Page 1

Votre fournisseur partenaire

5WRRQTVURQWTKORTGUUKQPUQNXCPV oEQUQNXCPV78GV.CVGZ 5WRRQTVURQWTKORTGUUKQPiDCUGGCW

10 Familles de produits pour l’imagerie grand format

'PETGU (KNOUFGRNCUVK±ECVKQP #FJoUKHUFGOCTSWCIGGVFGFoEQTCVKQP 6WPKPI(KNOU +ORTKOCPVGUITCPFHQTOCV .COKPCVGWTUITCPFHQTOCV

6CTKH

2013

/CVoTKGNUFGEQWRGGVCEEGUUQKTGUFG±PKVKQP 5[UVpOGUFGRToUGPVCVKQP

YYY±NOGFKCFKUVTKDWVKQPEQO


Supports pour impression solvant et ĂŠco-solvant .......................... P.3 Supports pour impression Ă base eau ........................ P.15

Pour passer votre commande Par tĂŠlĂŠphone :

02 99 55 17 19

Par Fax :

02 99 55 17 20

Par courrier :

ZAC de Bellevue 8, rue A. de St ExupĂŠry 35235 ThorignĂŠ-Fouillard

Par e-mail : Notre site : 

EQPVCEV"ÂąNOGFKCFKUVTKDWVKQPHT YYYÂąNOGFKCFKUVTKDWVKQPEQO %CVCNQIWGGPNKIPGÂąEJGUVGEJPKSWGU applications des produits.

Encres ........................ P.21

Films de plastiďŹ cation ....................... P.25

AdhĂŠsifs de marquage et de dĂŠcoration ........................ P.34

TuningFilms

Notre service

........................ P.36

Franco de port Ă partir de 400 â‚Ź par commande

Imprimantes, Rip Plotters de dĂŠcoupe Presse Ă chaud

DĂŠlai de livraison 24 - 48 heures (ExpĂŠdition le jour mĂŞme jusqu'Ă 16h30) Coupe de bobines : jusqu'Ă  170 cm

........................ P.37

Laminateurs grand format ........................ P.45

Sertisseuse - Soudeuse MatĂŠriels de coupe et accessoires de ďŹ nition ........................ P.50

Vos conditions d'achat Votre remise consommable particulière : Hors encres, matÊriels et accessoires ROLAND et GRAPHTEC

Prix net pour les systèmes de prÊsentation Systèmes de prÊsentation ........................ P.55

CONDITIONS GENERALES DE VENTE Les prÊsentes conditions gÊnÊrales de ventes sont tenues à la disposition de nos clients et communiquÊes dans les conditions prÊvues par la loi. En consÊquence le fait de passer commande implique l’adhÊsion entière et sans rÊserve de l’acheteur à nos conditions gÊnÊrales de ventes, à l’exclusion de tous autres documents tels que prospectus, catalogues et qui n’ont qu’une valeur indicative. Aucune condition particulière ne peut, sauf indication formelle et Êcrite de notre part, prÊvaloir contre nos conditions gÊnÊrales de vente. Toute condition contraire posÊe par l’acheteur nous sera donc, à dÊfaut d’acceptation expresse, inopposable quel que soit le moment oÚ elle aura pu être portÊe à notre connaissance. PRIX Article 1 - Nulle commande ne peut être annulÊe pour quelque motif que se soit sans l’assentiment de la sociÊtÊ FilmÊdia. Le prix de la facturation des machines ou fournitures commandÊes est celui du tarif en vigueur le jour de rÊception de la commande. Les prix de notre tarif s’entendent HT dÊpart entrepôts, emballage gratuit (sauf maritime). Le transporteur n’est pas tenu de dÊballer et d’installer la marchandise. COMMANDES : DÊpart de nos entrepôts Pour des commandes relatives à des machines, un acompte de 30% à la commande sera demandÊ. Pour les produits consommables : Franco à partir de 500 Euros Pour toute commande infÊrieure à ce seuil, participation forfaitaire aux frais de port de 35₏. PAIEMENT Article 2 - Nos factures sont payables à Filmedia 35235 ThorignÊ-Fouillard. &oNCKFGRCKGOGPViLQWTU¹PFGOQKUFŠGZRoFKVKQPCRTpUCEEGRVCVKQPFŠGPEQWTURCT#64#&+75UQEKoVo d’assurance risque. - Toute somme non payÊe à l’ÊchÊance porte de plein droit intÊrêt à au moins 1,5 fois le taux d’intÊrêt lÊgal (loi du 31/12/92). - En cas de non paiement d’une facture à son ÊchÊance, nous nous rÊservons le droit d’augmenter son montant de 10% avec minimum de 38₏ sans prÊjudice des intÊrêts de retard prÊvus prÊcÊdemment. Les fournitures de pièces dÊtachÊes de rechange sont payables comptant, net et sans escompte. Les contrats d’entretien, travaux de rÊparation et d’entretien sont Êgalement payables comptant, net et sans escompte. A dÊfaut de paiement aux ÊchÊances prÊvues, l’intÊrêt lÊgal sera dÝ sans avertissement. RÉSERVE DE PROPRIÉTÉ Article 3 - Nous nous rÊservons la propriÊtÊ de la marchandise jusqu’à complet paiement du prix (loi 80.335 du 12.05.80).Les risques sont à charge de l’acheteur. Les acomptes pourront être conservÊs pour couvrir les pertes Êventuelles à la revente.

DÉLAI DE LIVRAISON Article 4 - Nos dÊlais de livraison sont indicatifs et sans engagement. 'PCWEWPECUPQWUPGRQWTTKQPUUWDKTFGUKPFGOPKVoUFGTGVCTF7PGCPPWNCVKQPFGEQOOCPFGRQWT retard ne serait acceptÊe qu’après un dÊlai de 6 semaines après mise en demeure de livrer par lettre recommandÊe.

EXPÉDITION ET LIVRAISON Article 5 - Nos marchandises et fournitures voyagent toujours aux risques et pÊrils du destinataire, qui FGXTCXoTK¹GTNGUGPXQKUGVHCKTGNGUToUGTXGUFŠWUCIGCWRTpUFWVTCPURQTVGWTNQTUFGNCToEGRVKQP 4d%.#/#6+104'6174 Article 6 - Toute rÊclamation, pour être valable, doit être faite au plus tard dans les 3 jours suivant la rÊception des marchandises. Aucun retour ne sera acceptÊ sans notre accord et devra nous parvenir à l’Êtat neuf, franco de port dans l’emballage d’origine. Le client doit obtenir au prÊalable un numÊro d’autorisation de retour. Ce numÊro devra être repris de façon visible sur les emballages. 7POQPVCPVFGFGNCXCNGWTUGTCTGVGPWRQWTEQWXTKTNGUHTCKUFGOCPWVGPVKQPGVFGTGEQPFKVKQPPGment. Etant donnÊ la grande diversitÊ des usages possibles et le dÊveloppement continuel de nouvelles possibilitÊs, l’utilisateur doit examiner attentivement les aptitudes et les performances du produit pour chaque utilisation prÊcise et il assume seul tous les risques relatifs à cette utilisation. FilmÊdia Distribution ne sera responsable des dommages qu’à concurrence du prix d’achat des produits et ne sera pas responsable FGUFQOOCIGUKPFKTGEVUQWHQTVWKVU6QWVGUNGUURoEK¹ECVKQPUFGPQURTQFWKVUUQPVUWLGVVGUiOQFK¹ECVKQP UCPUPQVK¹ECVKQPRToCNCDNG GARANTIE 0QUOCEJKPGUUQPVICTCPVKGUCPiEQORVGTFGNCFCVGFŠCEJCVFGNŠWVKNKUCVGWT¹PCN L’application de la garantie ne peut en aucun cas donner lieu à paiement d’indemnitÊs. Elle consiste au remplacement pur et simple des pièces prÊsentant un vice de fabrication non apparent ou de matière après expertise par le fabricant. Les pièces sujettes à usure normale, tels que les lampes, tubes, lames, pièces en caoutchouc ne sont pas couvertes par la garantie. Les pièces dÊfectueuses sont remplacÊes gratuitement pendant la durÊe de la garantie. Les frais d’expÊdition, de rÊexpÊdition ou de dÊplacement sont à la charge de FilmÊdia pendant la pÊriode de garantie. .ŠoEJCPIGNCToRCTCVKQPQWNCOQFK¹ECVKQPFŠWPGRKpEGRGPFCPVNCRoTKQFGFGICTCPVKGPGRGWVCXQKTRQWT effet de prolonger la dite garantie. Le non respect des modes d’emploi, le dÊfaut d’entretien et l’utilisation des machines pour des travaux CWVTGUSWGEGWZRGTOKUGVNCOQFK¹ECVKQPFGUOCEJKPGUGPVTCuPGPVNŠCPPWNCVKQPRWTGGVUKORNGFGNC garantie. ,74+&+%6+10%1/2d6'06' Article 8 - En cas de litige, le Tribunal de RENNES sera seul compÊtent, même en cas de demande inciFGPVGQWGPICTCPVKGQWGPECUFGRNWTCNKVoFGFoHGPFGWTU.ŠCEEGRVCVKQPFGUVTCKVGUPGUCWTCKVOQFK¹GT cette attribution expresse de compÊtence et de juridiction.


Les supports pour impression solvant, éco-solvant, UV et Latex

Textile

Total covering

Total covering Surface vitrée

ultra conformable

Vinyle Une gamme de produits sélectionnés pour leur excellent rapport qualité prix

Caisson lumineux

QVinyles adhésifs monomères .................................................. P 4 QVinyles adhésifs polymères....................................................... P 6 QVinyles adhésifs pour murs et sols extérieurs .... P 8 QSpécialités pour surfaces vitrées et caissons lumineux ....................................................................... P 9 QBâches ................................................................................................................. P 11 QPapiers ................................................................................................................ P 12

Catalogue interactif

Q Supports écologiques et textiles ......................................... P 13 Q Papiers peints numériques ........................................................ P 14

T é l

:

0 2

9 9

5 5

1 7

1 9

3


572214652174+/24'55+10$#5'51.8#06 '%151.8#0678'6.#6':

VINYLES ADHÉSIFS MONOMĂˆRES 2TKPVXKP[N2$TKNNCPV/QPQOpTG

2TKPVXKP[N2/CV/QPQOpTG

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGoOWNUKQPVTCPURCTGPVRGTOCPGPV Q DĂŠcoration intĂŠrieure et extĂŠrieure court terme pour surfaces planes Q 'ZKUVGGPUGOKRGTOCPGPV4oH4iÂŽ*6/2

PNCUVKÂąECVKQPEQPUGKNNoG2TKPVEQXGT

PNCUVKÂąECVKQPEQPUGKNNoG2TKPVEQXGT

 

RĂŠfĂŠrence

Format en m

829P105

1,05

2 2

 

d

M /HTd

50

114,45

2,18

† †

 

† †

,62$TKNNCPV/QPQOpTG

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGVTCPURCTGPVRGTOCPGPV Q DĂŠcoration intĂŠrieure et extĂŠrieure court terme pour surfaces planes Q 'ZKUVGGPUGOKRGTOCPGPV4oH4iÂŽ*6/2

2

 

RĂŠfĂŠrence

Format en m

d

M /HTd

828P105

1,05

2 2

 

50

118,13

2,25

† †

 

† †

2

CPU

Q PVC souple blancOKETQPU Q #FJoUKHCET[NKSWGoOWNUKQPRGTOCPGPViHQTVRQWXQKTEQWXTCPV Q DĂŠcoration intĂŠrieure et extĂŠrieure court et moyen terme pour surfaces planes

Q 'ZKUVGGPUGOKRGTOCPGPV4oH,64iÂŽ*6/2 PNCUVKÂąECVKQPEQPUGKNNoG2TKPVEQXGT L(2)

 

RĂŠfĂŠrence

Format en m

JT5122P105 ,62 ,62

1,05  

50 † †

d

M /HTd

130,72  

2,49 † †

,62$TKNNCPV/QPQOpTG

2

CPU

Q PVC souple blancECNCPFToOKETQPU Q #FJoUKHCET[NKSWGoOWNUKQPVTCPURCTGPV  RGTOCPGPV

Q DĂŠcoration intĂŠrieure et extĂŠrieure court terme sur surface plane

,62/CV/QPQOpTG

Q 'ZKUVGGPUGOKRGTOCPGPV4oH,64iÂŽ*6/2 PNCUVKÂąECVKQPEQPUGKNNoG.(2) RĂŠfĂŠrence JT5822P137  ,62  ,62

Format en m 1,37  

50 † 

d

M /HTd

223,99  

3,27 † †

2

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGoOWNUKQPVTCPURCTGPVRGTOCPGPV Q DĂŠcoration intĂŠrieure et extĂŠrieure court terme sur surface plane Q 'ZKUVGGPUGOKRGTOCPGPV4oH,64iÂŽ*6/2 PNCUVKÂąECVKQPEQPUGKNNoG.(2)

 

RĂŠfĂŠrence JT5824P137 ,62 ,62

Format en m 1,37 50  †  

d 228,79  

M /HTd 3,34 † † 2

,6278$TKNNCPV

CPU

Q 'EQEQPnWUCPU28%

NOUVEAU GREEN

Q 2QN[QNpÂąPGCFJoUKHDNCPEOKETQPU Q AdhĂŠsif acrylique ĂŠmulsion (eau) transparent permanent ou semi-permanent

Q 7PKSWGOGPVEQORCVKDNGCXGENGUKORTKOCPVGU78 PNCUVKÂąECVKQPEQPUGKNNoG.WX.WX 

4

RĂŠfĂŠrence

Format en m

,6278





d

M /HTd





2


VINYLES ADHÉSIFS MONOMĂˆRES ,62$TKNNCPV/QPQOpTG

CPU

,62/CV/QPQOpTG

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGRGTOCPGPVQRCSWG Q DĂŠcoration intĂŠrieure et extĂŠrieure moyen terme sur surfaces planes Q 'ZKUVGGPUGOKRGTOCPGPV4oH,64iÂŽ*6/ PNCUVKÂąECVKQPEQPUGKNNoG.(2)

 

RĂŠfĂŠrence

Format en m

JT5829P137

1,37

,62 ,62

 

PNCUVKÂąECVKQPEQPUGKNNoG.(2)

d

M /HTd

50

267,83

3,91

† †

 

† †

2

,6/$($TKNNCPV/QPQOpTG

 

 OKETQUVTWEVWTo

1,37

50

d

M /HTd

JT5828P137

1,37

,62 ,62

 

50

265,78

3,88

† †

 

† †

2

CPU

surface planes

terme pour surfaces planes PNCUVKÂąECVKQPEQPUGKNNoG.(2) Format en m

Format en m

Q PVC souple DNCPEOKETQPU Q #FJoUKHDCUGUQNXCPVRGTOCPGPVQRCSWG Q DĂŠcoration intĂŠrieure et extĂŠrieure court et moyen terme sur

Q DĂŠcoration intĂŠrieure et extĂŠrieure moyen

JT5829MBF137

RĂŠfĂŠrence

,62/$TKNNCPV/QPQOpTG

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHDCUGUQNXCPVRGTOCPGPVQRCSWG

RĂŠfĂŠrence

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGRGTOCPGPVQRCSWG Q DĂŠcoration intĂŠrieure et extĂŠrieure moyen terme sur surfaces planes Q 'ZKUVGGPUGOKRGTOCPGPV4oH,64iÂŽ*6/

Q 2TQVGEVGWTRQN[oVJ[NoPGURoEKCN'EQUQNXCPV Q 'ZKUVGGPUGOKRGTOCPGPVToH4/iÂŽ*6/

d

M /HTd

419,90

6,13

PNCUVKÂąECVKQPEQPUGKNNoG.(2)

2

 

RĂŠfĂŠrence

Format en m

JT5829PM105 ,62/ ,62/

1,05  

50 † †

d

M /HTd

211,57  

4,03 † †

2

fs types d’adhÊsi Les diffÊrents sans rÊsidu Enlevable ettre une enlevabilitÊ calculÊe pour perm part plu la AdhÊsif à adhÊsion t deux ans sur ure ambiante pendan d’adhÊsif à tempÊrat

,652$$TKNNCPV/QPQOpTG

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGPQKTUGOKRGTOCPGPV Q DĂŠcoration de vĂŠhicules sur surfaces planes

ADHÉSIF

ou légèrement courbes PNCUVK±ECVKQPEQPUGKNNoG.(



RĂŠfĂŠrence

Format en m

JT5829SPB137

1,37

,652$



des surfaces. . Permanent maximum d’adhĂŠsion manière Ă assurer le de s çu able. con lev sifs en hĂŠ sif ad hĂŠ Supports ilement qu’un ad s’enlèvera moins fac t en an de rm n pe aďŹ dit ďŹ lm sif le Un adhĂŠ seillĂŠ de chauffer face il sera parfois con En fonction de la sur facile. s ur un dĂŠcollement plu ramollir l’adhĂŠsif po pliquĂŠs High Tack t conçus pour ĂŞtre ap ck sont spĂŠcialemen difďŹ ciles ats str sub Les adhĂŠsifs High Ta s de murs en pierre...) ou : (ex les ďŹ ci dif es .) sur les surfac ropylène, poubelles.. (containers en polyp e fac sur de n sio Ă  faible ten le ou de vos envies ! Repositionnab grĂŠ de vos besoins et repositionnable au le ab lev orte quel supen ra ult Film Ă  nouveau sur n’imp t, s’enlève et se pose en ilem fac e liqu pp Il s’a port plat.

NOIR

d

M /HTd

50

266,47

3,89

†



†

2

/CIPoVKSWGURoEKCNXoJKEWNG

OO

QCaoutchouc magnĂŠtique blanc mat microporeux spĂŠcial vĂŠhicules QForce 56g/m2 QPeut ĂŞtre traitĂŠ en impression directe solvant ou ĂŠco-solvant ou contre-collĂŠ avec un vinyle adhĂŠsif



T ĂŠ l

:

0 2

RĂŠfĂŠrence

Format en m

MAGN100010 /#)0

9 9

5 5

d

M /HTd

1,00 x 10

308,00

30,80

Z 



1 7

1 9

2

†

5


572214652174+/24'55+10$#5'51.8#06 '%151.8#0678'6.#6':

VINYLES ADHÉSIFS POLYMĂˆRES &)2$TKNNCPV2QN[OpTG

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHRGTOCPGPVQRCSWGDNGW Q Application longue durĂŠe en intĂŠrieur et extĂŠrieur Q Pour surfaces planes, courbes, convexes PNCUVKÂąECVKQPEQPUGKNNoG&).#/ RCIG  RĂŠfĂŠrence 

Format en m

d

M /HTd

DG80P137

1,37

50

305,51

4.46

&)2

†



†

852$TKNNCPV2QN[OpTG ,62$TKNNCPV2QN[OpTG

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHDCUGUQNXCPVRGTOCPGPVQRCSWG Q DĂŠcoration intĂŠrieure et extĂŠrieure long terme Q Pour surfaces planes ou courbes, idĂŠal vĂŠhicules Q 'ZKUVGGPOCV4oH,62iÂŽ*6/

M1

ClassĂŠ feu

 

Format en m

JT5929P105 ,62 ,62

1,05  

50 † †

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGRGTOCPGPVITKUENCKT Q DĂŠcoration intĂŠrieure et extĂŠrieure long terme Q Pour surfaces planes ou courbes PNCUVKÂąECVKQPEQPUGKNNoG.(&).#/

PNCUVKÂąECVKQPEQPUGKNNoG.( RĂŠfĂŠrence

2

RĂŠfĂŠrence

Format en m

d

M /HTd 2

VS115105P

1,05

50

317,10

6,04

d

M /HTd



852



†



†

384,82  

7,33 † †



852



†



†

2

,62/$TKNNCPV2QN[OpTG

CPU

Q PVC souple DNCPEECNCPFToOKETQPU Q #FJoUKHDCUGUQNXCPVRGTOCPGPVQRCSWG Q DĂŠcoration intĂŠrieure et extĂŠrieure long terme sur

M1

surfaces planes ou courbes

Q 2TQVGEVGWTRQN[oVJ[NpPGURoEKCN'EQUQNXCPV

ClassĂŠ feu

PNCUVKÂąECVKQPEQPUGKNNoG.(

 

RĂŠfĂŠrence

Format en m

JT5929PM105 ,62/ ,62/

1,05  

50 † †

d

M /HTd

418,95  

7,98 † †

2

,6/$($TKNNCPV2QN[OpTG

CPU

Q PVC souple DNCPEOKETQPU Q #FJoUKHCET[NKSWGRGTOCPGPVQRCSWGOKETQUVTWEVWTo Q DĂŠcoration intĂŠrieure et extĂŠrieure long terme Q Pour surfaces planes ou courbes PNCUVKÂąECVKQPEQPUGKNNoG.( RĂŠfĂŠrence

Format en m

JT5929MBF137

1,37

50

d

M /HTd

594,58

8,68

2

,62/CV7NVTCUQWRNG Q PVC UQWRNGDNCPEOKETQPU Q Adhésif permanent transparent Q Application promotionnelle de moyenne durée sur banderoles, bâche, voiles, tapis de supermarché PNCUVK±ECVKQPPQPEQPUGKNNoG

6

RĂŠfĂŠrence

Format en m

JT5826P

1,37

50

CPU

gie d’adhÊsif t une technolo bulles BubbleFree es des plis et des ination facile lim l’Ê tre et pour perm . : lors de la pose s Bubble Free ges des vinyle ta an Les av de pose ie sur le temps „ 50% d’Êconom prest d’une simple r disparaissen  Les bulles d’ai

„

SPECIAL

BACHE

d

M /HTd

612,39

8,94

2

sion du doigt iquer grâce niller et Ă appl „ Facile Ă  ĂŠche Ă  faible tack icro-structurĂŠ Ă  un adhĂŠsif m sion dĂŠďŹ nitive sitionner : AdhĂŠ „ Facile Ă  repo lication 24h après l’app iliser la rapide sans ut grand format „ DĂŠcoration ide. mĂŠthode hum


8+0;.'5#&*d5+(57.64#%10(14/#$.'5 &GUXKP[NGUFŠKORTGUUKQPGVFGU¹NOUFGRNCUVK¹ECVKQPWNVTCEQPHQTOCDNGURQWTNCFoEQTCVKQPNQPIVGTOGFG XoJKEWNGUUWTUWTHCEGURNCPGUEQWTDGUEQPXGZGUEQPECXGUTKXGVoGUGODQWVKGUQW& ,62$TKNNCPV2QN[OpTG

CPU

,6/$($TKNNCPV2QN[OpTG

Q PVC ultra conformable - 55 Ο Q AdhÊsif permanent opaque à fort pouvoir couvrant Q DÊcoration de vÊhicules très long terme Q Pour surfaces planes ou courbes, 3D extrême

Q PVC ultra conformable - 55 Ο Q AdhÊsif permanent opaque micro structurÊe à fort pouvoir couvrant Q DÊcoration de vÊhicules très long terme Q Pour surfaces planes ou courbes

PNCUVKÂąECVKQPEQPUGKNNoG.(.78



RĂŠfĂŠrence

Format en m

JT5529P137

1,37

,62



PNCUVKÂąECVKQPEQPUGKNNoG.(.78

d

M /HTd

50

891,19

13,01

†



†

,62/$TKNNCPV2QN[OpTGEQWNo

2

JT5629PM137 JT5629PM13710

1,37 1,37

50 10

M /HTd

856,93 190,43

12,51 13,90

2

CPU

JT5599P

1,37

50

M /HTd

JT5529MBF137

1,37

JT5529MBF13710

1,37

50

1035,72

15,12

10

230,16

16,80



2

CPU

RĂŠfĂŠrence

Format en m

d

JT5629MBF137

1,37

nous consulter

50

%T[UVCN2TQVGEV#PVK)TCXKNNQPU

Q PVC WNVTCEQPHQTOCDNG polymère - 55 Ο Q #FJoUKHVTCPURCTGPVRGTOCPGPV Q DÊcoration intÊrieure et extÊrieure très long terme PNCUVK¹ECVKQPEQPUGKNNoG.(.78 Format en m

d

PNCUVKÂąECVKQPEQPUGKNNoG.(QW.(

d

,626TCPURCTGPV$TKNNCPV

RĂŠfĂŠrence

Format en m

Q PVC ultra conformable 5oΟ Q AdhÊsif acrylique permanent opaque Q DÊcoration de vÊhicules très long terme Q Pour surface 3D extrême

PNCUVKÂąECVKQPEQPUGKNNoG.(QW.( Format en m

RĂŠfĂŠrence

,6/$(

CPU

Q PVC ultra conformable 5oΟ Q AdhÊsif acrylique permanent opaque Q DÊcoration de vÊhicules très long terme Q Pour surface 3D extrême RÊfÊrence

CPU

M /HTd 2

CPU

Q Film polyurÊthane brillant et ultra transparent Q 7NVTCEQPHQTOCDNGGVRTCVKSWGOGPVKPXKUKDNG Q6TpUToUKUVCPVCWZ78EG¹NOPGLCWPKVRCUne craquèle pas Q Epaisseur : 150 Ο

d

M /HTd

920,64

13,44

2

RĂŠfĂŠrence

Format en m

CRYSTALP150

1,50

25

d

M /HTd

1 548,75

41,30

2

Formation Total Covering Contactez-nous

(KNOUFGRNCUVKÂąECVKQPEQPUGKNNoU DurĂŠe

M2/HTd

CPU



Â’

CPU



Â’

CPU



CPU



RĂŠfĂŠrence

Surface

Epaisseur

.(

$TKNNCPV



.(

/CV

 

.78 $TKNNCPV 5RoEKCNKORTGUUKQP78

 

.78 $TKNNCPV 5RoEKCNKORTGUUKQP78

Â’

Â’

EQWNoG  RNCUVKÂąECVKQP 2 No W EQ G [N KP X m %QORNGZG 3499 =  â‚Ź/ JT5629PM + LF T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

7


572214652174+/24'55+10$#5'51.8#06 '%151.8#0678'6.#6':

#4%*+6'%674#.(+./5 9#..94#2$4+..#06

CPU

Q PVC ultra-conformable - 55 microns Q AdhĂŠsif permanent renforcĂŠ opaque gris Q #FJpTGUWTFGUUWTHCEGUFKHÂąEKNGUCXGEFWTGNKGH

M1 ClassĂŠ feu

( murs en brique, pierre, Parpaing,‌ ) Q &KURQPKDNGGPXGTUKQPVTCPURCTGPVGToH99iÂŽ*6O2 PNCUVKÂąECVKQPEQPUGKNNoG.CI.(.78 RĂŠfĂŠrence WALLWRAP100

Format en m 1,37 25

M2/HTd 16,87

d 577,80

9#..94#2/#6/101/Âź4'

CP

Q PVC souple blanc mat - 150 Îź Q AdhĂŠsif enlevable et repositionnable transparent Q DĂŠcoration intĂŠrieure et surfaces planes PNCUVKÂąECVKQPPQPEQPUGKNNoG RĂŠfĂŠrence

Format en m

WALLWRAP200

1,37

25

d

M2/HTd

328,11

9,58

9#..94#2/#6/101/Ÿ4' Q PVC souple - 100 microns Q AdhÊsif permanent renforcÊ opaque gris Q #FJpTGUWTFGUUWTHCEGURNCPGUFKH¹EKNGU ( murs rugueux, bÊton, panneaux tri vision,‌ )

CPU

M1

ClassĂŠ feu

PNCUVKÂąECVKQPEQPUGKNNoG UoTKG.(.782GTOCHWP2)2TQ RĂŠfĂŠrence

Format en m

WALLWRAP300

1,37

50

d

M2/HTd

521,29

7,61

&'%15#6+0

I

Q Tissu adhĂŠsif blanc satin 100% polyester Q AdhĂŠsif transparent enlevable et repositionnable Q %NCUUKÂąECVKQPCWHGW/( Q Donne un aspect tissĂŠ haut de gamme idĂŠal pour la dĂŠcoration murale PNCUVKÂąECVKQPKPWVKNG d

M2/HTd

25

265,75

10,63





†

RĂŠfĂŠrence

Format en m

DECOSATIN 100

1,00

DECOSATIN



Wallwrap

100

&'%1/74#.

