25 against San Jose.

Dwayne De Rosario’s 90th-minute penalty was the latest lead goal overcome for a win after 90 minutes had elapsed.

MOST DEFENSIVE SHUTOUTS IN ONE SEASON 2011 LA Galaxy 17 2000 Kansas City 17 2010 Real Salt Lake 15 2007 Chivas USA 14 2007 Houston 13 2009 Chivas USA 13

Chicago was also the first MLS team to win a game after falling behind in the 75th minute or later since the league eliminated overtime in 2004. It was the first time in league history that two teams gained wins from a losing position after the 80th minute on the same day (Chicago and Seattle).

18

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS BOX SCORES Seattle Sounders FC 0 vs. Los Angeles Galaxy 1 Seattle Sounders FC 0 at New York Red Bulls 1 March 15, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,433 (sellout) March 19, 2011 at Red Bull Arena (Harrison, N.J.) Att: 20,982 (sellout) Scoring - SEA - None Scoring - SEA - None LA - Juninho (Dunivant) 58’ NY - Agudelo (Tainio) 70’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 11 1 10 4 4 SEA 10 5 17 3 0 LA 10 6 12 2 4 NY 17 5 10 1 11 SEA Cautions: Friberg 44’, Gonzalez 46’ SEA Cautions: Hutado 61’ Seattle Sounders FC 1 vs. Houston Dynamo 1 Seattle Sounders FC 2 at San Jose Earthquakes 2 March 25, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,204 (sellout) April 2, 2011 at Buck Shaw Stadium (Santa Clara, Calif.) Att: 10,276 Scoring - SEA - Zakuani 80’ Scoring - SEA - Evans (Rosales, Friberg) 17’, White (Zakuani) 42’ HOU - Cameron 42’ SJ - Dawkins (Convey) 32’, Stephenson 52’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 26 1 15 5 12 SEA 17 2 12 3 10 HOU 6 6 16 4 1 SJ 12 3 4 3 6 SEA Cautions: Ianni 43’, Gonzalez 73’ SEA Cautions: Jaqua 71’, Gonzalez 80’ Seattle Sounders FC 2 vs. Chicago Fire 1 Seattle Sounders FC 1 at Philadelphia Union 1 April 9, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,233 (sellout) April 16, 2011 at PPL Park (Chester, Penn.) Att: 15,149 Scoring - SEA - White (Rosales) 7’, Zakuani (White) 25’ Scoring - SEA - Fernandez (Montero, Zakuani) 91’ CHI - Chaves (Nyarko, Puerari) 8’ PHI - Ruiz 32’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 14 4 16 1 5 SEA 7 2 17 1 2 CHI 12 2 10 2 4 PHI 7 0 14 2 2 SEA Cautions: Riley 32’, Hurtado 47’+, Carrasco 90’ SEA Cautions: Alonso 30’ Seattle Sounders FC 1 at Colorado Rapids 0 Seattle Sounders FC 3 vs. Toronto FC 0 April 22, 2011 at Dick’s Sporting Goods Park (Commerce City, Colo.) Att: 14, 185 April 30, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,287 (sellout) Scoring - SEA - Montero (Rosales, White) 19’ Scoring - SEA - Fernandez (Evans, Riley) 9’, Evans (Montero, Hurtado) 52’, Evans (penalty) 75’ COL - None TOR - None Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 11 2 19 3 4 SEA 18 2 13 2 5 COL 9 3 7 0 4 TOR 6 6 12 2 4 SEA Cautions: Montero 81’ SEA Cautions: Alonso 45’ Seattle Sounders FC 1 at D.C. United 2 Seattle Sounders FC 1 at Columbus Crew 1 May 4, 2011 at RFK Stadium (Washington, D.C.) Att: 11,254 May 7, 2011 at Crew Stadium (Columbus, Ohio Att: 7,148 Scoring - SEA - Evans (penalty) 71’ Scoring - SEA - Montero (Friberg) 7’ DC - Wolff (Davies, Najar) 31’, Davies (Wolff, Najar) 52’ CLB - Renteria (penalty) 67’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 14 4 11 1 7 SEA 7 5 22 1 3 DC 11 4 11 1 4 CLB 17 0 14 0 10 SEA Cautions: Jaqua 55’ SEA Cautions: Carrasco 38’, Montero 44’, Gonzalez 53’, Fernandez 64’, Levesque 90’ Seattle Sounders FC 1 vs. Portland Timbers 1 Seattle Sounders FC 1 vs. Sporting Kansas City 0 May 14, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,593 (sellout) May 21, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,098 (sellout) Scoring - SEA - Fernandez (Montero, Levesque) 52’ Scoring - SEA - Parke (Wahl) 93+ POR - Danso (Jewsbury) 65’ KC - None Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 12 4 10 1 7 SEA 12 3 14 1 8 POR 9 1 9 1 2 KC 7 1 15 0 4 SEA Cautions: NONE SEA Cautions: Fernandez 44’, Carrasco 51’, Rosales 64’, Alonso 84’ Seattle Sounders FC 0 vs. FC Dallas 1 Seattle Sounders FC 2 at Real Salt Lake 1 May 25, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,026 (sellout) May 28, 2011 at Rio Tinto Stadium (Sandy, Utah) Att: 14,674 Scoring - SEA - None Scoring - SEA - Ianni (Montero, Jaqua) 72’, Neagle (Wahl) 84’ DAL - Shea (Jacobson) 18’ RSL - Gonzalez 87’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 19 1 4 3 9 SEA 17 5 12 2 4 DAL 7 4 12 2 2 RSL 16 3 7 2 10 SEA Cautions: Scott 82’ SEA Cautions: Riley 81’, Wahl 90’ Seattle Sounders FC 0 at Chicago Fire 0 Seattle Sounders FC 2 vs. Vancouver Whitecaps FC 2 June 4, 2011 at Toyota Park (Bridgeview, Ill.) Att: 13,839 June 11, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,502 (sellout) Scoring - SEA - None Scoring - SEA - Rosales 81’, Alonso 84’ CHI - None VAN - Hassli (penalty) 29’, Hassli 85’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 11 5 11 1 5 SEA 14 2 13 1 6 CHI 16 3 15 3 6 VAN 11 3 12 1 1 SEA Cautions: Fucito 33’, Wahl 36’ SEA Cautions: Alonso 47’+ Seattle Sounders FC 1 at Toronto FC 0 Seattle Sounders FC 4 vs. New York Red Bulls 2 June 18, 2011 at BMO Field (Toronto, Ont.) Att: 21,839 June 23, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 46,065 (sellout) Scoring - SEA - Montero 90’ Scoring - SEA - Friberg 11’, Alonso 12’, Levesque (Gonzalez) 67’, Levesque 78’ TOR - None NY - Richards (Lindpere) 31’, Scott (own goal) 58’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 10 2 10 0 4 SEA 10 2 8 6 4 TOR 18 3 18 0 5 NY 13 1 11 4 5 SEA Cautions: Hurtado 34’, Hurtado 49’ (ejection) SEA Cautions: Riley 52’, Alonso 60’, Gonzalez 90’ Seattle Sounders FC 2 vs. New England Revolution 1 Seattle Sounders FC 0 at Los Angeles Galaxy 0 June 26, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,212 (sellout) July 4, 2011 at The Home Depot Center (Carson, Calif.) Att: 27,000 Scoring - SEA - Wahl 34’, Fernandez (Levesque, Rosales) 40’ Scoring - SEA - None NE - Nyassi (Feilhaber) 3’ LA - None Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 9 2 7 3 3 SEA 14 2 13 6 5 NE 11 1 13 1 5 LA 9 2 14 3 2 SEA Cautions: Carrasco 26’, Wahl 87’ SEA Cautions: Friberg 55’

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS BOX SCORES Seattle Sounders FC 3 at Portland Timbers 2 July 10, 2011 at JELD-WEN Field (Portland, Ore.) Att: 18,627 Scoring - SEA - Montero 57’, Montero (Rosales, Neagle) 74’, Alonso (penalty) 83’ POR - Parke (own goal) 46’, Perlaza (Chara) 69’ Shots Saves Fouls Offsides Corners SEA 14 2 9 0 3 POR 11 4 11 1 5 SEA Cautions: Montero 58’, Alonso 63’, Rosales 78’

Seattle Sounders FC 4 vs. Colorado Rapids 3 July 16, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,424 (sellout) Scoring - SEA - Fernandez (Alonso) 7’, Levesque (Rosales, Alonso) 48’, Montero 82’, Rosales (Montero) 84’ COL - Thompson 1’, Larentowicz (Thompson, Cummings) 42’, Folan (89’) Shots Saves Fouls Offsides Corners SEA 13 1 10 3 4 COL 13 5 8 3 5 SEA Cautions: Montero 27’, Levesque 69’

Seattle Sounders FC 1 at Houston Dynamo 3 July 30, 2011 at Robertson Stadium (Houston, Tex.) Att: 18,465 Scoring - SEA - Fernandez (penalty) 37’ HOU - Clark 7’, Ching (Cameron, Davis) 23’, Ching (Clark, Freeman) 70’ Shots Saves Fouls Offsides Corners SEA 8 5 8 4 7 HOU 16 2 10 4 4 SEA Cautions: Fernandez 38’, Fucito 87’

Seattle Sounders FC 2 at Sporting Kansas City 1 August 6, 2011 at LIVESTRONG Sporting Park (Kansas City, Kansas) Att: 17,493 Scoring - SEA - Rosales 90’, Neagle (Fucito, Rosales) 92+ KC - Kamara (Besler) 20’ Shots Saves Fouls Offsides Corners SEA 12 3 10 1 1 KC 13 3 9 4 6 SEA Cautions: NONE

Seattle Sounders FC 0 vs. Chivas USA 0 Seattle Sounders FC 1 at FC Dallas 0 August 13, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,364 (sellout) August 20, 2011 at Pizza Hut Park (Frisco, Texas) Att: 11,635 Scoring - SEA - None Scoring - SEA - Rosales (Montero) 16’ CHV - None DAL - None Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 10 3 18 4 4 SEA 8 4 22 2 3 CHV 4 2 12 3 5 DAL 25 1 19 0 11 SEA Cautions: Wahl 23’, Friberg 89’ SEA Cautions: Friberg 6’, Montero 60’, Hurtado 62’, Scott 94’+ Seattle Sounders FC 6 vs. Columbus Crew 2 Seattle Sounders FC 1 vs. Real Salt Lake 2 August 27, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,364 (sellout) Sept. 10, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 35,940 (sellout) Scoring - SEA - Neagle (Fucito) 3’, Rosales (penalty) 16’, Neagle (Riley, Rosales) 21’, Scoring - SEA - Montero (Rosales) 47+ Fucito (Rosales, Montero) 40’, Neagle (Alonso) 70’, Own Goal (Gardner) 74’ RSL - Own Goal (Keller) 13’, Saborio 56’ CLB - Cunningham (penalty) 59’, Gardner 73’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 19 3 10 3 11 SEA 13 5 18 2 5 RSL 10 4 12 2 2 DAL 19 2 12 3 4 SEA Cautions: Carrasco 38’, Hurtado 39’ (ejection), Alonso 94’+ SEA Cautions: Parke 73’, Scott 81’ Seattle Sounders FC 3 vs. D.C United 0 Sept. 17, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,242 (sellout) Scoring - SEA - Fucito (Rosales, Evans) 35’, Fernandez (Rosales, Montero) 47+, Fernandez 60’ DC - None Shots Saves Fouls Offsides Corners SEA 14 6 7 5 2 DC 14 4 16 3 6 SEA Cautions: Wahl 41’ Seattle Sounders FC 2 at New England Revolution 1 Cct. 1, 2011 at Gillette Stadium (Foxborough, Mass.) Att: 21,022 Scoring - SEA - Montero 36’, Montero (Jaqua) 47’ NE - Fagundez (Feilhaber) 35’ Shots Saves Fouls Offsides Corners SEA 10 6 17 3 1 NE 23 1 8 2 5 SEA Cautions: Montero 29’

Seattle Sounders FC 3 at Vancouver WhitecapsFC 1 Sept. 24, 2011 at Empire Field (Vancouver, BC) Att: 21,000 Scoring - SEA - Evans (PK) 33’, Montero 63’, Montero (Evans) 67’ VAN - Camilo (Chiumiento, Hassli) 22’ Shots Saves Fouls Offsides Corners SEA 21 6 9 1 5 VAN 17 5 15 1 7 SEA Cautions: Evans 30’, Parke 76’

Seattle Sounders FC 2 vs. San Jose Earthquakes 1 Cct. 15, 2011 on the XBOX Pitch at CenturyLink Field (Seattle, Wash.) Att: 64,140 Scoring - SEA - Ochoa (Rosales) 82’, Montero (Neagle, Evans) 87’ SJ - Wondolowski (Baca) 24’ Shots Saves Fouls Offsides Corners SEA 13 7 10 3 3 SJ 14 1 19 0 5 SEA Cautions: Ianni 48’

Seattle Sounders FC 3 at Chivas USA 1 Cct. 22, 2011 at The Home Depot Center (Carson, Calif.) Att: 22,137 Scoring - SEA - Own Goal (Boyens) 53’, Fernandez (Evans) 68’, Ochoa (Montero) 73’ CHV - Estupinan (Mondaini, Trujillo) 83’ Shots Saves Fouls Offsides Corners SEA 9 1 18 3 3 CHV 13 2 12 3 8 SEA Cautions: Levesque 40’, Evans 79’, Montero 80’

Seattle Sounders FC 0 vs. Philadelphia Union 2 Cct. 8, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 36,304 Scoring - SEA - None PHI - Adu (G. Farfan) 80’, Carroll (Le Toux) 70’ Shots Saves Fouls Offsides Corners SEA 13 2 9 1 8 PHI 6 2 10 1 5 SEA Cautions: Neagle 63’

2011 MLS GAME-BY-GAME LINEUPS vs. LA L, 0-1 March 15, 2011 G Keller D Riley D Hurtado D Parke D Gonzalez M Fernandez (Levesque 63’) M Alonso M Friberg M Zakuani (Montano 84’) F Montero F White (Neagle 79’)

at NY L, 0-1 March 19, 2011 G Keller D Riley D Hurtado D Parke D Gonzalez M Fernandez (Rosales 68’) M Alonso M Carrasco (Neagle 79’) M Friberg F Montero F White (Levesque 73’)

vs. HOU D, 1-1 March 25, 2011 G Keller D Scott D Ianni D Parke D Gonzalez M Friberg M Alonso M Evans (Rosales 71’) M Zakuani F Montero F White (Jaqua 61’)

at SJ D, 2-2 April 2, 2011 G Keller D Riley D Ianni D Parke D Gonzalez M Friberg (Fernandez 46’) M Alonso M Evans M Zakuani F Rosales (Estrada 83’) F White (Jaqua 66’)

vs. CHI W, 2-1 April 9, 2011 G Keller D Riley D Hurtado D Parke D Gonzalez M Friberg M Alonso M Evans M Zakuani F Rosales (Jaqua 64’) F White (Carrasco 81’)

at PHI D, 1-1 April 16, 2011 G Keller D Riley D Hurtado D Parke D Gonzalez (Montero 66’) M Friberg (Fernandez 78’) M Alonso M Evans M Zakuani F Rosales F White (Jaqua 67’)

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS GAME-BY-GAME LINEUPS at COL W, 1-0 April 22, 2011 G Keller D Riley D Hurtado D Ianni D Wahl M Rosales (Friberg 74’) M Alonso M Evans M Zakuani (Fernandez 9’, Gonzalez 82’) F Montero F White

vs. TOR W, 3-0 April 30, 2011 G Keller D Riley D Hurtado D Ianni D Wahl M Evans M Alonso M Friberg (Carrasco 80’) M Fernandez F Montero (Fucito 67’) F Jaqua (Levesque 72’)

at DC L, 1-2 May 4, 2011 G Keller D Riley (Rosales 59’) D Hurtado D Ianni D Wahl M Evans M Alonso M Friberg M Fernandez (Gonzalez 76’) F Montero F Jaqua (Levesque 64’)

vs. DAL at RSL at CHI L, 0-1 May 25, 2011 W, 2-1 May 28, 2011 D, 0-0 June 4, 2011 G Keller G Keller G Keller D Scott D Riley D Riley D Parke D Parke D Parke D Hurtado D Ianni D Hurtado D Gonzalez D Wahl D Wahl M Friberg M Friberg (Levesque 80’) M Evans M Alonso M Alonso M Alonso M Rosales (Neagle 83’) M Evans M Rosales (Levesque 67’) M Fernandez (Levesque 64’) M Fernandez (Neagle 18’) M Neagle F Montero (Jaqua 75’) F Fucito (Montero 70’) F Fucito (Carrasco 81’) F Fucito F Jaqua F Jaqua (Montero 54’)

at CLB vs. POR D, 1-1 May 7, 2011 D, 1-1 May 14, 2011 G Keller G Keller D Riley D Riley D Parke D Ianni D Ianni D Hurtado D Gonzalez D Wahl M Friberg (Jaqua 66’) M Evans (Levesque 42’) M Alonso M Alonso M Carrasco M Carrasco M Fernandez (Neagle 89’) M Fernandez F Montero (Fucito 84’) F Montero F Levesque F Jaqua (Neagle 79’) vs. VAN D, 2-2 June 11, 2011 G Keller D Riley D Parke D Hurtado D Wahl M Evans M Alonso M Rosales (Friberg 83’) M Neagle (Jaqua 59’) F Fucito (Montano 65’) F Montero

at TOR vs. NY W, 1-0 June 18, 2011 W, 4-2 June 23, 2011 G Keller G Keller D Riley D Riley D Parke D Parke D Hurtado D Scott D Wahl D Gonzalez M Rosales M Rosales M Alonso M Alonso M Evans (Friberg 71’) M Friberg M Neagle (Scott 52’) M Fernandez (Carrasco 72’) F Fucito (Fernandez 69’) F Fucito (Levesque 58’) F Montero F Montero (Jaqua 81’)

