Page 1

9LFWRU /DXQFK 7ZR 1HZ 6FUXEEHU 'U\HUV /RZ &RVW 6LPSOH WR 6HUYLFH &DOO IRU 'HPR 1RZ

ZZZ9LFWRU)ORRU&DUHFRP

CM &

9LFWRU /DXQFK 7ZR 1HZ 6FUXEEHU 'U\HUV ([FHOOHQW &OHDQLQJ 6XSHUE 'U\LQJ &DOO IRU 'HPR 1RZ

ZZZ9LFWRU)ORRU&DUHFRP

CleaningandMaintenance

0DUPCFS

5IFPGÃ DJBMQVCMJDBUJPOPG5IF$MFBOJOH4IPX

#ROBO2 #CLEANSAROUNDCORNERS #ROBOTICCLEANING

MEET ROBO 2 The most advanced fully autonomous industrial cleaning machine in the world!


HARD FLOOR CLEANING SOLUTIONS. It’s not just carpets that need care, but hard floors too. Designed for cleaning professionals across sectors ranging from janitorial, FM and healthcare to retail, transport and hospitality, Vax Commercial offers a range of effective, efficient and uncomplicated commercial machines, perfect for keeping hard floors brilliantly clean. From vacuuming and washing to scrubbing and polishing, Vax Commercial’s hard floor cleaning portfolio delivers the results you expect.

FOR A FREE DEMO OR FOR MORE INFORMATION, PLEASE CONTACT VAX COMMERCIAL:


VACUUM CLEANERS | HARD FLOOR SPOT CLEANER | SCRUBBER DRYERS | HIGH SPEED ROTARY CLEANER

0330 0264 275

sales@vaxcommercial.co.uk

vaxcommercial.co.uk

@vaxcommercial


THE UK’S LARGEST DEDICATED CLEANING & HYGIENE EVENT NEW DATES ANNOUNCED

THE

CLEANING SHOW 2017 14 –16 MARCH

Organised by

In association with

Official media partners

EXCEL • LONDON

THE MUST-ATTEND EVENT FOR ALL CLEANING, HYGIENE AND FACILITIES PROFESSIONALS This free-to-attend exhibition and conference offers essential business workshops, legislative advice and products for anyone with responsibility and purchasing authority within this sector.

EXHIBITION STAND SALES NOW OPEN This event sold out in 2015. If you would like to participate we encourage you to contact us now to receive your exhibition pack and reserve space now. Vanessa Van Santen - Smith, Sales Manager +44 (0)1737 855 041 / vanessavss@quartzltd.com

THE EVENT BRINGING TOGETHER 10,000 • Contract cleaners • Facilities managers • Healthcare estate managers • Hospitality, leisure and retail managers • Public service providers • Local government • Product and service providers

WWW.CLEANINGSHOW.CO.UK


Industry News 

05 Industry News 10 BICSc Comment 12 Contracts 14 BCC Comment 15 People 16 Golden Service Awards A look at the winner of the ‘Small Education Establishment - Best Cleaned Premises’ award at the 2015 Golden Service Awards.

18 Feature Healthcare & Hospital Hygiene.

28 Feature Computer Systems.

30 New Products

Who’s calling? Bacteria and infection! Sanondaf UK, a disinfection and decontamination specialist, is warning that new research proves that mobile phones present a high risk of spreading infection. The odds are that anyone reading this article will have checked their smartphone in the last hour, whether they are waiting for a call, an email or are just addicted to Facebook or Twitter. A survey carried out by the Journal of Clinical Microbiology and Infection found that mobile phones present a substantial infection risk, with evidence of viruses in 38.5% of devices. The research, undertaken in a French hospital, found that mobile phones used by hospital staff harbour viruses that cause stomach upsets and lung infections. It was also revealed that a fifth of staff did not clean their hands after handling their phones. Scientists took swabs from mobile and cordless phones used daily by 114 doctors and nurses at Saint-Etienne University Hospital in SaintPriest-en-Jarez, France. The most widespread contamination was from rotavirus, discovered on 39 out of 109 phones, which can cause vomiting and diarrhoea. Respiratory syncytial virus genetic material was found on