/CV

I

Q Papier peint adhĂŠsif vinylique texturĂŠ blanc mat Q AdhĂŠsif permanent repositionnable pendant la pose Q Surface lessivable Q Pour surfaces planes et lisses en intĂŠrieur

NOUVEAU

PNCUVKÂąECVKQPPQPEQPUGKNNoG 

RĂŠfĂŠrence

Format en m

&'%1/74#.





d

M2/HTd





&'%1+814;

/CV

I

Q Papier peint adhÊsif de couleur Ivoire et à la surface lisse Q AdhÊsif permanent Q Support Êco-conçu sans PVC constituÊ à 100% de papier Q 8GTUKQPEGTVK¹oG*2RQWTGPETGU.CVGZWPKSWGOGPV Q Pour surfaces planes et lisses en intÊrieur PNCUVK¹ECVKQPPQPEQPUGKNNoG RÊfÊrence DECOIVORY

Format en m 1,37

25

GREEN

NOUVEAU

d

M2/HTd

164.40

4.80

&d%14#6+10&'51.'0':6d4+'74 %1/2.':'8+0;.' (+./ 564''64#2/#6ECNCPFTo

OQKU

Q AdhĂŠsif acrylique permanent au tack ultra performant

Q (KNOFGRNCUVKÂąECVKQPiUWTHCEGVGZVWToGCPVKFoTCRCPVGÂ’ Q #FJoUKHRGTOCPGPVCET[NKSWGDCUGUQNXCPV

Q DĂŠcoration de sol en extĂŠrieur sur bitume, bĂŠton

Q Conforme Ă la norme ASTMD-2047-93

Q Vinyle adhĂŠsif ultra conformable - 85 Îź

Q Application au sol en extĂŠrieur de courte durĂŠe

Q 2NCUVKÂąECVKQPKPFKURGPUCDNGCXGE5VTGGVTCR2TQVGEV RĂŠfĂŠrence STREETR137

8

564''64#22416'%6(KNO28%ITCKPoOCVOQKU

Format en m 1,37 25

d 766,17

2

M /HTd 22,37

RĂŠfĂŠrence STREETRP137

Format en m 1,37

25

d 291,12

M /HTd 2

8,50


/+%412'4(14d510'9#;8+5+10 ,6278/KETQRGTHQTo

CPU

,62/KETQRGTHQTo

Q FGUWTHCEGKORTKOCDNG5RoEKCNXoJKEWNG Q %QORCVKDNG78 Q &KCOpVTGFGURGTHQTCVKQPUOO Q Polymère DNCPEOCV 180 microns Q #FJoUKHUGOKRGTOCPGPVQRCSWGXGTUQPQKT Q DÊcoration de vitre pour vision à sens unique  One Way vision 

Q FGUWTHCEGKORTKOCDNG

NOUVEAU



Format en m

,6278 ,6278

 

 

d

M2/HTd

 

 

,62/KETQRGTHQTo

ClassĂŠ feu

PNCUVKÂąECVKQP.78RQWTUWTHCEGUEQWTDGUQWRQN[GUVGT WPKSWGOGPVUKVQVCNGOGPVRNCV 2)241.78

CP

norme UTAC

d 845,97 186,04

Format en m

JT5837P137 JT5837P13710

1,37 1,37

50 10

d

M2/HTd

845,97 186,04

12,35 13,58

CP

Q FGUWTHCEGKORTKOCDNG Q &KCOpVTGFGURGTHQTCVKQPUOO Q Monomère DNCPEOCV 150 Ο Q #FJoUKHUGOKRGTOCPGPVQRCSWGXGTUQPQKT Q DÊcoration de vitre pour vision à sens unique One Way vision

PNCUVKÂąECVKQP.78RQWTUWTHCEGUEQWTDGUQWRQN[GUVGT WPKSWGOGPVUKVQVCNGOGPVRNCV 2)724O.78 Format en m 1,37 50 1,37 10

RĂŠfĂŠrence

8/24/KETQRGTHQTo

Q FGUWTHCEGKORTKOCDNG Q &KCOpVTGFGURGTHQTCVKQPUOO Q Monomère DNCPEOCV 160 microns Q #FJoUKHUGOKRGTOCPGPVQRCSWGXGTUQPQKT Q DÊcoration de vitre pour vision à sens unique  One Way vision  Q $TKUFGINCEG2TQEpUXGTDCNFoNKXToRCTNŠ76#%

RĂŠfĂŠrence JT5817P137 JT5817P13710

M1

Q &KCOpVTGFGURGTHQTCVKQPUOO Q Monomère DNCPEOCV 150 microns Q #FJoUKHUGOKRGTOCPGPVQRCSWGXGTUQPQKT Q DÊcoration de vitre pour vision à sens unique One Way vision

PNCUVKÂąECVKQP.78RQWTUWTHCEGUEQWTDGUQWRQN[GUVGT WPKSWGOGPVUKVQVCNGOGPVRNCV 2)241.78 RĂŠfĂŠrence

CP

PNCUVKÂąECVKQP.78RQWTUWTHCEGUEQWTDGUQWRQN[GUVGT WPKSWGOGPVUKVQVCNGOGPVRNCV 2)241.78

M2/HTd 12,35 13,58

RĂŠfĂŠrence VMP15R

Format en m 1,37 50

d 761,03

M2/HTd 11,11

Q Disponible en version spĂŠciale 78ToH,6278i*6O2

Vue de l’intÊrieur

Vue de l’extÊrieur

JT5917PUV

).#55&'%14#52'%68'44'&'21.+ ,6/$()NCUU&oEQT Q PVC polymère calandrĂŠ translucide mat Q Aspect verre dĂŠpoli sablĂŠ Q #FJoUKHVTCPURCTGPVRGTOCPGPVÂ’ Q Film repositionnable Ă sec Q VisibilitĂŠ Recto / Verso

CPU

,6/$()NCUU&oEQTRCKNNGVo

M1

ClassĂŠ feu

PNCUVKÂąECVKQPPQPEQPUGKNNoG

PNCUVKÂąECVKQPPQPEQPUGKNNoG

RĂŠfĂŠrence JT5798MBF

Format en m 1,37 50

d 987,09

M2/HTd 14,41

JT5798MBF10

1,37

217,16

15,86

10

CPU

Q PVC polymère calandrĂŠ translucide mat Q Aspect verre dĂŠpoli pailletĂŠ Q #FJoUKHVTCPURCTGPVRGTOCPGPVÂ’ Q Film repositionnable Ă sec Q VisibilitĂŠ Recto / Verso

T ĂŠ l

RĂŠfĂŠrence JT5796MBF

:

0 2

9 9

Format en m 1,37 50

5 5

1 7

d 1074,08

1 9

M2/HTd 15,68

9


572214652174+/24'55+10$#5'51.8#06 '%151.8#0678'6.#6':

64#052#4'065#&*d5+(521748+6412*#0+' ,6428%6TCPURCTGPV

CPU

QVinyle souple Polymère calandré $TKNNCPVOKETQPU Q#FJoUKHVTCPURCTGPVGPNGXCDNG QDécoration intérieure et extérieure long terme QPour surfaces planes ou courbes sur véhicules

M2

ClassĂŠ feu

PNCUVKÂąECVKQPEQPUGKNNoG.( RĂŠfĂŠrence

Format en m

JT5999R137

1,37

50

d

M2/HTd

493,88

7,21

2TKPVXKP[N 428%6TCPURCTGPV

CPU

Q Vinyle souple Monomère DTKNNCPVOKETQPU Q #FJoUKHVTCPURCTGPVGPNGXCDNG Q Décoration intérieure et extérieure court terme Q Pour surfaces planes PNCUVK±ECVKQPEQPUGKNNoG2TKPVEQXGT

  

RĂŠfĂŠrence 899R105 4 4

Format en m 1,05 50  †  †

d 123,90  

Format en m

JT5999MBF137

1,37

50

d

M2/HTd

650,75

9,50

(KNOFGUoTKITCRJKG

Â’

sĂŠrigraphie - DensitĂŠ supĂŠrieure Ă 4

M2/HTd 2,36 † † 4,54 †

28%6TCPURCTGPV'NGEVTQUVCVKSWG



RĂŠfĂŠrence

NOUVEAU

Q 5oEJCIGTCRKFG)TCPFGRNCIGFGFGPUKVo78 Q Compatible encres Eco-solvant

CP

Q PVC transparent monomère $TKNNCPVÂ’ Q #FJoUKQPUCPUEQNNGPKGHHGVUVCVKSWG Q DĂŠcoration intĂŠrieure court terme sur verre Q Protecteur papier pour un meilleur passage en machine Q (CEKNGiGPNGXGTGViFoRNCEGTUCPUToUKFWFGEQNNG Q'ICNGOGPVFKURQPKDNGGPDNCPEToH9%) d 169,78 

CPU

Q Polyester transparent non adhĂŠsif pour la rĂŠalisation d'ĂŠcran de

&KURQPKDNGCXGEFWTCDKNKVoCPUOKETQPU JT5899RM137 1,370 50 310,99 JT5499RM152 345,04 1,520 †

PNCUVK¹ECVKQPPQPEQPUGKNNoG RÊfÊrence Format en m CCG914 0,914 25 %%)  †

,6/$(28%6TCPURCTGPV Q Vinyle souple polymère transparent - 80 μ Q Adhésif permanent transparent micro-structuré Q Décoration intérieure et extérieure moyen et long terme Q Pour surfaces planes ou convexes sur véhicules PNCUVK±ECVKQPEQPUGKNNoG.(



RĂŠfĂŠrence SERIFSOLV914

Format en m 0,914 30

d 355,09

M2/HTd 12,95

5'4+(51.8





†

†

,642QN[GUVGT7NVTCVTCPURCTGPV

CP

Q Polyester brillant ultra-transparent - OKETQPU Q #FJoUKHCET[NKSWGVTCPURCTGPVGPNGXCDNGUCPUToUKFWFGEQNNG Q DĂŠcoration intĂŠrieure et extĂŠrieure moyen terme Q Pour surfaces planes en verre nettoyĂŠes avec Maccleaner PNCUVKÂąECVKQPEQPUGKNNoG2) RĂŠfĂŠrence JT5499R 

Format en m 1,370 25

d 514,43

&KURQPKDNGGPXGTUKQPURoEKCNGGPETGU78 ,6478   

M2/HTd 15,02 

M2/HTd 7,43 †

$#%-.+62174%#+55105.7/+0'7: ,62$CEMNKVCFJoUKHDTKNNCPV

,62$CEMNKVCFJoUKHOCV

CPU

Q Vinyle translucide monomère calandré blancOKETQPU Q #FJoUKHCET[NKSWGRGTOCPGPVVTCPURCTGPV Q Décoration intérieure et extérieure court terme

PNCUVKÂąECVKQPEQPUGKNNoG.(

PNCUVKÂąECVKQPEQPUGKNNoG.( RĂŠfĂŠrence JT5827P

Format en m 1,370 50

d 430,18

$CEMNKV(TQPVRTKPV/CV

2

M /HTd 6,28

Format en m

JT5728P137

1,370

50

d

M2/HTd

796,65

11,63

Â’

Q Diffusant polyester pour caissons lumineux non adhÊsif Q +ORTGUUKQPHCEGDTKNNCPVGUoEJCIGTCRKFG Q Poids : 180 g, meilleure rÊsistance mÊcanique Q Particulièrement adaptÊ aux milieux humides à forte condensation Q Excellent rendu même non rÊtro-ÊclairÊ

PNCUVKÂąECVKQPEQPUGKNNoG2)

PNCUVKÂąECVKQPEQPUGKNNoG2)



RĂŠfĂŠrence BLF200914 $.(

Format en m 0,914 30  †

d 227,03 

M2/HTd 8,28 †



$.(





†

10

RĂŠfĂŠrence

$CEMNKV(TQPVRTKPV$TKNNCPV

Â’

Q Diffusant polyester pour caissons lumineux non adhÊsif Q +ORTGUUKQPHCEGOCVG Q Manipulation facilitÊe pour les grands visuels Q Particulièrement adaptÊ aux milieux humides à forte condensation Q Couchage microporeux pour sÊchage immÊdiat

†

CPU

Q Vinyle translucide polymère calandré blancOKETQPU Q #FJoUKHCET[NKSWGRGTOCPGPVVTCPURCTGPV Q Décoration intérieure et extérieure long terme



RĂŠfĂŠrence DIFSOLV150914 &+(51.8

Format en m 0,914 30  †

d 209,01 

M2/HTd 7,62 †



&+(51.8





†

†


$¸%*'2174+/24'55+1051.8#06d%151.8#0678'6.#6': $jEJG2TGOKWO,'65CVKP

I

$jEJGNCOKPoG5CVKP

Q Epaisseur : 470 Ο Q Coating PVC, base polyester Q Enroulement : face imprimable à l’extÊrieur

Q 6KUUWEQORTKOoGPVTG¹NO28% Q Enroulement : face imprimable à l’extÊrieur d

M2/HTd

30

154,36

6,77



†



†

$51.8



†



†



$51.8



†



†



$51.8



†



†



$51.8



†



†

Q Epaisseur : 440 Îź



$51.8



†



†

Q %NCUUKÂąECVKQPCWHGW$

RĂŠfĂŠrence

Format en m

BSOLV076

0,76



$51.8



I

Q Epaisseur : 380 Îź

RĂŠfĂŠrence BSOLV440110 $51.8 $51.8

 

Format en m 1,10 30  †  †

d 105,60  

$jEJG(TQPVNKV5CVKP

I

NOUVEAU

Q Coating PVC, base polyester

550g

$jEJG/,'65CVKP Q Epaisseur : 460 Ο Q %NCUUK¹ECVKQPCWHGW/ Q Coating PVC, base polyester Q Enroulement : face imprimable à l’extÊrieur

M1 ClassĂŠ feu

RĂŠfĂŠrence

Format en m

d

M2/HTd

BSOLVM1106

1,06

30

267,75

8,42



$51.8/



†



†



$51.8/



†



†



$51.8/



†



†



$51.8/



†



†

$jEJGQRCSWG+ORTGUUKQP48

RĂŠfĂŠrence BSOLV520M2110 $51.8/ $51.8/ $51.8/

  

M2/HTd 3,20 † †

Format en m 1,10 30  †  †  †

d 177,54   

M2/HTd 5,38 † † †

Sertisseuse d'œillets Soudeuse pour bâche P 49

I

Q #URGEV5CVKPQRCEKVoiEpaisseur : 520 Îź Q %NCUUKÂąECVKQPCWHGW/$ Q Coating PVC, base polyester



d

M2/HTd

30

416,34

10,13

†



†

RĂŠfĂŠrence

Format en m

BSOLVRV137

1,37

$51.848



$jEJGQRCSWGKORTGUUKQP48

Double face et œillet adhÊsifs spÊcial bâche p53

I $jEJGNoIpTG/5CVKP

Q #URGEVUCVKPEpaisseur : 430 Îź

Q #URGEV5CVKPEpaisseur : 290 Îź Q 'ZEGNNGPVGRNCPoKVoRQWTGPTQWNGWT

Q %NCUUKÂąECVKQPCWHGW$PQTOGCNNGOCPFG

RQTVGCH¹EJGMCMoOQPQ Q Application intÊrieure extÊrieure jusqu’à 18 mois

Q DurabilitĂŠ : 3 ans extĂŠrieur



d

M2/HTd

30

216,19

5,26

†



†

RĂŠfĂŠrence

Format en m

BSOLV510RV137

1,37

$51.848



$jEJG$CEMNKV,'65CVKP

RĂŠfĂŠrence BSOLV29591425 $51.8



I

Format en m 0,914 25  †

d 265,08 

)TKNNG/'5* Q #URGEV5CVKPRGVKVUVTQWU

Q Coating PVC, base polyester

Q .CÂąPGUUGFGUVTQWURGTOGVFGUKORTGUUKQPU

Q Epaisseur : 400 Îź, Liner synthĂŠtique de bonne densitĂŠ

RĂŠfĂŠrence BSOLVBAC137

Format en m 1,37 30

d 390,86

M2/HTd 9,51



$51.8$#%



†



†



$51.8$#%



†



†

T ĂŠ l

Q Coating PVC, base polyester



:

0 2

RĂŠfĂŠrence MESH350137-50 /'5*

9 9

5 5

M1

ClassÊ feu M2/HTd 11,60 †

I

Q #URGEV5CVKPEpaisseur : 430 Ο Q %NCUUK¹ECVKQPCWHGW/$PQTOGCNNGOCPFG Q Enroulement : face imprimable à l’extÊrieur

I

Format en m 1,37 50  †

1 7

d 506,43 

1 9

B1

ClassÊ feu M2/HTd 7,39 †

11


572214652174+/24'55+10$#5'51.8#06 '%151.8#0678'6.#6':

2#2+'45'65722146552d%+#7: 2CRKGTFQUDNGW

I

Q Epaisseur : 135 Ο (5,3 mil) Q Supporte les forts taux d’encrage Q SÊchage rapide pour une haute productivitÊ Q Facilement pliable à la main ou en machine sans cassure Q PrÊconisations de mise en œuvre sur demande



RĂŠfĂŠrence

Format en m

PSOLV137DB61ST

1,370

251.8&$56



M /HTd

61

128,69

1,54

†



†

2

2CRKGTUCVKPo

I

Q Epaisseur : 228 Ο - QualitÊ supÊrieure haute rÊsolution Q OpacitÊ : 96 % Q &WTCDKNKVoGZVoTKGWTGUWTRCPPGCWOQKUUCPURNCUVK¹ECVKQP Q Excellent rendu d’impression Q Applications intÊrieures et extÊrieures

 

Format en m

PSOLV200127

1,270

251.8 251.8

 

M /HTd

50

163,19

2,57

† †

 

† †

2

5[PVKUQN2QN[RTQR[NpPG

SYNTY91440 5;06; 5;06;

0,914  

40 † †

d

M /HTd

243,12  

6,65 † †

Â’

Q Aspect satin – SÊchage rapide - Poids 145g Q RÊsistant à la dÊchirure et à l’eau Q AdhÊsif enlevable – OpacitÊ de 88 % Q Se manipule, se dÊcolle et se dÊcoupe très facilement Q Pour surfaces planes en intÊrieur ou extÊrieur

NOUVEAU

Format en m 1.07

30

PSOLVBK127

1,270

251.8$-



60

99,65

1,47

†



†

2

I

d

M /HTd

362,67

11,33

RĂŠfĂŠrence

Format en m

PSOLVM1RV127

1,27

60

d

M /HTd

236,22

3,10

6[XGM

2

I

Q Haute rÊsistance à la dÊchirure, rÊsistant à l’eau Q Non tissÊ 100 % polyÊthylène Q Très lÊger, durable et rÊsistant aux ultra-violets Q Applications intÊrieures et extÊrieures

  

RĂŠfĂŠrence

Format en m

TYVEK10591450 6;8'- TYVEK13591430 6;8'- 6;8'-

0,914  0,914  

50  30 † †

d

M /HTd

285,62  205,10  

6,25 † 7,48 † †

2

&TQR,GV%NCUUoHGW/

I

Q Support non tissÊ ignifugÊ - Existe en 137 g Q IdÊal pour enseignes d’intÊrieur de grandes dimensions Q %GTVK¹ECV/UWTFGOCPFG RÊfÊrence

Format en m

 

DRP80914 &42 &42

0,914  

 

&42 &42

 

PNCUVKÂąECVKQPPQPEQPUGKNNoG SYNTY107AD

M /HTd

après impression

2

5[PVKUQN2QN[RTQR[NpPG#FJoUKH

RĂŠfĂŠrence

d

Q Epaisseur : 230 Îź Q OpacitĂŠ supĂŠrieure Ă 96 % Q +ORTGUUKQP4GEVQ8GTUQ Q %NCUUGOGPVHGW/ Q Excellent rendu des couleurs, ne gondole pas et retrouve son aplat

Â’

Format en m

Format en m

NOUVEAU

Q Aspect satinÊ tendu et lisse - Poids : 130 g Q RÊsistant à la dÊchirure et à l’eau Q TouchÊ similaire à celui papier avec rendu photo Q IdÊal pour les systèmes dÊroulants (Ex. : WALLIS, KOMODO, ‌) Q Applications intÊrieures et extÊrieures

 



RĂŠfĂŠrence

2CRKGTUCVKPo48/

d

RĂŠfĂŠrence

I

NOUVEAU

d

RĂŠfĂŠrence

2CRKGTUCVKPo Q Epaisseur : 151 Îź - QualitĂŠ supĂŠrieure haute rĂŠsolution Q 2QWTCHÂąEJCIGITCRJKSWGGVToVTQoENCKTCIG Q DurabilitĂŠ extĂŠrieure sur panneau 3 mois sCPURNCUVKÂąECVKQP Q Excellent rendu des couleurs - SĂŠchage rapide Q Applications intĂŠrieures et extĂŠrieures Q 0QWXGNNGSWCNKVo2'(%

2

d

M /HTd

25 † †

186,91  

8,18 † †

† †

 

 

2

28%TKIKFG5CVKP

Â’

QPVC 630 g opaque Ă 98% pour impression directe QIdĂŠal pour stands parapluie et comptoirs

 

12

RĂŠfĂŠrence

Format en m

POP45091420 212 212

0,914  

20 † †

d

M /HTd

228,50  

12,50 † †

2


61+.'5'%1.1)+37'5 Une gamme de supports de communication et de dÊcoration Êcologique qui respecte les hommes et l’environnement. Tous les produits de la gamme Evergreen sont des toiles hautement ignifugÊes au-delà des normes habituellement exigÊes. Evergreen est une dÊmarche Êcologique volontaire de la conception au recyclage complet du produit.

IO2

,'6/&QUPQKT

Q #URGEVOCVRQN[GUVGT5CPU.KPGT Q %NCUUKÂąECVKQPCWHGW/ Q Opaque Ă 100% avec dos noir, ĂŠpaisseur 220 Îź Q Ne tuile pas du tout Q IdĂŠal pour enrouleurs, kakĂŠmonos, tous visuels suspendus

Q #URGEVOCVRQN[GUVGT5CPU.KPGT Q %NCUUKÂąECVKQPCWHGW/ Q Plus opaque, plus souple, ne tuile pas du tout

d

M /HTd

312,12

11,56

†



†





†

RĂŠfĂŠrence

Format en m

JET21090

0,90



,'6





,'6



30

,'66QKNGNoIpTGGZVoTKGWTG

  

2

d

M /HTd

217,26

7,10

†



†





†

JET250102

1,02



,'6





,'6



30

Format en m

d

M /HTd

JETTEX102

1,02

,'66': ,'66': ,'66':

  

30

316,71

10,35

† † 

  

† † †

2

IO2

Q #URGEV/CVRQN[GUVGT Q 5CPU28%WUCIGKPVoTKGWT

IO2

Q %NCUUK¹ECVKQPCWHGW/$ Q 6QKNG¹PGGVNoIpTGiNŠCURGEVPCVWTGN Q %GTVK¹oCPVKEWTNKPIKFoCNRQWTGPTQWNGWTUGVMCMGOQPQU

UQNXCPV Format en m

RĂŠfĂŠrence

':21,'6/

Q #URGEVOCVRQN[GUVGT5CPU.KPGT Q Epaisseur : 220 Ο Q Excellente tenue mÊcanique, ne tuile pas du tout Q Très bonne diffusion de la lumière en position backlit Q %QORCVKDNGCXGENGUKORTKOCPVGU.#6':78oEQUQNXCPVGV RÊfÊrence

IO2

,'66':/6QKNGNoIpTG



2

RĂŠfĂŠrence

Format en m

d

M /HTd

EXPOJET137

1,37

':21,'6



30

364,55

8,87

†



EXPOJET310

3,10

†

60

1584,72

8,52

2

6':6+.'5 IO2

/CKNNG&TCRGCW

Q Aspect : SatinĂŠ - liner de 75g Q 'RCKUUGWTGVÂ’CXGENGNKPGT Q RĂŠsistant Ă la dĂŠchirure, non lavable Q %QWEJCIGFGSWCNKVoUWRoTKGWTG Q 'ZKUVGUCPUNKPGTGPNCK\GUGVEO4oH(.#) RĂŠfĂŠrence

Format en m

d

M /HTd

 

FLAG422107 (.#) (.#)

1,067  

30,5 † †

530,46  

16,30 † †



(.#)



†



†

2

IO2

5/#46%CPXCU/CV Q Toile lÊgère 100% coton naturel Q Epaisseur : 600 Ο Q RÊsistant aux Êclaboussures RÊfÊrence

Format en m

SMARTCAN137

1,370

15

d

M /HTd

247,15

12,05

2

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

13


2#2+'42'+0607/d4+37'



%1/2#6+$.'#8'%+/24+/#06'5Â&#x;$#5'51.8#06d%151.8#06'678 %10%'26 )#//'5 (+0+6+105 IO2

/74#/174 Q Revêtement mural PVC sur support papier Q Epaisseur 410 Ο, sÊchage trÊs rapide Q 5WTHCEGToUKUVCPVGCWZoTC²WTGUGViFGUKORCEVUOQFoToURCTHCKVGOGPVNCXCDNG Q 2QUGRCTJWOKFK¹ECVKQPFWFQUFWRCRKGTGVGPEQNNCIGFWOWT Q Classement feu Euro Class B Q Ne laisse aucun rÊsidu à la dÊpose RÊfÊrence /74#5#$.+0.+5,#2&70

Format en m Z

d M2/HTd  

DKURQPKDNGGPÂąPKVKQPU

Q Sable : Surface mate Ă effet sablĂŠ Q Lin : Surface mate Ă  effet toilĂŠ Q Lisse : Surface satinĂŠe et lisse Q ,CRQP4GPFWOCViGHHGVÂąDTGWZ Q &WPG5WTHCEGOCVGiNCVGZVWTGÂąDTGWUG

%1..'52d%+#.'/74#$10&.+)*6 Pour une pose et une dĂŠpose plus facile sans rĂŠsidu Q Conditionnement : 10kg 

RĂŠfĂŠrence /74#.+)*6

Prix HTd 

IO2

&+)+/74# Q Revêtement mural composÊ d’une couche d’usure PVC et d’un envers en polyester non tissÊ Q Epaisseur 410 Ο, sÊchage rapide Q 5WTHCEGToUKUVCPVGCWZoTC²WTGUGViFGUKORCEVUOQFoToU parfaitement lavable Q Pose par encollage direct du mur Q Classement feu M1 RÊfÊrence

Format en m

&+)+$476(+01.+0'567%#%6

Z

d

DKURQPKDNGGPÂąPKVKQPU Q $TWV5WTHCEGOCVGCWZTG²GVUUCVKPUVGZVWTGÂąPGV[RG›GPFWKVToIWNKGTÂœ Q (KPQ5WTHCEGOCVGCXGEFGNoIGTUTG²GVUUCVKPUVGZVWTGVTpUÂąPGV[RG  ÂŤenduit rĂŠgulier Âť Q .KPoC5WTHCEGNoIpTGOGPVUCVKPoGCXGEWPGVGZVWTGÂąDTGWUGVTpUHQPFWG Q Stucco : Surface mate ĂŠlĂŠgante lĂŠgèrement travaillĂŠe Q Tactile : Surface mate Ă effet toilĂŠ

M2/HTd

 

%1..'52d%+#.'/74#$10&(146' Pour une adhĂŠsion forte et une dĂŠpose plus facile sans rĂŠsidu Q Conditionnement : 5 kg (20M2) 

RĂŠfĂŠrence

Prix HTd

/74#$#&*



IO2

&+)+/74# Q Cette version 2.1 plus blanche et plus Êpaisse offre une rÊsolution dŠKORTGUUKQPUWRoTKGWTGCW&+)+/74#GVRGTOGVWPGRQUG plus facile. Q Revêtement plus adaptÊ aux lieux publics à usage intense grâce à une rÊsistance mÊcanique supÊrieure de la couche PVC. RÊfÊrence

Format en m

DM2S / T / D / R / F

1,30 x 30

d

M2/HTd

641,16

16,44

DKURQPKDNGGP¹PKVKQPU Q Smooth : Surface satinÊe et lisse permettant les meilleurs rendus  photographiques  Q Tactile : Surface mate à texture toilÊe Q &WPG5WTHCEGOCVGiVGZVWTG¹DTGWUG Q 4WFG5WTHCEGCWZTG²GVUUCVKPUCXGEWPGVGZVWTGV[RG  enduit rÊgulier  Q (CnCFG5WTHCEGCWZTG²GVUUCVKPUCXGEWPGVGZVWTGRNWUHQPFWG que l’aspect Rude

14


Ecologie

MASTERCLASS Papiers photos professionnel

Qualité

%QORCVKDKNKVoFGUUWRRQTVU Dye

Pour encres d’intérieur à base d’eau

Uv

Pour encres d’extérieur pigmentées à base aqueuse

Th

Pour imprimantes à têtes thermiques (Hp®, Encad®, Canon®, Océ®...)