vs. NE at LA at POR vs. COL at HOU W, 2-1 June 26, 2011 D, 0-0 July 4, 2011 W, 3-2 July 10, 2011 W, 4-3 July 16, 2011 L, 1-3 July 30, 2011 G Keller G Keller G Keller G Keller G Keller D Riley D Riley D Riley D Riley D Riley D Parke (Ianni 17’) D Parke D Parke D Parke D Parke D Hurtado D Hurtado D Hurtado (Ianni 57’) D Ianni D Ianni D Wahl D Wahl D Wahl D Wahl D Wahl M Neagle M Rosales (Neagle 93+) M Rosales M Rosales M Rosales M Carrasco M Alonso M Alonso M Alonso M Alonso M Friberg M Friberg M Friberg M Friberg (Evans 73’) M Friberg M Fernandez (Noonan 69’) M Fernandez (Noonan 71’) M Fernandez (Neagle 66’) M Fernandez (Neagle 71’) M Fernandez (Fucito 78’) F Levesque F Levesque F Levesque F Levesque F Levesque (Jaqua 57’) F Rosales (Jaqua 89’) F Montero (Evans 61’) F Montero (Noonan 89’) F Montero (Jaqua 89’) F Montero (Noonan 67’) vs. CHV D, 0-0 Aug, 13, 2011 G Keller D Riley D Parke D Scott D Wahl M Rosales M Alonso M Friberg M Fernandez F Noonan (Jaqua 69’) F Montero (Neagle 83’)

at DAL W, 1-0 Aug. 20, 2011 G Keller D Scott D Parke D Hurtado D Gonzalez M Rosales M Alonso M Friberg (Evans 63’) M Neagle F Fucito (Noonan 78’) F Montero (Fernandez 68’)

vs. CLB W, 6-2 Aug. 27, 2011 G Keller D Riley D Parke (Scott 75’) D Hurtado D Wahl M Rosales (Fernandez 71’) M Alonso M Friberg M Neagle F Fucito (Jaqua 78’) F Montero

at NE W, 2-1 Oct. 1, 2011 G Keller D Levesque D Scott D Ianni D Wahl M Carrasco M Friberg (Alonso 68’) M Fernandez (Neagle 45’) M Estrada F Jaqua F Montero (Fucito 68’)

vs. PHI L, 0-2 Oct. 8, 2011 G Keller D Riley D Parke (Ianni 46’) D Hurtado D Wahl M Evans M Alonso M Friberg M Neagle F Fucito (Jaqua 68’) F Noonan (Ochoa 62’)

vs. SJ at CHV W, 2-1 Oct. 15, 2011 W, 3-1 Oct. 22, 2011 G Keller G Keller D Riley D Riley D Ianni D Parke D Hurtado D Hurtado D Wahl D Gonzalez (Wahl 82’) M Evans M Rosales (Levesque 11’) M Alonso M Alonso M Fernandez (Ochoa 68’) M Evans M Neagle (Scott 89’) M Fernandez F Fucito (Rosales 64’) F Fucito (Ochoa 65’) F Montero F Montero

vs. KC W, 1-0 May 21, 2011 G Keller D Riley D Parke D Hurtado D Wahl M Carrasco (Jaqua 55’) M Alonso M Rosales (Fucito 69’) M Fernandez F Montero (Ianni 94+) F Levesque

at KC W, 2-1 Aug. 6, 2011 G Keller D Riley D Parke D Scott D Wahl M Rosales M Alonso M Carrasco M Fernandez (Noonan 55’) F Levesque (Neagle 68’) F Montero (Fucito 55’)

vs. RSL vs. DC at VAN L, 1-2 Sept. 10, 2011 W, 3-0 Sept. 17, 2011 W, 3-1 Sept. 24, 2011 G Keller G Keller G Keller D Riley D Riley D Gonzalez D Parke D Parke D Hurtado D Hurtado D Scott D Parke D Wahl D Wahl D Scott M Rosales M Rosales M Alonso M Alonso M Alonso M Evans M Friberg (Carrasco 31’) M Evans (Sangyang ‘82) M Fernandez (Estrada ‘80) M Fernandez (Neagle 65’) M Fernandez (Neagle 65’) M Neagle F Fucito (Noonan 73’) F Fucito (Noonan 73’) F Jaqua (Ochoa 67’) F Montero F Montero F Montero

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS GAME-BY-GAME RECAPS Sounders FC 0 vs. LA Galaxy 1 - March 15, 2011 (Xbox Pitch at CenturyLink Field) • Galaxy got game-winner in the 58th minute when Juninho capitalized on defensive lapse, firing off the outstretched hands of Kasey Keller from 30 yards. Todd Dunivant assisted • Seattle almost equalized several times in the second half, most notably by Osvaldo Alonso in the 61st and O’Brian White in the 72nd • Crowd of 36,433 was the highest for a Seattle MLS home match, and fans contributed $22,000 to the American Red Cross for Japan earthquake and Pacific tsunami relief Seattle Sounders FC 0 at New York Red Bulls 1 - March 19, 2011 (Red Bull Arena) • Juan Agudelo scored the game-winner in the second half as Seattle Sounders FC fell to the New York Red Bulls • Sounders FC’s first loss at New York • Agudelo scored in the 70th minute after chasing down a long ball from Teemu Tainio. It was Agudelo's first career MLS goal • Kasey Keller blocked a Thierry Henry PK in the 8th minute Seattle Sounders FC 1 vs. Houston Dynamo 1 - March 25, 2011 (Xbox Pitch at CenturyLink Field) • Steve Zakuani's 80th minute equalizer earned Seattle Sounders FC a draw in front of 36,204 fans • First goal of the season for Sounders FC • Sounders FC had team record 26 shots—six more than the previous mark—and set a new standard with 15 coming in the first half • Seattle tied its record for corner kicks with 12 Seattle Sounders FC 2 at San Jose Earthquakes 2 - April 2, 2011 (Buck Shaw Stadium) • First-half goals from Brad Evans and O'Brian White provided the offense for Seattle Sounders FC in a draw against the Earthquakes • First goal for Evans since the opening match of 2010 after missing the second half of last season with a knee injury • Kasey Keller's quick reactions saved Sounders FC twice in the first half including a left handed denial on last year's MLS scoring king Chris Wondolowski in the 9th minute Seattle Sounders FC 2 vs. Chicago Fire 1 - April 9, 2011 (Xbox Pitch at CenturyLink Field) • Steve Zakuani got the game winning goal in the 25th minute goal by slipping the ball inside the near left post after a give-and-go with O’Brian White • Marked the third straight win for Sounderrs FC against the Fire • The first two goals of the match came less than two minutes apart—the 7th minute White scored in his second consecutive match when a Mauro Rosales cross found him for a header from 10 yards. Chicago equalized in the 8th minute Seattle Sounders FC 1 at Philadelphia Union 1 - April 16, 2011 (PPL Park) • Alvaro Fernandez tied the game in the first minute of stoppage time with a short header after Fredy Montero chipped him the ball on a possession that started with a Mauro Rosales corner • Montero made his return following a two-game absence for surgery to repair a broken right wrist Seattle Sounders FC 1 at Colorado Rapids 0 - April 22, 2011 (Dick’s Sporting Goods Park) • Seattle got the early winner the 19th minute on a counter-attack when O’Brian White passed to a streaking Mauro Rosales on the left side, who fed Fredy Montero for a his first goal of the season on a one-touch ball past Colorado goalkeeper Matt Pickens into the right corner of the net • Extended Seattle’s unbeaten streak to five games • Steve Zakuani suffered a broken leg minutes into the match on hard tackle that resulted in a red card for Colorado’s Brian Mullan. Zakuani sat the remainder of the season • White’s last appearance of the season before undergoing surgery to remove a blood clot in his leg Seattle Sounders FC 3 vs. Toronto FC 0 - April 30, 2011 (Xbox Pitch at CenturyLink Field) • Brad Evans scored twice and added an assist as Seattle extended its unbeaten streak to six games • First career multi-goal game for Evans • Alvaro Fernandez scored Seattle's opening goal in the 9th minute when he headed in a long cross from Evans past keeper Stefan Frei. James Riley also credited with an assist on the play • Both Evans goals came in the second half. In the 52nd minute Jhon Kennedy Hurtado broke up a play at midfield and played to Montero, who sent Evans into the right side of the box for a 17-yard blast to the far corner. He converted a PK in the 75th minute

Seattle Sounders FC 1 at DC United 2 - May 4, 2011 (RFK Stadium) • DC’s Charlie Davies and Josh Wolff each registered a goal and an assist to give Seattle its first loss since March 19 • In the 71st minute, Brad Evans converted a PK in his second straight game--his fourth goal of the season and third in his last two games Seattle Sounders FC 1 at Columbus Crew 1 - May 7, 2011 (Crew Stadium) • Fredy Montero in the 7th minute when his header ricocheted off the near post and into the back of the net. Erik Friberg assisted on the goal • Kasey Keller made five saves, including a diving save on a free kick in the first minute of stoppage time. The Crew’s lone goal came on a PK in the 67th minute • Servando Carrasco, Montero, Leo Gonzalez, Alvaro Fernandez, and Roger Levesque were all issued yellow cards for Seattle. The five yellow cards is a team record and more than the past four games combined Seattle Sounders FC 1 vs. Portland Timbers 1 - May 14, 2011 (Xbox Pitch at CenturyLink Field) • Seattle scored its lone goal in the 52nd minute when Alvaro Fernandez pounded in a left-footed shot from 12 yards after chesting a short pass from Fredy Montero. Roger Levesque also assisted • Portland’s Mamadou Danso equalized in the 65th minute • Initial MLS meeting between the two rivals and first of four Cascadia Cup fixtures in a match played in heavy rain in front of a Sounders FC home MLS regular season record 36,593 fans and a national television audience Seattle Sounders FC 1 vs. Sporting Kansas City 0 - May 21, 2011 (Xbox Pitch at CenturyLink Field) • Jeff Parke's game-winner for Seattle came in the third minute of stoppage time when a Tyson Wahl corner kick found Parke in the box, who managed to slip through the defense of Kansas City and connect with an 8-yard header that snuck inside the far post • With the victory, Sounders FC jumped from fifth to second in the MLS Western Conference standings and extended its unbeaten streak to three games • Parke's first Sounders FC goal and his first overall since June 12, 2004, his rookie year with New York. Parke has two goals in his seven MLS seasons. This his first game-winner • First assist of the season for Wahl and the first game-winning assist of his career Seattle Sounders FC 0 vs. FC Dallas 1 - May 25, 2011 (Xbox Pitch at CenturyLink Field) • Sounders FC controlled much of the game and created numerous chances, but was unable to capitalize in a game where Brek Shea's first-half goal proved to be the winner for FC Dallas • Second loss in 11 games for Sounders FC • Seattle held the advantage in shots (19-7) and shots on goal (6-2), forcing FC Dallas keeper Kevin Hartman to make four saves Seattle Sounders FC 2 at Real Salt Lake 1 - May 28, 2011 (Rio Tinto Stadium) • Lamar Neagle scored the game-winner in the 84th minute--his first-career MLS goal--after controlling a ball at the top corner of the box, then turning and firing a shot that ricocheted off the corner of the crossbar and into the goal • In the 72nd minute, Patrick Ianni put Seattle up 1-0 when Fredy Montero and Nate Jaqua assisted on a sequence that started with a Tyson Wahl corner kick. Third career goal for Ianni • RSL played a man down most of the second half after a Jamison Olave red card in the 58th minute Seattle Sounders FC 0 at Chicago Fire 0 - June 4, 2011 (Toyota Park) • Strong first-half goalkeeping from Seattle Sounders FC's Kasey Keller earned the Rave Green a draw against the Chicago Fire • Seattle is an undefeated 3-0-3 against Chicago • Keller finished the contest with five saves, including three key first half stops. • Keller’s fourth shutout of the season and 25th of his MLS career

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS GAME-BY-GAME RECAPS Seattle Sounders FC 2 vs. Vancouver Whitecaps 2 - June 11, 2011 (Xbox Pitch at CenturyLink Field) • Second-half goals from Mauro Rosales and Osvaldo Alonso were not enough to overcome late game heroics and a first-half PK from Eric Hassli • In the 81st minute, Sounders FC equalized the score at 1-1 when a Tyson Wahl pass was deflected off the head of a Vancouver defender to Rosales at the front of the goal, who pounded it into the back of the net for his first goal in MLS play • Sounders FC pulled ahead in the 84th minute when Alonso collected a steal at the top of the box, played the ball to his left foot and fired a shot past Vancouver goalkeeper Joe Cannon, giving Seattle the 2-1 lead • Hassli's acrobatic equalizer came a minute later when he placed a twisting half-volley from the right side of the box just inside the far post for his second goal of the night. He also converted a PK in the 29th minute to put Vancouver up 1-0 • Initial meeting between the two MLS clubs Seattle Sounders FC 1 at Toronto FC 0 - June 18, 2011 (BMO Field) • In the final minute of regulation, Fredy Montero scored on free kick rom 22 yards out that bent around the Toronto defensive wall into the upper right corner of the goal. The play was set up when Toronto’s Ty Harden fouled Mauro Rosales from behind • Sounders FC played nearly the entire second half a man down after Jhon Kennedy Hurtado received his second yellow card of the match in the 49th minute. It was Seattle’s first man-down victory in the club's history in MLS • Kasey Keller’s fifth clean sheet of the season and third in his previous six Seattle Sounders FC 4 vs. New York Red Bulls 2 - June 23, 2011 (Xbox Pitch at CenturyLink Field) • Sounders FC matched a team-record with four goals • After subbing in for Mike Fucito in the 58th minute, Rover Levesque headed in a Leo Gonzalez corner kick in the 67th minute and took the ball from NY keeper Greg Sutton’s feet at the top of the box in the 78th minute and knocked it into the empty net for his first two goals of the season • Seattle extended its unbeaten streak to five matches and moved into a tie for second place in the Western Conference standings with FC Dallas • The Rave Green scored the fastest two goals in club history, in addition to scoring the quickest back-to-back goals. In the 11th minute, Erik Friberg controlled a deflected corner at the top of the box and bent it around several defenders and into the right corner of the net for his first MLS goal. In the 12th, Osvaldo Alonso cracked a left-footed half-volley from the top of the box that skipped off the turf and through New York's defense and into the net for his second goal of the season Seattle Sounders FC 2 vs. New England Revolution 1 - June 26, 2011 (Xbox Pitch at Century Link Field) • Tyson Wahl and Alvaro Fernandez scored six minutes apart as Sounders FC picked up their third-straight win, extending their unbeaten streak to six games • After going down 1-0 on a Sainey Nyassi goal in the third minute, Seattle evened the score on a Wahl direct free kick in the 34th minute that bent around the wall and into the upper left corner. It was Wahl’s first career MLS goal • Seattle's winner started off of a quick counter-attack when Mauro Rosales fed Roger Levesque, who quickly found Fernandez open on the left for a goal from 12 yards out Seattle Sounders FC 0 at LA Galaxy 0 - July 4, 2011 (Home Depot Center) • Kasey Keller recorded his 27th career shutout in his 75th straight start as Seattle Sounders FC extended their unbeaten streak to seven matches • Third-string Galaxy goalkeeper Brian Perk recorded two saves, including a PK stop of Fredy Montero in the 18th minute. It was the MLS debut for Perk, who started in place of injured starter Donovan Ricketts and suspended back-up Josh Saunders Seattle Sounders FC 3 at Portland Timbers 2 - July 10, 2011 (JELD-WEN Field) • Seattle’s game-winner came in the 83rd minute when Osvaldo Alonso put away a PK low and to his right, past keeper Troy Perkins. Portland’s Eric Brunner took down Lamar Neagle in the box to set up the play • Fredy Montero scored two second-half equalizing goals. The first came in the 57th minute when he cracked a 27-yard free kick over the wall of Portland defenders and into the corner of the net. The second came in the 74th on assists from Mauro Rosales and Lamar Neagle • Portland went up on goals in the 46th minute and 70th minute • Sounders FC extended their club-record unbeaten streak to eight straight matches (5-0-3) and surpassed FC Dallas to move into sole possession of second place in the Western Conference

Seattle Sounders FC 4 vs. Colorado Rapids 3 - Saturday, July 16, 2011 (Xbox Pitch at Century Link Field) • Fredy Montero and Mauro Rosales goals in the final eight minutes spurred a comeback win and pulled Seattle within a point of the league-leading L.A. Galaxy • Alvaro Fernandez and Roger Levesque also scored for Sounders FC, who won their third straight MLS home match and extended their unbeaten streak to nine games (6-0-3) • Sounders FC collected 13 shots with nine of them coming on goal. The Rapids racked up 13 shots as well, but just four on goal Seattle Sounders FC 1 at Houston Dynamo 3 – July 30, 2011 (Robertson Stadium) • Brian Ching netted a brace and Colin Clark added a goal and an assist for the Dynam as Sounders FC saw its club record nine-game unbeaten streak end • Alvaro Fernandez converted a PK in the 37th minute Seattle Sounders FC 2 at Sporting Kansas City 1 – August 6, 2011 (LIVESTRONG Sporting Park) • Sounders FC came back in dramatic style as Mauro Rosales scored an equalizer in the 90th minute and assisted on a Lamar Neagle game-winner in stoppage time • Snapped Sporting Kansas City's league-best 14-game unbeaten streak and became the first MLS side to win at LIVESTRONG Sporting Park • Sounders FC head coach Sigi Schmid became the first in MLS history to reach 150 career victories • Mike Fucito’s assist on Neagle’s goal was his first point in MLS since scoring the winner against Kansas City on April 17, 2010 • Seattle played with a one-man advantage for the final 31 minutes after Omar Bravo was sent off in the 59th minute for a hard tackle on Pat Noonan Seattle Sounders FC 0 vs. Chivas USA 0 – August 13, 2011 (Xbox Pitch at CenturyLink Field) • Seattle finished with a 10-4 advantage in shots and Kasey Keller collected his 28th career shutout • Alvaro Fernandez had the game's best scoring opportunity when his PK in the 19th minute deflected off the left post • Five yellow cards were issued in the game, with three going to the Goats Seattle Sounders FC 1 at Dallas FC 0 – August 20, 2011 (Pizza Hut Park) • Mauro Rosales scored in the 16th minute when Lamar Neagle found Fredy Montero in the middle of the pitch, who brought the ball forward and touched it to Rosales who was charging down the right side. Rosales slotted a low right-footed strike inside the post from 16 yards • Seattle’s first victory in Texas • Sounders FC played with a man advantage after Daniel Cruz was issued his second yellow in the 56th minute. • Seattle's defense held strong as FC Dallas fired 25 total shots. Kasey Keller had four saves and posted his eighth shutout Seattle Sounders FC 6 vs. Columbus Crew 2 – August 27, 2011 (Xbox Pitch at CenturyLink Field) • Seattle’s six goals and four first half goals both broke team records • Lamar Neagle scored a hat trick, his first two strikes coming in the first 21 minutes of play. His third came in the 70th when maneuvered up the left side and blasted a shot that ricocheted off the crossbar and bounced down across the line, boosting the lead to 5-1 • The 17 minutes between Seattle's first three goals marked the fastest time between three goals in club history. The previous best was 19 minutes between three goals scored against DC United in 2009 • Mauro Rosales had two assists in the game and converted a PK to make it 2-0 in the 16th minute • Mike Fucito’s goal in the 40th minute was his first MLS goal since ousting Kansas City in stoppage time in 2010 • It was the first time Columbus has allowed four goals in a match since Seattle scored four at Columbus last year