three phones, and evidence of metapneumovirus was on one. Both of these viruses are associated with lung infections, which in high-risk patients may be severe. Sanondaf UK’s Stuart White said: “These results are quite alarming, and I think will be mirrored across many businesses. The survey found that 64% of workers used their mobile phones during patient care, with 20% of them admitting they had never carried out any hand hygiene procedures, either before or after using their phone. It’s something that many of us do not think

about, but it’s something that businesses need to be aware of, particularly if you are in a caring profession, such as hospitals, care

homes or nurseries. Workplace infection can be spread in a variety of different ways, with the best cleaners in the world unable to catch everything. Businesses lose many man hours a year to illness, which equates to a lot of money being wasted. These businesses need to put steps in place now to protect workers from infection.” Sanondaf is offering all UK businesses a free swab test, including mobile phones. This offer can work in two ways: either a member of the Sanondaf team will come to your workplace and take a few samples, or a swab test kit can be sent out for you to undertake the swab yourself. The samples are then cultured in an incubator and the findings sent back to you in the form of a report. www.sanondaf.co.uk

CSSA to host Open Evening Reserve your place today The CSSA is hosting an ‘Autumn Open Evening’ at Taylor Wessing’s offices in London on 12th October. The event will be open from 5.30 to 7.30pm with refreshments and snacks, and all are welcome. The address of the venue is: 5 New Street Square, London, EC4A 3TW, moments from St Pauls and Chancery Lane Tube stations, and just around the corner from St Pauls Cathedral. For further details and to reserve a place, please contact: john.findlater@cleaningta.org.

www.cleaninghub.net l OCTOBER 2016 l C&M l 5


 Industry News

Cleaning up with support from Yorkshire Bank A Newcastle-based manufacturer of odour control products has moved to new premises and is more than doubling its workforce with support from Yorkshire Bank. The company, 2Pure, obtained a six figure funding package from Yorkshire Bank’s North East Customer Banking Centre, with the deal delivered by relationship manager, Andrew Grundy. 2Pure’s product range was developed using unique patented technology which destroys odours by changing the molecular structure of odour compounds. It also kills odour-causing bacteria which helps to prevent odours from returning and keeps treated areas hygienic. The firm’s flagship product is OdorBac, a powerful cleaning liquid which was specially formulated for use in commercial environments. End users include NHS Trusts, Care UK, the British Museum, Newcastle United, and London Overground. The Newcastle born-andbred business, which spent 20 years developing its technology before gaining a patent in 2014, has tripled production over the past year. The company recently moved to bigger premises in Eltringham Works in Prudhoe to help meet demand and there are plans to create

Letter to the Editor Sir, I welcome the news that UK MPs are calling for a global ban on the use of plastic microbeads in cosmetic and industrial cleansing products. The US has already introduced legislation to ban them and it seems the UK is responding well with this call to action. Plastic microbeads bypass wastewater filtration systems and can find their way into the stomachs of fish, seabirds, and other marine life. This contributes to the 250,000 tonnes of plastic in the world's oceans. It is not just cosmetic products that contain microbeads. Many industrial sites use abrasive hand cleaners that contain them and so manufacturers of these products must find natural alternatives. For example, using a natural olive-stone scrub instead of plastic microbeads will make a big difference. We are pleased to join businesses, such as Unilever and L'Oreal, who have already pledged to eliminate microbeads. As an industry, we should step forward and not wait for legislation to come into effect to force positive change. Yours etc, Bernard Daymon, president and CEO, NCH Europe.

Left to right: Philip Nichols, James Law, Andrew Grundy and Barry Donaghey. 14 new jobs. 2Pure, which attitude, which matches our currently employs about 10 own. With Yorkshire Bank’s staff, is a new customer of support, we are ready to step Yorkshire Bank. up to the next level and beBarry Donaghey, managing come a player on the world director of 2Pure, said: “It’s a stage.” very exciting time for us. Phil Empson, senior manSince gaining our patent a ager at Yorkshire Bank’s couple of years ago, we have North East Customer Bankworked hard to establish the ing Centre, said: “We welbrand. We’re now at a point come the opportunity to where our products are used work in partnership with by many major UK organisa2Pure as they expand and tions and we’re gradually grow the business. A local being adopted by households business, its management across the land. I see the team are committed to reteam at Yorkshire Bank playtaining their Newcastle ing a key role in helping us to roots, growing jobs locally achieve our growth aspiraand strengthening the local tions. We’ve been extremely economy. It is rewarding to impressed by Yorkshire be supporting such a strong Bank’s experience of growbusiness with fantastic ing SMEs and their can-do growth potential.”