Piezo

Pour imprimantes à têtes piezo électriques (Roland®, Mutoh®, Epson®, Mimaki®,…)

Solv

Encres à base solvant ou Eco solvant

Chaud 2NCUVK±CDNGiEJCWF

Supports compatibles

Imprimantes Supports compatibles

Papiers affiche Vinyles adhésifs Bâche

Diversité

Supports pour impression base eau

Q2CRKGTUCH±EJGU

..................................................................................................

P 16

QPapiers photographiques ......................................................................... P 17 QSupports pour systèmes de présentation Backlit pour caisson lumineux ......................................................... P 18 QVinyles adhésifs, bâches et Tyvek ................................................ P 19 QCanvas, polyester, Drop paper

T é l

:

T é l 0 2

:

.........................................................

Toile Canvas

P 20

0 2 9 9 5 5 1 7 9 9 5 5 1 7 1 9

1 9

1515


572214652174+/24'55+10$#5''#7

2#2+'45#((+%*'5 Papier fabriquÊ à partir de bois issu de forêts gÊrÊes de façon durable en respectant les normes environnementales et sociales de la FSC

2CRKGTCH¹EJG&QUDNGW Q Support papier rÊsistant à l’eau Q Verso bleu, haute opacitÊ et stabilitÊ Q 4oCNKUCVKQPFŠCH¹EJGURWDNKEKVCKTGUGPGZVoTKGWT Q 2GWVqVTGKOOGTIoVQVCNGOGPVFCPUNCEQNNGCH¹EJG

I



2CRKGTCHÂąEJG

Th Dye travaux de s pe ty us to Q Pour portants ux d’encrage im Q Supporte des ta s Q Ne gondole pa couleur u nd re n bo ès Q Tr Format en m RĂŠfĂŠrence    647%1. †   647%1.  †  647%1.  †  647%1.

I Th Dye Uv Piezo Chaud

RĂŠfĂŠrence

Format en m

DB130914

0,914

45

d 137,37

2CRKGTLCWPGUVCPFCTF/

d

M /HTd







†



†



†

I

Th Dye Uv Piezo Chaud

haute rĂŠsolution

Q jusqu’à 1440DPI Q SÊchage instantanÊ avec bonne rÊsistance au grattage Q RÊsistant à l’eau même en encre dye Q Encres pigmentÊes conseillÊes

   

Format en m

PWP140914 292 292 292 292

0,914    

30 † † † †

I

Q Support papier ignifugĂŠ Q Jaune standard Q RĂŠalisation de kakĂŠmonos, de banderoles etc...



d

M2/HTd

45

115,00

2,79

†





RĂŠfĂŠrence

Format en m

PM1130914JST

0,914

2/,56



M2/HTd

53,47    

1,95 † † † †

I Th Dye Uv Chaud

Q Support papier ignifugĂŠ Q Fort contraste des couleurs Q RĂŠalisation de kakĂŠmonos, de banderoles etc... Format en m

PM1130914B45 PM1130127B90

0,914 1,270

45 90

d

M2/HTd

109,30 335,66

2,66 2,94

120g

2CRKGTCHÂąEJG

Th Dye Uv Piezo Chaud

Q Papier couchÊ pour tracÊ haute rÊsolution jusqu’à 1440DPI

Q 7VKNKUCDNGGPKOCIGTKG Q Bonne vivacitĂŠ des couleurs Q 2NCUVKÂąECVKQPiEJCWFQWiHTQKFHCEKNG

  

16

RĂŠfĂŠrence

Format en m

d

M2/HTd

PCX120914

0,914

30

44,97

1,64

2%: 2%: 2%:

  

† † †

  

† † †

I Th Dye Uv Chaud

Q Support papier ignifugÊ Q ,CWPG²WQ Q RÊalisation de kakÊmonos, de banderoles etc...



d

2CRKGTEQWEJo%NCUUoHGW/

RĂŠfĂŠrence

M /HTd 3,34

Th Dye Uv Chaud 2

2CRKGTCH¹EJGToUKUVCPViNŠGCW

RĂŠfĂŠrence

BLEU 2

d Uv Piezo Chau

2CRKGTLCWPG²WQ/

Q Papier couchĂŠ pour tracĂŠ couleur

DOS

RĂŠfĂŠrence

Format en m

PM1130914JF 2/,(

0,914 

45 †

d

M2/HTd

118,05 

2,87 

2CRKGTTGE[ENoRQWTEQPVTzNGF©KORQUKVKQP I Th Dye Uv Piezo Chaud

Q Papier ĂŠconomique opaque Q 6TCEoÂąNCKTGOQPQEJTQOGGVEQWNGWT Q Pliage facile Q %QPFKVKQPPGOGPVRCTDQuVGFGTQWNGCWZ RĂŠfĂŠrence PC80914R

Format en m 0,914 50

d 18,82

M2/HTd 0,41


2#2+'452*161)4#2*+37'5 2CRKGTRJQVQ241UCVKP

I

2CRKGTRJQVQ241DTKNNCPV

Th Dye Uv Piezo Chaud

Q Excellente stabilitÊ sur le long terme Q VÊritable papier photo professionnel Q Surface particulièrement homogène Q Excellent rendu des tons chauds RÊfÊrence 

Q Brillance exceptionnelle Q VĂŠritable papier photo professionnel Q Parfaite restitution des dĂŠtails Q Noirs profonds

Format en m

M /HTd

RĂŠfĂŠrence PH33061B

0,610

30

159,57

8,72

2*$



†



†

2

d

PH30061S

0,610

30

159,57

8,72

2*5



†



†

2CRKGTRJQVQUGOKDTKNNCPV

RĂŠfĂŠrence  

PZH170914S 2<*5 2<*5



Format en m 0,914  

30 Â&#x2020; Â&#x2020;

RĂŠfĂŠrence

4,24 Â&#x2020; Â&#x2020;

2CRKGTRJQVQCFJoUKHDTKNNCPV

   

I Th Dye Uv

Piezo

Q CouchĂŠ jet dâ&#x20AC;&#x2122;encre stabilisĂŠ Q Pas de limitation de taux dâ&#x20AC;&#x2122;encrage Q Excellents contrastes, sĂŠchage instantanĂŠ Q IdĂŠal pour documents de haute qualitĂŠ avec rendu photographique RĂŠfĂŠrence 

PH195914AD 2*#&

Format en m 0,914 

d

20 Â&#x2020;

155,75 

M /HTd 2

POSCOL170914 215%1. 215%1. 215%1. 215%1.

0,914    

d

30 Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;

83,39    

M /HTd 2

3,04 Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;

2CRKGTRJQVQUCVKPUoEJCIGKPUVCPVCPo 

I

Th Dye Uv Piezo Chaud

Th Dye Uv Piezo Chaud

d

Format en m

8,52 Â&#x2020;

Q7VKNKUCDNGUWTKORTKOCPVGURKG\QGVVJGTOKSWGU Q Couche nanocÊramique Q Imprimable encre pigmentÊe ou teintÊe (colorants) Q ImmÊdiatement sec au toucher après impression Q%QORCVKDNGCXGENCRNCUVK¹ECVKQPiEJCWF

Q7VKNKUCDNGUWTKORTKOCPVGURKG\QGVVJGTOKSWGU Q Couche nanocÊramique Q Imprimable encre pigmentÊe ou teintÊe (colorants) Q ImmÊdiatement sec au toucher après impression Q%QORCVKDNGCXGENCRNCUVK¹ECVKQPiEJCWF Format en m

I

*Bien que les images soient sèches au toucher dès la sortie de lâ&#x20AC;&#x2DC;imprimante, il est recommandĂŠ FGNGUNCKUUGTUoEJGTEQORNoVGOGPVCXCPVFGNGURNCUVKÂąGT (un dĂŠlai de 24 heures est recommandĂŠ pour garantir des rĂŠsultats constants).

2CRKGTRJQVQDTKNNCPVUoEJCIGKPUVCPVCPo  I

RĂŠfĂŠrence

2

Th Dye Uv Piezo Chaud

2

116,26  

M /HTd

d

Q CouchĂŠ jet dâ&#x20AC;&#x2122;encre stabilisĂŠ Q Pas de limitation de taux dâ&#x20AC;&#x2122;encrage Q Excellents contrastes, sĂŠchage instantanĂŠ Q IdĂŠal pour documents de haute qualitĂŠ avec rendu photographique Q 4GEQOOCPFoRQWTNCRNCUVKÂąECVKQPiEJCWF

M /HTd

d

Format en m

2CRKGTSWCNKVo7*4OCV

I Th Dye Uv Piezo Chaud

Q Couche microporeuse Q SĂŠchage ultra rapide Q Papier photorĂŠaliste Q Aspect perlĂŠ

I Th Dye Uv Piezo Chaud

RĂŠfĂŠrence M /HTd

Format en m

d

M /HTd 2

2

PZM195061S

0,610

30

99,54

5,35



PZM195061B 2</$

0,610 

30 Â&#x2020;

99,54 

5,35 Â&#x2020;

 

2</5 2</5

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;

  

2</$ 2</$ 2</$

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

Â&#x2020; Â&#x2020; Â&#x2020;

 

2</5 2</5

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;



2</5



Â&#x2020;



Â&#x2020;



2</$



Â&#x2020;



Â&#x2020;

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

17


572214652174+/24'55+10$#5''#7

572214652174'0417.'745 56#0&52#4#2.7+'%1/261+45 $CPPGTRQN[RTQR[NpPG/CV

I

$jEJGKPVoTKGWTG/

Â&#x2019;

Th Dye Uv Piezo

Th Dye Solv Piezo

Q Toile polyester mate de 340g souple et lÊgère Q Classement feu M1 Q Ne curle pas, idÊal pour enrouleurs et kakÊmonos

Q Film synthĂŠtique au toucher papier, excellente blancheur Q RĂŠsistant Ă la dĂŠchirure, rĂŠsistant Ă  lâ&#x20AC;&#x2122;eau Q+FoCNRQWTGPTQWNGWTRQTVGCHÂąEJGFoÂąNCPVoNGEVTKSWG



RĂŠfĂŠrence

Format en m

SYNT180914

0,914

5;06

30



Â&#x2020;

d

M2/HTd

177,35

6,47



Â&#x2020;

2QRWRURoEKCNFKURNC[UCVKP

 

Â&#x2019;

Th Dye Uv Piezo Chaud

RĂŠfĂŠrence 21272

Format en m  

d 

M2/HTd 



21272





Â&#x2020;

Â&#x2020;

Format en m

BAC300914

0,914

$#% $#%

 

15 Â&#x2020; Â&#x2020;

ENROULEUR

d

M2/HTd

197,01

14,37

 

Â&#x2020; Â&#x2020;

&WTCSWCNKIJVOCV

Q Polyester satin microporeux pour rĂŠalisation de stand parapluie Q Dos gris, opacitĂŠ 100% Q Rendu photographique, sĂŠchage instantanĂŠ 

RĂŠfĂŠrence

SpĂŠcial

Q Mandrin 3â&#x20AC;?(76mm) Q PVC mat, pour rĂŠalisation d'enrouleurs Q Bonne rigiditĂŠ, peu de mĂŠmoire de forme



Â&#x2019; Th Dye Uv Piezo

RĂŠfĂŠrence ROL230M914

Format en m 0,914 30

d 215,52

M2/HTd 7,86

41./





Â&#x2020;

Â&#x2020;

$#%-.+62174%#+55105.7/+0'7: $CEMNKVCFJoUKH(TQPV2TKPV

Â&#x2019; Th Dye Uv Piezo

Q Backlit adhĂŠsif repositionnable pour vitrines Q Double utilisation ÂŤintĂŠrieur jourÂť, ÂŤextĂŠrieur nuitÂť Q Aspect mat haute qualitĂŠ dâ&#x20AC;&#x2122;impression Q Enlevable sans rĂŠsidu de colle Q +ORTGUUKQPRNWUFoNKECVGGPRKG\QQW78



d

M2/HTd

20

271,25

14,84

Â&#x2020;



Â&#x2020;

RĂŠfĂŠrence

Format en m

DIF225914AD

0,914

&+(#&



$CEMNKV5WRGT&T[(TQPVRTKPVUCVKP

Â&#x2019;

Th Dye Chaud Piezo

Q Diffusant satin 5WRGT&T[ Q Impression qualitĂŠ photo mĂŞme non rĂŠtro ĂŠclairĂŠe Q DensitĂŠ > 3,5 avec les encres pigmentĂŠes Q Ecriture face avant sens lecture RĂŠfĂŠrence

Format en m

d

M2/HTd

DIF175914SD

0,914

20

172,25

9,42



&+(5&



Â&#x2020;



Â&#x2020;



&+(5&



Â&#x2020;



Â&#x2020;

18

$CEMNKV(TQPVRTKPVOCV

Â&#x2019; Th Dye Uv Piezo

Q Diffusant mat waterproof Q Polyester translucide blanc Q Ecriture face avant sens lecture Q 7PKXGTUGN6JGTOKSWG2KG\QKPVoTKGWTGVGZVoTKGWT d

M2/HTd

30,5 Â&#x2020;

270,96 

9,72 Â&#x2020;

Â&#x2020; Â&#x2020; Â&#x2020;

  

Â&#x2020; Â&#x2020; Â&#x2020;

RĂŠfĂŠrence

Format en m



DIF210914FP &+((2

0,914 

  

&+((2 &+((2 &+((2

  


8+0;.'5#&*d5+(5$¸%*'5'66;8'8KP[NGCFJoUKHGZVoTKGWT/CV

6[XGMÂ&#x2030;

Â&#x2019;

I Th Dye Uv Piezo Oil

Th Dye Uv Piezo

Q PVC mat avec couchage micro-poreux rĂŠsistant Ă l'eau Q AdhĂŠsif permanent Ă  base solvant Q Impression avec des encres pigmentĂŠes

NOUVEAU

Hp, Canon, Epson

Q Pour surfaces planes en intÊrieur et extÊrieur Q DurabilitÊ de 1 an Q 2NCUVK¹ECVKQPiHTQKFEQPUGKNNoGRQWTNŠGZVoTKGWT



RĂŠfĂŠrence

Format en m

d

M /HTd

0,914

20

140,57

7,69

 

8+0% 8+0%

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;



8+0%



Â&#x2020;



Â&#x2020;

d

M2/HTd

30

205,10

7,48

Â&#x2020;



Â&#x2020;

RĂŠfĂŠrence

Format en m

TYVEK13591430

0,914

6;8'-



QDisponible en 105g

2

VINC80914

Solv

QHaute rĂŠsistance Ă la dĂŠchirure Q RĂŠsiste Ă  lâ&#x20AC;&#x2122;eau avec des encres pigmentĂŠes Q Peut ĂŞtre coupĂŠ, collĂŠ, cousu, perforĂŠ avec Ĺ&#x201C;illets

Equivalences bobines pouce (1") et mm 24" 610mm 36" 914mm 42" 1067mm 50" 1270mm 54" 1370mm 60" 1524mm

$jEJGKPVoTKGWTGGZVoTKGWTG

$jEJGKPVoTKGWTG/

Â&#x2019;

Â&#x2019; Th Dye Uv Piezo

Th Dye Uv Piezo

Q Aspect mat Q Toile polyester de 340g, souple et lÊgère Q Classement feu M1 Q Ne curle pas Q IdÊale pour enrouleurs et kakÊmonos

Q Aspect mat Q NĂŠcessite un faible encrage Q Polyvalente, 380g, intĂŠrieur et extĂŠrieur Q IdĂŠale pour la signalĂŠtique ĂŠvĂŠnementielle courte durĂŠe RĂŠfĂŠrence

Format en m

d

M2/HTd

BAC375914E

0,914

15

176,86

12,90

 $#%'  $#%'  $#%'

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

Â&#x2020; Â&#x2020; Â&#x2020;

 

RĂŠfĂŠrence

Format en m

BAC300914 $#% $#%

0,914  

15 Â&#x2020; Â&#x2020;

d

M2/HTd

197,01  

14,37 Â&#x2020; Â&#x2020;

ADHĂ&#x2030;SIF DOUBLE FACE SPĂ&#x2030;CIAL BĂ&#x201A;CHE P 53

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

19


572214652174+/24'55+10$#5''#7

61+.'5%#08#5 6QKNG%CPXCU/CV

I

6QKNG%CPXCU/CV

I

Th Dye Uv Piezo

Q VĂŠritable toile de peintre, rembordage facile Q Reproduction de tableaux, beaux arts Q 7VKNKUCDNGGPGPETGUVGKPVoGUQWRKIOGPVoGU M2/HTd

12

192,75

17,57



Â&#x2020;



Â&#x2020;



Â&#x2020;



Â&#x2020;

Format en m

CAN390914

0,914



%#0



%#0

NOUVEAU

Q Toile lÊgère de 430Ο, 100% polyester Q Couchage blanc et rÊgulier, sÊchage rapide Q 7VKNKUCDNGGPGPETGUVGKPVoGUQWRKIOGPVoGU d

RĂŠfĂŠrence

Th Dye Uv Piezo

RĂŠfĂŠrence

Format en m

d

M2/HTd

CAN260914

0,914

18

130,79

7,95



%#0



Â&#x2020;



Â&#x2020;



%#0



Â&#x2020;



Â&#x2020;

DROP PAPER &TQRÂ&#x2030;LGV%NCUUoHGW/

I Th Dye Uv Piezo

QSupport non tissĂŠ ignifugĂŠ Q IdĂŠal pour enseignes dâ&#x20AC;&#x2122;intĂŠrieur de grandes dimensions Q %GTVKÂąECV/UWTFGOCPFG

  

RĂŠfĂŠrence

Format en m

DRP80914

0,914

&42 &42 &42

  

25 Â&#x2020; Â&#x2020; Â&#x2020;

d

M2/HTd

186,91

8,18

  

Â&#x2020; Â&#x2020; Â&#x2020;

&TQRÂ&#x2030;LGV%NCUUoHGW/

I Th Dye Uv Piezo

Q Support non tissĂŠ ignifugĂŠ Q IdĂŠal pour enseignes dâ&#x20AC;&#x2122;intĂŠrieur de grandes dimensions Q %GTVKÂąECV/UWTFGOCPFG

  

RĂŠfĂŠrence

Format en m

DRP137914 &42 &42 &42

0,914   

25 Â&#x2020; Â&#x2020; Â&#x2020;

d

M2/HTd

205,42   

8,99 Â&#x2020; Â&#x2020; Â&#x2020;

21.;'56'4564#052#4'065 5oTKÂąNOWPKXGTUGNJQTU*2

Â&#x2019; Th Dye Uv Piezo

Q Polyester 160Îź pour rĂŠalisation dâ&#x20AC;&#x2122;ĂŠcran de sĂŠrigraphie Q DensitĂŠ > 3,0 en utilisant des encres noires Q Impression avec encres dâ&#x20AC;&#x2122;intĂŠrieur ou dâ&#x20AC;&#x2122;extĂŠrieur Q SĂŠchage rapide

ECRAN DE SERIGRAPHIE

 

RĂŠfĂŠrence

Format en m

5'4+(7 5'4+(7

 

 Â&#x2020;

d

M2/HTd

 

 Â&#x2020;

Q Disponible en version spĂŠciale HP Ă 15,95 â&#x201A;ŹHT/m2

6TCPURCTGPV*245

Â&#x2019; Th Dye

Q Polyester 100Îź pour vitrines ou portes vitrĂŠes Q Bande de dĂŠtection pour traceurs HP Q Impression avec encres dâ&#x20AC;&#x2122;intĂŠrieur



20

RĂŠfĂŠrence

Format en m

POLYTR914HP 21.;64*2

0,914 

30 Â&#x2020;

d

M2/HTd

229,78 

8,38 Â&#x2020;

DROP

PAPE

R


Les Encres

Cartouches

C O M P A T I B L E S

QEncres et accessoires pour ROLAND ....................................................... P 22 QEncres compatibles 'PETGURQWT'RUQP$CUGGCWGV/761*'EQUQNXCPV ........ P 23 Q Encres pour HP

T ĂŠ l

ÂŽ

.................................................................................................................

:

0 2

9 9

5 5

P 24

1 7

1 9

21


LES ENCRES ET ACCESSOIRES

Eco-solvant Max Couleurs

220 ml - 440 ml 220 ml

440ml

Cyan

ESL3-CY

ESL3-4CY

Magenta

ESL3-MG

ESL3-4MG

Jaune

ESL3-YE

ESL3-4YE

Noire

ESL3-BK

ESL3-4BK

Light cyan

ESL3-LC

ESL3-4LC

Light magenta

ESL3-LM

ESL3-4LM



$NCPE

'5.9*

Â&#x2020;



/oVCN

'5./6

Â&#x2020;

Eco UV pour LEJ-640 et LEF-12

Eco-solvant Max 2 pour SOLJET PRO4

XR-640

Encres de nouvelle gĂŠnĂŠration, sans nickel , sans odeur, sans système dâ&#x20AC;&#x2122;aspiration, composĂŠes de pigments très purs. SĂŠchage rapide, haute tenue Ă lâ&#x20AC;&#x2122;extĂŠrieur, ²WKFKVoWPKSWG en son genre. 

Couleurs %[CP

440 ml '5.%;

220 ml Â&#x2020;

  

/CIGPVC ,CWPG 0QKTG

'5./) '5.;' '5.$-

Â&#x2020; Â&#x2020; Â&#x2020;

 

.KIJVE[CP .KIJVOCIGPVC

'5..% '5../

Â&#x2020; Â&#x2020;



0QKTNoIGT Blanc MĂŠtal

'5..-

Â&#x2020; ESL4-4WH ESL4-4MT

220 ml

Couleurs

RĂŠfĂŠrence



%[CP

'78%;

Â&#x2020;



/CIGPVC

'78/)

Â&#x2020;



,CWPG

'78;'

Â&#x2020;



0QKTG

'78$-

Â&#x2020;



$NCPE

'789*

Â&#x2020;

ESL-CL

Cartouche 220ml de liquide de nettoyage

37,00 â&#x201A;Ź HT



8GTPKUDTKNNCPV

'78).