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS GAME-BY-GAME RECAPS Seattle Sounders FC 1 vs. Real Salt Lake 2 – September 10, 2011 (Xbox Pitch at CenturyLink Field) • Seattle Sounders FC could not overcome a go-ahead, early second-half strike by forward Alvaro Saborio in a game that had both sides playing with ten men • In the 35th minute, Real Salt Lake's Tony Beltran was issued his second yellow card and was ejected after a hard foul on Rosales. In the 39th, Sounders FC defender Jhon Kennedy Hurtado was issued a straight red card after the referee ruled Hurtado elbowed Saborio • Real Salt Lake got on the scoreboard first as a result of an own goal by Seattle in the 13th minute • Seattle’s equalizer came in first-half stoppage time when Mauro Rosales maneuvered into the left side of box and saw his pass skip through to Fredy Montero, who struck it past Real Salt Lake goalkeeper Nick Rimando for his seventh goal of the season Seattle Sounders FC 3 vs. DC United 0 – September 17, 2011 (Xbox Pitch at CenturyLink Field) • Mike Fucito put Seattle on the board in the 35th minute, while Kasey Keller matched his season-high with six saves en route to his ninth shutout • Alvaro Fernandez added two goals--one in first half stoppage time that was assisted by Rosales and Fredy Montero, and another in the 60th minute when he put-back a Montero header that was blocked by keeper Joe Willis • Rosales established a new Seattle season record for assists on the first goal, breaking Montero’s record of 10, set last year. He was helped from the field in the 89th minute after spraining his MCL on a foul from behind by Daniel Woolard Seattle Sounders FC 3 at Vancouver Whitecaps 1 – September 24, 2011 (Empire Field) • A pair of Fredy Montero goals in the second half was the difference in a win that clinched the Cascadia Cup for Seattle • Final game at Vancouver's Empire Field • After the Whitecaps took a 1-0 lead in the 22nd minute on a Camilo goal, the Rave Green tied the score before the half on a Brad Evans PK in the 32nd minute • In a four-minute span, Montero made the game 3-1. In the 63rd minute, he controlled a bouncing ball at the top of the box, faked a shot with his right foot, cut to his left, then shot with his left foot into the top left corner of the net. In the 67th, his shot from the top of the box and was deflected by a Vancouver defender up and over the reach of keeper Joe Cannon • Sammy Ochoa made his MLS debut when he subbed in for Nate Jaqua in the 66th minute, then almost scored in the 85th when he headed a Montero free kick off the right post Seattle Sounders FC 2 at New England Revolution 1 – October 1, 2011 (Gillette Stadium) • Fredy Montero’s second consecutive brace, a first in his career, powered Sounders FC in a comeback victory • The equalizer came just a minute after New England went up 1-0 in the 35th when Montero took advantage of a misplayed ball by the Revolution defense. The game-winner came in the 48th minute after David Estrada's shot was deflected up the air, then chested down by Nate Jaqua to set up Montero, who poked it past keeper Matt Reis Seattle Sounders FC 0 vs. Philadelphia Union 2 – October 8, 2011 (Xbox Pitch at CenturyLink Field) • A goal by Freddy Adu in the 60th minute broke a scoreless tie as the Union snapped Seattle’s three-game winning streak and eliminated them from contention for the Supporter’s Shield • Brian Carrol’s goal in the 70th minute was assisted by former-Sounder Sebastien Le Toux • Seattle played without its top three point producers: forward Fredy Montero (yellow card accumulation) and midfielders Alvaro Fernandez (concussion) and Mauro Rosales (MCL sprain) • Sounders FC defender Jeff Parke was removed from the match at halftime with a concussion

Seattle Sounders FC 2 vs. San Jose Earthquakes 1 – October 15, 2011 (Xbox Pitch at Century Link Field) • Two late goals from Sammy Ochoa and Fredy Montero provided Sounders FC a dramatic 2-1 comeback victory before a crowd of 64,140, the thirdlargest single-game crowd in MLS history • Goalkeeper Kasey Keller, who will retire at the end of the season, made a season-high seven saves to keep Seattle within reach, and was honored in a postgame tribute following his final home regular season match. The Rave Green's captain thrilled the throng on one frenetic series in the 65th minute when he made a double save on Chris Wondolowski and Simon Dawkins, then slapped another ball away from Wondolowski's feet • Wondolowski put SJ up 1-0 after scoring his 15th goal of the season in the 24th minute • Mauro Rosales returned from a three-game absence (sprained MCL) when he came off the bench in the 64th minute and assisted on Ochoa's equalizer in the 82nd minute. It was Ochoa’s first MLS goal • Montero scored the game-winner in the 87th minute when took a short feed from Lamar Neagle and beat keeper Joe Busch to the right corner from 12 yards. Brad Evans also assisted on the play. Montero tied his team record with 12 goals • Seattle finished the season with an average of 38,498 fans per game, setting the MLS record for the third year in a row Seattle Sounders FC 3 at Chivas USA 1 – October 22, 2011 (Home Depot Center) • Second half goals by Alvaro Fernandez and Sammy Ochoa propelled Sounders FC in the final MLS regular season game of the season • A Chivas own goal in the 53rd minute broke a scoreless tie and put Seattle up 1-0 • In the 68th minute, Fernandez got behind the defense on the left side and converted a well-placed pass from Brad Evans into the top right corner of the net. In the 73rd, Ochoa knocked a diving-header past keeper Dan Kennedy on a cross from Fredy Montero. • Montero finished the season having scored or assisted in his last eight games • Mauro Rosales made his first start since September 17 game against D.C. United when he sprained his MCL. He left the game in the seventh minute after suffering a right knee injury on a foul by Ben Zemanski. Zemanski was issued a yellow card for the foul

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 CONCACAF CHAMPIONS LEAGUE STATISTICS UNF POS 17 F 15 M 2 F 6 M 21 F 3 M 12 D 23 M 10 M 24 F 25 F 7 D 18 G 20 D 4 D 31 D 27 M 34 D 8 M 28 G 5 D 30 M 19 F 35 G 16 M 29 G 26 D 32 M 22 M 14 D 13 F 11 M

PLAYER GP Fredy Montero 7 Alvaro Fernandez 6 Mike Fucito 4 Osvaldo Alonso 6 Nate Jaqua 6 Brad Evans 2 Leo Gonzalez 6 Servando Carrasco 6 Mauro Rosales 3 Roger Levesque 6 Pat Noonan 5 James Riley 6 Kasey Keller 5 Zach Scott 7 Patrick Ianni 5 Jeff Parke 5 Lamar Neagle 7 Jhon Kennedy Hurtado4 Erik Friberg 4 Terry Boss 2 Tyson Wahl 3 Amadou Sanyang 3 Sammy Ochoa 3 Bryan Meredith 1 David Estrada 1 Josh Ford 0 Taylor Graham 0 Miguel Montano 0 Mike Seamon 0 Michael Tetteh 0 O'Brian White 0 Steve Zakuani 0 Own Goals Received Team totals 8 Opponent totals 8

GS 6 5 2 4 3 2 5 4 2 5 3 5 5 6 4 5 5 4 4 2 3 1 1 1 1 0 0 0 0 0 0 0

MIN 577 489 204 489 281 180 479 384 237 384 281 481 480 569 377 457 295 360 350 180 270 69 114 90 79 0 0 0 0 0 0 0

8 8

750 750

G 3 2 2 2 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 12 8

A 2 3 1 0 2 1 1 1 1 2 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

SHT 39 11 7 14 8 5 2 2 3 2 5 0 0 1 1 2 10 1 1 0 1 0 3 0 1 0 0 0 0 0 0 0

SOG 12 7 5 4 2 2 0 0 0 2 1 0 0 0 1 1 3 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0

FC/FS 10/13 10/11 2/3 8/7 12/5 1/1 14/8 4/3 3/9 4/5 2/5 6/2 0/0 14/4 3/1 2/4 8/3 5/1 6/2 0/0 2/1 2/2 3/1 0/0 1/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0

OFF 2 0 2 0 0 0 0 0 1 3 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

15 3

119 88

42 33

122/106 17 106/122 28

CK 10 0 7 0 0 1 0 6 9 0 0 0 0 0 0 0 1 0 1 0 3 0 2 0 0 0 0 0 0 0 0 0

C/E 0/0 2/0 0/0 2/0 1/0 0/0 1/0 0/0 1/0 0/0 0/0 1/0 1/0 2/0 2/0 1/0 1/1 2/0 1/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0

41 28

18/1 20/1

GP-games played; GS-goals scored; MIN-minutes; G-goals; A-assists; SHTS-shots; SOG-shots on goal; FC-fouls committed; FS-fouls suffered; OFF-offside; CK-corner kicks; C/E-cards/ejections

GAME-WINNING GOALS: Alvaro Fernandez 1, Mike Fucito 1, Nate Jaqua 1, Fredy Montero 1 GAME-WINNING ASSISTS: Alvaro Fernandez 2, Servando Carrasco 1, Nate Jaqua 1, Roger Levesque 1, Fredy Montero 1, Pat Noonan 1, Mauro Rosales 1 PENALTY KICK GOALS/ATTEMPTS: 0/0 SEATTLE SOUNDERS FC INDIVIDUAL GOALKEEPING UNF POS GOALKEEPER GP GS MIN SHTS SV GA GAA PG PA W -L-T 18 G Kasey Keller 5 5 480 18 15 5 1.00 2 2 2-2-1 28 G Terry Boss 2 2 180 7 6 1 0.50 0 0 2-0-0 35 G Bryan Meredith 1 1 90 3 1 2 2.00 0 0 0-1-0 Team totals 8 8 750 28 22 8 1.00 2 2 4-3-1 Opponent totals 8 8 750 37 29 12 1.50 0 0 3-4-1

SO 1 1 0 2 2

GP-games played;GS-goals scored;MIN-minutes;SHTS-shots;SV-saves;GA-goals allowed;GAA-goals against avg.;PG-penalty goals;PA-penalty attempts;W/L/T-wins/losses.ties;SO-shutouts

2011 CONCACAF CHAMPIONS LEAGUE RESULTS Day Date Tues.7/26 Weds.8/3 Tues.8/16

Opponent at San Francisco FC (Panama City) vs. San Francisco FC (Seattle) vs. Comunicaciones (Seattle)

Round Play-in/leg 1 Play-in/leg 2 Group/rd. 1

Result L W W

Score 0-1 2-0 4-1

Attend. N/A 21,233 10,017

Record 0-1-0 1-1-0 2-1-0

Tues.8/23 at Monterrey (Monterrey, Mex.) Group/rd. 2 Weds.9/14 at Herediano (Alajuela, C.R.) Group/rd. 3

W W

1-0 2-1

N/A 2,000

3-1-0 4-1-0

Tues.9/20 Tues. 9/27

L D

0-1 2-2

10,163 4-2-0 N/A 4-2-1

L

2-1

15,866 4-3-1

vs. Herediano (Seattle) Group/rd. 4 at Comunicaciones (Guatemala)Group/rd. 5

Tues.10/18 vs. Monterrey (Seattle)

Group/rd. 6

Goal scorers SFR: Brown (28) SEA: Fernandez (41), Jaqua (98) SEA: Evans (35), Fucito (61, 67), Own Goal (87); COM: Arreola (2) SEA: Fernandez (38) SEA: Montero (3, 54); CSH: Cancela (46) CSH: Arias (25) SEA: Alonso (44, 89) COM: Montepeque (7), Morales(64) SEA: Montero (42) MNT: Carreno (3), Delgado (61)

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 U.S. OPEN CUP STATISTICS UNF POS 17 F 2 F 21 F 6 M 27 M 15 M 31 D 25 F 12 D 20 D 28 G 3 M 34 D 18 G 7 D 4 D 32 M 26 D 14 D 10 M 22 M 8 M 16 M 24 F 23 M 29 G 19 F 30 M 5 D 13 F 11 M

PLAYER GP Fredy Montero 3 Mike Fucito 4 Nate Jaqua 2 Osvaldo Alonso 4 Lamar Neagle 3 Alvaro Fernandez 3 Jeff Parke 4 Pat Noonan 3 Leo Gonzalez 4 Zach Scott 3 Terry Boss 2 Brad Evans 2 Jhon Kennedy Hurtado 2 Kasey Keller 2 James Riley 2 Patrick Ianni 1 Miguel Montano 1 Taylor Graham 1 Michael Tetteh 1 Mauro Rosales 1 Mike Seamon 1 Erik Friberg 2 David Estrada 1 Roger Levesque 2 Servando Carrasco 1 Josh Ford 0 Sammy Ochoa 0 Amadou Sanyang 0 Tyson Wahl 0 O'Brian White 0 Steve Zakuani 0 Team totals 4 Opponent totals 4

GS 3 2 2 4 2 3 3 2 4 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 4 4

MIN 258 192 161 360 186 219 292 166 360 270 180 180 180 180 91 90 90 90 90 90 85 71 54 20 5 0 0 0 0 0 0 360 360

G 3 2 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8 2

A 0 0 2 0 0 2 1 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6 2

SHT 11 11 10 8 8 3 2 3 2 5 0 3 1 0 0 0 5 0 2 3 1 3 1 2 0 0 0 0 0 0 0 85 40

SOG 4 4 4 2 3 2 2 0 1 2 0 2 0 0 0 0 2 0 0 2 0 2 0 0 0 0 0 0 0 0 0 31 13

FC/FS 7/6 6/4 3/3 4/8 3/3 4/5 3/1 1/1 7/4 3/1 0/0 3/3 4/2 0/0 1/2 0/0 0/2 0/0 1/0 0/1 0/0 0/0 0/0 0/1 0/0 0/0 0/0 0/0 0/0 0/0 0/0 49/50 50/49

OFF 2 2 0 0 0 0 0 1 0 0 0 0 0 0 0 0 2 0 1 0 0 0 0 0 0 0 0 0 0 0 0 8 8

CK 0 7 0 0 5 0 0 3 0 0 0 0 0 0 0 0 4 0 0 4 0 1 0 0 0 0 0 0 0 0 0 24 23

C/E 1/0 1/0 0/0 2/0 0/0 0/0 1/0 0/0 1/0 0/0 0/0 1/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 7/0 10/1

GP-games played; GS-goals scored; MIN-minutes; G-goals; A-assists; SHTS-shots; SOG-shots on goal; FC-fouls committed; FS-fouls suffered; OFF-offside; CK-corner kicks; C/E-cards/ejections

GAME-WINNING GOALS: Fredy Montero 3, Mike Fucito 1 GAME-WINNING ASSISTS: Alvaro Fernandez 1, Nate Jaqua 1, Jeff Parke 1 PENALTY KICK GOALS/ATTEMPTS: 0/0 SEATTLE SOUNDERS FC INDIVIDUAL GOALKEEPING UNF POS GOALKEEPER GP GS MIN 18 G Kasey Keller 2 2 180 28 G Terry Boss 2 2 180 Team totals 4 4 360 Opponent totals 4 4 360

SHTS 5 8 13 32

SV 5 5 10 24

GA 0 2 2 8

GAA 0.00 1.00 0.50 2.00

PG 0 0 0 0

PA 0 0 0 0

W -L-T 2-0-0 2-0-0 4-0-0 0-4-0

SO 2 0 2 0

GP-games played;GS-goals scored;MIN-minutes;SHTS-shots;SV-saves;GA-goals allowed;GAA-goals against avg.;PG-penalty goals;PA-penalty attempts;W/L/T-wins/losses.ties;SO-shutouts

2011 U.S. OPEN CUP RESULTS Day Date Opponent Round Tues. 6/28 vs. Kitsap Pumas (Tukwila, WA)USOC 3rd Rd Weds.7/13 vs. LA Galaxy (Tukwila, WA) USOC Qtrs.