Kärcher’s new UK HQ opens its doors Kärcher UK’s brand new, purpose-built UK headquarters opened for business at Banbury’s Brookhill Way on Tuesday 13 September 2016. The move has been a long time in the planning and, as the new site includes a Kärcher Center shop, a large Academy for customer and employee training, and in phase two a Wash Center for the public, the move is expected to make a difference to staff, customers and the local community alike. Since its UK launch in the 1970s the company has

Sustainable Cleaning Products Summit to discuss impact of cleaning The Sustainable Cleaning Products Summit will discuss practical approaches to address the impacts of cleaning products. Hosted in Paris on 26-27 October, the second edition of this executive summit will feature sustainability metrics, green ingredients, sustainable packaging, and consumer impacts. Professor Dr. Michael Braungart, co-founder of the Cradle-to-Cradle (C2C) design approach, will kick off the conference programme with a keynote titled ‘Re-thinking sustainability’. With the sustainability efforts of most cleaning product firms focusing on reducing environmental footprints, Braungart will make the case for positive impacts. How can the detergents industry go beyond lowering impacts and create positive

value? How can the C2C design approach be deployed by cleaning product firms? What are the key lessons from related industries? Subsequent speakers will discuss the role of sustainability metrics. A leading cleaning products firm will share its experiences in using metrics in its sustainability plan. Ecover will then give a critique of metrics. The practical use of metrics will be further discussed by panellists. With growing concerns about sustainable sources of raw materials, the ‘green ingredients’ session covers important developments. Karen Frederix from Wilmar will give an update on sustainable palm oil and its use as surfactant feedstock. Jessica Custer from Fairtrade USA will make the case for ethically sourced coconut oil. Another speaker will high-

6 l C&M l OCTOBER 2016 l www.cleaninghub.net

light the difficulties when monitoring sustainable supply chains for agricultural materials. Jürgen Hack, managing director of the eco-detergents brand Sodasan, will share the brand’s experiences in using green ingredients. The ‘customer impacts’ session will look at ways of encouraging responsible use of cleaning products. How can companies and retailers encourage sustainable purchases and responsible consumption of such products? Kirsi Maria Laitala from Consumption Research Norway will give some findings into sustainable cleaning and laundry behaviour. Coop Denmark will share its experiences in developing and marketing green cleaning products, whilst Deloitte will give success stories on consumer engagement. The concept of ‘sustainable

detergents’ will be featured in a dedicated workshop. Peter Malaise of Meta.Consort Partnership and Fabrizio Zago of Assust have 70 years combined experience in developing cleaning products for sustainability. The workshop leaders will give an assessment of sustainable detergents, covering raw materials, green chemistry and processing, standards and labels, as well as marketing issues. Expert insights will be given on the future direction of sustainable detergents. A second workshop will discuss the packaging impacts of cleaning products. Michel Fontaine, president of the French Packaging Council, will give practical solutions to brands looking to make their packaging more sustainable. www.sustainablecleaning summit.com

grown to employ almost 300 people and its product range now encompasses 380 machines across 13 product lines for both home and garden and professional users. Simon Keeping, managing director of Kärcher UK, said: "While Kärcher is renowned for our commercial and domestic pressure washers, other products are increasingly coming to the fore among them our window vacs, steam cleaners and professional floor care solutions. These are exciting times and this opportunity, afforded by the company's expansion, is testament to the quality inherent in Kärcher - not only of our products but of our team and its ethos too. In order to maintain continuity amidst our growth and retain key Kärcher knowhow, remaining near to our Banbury roots was crucial. Indeed the new site is only one mile from the old, albeit the environment will be very different.” The company is confident that the Kärcher Academy, through its certified training courses, and Kärcher Center Banbury, through informal advice and support, will each serve to help better acquaint visitors with smarter, greener and more efficient cleaning practice. The company’s new address is: Kärcher House, Brookhill Way, Banbury, OX16 3ED. Tel: 01295 752000. www.karcher.co.uk