Â&#x2020;

ESL4-CL

Cartouche 220ml de liquide de nettoyage pour XR640 uniquement

37,00 â&#x201A;Ź HT

Z22085118

Kit de nettoyage 100ml + 10 bâtonnets

43,00 â&#x201A;Ź HT

COTONTIGE

BoĂŽte de 100 cotons-tige de nettoyage

58,50 â&#x201A;Ź HT

Z21755107

Flacon 500ml de liquide de nettoyage

67,50 â&#x201A;Ź HT

Z10003390

Wipper pour SP / VP / XJ / XC

13,00 â&#x201A;Ź HT

Z10006517 5 7

Wipper head pour sĂŠries VS300/420/540/640

21,50 â&#x201A;Ź HT

Wipper head felt pour sĂŠries VS VS300/420/540/640

12,50 â&#x201A;Ź HT

Programme de recyclage de vos cartouches vides Consultez-nous Accessoires dâ&#x20AC;&#x2122;entretien

Lames - Porte-lames ZEC-U10055

ZEC-U5025 5 5  

 

Z10006736

BoĂŽte de 5 lames 170,00 â&#x201A;Ź HT 2QWTXKP[NGUEQOOWPUiVTpUFWTU²WQTGUEGPVU To²oEJKUUCPVU Tranchant plus important que ZEC-U1005. DurĂŠe moyenne de 4000 m. Capuchon rouge

Z1000000415

Filtre ĂŠponge pour XC / XJ

2.86 â&#x201A;Ź HT

Z1000000416

Filtre ĂŠponge pour VP / SP

2,40 â&#x201A;Ź HT

Z10004546

Capping pour Pro2 / Pro3 / Versacamm

42,00 â&#x201A;Ź HT

Z6701409200

Assy Cap Top pour VS640 ( capping )

90,00 â&#x201A;Ź HT

BoĂŽte de 5 lames 180,00 â&#x201A;Ź HT Pour supports souples themofusibles Flex et Flock. Capuchon vert

100001658/213

Wiper Scraper pour SP / VP / PRO2 / PRO3

7,50 â&#x201A;Ź HT

Z1000003083

Flasque guide VP300/540 / XC540

44,50 â&#x201A;Ź HT

XD CH2

Porte-lames Porte-lames mĂŠtallique

77,00 â&#x201A;Ź HT

Z22805576/75

Media Clamp droite et gauche pour VP540

33,50 â&#x201A;Ź HT

Z6700319060/70

Media Clamp droite et gauche pour XC540

62,00 â&#x201A;Ź HT

XD CH3

Porte-lames Porte lames Porte-lames en rĂŠsine

55,00 â&#x201A;Ź HT

Z6085393800

Damper pour XC540 / XJ640 / VP300 / VP540

49,00 â&#x201A;Ź HT

Z10006713

$CPFGOCTV[TGPVo²QPRQWT85

ÂŽ*6

$CPFGOCTV[TGPVo²QPRQWT:%

ÂŽ*6

ZEC-U1715 7 5

Z11849102

22

BoĂŽte de 5 lames 146,00 â&#x201A;Ź HT Pour vinyles communs. Utilisation intensive. Haute rĂŠsistance. DurĂŠe moyenne de 8000 m. Capuchon bleu

Pièces de rechange

BoĂŽte de 25 lames 45,00 â&#x201A;Ź HT Pour la coupe transversale en sortie dâ&#x20AC;&#x2122;impression




C O M P A T I B L E S

'PETGU'EQ5QNXCPV %QORCVKDNGU'EQUQNXCPV4QNCPF

CPV 'PETGU'EQ5QNX MJQRRGT

ON

'EQ

C O M P A T I B L E S



Couleurs %[CP

RĂŠfĂŠrence %'%;

Â&#x2020;



 

/CIGPVC ,CWPG

%'/) %';'

Â&#x2020; Â&#x2020;



  

0QKTG .KIJVE[CP .KIJVOCIGPVC

%'$- %'.% %'./

Â&#x2020; Â&#x2020; Â&#x2020;



%QORCVKDNGU'EQUQNXCPV4QNCPF C O M P A T I B L E S



RĂŠfĂŠrence '%;.

Â&#x2020;

    

/CIGPVC ,CWPG 0QKTG .KIJVE[CP .KIJVOCIGPVC

'/). ';'. '$-. '.%. './.

Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;

%QORCVKDNGU'EQUQNXCPV4QNCPF

Â&#x2020;

4,7;' 4,7$- 4,7.% 4,7./

,CWPG 0QKTG

2TQ

Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;

7NVTCEJTQOGON

Couleurs

NKVTG

C O M P A T I B L E S

RĂŠfĂŠrence '41..% '41../ '41..; '41..$- '41...% '41.../

Â&#x2020;

'PETGU'2510$CUGGCW

$14&'#7:      

Â&#x2020;

4,7%; 4,7/)

.KIJVE[CP  .KIJVOCIGPVC  ON 4,7%.0  ge ya tto ne uide de Cartouche de liq

NKVTG

Couleurs %[CP

RĂŠfĂŠrence

Couleurs %[CP /CIGPVC



Egalement disponible en litre avec kit grand encrage

Couleurs %[CP /CIGPVC ,CWPG 0QKTG .KIJVE[CP .KIJVOCIGPVC

ON

RQWT4QE UQNXCPVWNVTC

Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;

RĂŠfĂŠrence

0QKTRJQVQ

6

Â&#x2020;



%[CP

6

Â&#x2020;



/CIGPVC

6

Â&#x2020;



,CWPG

6

Â&#x2020;



%[CPENCKT

6

Â&#x2020;



/CIGPVCENCKT

6

Â&#x2020;



)TKU

6

Â&#x2020;



0QKTOCV

6

Â&#x2020;

2TQ7NVTCEJTQOG-ON Couleurs 0QKTRJQVQ

6

%[CP

6

Â&#x2020;

Magenta (Vivid)

T6033

7880 et 9880



,CWPG

6

Â&#x2020;



%[CPENCKT

6

Â&#x2020;

Magenta clair (Vivid)

T6036

7880 et 9880



)TKU

6

Â&#x2020;



)TKUENCKT NKIJVDNCEM 

6

Â&#x2020;



0QKTOCV

6

Â&#x2020;

Magenta

T603B

7800 et 9800

Magenta clair

T603C

7800 et 9800



-KVUITCPFGPETCIGRQWTGPETGCWNKVTG Q Kit 4 couleurs pour SP300/540, VP300/540, RS640. 4oHoTGPEGMKV)'5 QKit 6 couleurs doublĂŠes pour XJ640/XC540,  4oHoTGPEGMKV)'& QKit 4 couleurs (8 cartouches) pour VS 300/420/540/640.  4oHoTGPEGMKV)'85&

RĂŠfĂŠrence

QKit 6 couleurs (6 cartouches) pour VS 300/420/540/640.  4oHoTGPEGMKV)'855

Â&#x2020;

2TQ 7NVTCEJTQOG*&4ON Couleurs

T ĂŠ l

:

RĂŠfĂŠrence



0QKTRJQVQ

6

Â&#x2020;



%[CP

6

Â&#x2020;



/CIGPVC 8KXKF 

6

Â&#x2020;



,CWPG

6

Â&#x2020;



%[CPENCKT

6

Â&#x2020;



/CIGPVCENCKT 8KXKF 

6

Â&#x2020;



)TKU .KIJVDNCEM 

6

Â&#x2020;



)TKUENCKT .KIJV.KIJVDNCEM 

6

Â&#x2020;



0QKTOCV

6

Â&#x2020;



1TCPIG

6#

Â&#x2020;



8GTV

6$

Â&#x2020;

0 2

9 9

5 5

1 7

1 9

23


.'5'0%4'5$#5''#7

'PETGU*2Â&#x2030;

Le marchĂŠ des encres ĂŠtant en constante ĂŠvolution , nos tarifs sont sujets Ă variation sans prĂŠavis, nous consulter au moment de la commande.

*2<



Q Cartouches encres pigmentĂŠes Vivera 775ml Couleurs

Q TĂŞtes dâ&#x20AC;&#x2122;impression pour 2 couleurs

RĂŠfĂŠrence

Couleurs

RĂŠfĂŠrence

0QKTOCV

%#

Â&#x2020;



0QKTOCVGV%[CP

%#



0QKTRJQVQ

%#

Â&#x2020;



/CIGPVCGV,CWPG

%#

Â&#x2020; Â&#x2020;



)TKUENCKT

%#

Â&#x2020;



/CIGPVCENCKTGV%[CPENCKT%#

Â&#x2020;



%[CP

%#

Â&#x2020;



)TKUENCKTGV0QKTRJQVQ

%#

Â&#x2020;



/CIGPVC

%#

Â&#x2020;



%CTVQWEJGFGOCKPVGPCPEG%#

Â&#x2020;



,CWPG

%#

Â&#x2020;



%[CPENCKT

%#

Â&#x2020;



/CIGPVCENCKT

%#

Â&#x2020;

Cartouches dâ&#x20AC;&#x2122;encre disponibles pour HP Z6200

*2Â&#x203A;F[GÂ&#x153;

*2Â&#x203A;78Â&#x153;

Q TĂŞte dâ&#x20AC;&#x2122;impression + dispositif de nettoyage N° 81 encre dye Q%CTVQWEJG*2Â&#x2030;FGON0Â&#x201A;GPETG78 Couleurs

Q TĂŞte dâ&#x20AC;&#x2122;impression + dispositif de nettoyage N° 81 encre dye Q Cartouche HPÂŽ de 680ml N° 81 encre dye

TĂŞte

Cartouche

TĂŞte

Cartouche

Noire

C4960A

C4940A

Noire

C4950A

C4930A

Cyan

C4961A

C4941A

Cyan

C4951A

C4931A

Magenta

C4962A

C4942A

Magenta

C4952A

C4932A

Jaune

C4963A

C4943A

Jaune

C4953A

C4933A

Cyan clair

C4964A

C4944A

Cyan clair

C4954A

C4934A

Magenta clair

C4965A

C4945A

Magenta clair

C4955A

C4935A

Couleurs

*2<*2<*2<*225 Q Cartouches Encres Vivera twin pack 2 x 130ml Couleurs

RĂŠfĂŠrence

Couleurs

RĂŠfĂŠrence

0QKTOCV

%$#

Â&#x2020;

Optimiseur

C9459A

1 x 130 ml

Noir photo

C9459A

1 x 130 ml

Cyan clair

C9390A

1 x 130 ml



)TKU

%$#

Â&#x2020;



4QWIGEJTQOCVKSWG

%&#RQWT<



)TKUENCKT

%$#

Â&#x2020;

Q TĂŞtes dâ&#x20AC;&#x2122;impression pour 2 couleurs



%[CP

%$#

Â&#x2020;

Couleurs

Â&#x2020;

RĂŠfĂŠrence

/CIGPVC

%$#

Â&#x2020;



0QKTOCVGV%[CP

%#

Â&#x2020;

Jaune

C9454A

1 x 130 ml



/CIGPVCENCKTGV%[CPENCKT

%#

Â&#x2020;



/CIGPVCENCKT

%$#

Â&#x2020;



/CIGPVCGV,CWPG

%#

Â&#x2020;



4QWIG

%$#

Â&#x2020;



0QKTRJQVQGV)TKUENCKT

%#

Â&#x2020;

Vert

C9457A

1 x 130 ml



$NGWGVXGTV

%#

Â&#x2020;

$NGW

%$#

Â&#x2020;



0QKTOCVGV4QWIG

%#

Â&#x2020;





*2 Q HPŽ N° 80 cartouche de 350 ml Couleurs

Q TĂŞte dâ&#x20AC;&#x2122;impression + dispositif de nettoyage N° 80

RĂŠfĂŠrence

Couleurs



%[CP

%#

Â&#x2020;



/CIGPVC

%#

Â&#x2020;



,CWPG

%#



0QKTG

%#

%#

Â&#x2020;



/CIPGVC

%#

Â&#x2020;

Â&#x2020;



,CWPG

%#

Â&#x2020;

Â&#x2020;



0QKTG

%#

Â&#x2020;

2QWT*2&GUKIPLGVGV%QORCVKDNGU

VKDNGU 'PETGU%QORC

Q Cartouche HPÂŽ de 680ml Encre pigmentĂŠe outdoor Couleurs

RĂŠfĂŠrence

Encre dye indoor

PLGV

RĂŠfĂŠrence

%[CP

*27%

*2%



/CIGPVC

*27/

*2/



,CWPG

*27;

*2;



0QKTG

*27-

*2-



%[CPENCKT

*27.%

*2.%



/CIGPVCENCKT

*27./

*2./

2QWT*2&GUKI

Â&#x2030;FGON

Q %CTVQWEJG*2 or Âť ncre dye ÂŤ indo  rechargĂŠe dâ&#x20AC;&#x2122;e fĂŠrence Couleurs %[CP

 

/CIGPVC



,CWPG 0QKTG

 24

RĂŠfĂŠrence

%[CP

RĂŠ

*2% *2/ *2; *22-

Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;


Les Films GHSODVWL±FDWLRQ Films à chaud

Ultra conformable

Polymère

9800 Pro

Adhésifs de marquage

Q(KNOUFGRNCUVK±ECVKQPiEJCWF .................................................................. P 26

Sublime

Iridescent

8900 Pro Designer

Tuning Films

Carbone

Q/CEJKPGUGVRQEJGVVGUFGRNCUVK±ECVKQPiEJCWF................ P 28 Q(KNOUFGRNCUVK±ECVKQPiHTQKF ...................................................................... P 29 Q(KNOUFGOQPVCIGGV±NOFGToVTQRTQLGEVKQP ........................... P 33 QAdhésifs de marquage .......................................................................................... P 34 QTuning Film ....................................................................................................................... P 36

T é l

T é l : 0 2 9 9 5 5 1 7 : 0 2 9 9 5 5 1 7 1 9

1 9

25 25


(+./5&'2.#56+(+%#6+10#%*#7&

FILMS DE PLASTIFICATION A CHAUD sur mandrin de 57 mm et 25 mm

(KNORQN[GUVGTDTKNNCPV

LM57042305

mm 305

m 150

Â&#x2019;

Q Mandrin de 57 mm de diamètre Q Diamètre extĂŠrieur des bobines 120 mm Q Film Ă chaud de qualitĂŠ supĂŠrieure Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;Â&#x201A;

Q Mandrin de 57 mm de diamètre Q Diamètre extĂŠrieur des bobines 115 mm Q Film Ă chaud de qualitĂŠ supĂŠrieure Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;Â&#x201A; RĂŠfĂŠrence

(KNORQN[GUVGTDTKNNCPV

Â&#x2019;

d 48,04

m2/HTd

m2/HTd

RĂŠfĂŠrence

mm

m

1,05

LM57075305

305

100

43,31

1,42

  

./ ./ ./

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

  

 

./ ./

 

Â&#x2020; Â&#x2020;

 

 

d

 

./ ./

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;

  

./ ./ ./

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

./ ./ ./

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

./ ./ ./

  

Â&#x2020; Â&#x2020; Â&#x2020;

  

  



./



Â&#x2020;



Â&#x2020;



./



Â&#x2020;





(KNORQN[GUVGTDTKNNCPV

Â&#x2019;

Q Mandrin de 57 mm de diamètre Q Diamètre extĂŠrieur des bobines 144 mm Q Film Ă chaud de qualitĂŠ supĂŠrieure Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;Â&#x201A; RĂŠfĂŠrence LM57125305 ./ ./ ./ ./ ./ ./ ./ ./ ./ LM57125100050

        

mm 305          1000

m 100 Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; 50

d 65,58          107,00

(KNORQN[GUVGTWNVTCOCV

m2/HTd 2,15          2,15

Â&#x2019;

Q Mandrin de 57 mm de diamètre Q Diamètre extĂŠrieur des bobines 95 mm Q Film Ă chaud low left Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;Â&#x201A;

(KNORQN[GUVGTDTKNNCPV Q Mandrin de 57 mm de diamètre Q Diamètre extĂŠrieur des bobines 144 mm Q Film Ă chaud de qualitĂŠ supĂŠrieure Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;Â&#x201A;

       

RĂŠfĂŠrence LM57250305 ./ ./ ./ ./ ./ ./ ./ ./

mm 317

m 75

d 58,25

m2/HTd 2,45

 .//  .//

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;

mm 305        

m 50 Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;

d 65,12        

(KNORQN[GUVGTWNVTCOCV

m2/HTd 4,27 Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020; Â&#x2020;

Â&#x2019;

Q Mandrin de 57 mm de diamètre Q Diamètre extĂŠrieur des bobines 185 mm Q Film Ă chaud low melt Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;Â&#x201A; RĂŠfĂŠrence

RĂŠfĂŠrence LM57075317M2

Â&#x2019;

LM57125317M2  .//  .//

mm

m

317  

75 Â&#x2020; Â&#x2020;

d 84,40  

m2/HTd 3,55 Â&#x2020; Â&#x2020;

(KNORQN[GUVGTDTKNNCPVUWTOCPFTKPOO Q Mandrin de 25 mm de diamètre Q Diamètre extĂŠrieur des bobines 120 mm Q Film Ă chaud de qualitĂŠ supĂŠrieure Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;Â&#x201A;

 

26

RĂŠfĂŠrence 42 microns OKETQPU

mm 305 

m 150 Â&#x2020;

d 48,04 

m2/HTd 1,05 

OKETQPU



Â&#x2020;





75 microns

305

100

43,31

1,42

 

OKETQPU OKETQPU

 

Â&#x2020; Â&#x2020;

 

 



125 microns OKETQPU

305 

60 Â&#x2020;

39,35 

2,15 



OKETQPU



Â&#x2020;






FILMS DE PLASTIFICATION A CHAUD GAMME BASSE TEMPĂ&#x2030;RATURE spĂŠcial grand format mandrin de 76 mm (KNORQN[GUVGTDTKNNCPV

(KNORQN[GUVGTUGOKOCV

Â&#x2019;



RĂŠfĂŠrence LM760421040

mm 1040

m 300

d 255,84

M2/HTd 0,82

./



Â&#x2020;



Â&#x2020;

(KNORQN[GUVGTDTKNNCPV

RĂŠfĂŠrence LM760751040S

mm 1040

m 150

d 283,92

m2/HTd 1,82

 ./5



Â&#x2020;



Â&#x2020;

(KNORQN[GUVGTUGOKOCV

Â&#x2019;

Â&#x2019;

Q Polyester de qualitĂŠ supĂŠrieure Q ClartĂŠ ĂŠlevĂŠe, rigiditĂŠ accrue Q Colle Ă lâ&#x20AC;&#x2122;intĂŠrieur Q TempĂŠrature dâ&#x20AC;&#x2122;activation: 105 - 110°C

Q Polyester de qualitĂŠ supĂŠrieure Q ClartĂŠ ĂŠlevĂŠe, rigiditĂŠ accrue Q Colle Ă lâ&#x20AC;&#x2122;intĂŠrieur Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;%

 

Â&#x2019;

Q Polyester de qualitĂŠ supĂŠrieure Q ClartĂŠ ĂŠlevĂŠe, rigiditĂŠ accrue Q Colle Ă lâ&#x20AC;&#x2122;intĂŠrieur Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;%

Q Polyester de qualitĂŠ supĂŠrieure Q ClartĂŠ ĂŠlevĂŠe, rigiditĂŠ accrue Q Colle Ă lâ&#x20AC;&#x2122;intĂŠrieur Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;%

RĂŠfĂŠrence LM760751040

mm 1040

m 150

d 226,20

m2/HTd 1,45

./ ./

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;

RĂŠfĂŠrence LM761251040S

mm 1040

m 120

d 351,94

m2/HTd 2,82

 ./5



Â&#x2020;



Â&#x2020;

(KNORQN[GUVGT.QY/GNVWNVTCOCV (KNORQN[GUVGTDTKNNCPV

Â&#x2019;

Q Polyester de qualitĂŠ supĂŠrieure Q ClartĂŠ ĂŠlevĂŠe, rigiditĂŠ accrue Q Colle Ă lâ&#x20AC;&#x2122;intĂŠrieur Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;%

 

RĂŠfĂŠrence LM761251040 ./ ./

mm 1040  

m 120 Â&#x2020; Â&#x2020;

d 243,36  

Q Polyester High construction spĂŠcial numĂŠrique  ( 25Îź/50Îź de polyester ) construction 1/2 Q RigiditĂŠ et brillance supĂŠrieure Q Colle Ă lâ&#x20AC;&#x2122;intĂŠrieur Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;% RĂŠfĂŠrence LM760751040LM  ././

mm 1040 

m 150 Â&#x2020;

NOUVEAU m2/HTd 1,90 Â&#x2020;

(KNORQN[GUVGTDTKNNCPV.QY/GNV

Â&#x2019;

m 120

d 287,04

m HTd 2,30

 ././



Â&#x2020;



Â&#x2020;

(KNO5VQR.KIJVFQUDNCPE

d   

m2/HTd  Â&#x2020; Â&#x2020;

Â&#x2019;

Q5RoEKCNKORTGUUKQPPWOoTKSWG Q (KNONGRNWUOCVFWOCTEJoUCPUTG²GV Q 7NVTCToUKUVCPVCWZTC[WTGU Q Vitesse de travail plus ĂŠlevĂŠe et temps de prĂŠ-chauffage raccourci Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;% RĂŠfĂŠrence

mm

m

 ./7/  ./7/  ./7/

  

 Â&#x2020; Â&#x2020;

d

m2/HTd

  

 Â&#x2020; Â&#x2020;

Â&#x2019;

Q#PVKTG²GVCPVKTC[WTGCURGEVITCKPoURoEKCNUVCPF Q Film ultra basse tempĂŠrature Q TempĂŠrature dâ&#x20AC;&#x2122;activation 85°-95°, spĂŠcial impression numĂŠrique RĂŠfĂŠrence LM761250880GR

2/

mm 1040

m  Â&#x2020; Â&#x2020;

%T[UVCN(CEGITCKPoG

NOUVEAU

RĂŠfĂŠrence LM7601251040LM

mm   

(KNORQN[GUVGT.QY/GNVWNVTCOCV

Â&#x2019;

d 296,40 

Q Polyester High construction spĂŠcial numĂŠrique ( 50Îź/75Îź de polyester ) Q RigiditĂŠ et brillance supĂŠrieure Q Colle Ă lâ&#x20AC;&#x2122;intĂŠrieur Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;%

RĂŠfĂŠrence  ./7/  ./7/  ./7/

m2/HTd 1,95 Â&#x2020; Â&#x2020;

(KNORQN[GUVGTDTKNNCPV.QY/GNV

Â&#x2019;

Q SpĂŠcial impression numĂŠrique Q (KNONGRNWUOCVFWOCTEJoUCPUTG²GV Q 7NVTCToUKUVCPVCWZTC[WTGU Q Vitesse de travail plus ĂŠlevĂŠe et temps de prĂŠ-chauffage raccourci Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;%

mm 880

m 50

d 337,92

m2/HTd 7,68

 ./)4  Â&#x2020;  Disponible en 75 Îź - Largeur 88cm Ă 6,30 M2/HTd

Â&#x2020;

(KNO5VQR.KIJVFQUDNCPE

Â&#x2019;

Â&#x2019;

Q Film occultant à 100%, blanc mat Q7PGEQWEJGFŠCNWOKPKWODNQSWGVQVCNGOGPVNCNWOKpTGGV

Q Film occultant à 100%, blanc mat Q7PGEQWEJGFŠCNWOKPKWODNQSWGVQVCNGOGPVNCNWOKpTGGV

renforce la rigiditĂŠ

renforce la rigiditĂŠ

Q TempĂŠrature dâ&#x20AC;&#x2122;activation 100 - 105°C

Q 6GORoTCVWTGFŠCEVKXCVKQPÂ&#x201A;% RĂŠfĂŠrence LM761250880DB

mm 880

m 50

d 370,48

m2/HTd 8,42

RĂŠfĂŠrence LM762500880DB

mm 880

m 50

d 474,32

m2/HTd 10,78

 ./&$



Â&#x2020;



Â&#x2020;

 ./&$



Â&#x2020;



Â&#x2020;

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

27


(+./5&'2.#56+(+%#6+10#%*#7&

/#%*+0'5&'2.#56+(+%#6+10

Ÿ21%*'66'5'6'0%106+072'6+6(14/#6 2415;0%###

241.#/(QTOCV#

Q2NCUVK±GWUGITCPFGXKVGUUGGVVGEJPQNQIKGFGRQKPVG Q Formats A1, A2 et A3 Q$QuVKGTCXGEQWXGTVWTGCKUoGUCPUXKUGVTCDCVVCDNG Q 4 rouleaux chauffés par infra rouge Q Réglage continu de la température et de la vitesse par écran LCD Q Compteur Q 9 programmes en mémoire Q Vitesse jusqu’à 1,6m/mn Référence Prosync A1

Largeur 650mm

Prix 1 865,00 €

Prosync A2 Prosync A3

470mm 320mm

1 530,00 € 1 210,00 €

Q2NCUVK±GWUGRTQHGUUKQPPGNNGFKTGEVGUCPUECTVQPVTCPURQTVGWT Q Vitesse : 0.80 m / mn Q Epaisseur maxi. des documents : 3,5 mm Q Temps de préchauffage : 3 à 4 mn Q Préréglage de température avec 5 positions Q 4 rouleaux dont 2 chauffants Q Poids : 7 kg Référence

Largeur

Prix

Prolam 330FL

330mm

348,00 €

21%*'66'5&'2.#56+(+%#6+10 2QEJGVVGURQN[GUVGTDTKNNCPVGU Q Longévité accrue. Esthétique préservée Q Améliore l’éclat et le contraste des couleurs Q4KIKFK±GXQUFQEWOGPVU Q Le document est rendu hermétique à l’eau Q Résiste aux solvants, aux graisses Q2TQVpIGEQPVTGNGUOCPKRWNCVKQPUGVNGUHCNUK±ECVKQPU Q Idéales pour menus, sets de table, plans incendie, tarifs, documentations, signalétique, tous documents à usage intensif

Q Coins arrondis Référence POCA4075100

28

Format Epaisseur μ / face A4

80

Quantité par boîte

Prix en D par boîte

100

19,84

POCA4100100

A4

100

100

26,03

POCA4125100

A4

125

100

29,99

POCA4180100

A4

175

100

48,50

POCA4250100

A4

250

100

70,34

POCA3075100

A3

80

100

42,12

POCA3100100

A3

100

100

48,70

POCA3125100

A3

125

100

64,01

POCA3175100

A3

175

100

93,53

POCA3250100

A3

250

100

134,47

POCA2080050

A2

80

50

69,69

POCA2100050

A2

100

50

75,62

POCA2125050

A2

125

50

80,88

POCA2250050

A2

250

50

134,57

Formats papier

Formats pochettes

A4 210 x 297 mm

216 x 303 mm

A3 297 x 420 mm

303 x 426 mm

A2 420 x 594 mm

426 x 600 mm

':%'.#/4/.#/+0#6'74Ÿ%*#7& Q Largeur de travail 655 mm Q Vitesse : 1,5 m / mn Q Epaisseur maxi. 1,5 mm Q Mandrins de 25 mn


(+./5&'2.#56+(+%#6+10Â&#x;(41+& MONOMĂ&#x2C6;RES 2TKPVEQXGTDTKNNCPV

2TKPVEQXGT

Â&#x2019;

Q Film auto-adhĂŠsif et lisse Q Application intĂŠrieure ou extĂŠrieure Q2ToEQPKUoRQWTNCRNCUVKÂąECVKQPFGU2TKPVXKP[NU Q6TCKVoCPVK78FWTCDKNKVoGPGZVoTKGWTCPU

 

RĂŠfĂŠrence FFPC104050B ((2%$ ((2%$

Format en m 1,040 50  Â&#x2020;  

M2/HTD 2,50 Â&#x2020; Â&#x2020;

D 130,00  

(KNO28%DTKNNCPV

 