Result Score W 2-1 W 3-1

Tues.8/30 Tues.10/4

W W

vs. FC Dallas (Tukwila, WA) vs. Chicago Fire (Seattle)

USOC Semis. USOC Final

1-0 2-0

Attend. Record Goal scorers 3,811 1-0-0 SEA: Fucito (39, 62); KIT: Besagno (71) 4,322 2-0-0 SEA: Jaqua (3), Montero (25), Neagle (74); LA: Cristman (40) 4,593 3-0-0 SEA: Montero (40) 35,615 4-0-0 SEA: Montero (78), Alonso (96+)

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 ALL COMPETITIONS STATISTICS UNF POS 17 F 15 M 3 M 6 M 2 F 27 M 10 M 24 F 21 F 13 F 11 M 8 M 5 D 31 D 4 D 19 F 7 D 12 D 25 F 34 D 23 M 18 G 20 D 28 G 32 M 35 G 26 D 14 D 22 M 30 M 16 M 29 G

PLAYER GP Fredy Montero 40 Alvaro Fernandez 38 Brad Evans 24 Osvaldo Alonso 43 Mike Fucito 27 Lamar Neagle 32 Mauro Rosales 30 Roger Levesque 27 Nate Jaqua 29 O'Brian White 7 Steve Zakuani 6 Erik Friberg 32 Tyson Wahl 26 Jeff Parke 37 Patrick Ianni 22 Sammy Ochoa 7 James Riley 37 Leo Gonzalez 24 Pat Noonan 17 Jhon Kennedy Hurtado 29 Servando Carrasco 19 Kasey Keller 41 Zach Scott 22 Terry Boss 4 Miguel Montano 3 Bryan Meredith 1 Taylor Graham 1 Michael Tetteh 1 Mike Seamon 1 Amadou Sanyang 4 David Estrada 5 Josh Ford 0 Own Goals Received: Own Goals Conceded: Team totals 46 Opponent totals 46

GS 36 31 21 40 17 17 25 15 13 7 6 28 25 36 17 2 35 21 7 29 11 41 18 4 1 1 1 1 1 1 3 0

MIN 3139 2497 1779 3730 1465 1589 2197 1466 1285 517 453 2334 2259 3136 2149 214 3151 1908 706 2485 1078 3720 1703 360 121 90 90 90 85 77 241 0

46 46

4170 4170

G 18 11 6 6 6 6 5 3 2 2 2 1 1 1 1 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 3 76 47

A 11 5 6 3 3 2 14 4 6 2 2 2 2 1 0 0 2 2 2 1 1 0 0 0 0 0 0 0 0 0 0 0

SHT 157 56 41 77 41 49 24 17 34 15 12 13 7 14 5 9 7 8 14 12 9 0 9 0 5 0 0 2 1 0 5 0

SOG 58 30 13 18 17 18 10 8 8 8 5 5 2 7 2 5 1 2 4 1 0 0 2 0 2 0 0 0 0 0 0 0

FC/FS 72/72 30/47 17/12 61/56 30/19 21/20 21/69 19/22 44/17 9/3 6/3 36/15 24/4 22/20 17/11 2/7 33/21 43/20 4/10 37/18 15/8 0/5 28/11 0/0 1/3 0/0 0/0 1/0 0/0 2/2 2/1 0/0

OFF 21 6 1 0 13 2 10 14 8 6 5 3 0 0 0 3 0 1 11 1 0 0 0 0 3 0 0 1 0 0 1 0

CK 18 3 1 5 22 14 79 0 0 0 0 29 31 0 0 0 0 1 3 0 13 0 0 0 4 0 0 0 0 0 0 0

C/E 8/0 5/0 3/0 11/0 3/0 2/1 3/0 3/0 3/0 0/0 0/0 5/0 5/0 4/0 4/0 0/0 4/0 7/0 0/0 6/2 5/0 1/0 4/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0 0/0

71 34

644 552

227 191

594/561 109 561/594 98

228 215

88/3 92/8

GP-games played; GS-goals scored; MIN-minutes; G-goals; A-assists; SHTS-shots; SOG-shots on goal; FC-fouls committed; FS-fouls suffered; OFF-offside; CK-corner kicks; C/E-cards/ejections

GAME-WINNING GOALS: Fredy Montero 9, Alvaro Fernandez 4, Mike Fucito 3, Lamar Neagle 3, Mauro Rosales 2, Osvaldo Alonso 1, Nate Jaqua 1, Roger Levesque 1, Jeff Parke 1, Steve Zakuani 1, GAME-WINNING ASSISTS: Mauro Rosales 6, Brad Evans 4, Fredy Montero 3, Alvaro Fernandez 3, James Riley 2, Tyson Wahl 2, O'Brian White 2, Servando Carrasco 1, Mike Fucito 1, Leo Gonzalez 1, Nate Jaqua 3, Roger Levesque 2, Lamar Neagle 1, Pat Noonan 1, Jeff Parke 1 PENALTY KICK GOALS/ATTEMPTS: Brad Evans 3-3, Alvaro Fernandez 1-2, Osvaldo Alonso 1-1, Mauro Rosales 1-2, Fredy Montero 0-1 SEATTLE SOUNDERS FC INDIVIDUAL GOALKEEPING UNF POS GOALKEEPER GP GS MIN SHTS SV GA GAA PG PA W -L-T SO 18 G Kasey Keller 41 41 3720 170 130 42 1.02 4 5 22-9-10 12 28 G Terry Boss 4 4 360 15 11 3 0.75 0 0 4-0-0 1 35 G Bryan Meredith 1 1 90 3 1 2 2.00 0 0 0-1-0 0 Team totals 46 46 4170 188 142 47 1.02 4 5 26-10-10 13 Opponent totals 46 46 4170 225 146 76 1.66 6 9 10-26-10 9 GP-games played;GS-goals scored;MIN-minutes;SHTS-shots;SV-saves;GA-goals allowed;GAA-goals against avg.;PG-penalty goals;PA-penalty attempts;W/L/T-wins/losses.ties;SO-shutouts

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 ALL COMPETITIONS RESULTS Day Date Tue. 3/15 Sat. 3/19 Fri. 3/25 Sat. 4/2

Opponent vs. L.A. Galaxy (Seattle) at New York (Harrison, NJ) vs. Houston Dynamo (Seattle) at San Jose (Santa Clara, CA)

Result L L D D

Score 0-1 0-1 1-1 2-2

Attend. 36,433 20,982 36,204 10,276

Record 0-1-0 0-2-0 0-2-1 0-2-2

Sat. 4/9 Sat. 4/16 Fri. 4/22 Sat. 4/30 Wed. 5/4 Sat. 5/7 Sat. 5/14 Sat. 5/21 Wed. 5/25 Sat. 5/28 Sat. 6/4 Sat. 6/11 Sat. 6/18 Thu. 6/23

vs. Chicago Fire (Seattle) at Philadelphia (Chester, PA) at Colorado (Commerce City, CO) vs. Toronto FC (Seattle) at D.C. United (Washington, D.C.) at Columbus (Columbus, OH) vs. Portland Timbers (Seattle) vs. Sporting KC (Seattle) vs. FC Dallas (Seattle) at Real Salt Lake (Sandy, UT) at Chicago Fire (Bridgeview, IL) vs. Vancouver (Seattle) at Toronto FC (Toronto, ON) vs. New York (Seattle)

W D W W L D D W L W D D W W

2-1 1-1 1-0 3-0 1-2 1-1 1-1 1-0 0-1 2-1 0-0 2-2 1-0 4-2

36,233 15,149 14,185 36,287 11,254 7,148 36,593 36.098 36,026 14,674 13,839 36,502 21,839 46,065

1-2-2 1-2-3 2-2-3 3-2-3 3-3-3 3-3-4 3-3-5 4-3-5 4-4-5 5-4-5 5-4-6 5-4-7 6-4-7 7-4-7

Sun. 6/26 Tues. 6/28 Mon. 7/4 Sun. 7/10

vs. New England (Seattle) vs. Kitsap Pumas (Tukwila, WA) at L.A. Galaxy (Carson, CA) at Portland Timbers (Portland, OR)

W W D W

2-1 2-1 0-0 3-2

36,212 3,811 27,000 18,627

8-4-7 9-4-7 9-4-8 10-4-8

Weds.7/13

vs. LA Galaxy (Tukwila, WA)

W

3-1

4,322

11-4-8

Sat.

vs. Colorado Rapids (Seattle)

W

4-3

36,424

12-4-8

Tues.7/26 Sat. 7/30 Weds. 8/3 Sat. 8/6 Sat. 8/13 Tues.8/16

at San Francisco FC (Panama City) at Houston Dynamo (Houston) vs. San Francisco FC (Seattle) at Sporting Kansas City (Kansas City) vs. Chivas USA (Seattle) vs. Comunicaciones (Seattle)

L L W W D W

0-1 1-3 2-0 2-1 0-0 4-1

N/A 18,465 21,233 17,493 36,364 10,017

12-5-8 12-6-8 13-6-8 14-6-8 14-6-9 15-6-9

Sat. 8/20 Tues.8/23 Sat. 8/27

at FC Dallas (Frisco, Texas) at Monterrey (Monterrey, Mex. vs. Columbus Crew (Seattle)

W W W

1-0 1-0 6-2

11,635 N/A 36,364

16-6-9 17-6-9 18-6-9

Tues.8/30 Sat. 9/10

vs. FC Dallas (Tukwila, WA) vs. Real Salt Lake (Seattle)

W L

1-0 1-2

4,593 35,940

19-6-9 19-7-9

Weds.9/14

at Herediano (Alajuela, C.R.)

W

2-1

2,000

20-7-9

Sat 9/17 Tues.9/20 Sat. 9/24

vs. D.C. United (Seattle) vs. Herediano (Seattle) at Vancouver (Vancouver, BC)

W L W

3-0 0-1 3-1

36,242 10,163 21,000

21-7-9 21-8-9 22-8-9

Tues. 9/27

at Comunicaciones (Guatemala)

D

2-2

N/A

22-8-10

Sat

at New England (Foxborough, MA)

W

2-1

21,022

23-8-10

Tues.10/4 Sat. 10/8 Sat. 10/15

vs. Chicago Fire (Seattle) vs. Philadelphia Union (Seattle) vs. San Jose (Seattle)

W L W

2-0 0-2 2-1

35,615 36,304 64,140

24-8-10 24-9-10 25-9-10

Tues.10/18 Sat.10/22

vs. CF Monterrey (Seattle) at Chivas USA (Carson, CA)

L W

1-2 3-1

15,866 22,137

25-10-10 26-10-10

7/16

10/1

Goal scorers LA: Juninho (58) NY: Agudelo (70) SEA: Zakuani (80); HOU; Cameron (42) SEA: Evans (17), White (42); SJ: Dawkins (32), Stephenson (50) SEA: White (7), Zakuani (25); CHI: Chaves (8) SEA: Fernandez (91); PHI: Ruiz (32) SEA: Montero (19) SEA: Fernandez (9), Evans (52, 75) SEA: Evans (71); DC: Wolff (31), Davies (52) SEA: Montero (7); CLB: Renteria (67) SEA: Fernandez (52); POR: Danso (65) SEA: Parke (93+) DAL: Shea (18) SEA: Ianni (72), Neagle (84); RSL: Gonzalez (87) None SEA: Rosales (81), Alonso (84); Hassli (29, 85) SEA: Montero (90) SEA: Friberg (11), Alonso (12), Levesque (67, 78); NY: Richards (31), Own Goal (58) SEA: Wahl (34), Fernandez (40); NE: Nyassi (3) SEA: Fucito (39, 62); KIT: Besagno (71) None SEA: Montero (57, 74), Alonso (83); POR: Own Goal (46), Perlaza (69) SEA: Jaqua (3), Montero (25), Neagle (74); LA: Cristman (40) SEA: Fernandez (7), Levesque (48), Montero (82), Rosales (84) COL: Thompson (1), Larentowicz (42), Folan (89) SFR: Brown (28) SEA: Fernandez (37); HOU: Clark (7), Ching (23, 70) SEA: Fernandez (41), Jaqua (98) SEA: Rosales (90), Neagle (92); KC: Kamara (20) None SEA: Evans (35), Fucito (61, 67), Own Goal (87); COM: Arreola (2) SEA: Rosales (16) SEA: Fernandez (38) SEA: Neagle (4, 21, 70), Rosales (16), Fucito (40), Own Goal (74); CLB: Cunningham (59), Gardner (73) SEA: Montero (40) SEA: Montero (47+); RSL: Own Goal (13), Saborio (56) SEA: Montero (3, 54); CSH: Cancela (46) SEA: Fucito (35), Fernandez (47+, 60) CSH: Arias (25) SEA: Evans (33), Montero (63, 67); VAN: Camilo (22) SEA: Alonso (44, 89) COM: Montepeque (7), Morales(64) SEA: Montero (36, 47) NE: Fagundez (35) SEA: Montero (78), Alonso (96+) PHI: Adu (60), Carroll (70) SEA: Ochoa (82), Montero (87) SJ: Wondolowski (24) SEA: Montero (42); MNT: Carreno (3), Delgado (61) SEA: Own Goal (53), Fernandez (68), Ochoa (73) CHV: Estupinan (83)

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 OUTSIDE COMPETITIONS BOX SCORES Seattle Sounders FC 2 vs. Kitsap Pumas 1 June 28, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Att: 3,811 Scoring - SEA - Fucito (Jaqua) 39’, Fucito 62’ KIT - Besagno (Christner) 71’ Shots Saves Fouls Offsides Corners SEA 25 2 4 3 7 KIT 7 2 8 5 6

Seattle Sounders FC 3 vs. L.A. Galaxy 1 July 13, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Att: 4,322 Scoring - SEA - Jaqua (Noonan) 4’, Montero (Jaqua) 25’, Neagle (Fernandez) 74’ LA - Cristman (Birchall) 40’ Shots Saves Fouls Offsides Corners SEA 23 5 17 3 3 LA 13 8 10 0 7

Seattle Sounders FC 0 at San Francisco FC 1 July 26, 2011 at Estadio Rommel Fernandez (Panama City, Panama) Scoring - SEA - None SFR - Brown (penalty) 28’ Shots Saves Fouls Offsides Corners SEA 10 3 20 0 3 SFR 7 2 15 3 2

Seattle Sounders FC 2 vs. San Francisco FC 0 August 3, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 21,233 Scoring - SEA - Fernandez (Gonzalez, Montero) 41’, Jaqua (Fernandez, Rosales) 98’ SFR - None Shots Saves Fouls Offsides Corners SEA 34 5 18 3 14 SFR 9 11 20 4 2

Seattle Sounders FC 4 vs. CSD Comunicaciones 1 August 16, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 10,017 Scoring - SEA - Evans (Fucito) 35’, Fucito (Montero, Fernandez) 61’, Fucito (Fernandez, Evans) 67’, Gomez (Own Goal) 87’ COM - Arreola (Ordonez) 2’ Shots Saves Fouls Offsides Corners SEA 11 2 13 0 7 COM 13 1 13 1 0 Seattle Sounders FC 1 vs. FC Dallas 0 August 30, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Att: 4,593 Scoring - SEA - Montero (Fernandez) 40’ DAL - None Shots Saves Fouls Offsides Corners SEA 13 1 16 2 4 DAL 14 4 14 0 4

Seattle Sounders FC 1 at CF Monterrey 0 August 23, 2011 at Estadio Tecnologico (Monterrey, Mex.) Scoring - SEA - Fernandez (Noonan, Carrasco) 38’ MNT - None Shots Saves Fouls Offsides Corners SEA 7 4 11 6 1 MNT 17 1 9 1 7 Seattle Sounders FC 2 at CS Herediano 1 September 14, 2011 at Estadio Alejandro Morrera Soto (Alajuela, Costa Rica) Att: 2,000 Scoring - SEA - Montero (Jaqua, Levesque) 3’, Montero (Levesque, Jaqua) 54’ CSH - Cancela (penalty) 46’ Shots Saves Fouls Offsides Corners SEA 8 3 22 0 4 CSH 9 2 16 4 8

Seattle Sounders FC 0 vs. CS Herediano 1 Seattle Sounders FC 2 at CSD Comunicaciones 2 September 20, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 10,163 September 27, 2011 at Estadio Cemento Progresos (Guatemala City) Scoring - SEA - None Scoring - SEA - Alonso 44’, Alonso 89’ CSH - Arias 25’ COM - Montepeque (Mejia) 7’, Morales 64’ Shots Saves Fouls Offsides Corners Shots Saves Fouls Offsides Corners SEA 12 1 18 2 5 SEA 26 1 11 3 3 CSH 8 4 14 2 4 COM 14 3 11 9 2 Seattle Sounders FC 2 vs. Chicago Fire 0 October 4, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 35,615 Scoring - SEA - Montero (Parke) 78’, Alonso 96+ CHI - None Shots Saves Fouls Offsides Corners SEA 24 4 12 0 10 CHI 6 6 18 3 6

Seattle Sounders FC 1 vs. CF Monterrey 2 October 18, 2011 on the Xbox Pitch at CenturyLink Field (Seattle, Wash.) Att: 15,866 Scoring - SEA - Montero (unassisted) 42’ MON - Carreno (Suazo) 3’, Delgado 61’ Shots Saves Fouls Offsides Corners SEA 12 1 14 2 4 MON 6 5 10 5 3

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 OUTSIDE COMPETITIONS LINEUPS vs. KIT W, 2-1 June 28, 2011 G Boss D Gozalez D Graham D Scott D Tetteh M Estrada (Noonan 54’) M Alonso M Seamon (Carrasco 85’) M Montano F Fucito (Parke 68’) F Jaqua

vs. LA W, 3-1 July 13, 2011 G Boss D Scott D Parke D Ianni D Gonzalez M Noonan (Friberg 64’) M Alonso M Fernandez M Neagle F Jaqua (Levesque 71’) F Montero (Fucito 79’)

at SFR L, 0-1 July 26, 2011 G Keller D Riley D Parke D Ianni D Gonzalez M Rosales M Alonso M Friberg (Noonan 75’) M Neagle (Fernandez 59’) F Levesque (Fucito 59’) F Montero

vs. SFR W, 2-0 August 3, 2011 G Keller D Riley D Parke D Scott D Gonzalez M Rosales M Alonso M Friberg (Carrasco 112’) M Fernandez (Neagle 111’) F Noonan (Jaqua 68’) F Montero

vs. COM W, 4-1 August 16, 2011 G Boss D Riley D Ianni (Levesque 84’) D Hurtado D Gonzalez (Scott 75’) M Neagle M Carrasco M Evans M Fernandez F Fucito F Montero (Rosales 63’)

at MNT W, 1-0 August 23, 2011 G Boss D Riley D Scott D Parke D Wahl M Levesque (Sanyang 84’) M Carrasco M Evans M Fernandez (Gonzalez 76’) F Noonan F Jaqua (Alonso 65’)

vs. DAL W, 1-0 August 30, 2011 G Keller D Scott D Hurtado D Parke D Gonzalez M Rosales M Alonso M Evans M Fernandez (Neagle 84’) F Noonan (Fucito 66’) F Montero (Riley 91+)

at CSH W, 2-1 Sept. 14, 2011 G Keller D Scott D Hurtado D Ianni D Gonzalez M Levesque (Riley 90’) M Carrasco M Fernandez M Neagle (Sanyang 83’) F Montero F Jaqua (Noonan 73’)

vs. CSH L, 0-1 Sept. 20, 2011 G Keller D Scott (Ochoa 74’) D Hurtado D Ianni D Gonzalez M Levesque (Montero 56’) M Carrasco M Sanyang (Alonso 56’) M Neagle F Noonan F Jaqua

at COM D, 2-2 Sept. 27, 2011 G Keller D Hurtado D Parke D Scott D Wahl M Friberg (Carrasco 74’) M Alonso M Neagle (Jaqua 89’) M Fernandez F Fucito (Ochoa 66’) F Montero

vs. CHI W, 2-0 October 4, 2011 G Keller D Riley D Parke D Hurtado D Gonzalez M Fernandez (Friberg 46’) M Alonso M Evans M Fernandez F Fucito (Levesque 89’) F Montero

vs. MNT L, 2-1 October 18, 2011 G Meredith D Riley D Parke (Ianni 67’) D Scott D Wahl M Estrada (Neagle 89’) M Alonso M Friberg M Levesque F Ochoa (Fucito 74’) F Montero