(KNO28%

Format en m 1,040 50  Â&#x2020;  Â&#x2020;

RĂŠfĂŠrence FFPC104050M ((2%/ ((2%/

 

Â&#x2019;

Q Film auto-adhĂŠsif et lisse pour application intĂŠrieure ou extĂŠrieure Q6TCKVoCPVK7V, durabilitĂŠ en extĂŠrieur 2 ans RĂŠfĂŠrence FLAM104G80 (.#/) (.#/)

OCV

Format en m 1,040 50  Â&#x2020;  Â&#x2020;

(KNO28% M /HTD 3,56 Â&#x2020; Â&#x2020;

UCVKPo

D 130,00  

OCV

M2/HTD 2,50 Â&#x2020; Â&#x2020;

Â&#x2019;

Q Film auto-adhĂŠsif et lisse pour application intĂŠrieure  ou extĂŠrieure Q6TCKVoCPVK78FWTCDKNKVoGPGZVoTKGWTCPU

2

D 185,12  

Â&#x2019;

Q Film auto-adhĂŠsif et lisse Q Application intĂŠrieure ou extĂŠrieure Q2ToEQPKUoRQWTNCRNCUVKÂąECVKQPFGU2TKPVXKP[NU Q6TCKVoCPVK78FWTCDKNKVoGPGZVoTKGWTCPU

 

Â&#x2019;

RĂŠfĂŠrence FLAM104M80 (.#// (.#//

Format en m 1,040 50  Â&#x2020;  Â&#x2020;

D 185,12  

M2/HTD 3,56 Â&#x2020; Â&#x2020;

Q Film auto-adhĂŠsif et lisse pour application intĂŠrieure  ou extĂŠrieure

Q6TCKVoCPVK78FWTCDKNKVoGPGZVoTKGWTCPU

 

RĂŠfĂŠrence FLAM104S80 (.#/5 (.#/5

Format en m 1,040 50  Â&#x2020;  Â&#x2020;

M2/HTD 3,56 Â&#x2020; Â&#x2020;

D 185,12  

(KNO28%DTKNNCPV.(

(KNO28%OCV.(

Â&#x2019;

Q Film-adhĂŠsif calandrĂŠ et lisse, durabilitĂŠ 3 ans Q6TCKVGOGPVCPVK78RQWTRToUGTXGTNGUEQWNGWTU Q Facilite la pose des vinyles, protection mĂŠcanique Q4oUKUVCPEGCWZEQPFKVKQPUFKHÂąEKNGU 6Â&#x201A;RNWKGRQNNWVKQP

 

RĂŠfĂŠrence FF104100B (($ (($

Format en m 1,040 100  Â&#x2020;  Â&#x2020;

M2/HTD 4,83 Â&#x2020; Â&#x2020;

D 502,32  

(KNO28%UCVKPo.(

 

 

Format en m 1,040 100  Â&#x2020;  Â&#x2020;

RĂŠfĂŠrence FF104100M ((/ ((/ FF200050M

Format en m 1,040 100  Â&#x2020;  Â&#x2020; 2,000 50

D 502,32   620,00

M2/HTD 4,83 Â&#x2020; Â&#x2020; 6,20

Â&#x2019;

Q Film-adhĂŠsif calandrĂŠ et lisse, durabilitĂŠ 3 ans Q6TCKVGOGPVCPVK78RQWTRToUGTXGTNGUEQWNGWTU Q Facilite la pose des vinyles, protection mĂŠcanique Q4oUKUVCPEGCWZEQPFKVKQPUFKHÂąEKNGU 6Â&#x201A;RNWKGRQNNWVKQP RĂŠfĂŠrence FF104100S ((5 ((5

Â&#x2019;

Q Film-adhĂŠsif calandrĂŠ et lisse, durabilitĂŠ 3 ans Q6TCKVGOGPVCPVK78RQWTRToUGTXGTNGUEQWNGWTU Q Facilite la pose des vinyles, protection mĂŠcanique Q4oUKUVCPEGCWZEQPFKVKQPUFKHÂąEKNGU 6Â&#x201A;RNWKGRQNNWVKQP

D 502,32  

Papier perdu p 33 : iďŹ er seul des Contre papier permettant de plast de ďŹ lm sans ne visuels moins larges que la bobi infĂŠrieur du au roule le sur faire coller l'adhĂŠsif laminateur.

M2/HTD 4,83 Â&#x2020; Â&#x2020;

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

29


FILMS DE PLASTIFICATION A FROID

FILMS POLYMĂ&#x2C6;RES Q Film polymère stabilisĂŠ Q AdhĂŠsif acrylique permanent et transparent Q Applications extĂŠrieures longue durĂŠe Q IdĂŠal pour la dĂŠcoration de vĂŠhicules Q Surfaces planes et lĂŠgèrement courbes Q(KNVTGFGU78

 

M1 ClassĂŠ feu

Format en m 1,040 50

D 377,52

m HTD 7,26

.( .(

 

 

Â&#x2020; Â&#x2020;

RĂŠfĂŠrence  

Format en m



Â&#x2019;

Q Film stabilisÊ Q AdhÊsif acrylique permanent et transparent Q Applications extÊrieures longue durÊe Q IdÊal pour la dÊcoration de vÊhicules Q Surfaces planes et lÊgèrement courbes

M1 ClassĂŠ feu D

m /HTD 2

LF3998104

1,040

50

423,28

8,14

.( .(

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;

NOUVEAU

IFoCNRQWT XKP[NGRQN[OpTG&)2 RĂŠfĂŠrence Format en m D DGLAM137 1,37 50 305,51

2

(KNO28%OCV.(CPU

Â&#x2019;

Q Film polymère souple calandrÊ Q AdhÊsif acrylique permanent Q Applications extÊrieures longue durÊe Q Pour surfaces planes et courbes

/

RĂŠfĂŠrence LF3999104

Â&#x2020; Â&#x2020;

(KNO28%DTKNNCPVCPU

80Îź

(KNO28%DTKNNCPV.(CPU

&).#/



Â&#x2020;

m /HTD 4,46 2



Â&#x2020;

(KNO2QN[OpTGOQFK¹o.#)¤CPU

Â&#x2019;

Q Film satinĂŠ WNVTCEQPHQTOCDNGGVCPVKITCHÂąVK Q AdhĂŠsif transparent *KIJ6CEM Q Compatible avec les impressions solvant,  ĂŠEQUQNXCPVGV78 Q 2QWTUWTHCEGURNCPGUEQWTDGUQPFWNoGUTKXGVoGU& Q Combinaison idĂŠale avec Wallwrap100 (voir p8)

M1- ANTI GRAFFITI

RĂŠfĂŠrence LAG100137

Format en m 1,370 25

D 645,95

M /HTD 18,86 2

616#.%18'4+0)(+./57.64#%10(14/#$.'5 (KNO28%EQWNoDTKNNCPV.78CPU

(KNO28%EQWNoOCV.(CPU

Â&#x2019;

Q Film28%EQWNoWNVTCEQPHQTOCDNG Q Applications extĂŠrieures longue durĂŠe Q IdĂŠal pour JT 5529P -JT5529 MBF- JT5929P-JT5929 MBF

Q (KNO28%EQWNoVTpUEQPHQTOCDNGWNVTCVTCPURCTGPV Q Compatible avec les impressions solvant, ĂŠEQUQNXCPV.CVGZGV78

Q Protecteur polyester 36 Îź Q Convient parfaitement pour la protection des dĂŠcors en micro perforĂŠ JT278,62,62 RĂŠfĂŠrence Format en m D

RĂŠfĂŠrence LF3398137 m /HTD

.78











.78 

10

332,08

24,24

(KNO28%EQWNo.(¤CPU

Â&#x2019;

et ultra transparent Q AdhĂŠsif acrylique permanent transparent Q Compatible avec les impressions solvant, ĂŠco-solvant Q 2QWTUWTHCEGURNCPGUEQWTDGUQPFWNoGU TKXGVoGU& Q IdĂŠal avec JT5529P, JT5529PM et JT 5629PM RĂŠfĂŠrence Format en m D 50 10

1,370

M /HTD 2

D 50

1365,89

19,94

(KNO28%EQWNo.78¤CPU Q Film $TKNNCPVWNVTCEQPHQTOCDNG et ultra transparent Q AdhÊsif acrylique permanent transparent Q Compatible avec les impressions solvant,

Â&#x2019;

SPECIAL IMPRESSION UV

ĂŠEQUQNXCPV.CVGZGV78

QFilm $TKNNCPVWNVTCEQPHQTOCDNG

1,370 1,370

Format en m

2



LF3499137 LF349913710

Â&#x2019;

NOUVEAU 10 METRES

975,44 214,54

Q 2QWTUWTHCEGURNCPGUEQWTDGUQPFWNoGUTKXGVoGU& Q IdĂŠal avec JT5599P, JT5529P, JT5529PM, JT5529MBF et JT 5629PM 

RĂŠfĂŠrence .78

Format en m  

D 

M /HTD  2

(KNO28%EQPHQTOCDNG$TKNNCPV.78CPUÂ&#x2019; m /HTD 2

14,24 15,66

QFilm URoEKCNGOGPVEQORCVKDNGCXGENŠKORTGUUKQP78 Q AdhÊsif haute performance Q Pour surfaces planes, courbes, rivetÊes ou ondulÊes Q Compatible avec : JT5529P/PM, JT5629PM, JT 5529 MBF RÊfÊrence  

.78 .78

Format en m  

m /HTD 2

D  Â&#x2020;

 

 Â&#x2020;

SPECIAL IMPRESSION UV

30


2.#56+(+%#6+10Â&#x;(41+&2174+/24'55+1078)#//'.78 (KNO28%$TKNNCPV.78CPU

(KNO28%$TKNNCPV.78CPU

Â&#x2019;

Q Film PVC RQN[OpTG et lisse URoEKCNKORTGUUKQP78 Latex  ou solvant

Q #FJoUKH*CWVG2GTHQTOCPEG dotĂŠ dâ&#x20AC;&#x2122;un fort pouvoir ÂŤ mouillant Âť

qui ĂŠpouse toutes les irrĂŠgularitĂŠs de surface liĂŠes Ă la technique  FŠKORTGUUKQP78 QConvient pour des applications court Ă  moyen terme sur surface planes RĂŠfĂŠrence Format en m D M2/HTD  .78      .78  Â&#x2020;  Â&#x2020;  .78  Â&#x2020;  Â&#x2020;

 qui Êpouse toutes les irrÊgularitÊs de surface liÊes à la technique FŠKORTGUUKQP78 Q Convient parfaitement pour les surfaces planes ou convexes RÊfÊrence Format en m D M2/HTD  .78    

(KNO28%/CV.78CPU

Â&#x2019;

Q Film PVCOQPQOpTG etNKUUGURoEKCNKORTGUUKQP78 LCVGZQu solvant Q#FJoUKH*CWVG2GTHQTOCPEG dotĂŠ dâ&#x20AC;&#x2122;un fort pouvoir ÂŤ mouillant Âť

Â&#x2019;

Q Film PVC RQN[OpTG et lisse URoEKCNKORTGUUKQP78

(KNO28%/CV.78CPU

.CVGZ ou solvant Q #FJoUKH*CWVG2GTHQTOCPEG dotĂŠ dâ&#x20AC;&#x2122;un fort pouvoir ÂŤ mouillant Âť  qui ĂŠpouse toutes les irrĂŠgularitĂŠs de surface liĂŠes Ă la technique  dŠKORTGUUKQP78 Q Convient parfaitement pour les surfaces planes ou convexes RĂŠfĂŠrence Format en m D M /HTD  .78    

Â&#x2019;

QFilm PVC OQPQOpTG et lisse spĂŠcial impression UV, .CVGZ ou solvant

Q#FJoUKH*CWVG2GTHQTOCPEG dotĂŠ dâ&#x20AC;&#x2122;un fort pouvoir ÂŤ mouillant Âť qui ĂŠpouse toutes les irrĂŠgularitĂŠs de surface liĂŠes Ă la technique  FŠKORTGUUKQP78 QConvient pour des applications court Ă  moyen terme sur surface plane RĂŠfĂŠrence Format en m D M2/HTD  .78      .78  Â&#x2020;  Â&#x2020;  .78  Â&#x2020;  Â&#x2020;

2

(KNORQN[GUVGTCPVKITCHÂąVKToH.78 (KNOURoEKCNOKETQRGTHQToToH.78

)#//'2'4/#HWPÂ&#x;'(('6/#6+Âź4' (KNO28%5CVKPo$QKU4CKPWToCPU Q Q Q Q

Â&#x2019;

Film RQN[OpTGstructurĂŠ reproduisant lâ&#x20AC;&#x2122;aspect du bois rainurĂŠ AdhĂŠsif High Tack permanent Ă base solvant %NCUUGOGPVHGW/ 2QWTUWTHCEGURNCPGUQWNoIpTGOGPVEQWTDGU RĂŠfĂŠrence Format en m D FPF137BOISR 1,37 50 730,31

M2/HTD 10,66

(KNO28%5CVKPo$TQUUo5Q[GWZCPU

Â&#x2019;

QFilm RQN[OpTG structurĂŠ reproduisant lâ&#x20AC;&#x2122;aspect du mĂŠtal brossĂŠ, de lâ&#x20AC;&#x2122;aluminium

QAdhÊsif High Tack permanent à base solvant Q%NCUUGOGPVHGW/ QPour surfaces planes ou lÊgèrement courbes RÊfÊrence FPF137BROS

(KNO28%5CVKPo%CTDQPGOQKU

Format en m 1,370

M /HTD 2

D 50

730,21

10,66

Â&#x2019;

Q(KNOOQPQOpTGUVTWEVWToTGRTQFWKUCPVNŠCURGEV¹DTGFGECTDQPG Q AdhÊsif High Tack permanent à base solvant Q %NCUUGOGPVHGW/ Q 2QWTUWTHCEGURNCPGUQWNoIpTGOGPVEQWTDGU RÊfÊrence FPF137CARB

Format en m 1,37 50

D 2093,36

(KNO28%OCV2GCWFGRqEJG

M2/HTD 30,56

#URGEV #NWDTQUUo

Â&#x2019;

QFilmRQN[OpTG structurĂŠ aspect peau de pĂŞche QAdhĂŠsif *KIJ6CEM permanent Ă base solvant Q%NCUUGOGPVHGW/1 Q%QORCVKDNGCXGENGUKORTGUUKQPUUQNXCPVoEQUQNXCPVGV78 Q2QWTUWTHCEGURNCPGUQWNoIpTGOGPVEQWTDGU RĂŠfĂŠrence FPF137PDP

Format en m 1,370 25

D 713,08

28%$TKNNCPV%T[UVCN)NQUUCPU Q Film RQN[OpTG coulĂŠ avec effets scintillants et pailletĂŠs Q AdhĂŠsif *CWVGRGTHQTOCPEG permanent Ă base solvant Q %NCUUGOGPVHGW/ Q 2QWTUWTHCEGURNCPGUQWVTpUNoIpTGOGPVEQWTDGU

M2/HTD 21,44

RĂŠfĂŠrence FPF137PAIL

ropre fond en Pour crĂŠer votre plterforge.com "seamless" : ďŹ

T ĂŠ l

Â&#x2019;

:

0 2

9 9

Format en m 1,370

5 5

D 25

1 7

727,12

1 9

M /HTD 2

21,23

31


FILMS DE PLASTIFICATION A FROID

#06+)4#((+6+ (KNO2QN[GUVGTWNVTCDTKNNCPV2) Q Film auto-adhĂŠsif de surface lisse et ultra transparent Q AdhĂŠsif acrylique solvant ultra transparent Q6TCKVoCPVK78CPVKITCHÂąVK Q DurabilitĂŠ 3 ans RĂŠfĂŠrence

Format en m

M1 2

PET3610450

1,040

50

304,72

5,86

2'6



Â&#x2020;



Â&#x2020;



2'6



Â&#x2020;



Â&#x2020;



2'6  Â&#x2020;  Â&#x2020; Q &KURQPKDNGRQWTKORTKOCPVGU784oH.78iÂŽO2

(KNO2QN[GUVGTWNVTCDTKNNCPV2)241

Â&#x2019;

Q Film auto-adhĂŠsif ultra transparent de surface lisse Q AdhĂŠsif acrylique solvant ultra transparent Q#PVKITCHÂąVK Q &WTCDKNKVoCPU

NOUVELLE DURABILITE



Format en m

D

 

RĂŠfĂŠrence PET7510450

Format en m 1,040 50

D 393,64

M /HTD 7,57

2'6 2'6

 

 

Â&#x2020; Â&#x2020;

1,300

50

856,05

13,17



Â&#x2020;



Â&#x2020;

Â&#x2019;

Q Film auto-adhĂŠsif de surface lisse et ultra transparent Q AdhĂŠsif acrylique super transparent permanent Q 6TCKVoCPVK78CPVKITCHÂąVK Q DurabilitĂŠ 3 ans RĂŠfĂŠrence PET17513050

Format en m 1,300

M /HTD 2

D 50

751,90

11,66

yant o t t e n Gel rafďŹ ti anti-g Page 54

2

2'6241

Â&#x2020; Â&#x2020;

2

(KNO2QN[GUVGTWNVTCDTKNNCPV2)

M /HTD

PET36PRO130

Â&#x2019;

Q Film auto-adhĂŠsif de surface lisse et ultra transparent Q AdhĂŠsif acrylique solvant ultra transparent Q6TCKVoCPVK78CPVKITCHÂąVK Q DurabilitĂŠ 3 ans

M /HTD

D



RĂŠfĂŠrence

(KNO2QN[GUVGTWNVTCDTKNNCPV2)

Â&#x2019;

'((#c#$.'Â&#x;5'% (KNOGHHCnCDNGiUGEDTKNNCPV2)

Â&#x2019;

Q Film polypropylène auto-adhÊsif de surface brillante et lisse Q Effaçable à sec avec marqueurs appropriÊs Q 7VKNKUCVKQPGPKPVoTKGWT RÊfÊrence OPP3010450 122 122

 

Format en m 1,040 50  Â&#x2020;  Â&#x2020;

D 247,00  

M /HTD 4,75 Â&#x2020; Â&#x2020; 2

52'%+#.51.56#0&52#4#2.7+' (KNO28%ITCKPoOCV

Â&#x2019;

Q Film PVC grainĂŠ 125Îź Q7VKNKUCVKQPGPKPVoTKGWT Q IdĂŠal pour stand parapluie RĂŠfĂŠrence

Format en m

D

M /HTD 2









 (.#/%



Â&#x2020;



Â&#x2020;

 (.#/%  (.#/%

 

Â&#x2020; Â&#x2020;

 

Â&#x2020; Â&#x2020;

(KNO28%RGTNo'/$1

Â&#x2019;

SPECIAL PHOTOGRAPHIE

Q Film PVC perlĂŠ 80Îź Q 6TCKVoCPVK78 Q AdhĂŠsif acrylique solvant

32

Â&#x2019;

jusquâ&#x20AC;&#x2122;Ă 6 mois

 (.#/%

 

(KNO28%ITCKPoOCV2( QSurface texturĂŠe anti-dĂŠrapante, durabilitĂŠ

RĂŠfĂŠrence EMBO 065050

Format en m 0,650 50

D 180,05

'/$1 '/$1

 

 

Â&#x2020; Â&#x2020;

M /HTD 5,54 2

Â&#x2020; Â&#x2020;

QAdhĂŠsif acrylique permanent Q 5RoEKCNÂ&#x203A;²QQTITCRJKEÂ&#x153;GVUWTHCEGUEQWTDGUFGUVCPF Q TestĂŠ selon la norme #56/& RĂŠfĂŠrence Format en m D M /HTD FGR104050 1,040 50 444,60 8,55  ()4  Â&#x2020;  Â&#x2020; Q &KURQPKDKNKVoCXGEFWTCDKNKVoOQKUToH(2(iÂŽO2 2

(KNO2QN[RTQR[NpPGITCKPoOCV2( QEco-conçu, sans PVC QSurface texturÊe anti-dÊrapante, durabilitÊ

de 1 mois au sol et 9 mois en vertical QAdhĂŠsif acrylique transparent QSpĂŠcial ÂŤ Floor graphic Âť Q6GUVoUGNQPNCPQTOG#56/% RĂŠfĂŠrence

Format en m

FGRP104050

1,040

 ()42



Â&#x2019;

GREEN

D

M /HTD

50

277,16

5,33

Â&#x2020;



Â&#x2020;

2


(+./5&17$.'(#%'2174/106#)').#55/18+' #FJoUKHFQWDNGHCEG7PKXGTUGN22 

#FJoUKHFQWDNGHCEG126+37'

Â&#x2019;

Q Film polyester 12 microns enduit de chaque cĂ´tĂŠ dâ&#x20AC;&#x2122;un adhĂŠsif acrylique solvant destinĂŠ au montage

Q 7VKNKUCVKQPKPVoTKGWTGGVGZVoTKGWTG Q Permet de repositionner la plupart des supports dâ&#x20AC;&#x2122;impression Q DurabilitĂŠ 10 ans intĂŠrieur, 5 ans extĂŠrieur RĂŠfĂŠrence

Format en m

RĂŠfĂŠrence

M2/HTD

D

FDF104100

1,040

100

590,72

5,68

 

(&( (&(

 

 

 

Â&#x2020; Â&#x2020;

 

(&( (&( FDF200050

  2,000

Â&#x2020; Â&#x2020; 50

  1062,00

Â&#x2020; Â&#x2020; 10,62

#FJoUKHFQWDNGHCEG'EQ22

FDF104100E  (&('  (&('  (&('

1,040   

100 Â&#x2020; Â&#x2020; Â&#x2020;

M2/HTD

D

FLAM1040OPT

1,040

50

355,16

6,83

 (.#/126



Â&#x2020;



Â&#x2020;

#FJoUKHFQWDNGHCEGQRVKSWG26

RĂŠfĂŠrence

Â&#x2019; 

Format en m

M2/HTD

D

PT2113130

1,300

50

857,35

14,41

26



Â&#x2020;



Â&#x2020;

2CRKGTRGTFW 436,80   

I

Q %QPVTGRCRKGTUGRQUKVKQPPCPVCWFQUFWFQEWOGPViRNCUVKÂąGT

M2/HTD

D

Â&#x2019;

supports en verre ou verre acrylique

 acrylique ĂŠmulsion destinĂŠ au montage Q 7VKNKUCVKQPKPVoTKGWTGWPKSWGOGPV Q DurabilitĂŠ 2 ans extĂŠrieur, 5 ans intĂŠrieur Format en m

Format en m

Q Film de montage ultra transparent Q AdhÊsif acrylique solvant permanent Q Porteur polyester 36Ο de grande transparence Q 7VKNKUCVKQPRQWTOQPVCIGFGRJQVQUQWFŠKOCIGUJCWVGSWCNKVoUWTFGU

Q Film polyester 12 microns enduit de chaque cĂ´tĂŠ dâ&#x20AC;&#x2122;un adhĂŠsif

RĂŠfĂŠrence

Â&#x2019;

Q Film de montage ultra transparent - Porteur polyester 25Ο Q AdhÊsif acrylique solvant Q 7VKNKUCVKQPRQWTOQPVCIGFGRJQVQUQWFŠKOCIGUJCWVGSWCNKVo

FCPUNGECUFŠWPGRNCUVK¹ECVKQPUKORNGHCEG

4,20 Â&#x2020; Â&#x2020; Â&#x2020;

Q 'XKVGSWGNG¹NOCFJoUKHPGEQNNGUWTNGTQWNGCWKPHoTKGWTNQTUSWŠKN est plus large que le visuel. Permet de travailler seul sans perte

 

Montage du double face

RĂŠfĂŠrence

Format en m

PAP107100 2#2 2#2

1,070  

100 Â&#x2020; Â&#x2020;

D

M2/HTD

67,41  

0,63* Â&#x2020; Â&#x2020;

 â&#x201A;ŹO2UKXGPFWCXGEFWÂąNOFGRNCUVKÂąECVKQP

â&#x201A;ŹO2UKXGPFWUGWN

1,'%6+10 4 2 1 4 6 d 4 4 7 1 2 .'(+./ 8+64+0' 37+#0+/'8164' Â&#x2019;

)NCUU/QXKG



RĂŠfĂŠrence GLASSMOV ).#55/18

%QOOGPV HQPEVKQPPG NG)NCUU/QXKG

Format en m 5 1,23   

D 845,62 

VTQRTQLGEVKQP est un ÂąNOFGTo sur les matĂŠMACtac GlassMovie ou res lique sur les vit CFJoUKH qui sâ&#x20AC;&#x2122;app s transparents. riaux synthĂŠtique FG NŠKOCIG et WVG ToUQNWVKQP JC e un et KPVoTKGWTQW Il perm en n tio communica sâ&#x20AC;&#x2122;utilise pour une GZVoTKGWT

M2/HTD 137,50 Â&#x2020;

CLQWVoG

GGUVWPGXCNGWT

CI 2CTVQWVQWNŠKO

parcs ires, parfumeries, ges, concessionna ya vo de s 'PGZVoTKGWT ce en ag rines de magasins, Animation des vit â&#x20AC;Ś gasins de jouet etc ma , ns dâ&#x20AC;&#x2122;attractio rĂŠe, show-rooms, salons, halls dâ&#x20AC;&#x2122;ent x, iau erc mm co 'PKPVoTKGWT centres ence immobilière, EvĂŠnementiel, ag de congrĂŠsâ&#x20AC;Ś res nt ce s, ort rop musĂŠes, gares, aĂŠ

KG

#%VCE)NCUU/QX

/ .GUCXCPVCIGUFG

e astĂŠes et une imag QDes couleurs contr n. haute rĂŠsolutio QKP FGRTpUEQOOGFGN Q7PGKOCIGXKUKDNG Â&#x201A;  G GF Q7PCPINGFGXW QWTEQOOGFGPWKV Q7PGXKUKDKNKVoFGL s: cran sont possible s QToutes les taille dâ&#x20AC;&#x2122;ĂŠ ge lar tra ex n cra lâ&#x20AC;&#x2122;ĂŠ Ă du logo de sociĂŠtĂŠ

T ĂŠ l

:

0 2

9 9

5 5

OUG

UQPVRQUUKDNGUNGÂąN

Q6QWVGUNGUHQTOGU ment sans plotter dÊcoupe très facile

FG XGENGU¹NOUEQNQToU O  OCTSWCIG/#%  EKNGOGPVSWŠWP¹NO Q5ŠCRRNKSWGCWUUKHC aucoup moins cher que be ard nd adhÊsif sta its concurrents la plupart des produ

Q2GWVUGEQODKPGTCCTMQWFGUÂąNOUKORTKOoU

1 7

1 9

33


#&*d5+(5&'/#437#)''6#22.+%#6+106#2'