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS RESERVE LEAGUE STATISTICS UNF POS 27 M 14 D 21 F 25 F 19 F 32 M 16 M/F 24 F 23 M 2 F F 20 D 12 D 8 M 22 M 28 G 26 D 4 M 5 D 34 D 29 G M 31 D 30 M 39 D 17 F F 3 M 13 F 35 G D M M F M F M M D 6 M 15 M 18 G 7 10 11

D M M

PLAYER Lamar Neagle Michael Tetteh Nate Jaqua Pat Noonan Sammy Ochoa Miguel Montano David Estrada Roger Levesque Servando Carrasco Mike Fucito Cillian Sheridan Zach Scott Leo Gonzalez Erik Friberg Michael Seamon Terry Boss Taylor Graham Patrick Ianni Tyson Wahl Jhon Kennedy Hurtado Josh Ford Aaron Kovar Jeff Parke Amadou Sanyang Kevin Sakuda Fredy Montero Myron Samuel Brad Evans O'Brian White Bryan Meredith Ian Lange Danny Barrera Sinisa Ubiparipovic Austin Sweeney Sean Okoli Dominique Dismuke DeAndre Yedelin Will Lopez Manny Guzman Osvaldo Alonso Alvaro Fernandez Kasey Keller Taylor Mueller James Riley Mauro Rosales Steve Zakuani Team totals Opponent totals

GP 6 9 6 8 3 8 10 6 5 4 2 9 5 2 10 7 8 5 3 2 2 4 1 1 2 1 2 1 1 1 1 1 1 1 2 1 1 1 1 0 0 0 0 0 0 0 10 10

GS 6 8 5 6 1 6 10 5 5 4 1 9 5 2 10 7 7 4 3 2 2 0 1 1 0 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 10

MIN 429 748 247 671 148 465 773 467 398 316 90 755 450 149 899 630 665 315 225 135 180 95 90 90 83 65 62 45 45 90 45 26 27 24 14 13 1 31 15 0 0 0 0 0 0 0 900 900

G 4 3 3 3 2 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 21 11

A 3 2 1 1 1 2 2 1 1 0 0 1 1 1 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 20 8

C 1 1 0 0 0 2 1 2 0 1 0 1 1 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12 6

E 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

GP-games played; GS-goals scored; MIN-minutes; G-goals; A-assists; C-cards; E-ejections

GAME-WINNING GOALS: Sammy Ochoa 2, Michael Tetteh 2, Servando Carrasco 1, Miguel Montano 1, Lamar Neagle 1, Cillian Sheridan 1 GAME-WINNING ASSISTS: Servando Carrasco 1, David Estrada 1, Erik Friberg 1, Roger Levesque 1, Miguel Montano 1, Pat Noonan 1, Sammy Ochoa 1 PENALTY KICK ATTEMPTS/GOALS: Lamar Neagle 2-2 SEATTLE SOUNDERS FC INDIVIDUAL GOALKEEPING UNF POS GOALKEEPER GP GS MIN GA GAA PG PA W-L-T SO 28 G Terry Boss 7 7 630 5 0.71 0 0 7-0-0 4 29 G Josh Ford 2 2 180 3 1.50 0 0 1-1-0 0 35 G Bryan Meredith 1 1 90 3 3.00 0 0 0-0-1 0 Team totals 10 10 900 11 1.10 0 0 8-1-1 4 Opponent totals 10 10 900 21 2.10 2 2 1-8-1 0 GP-games played;GS-goals scored;MIN-minutes;SHTS-shots;SV-saves;GA-goals allowed;GAA-goals against avg.;PG-penalty goals;PA-penalty attempts;W/L/T-wins/losses.ties;SO-shutouts

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 MLS RESERVE LEAGUE RESULTS Day Date Sun. 4/3 Mon. 5/9 Sun. 5/15 Mon.5/30 Tues. 6/7 Mon.6/13 Tues. 7/5 Tues. 8/9 Mon.10/10 Sun.10/23

Opponent at San Jose (Santa Clara, CA) vs. Chivas USA (Tukwila, WA) vs. Portland (Tukwila, WA) at Portland (Portland, OR) vs. Vancouver (Tukwila, WA) vs. L.A. Galaxy (Tukwila, WA) at L.A. Galaxy (Carson, CA) at Vancouver (Burnaby, BC) vs. San Jose (Tukwila, WA) at Chivas USA (Carson, CA)

Result W W W W W W W L W D

Score 1-0 3-2 3-2 2-0 2-0 1-0 2-1 1-2 3-1 3-3

Record 1-0-0 2-0-0 3-0-0 4-0-0 5-0-0 6-0-0 7-0-0 7-1-0 8-1-0 8-1-1

Goal scorers SEA: Tetteh (88’) SEA: Fucito (25’), Neagle (52’), Montano (60’); CHV: Cortez (22’, 69’) SEA: Neagle (44’), Noonan (57’), Tetteh (74’); POR: Horst (68’), Ogunyemi (90+) SEA: Carrasco (77’), Estrada (89’) SEA: Sheridan (8’), Levesque (26’) SEA: Ochoa (82’) SEA: Jaqua (18’), Neagle (31’); LA: Cristman (74’) SEA: Jaqua (52); VAN: Nanchoff (21), Tan (57) SEA: Tetteh (7), Ochoa (30), Jaqua (84); SJ: Luzanaris (68) SEA: Noonan (2), Neagle (4), Noonan (14) CHV: Estipunan (31), Spencer (42), Vanney (88)

2011 MLS RESERVE LEAGUE BOXSCORES Seattle Sounders FC 1 at San Jose Earthquakes 0 April 2, 2011 at Nutrilite Training Facility (San Jose, Calif.) Scoring -SEA - Tetteh 88’ SJ - None

Seattle Sounders FC 3 vs. Chivas USA 2 May 9, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Scoring - SEA - Fucito (Jaqua, Estrada) 25’, Neagle (penalty) 52’, Montano (Noonan) 60’ CHV - Cortez 22’, Cortez (de la Fuente) 69’

Seattle Sounders FC 3 vs. Portland Timbers 2 May 15, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Scoring - SEA - Neagle 44’, Noonan (Neagle) 57’, Tetteh (Levesque) 74’ POR - Horst 68’, Ogunyemi 90+

Seattle Sounders FC 2 at Portland Timbers 0 May 30, 2011 at JELD-WEN Field (Portland, Ore.) Scoring - SEA - Carrasco 77’, Estrada (Gonzalez) 89’ POR - None

Seattle Sounders FC 2 vs. Vancouver Whitecaps FC 0 June 7, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Scoring - SEA - Sheridan (Montano, Carrasco) 8’, Levesque (Scott) 26’ VAN - None

Seattle Sounders FC 1 vs. L.A. Galaxy 0 June 13, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Scoring - SEA - Ochoa (Friberg) 82’ LA - None

Seattle Sounders FC 2 at L.A. Galaxy 1 July 5, 2011 at University Field #1 at The Home Depot Center (Carson, Calif.) Scoring - SEA - Jaqua (Neagle) 18’, Neagle (penalty) 31’ LA - Cristman (McBean) 74’

Seattle Sounders FC 1 at Vancouver Whitecaps FC 2 August 9, 2011 at Swangard Stadium (Burnaby, BC) Scoring - SEA - Jaqua (Neagle, Montano) 52’ VAN - Nanchoff (Chiumiento) 21’, Tan (Khalfan, Davies) 57’

Seattle Sounders FC 3 vs. San Jose Earthquakes 1 October 10, 2011 at Starfire Sports Stadium (Tukwila, Wash.) Scoring - SEA - Tetteh (Ochoa, Estrada) 7’, Ochoa (Seamon) 30’, Jaqua (Tetteh) 84’ SJ - Luzanaris (Gjertsen) 68’

Seattle Sounders FC 3 at Chivas USA 3 October 23, 2011 at The Home Depot Center (Carson, Calif.) Scoring - SEA - Noonan (Seamon) 2’, Neagle (Seamon) 4’, Noonan (Tetteh) 14’ CHV - Estupinan (Dieuze) 31’, Spencer (Delgado) 42’, Vanney 88’

2011 MLS RESERVE LEAGUE LINEUPS at SJ W, 1-0 April 2, 2011 G Boss D Levesque D Hurtado D Wahl D Scott M Neagle (Noonan 80’) M Carrasco M Seamon M Montano (Tetteh 62’) F Jaqua (Graham 55’) F Estrada vs. LA W, 1-0 June 13, 2011 G Boss D Levesque D Scott D Ianni (Montano 46’) D Gonzalez M Estrada (Samuel 73’) M Seamon M Friberg M Tetteh F Noonan (Ochoa 62’) F Jaqua (Sheridan 46’)

vs. CHV W, 3-2 May 9, 2011 G Boss D Scott D Graham D Wahl (Sakuda 46’) D Tetteh M Neagle M Seamon M Estrada M Montano F Fucito (Ubiparipovic 63’) F Jaqua (Noonan 46’) at LA W, 2-1 July 5, 2011 G Boss D Scott D Graham D Ianni D Gonzalez M Noonan (Estrada 46’) M Seamon M Carrasco M Neagle (Montano 60’) F Jaqua (Kovar 70’) F Fucito

vs. POR W, 3-2 May 15, 2011 G Boss D Scott (Sakuda 52’) D Graham D Parke D Gonzalez M Neagle M Seamon M Estrada M Tetteh F Fucito (Levesque 73’) F Noonan (Montano 63’) at VAN L, 1-2 August 9, 2011 G Ford D Estrada D Graham D Hurtado (Ianni 46’) D Tetteh M Seamon M Sanyang M Evans (Montano 46’) M Neale (Berrera 64’) F Fucito F White (Jaqua 46’)

at POR W, 2-1 May 30, 2011 G Boss D Levesque D Scott D Graham D Gonzalez M Montano (Okoli 78’) M Carrasco M Seamon M Tetteh F Noonan (Kovar 81’) F Montero (Estrada 65’) vs. SJ W, 3-1 October 10, 2011 G Ford D Levesque D Graham D Ianni (Lange 46’) D Scott M Estrada M Carrasco (Kovar 39’) M Seamon M Tetteh F Ochoa (Sweeney 76’) F Jaqua (Dismuke 87’)

vs. VAN W, 2-0 June 7, 2011 G Boss D Levesque D Scott D Gonzalez D Tetteh M Carrasco M Seamon (Yedelin 90+) M Noonan (Kovar 75’) M Montano (Okoli 88’) F Estrada F Sheridan (Samuel 45’) at CHV D, 3-3 October 23, 2011 G Meredith D Wahl D Graham D Ianni D Scott (Guzman 74’) M Estrada M Friberg (Lopez 59’) M Seamon M Tetteh F Neagle (Ochoa 46’) F Noonan

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

2011 PRESEASON STATISTICS UNF POS 17 F 13 F 16 M/F 25 M/F 24 F 32 F 2 M 34 D 23 M 27 M 3 M 14 D/M 8 M 6 M 20 D M 4 D 38 M 5 D 11 M/F 7 D 31 D 15 M 18 G 12 D M 28 G 19 D 29 G 9 F 30 G 26 D D F 22 M D 21 F

Player GP GS MIN G Montero, Fredy 9 7 515 4 White, Oâ&#x20AC;&#x2122;Brian 8 3 302 3 Estrada, David 8 3 411 2 Noonan, Pat 6 1 154 2 Levesque, Roger 9 2 401 1 Montano, Miguel 9 3 381 1 Fucito, Mike 9 4 360 1 Hurtado, Jhon Kennedy 8 6 491 1 Carrasco, Servando 9 4 482 1 Neagle, Lamar 10 2 422 1 Evans, Brad 7 6 373 1 Tetteh, Michael 10 2 274 1 Friberg, Erik 7 2 315 0 Alonso, Osvaldo 10 7 546 0 Scott, Zach 8 3 450 0 Prieto, Jonathan 8 1 314 0 Ianni, Patrick 6 4 288 0 Rosales, Mauro 2 1 90 0 Wahl, Tyson 8 4 454 0 Zakuani, Steve 10 7 494 0 Riley, James 8 8 489 0 Parke, Jeff 7 5 441 0 Fernandez, Alvaro 8 6 425 0 Keller, Kasey 7 7 413 0 Gonzalez, Leo 6 5 394 0 Cruz, Leone 7 1 253 0 Boss, Terry 5 3 252 0 Earls, Danny 5 4 232 0 Meredith, Bryan 5 2 200 0 Nkufo, Blaise 4 4 262 0 Ford, Josh 5 0 190 0 Graham, Taylor 5 1 186 0 Martinez, Richard 4 2 181 0 Bah, Seedy 4 1 155 0 Seamon, Michael 2 1 130 0 Attaway, Corey 1 0 35 0 Jaqua, Nate 0 0 0 0 Own Goals Received: 1 Own Goals Conceded: 1 TEAM TOTALS 11 11 1115 20 OPPONENT TOTALS 11 11 1115 16 GP-games played;GS-games started;MIN-minutes;G-goals;A-assists; YC/E-yellow cards/ejections

A 1 3 3 1 3 3 2 0 0 0 0 0 2 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

YC/E 0/0 1/1 0/0 0/0 0/0 1/0 0/0 1/0 2/0 0/0 1/0 1/0 1/0 3/0 0/0 0/0 0/0 1/0 1/0 0/0 0/0 0/0 0/0 0/0 1/0 0/0 0/0 1/0 0/0 0/0 0/0 1/0 0/0 0/0 0/0 0/0 0/0

23 6

16/1 16/4

GAME-WINNING GOALS: Carrasco (1), Estrada (1), Evans (1), Montero (1), Noonan (1) GAME-WINNING ASSISTS: Montano (3), White (2), Estrada (1), Friberg (1), Levesque (1), Prieto (1) PENALTY KICK ATTEMPTS/GOALS: Montero (2/2)

2011 PRESEASON RESULTS DayDate Fri. 2/4 Tue. 2/8 Thu.2/10 Sat. 2/12 Mon.2/21 Tue.2/22 Thu.2/24 Sat. 2/26 Fri. 3/4 Sun. 3/6 Wed. 3/9

Opponent Result Vancouver (Casa Grande, AZ) W Salt Lake (Casa Grande, AZ) D Columbus (Phoenix, AZ) L Chivas (Casa Grande, AZ) W Dallas (Orlando, FL) L Houston (Orlando, FL) D UCF (Bradenton, FL) W Chicago Fire (Bradenton, FL) W Portland Timbers (Tukwila, WA) L Vancouver (Tukwila, WA) L Colorado Rapids (Seattle, WA) W

Score 1-0 3-3 0-3 1-0 0-2 2-2 7-0 1-0 0-2 2-3 3-1

Record 1-0-0 1-0-1 1-1-1 2-1-1 2-2-1 2-2-2 3-2-2 4-2-2 4-3-2 4-4-2 5-4-2

Goal scorers SEA: Evans (28) SEA: Neagle (3), White (90), Montero (110); RSL: Morales (37), Warner (97, 99) CLB: Mendoza (19), Own Goal (87), Cunningham (88) SEA: Estrada (75) DAL: Chavez (21), Shea (27) SEA: Montero (62), Tetteh (70); HOU: Weaver (11), Ching (57) SEA: Noonan (39, 43), Own Goal (57), White (59, 63), Estrada (61), Fucito (75) SEA: Carrasco (120) POR: Perlaza (21), Cooper (93) SEA: Levesque(45),Montano(77);VAN:Salgado(6),Teibert(12),Sanvezzo(47) SEA: Hurtado (60), Montero (67, 78); COL: Larentowicz (pen. 63)

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT COACHES CORNER HEAD COACH SIGI SCHMID

THE STAFF

Named the first head coach of Seattle Sounders FC on Dec. 16, 2008, and is recognized as one of the most successful coaches in MLS history. Since 1999, Schmid’s teams have won eight major titles, including two MLS Cups. Schmid is the most successful active coach in MLS history and a twotime coach of the year. This past 2010 season he guided Sounders FC to the playoffs for the second straight year. Sounders FC finished season two with a regular season record of 14-10-6. On October 4, 2011, Schmid’s Sounders FC team defeated the Chicago Fire, 2-0, in front of a record crowd at CenturyLink Field to win the club’s third Lamar Hunt U.S. Open Cup, becoming the first team in 42 years to win three consecutive Open Cups. In Seattle’s inaugural season in 2009, Schmid led the club to a 12-7-11 record and became the first expanside side since 1998 to qualify for the playoffs. In 2008, Schmid led his former club, the Columbus Crew to both its first MLS Cup and Supporters’ Shield, earning MLS Coach of the Year. From 1999 through 2004 Schmid’s L.A. Galaxy teams won four major competitions: 2002 MLS Cup, 2002 MLS Supporters’ Shield, 2001 U.S. Open Cup and the 2001 CONCACAF Champions Cup. He was voted the MLS Coach of the Year in his first season, 1999. Altogether, his Galaxy teams were 79-53-32 and reached the MLS Cup final four times and won three division crowns. Schmid ranks No. 1 in MLS career victories (156), 28 ahead of Bruce Arena (128). Schmid’s combined postseason win total (19) from L.A. and Columbus is the highest in MLS history. Schmid (349) has coached the most MLS games. Schmid is the only man in MLS history to coach two different teams to MLS Cup titles. He is one of two to coach in four MLS Cup finals (Steve Nicol). Twice Schmid has served as U.S. Under-20 National Team head coach, most recently in 2005 at the FIFA World Championships. Schmid was an assistant to Bora Milutinovic on the Americans’ 1994 World Cup team. He also was head coach for the 1991 World University Games and 1995 Pan American Games.