.#)#//'/#%/#4- est conçue pour assurer une dÊcoupe par Plotter et un Êchenillage facile et rapide

5oTKG/#%#.RTQ2QN[OpTGCPU#FJoUKH2GTOCPGPV

EQWNGWTUÂ&#x2019;

Q Applications de marquage haute performance - Long terme - Surfaces planes et courbes Q Classement feu M1 Couleur

Finition

Blanc / Noir

Format bobine

Brillant / Mat

1.23 x 50ml

 %QWNGWT $TKNNCPV Â&#x2020;   Largeurs de 1,00 et 1,52m disponibles dans certaines couleurs. Nous consulter

M2/HTD 7.80 

5oTKG/#%#.RTQ/QPQOpTGCPU#FJoUKH'PNGXCDNG Q Applications de marquage haute performance - Moyen terme - Surfaces planes Q Classement feu M1 Couleur Blanc / Noir

Finition Brillant / Mat

Format bobine 1.23 x 50ml

M2/HTD 4.92

EQWNGWTUÂ&#x2019;

NOUVELLES COULEURS TENDANCE

 %QWNGWT $TKNNCPV/CV Â&#x2020;   EQWNGWTU /CV2TQ&GUKIPGT Â&#x2020;  Largeurs de 1,00 et 1,52 m en noir et blanc disponibles dans certaines couleurs. Nous consulter

5oTKG/#%#.RTQ/QPQOpTGCPU#FJoUKH2GTOCPGPV

EQWNGWTUÂ&#x2019;

Q Applications de marquage - Moyen terme - Surfaces planes Q Classement feu M1 Couleur Finition Format bobine Blanc / Noir Brillant / Mat 1.23 x 50ml  %QWNGWT $TKNNCPV/CV Â&#x2020; Largeur de 1,52m disponible dans certaines couleurs. Nous consulter

M2/HTD 4.32 

5oTKG/#%#.RTQ/QPQOpTGCPU#FJoUKH2GTOCPGPV Q Applications de marquage - Court terme - Surfaces planes Q Classement feu M1 Couleur Blanc / Noir %QWNGWT



Finition Brillant / Mat $TKNNCPV/CV

Format bobine 1.23 x 50ml Â&#x2020;

M2/HTD 3.45 

#22.+%#6+106#2' #RRNKECVKQP6CRG#6

Â&#x2019;

Q Papier transfert imprĂŠgnĂŠ au latex de 85g / m Q #FJoUKHGPNGXCDNGiVCEMoNGXoRQWTNGVTCPUHGTVFGRGVKVUECTCEVpTGU Q IdĂŠal pour des applications mouillĂŠes Q La transparence du papier permet de distinguer facilement les 2

formes et les lettrages RĂŠfĂŠrence Format en m 

D

M /HTD 2

MT210100

1,000

100

127,00

1,27

/6



Â&#x2020;



Â&#x2020;

#RRNKECVKQP6CRG#6

Â&#x2019;

Q Film polyÊthylène transparent Q #FJoUKHVTCPURCTGPVGPNGXCDNGiVCEMHCKDNG Q.CVTCPURCTGPEGFW¹NORGTOGVFGXKUWCNKUGTNGUEQWNGWTUGVNGU formes des lettrages RÊfÊrence Format en m MT400100

1.00 x 100 ml

D 127,00

M /HTD 2

1,27

#RRNKECVKQP6CRG#6

Â&#x2019;

Q Film polyÊthylène transparent de 105g / m Q #FJoUKHVTCPURCTGPVGPNGXCDNGiVCEMOQ[GP Q .CVTCPURCTGPEGFW¹NORGTOGVFGXKUWCNKUGTNGUEQWNGWTUGVNGU 2

formes des lettrages RĂŠfĂŠrence Format en m 

34

MT500100 /6

1,000 

100 Â&#x2020;

D 165,00 

M /HTD 2

1,65 Â&#x2020;

Coupe sur demande

EQWNGWTUÂ&#x2019;


#&*d5+(5&'/#437#)' /KTQKTUCPUVCKPCTIGPV

(KNOURQWTRQEJQKTU.QPIWGWTON

Â&#x2019;

Q Polyester adhĂŠsif, durabilitĂŠ 8 Ă 10 ans Q Permet de voir sans ĂŞtre vu Q Application Ă  lâ&#x20AC;&#x2122;extĂŠrieur, pose Ă  lâ&#x20AC;&#x2122;eau savonneuse Q Classement au Feu M1 RĂŠfĂŠrence

Format en m

MIR500X1522

1,52

MIR500X15210 MIR500X15230

Â&#x2019;

QSâ&#x20AC;&#x2122;enlèvent facilement sans transfert dâ&#x20AC;&#x2122;adhĂŠsif jusquâ&#x20AC;&#x2122;Ă 4 heures

NOUVEAU D

M /HTD

2,5

123,04

32,38

1,52

10

229,06

15,07

1,52

30

598,27

13,12

après lâ&#x20AC;&#x2122;application

QITKUVTCPURCTGPVRQWTDjEJGU6TpUToUKUVCPVCWZRNCUVK±CPVU Q 28.180 Blanc mat pour carrosseries, très résistant aux solvants Référence

Largeurs

M2/HTD

84.817 28.180

1.00 - 1.23 - 1.52 1.524

5.25 4.79

2

Q 'ICNGOGPVFKURQPKDNGRQWTWPGRQUGiNŠKPVoTKGWT

8KP[NGVTCPURCTGPVEQNQTo5oTKG/#%ET[UVCN

Â&#x2019;

Q1.23 x 25 ml QPVC monomère transparent à coloration uniforme Q AdhÊsif permanent transparent à base solvant QApplications moyen terme pour UWTHCEGURNCPGUUWTXKVTGUGV  OCVoTKCWZQRCNKPU Couleur Finition 17 couleurs

DurabilitĂŠ/an

Brillant

M2/HTD

3

7,49

8KP[NGVTCPUNWEKFG5oTKG/#%#.RTQZO

Â&#x2019;

QPVC RQN[OpTG translucide quand ĂŠclairĂŠ et opaque quand non ĂŠclairĂŠ

QAdhĂŠsif RGTOCPGPV transparent Ă base solvant QApplications long terme pour UWTHCEGURNCPGUV[RG



ECKUUQPUNWOKPGWZ GVXKVTKPGU Couleur

Finition

DurabilitĂŠ /an

M2/HT

MACAL 9700 Blanc / Noir / 29 couleurs Mat 7 et 5 ans pour la couleur 12,20 MACAL 9798 Light Diffuseur 30 et 60% Mat

5 ans pour la couleur

12,54

MACAL 9722 Light Stop 140Îź

7 ans pour la couleur

15,11

Mat

8KP[NGFoRQNK5oTKG/#%#.)NCUU&GEQTZ ON 8KP[NG²WQTGUEGPV/#%#.ZON

Â&#x2019;

QPVC OQPQOpTGUQWRNG²WQTGUEGPVUQWUVQWVV[RGFGNWOKpTG QAdhÊsif UGOKRGTOCPGPV blanc à base solvant QApplications court terme UWTUWTHCEGURNCPGU Couleur

Finition

5 couleurs

Satin

DurabilitĂŠ/an

M2/HTD

3/6 mois

8KP[NGToVTQTo²oEJKUUCPV/#%.+6'

QPVC RQN[OpTG translucide aspect verre dĂŠpoli, gravĂŠ QAdhĂŠsif RGTOCPGPV transparent Ă base solvant QApplications long terme pour surfaces planes sur XKVTGUQWRQWT GHHGVCPVKXWG

Q%NCUUGOGPVHGW/

15,05

Couleur  &oRQNKÂąPKVKQPUCDNo  

Â&#x2019;

 &oRQNKÂąPKVKQPRCKNNGVo  

Q /#%.+6' : Polymère long terme 7 ans pour surfaces courbes Q Blanc : 45 ml â&#x20AC;&#x201C; Noir 20 ml â&#x20AC;&#x201C; Couleur : 45 ml Q /#%.+6': Monomère moyen terme 5 ans pour surfaces planes Q Blanc et Couleur : 45,7 ml Couleur

Finition

Largeur

M2/HTD

5700 Blanc / Noir / Couleur 4700 Blanc / Noir / Couleur

Brillant Brillant

1,22 1,22

35.85 26,60

: T ĂŠ0 l 2

Finition /CV

DurabilitĂŠ /an 

M2/HT 

/CV





Mat

5

14,97

DĂŠpoli 5 couleurs

(KNORJQURJQTGUEGPV/#%RJQURJQZON

Â&#x2019;

Q Vinyle de haute intensitĂŠ sans cadmium et non radioactif QAdhĂŠsif RGTOCPGPV QSignalisation, issues de secours, sĂŠcuritĂŠ sur UWTHCEGURNCPGUGPKPVo TKGWT Couleur Jaune vert

T ĂŠ l

Â&#x2019;

Finition Mat

: 9 90 2 5 59 9 1 7 5 5 1 9 1 7

DurabilitĂŠ/an 5

1 9

M2/HTD 56,53

35


#&*d5+(5&'/#437#)'5

6WPKPI(KNOU $NCPEOCV0QKTOCV

%CTDQP$(EQWNGWTU

CPU

Q PVC polymère embossĂŠ sans cadmium - 175Îź Q AdhĂŠsif permanent renforcĂŠ micro-structurĂŠ Q Pose facile, rapide et sans bulle grâce Ă

Q PVC polymère calandrÊ sans cadmium - 100Ο Q AdhÊsif à faible tack et repositionnable pour une pose facile Q Hautement conformable et totalement opaque Q Pour surface planes, courbes et convexes RÊfÊrence

Format en m



670(+.$0







670(+.$0

Â&#x2020;



D

M /HTD





18,35





Â&#x2020;

la technologie Bubble Free

Q Pour surfaces planes ou courbes Q Face embossĂŠe donnant un aspect carbone Q Noir, Graphite, Blanc, Argent, Or

2

/oVCN$TQUUoCURGEVU

CPU

RĂŠfĂŠrence

Â&#x2019;

Format en m

D

M /HTD 2

 670(+./% PQKT 









 670(+./%









Q Vinyle polymère brossÊ au toucher soyeux qui accroche la lumière Q AdhÊsif permanent renforcÊ et micro-structurÊ Bubble Free pour une pose facile, rapide et sans bulles

Q Pour surfaces planes, courbes, convexes, concaves DurabilitĂŠ extĂŠrieure : 5 ans ( Noir, Titane, Graphite ), 4 ans (acier ) et 2,5 ans ( aluminium ) Couleur Finition Largeur M2/HTD 

670($$(







'HHGVOCVKpTGCURGEVU

CPU

Q Vinyle polymère coulÊ et structurÊ - 220Ο Q AdhÊsif solvant repositionnable pour une pose facile Q Hautement conformable et totalement opaque Q Pour surface planes, courbes et convexes Q 2 aspects : cuir noir haut de gamme et argent martelÊ Q Personnalisation de vÊhicules et dÊcoration intÊrieure RÊfÊrence

Format en m

670(+./%0 EWKT 



670(+./#/ CTIGPV  

+TKFGUEGPV

CPU

Q Vinyle polymère coulÊ hautement conformable et totalement opaque

D

M /HTD













Q AdhĂŠsif solvant repositionnable pour une pose facile Q La couleur change en fonction de lâ&#x20AC;&#x2122;angle de vue Q2GCTNPCEToCXGEFGNoIGTUTG²GVUXGTVUÂ&#x2019;$NGWXGTVÂ&#x2019;

2

et Fushia/vert RĂŠfĂŠrence 

57$.+/'2QN[OpTGEQWNGWTU

CURGEVU

670(+./2'

Format en m 





D

M /HTD





2

CPU

Q 85 Îź - AdhĂŠsif Permanent - Longueur : 25 ml Q Applications de marquage haute performance - Long terme Surfaces planes et courbes, convexes, concaves ou embouties

NOUVEAU

Q Pose facile, rapide et sans bulles grâce Ă lâ&#x20AC;&#x2122;adhĂŠsif repositionnable Bubble Free Couleur Finition Blanc / Noir Brillant / Mat Couleur Brillant / Mat

Largeur 1,524 1,524

M2/HTD 18,30 18,30

N Dâ&#x20AC;&#x2122;APPLICApliTquIO ectedir er MĂ&#x2030;THODEèrem ap ent courbes :

nes et lĂŠg Q Surfaces pla oVJQFGiUGE  NO FoECRGWT OGPVNGÂą  O NOiNŠCKFGFŠWP UEJCWHHGTNGÂą ZG XG QP UE EG Q5WTHC uer. ant de lâ&#x20AC;&#x2122;appliq RRNKthermique av WGNGÂąNOGUVC DQWVKGUNQTUS O WG UQ XG EC ent du m lle co dĂŠ Q5WTHCEGUEQP un embouti, la surface dâ&#x20AC;&#x2122;un tard. Il est par quĂŠ sur toute semaines plus s ue elq qu ir en et rv su ut pe upe au cutter vinyle faire une dĂŠco commandĂŠ de consĂŠquent re PUVGPUKQP WKVGNGÂąNOUC UŠGPNpXGVTpU FŠCRRNKSWGTGPU NG6WPKPI(KNO HHo CW EJ KU HQ PG 7 o KNKV peuvent ĂŞtre Q'PNGXCD us dâ&#x20AC;&#x2122;adhĂŠsifs ĂŠventuels rĂŠsid s Le t. en decol.05). em facil graissant (MAC dâ&#x20AC;&#x2122;un produit dĂŠ ĂŠliminĂŠs Ă lâ&#x20AC;&#x2122;aide

36


LEJ - 640

mpression p o-Solvan

XR - 640

VS - 640

Imprimantes Grand format, Rip, Presses à chaud, Plotters de découpe

mpression

UV

Flex - Flock

Rip d’impression

Impression

Presse à chaud

Q Imprimantes Eco-solvant Roland

®

............

®

Q Imprimantes UV Roland

...................................

P 38 P 40

Q Presses à chaud, Flex, Flock ............................. P 43 Q Plotters de découpe GRAPHTEC................ P 44

Découpe

37 T é l

:

0 2

9 9

5 5

1 7

1 9


IMPRIMANTES

IMPRESSION ET DÉCOUPE ROLAND® ÉCO-SOLVANT

Roland VersaCAMM VS-300/420/540/640 Q Largeurs d’impression et découpe : VS-300 : 762 mm VS-420 : 1046 mm VS-540 : 1340 mm VS-640 : 1600 mm Q 4 combinaisons d’encre possible : O 4 couleurs : 2 cyan, 2 magenta, 2 jaune, 2 noir O 6 couleurs : 2 cyan, 2 magenta, 1 jaune, 1 noir, 1 light cyan, 1 light magenta O 8 couleurs : 1 cyan, 1 magenta, 1 jaune, 1 noir, 1 light cyan, 1 light magenta, 1 blanc et 1 métallique O 7 couleurs : 1 cyan, 1 magenta, 1 jaune, 1 noir, 1 light cyan, 1 light magenta et 2 blanc 220ml QCartouches de 440 et 220 ml QRésolution d’impression : 1440 x 1440 dpi QVitesse d’impression maximum de 23,1 m2 sur bâche à 13,1 m2 /h sur vinyle Q Fonctionne avec le mode RIPC ( Roland Intelligent Pass Control ) pour diminuer l’effet de banding et augmenter la vitesse d’impression QRip logiciel Versa Works en français avec mises à jour automatiques QNouvelle tête d’impression avec 7 tailles de gouttes et un nouveau revêtement répulsif à l’encre pour éviter que les buses d’impression ne se bouchent QOptions : O O

Ré-enrouleur de documents Sécheur avec ventilateur

Roland VersaCamm SP-300i et SP540i Q Largeurs d’impression et découpe SP 300i : 762 mm SP 540i : 1346 mm Q Résolution maximum : 1440 x 1440 dpi Q Nombre de couleurs : 4 sur 2 têtes Q Cartouches : 4 x 220 ou 4 x 440ml Q Vitesse d’impression maxi : SP300i : jusqu’à 5,7 m²/h SP540i : jusqu’à 6,7 m²/h Q RIP Roland Versaworks en français QOption : Ré-enrouleur de document ®

Roland VersaSTUDIO BN-20 Q Largeur d’impression et découpe : 480 mm Q 5 couleurs avec des cartouches de 220 ml :  1 cyan, 1 magenta, 1 jaune, 1 noir + 1 métallique ou 2 magenta Q+NGUVRQUUKDNGFGEJQKUKTWPGEQP±IWTCVKQPUCPUGPETG métallique, dans ce cas le magenta est doublé Q Modèle de table ( pied en option à 180 € HT ) Q Largeur du rouleau ou de la feuille chargeable : de 150 à 515 mm Q Diamètre maxi du rouleau : 150 mm, poids maxi de 6 kg Q Connexion USB 2.0 Q Vitesse de découpe de 10 à 150 mm/s Q Epaisseur maxi du support : 1 mm Q RIP Roland VersaWorks en français Q Logiciel de création graphique Rolands R-Works en français Q Option : Stand

38

DISPONIBLE AVEC ENCRE BLANCHE ET METAL


IMPRIMANTE ET DECOUPE ROLAND® ECO-SOLVANT

NOUVEAU

Roland SOLJET PRO4 XR-640 QLargeurs d’impression et découpe : 1600 mm Q4 combinaisons d’encre possible : 7 couleurs : Cyan, Magenta, Jaune, Noir, Light cyan, Light magenta et Noir léger 8 couleurs : Cyan, Magenta, Jaune, Noir, Light cyan, Light magenta, Noir léger et Métallique 8 couleurs : Cyan, Magenta, Jaune, Noir, Light cyan, Light magenta, Noir léger et Blanc 8 couleurs : Cyan, Magenta, Jaune, Noir, Light cyan, Light magenta, Métallique et Blanc

QCartouches de 440 et 220 ml de la nouvelle encre ECO-SOL MAX3 sans nickel et sans odeur QRésolution d’impression : 1440 x 1440 dpi QVitesse d’impression maximum de 28 m2 en haute vitesse à 15 m2 /h en standard QRip logiciel VersaWorks en français avec mises à jour automatiques QNouvelle double tête d’impression « Gold Plated » en disposition miroir QVitesse de découpe de 10 à 600 mm/sec. QRé-enrouleur de document 40 kg de série QOption : Sécheur avec ventilateur

IMPRIMANTE ROLAND ECO-SOLVANT

Roland VersaArt RE-640 La VersaArt RE-640 est le mélange de tout ce que Roland a développé en trente années d’expérience. Une facilité d’utilisation unique, pour être instantanément productif, ainsi qu’une qualité d’impression extraordinaire, pour offrir à la clientèle un résultat de très haut niveau. QLargeur d’impression : 1600 mm Q4 couleurs : 2 cyan, 2 magenta, 2 jaune, 2 noir

T é l

:

QCartouches de 440 ou 220 ml QRésolution d’impression : 1440 x 1440 dpi QVitesse d’impression maximum de 23,1 m2 /h QFonction avec le mode RIPC ( Roland Intelligent Pass Control ) pour diminuer l’effet de banding et augmenter la vitesse d’impression QRip logiciel VersaWorks 4.8 en français avec mises à jour automatiques QOption : Ré-enrouleur de documents

0 2

9 9

5 5

1 7

1 9

39


IMPRIMANTES

IMPRESSION FLATBED AVEC ENCRES UV

ROLAND Versa UV LEJ-640 Pour lâ&#x20AC;&#x2122;impression des supports souples ou rigides jusquâ&#x20AC;&#x2122;Ă 13 mm dâ&#x20AC;&#x2122;ĂŠpaisseur QLaizes dâ&#x20AC;&#x2122;impression :  Â&#x2020;FGiOORQWTNGUUWRRQTVUTKIKFGU  Â&#x2020;FGiOORQWTNGUUWRRQTVUUQWRNGUGPDQDKPG Q 6 tĂŞtes dâ&#x20AC;&#x2122;impresssion Q6 couleurs avec cartouches de 220 ml Q3 combinaisons dâ&#x20AC;&#x2122;encre possible : Â&#x2020;Cyan, Magenta, Jaune, Noir + Vernis + Blanc Â&#x2020;Cyan, Magenta, Jaune, Noir + 2 Vernis pour obtenir des effets de gaufrage, embossing en mat ou brillant Â&#x2020;Cyan, Magenta, Jaune, Noir + 2 blanc pour obtenir une haut couverture en blanc 2QUUKDKNKVoFŠWVKNKUGTNŠGPETG²GZKDNG'%1785GZVGPUKDNGi en C, M, Y, BK, WH, WH

QPlateaux amovibles avant et arrière pour passer du rigide au souple inclus Q Calandre de sortie pour maintenir le support rigide après les tĂŞtes dâ&#x20AC;&#x2122;impression inclus Q Capteur pour dĂŠtecter la hauteur du support Q Guide dâ&#x20AC;&#x2122;alignement pour le chargement du panneau Q 18 galets dâ&#x20AC;&#x2122;entraĂŽnement pour un avancement rĂŠgulier de la matière Q RIP logiciel VersaWorks avec bibliothèque de textures inclus Q Lampes UV basse consommation longue durĂŠe ( garantie 3 ans ou 10000 heures ) Q Fonction RIPC ( Roland Intelligent Pass Control ) pour diminuer lâ&#x20AC;&#x2122;effet de banding et augmenter la vitesse dâ&#x20AC;&#x2122;impression QPorte rouleau et rĂŠ-enrouleur de capacitĂŠ de 40 kg inclus

IMPRESSION UV SUR OBJETS ET PERSONNALISATION ROLAND Versa UV LEF-12 Pour lâ&#x20AC;&#x2122;impression des supports rigides jusquâ&#x20AC;&#x2122;Ă 100 mm dâ&#x20AC;&#x2122;ĂŠpaisseur QAire imprimable de 305 x 280 mm Q6 couleurs en 220 ml : 1 cyan, 1 magenta, 1 jaune, 1 noir + 1 blanc et 1 vernis transparent Q2GTOGVFŠKORTKOGTGPXGTPKUUoNGEVKHCXGEÂąPKVKQPOCVGQWDTKNNCPVG QLampe UV basse consommation longue durĂŠe garanties 3 ans ou 10000 heures QCapot frontal pour protĂŠger lâ&#x20AC;&#x2122;utilisateur des rayonnements UV QRĂŠsolution dâ&#x20AC;&#x2122;impression : 1440 dpi max QInterface Ethernet 10/100 QRIP logiciel VersaWorks avec bibliothèque de textures inclus

40


IMPRESSION FLATBED AVEC ENCRES UV

NOUVEAU

ROLAND VersaUV

LEJ-640 F

Pour lâ&#x20AC;&#x2122;impression des supports rigides jusquâ&#x20AC;&#x2122;Ă 150 mm dâ&#x20AC;&#x2122;ĂŠpaisseur Lâ&#x20AC;&#x2122;outil idĂŠal pour imprimer un panneau ou une sĂŠrie dâ&#x20AC;&#x2122;objets 5WTHCEGFŠKORTGUUKQP.CTIGWTOOZ.QPIWGWTOO Q6 tĂŞtes dâ&#x20AC;&#x2122;impression piezo haute rĂŠsolution de 1440 dpi Q6 couleurs : Cyan, Magenta, Jaune, Noir, Vernis et Blanc QCartouches de 220 ml Q3 combinaisons dâ&#x20AC;&#x2122;encre possible : Â&#x2020;Cyan, Magenta, Jaune, Noir + Vernis + Blanc Â&#x2020;Cyan, Magenta, Jaune, Noir + 2 Vernis pour obtenir des effets de gaufrage, embossing en mat ou brillant Â&#x2020;Cyan, Magenta, Jaune, Noir + 2 blanc pour obtenir une haut couverture en blanc 2QUUKDKNKVoFŠWVKNKUGTNŠGPETG²GZKDNG'%1785GZVGPUKDNGi en C, M, Y, BK, WH, WH Q Lampes UV basse consommation longue durĂŠe ( Garantie 3 ans ou 10000 heures ) QCapteur automatique de dĂŠtection de la hauteur des matĂŠriaux QTable aspirante divisible en 4 zones Q2QKFUOCZKOWOFWRCPPGCWMI

T ĂŠ l

:

Q 4KRNQIKEKGN8GTUC9QTMUGPHTCPnCKU Â&#x2020;Mises Ă jour automatiques gratuites Â&#x2020;Bibliothèque de couleurs et de textures Â&#x2020;Gestion des donnĂŠes variables Â&#x2020;Gestion des diffĂŠrentes couches dâ&#x20AC;&#x2122;impression et de combinaisons dâ&#x20AC;&#x2122;encre Â&#x2020;Calcul de la consommation dâ&#x20AC;&#x2122;encre et du temps dâ&#x20AC;&#x2122;impression de EJCSWGÂąEJKGT Â&#x2020;Fonction RIPC pour diminuer lâ&#x20AC;&#x2122;effet de banding en harmonisant les passes dâ&#x20AC;&#x2122;impression QExtracteur Ă  charbon actif QEncombrement : Largeur 3184 x Longueur 3283 mm Q2QKFUMI QAlimentation : AC 380V triphasĂŠ 16A prise 50/60Hz QAir comprimĂŠ : pression de 4 Ă  7 bars Ă  prĂŠvoir

0 2

9 9

5 5

1 7

1 9

41


TRACEURS DE DĂ&#x2030;COUPE

GAMME FC8000

Robuste, prĂŠcise et performante QUne force de dĂŠcoupe de 600 gf Pour pouvoir dĂŠcouper une large gamme de matières. QUne vitesse de dĂŠcoupe de 1485 mm/s Vous rĂŠaliserez votre travail en un temps record. Q7PU[UVpOGFŠGPVTCuPGOGPVÂąCDNG La structure renforcĂŠe du châssis associĂŠe aux galets presseurs dont la pression est ajustable sur 3 niveaux, ainsi que le panier de rĂŠception livrĂŠ en UVCPFCTFICTCPVKUUGPVWPFoÂąNGOGPVÂąCDNG Q Un choix parmi 5 formats QChoisissez le juste format : 610mm, 760mm, 1060mm, 1370 mm ou 1620mm. QSimplicitĂŠ dâ&#x20AC;&#x2122;utilisation

FC8000 - 160 1626 mm

Le contrôleur de dÊcoupe permet de piloter le FC8000 FKTGEVGOGPViRCTVKTFW2%.ŠCH¹EJGWT.%&XQWURTQRQUG des icônes pour un dialogue interactif avec le clavier.

FC8000 - 130 1372 mm

Nouveau système de repèrage ARMS innovant. QCutting Master 2 QPour piloter directement le traceur de dĂŠcoupe Ă partir dâ&#x20AC;&#x2122;Adobe Illustrator et de Corel Draw.

FC8000 - 100 1067 mm

FC8000 -75 762 mm

GAMME CE 6000 Une petit prix pour un rendement dâ&#x20AC;&#x2122;exception

FC8000 -60 610 mm

GAMME CE 6000 Un petit prix pour un rendement dâ&#x20AC;&#x2122;exception Ce nouveau modèle simple dâ&#x20AC;&#x2122;utilisation et aux performances amĂŠliorĂŠes permet entre autre de rĂŠaliser de la dĂŠcoupe pleine chair sur des laizes plus petites. QNouveau système de repĂŠrage optique ARMS 5.0 pour lâ&#x20AC;&#x2122;impression et la dĂŠcoupe ĂŠquipĂŠ dâ&#x20AC;&#x2122;un presse papier automatique QForce de dĂŠcoupe amĂŠliorĂŠe : 4,41 N ( 450 gf ) QVitesse de lecture des repères doublĂŠe QDĂŠcoupe totale, mi-chair et pointillĂŠs QGrand ĂŠcran LCD tactile pour naviguer rapidement dans les menus QMode de fonctionnement commutable ( Expert ou DĂŠbutant ) Q Logiciel de crĂŠation et plug-in fournis en standard : - Graphtec Studio - Cutting Master 3 ( pour Illustrator et Corel Draw ) - ContrĂ´leur de dĂŠcoupe

CE6000-40

CE6000-60 Avec ( ES ) ou sans piètement ( E ) Laize utile de 603 mm

CE6000-120

42

Lames diamètre 0,9 mm Porte-outil PHP33-CB09 156,00 BoÎte de 5 lames CB09UD 139,00 2QWTXKP[NG²GZ¹NOKPCEVKPKSWGOCUSWGFGUCDNCIG¹P

Sans piètement Laize utile de 375 mm

Avec piètement Laize utile de 1213 mm

NOUVEAU

Lames diamètre 1,5 mm Porte-outil PHP33-CB15N 156,00 BoÎte de 5 lames CB15U 139,00 En plus : masque de sablage Êpais ou peu tendre, cartonette, synthÊtique souple


FLEX ET FLOCK POUR Lâ&#x20AC;&#x2122;IMPRESSION SOLVANT ECO-SOLVANT Flex

Tatoo Flash

Flock Viscose

60Îź

ECOPRINT

450Îź

QFlock rayon viscose

QFlex 100 % polyurÊthane sans PVC QAspect satin, très lÊger et Êtirable QApplication : coton, poly/coton, polyester QTempÊrature de lavage 60°C QT°transfert 165°C /Temps 15 -17s

QAspect mat au toucher soft et ĂŠtirable QApplication : coton, poly/coton, polyester QTempĂŠrature de lavage 40°C QT°transfert 165°C /Temps 15 -17s â&#x201A;Ź

â&#x201A;Ź/HT/M2

Couleurs

Format en m

Couleurs

Format en m

TATOOF5010

0,50

10

76,85

15,37

ECOPRINT5010

0,50

10

104,35

20,87

TATOOF5025

0,50

25

192,12

Â&#x152;

ECOPRINT5020

0,50

20

208,70

Â&#x152;

TATOOF7510

0,75

10

115,27

Â&#x152;

Tatoo Nylon

â&#x201A;Ź/HT/M2

Q Disponible pour imprimante Ă sublimation RĂŠf. FIBERPLUS Ă  27,03 â&#x201A;Ź HT / m2

QDisponible avec barrière pour bloquer la migration des encres sublimĂŠes du vĂŞtement au transfert ( T° de transfert : 130°C ) RĂŠf. TATOO SubliBlock2 Ă 35,50 â&#x201A;Ź HT /m2

Flex

â&#x201A;Ź

Flex transparent

60Îź

CLEARFLEX

60Îź

QFlex 100 % polyurĂŠthane transparent

Q Flex 100 % polyurÊthane sans PVC Q Aspect satin, très lÊger et Êtirable Q Application : SpÊcial Nylon QTempÊrature de lavage 40°C Q T°transfert 115°C /Temps 15s

Q#URGEVUCVKPVTpUNoIGTVTpUÂąPGVoVKTCDNG Q Application : sur tissus blanc en coton, poly/coton, polyester QTempĂŠrature de lavage 60°C- Se pose sans tape QT°transfert 160°C /Temps 15s â&#x201A;Ź

â&#x201A;Ź/HT/M2

Couleurs

Format en m

Couleurs

Format en m

TATOON10

0,50

10

120,85

24,17

CLEARFLEX10

0,50

10

68,60

13,72

TATOON25

0,50

25

302,12

Â&#x152;

CLEARFLEX25

0,50

25

171.50

Â&#x152;

â&#x201A;Ź

â&#x201A;Ź/HT/M2

FLEX ET FLOCK POUR LA DĂ&#x2030;COUPE Flex de dĂŠcoupe

FlexCut Sticky Flash

Flex de dĂŠcoupe

70Îź

QFlex 100 % polyurĂŠthane sans PVC Q#URGEVOCVVTpUÂąPGVoVKTCDNG QApplication : coton, poly/coton, polyester QTempĂŠrature de lavage 60°C QT°transfert 115°C /Temps 17s ou 160C° pendant 8s â&#x201A;Ź

Couleurs

Format en m

Blanc et Noir

0,50

10

101,75

22 couleurs

0,50

10

102.90

4 Fluo et 4 MĂŠtal

0,50

10

107,70

â&#x201A;Ź/HT/M2

20,35

Blanc et Noir

0,50

10

104,15

20.58

Couleur

0,50

10

105.30

21,10

21,54

MĂŠtal

0,50

10

110,00

22,00

Flock de dĂŠcoupe

QAdhĂŠsif rĂŠsistant Ă la tempĂŠrature de la presse â&#x201A;Ź/HT/M2

FLEXTAPE 50-25

0,50

25

87,12

6,97

FLEXTAPE 75-25

0,75

.

130,68

Â&#x152;

VelCut Evo

20,80

500Îź

QFlock rayon viscose QFlock de haute qualitÊ au toucher velour très doux QAdhÊsif rÊsine synthÊtique QApplication : coton, poly/coton, polyester QTempÊrature de lavage 60°C QT°transfert 165°C /Temps 15/17s

Tape polyester

â&#x201A;Ź

â&#x201A;Ź

Format en m

QTape polyester transparent Format en m

70Îź

Couleurs

â&#x201A;Ź/HT/M2

QDisponible pour les tissus en polyester sublimĂŠs ( type maillot de sport ). Une barrière bloque la migration des encres sublimĂŠes du vĂŞtement vers le transfert RĂŠf. FlexCut Sticky Subliblock Ă 30,20 â&#x201A;Ź HT /m2

Couleurs

FlexCut Sticky NYLON

QFlex 100 % polyurÊthane sans PVC Q#URGEVOCVVTpU¹PGVoVKTCDNG QApplication : Nylon, tissus traitÊs QTempÊrature de lavage 40°C QT°transfert 115°C /Temps 15s

â&#x201A;Ź

â&#x201A;Ź/HT/M2

Couleurs

Format en m

Blanc et Noir

0,50

10

104,15

30.80

Couleur

0,50

10

105.30

Â&#x152;

QDisponible en version plus ĂŠcologique (polyamide) et plus rĂŠsistante RĂŠf. PREMIUM Ă 36,90 â&#x201A;Ź HT / m2

FLEX POUR FLOCK nous consulter

NOUVELLE GAMME SEF MADE IN FRANCE

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

43


PRESSES À CHAUD

Presse manuelle à ouverture en portefeuille

Presse manuelle à tiroir

QPour petites et moyennes séries

Q Pour petites et moyennes séries

Q Encombrement minimal Q Puissance : 2250 W, Pression 620 daN QGarantie 2 ans Q Disponible avec 2 formats de plateau : 400 x 450 mm : 975,00 € HT 400 x 500 mm : 1.040,00 € HT

Q Le tiroir avance pour plus de confort QPuissance : 2250 W, Pression 620 daN

Q Garantie 2 ans QFormat du plateau chauffant :

400 x 500 mm : 1.225,00 € HT

Presse manuelle à ouverture latérale QPour petites et moyennes séries QDégagement maximal du plateau chauffant QPuissance : 2500 W, Pression 900 daN QGarantie 2 ans Q Disponible avec 2 formats de plateau :

400 x 450 mm : 1.428,00 € HT 400 x 500 mm : 1.477,00 € HT

Ces modèles sont disponibles en version à ouverture électro-magnétique et pneumatique

PORTES BOBINES Portes-bobines Pour un stockage sûr et pratique des bobines FGUWRRQTVUF©KORTGUUKQPGVFG±NOUFGRNCUVK±ECVKQP QEncombrement au sol : 60 x 100 cm QPlateau et mâts en aluminium anodisé QMontage facile avec une simple clé à 6 pans QRoulettes QPrix :  Plateau  246,00 €.H.T. 5 mâts L 30cm pour bobines diam. 76mm 103,00 €.H.T. 5 mâts L 30cm pour bobines diam. 57 mm 73,00 €.H.T.

44


Quelle que soit votre demande GPRNCUVKÂąECVKQPITCPFHQTOCV une de nos machines y rĂŠpond ! FilmĂŠdi@ vous propose une gamme complète de RNCUVKÂąGWUGURTQHGUUKQPPGNNGU jusquâ&#x20AC;&#x2122;Ă une laize de 2,10 m pour la mise en valeur, la protection et la conservation de vos travaux grand format.

Laminateurs grand format

CONSEILS,

FORMATION ET APRĂ&#x2C6;S-VENTE.

oller

INSTALLATION,

ExpĂŠrience

PlastiďŹ er

LIVRAISON,

Outils de coupe Sertisseuses dâ&#x20AC;&#x2122;Ĺ&#x201C;illets Soudeuse pour bâche Accessoires de ďŹ nition Couper

Couper PrĂŠsenter

Se

Systèmes de prĂŠsentation QLaminateurs Ă froid et table de lamination .................................... P 46 QLaminateurs Ă  chaud et Ă  froid......................................................................... P 48 QSertisseuses dâ&#x20AC;&#x2122;Ĺ&#x201C;illets et soudeuse pour bâche ............................P 49 Q Coupe grand format .......................................................................................................... P 50 Q Cartons mousse magnĂŠtique .............................................................................. P 52 Q#EEGUUQKTGUFGÂąPKVKQP ................................................................................................... P 53 Q Systèmes de prĂŠsentation......................................................................................... p 55

45 T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9


LAMINATEURS GRAND FORMAT

LAMINATEURS À FROID MISTRAL 1650 et 2100 QLaminateur à froid avec rouleau supérieur chauffant jusqu’à 60°C pour accélérer la polymérisation QLargeur de travail : 1710 mm et 2160 mm Vitesse de plastification jusqu’à 6,2 m/mn QEcartement des rouleaux réglable jusqu’à 50 mm Q2NCUVK±ECVKQPTGEVQGVXGTUQGPUGWNRCUUCIG QTable d’introduction et carter de protection articulés QPlateau avant et mandrins gradués QAxes autobloquants QStand sur roulettes avec possibilité de stockage de 4 bobines QRé-enrouleur inclus QDérouleur inclus

BALTIC 1080 et 1400 QLaminateur à froid QLargeur de travail : 1080 mm et 1400mm QEcartement des rouleaux réglable jusqu’à 25mm QOption : stand et ré-enrouleur pour 1080 et 1400 QOption : ré-enrouleur pour 1400

STARTER 1600 - 1400 - 1080 QLaminateur à froid économique QDisponible en 3 largeurs : 160, 140 et 108 cm QEcartement des rouleaux réglable jusqu’à 50 mm QVitesse réglable de 1 à 3,6 m / mn QCommande de l’avance par pédale Q3 axes autobloquants pour mandrins de 76 mm Options : QStand à roulettes

MADE IN M FRANCE

Q)WKFGFGFQEWOGPVUGVDCTTGFGFo±NGOGPV Possibilités de travail QLamination simple face QAdhésivage (application d’un double face au dos d’un papier) QLamination et adhésivage simultanés QContre-collage sur tous types de supports jusqu’à 5 cm d’épaisseur QPose d’application tape QPose de fond de couleur

46

Guide d’introduction

Panneau de commande


TABLES DE LAMINATION ET DE MONTAGE

BOSS 165 CM

SOLUTION TIVE

MODUL MOUNTER : Une solution évolutive qui grandit au gré de vos besoins Q3 modèles disponibles : O JUNIOR 100 : Longueur 200 O PROFI 145 : longueur 300 O BOSS165 : Longueur 300 QLongueur évolutive jusqu’à 6m par modules de 1 m

Modul Mounter offre 4 fonctions QContre collage jusqu’à 50 mm d’épaisseur QPose d’Application Tape QPose de Fond de couleur Q2NCUVK±ECVKQPUKORNGHCEG QPression et vitesse variables

EXCELAM 1120 et 880 QLaminateur à froid sur stand Q Largeur maximum de travail 1120 et 880 mm Q8KVGUUGFGRNCUVK±ECVKQPLWUSW©iOOP QEcartement des rouleaux réglable jusqu’à 13 mm Q2NCUVK±ECVKQPTGEVQGVXGTUQGPRCUUCIGU QCoupe transversale QMandrins de 77 mm QPression et vitesse variables

T é l

:

0 2

9 9

5 5

1 7

1 9

47


LAMINATEURS GRAND FORMAT

LAMINATEURS À CHAUD ET À FROID ATLANTIC 1650 QLaminateur polyvalent à chaud et à froid QLargeur maximum de travail 1600 mm Q Ecartement des rouleaux réglable jusqu’à 50 mm Q8KVGUUGFGRNCUVK±ECVKQPLWUSW©iOOP Q4oINCIGGVCH±EJCIGKPFoRGPFCPVFGNCVGORoTCVWTG des rouleaux Q2NCUVK±ECVKQPiEJCWFLWUSW©iZOKETQPU Q Puissance de chauffe : 2 x 1700 W Q Marche arrière Q Pédale de commande moteur Q Plateau d’introduction pivotant Q Axes autobloquants Q Poids 414 kg Contrôle digital des différents réglages

SIROCCO 1600 Q Laminateur polyvalent à chaud et à froid pour usage semi-intensif Q .CTIGWTOCZKOWOFGVTCXCKNOO Q8KVGUUGFGRNCUVK±ECVKQPLWUSW©iOOP Q Ecartement des rouleaux réglable jusqu’à 25mm Q2NCUVK±ECVKQPTGEVQGVXGTUQGPUGWNRCUUCIGiHTQKF Q2NCUVK±ECVKQPiEJCWFLWUSW©iZOKETQPU Q Puissance de chauffe : 2 x 1700 W Q Marche arrière Q Plateau avant et mandrins gradués Q Axes autobloquants Q Stand sur roulettes avec possibilité de stockage de 4 bobines Q Poids 300 kg Q Option : Ré-enrouleur électrique

ATLANTIC 1080 Q Laminateur polyvalent à chaud et à froid Q Largeur de travail : 1080 mm Q Mêmes caractéristiques que le modèle ATLANTIC 1600 Q Options : Ré-enrouleur électrique

SIROCCO 1080 Q Laminateur polyvalent à chaud et à froid Q .CTIGWTOCZKOWOFGVTCXCKNOO Q Mêmes caractéristiques que le modèle SIROCCO 1600 Q Options : Ré-enrouleur électrique Stand et ré-enrouleur

48

NOUVEAU MADE IN FRANCE


SERTISSEUSES D’ŒILLETS

MANUELLE ET PNEUMATIQUE Système de mesure

Jeu de pose magnétique

Sertisseuse pneumatique SERT 2000

Sertisseuse manuelle SERT 1000

Pour un sertissage facile et sans effort Adaptée aux moyennes séries. Equipée d’un système de protection et de détection pour un travail en toute sécurité et fonctionne par alimentation pneumatique modulable de 3 à 6 bars.

Pour un sertissage rapide et facile Adaptée aux petites séries. Machine robuste et simple d’utilisation. Elle ne nécessite aucun entretien particulier. CARACTÉRISTIQUES COMMUNES : Tous nos RIVETS sont AUTO-FOREURS et permettent d’utiliser les sertisseuses sans préparation ni pré-perçage de vos supports. Un dispositif de réglage permet un sertissage de 1 à 4 mm d’épaisseur. Un système de mesure précis facilite la mise en place des œillets.

Référence

Jeux de pose et oeillets 5pIpUHQFH

Désignation

Prix HT€

SERT 1000

Machine de pose manuelle

411,00

SERT 2000

Machine de pose pneumatique

1780,00

Œillets

'pVLJQDWLRQ



3UL[+7

5pIpUHQFH

'pVLJQDWLRQ



3UL[+7

JP20

Jeu de pose pour œillets de 20 mm

115,60

OEIL20

200 œillets inox + contre-œillets de 20 mm

159,23

JP15

Jeu de pose magnétique pour œillets de 15 mm

115,60

OEIL15

1000 œillets + contre-œillets de 15 mm

202,85

JP13

Jeu de pose magnétique pour œillets de 13 mm

115,60

OEIL13

1000 œillets + contre-œillets de 13 mm

137,70

JP12

Jeu de pose pour œillets de 12 mm

115,60

OEIL12

200 œillets inox + contre œillets de 12 mm

JP8

Jeu de pose magnétique pour œillets de 8 mm

115,60

OEIL8

1000 œillets + contre-œillets de 8 mm

JP6

Jeu de pose magnétique pour œillets de 6 mm

115,60

OEIL6

1000 œillets de 6 mm

96,77 112,85 33,92

SOUDEUSE À AIR CHAUD POUR BÂCHE 2QWTWPUQWFCIGiCKTEJCWFGH±ECEGFGUDjEJGU7PTQWNGCWFGIWKFCIGOCKPVKGPVN©70+2.#0'RToEKUoOGPVGPRQUKVKQP#H±EJCIGFKIKVCN de la valeur de consigne et de la valeur effective de la température et de la vitesse de soudage. Le chauffage est réglé electroniquement. QPetit, léger et maniable Q#H±EJCIGFKIKVCN QHaute vitesse de soudage QDispositif de soulèvement intégré QDimensions : L420 x I270 x H210 QPoids : 11,5 kg avec 3m de cable QTempérature de 20 à 620°C QLargeur de soudure : 30 mm QVitesse de 1 à 7,5 m/mn QDémarrage automatique QTension : 230 V QPuissance 2300 w

T é l

:

0 2

9 9

5 5

1 7

1 9

49


OUTILS DE COUPE

Coupeuse manuelle verticale Pour couper avec prĂŠcision et proprement tous les matĂŠriaux rigides utilisĂŠs dans les arts graphiques.

Hauteur de coupe PVC 10 mm

Steeltrack

Steeltrack

165 cm

210 cm





Carton mousse 13 mm

6

6

Plastic extrudĂŠ





Dibond 3mm

6

6

Verre





Rainage Plexi.

Prix â&#x201A;Ź H.T.





2829,00

3255,00

Q Kit dâ&#x20AC;&#x2122;installation autonome : 167,00 â&#x201A;Ź HT pour Steeltrack 165 Q Kit dâ&#x20AC;&#x2122;installation autonome : 209,00 â&#x201A;Ź HT pour Steeltrack 210 Q Kit coupe du verre pour STEELTRACK : 130,00 â&#x201A;Ź HT STEELTRACK : Modèle puissant et plus confortable. Une tĂŞte de coupe avec tous les outils nĂŠcessaires montĂŠs en permanence pour passer dâ&#x20AC;&#x2122;une application Ă une autre très rapidement.

Outil de rainage à 90° RÊfÊrence

Prix HTâ&#x201A;Ź

STV63

147 ,00

Pour DIBONDŽ et PVC de 3 mm Travail net sans dÊbris ou bord ÊbavurÊ. Enlève exactement la quantitÊ appropriÊe pour faciliter le pliage.

Rogneuses Êlectriques 210 et 250 Pour façonner rapidement et prÊcisÊment tous les supports UQWRNGUCXCPVGVCRTpURNCUVK¹ECVKQP Q Epaisseur de coupe : 1,8 mm Q Rogneuse Êlectrique sur stand Q Longueur utile de coupe : 210 ou 250 cm Q Collecteur des rÊsidus de coupe Q Equerre de guidage mobile Q Eclairage du plan de coupe Q Dimensions L x l x H : 259 / 299 x 50 x 101 cm Q Hauteur du plan de travail : 87 cm Q Poids : 83 / 103 Kg Q Lame rotative en acier trempÊ entièrement carÊnÊe pour un travail en toute sÊcuritÊ et montÊe sur barre de guidage à section rectangulaire pour une pression rÊgulière lors de la coupe. Modèle 210 cm : nous consulter Modèle 250 cm : nous consulter Rogneuse Êlectrique avec tête de coupe à lame giratoire en acier VTGORo%QPVTGNCOG¹ZGGPCEKGTKPQZXGTPKUOQPVoGUWTWPRNCPFG coupe renforcÊ. PossibilitÊ de sÊlectionner la sortie du papier en horizontal arrière ou directement dans le bac collecteur. 7P¹NRJQURJQTGUEGPVFGToHoTGPEGRGTOGVFGTGRoTGTNCNKIPGFGEQWRG Parties mÊtalliques vernies, couleur gris RAL 7035. Stand tubulaire en acier avec pieds rÊglables. DÊclenchement de la coupe par pÊdale ou manuellement sur le plan de travail.

50


COUPE GRAND FORMAT Règle de coupe JAVELIN SERIE 2 Grande linĂŠaritĂŠ de coupe Ă moins de 0,2 mm sur la longueur. Outil conçu pour ĂŞtre posĂŠ sur le plan de travail. Deux bandes en silicone antidĂŠrapant protègent lâ&#x20AC;&#x2122;impression. Nouvelle tĂŞte de coupe montĂŠe sur roulements garantis 20 ans avec lame interchangeable rapidement. IdĂŠal pour couper VQWUNGUUWRRQTVUKORTKOoUUQWRNGUCXGEQWUCPURNCUVKÂąECVKQP2TQHQPFGWT de coupe maxi de 13 mm Lame circulaire destinĂŠe Ă  couper le textile incluse 1RVKQPUÂ&#x2020;#FCRVCVGWTFGVCDNGCXGEOoECPKUOGFŠoNoXCVKQP   Â&#x2020;'VCDNKGPCNWOKPKWOCXGEU[UVpOGFŠoNoXCVKQPFGNCTpING Modèle 160 210 260 310 Longueur de coupe 160 cm 210 cm 260 cm 310 cm Prix â&#x201A;Ź H.T. 565,00 651,00 704,00 757,0

Javelin sĂŠrie 2

TĂŞte de coupe Javelin et IntĂŠgra

Règle de coupe INTEGRA /QFpNGKFGPVKSWGiNCTpING,#8'.+05'4+' RNCVGCWCNWOKPKWOiÂąZGT + 2 poignĂŠes dâ&#x20AC;&#x2122;ĂŠlĂŠvation avec position haute maintenue. Permet un meilleur maintien des panneaux rigides. TĂŞte de coupe avec lame circulaire destinĂŠe Ă couper le textile incluse. Modèle 160 210 260 310 Longueur de coupe 160 cm 210 cm 260 cm 310 cm Prix â&#x201A;Ź H.T. 684,00 783,00 874,00 987,00

IntĂŠgra

Barre de coupe EVOLUTION E2 Modèle aux mĂŞmes caractĂŠristiques que la règle INTEGRA mais avec une double tĂŞte de coupe intĂŠgrant la lame circulaire pour textiles et RGTOGVVCPVWPGEQWRGDKFKTGEVKQPPGNNG2GWVqVTGÂąZoGUWTWPGVCDNGQW KPVoIToGiWPoVCDNKURoEKÂąSWG6qVGFGEQWRGCXGENCOGEKTEWNCKTGFGUVKPoG Ă couper le textile incluse. Option : Etabli en aluminium Modèle 160 210 260 310 360 Longueur de coupe 160 cm 210 cm 260 cm 310 cm 360 cm Prix â&#x201A;Ź H.T. 919,00 1.031,00 1.151,00 1.299,00 1.452,00

Evolution E2

TĂŞte de coupe ĂŠvolution

Barre de coupe SABRE SERIE 2 4pINGFGEQWRGOQPQVqVGCTVKEWNoGGVÂąZoGUWTWPRNCVGCWCNWOKPKWO lui-mĂŞme posĂŠ sur un stand. Lame circulaire pour textile incluse Modèle 150 200 250 300 Longueur de coupe 150 cm 200 cm 250 cm 300 cm Prix â&#x201A;Ź H.T. Sabre seul 821,00 942,00 1.061,00 1.182,00 Prix â&#x201A;Ź H.T. Sabre Pack 1.338,00 1.540,00 1.744,00 1.940,00 Sabre Pack : RĂŠceptacle pour rĂŠsidus de coupe + porte bobine

Sabre sĂŠrie 2

Règle manuelle Règle aluminium graduĂŠe avec prise en main. Bord de coupe arrondi anti-usure en acier inoxydable. Patins anti-dĂŠrapant. Modèle SS120 SS150 SS180 Longueur de coupe 120 cm 150 cm 180 cm Prix â&#x201A;Ź H.T. 73 ?00 88,00 102,00 Sabre Pack : RĂŠceptacle pour rĂŠsidus de coupe + porte bobine

Lames de rechange RĂŠfĂŠrence CA50-032 CR80 CA50-010 XRBLADE CA50-027 CA50-019 CIR45

Prix â&#x201A;Ź HTqtĂŠs 56,92 100 Lame Graphik 55,38 100 PVC 28,33 100 Standard 13 mm 21.53 100 Coupe medium 133,84 10 Textile

Modèle Javelin2/Sabre2/IntÊgra/Evolution2 Javelin/Integra/Evolution/Sabre/Steeltrack Javelin/Sabre/ Javelin2/Integra/Evolution/Sabre/Steeltrack Pour tête de coupe VABHC (lame circulaire)

T ĂŠ l

:

0 2

9 9

Règle manuelle

5 5

1 7

1 9

51


CARTON MOUSSE - TAPIS DE COUPE Carton mousse 3 mm

Boite de 12 plaques

Carton mousse 10 mm

Boite de 12 plaques

Q%QORNGZGGZVTqOGOGPVNoIGTCXGEWPGjOGRQN[UV[TpPG DNCPEJGPGLCWPKUUCPVRCUITjEGiUQPVTCKVGOGPVCPVK78

Q%QORNGZGGZVTqOGOGPVNoIGTCXGEWPGjOGRQN[UV[TpPG DNCPEJGPGLCWPKUUCPVRCUITjEGiUQPVTCKVGOGPVCPVK78

Q Recouvert sur les 2 faces dâ&#x20AC;&#x2122;une carte blanche teintĂŠe dans la masse

Q Recouvert sur les 2 faces dâ&#x20AC;&#x2122;une carte blanche teintĂŠe dans la masse