BRIAN SCHMETZER Assistant Coach Named the top assistant coach on Dec. 22, 2008. A Seattle native, he is one of the Puget Sound soccer community’s most recognizable figures after playing and coaching for the region’s top professional franchises since 1980. Schmetzer was head coach of the USL-1 Sounders from 2002-08. He guided Seattle to USL-1 championships in 2005 and 2007, and U.S. Open Cup semifinal advancements in 2007 and 2008. Schmetzer has ten years of experience coaching and 15 years of playing at the professional level. He was a member of six championship teams during that span. In addition to the two USL-1 championships, his teams also twice won the Commissioner’s Cup for the best record and qualified for the playoffs six times. He was chosen USL-1 Coach of the Year in 2002 after going 23-4-1. The Sounders were league runners-up in 2004. His overall regular season record was 100-57-41.

SCHMID Team Regular Season Chicago 14-9-8 Chivas USA 3-5-5 Colorado 18-10-7 Columbus 8-3-7 D.C. United 16-10-4 FC Dallas 13-8-10 Houston 3-3-5 Kansas City 18-15-5 L.A. Galaxy 4-4-4 Miami 4-1-1 New England 13-11-5 New York 11-14-5 Philadelphia 1-2-0 Portland 1-0-1 Real Salt Lake 5-4-3 San Jose 14-8-5 Tampa Bay 3-2-1 Toronto 7-1-4 Vancouver 1-0-1 TOTAL 157-110-83 *most wins in MLS history

T HE R OAD

TO

VS

. MLS

Postseason 2-0-1 5-1-0 0-1-0 2-0-1 0-1-1 4-2-1 0-2-0 1-0-0 2-1-1

1-2-0 2-0-0 19-10-5

Total 16-9-9 3-5-5 23-11-7 8-3-7 16-11-4 15-8-10 3-4-6 22-17-6 4-6-4 4-1-1 13-11-5 13-15-6 1-2-0 1-0-1 5-4-3 15-10-5 5-2-1 7-1-4 1-0-1 175-120-88

M OST C AREER R EGULAR S EASON W INS

Coach (Team) Sigi Schmid* (LAG, Columbus, SFC) Bob Bradley (Chicago, NYM, Chivas) Bruce Arena* (LAG) Steve Nicol* (NER) Bob Gansler (KC) Dominic Kinnear* (HOU)

Overall Wins (Home/Away) 157 (96/61) 124 (75/49) 109 (67/42) 107 (67/40) 86 (58/28) 84 (52/32) *active

THE SIGI CONNECTION Three players have played previously in some capacity for Schmid: Brad Evans Patrick Ianni Kasey Keller Sammy Ochoa

Columbus Crew (2008) U.S. National U-20 (2005) U.S. National B Team (1998) U.S. National U-20 (2005)

EZRA HENDRICKSON Assistant Coach Announced as assistant coach on Jan. 20, 2009 after completing a 14-year professional career, including 12 seasons in Major League Soccer. Hendrickson earned his U.S. Soccer ‘A’ Coaching License in December of 2009. Hendrickson played parts of eight seasons for Sigi Schmid, including three in Columbus prior to his retirement. He appeared in 266 regular season MLS matches (225 starts), scored 23 goals and added 30 assists. Hendrickson was a member of three MLS Cup championship teams: 2002 Los Angeles Galaxy, 2004 D.C. United and 2008 Columbus Crew. While with the Galaxy he also won the 2000 CONCACAF Champions Cup and the 2001 Lamar Hunt U.S. Open Cup, when he was the team’s MVP. An All-American and business administration major at Drake University, Hendrickson first played professionally with New Orleans of the USISL Select League (1995-96). After earning his first international cap in 1995, he served 12 years as captain of the Saint Vincent and the Grenadines national team. TOM DUTRA Goalkeeper Coach Named the goalkeeper coach on Dec. 29, 2008 after serving two seasons as keeper coach for the USL Sounders. Dutra has worked with Kasey Keller in offseason training sessions since 2002. Under Dutra’s guidance in 2007 and 2008, Chris Eylander led USL-1 in saves and finished second in shutouts. DAVID TENNEY Fitness Coach Named the fitness coach on January 9, 2009. He is one of Major League Soccer’s most respected and highly-regarded fitness coaches following two years in Kansas City. During the 2007 and 2008 seasons Tenney served as both fitness and goalkeeper coach for Kansas City. He also holds an ‘A’ license from the Czech Republic F.A. and NSCAA 'Premier' Diploma. Prior to MLS, Tenney held the same dual role as the George Mason University men’s and women’s teams for two seasons. He earned his B.I.S. in coaching science from George Mason in 2005. While at George Mason, Tenney also served as director of coaching for the Washington Freedom youth teams from 2004-06 and as Maryland’s girls director of ODP. KURT SCHMID Scout/Assistant Coach Named to staff on March 12, 2009. Schmid scouts players from the youth to international level and coordinate the Match Analysis scouting system and also serves as a first team assistant. Kurt Schmid has been an assistant coach at the collegiate level, first at Saint Mary’s College, then at UC Irvine.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT S O U N D E R S F C 2 0 11 P L AY E R N O T E S 2 | MIKE FUCITO Position: Forward Height: 5-9 Weight: 165 Born: March 29, 1986 College: Harvard Hometown: Westford, Mass. Citizenship: United States Pronunciation: few-SEE-toe How Acquired: Signed on March 23, 2010 2011 • Has 6 goals and 3 assists in all competitions • Recorded 1st career MLS assist on late winner at KC (8/6) • Named U.S. Open Cup Player of the Round for 2 goals vs. Kitsap (6/28) • Made 1st MLS start vs. DAL (5/25) Prior • Became the sixth player in MLS history whose first goal was a game-winner in stoppage time (vs. KC, 4/17/10) • Scored four goals in nine appearances in all competitions in 2010 • Led Ivy League in total points and second team All-America as senior in 2008 and finished No. 4 on Crimson’s career scoring list

Last MLS Match: Seattle (93), played 90 minute in 2-1 win vs. SJ, 10/15/11 Last MLS Goal: Seattle (3), 2-1 win at RSL, 5/28/11 Last MLS Assist: Seattle (3), 2-1 win vs. SJ, 6/13/09 5 | TYSON WAHL Position: Defender Height : 6-2 Weight: 185 Born: February 23, 1984 College: California Hometown: Newport Beach, California Citizenship: United States Pronunciation: WALL How Acquired: Selected from Kansas City in the 2008 Expansion Draft on November 28, 2008 Previous Clubs: Kansas City (MLS, 2006-08) 2011 • Scored 1st career MLS goal vs. NE (6/26) • Recorded winning assists vs. KC (5/21) and at RSL (5/28) • Debuted as starter at COL (4/22) Prior

Last MLS Match: Seattle (23), played 64 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (3), 3-0 win vs. DC, 9/17/11 Last MLS Assist: Seattle (2), 6-2 win vs. CLB, 8/27/11

• Recorded first career MLS assist vs. CHI (8/28/10) • Saw 1st action of 2010 season as a reserve at RSL (4/10) and started in

3 | BRAD EVANS Position: Midfielder Height: 6-1 Weight: 170 Born: April 20, 1985 College: UC Irvine Hometown: Phoenix, Arizona Citizenship: United States

Last MLS Match: Seattle (71), played 9 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (1), 2-1 win vs. NE, 6/26/11 Last MLS Assist: Seattle (3), 2-1 win at RSL, 5/28/11

How Acquired: Selected from Columbus in the MLS Expansion Draft on November 26, 2008 Previous Club: Columbus (2007-08) 2011 • Made first start since suffering injury on June 18 vs. DC (9/17) • Career-high 5 goals and 5 assists in 2011 MLS season • First 2-goal game of career vs. TOR (4/30) and added assist • Named to MLSsoccer.com Team of the Week vs. TOR (4/30) • Made season debut vs. HOU (3/25), first action since June 10, 2010 Prior

• Tied 3rd on team with career-high 3 assists in injury-shortened 2010 season • Missed final 15 games of 2010 season with right knee injury (8/13-10/2/10) • Played all 4 MLS seasons under Schmid, winning the 2008 MLS Cup in Columbus and 2009 and 2010 Open Cups in Seattle

• Earned first three U.S. National Team caps during 2009 CONCACAF Gold Cup

Last MLS Match: Seattle (89), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (14), 3-1 win at VAN, 9/24/11 Last MLS Assist: Seattle (12), 3-1 win at CHV, 10/22/11 4 | PATRICK IANNI Position: Defender Height : 6-1 Weight: 175 Born: June 15, 1985 College: UCLA Hometown: Lodi, California Citizenship: United States Pronunciation: ee-AWN-ee How Acquired: Acquired via trade from the Houston Dynamo on January 26, 2009 Previous Club: Houston (MLS, 2006-08) 2011

• Scored 1st goal of season in 2-1 win at RSL (5/28) Prior • Recorded career-highs in starts (24) and minutes (2,096) in 2010 • No. 8 overall pick in the 2006 MLS SuperDraft • Member of Houston’s 2006 and 2007 MLS Cup championship teams

2nd appearance at TOR (4/25)

6 | OSVALDO ALONSO Position: Midfielder Height: 5-11 Weight: 165 Born: November 11, 1985 Hometown: San Cristóbal, Cuba Citizenship: Cuba Pronunciation: ahs-VAHL-doe How Acquired: Signed as free agent on January 26, 2009 and signed to contract extension on February 17, 2011 Previous Clubs: FC Pinar del Rio (Cuba, 2005-07); Charleston Battery (USL, 2008) 2011

• Has scored career-high 3 goals in MLS, 6 in all competitions • Scored two equalizers at COM (9/27) to help SEA advance to quarterfinal • Scored 2nd goal in U.S. Open Cup final vs. cHI (10/4) • Scored game-winning penalty kick at POR (7/10) • Issued 5th yellow card of season vs. NY (6/23), missed game vs. NE (6/26) • MLS All-Star and MLSsoccer.com Team of the Week vs. HOU (3/25) Prior

• Voted team’s Most Valuable Player by his teammates in 2010 • Injured quadricep vs. LA (5/8/10) and returned as a reserve vs. DAL (7/11) • Has scored 1 goal with 3 assists both seasons Last MLS Match: Seattle (83), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (5), 3-2 win at POR, 7/10/11 Last MLS Assist: Seattle (9), 6-2 win vs. CLB, 8/27/11

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT S O U N D E R S F C 2 0 11 P L AY E R N O T E S 7 | JAMES RILEY Position: Defender Height : 5-10 Weight: 150 Born: October 26, 1982 College: Wake Forest Hometown: Colorado Springs, Colorado Citizenship: United States How Acquired: Selected from San Jose in Expansion Draft, November 26, 2008 Previous Clubs: New England (MLS, 2005-07), San Jose (MLS, 2008) 2011 • Recorded 14th assist of career vs. TOR (4/30) • Missed match vs. HOU (3/25) with mild concussion Prior • Started 28 appearances in 2010, leading all field players in minutes (2,508) • Scored 1st goal with SEA at HOU (10/23), named MLS Goal of the Week • Named MLS Humanitarian of the Month for October and Sounders FC Humanitarian of the Year for 2010 Last MLS Match: Seattle (178), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (2), 1-2 loss at HOU, 10/23/10 Last MLS Assist: Seattle (14), 6-2 win vs. CLB, 8/27/11 8 | ERIK FRIBERG Position: Midfielder Height : 5-11 Weight: 154 Born: February 2, 1986 Hometown: Goteberg, Sweden Citizenship: Sweden Pronunciation: FREE-burg How Acquired: Signed on December 16, 2010 Previous Clubs: Västra Frölunda IF (Sweden, 2005-06), BK Häcken (Sweden, 2007-10) 2011 • Suffered right hip injury vs. RSL (9/10) • Scored 1st MLS goal vs. NY (6/23) • Recorded 1st MLS assist in 2-2 draw at SJ (4/2) • Made MLS debut in First Kick 2011 vs. LA (3/15) Prior

• Recorded 2 assists in 2011 preseason • 24-year-old midfielder with five years professional experience in Sweden Last MLS Match: Seattle (26), played 90 minutes in 0-2 loss vs. PHI, 10/8/11 Last MLS Goal: Seattle (1), 4-2 win vs. NY, 6/23/11 Last MLS Assist: Seattle (2), 1-1 draw at CLB, 5/7/11 10 | MAURO ROSALES Position: Midfielder Height : 5-8 Weight: 160 Born: February 24, 1981 Hometown: Villa Maria, Cordoba, Argentina Citizenship: Argentina Pronunciation: MOU-ro Roh-SAH-les How Acquired: Signed on March 24, 2011 Previous Clubs: Newell’s Old Boys (1999-2004), Ajax (2004-07), River Plate (2007-10) 2011 • Set single-season club record with 13 assists; earned record 11th vs. DC (9/17) • Scored 2 winners and recorded 5 winning assists • Suffered MCL sprain vs. DC (9/17); returned vs. SJ (10/15) • MLSsoccer.com Team of the Week team-high 7 times • Scored 1st MLS goal vs. VAN (6/11) • Recorded 2 assists in 1st 2 MLS starts • Made MLS debut at. NY (3/19)

Prior • Played past 4 seasons for River Plate (ARG) • Capped 10 times by Argentina Last MLS Match: Seattle (26), played 10 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (5), 6-2 win vs. CLB, 8/27/11 Last MLS Assist: Seattle (13), 2-1 win vs. SJ, 10/15/11 11 | STEVE ZAKUANI Position Midfielder Height 6-0 Weight 160 Born February 9, 1988 College Akron Hometown London, England Citizenship United Kingdom Pronunciation zak-uh-WAH-nee How Acquired: Selected with the 1st overall pick in the MLS SuperDraft, January 15, 2009 2011

• Sustained fractured right tibia and fibula at COL (4/22) • MLSsoccer.com Team of the Week at SJ (4/2) and vs. CHI (4/9) • Scored 1st goal of season vs. HOU (3/25) and winner vs. CHI (4/9) • Recorded 1st assist of season in 2-2 draw at SJ (4/2) Prior

• Team co-leader with 10 goals in 2010 (MLS Player of the Week twice) • Tied for fastest goal in club history with 4th min. strike vs. CLB (4/25/10) • Finalist for 2009 MLS Rookie of the Year Last MLS Match: Seattle (64), played 9 minutes in 1-0 win at COL, 4/22/11 Last MLS Goal: Seattle (16), 2-1 win vs. CHI, 4/9/11 Last MLS Assist: Seattle (12), 1-1 draw at PHI, 4/16/11 12| LEO GONZALEZ Position: Defender Height: 6-1 Weight: 174 Born: November 21, 1980 Hometown: San Jose, Costa Rica Citizenship: Costa Rica How Acquired: Signed on July 2, 2009 Previous Clubs: CS Herediano (Costa Rica, 2000-08), Municipal Liberia (Costa Rica, 2009) 2011

• Returned to Costa Rica to play against former club for 1st time, at

CS Herediano (9/14) • Recorded 1st assist of season on 1st corner kick of season vs. NY (6/23) • Issued 5th yellow card of season vs. NY (6/23), missed game vs. NE (6/26) • Received U.S. green card (3/29) Prior • Started all 27 appearances in 2010 • Scored 1st MLS goal and 1st MLS assist vs. NE (6/5) Last MLS Match: Seattle (52), played 81 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (1), 3-0 win vs. NE, 6/5/10 Last MLS Assist: Seattle (2), 4-2 win vs. NY, 6/23/11

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT S O U N D E R S F C 2 0 11 P L AY E R N O T E S 13 | O’BRIAN WHITE Position: Forward Height: 6-1 Weight: 180 Born: December 14, 1985 College: Connecticut Hometown: Ocho Rios, Jamaica Citizenship: Jamaica

16 | DAVID ESTRADA Position: Midfielder Height: 5-8 Weight: 160 Born: February 4, 1988 College: UCLA Hometown: Salinas, Calif. Citizenship: United States

How Acquired: Selected in the second round (20th overall) of the 2011 MLS SuperDraft on January 13, 2011

How Acquired: Selected with the 11th overall selection in the 1st round of the 2010 MLS SuperDraft January 14, 2010. Signed on March 23, 2010

Previous Clubs: Toronto (MLS, 2009-10) 2011 • Underwent 2 surgeries on left leg to remove blood clot, 4/27 and 8/27 • Saw action in final 14 minutes of Man Utd friendly (7/20) & 45 minutes of Reserve League match at VAN (8/9) • Scored 1st 2 club goals in consecutive games (at SJ, 4/2; vs. CHI, 4/9) • MLSsoccer.com Team of the Week vs. CHI (4/9)

2011

• Made 2nd career MLS start, 1st of season, at NE (10/1) • Scored winning goal in MLS Reserve League at POR (5/28) Prior

• Played in 3 games, making 1st MLS start at DAL (4/22) • Scored 1st club goal in friendly vs. Celtic FC (7/18) • Finished UCLA career with 22 goals and 14 assists in 78 games

Prior

Last MLS Match: Seattle (6), played 90 minutes in 2-1 win at NE, 10/01/11

with 4 assists • MAC Hermann Trophy Winner as a junior at UConn

17 | FREDY MONTERO Position: Forward Height: 5-9 Weight: 162 Born: July 26, 1987 Hometown: Campo de la Cruz, Colombia Citizenship: Colombia Pronunciation: mon-TARE-oh

• Appeared in career-high 24 games with Toronto in 2010, scoring 2 goals Last MLS Match: Seattle (40), played 90 minutes in 1-0 win at COL, 4/22/11 Last MLS Goal: Seattle (6), 2-1 win vs. CHI, 4/9/11 Last MLS Assist: Seattle (6), 1-0 win at COL, 4/22/11 14 | MICHAEL TETTEH Position: Defender/Midfielder Height : 5-8 Weight: 155 Born: January 16, 1989 College: UC Santa Barbara Hometown: Accra, Ghana Citizenship: Ghana Pronunciation: TETT-tay How Acquired: Selected in the second round (20th overall) of the 2011 MLS SuperDraft on January 13, 2011 2011

• Loaned to Orlando City from June 29 to July 10 Prior

• Generation adidas player selected with Seattle’s top pick in the 2011 MLS

How Acquired: Signed on loan January 21, 2009 Previous Clubs: Deportivo Cali (Colombia, 2005-09), Atlético Huila (Colombia, loan 2007) 2011

• Has scored (6) or assisted (4) in his past 8 league matches, a record in MLS

this season • Leads team with 18 goals and 11 assists in all competitions • Named U.S. Open Cup Player of the Tournament, scoring 3 game-winning goals, including winner in final vs. CHI (10/4) • Named MLS Player of the Week for 2 goals at POR (7/10) • Scored winning free kick in 90’ at TOR (6/18), voted MLS Goal of the Week • Missed matches at SJ (4/2) and vs. CHI (4/9) after wrist surgery Prior

SuperDraft • Native of Ghana and three-year starter at UCSB

• Team co-leader with 10 goals and 10 assists, scoring or assisting on 20 of

15 | ALVARO FERNANDEZ Position: Midfielder Height: 6-1 Weight: 159 Birthdate: 10/11/1985 Hometown: Soriano, Uruguay Citizenship: Uruguay Pronunciation: AHL-bah-ro

international competition vs. Metapan (7/28/10) • Named MLS Newcomer of the Year for 2009 and MLS All-Star (twice)

How Acquired: Signed on July 29, 2010 Previous Clubs: Atenas (2006), Montevideo Wanderers (2007-08), Puebla (Mexico, 2008), Nacional (Uruguay, 2008-09), Vitoria Setubal (Portugal, 2009-10), Universidad de Chile (Chile; on loan from Nacional, 2010) 2011 • Scored brace vs. DC (9/17), first of career • Second on team with 9 league goals • Scored goal & named to MLSsoccer.com Team of the Week vs. POR (5/14) • Scored game-tying goal in 91 min. at PHI (4/16) and winner vs. TOR (4/30) Prior

• Started 4 of 12 appearances with 2 goals and 1 assist in 2010 • Scored 1st MLS goal vs. HOU (8/8) and scored 1st club goal on 1st shot to clinch a spot in CCL group stage at Metapan (8/3)

• Played for Uruguay in 2010 World Cup

Last MLS Match: Seattle (41), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (11), 3-1 win at CHV, 10/22/11 Last MLS Assist: Seattle (1), 1-3 loss at NE, 9/4/10

39 team goals in 2010

• Named MLS Humanitarian of the Month for March 2011 • Scored first club goal in MLS play vs. NY (3/19/09) and

Last MLS Match: Seattle (86), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (34), 2-1 win vs. SJ, 10/15/11 Last MLS Assist: Seattle (26), 3-1 win at CHV, 10/22/11

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT S O U N D E R S F C 2 0 11 P L AY E R N O T E S 18 | KASEY KELLER Position: Goalkeeper Height : 6-2 Weight: 190 Born: November 29, 1969 College: Portland (Ore.) Hometown: Olympia, Washington Citizenship: United States How Acquired: Signed as free agent on August 14, 2008, using MLS No. 1 Allocation Selection and signed one-year contract extension on December 16, 2010 Previous Clubs: Millwall (England, 1992-96), Leicester City (England, 199699), Rayo Vallecano (Spain, 1999-2001), Tottentham (England, 2001-2004), Southampton (England, Loan 2002-03), Borussia Mönchengladbach (Germany, 2004-07), Fulham (England, 2007-08) 2011 • Has started league-best 98 consecutive matches • Made season-high 7 saves vs. SJ (10/15) • Made 4 saves in U.S. Open Cup shutout victory vs. CHI (10/4) • Named to MLS First XI All-Star team • MLSsoccer.com Player of the Week vs. SJ (10/15) • Stopped Thierry Henry’s PK in 1-0 loss at NY (3/19) Prior

21 | NATE JAQUA Position: Forward Height: 6-4 Weight: 205 Born: October 28, 1981 College: Portland (Ore.) Hometown: Eugene, Oregon Citizenship: United States Pronunciation: JAKE-wuh How Acquired: Selected from Houston in the MLS Expansion Draft on November 26, 2008 Previous Clubs: Chicago (MLS, 2003-06), L.A. Galaxy (MLS, 2007), Houston (MLS, 2007), SC Rheindorf Altach (Austria, 2007-08), Houston (MLS, 2008) 2011

• Scored 2nd and deciding goal vs. SFR (8/3) • Recorded 1st assist of seaon and played 90 mins. at RSL (5/28) • Made 1st start of season vs. TOR (4/30) Prior

• Ranks 11th amongst active players with 41 goals • Started 3 of 15 appearances in injury-shortened 2010 season • Named 2010 U.S. Open Cup Player of the Tournament • Tied for top MLS career scorer on Sounders FC, with 41 goals

• Won MLS Save of the Year in 2010 for his stop vs. KC (4/17) • 16 years playing in three of Europe’s top-flight leagues: English Premier

Last MLS Match: Seattle (197), played 22 minute in 0-2 loss vs. PHI, 10/8/11 Last MLS Goal: Seattle (41), 2-1 win vs. DAL, 10/24/09 Last MLS Assist: Seattle (29), 2-1 win at NE, 10/01/11

Last MLS Match: Seattle (93), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Shutout: Seattle (30), 3-0 win vs. DC, 9/17/11 Last MLS Assist: Seattle (1), 2-0 win vs. HOU, 8/8/10

22 | MICHAEL SEAMON Position: Midfielder Height: 6-1 Weight: 183 Born: August 30, 1988 College: Villanova Hometown: Rahway, New Jersey Citizenship: United States

League, Spain’s La Liga and Germany’s Bundesliga • Named U.S. Soccer Athlete of the Year an unprecedented three times (1997, 1999 and 2005)

19 | SAMMY OCHOA Position: Forward Height: 6-0 Weight: 190 Born: September 4, 1986 Hometown: Riverside, Calif. Citizenship: United States/Mexico

• Started all 8 MLS Reserve League games, logging 719 mins, most of any

How Acquired: Signed on August 26, 2011.

• Placed on Disabled List (9/12) and will miss remainder of season

2011 Scored in past two matches, 1st MLS goal vs. SJ (10/15) and at CHV (10/22) • Made MLS debut at VAN (9.24), entering in the 66th minute

• Started 1st MLS game and recorded 1st assist vs. DAL (7/11) • Taken with 27th overall pick in 2010 MLS SuperDraft

Prior • Played previous 5 seasons for Mexico’s Estudiantes Tecos • Member of Sigi Schmid's U.S. team at the 2005 FIFA U-20 World Cup • Scored winner for Seattle in MLS Reserve League match vs. LA (6/13) Last MLS Match: Seattle (4), played 26 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (2), 3-1 win at CHV, 10/22/11 20| ZACH SCOTT Position: Defender Height: 5-11 Weight: 175 Born: July 2, 1980 College: Gonzaga Hometown: Haiku, Hawaii Citizenship: United States How Acquired: Signed as Discovery Player on March 16, 2009 Previous Clubs: Seattle Sounders (USL-1, 2002-08)

How Acquired: Selected in the 2010 MLS SuperDraft on January 14, 2009 2011

field player Prior

Last MLS Match: Seattle (8), played 5 minutes in 0-0 draw vs. RSL, 9/9/10 Last MLS Assist: Seattle (1), 1-1 draw vs. DAL, 7/11/10 23 | SERVANDO CARRASCO Position: Midfielder Height: 5-10 Weight: 170 Born: August 13, 1988 College: California Hometown: Tijuana, Mexico Citizenship: United States/Mexico Pronunciation: sir-VAWN-dough cuh-ROSS-coh How Acquired: Selected in the second round (27th overall) of the 2011 MLS SuperDraft on January 13, 2011 and signed on March 2, 2011 2011 • Scored in MLS Reserve League at POR (5/30) • MLSsoccer.com Team of the Week at CLB (5/7) • Started in MLS Debut in 1-0 loss at NY (3/19) Prior

2011 • Has logged career-high 593 mins. in MLS and tied career-high with 6 starts

• Two-time All-Pac 10 second-team honoree • Selected with the 27th overall pick in the 2011 MLS SuperDraft

Prior

Last MLS Match: Seattle (12), played 90 minutes in 2-1 win at NE, 10/01/11

• Converted winning PK at POR (USOC, 6/30/10) • Started all 4 appearances in league play in 2010 • Key defender for USL-1 Sounders during championship seasons of 2005 and 2007

Last MLS Match: Seattle (25), played 1 minutes in 2-1 win vs. SJ, 10/15/11

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT S O U N D E R S F C 2 0 11 P L AY E R N O T E S 24 | ROGER LEVESQUE Position: Midfielder/Forward Height: 6-2 Weight: 174 Born: January 22, 1981 College: Stanford Hometown: Portland, Maine Citizenship: United States Pronunciation: luh-VECK

27 | LAMAR NEAGLE Position: Midfielder/Forward Height: 5-11 Weight: 160 Born: May 7, 1987 Hometown: Federal Way, Washington College: UNLV Citizenship: United States Pronunciation: NAY-gull

How Acquired: Signed as Discovery Player on March 16, 2009

How Acquired: Signed on March 2, 2011

Previous Clubs: San Jose (MLS, 2003), Seattle Sounders (USL-1, 2004-08), San Jose (MLS, 2005)

Previous Clubs: Seattle Sounders FC (2009), Charleston Battery (2010), IFK Mariehamn (Finland, 2010-11)

2011 • Recorded 1st brace of career in 4-2 win vs. NY (6/23) • Recorded 1st MLS career assist vs. POR (5/14) • Made 1st start of season at CLB (5/7)

• Made a career-high 16 appearances with five starts in 2010, including one

2011 • Scored club’s 2nd hat trick vs. CLB (8/27), named MLS Player of the Week • Scored late winner at KC (8/3) and winner, 1st of MLS career at RSL (5/28), named MLS Goal of the Week • Leads team in MLS Reserve League scoring with 3 goals and 2 assists in 4 games played • Made MLS debut in First Kick 2011 vs. LA (3/15)

• 4 of 6 MLS goals for Seattle have come on road, including 3 game-winners • Scored first MLS career goal to end record home unbeaten streak at CLB

Prior

late game-winning goal at DC (7/15)

(10/3/09), and game-winner at KC (10/17/09) to clinch a postseason berth

Last MLS Match: Seattle (53), played 80 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (6), 4-3 win vs. COL, 7/16/11 Last MLS Assist: Seattle (2), 2-1 win vs. NE, 6/26/11 25 | PAT NOONAN Position: Forward Height: 6-0 Weight: 170 Born: August 2, 1980 College: Indiana Hometown: Ballwin, Missouri Citizenship: United States How Acquired: Signed on March 31, 2010 Previous Clubs: Mid Michigan (USL PDL, 2002), New England (MLS, 200308), Aalesunds FK (Norway, 2008), Columbus (MLS, 2008-09), Colorado (MLS, 2009). 2011

• Made 1st start of season vs. CHV (8/13) • Signed 3-month contract extension on April 1 Prior • Started 8 of 12 appearances in 2010 • Two-time MLS All-Star ranks 11th amonst active players with 41 goals scored Last MLS Match: Seattle (173), played 62 minutes in 0-2 loss vs. PHI, 10/8/11 Last MLS Goal: Seattle (41), 1-3 loss at PHI, 6/27/10 Last MLS Assist: Seattle (33), 3-0 win vs. NE, 6/5/10 26 | TAYLOR GRAHAM Position: Defender Height: 6-4 Weight: 190 Born: June 3, 1980 College: Stanford Hometown: Fair Oaks, California Citizenship: United States How Acquired: Signed as Discovery Player on January 21, 2009 Previous Clubs: Kansas City (MLS, 2003-04), Seattle (USL, 2005), New York (MLS, 2006-07), Seattle Sounders (USL-1, 2007-08) Prior • Saw 1st MLS action for SEA vs. NE (6/5/10); his first since 6/16/07 (NY) • Team’s 2009 Humanitarian of the Year • Member of the 2005 and 2007 USL-1 Sounders championship teams Last MLS Match: Seattle (35), played 1 minute in 3-0 win vs. NE, 6/5/10 Last MLS Goal: Kansas City (1), 1-2 loss at CLB, 8/18/04 Last MLS Assist: New York (1), 3-0 win vs. CHI, 5/24/07

Prior He scored 12 goals in 19 regular season matches for the Charleston Battery to earn Golden Boot and MVP honors in USL-2 in 2010 • A native of nearby Federal Way where he played for Thomas Jefferson High School Last MLS Match: Seattle (23), played 89 minutes in 2-1 win vs. SJ, 10/15/11 Last MLS Goal: Seattle (5), 6-2 win vs. CLB, 8/27/11 Last MLS Assist: (2), 2-1 win vs. SJ, 10/15/11 28 | TERRY BOSS Position: Goalkeeper Height: 6-3 Weight: 205 Born: September 1, 1981 Hometown: Philomath, Oregon College: Tulsa How Acquired: Signed on June 26, 2009 Previous Clubs: Charlotte Eagles (USL-2, 2005), Puerto Rico Islanders (USL-1, 2006-07), Vermont (2004, PDL), Fort Wayne (2004, PDL), Charlotte Eagles (USL-2, 2008), New York Red Bulls (2008-09) 2011

• Placed on club’s Disabled List (9/9) • Suffered concussion in World Cup qualifier for Puerto Rico (9/2) • Has started 4 games in all competitions with 4 wins, including shutout at

Monterrey (8/23)

Prior • Called in by Puerto Rico national team for Carribean Championship Stage One and played all 3 games (all wins); has 7 caps • Made 1st competitive start in USOC quarterfinal shutout 2-0 over LA (7/7/10) Last MLS Match: Seattle (1), played 45 minutes in 2-2 draw at DAL, 4/22/10 29 | JOSH FORD Position: Goalkeeper Height: 6-0 Weight: 175 Born: November 6, 1987 College: Connecticut Hometown: Liverpool, New York Citizenship: United States How Acquired: Selected in the first round (11th overall) of the 2011 MLS Supplemental Draft Prior • 2010 Big East Goalkeeper of the Year • Holds UConn career records in shutouts (50), consecutive starts (85) and wins (54)

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT S O U N D E R S F C 2 0 11 P L AY E R N O T E S 30 | AMADOU SANYANG Position: Midfielder Height: 6-0 Weight: 165 Born: August 1, 1991 Hometown: Banjul, Gambia Citizenship: Gambia Pronunciation: Ah-ma-DOO SAN-yang

34 | JHON KENNEDY HURTADO Position: Defender Height: 6-0 Weight: 183 Born: May 16, 1984 Hometown: Palmira, Colombia Citizenship: Colombia Pronunciation: jon her-TOD-oh

How Acquired: Signed as free agent on July 30, 2011

How Acquired: Signed on February 18, 2009

Previous Clubs: Real de Banjul (2007-09), Toronto FC (2009-10)

Previous Clubs: Unión Magdalena (Colombia, 2004), Monagas de Maturin (Colombia, 2005), Centauros Villavicencio (Colombia, 2006), Expreso Rojo (Colombia, 2006), Real Cartagena (Colombia, 2007), Deportivo Cali (Colombia, 2008-09)

2011 • Made 1st home and league club appearance vs. DC (9/17) • Made club debut at MNT (8/23) in CCL round 2 Prior • Signed at age 17 by Toronto FC and made debut on 18th birthday (8/1/09) • Played in 20 regular season games over two seasons for TFC, starting 15 • Won Gambian 1st division championship in 2007 and named the league’s top midfielder • Represented Gambia internationally at the U-17 and U-20 levels Last MLS Match: Seattle (21), played 8 minutes in 3-0 win vs. DC, 9/17/11 31 | JEFF PARKE Position: Defender Height: 6-1 Weight: 185 Born: March 23, 1982 College: Drexel University Hometown: Downingtown, Pennsylvania Citizenship: United States Pronunciation: Park

2011

• Recorded 1st assist in 27 games vs. TOR (4/30) • Issued 2 yellows at TOR (6/18) and missed match

vs. NY (6/23) and received red card ejection vs. RSL (9/10) and missed match vs. DC (9/17) Prior

• Suffered left ACL tear in stoppage time vs. SJ (5/22/10) • Selected to MLS All-Stars and Finalist for Defensive Player of the Year (2009) • Started and played the full 90 mins. in 28 of 29 appearances in 2009 Last MLS Match: Seattle (59), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: Seattle (1), 1-1 draw at DAL, 5/16/09 Last MLS Assist: Seattle (2), 3-0 win vs. TOR, 4/30/11

How Acquired: Selected from New York in the MLS Expansion Draft on November 26, 2008. Signed on May 13, 2010

35 | BRYAN MEREDITH Position: Goalkeeper Height: 6-2 Weight: 195 Born: August 2, 1989 College: Monmouth Hometown: Scotch Plains, New Jersey Citizenship: United States

Previous Clubs: New York Red Bulls (MLS, 2004-2008), Vancouver Whitecaps (USL-1, 2009)

How Acquired: Selected in second round (29th overall) of the 2011 MLS SuperDraft. Signed on September 12, 2011

2011

Prior • Starting keeper for 2011 USL PDL champions Kitsap Pumas • Named to the 2010 All-Northeast Conference first team and NEC Tournament MVP as a senior • Led nation in goals against average (0.306) and posted 12 shutouts as a junior

• Named MLS Player of the Week vs. KC (5/21) • Scored game-winner in 93rd min. vs. KC (5/21), 1st goal since 2004 • MLSsoccer.com Team of the Week vs. LA (3/15) and NY (3/19) Prior