Q Aspect satinĂŠ

Q Aspect satinĂŠ

Q Sans CFC

Q Sans CFC

RĂŠfĂŠrence

â&#x201A;Ź

Format en cm Larg

Long

50

65

CPP350 CPP370

70

CPP3100

88,70

100

100

M2/HTâ&#x201A;Ź

10,92

180,60

140

10,32

360,86

Carton mousse 5 mm

10,31

Boite de 25 plaques

RĂŠfĂŠrence

â&#x201A;Ź

Format en cm Larg Long

CPP1050

50

65

69,03

17,70

CPP1070

70

100

118,96

14,16

CPP10100

100

140

237,41

14,13

Carton mousse 10 mm

AdhĂŠsif

Boite de 12 plaques

Q%QORNGZGGZVTqOGOGPVNoIGTCXGEWPGjOGRQN[UV[TpPG DNCPEJGPGLCWPKUUCPVRCUITjEGiUQPVTCKVGOGPVCPVK78

Q Parfaitement plan et très lisse

Q Recouvert sur les 2 faces dâ&#x20AC;&#x2122;une carte blanche teintĂŠe dans la masse

Q Pas de dĂŠformation Ă lâ&#x20AC;&#x2122;humiditĂŠ

Q Aspect satinĂŠ

Q*CWVGToUKUVCPEGiNCEQORTGUUKQPGViNC²GZKQP

Q Sans CFC RĂŠfĂŠrence

â&#x201A;Ź

EXPFOAM10100AD

Long

CPP550

50

65

100,76

12,40

CPP570

70

100

205,04

11,65

CPP5100

100

140

408,44

11,67

Le rouleau femelle

27,25

Prix HTâ&#x201A;Ź 41,54

8'.#&*%41

.GTQWNGCWOjNG

28,21 

Ruban adhĂŠsif magnĂŠtique



POUR STANDS PARAPLUIE

Q Force : 80g/cm2 Q Epaisseur : 1.5 mm Q Conditionnement au rouleau

Prix HTâ&#x201A;Ź

ADHMAGN127

12.7 mm x 30 m 5 pĂ´les

45,00

ADHMAGN195

19 mm X 30 m

69,00

7 pĂ´les

Tapis de coupe 60 x 90 cm 100 x 150 cm 100 x 200 cm

QEpaisseur : 3 mm QCouleur : verte Ces tapis sont sĂŠrigraphiĂŠs 1 face avec graduation par cm Utilisables sur les 2 faces pour la coupe Surface de coupe totale

Attache triangle adhĂŠsive Q Attache sur disque plastique adhĂŠsif Pour supports rigides type DibondÂŽ ou ForexÂŽ RĂŠfĂŠrence :

RĂŠfĂŠrence :

52

457,90

Prix HTâ&#x201A;Ź

VELADHBOUCL

Q3 formats :

140

M2/HTâ&#x201A;Ź

Crochet mousse 5 mm

CPAT50

RĂŠfĂŠrence :

100

â&#x201A;Ź

Attache de suspension destinÊe au carton mousse 5G¹ZGRCTUKORNGRTGUUKQPFWFQKIV Conditionnement : les 50 pièces RÊfÊrence :

Q Longueur : 25 mètres Q Largeur : 20 mm

NOUVEAU

Format en cm Larg Long

M2/HTâ&#x201A;Ź

Larg

Velcro adhĂŠsif en bande



Q 2 faces aluminium laquĂŠ

RĂŠfĂŠrence Format en cm

M2/HTâ&#x201A;Ź

Format graduĂŠ utile

Prix HTâ&#x201A;Ź

60 x 90 cm

55 x 85 cm

71,00

100 x 150 cm

92 x 142 cm

208,00

100 x 200 cm

92 x 192 cm

291,00

Conditionnement

Diamètre

Prix HTâ&#x201A;Ź

ATTACH25

50 pièces

25mm

18,40

ATTACH40

50 pièces

40mm

22,30


Ĺ&#x2019;ILLETS ADHĂ&#x2030;SIFS ET DOUBLE FACE POUR BĂ&#x201A;CHE BANNER UPS ÂŽ Lâ&#x20AC;&#x2122;alternative aux Ĺ&#x201C;illets : Rapide RĂŠsistant Economique Q Se pose sans outil et ĂŠvite la couture et les ourlets Q Transparent pour se fondre dans le visuel Q AdhĂŠsif haute performance pour adhĂŠrer sur tout type de matière Q+FoCNRQWTDjEJGU28%RQN[RTQR[NpPGVQKNGUNoIpTGU6[XGM&TQRRCRGTRCRKGTÂ? Q+FoCNRQWTFGURCPPGCWZNoIGTUGVÂąPU#SWKNWZ28%%CTVQPOQWUUGÂ? Q2QWTNŠKPVoTKGWTGVNŠGZVoTKGWTEGVVGÂąZCVKQPPGTKUSWGRCUFGTQWKNNGT rĂŠsistant aux vents et aux ĂŠcarts de tempĂŠrature

POWER TABS

BAN001

BAN014

BAN014

BAN016

BAN001

BAN016

Transparent

QSe colle dans lâ&#x20AC;&#x2122;angle de la bannière en R/V Q Utiliser le trou central pour les utilisations extĂŠrieures Q Utiliser la boucle pour une rĂŠsistance moindre Q Couper la boucle si elle ne sert pas  5pIpUHQFH 3UL[+7 BAN01450

56,90 les 50 pièces

EDGE TABS BANNER UPS

BLANC

Q Se colle sur les cĂ´tĂŠs de la bannière en R/V Q Peut servir Ă renforcer la tenue dâ&#x20AC;&#x2122;un Ĺ&#x201C;illet en ĂŠvitant lâ&#x20AC;&#x2122;ourlet Q Utiliser le trou central pour les utilisations extĂŠrieures Q Utiliser la boucle pour une rĂŠsistance moindre Q Couper la boucle si elle ne sert pas  5pIpUHQFH 3UL[+7

Q Convient pour des grands visuels en extĂŠrieur Q Se colle dans lâ&#x20AC;&#x2122;angle de la bannière en R/V Q Utiliser le trou central pour les utilisations extĂŠrieures Q Utiliser la boucle pour une rĂŠsistance moindre Q Couper la boucle si elle ne sert pas  5pIpUHQFH 3UL[+7 -BAN00150

Transparent

BAN01650

43,00 les 50 pièces

36,90 les 50 pièces

POWER PUNCH POWER TAPE

AdhĂŠsif simple face blanc

Q Permet de renforcer la tenue des Ĺ&#x201C;illets adhĂŠsifs Q Assure des bords droits Q Peut ĂŞtre utilisĂŠ le long des cĂ´tĂŠs verticaux pour ĂŠviter le ÂŤ curl Âť des kakĂŠmonos Q Se pose par-dessus les Ĺ&#x201C;illets adhĂŠsifs Q Conditionnement : Rouleau de 38 mm x 33 m  5pIpUHQFH 3UL[+7 PTAPEDC

Q2QWTRGTHQTGTOCPWGNNGOGPVNGU£KNNGVUCFJoUKHUGVNCDjEJG QDiamètre de perforation : 8 mm  5pIpUHQFH 3UL[+7 PPUNCH

89,80

57,70 le rouleau

AdhÊsif double face SpÊcial bâche

AdhÊsif simple face SpÊcial bâche

Q Largeur : 12, 25 et 50 mm Q Longueur : 50 m Q AdhĂŠsif transparent acrylique permanent Q4oUKUVCPVCWZRNCUVKÂąCPVUEQPVGPW FCPUNGUDjEJGU RĂŠfĂŠrence :

Pince Ă perforer

Q2QWTNCLQPEVKQPFGDjEJGUGVNGTGPHQTV des visuels des enrouleurs

Q Largeurs : 50 et 100 mm Q Longueur : 33 m

Prix HTâ&#x201A;Ź

RĂŠfĂŠrence :

Prix HTâ&#x201A;Ź

ADH908812 ( 12 mm )

14,18

ADH471050 ( 50 mm )

51,64

ADH908825 ( 25 mm )

29,62

ADH4710100 ( 100 mm )

101,11

ADH908850 ( 50 mm )

52,20

Film double face Ă porteur

Ĺ&#x2019;illets sans perçage pour bâche

Q Mousse spĂŠcial montage Q AdhĂŠsif acrylique solvant Q Largeur : 19 mm Q Longueur : 66 m Q Epaisseur : 0.9 mm RĂŠfĂŠrence : M2751

Q Se place rapidement et facilement sans outils Q Repositionnable, rĂŠutilisable et esthĂŠtique Q Plus on tire plus la pression sâ&#x20AC;&#x2122;accroĂŽt Q Conditionnement : les 50 pièces Prix HTâ&#x201A;Ź

RĂŠfĂŠrence :

43,40

Prix HTâ&#x201A;Ź

OEILSP

T ĂŠ l

:

0 2

9 9

61,60

5 5

1 7

1 9

53


ACCESSOIRES DE POSE - PRODUITS DE NETTOYAGE

Positionneur de lettres

MACpose

Q Pour appliquer facilement les vinyles adhésifs en méthode humide Q Biodégradable à plus de 95 % et diluable Q Bidon de 5 litres Référence : MACPOSE

Prix HT€ 53,50

Nettoyant degraissant

MACcleaner

Q Nettoyant à très haut pouvoir dégraissant pour obtenir un support impeccable avant la pose - Biodégradable à 70%

Q Sèche rapidement sans laisser de résidus Q Bidon de 5 litres Référence : MACCLEANER

Prix HT€ 56,06

Dissolvant de colle

MACdécol .05

Q Pour enlever facilement toutes les colles résiduelles après la dépose de l’ancien décor

Q Excellent dégraissant - Biodégradable à 70% Q Bidon de 5 litres Référence : MACDECOL

Prix HT€ 94,02

Gel nettoyant anti-tags

TagAway

Q2GTOGVNGPGVVQ[CIGFGVQWVGUNGUUWTHCEGUEQWXGTVGUFGITCH±VKU Q.GUOGKNNGWTUToUWNVCVUUQPVQDVGPWUUWTNG±NOFGRTQVGEVKQPOWTCN LAG100, P67036, LUV7036

Q Produit biodégradable sans risque pour l’utilisateur Q Bidon de 1 litre Q Action rapide en seulement 2 minutes

Cutter caréné Q Lame interchangeable Référence :

Prix HT€

CUTTER

8,46

Référence : TAGAWAY

Raclette d’application

Eco Rouge

Q Raclette plastique économique souple idéale pour joindre

Plot de montage magnétique

à l’envoi de kit

Q Permet de positionner le vinyle sur le véhicule Q Conditionnement par 5 pièces Référence : SIGNGRIP

Prix HT€ 37,90

Prix HT€ 27,00

Q Conditionnement : les 50 pièces Référence : RACLECOR

Prix HT€ 56,16

Raclette d’application « High Grade »

Blanche

Q Raclette plastique semi-rigide pour un usage quotidien en atelier Q Conditionnement : les 20 pièces Référence : RACLHGB

Prix HT€ 57,62

Raclette d’application Roulettes d’application Q Caoutchouc semi dur particulièrement adapté pour la pose des adhésifs spéciaux comme STREET RAP, WW100, WW300 Référence : WHEELIE - 6,5 cm

Prix HT€ 121,90

Feutre blanc

Q Raclette en feutrine pour un travail sans marques ni rayures Q Conditionnement : les 10 pièces Référence : RACLFEUB

Prix HT€ 43,20

Roulettes d’application Référence : PIZZIE

54

Prix HT€ 49,90


LES SYSTÈMES DE PRÉSENTATION

SYSTÈMES À ENROULEUR MOOREA

BORA

Q Stand à enrouleur avec le meilleur rap-

Q Stand à enrouleur double face Q Structure et mécanisme robuste en

port qualité / prix Q Structure et mécanisme robuste en aluminium Q Visuel pincé en haut et collé en bas Q Embouts en plastique gris souple Q Sac de transport inclus

aluminium

Q Visuel pincé en haut et collé en bas Q Embouts en plastique gris souple Q Sac de transport inclus

Réf. PR300 Format 80 x 200 cm Quantité Prix Net €+7 à l’unité 35,00 à partir de 6 32,00 à partir de 12

Réf. PR310 Format 80 x 200 cm Quantité Prix Net €+7 à l’unité à partir de 4 à partir de 8

29,00

Réf. PR301 Format 100 x 200 cm Quantité Prix Net €+7 à l’unité 53,00 à partir de 6 49,00 à partir de 12 Spot 50w

105,00 96,00 87,00

Réf. PR311 Format 100 x 200 cm Quantité Prix Net €+7 à l’unité à partir de 4 à partir de 8

45,00 37,00

MADERE

128,00 119,00 109,00

CAPRI Q Stand à enrouleur robuste et esthétique Q Hauteur ajustable de 154 à 215 cm Q Visuel pincé en haut et en bas Q Visuel renouvelable par l’utilisateur Q Matière & Couleur aluminium,

NOUVEAU Q Stand à enrouleur économique Q Matière & Couleur : aluminium Q Visuel pincé en haut et collé en bas Q Sac de transport inclus

embouts plastique gris

Q Base personnalisable Q Sac de transport matelassé inclus Réf.PR110 Format 83 x 215cm Quantité Prix Net €+7 à l’unité 95,00 à partir de 4 89,00

Réf. QRM085 Format 85 x 200 cm Quantité Prix Net € H.T. à l’unité 18,00

à partir de 8

79,00

Réf. PR111 Format 98 x 215 cm Quantité Prix Net €+7 à l’unité à partir de 4 à partir de 8

129,00 119,00 109,00

WALLIS Q Stand à enrouleur robuste et esthétique Q Matière & Couleur aluminium Q Visuel pincé en haut et collé en bas Q Embouts en plastique gris Q Base personnalisable Q Sac de transport matelassé inclus Quantité à l’unité à partir de 4 à partir de 8 Spot 50w

Réf. PR112 Format 118 x 215 cm Quantité Prix Net €+7 à l’unité 153,00 à partir de 4 141,00 à partir de 8 Spot 50w

Prix Net €+7 78,00

129,00 37,00

73,00 69,00 37,00

T é l

:

0 2

9 9

5 5

1 7

1 9

55


LES SYSTĂ&#x2C6;MES DE PRĂ&#x2030;SENTATION EXTĂ&#x2030;RIEUR

5[UVpOGFGÂąZCVKQP pour enseignes publicitaires et drapeaux

WINPALÂŽ

QMontage simple, rapide et sans outils Q8KVGOQPVoXKVGFoOQPVoUCPUFoIjVUPKOCTSWGUFGÂąZCVKQPUWTNCHCnCFG Q.CEQPPGZKQPKPPQXCPVGGPVTGNGEJjUUKUFGNCHGPqVTGGVNGTGDQTFGZVGTPG assure une grande stabilitĂŠ Q Se pose Ă partir de la fenĂŞtre avec ouverture intĂŠrieur et par tous les temps Q Sâ&#x20AC;&#x2122;adapte sur des corniches de 5 Ă  41 cm de profondeur Q Echafaudage, ĂŠchelle, nacelle deviennent inutiles Q RĂŠutilisable, qualitĂŠ Allemande VidĂŠos de montage disponibles sur notre site : JVVRYYYÂąNOGFKCFKUVTKDWVKQPGWU[UVGOGUFGRTGUGPVCVKQPYKPRCNJVON

NOUVEAU

Vos clients : QAgences immobilières et de communication, magasins, particuliers, hĂ´tels, restaurants, GĂŽtes, B&B Q Mairies, administrations, Q Artisans pendant et après les travaux Les applications : QCommĂŠmorations, fĂŞtes, Q DĂŠcorations crĂŠatives, Q Manifestations sportives, courses BoĂŽte de 2 kits 54,99 â&#x201A;Ź HT Q Location dâ&#x20AC;&#x2122;espaces publicitaires  $QuVGFGMKV ²CI ÂŽ*6 Q Signalisation temporaire, ĂŠvènementiel, 8 extensions 22,36 â&#x201A;Ź H T BientĂ´t disponible : - RĂŠtro ĂŠclairage - Caisson lumineux Ă Led

STOP TROTTOIR RECTO VERSO Q Chevalet composĂŠ de 2 cadres

NOUVEAU

VISUAL EXT

ORCADES

aluminium articulÊs et clipants Q2TQVGEVKQPCPVKTG²GVUKPECUUCDNG Q Structure grand format pliable Q Matière et couleur : Aluminium Q Sac de transport inclus

Q 2QTVGCHÂąEJGGZVoTKGWT Q(KZCVKQPFWXKUWGNRCTÂŁKNNGVU OO Q5QENGCXGEToUGTXQKTNGUVFGNKVTGU Q/jVVoNGUEQRKSWGToINCDNG Q*CWVGWTGVNCTIGWTCLWUVCDNGFGZ Ă 80 x 200 cm

Q 2QTVGCHÂąEJGGZVoTKGWT Q Visuel renouvelable par lâ&#x20AC;&#x2122;utilisateur Q Fixation du visuel par oeillets Q Socle gris avec rĂŠservoir lest de 10 litres Q Sac de transport inclus

RĂŠf. PR70 Format 70 x 100 cm QuantitĂŠ Prix Net â&#x201A;Ź H.T. Ă lâ&#x20AC;&#x2122;unitĂŠ 169,00

RĂŠf. QREXT8020 Format 80 x 200 cm QuantitĂŠ Prix Net â&#x201A;Ź H.T.

RĂŠf. PR008 Format 45 x 160 cm QuantitĂŠ Prix Net â&#x201A;Ź H.T. Ă lâ&#x20AC;&#x2122;unitĂŠ 75,00 Ă  partir de 6 68,00

Ă partir de 5 Ă  partir de 10

56

159,00 149,00

Ă lâ&#x20AC;&#x2122;unitĂŠ Ă  partir de 4 Sac de transport

117,00 107,00 (QREXTSAC)

29,50


TRINIDAD

TAHITI

RĂŠglable en hauteur

Q2QTVGCHÂąEJGUVCDNGNoIGTGVoEQPQOKSWG Q Hauteur ajustable jusquâ&#x20AC;&#x2122;Ă 210 cm Q Matière et couleur : Aluminium Q8KUWGNTGPQWXGNCDNGGVÂąZoRCTENKR Q Sac de transport inclus RĂŠf. PR330 Format 60 x 150/200 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă  lâ&#x20AC;&#x2122;unitĂŠ 25,00 Ă  partir de 6 23,00 Ă  partir de 12

Q2QTVGCHÂąEJGUKORNGGVoEQPQOKSWG Q Visuel renouvelable par lâ&#x20AC;&#x2122;utilisateur Q Hauteurs extensible de 180 et 200 cm Q/CVKpTG#NWOKPKWOGVÂąDTGFGECTDQPG noire

Q Sac de transport inclus RĂŠf. PR009 Format 83 x 180 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ Ă  partir de 10

19,00

23,00 19,00

RĂŠf. PR331 Format 80 x 180/210 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ 29,00 Ă  partir de 6 Ă  partir de 12

27,00 25,00

RĂŠf. P332 Format 100 x 180/210 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ Ă  partir de 6 Ă  partir de 12 Spot 50w

32,00 30,00 26,00 37,00 2410 mm

2435 mm

The best exhibition VISUAL BANNER

VISUAL MAT

Q2QTVKSWGRQWTXKUWGNUWURGPFWGPCNWOKPKWOCPQFKUo Q/jVUGVVTCXGTUGUVoNGUEQRKSWGURQWTWPXKUWGNCLWUVCDNGGPJCWVGWTGVGPNCTIGWT Q(QTOCVOCZKOCNFWXKUWGNJCWVGWTZNCTIGWTOO Q(QTOCVOKPKOCNFWXKUWGNJCWVGWTZNCTIGWTOO Q&KCOpVTGFGVTCXGTUGUJQTK\QPVCNGUOO Q5CEFGVTCPURQTVKPENWU Q+FoCNCXGE$jEJGNoIpTGVQKNG'XGTITGGP

Q 2QTVGCHÂąEJGOQFWNCDNGUWTVToRKGF Q Mat tĂŠlescopique pour une hauteur ajustable Q Visuel renouvelable par lâ&#x20AC;&#x2122;utilisateur Q Visuel pincĂŠ en haut et en bas

NOUVEAU

RĂŠf. QR241 QuantitĂŠ Ă lâ&#x20AC;&#x2122;unitĂŠ

RĂŠf. PR080 Format 80 x 190 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ 55,00

Format 241 x 243 cm Prix Net â&#x201A;Ź HT 118,00

Sac de transport rĂŠf. SAVM

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

12,50

57


LES SYSTĂ&#x2C6;MES DE PRĂ&#x2030;SENTATION

126 mm

VISUAL EXPO Q Structure autoportante en X la plus 974 mm

stable et robuste du marchĂŠ

Q Finition aluminium anodisĂŠ ou noir Q Fixation du visuel par Ĺ&#x201C;illets de15 mm RĂŠf. PR819 Format 80 x 190 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ 54,00 Sac de transport Ref. SACVX 12,50

COMPTOIR COURBE Q Comptoir courbĂŠ pour promotions sur point de vente.

Q Système Pop-up pliable Q Etagère intÊrieure courbÊe. Q Sacs de transport pour le comptoir et le visuel inclus

BARRES PORTE-AFFICHE PROFIL

58

Format du visuel : 9950 x 1984mm RĂŠf. PR971 Format 126 x 97 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ 215,00

Aluminium

Q-KVDCTTGURQTVGCHÂąEJG#NWOKPKWORTQÂąNRKPnCPV Q Coloris : aluminium anodisĂŠ, haute qualitĂŠ Q%QORTGPFTCKNJCWVTCKNDCUÂąZCNW Q Disponible en largeurs: 50, 80, 100, 120, 150 et 300 cm Q Fix alu (20 crochets + 20 bouchons dâ&#x20AC;&#x2122;extrĂŞmitĂŠ)

VISUAL LIGHT

RĂŠfĂŠrence ALF50

Description Longueur 50 cm

QuantitĂŠ 10 barres

Prix HTâ&#x201A;Ź 71,92

ALF80 ALF100 ALF120

Longueur 80 cm Longueur 100 cm Longueur 120 cm

10 barres 10 barres 10 barres

125,60 157,28 181,25

ALF150 ALF300

Longueur 150 cm Longueur 300 cm

10 barres 10 barres

236,00 448,00

FIXALU

Crochets et embouts

20 + 20

(+:#.7RGTOGVFGToCNKUGTCHÂąEJGUUWURGPFWGU

Dimensions du comptoir: Q Hauteur: 974 mm. Q Longueur: 1260 mm. Q Largeur: 360 mm

7,30

Q Structure autoportante en X Q/CVKpTGÂąDTGFGECTDQPG0QKT Q Sac de transport inclus Q Fixation du visuel par Ĺ&#x201C;illets 13mm RĂŠf. QR722 Format 80 x 180 cm et 60 x 150 cm mini QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă patir de 6 24,00 Ă  partilr de 12

19,00


STANDS PARAPLUIE

Spot 150w

Structure solide et pratique à monter grâce à son verrouillage magnÊtique. 2NCPFGOQPVCIGUKORNK¹oCXGEFGUNoU de même largeur Q Structure dÊpliable 3 x 3 et 4 x 3 Q Barres magnÊtiques Q Suspentes hautes et basses Q 1 rouleau de bande magnÊtique Q 1 valise de transport à roulettes Q 1 tablette bois pliable pour transformer la valise de transport en comptoir Q 2 spots halogène

Dimensions 3 x 3 : Q L. 2.550 x H. 2.225 x P. 720 mm Q 5 lĂŠs de 673 mm : 3 centraux + 2 retours RĂŠf. QR6800 Format 254 x 222,5 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ 490,00 Ă  partir de 5

449,00

Dimensions 4 x 3 : Q L. 3070 x H. 2.225 x P. 960 mm Q 6 lĂŠs de 673 mm : 4 centraux + 2 retours Ref QR6900 format 307 x 222,5 cm QuantitĂŠ Prix Net â&#x201A;Ź+7 Ă lâ&#x20AC;&#x2122;unitĂŠ 590,00 Ă  partir de 5 539,00

Q Format visuel du comptoir : Longueur 1735 mm Hauteur : 785 mm

Mur dâ&#x20AC;&#x2122;exposition portable 'PVKpTGOGPV²GZKDNGSWKUŠCFCRVGRCTHCKVGment Ă votre espace Q 3 hauteurs : 209, 229 et 249 cm Q Largeur unique des lĂŠs : 800 mm Q Assemblage rapide et sans outils, Q #LWUVCDNGiNŠKPÂąPK Q Novateur, unique, et dâ&#x20AC;&#x2122;une simplicitĂŠ remarquable, Q Moins coĂťteux quâ&#x20AC;&#x2122;un stand traditionnel, Q Lâ&#x20AC;&#x2122;outil idĂŠal pour renforcer lâ&#x20AC;&#x2122;image de vos clients en marquant la diffĂŠrence face Ă  la concurrence. Kit de dĂŠpart* Hauteur 209 cm Hauteur 226 cm

Prix Net â&#x201A;Ź H.T. 420,00 435,00

Hauteur 249 cm

455,00

* Correspond Ă la structure du premier lĂŠ Prix Net â&#x201A;Ź H.T.

Extension

NOUVEAU

Hauteur 209 cm Hauteur 226 cm Hauteur 249 cm

CONCEPT

255,00 265,00 270,00

Sac Ă roulettes pour 6 modules : 167,00 â&#x201A;Ź HT Sac de transport (qui sâ&#x20AC;&#x2122;attache au sac Ă  roulettes) Q Contenance 6 visuels : 93,00 â&#x201A;Ź HT Q Contenance 9 visuels : 123,00 â&#x201A;Ź HT Pour commander :

Q 1 kit de dĂŠpart + les extensions nĂŠcessaires + bande magnĂŠtique + accessoires

Q 0QWUEQPUWNVGTRQWTNŠGPUGODNGFGU accessoires disponibles et le choix du UWRRQTVFŠKORTGUUKQP

6QVCNGOGPV²GZKDNG/QPVCIGTCRKFGUCPUQWVKN

T ĂŠ l

:

0 2

9 9

5 5

1 7

1 9

59


Votre fournisseur partenaire

10 Familles de produits pour lâ&#x20AC;&#x2122;imagerie grand format

Caen

Brest

ThorignĂŠ-Fouillard Rennes Paris

Nantes

ZAC de Bellevue IV 8, rue Antoine de Saint ExupĂŠry 35235 THORIGNE-FOUILLARD TĂŠl. 02 99 55 17 19 Fax. 02 99 55 17 20

'OCKNEQPVCEV"ÂąNOGFKCFKUVTKDWVKQPHT

YYYÂąNOGFKCFKUVTKDWVKQPEQO

Tarif filmedia2  
Read more
Read more
Similar to
Popular now
Just for you