• Started all 21 appearances after joining SEA in May of 2010 • Registered first club assist in win vs. CHV (10/15/10) Last MLS Match: Seattle (180), played 90 minutes in 3-1 win at CHV, 10/22/11 Last MLS Goal: New York (2), 1-0 win vs. KC, 5/21/11 Last MLS Assist: Seattle (4), 2-1 win vs. CHV, 10/15/10 32 | MIGUEL MONTAÑO Position: Forward Height: 5-11 Weight: 150 Born: June 25, 1991 Hometown: Palmira, Colombia Citizenship: Colombia Pronunciation: mon-TAN-yo How Acquired: Signed on April 30, 2010 Previous Clubs: Envigado FC (Colombia, 2008), Quilmes Atletico Club (Argentina, 2009) 2011

• Loaned to Montreal Impact for remainder of 2011 season (8/15) • Scored game-winner in MLS Reserve League vs. CHV (5/9) Prior • Became youngest Sounders FC player to appear in an MLS match, entering in the 57th min. vs LA (5/8/10) as a 19-year-old • Assisted on both goals in 2-nil USOC quarterfinal win vs. LA (7/7/10) • Called in to Colombia Under-20 National Team for two friendlies in April Last MLS Match: Seattle (8), played 25 minutes in 2-2 draw vs. VAN, 6/11/11

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

T E A M T R A N S A C T I O N S ( S I N C E N O V. 2 0 1 0 ) November 12, 2010 Midfielder Steve Zakuani called in by Congo DR national team (vs. Mali in Paris) November 22, 2010 Traded midfielder Peter Vagenas to Colorado Rapids for defenders Danny Earls and Julien Baudet

February 17, 2011 Signed midfielder Osvaldo Alonso to contract extension March 2, 2011 Signed midfielder Servando Carrasco Signed midfielder/forward Lamar Neagle Waived defender Danny Earls

November 24, 2010 Midfielder Sanna Nyassi selected by Vancouver in 2010 MLS Expansion Draft Midfielder Nathan Sturgis selected by Vancouver in 2010 MLS Expansion Draft Acquired forward O’Brian White in trade with Vancouver

March 14, 2011 Re-signed midfielder Miguel Montano Signed goalkeeper Josh Ford

December 1, 2010 Signed forward Fredy Montero to contract extension

March 28, 2011 Announced forward Blaise Nkufo has retired

December 15, 2010 Defender Tyrone Marshall selected by Colorado in MLS Re-Entry Draft Acquired goalkeeper Chris Seitz Traded goalkeeper Chris Seitz to Dallas for a fourth round SuperDraft pick in 2012

March 29, 2011 Defender Leo Gonzalez received U.S. green card

December 16, 2010 Signed midfielder Erik Friberg

July 12, 2011 Removed forward O’Brian White from Disabled List

December 17, 2010 Signed goalkeeper Kasey Keller to contract extension

July 30, 2011 Signed midfielder Amadou Sanyang

January 13, 2011 Five players selected in the 2011 MLS SuperDraft. Michael Tetteh (UCSB, 2nd round, 20th overall), Leone Cruz (2nd round, 21st overall), Servando Carrasco (Cal, 2nd round, 27th overall), Bryan Meredith (Monmouth, 2nd round, 29th overall), Alex Caskey (Davidson, 3rd round, 47th overall) (Con’t.) Traded 2011 MLS SuperDraft first round pick (11th overall) and an international roster slot for one year to Portland for the second pick in the second round (20th overall) in the 2011 MLS SuperDraft and allocation money

August 15, 2011 Loaned midfielder Miguel Montano to Montreal Impact for remainder of 2011 season

January 18, 2011 Three players selected in 2011 MLS Supplemental Draft. Josh Ford (UConn, 1st round, 11th overall), Corey Attaway (Cal, 2nd round, 29th overall), Sean Morris (Seattle University, 3rd round, 47th overall)

September 12, 2011 Placed midfielder Michael Seamon on Disabled List Signed goalkeeper Bryan Meredith

March 18, 2011 Signed midfielder Mauro Rosales

June 29, 2011 Defender/Midfielder Michael Tetteh Loaned to Orlando City (USL PRO)

August 26, 2011 Signed forward Sammy Ochoa September 9, 2011 Placed goalkeeper Terry Boss on Disabled List

TEAM MILESTONES (SINCE FEB. 2011) February 22, 2011 Sounders FC announces it will participate in Inaugural Beach Soccer Club World Cup March 4-6, 2011 Sounders FC hosts inaugural Cascadia Summit at Starfire Sports Complex March 8, 2011 Fredy Montero named MLS Humanitarian of the Month for March June 23, 2011 Sounders FC sets home attendance record for MLS match at 46,065 (vs. NY) July 20, 2011 The capacity crowd of 67,052 for the friendly against Manchester United broke the attendance record for any match played in the Pacific Northwest August 23, 2011 Sounders FC becomes the second MLS club to win a competitive match in Mexico with a 1-0 win over reigning CONCACAF Champions League winners CF Monterrey September 17, 2011 Sounders FC broke the season total attendance record when 36,242 showed up for the 47th consecutive sellout in a 3-0 win over D.C. United, bringing the season total to 553,987. Seattle has set a new record each of the past two seasons (previous record: 542,600 in 2010)

September 23, 2011 Sounders FC clinched berth in MLS Cup Playoffs for third straight season September 27, 2011 Sounders FC clinched advancement to CONCACAF Champions League quarterfinal with a 2-2 draw at Guatemala’s CSD Comunicaciones October 4, 2011 Sounders FC becomes first MLS club to win three consecutive Lamar Hunt U.S. Open Cup championships. Seattle is the fourth three-peat winner and first in 42 years. October 15, 2011 The attendance of 64,140 for the regular season finale was the most ever for a competitive soccer match played in Seattle or the Pacific Northwest. It was also the third-largest crowd for a single match in MLS history.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT ATTENDANCE RECORDS BROKEN Seattle set a new MLS record for attendance with an average of 30,897 in 2009, only to surpass that mark in 2010 with an average of 36,173 and again in 2011 with an average of 38,498. The previous mark of 28,916 was set by the L.A. Galaxy in 1996. Sounders FC is the first franchise in MLS history to have 28,000 or more fans at 15 games, with each regular season match on Xbox Pitch at CenturyLink Field a sell-out. The top regular season crowd was 46,065, a 4-2 win over New York. The top 10 home season attendance averages are as follows: 2011 Seattle Sounders FC - 38,498 2010 Seattle Sounders FC - 36,173 2009 Seattle Sounders FC - 30,897 1996 Los Angeles Galaxy - 28,916 2008 Los Angeles Galaxy - 26,009 2007 Los Angeles Galaxy - 24,252 2005 Los Angeles Galaxy - 24,204 1996 MetroStars - 23,898 2004 Los Angeles Galaxy - 23,809 1997 New England Revolution - 21,423 * Sounders FC have sold out 48 consecutive MLS matches at CenturyLink Field.

S O U N D E R S FC T O P A T T E N D A N C E S The top 10 attendances at CenturyLink Field are as follows: 67,052 July 20, 2011 Seattle v Manchester United (friendly) 66,848 August 5, 2009 Seattle v Barcelona (friendly) 65,289 July 18, 2009 Seattle v Chelsea (friendly) 64,140 October 15, 2011 Seattle v San Jose 46,065 June 23, 2011 Seattle v New York Red Bulls 45,631 July 18, 2010 Seattle v Celtic (friendly) 41,047 Oct.12, 2010 Seattle v Chivas Guadalajara (friendly) 40,122 May 26, 2010 Seattle v Boca Juniors (friendly) 36,593 May 14, 2011 Seattle v Portland Timbers 36,502 June 11, 2011 Seattle v Vancouver Whitecaps FC *46,011 Nov. 22, 2009

MLS Cup (Real Salt Lake v L.A.)

PA C I F I C N O R T H W E S T R E C O R D S WAT C H The top 10 attendances for matches played in the Pacific Northwest (notably Seattle, Vancouver, B.C. and Portland): 66,848 August 5, 2009 CenturyLink Field Seattle vs. Barca* 66,830 August 9, 2006 CenturyLink Field Real Madrid vs. D.C.* 66,722 July 22, 2003 CenturyLink Field Man Utd. vs. Celtic * 65,289 July 18, 2009 CenturyLink Field Seattle vs. Chelsea* 64,140 October 15, 2011 CenturyLink Field Seattle vs. San Jose 60,342 June 20, 1983 BC Place Vancouver v Seattle 60,051 October 1, 1983 BC Place Toronto v Tulsa58,218 April 9, 1976 Kingdome Seattle v New York* 56,416 April 16, 2008 Qwest Field Mexico v China* 56,256 August 25, 1977 Kingdome Seattle v Los Angeles* friendly - NASL

R AV E G R E E N S U P P O R T

IS A

GROWING LEGEND

Sounders FC supporters continue to come out in record numbers, drawing a crowd of 34,140 to the regular season hom finale, setting an MLS record average attendance of 38,498. Seattle has set the season total and average MLS attendance records in their first two seasons. The 2011 average is over 14,000 more than their nearest MLS opponent (L.A. Galaxy) and would rank 10th amongst Major League Baseball teams and eighth amongst English Premier League clubs. Sounders FC would currently rank seventh in Spain's La Liga, fifth in Italy's Serie A and 13th in Germany's Bundesliga. Seattle also set the Open Cup final record for the second straight year when 35,615 packed CenturyLink Field. Top MLB Average Attendances: 1. Philadelphia Phillies 45,440 2. NY Yankees 45,107 3. San Francisco Giants 41,818 4. Minnesota Twins 39,112 5. LA Angels 39,090 6. Seattle Sounders FC 38,498 8. St. Louis Cardinals 38,196 9. Milwaukee Brewers 37,918 10. Boston Red Sox 37,703 Top EPL Average Attendances: 1. Manchester United 75,478 2. Arsenal 59,968 3. Manchester City 46,868 4. Newcastle United 45,271 5. Liverpool 44,888 6. Chelsea 41,552 7. Seattle Sounders FC 38,498 8. Sunderland 37,890 9. Tottenham Hotspur 36,184 10. Everton 34,707

3 G O A L S AT H O M E M E A N S F R E E H A I R C U T If Sounders FC scores three goals against its opponent at any home game, all fans in attendance are eligible to receive a free haircut at any participating Seattle area Great Clips Salon. Fans need to take their Sounders FC game ticket to participating Great Clips Salons within seven (7) days of the game to receive your free cut.

H O M E S H U TO U T = J A C K I N T H E B O X TA C O S If Sounders FC shutout its opponent at home, simply show your game ticket at any participating Jack in the Box location and receive two free tacos. No purchase necessary. Show game ticket when ordering. Offer only valid until start time of the next Sounders FC home game.

Seattle Sounders FC at Real Salt Lake - Saturday, October 29, 2011 - 7:00 p.m. PT

TEAM/INDIVIDUAL RECORDS (SINCE FEB. 2011) TEAM Most Goals, Game 6 vs. CLB Most Goals, Half 4 vs. CLB Most Shots, Game 26 vs. HOU (3/25) Fewest Offsides Both Teams, Game 0 2 Times (Last 6/18 at TOR) Most Shots, Half 15 vs. HOU (3/25) Most Corner Kicks, Game 12 2 Times (Last 3/25 vs. HOU) Fewest Corner Kicks Both Teams, Game 4 2 Times (Last 4/16 at PHI)

Most Fouls Committed, Game 22 at CLB, 5/7 Fewest Fouls Suffered, Game 4 at SJ, 4/2

2 0 11 P L AY MLSsoccer.com Team of the Week Week 1: Jeff Parke Week 2: Osvaldo Alonso Week 3: Steve Zakuani Week 4: Kasey Keller, Zakuani, Mauro Rosales, O'Brian White Week 7: Brad Evans Week 8: Servando Carrasco Week 9: Fernandez Week 10: Parke Week 13: Rosales Week 15: Rosales Week 17: Fredy Montero Week 18: Rosales, Alonso, Roger Levesque Week 21: Rosales Week 22: Alonso Week 23: Jhon Kennedy Hurtado, Leo Gonzalez Week 24: Lamar Neagle, Rosales Week 26: James Riley Week 27: Rosales, Fernandez Week 28: Montero Week 29: Montero Week 31: Alonso, Keller

ER AWARDS MLS Player of the Week Jeff Parke Fredy Montero Mauro Rosales Lamar Neagle Kasey Keller

INDIVIDUAL Most Goals, Game 3 Lamar Neagle (8/27 vs. CLB) Most Shots, Game 8 Fredy Montero (7/10 at POR) Most Shots on Goal, Game 5 Fredy Montero (7/10 at POR) Most Fouls Committed, Game 5 Osvaldo Alonso (4/16 at PHI)

Week 10 Week 17 Week 18 Week 24 Week 31

MLS Coach of the Week Sigi Schmid Week 15 MLS Goal of the Week Oâ&#x20AC;&#x2122;Brian White Lamar Neagle Fredy Montero Tyson Wahl Alvaro Fernandez MLS Save of the Week Kasey Keller

Week 4 Week 11, Week 24 Week 14, Week 28 Week 15 Week 27 Week 3, Week 4, Week 12, Week 23, Week 32

U.S. Open Cup Player of the Round Mike Fucito Third Round Osvaldo Alonso Final U.S. Open Cup Player of the Tournament Fredy Montero 2011

OCTOBER 26 - NOVEMBER 20

MEDIA GUIDE GUIA DE PRENSA

SUNDAY, NOVEMBER 20

THE HOME DEPOT CENTER

9:00 PM ET • 6:00 PM PT

CARSON, CALIFORNIA

REAL SALT LAKE vs. SEATTLE SOUNDERS FC ² WESTERN CONFERENCE SEMIFINAL SERIES    

2011 REAL SALT LAKE RESERVE LEAGUE STATS (3-­7-­0, 9 pts.)    

UNF  POS   10   M/F   13   FW   16   FW   26   MF   12   MF   22   MF   -­-­   DF   -­-­   MF   14   MF   27   FW   2   DF   -­-­   DF   -­-­   DF   -­-­   MF   21   MF   20   MF   23   FW   45   DF   30   DF   -­-­   MF   -­-­   FW   16   MF   -­-­   MF   -­-­   MF   -­-­   MF   43   M/F   3   DF   28   DF   13   DF   25   FW   41   MF   19   DF   77   MF   17   DF          

PLAYER   Arturo  Alvarez   Chris  Agorsor   Conor  Chinn   Collen  Warner   Jean  Alexandre   Nelson  Gonzalez   Julio  Alarcon*   Jordan  Allen   Yordany  Alvarez   Cody  Arnoux   Tony  Beltran   Leone  Cruz#   Paulo  da  Silva#   David  Flores#   Luis  Gil   Ned  Grabavoy   Paulo  Jr.   Phanuel  Kavita*   Rauwshan  McKenzie   Paulo  Mendes#   Pedro  Mendes#   Nico  Muniz   Kevin  Molina#   Lucas  Neel#   Nelio#   Maikon  Orellana*   Robbie  Russell   Chris  Schuler   Seth  Sinovic#   Donny  Toia   Ricardo  Velasco*   Blake  Wagner   Andy  Williams   Chris  Wingert   RSL  totals   Opponent  totals  

GP   3   5   4   9   8   6   5   1   4   6   4   2   2   1   6   1   7   3   10   1   1   6   1   1   1   3   1   6   1   9   5   6   1   1   10   10  

GS   3   3   4   9   8   5   4   0   4   3   3   2   0   1   5   1   6   2   10   0   0   3   0   1   1   2   0   6   1   7   1   5   0   1   10   10  

MIN   G   A   C   E   239   2   1   0   0   286   1   0   0   0   285   1   0   1   0   525   1   0   2   0   698   1   0   2   0     426   0   2   2   1   338   0   0   1   0   17   0   0   0   0   342   0   0   1   0     299   0   0   1   0   299   0   0   0   0   172   0   0   0   0   21   0   0   0   0     90   0   0   0   0   434   0   0   0   0   45   0   0   0   0   429   0   0   0   0   200   0   0   0   0   900   0   0   1   0   35   0   0   0   0   18   0   0   0   0   346   0   0   1   0     45   0   0   0   0   90   0   0   0   0   77   0   0   0   0     154   0   0   0   0   14   0   0   0   0   540   0   0   1   1   90   0   0   0   0   458   0   0   3   0   135   0   0   2   0     293   0   0   1   0   35   0   0   0   0   45   0   0   0   0     900      6        3        19        2   900   10   -­   -­   -­  

  (*)-­  RSL-­Arizona  Academy  player   (#)-­  RSL  guest  player      

REAL SALT LAKE RESERVES INDIVIDUAL GOALKEEPING UNF  POS   1   GK   24   GK              

GOALKEEPER   Tim  Melia   Kyle  Reynish   Team  Totals   Opponent  totals  

GP   7   6   10   10  

GS   5   5   10   10  

MIN   475   425   900   900  

GA   7   3   10   6  

GAA   1.75   0.60   1.00   0.60  

PG   3   1   4   0  

PA   3   1   4   0  

W   1   2   3   7  

L   4   3   7   3  

T   0   0   0   0  

SO   0   2   3   7  

REAL SALT LAKE RESERVES 2011 RESULTS/SCHEDULE Date 3/29 4/14 5/03 5/14 5/22 8/21 9/06 9/18 10/08 10/15  

 

Opponent FC Dallas Reserves Colorado Rapids Reserves @ Sporting KC Reserves Houston Dynamo Reserves @ FC Dallas Reserves @ Houston Dynamo Reserves @ Chicago Fire Reserves Sporting KC Reserves Chicago Fire Reserves @Colorado Rapids Reserves

Result/Time (MT) 0-2 L 2-0 W 0-2 L 0-1 L 2-0 W 0-1 L 0-2 L 0-1 L 0-1 L 2-0 W

Venue XanGo Field ± Lehi, Utah XanGo Field ± Lehi, Utah Swope Park Training Center ± Kansas City, Missouri Rio Tinto Stadium ± Sandy, Utah Pizza Hut Park ± Frisco, Texas Robertson Stadium ± Houston, Texas Toyota Park ± Bridgeview, Illinois XanGo Field ± Lehi, Utah XanGo Field ± Lehi, Utah Dicks Sporting Goods Park

 


RSL_2011_PLAYOFF_MEDIA_GUIDE_WCSS-1