 Industry News

Don’t forget to get all the latest news from the cleaning industry’s online information source:

CountyClean rebrands for a sustainable future Eastbourne based company CountyClean Group has unveiled a new visual identity with simplified logo, new strapline and enhanced online presence to support its future plans and evolution to become a leading liquid waste management solutions provider across London and the south east. “This is a very exciting time for my company and its everexpanding client base,” said Mike Walker, managing director of CountyClean. “We feel that our growth has enabled us to develop our marketing strategy with the aim of creating an even stronger and sustainable brand presence. Based on customer feedback and through our commitment to quality services, this summer we are also starting a new chapter with a large scale waste management facility in Surrey as well as significant investment in brand new road sweeper trucks. We believe that the rebrand and launch of the new website represents our ambitions and

demonstrates how CountyClean Group has evolved into the most progressive liquid waste management solution provider for London and the south east of England.” The redesigned CountyClean Group website www.countycleangroup.co.uk - enables visitors to quickly and easily navigate the company’s array of services and get in touch in an emergency, whilst reinforcing communication by engaging with current and prospective

clients, trade authorities and the media. Business development manager, Louis Dimmock, said: “It is important that CountyClean Group retains its established values but at the same time develops a new and modern identity. We are eager to let people know what we stand for and we believe that our new tagline ‘effective liquid waste management solutions’ signifies our commitment of quality to our clients.”

Sodexo leads sustainability index for 12th year Sodexo is once again the top-rated company in its sector on the Dow Jones Sustainability Index (DJSI), giving the group 12 consecutive years of recognition in corporate responsibility. Sodexo is also named number one of consumer services companies for the third year in a row. The DJSI is one of the major global sustainability benchmarks and a leading source of information on sustainability investing. The annual DJSI review is based on a thorough analysis of the corporate economic, environmental and social performance of over 2500 listed companies, assessing issues such as corporate governance, risk and crisis management, climate strategy, environmental policy/management systems, supply chain standards, labour practices, and philanthropic activities.

Monthind Clean opens new administration hub Monthind Clean has opened an administration hub at its new office in Gorleston, Norfolk. Simon Howes, window and specialist cleaning business manager, said: “We operate across the whole of East Anglia and our operatives are based in optimal locations, including Peterborough, Cambridge,

Great Yarmouth, Norwich, Ipswich, Colchester, and Harwich, facilitating a service provision that is second to none. Our new office in Gorleston allows us to consolidate the administrative processes including sales, health and safety, and training resulting in streamlined and cost-effective manage-

8 l C&M l OCTOBER 2016 l www.cleaninghub.net

ment. We provide our workforce with the best training, including day to day health and safety training through IOSH, IPAF certificates to enable our operatives to use an extensive range of access platforms, and PASMA to give us the flexibility to use mobile scaffold towers.” www.monthindclean.co.uk

Jigsaw Cleaning Systems

The importance of investing in technology Matt Baines is learning and development manager at Jigsaw Cleaning Systems. Here, in his regular column, he talks about the benefits of investing in technology. Whilst I do not consider myself a proponent of change for the sake of change or of introducing unnecessary complexity into operations, I am certainly not averse to change when it is appropriate and is proven to provide benefits for the operative, the service provider and/or the client. The last two or three years have delivered some notable advances in scrubber drier technology which deliver clear advantages to all three of these groups and are therefore well worth the investment. These advances include lithium-ion batteries, dosing systems, and Wetrok’s Quick Fill systems, Power Whirl technology, and Touch n Clean handles. Although lithium-ion batteries are currently more expensive than their gel or wet-cell counterparts, they deliver what I consider to be such ‘pros’ over the single ‘con’ of cost that I would choose them every single time where available. With lithium-ion batteries the benefits include longer machine run times, longer battery life, and a significant reduction in the opportunity for operative error. Lithium-ion batteries are maintenance free and do not suffer from the battery memory issues which gel and wet-cell batteries do. Admittedly, dosing systems aren’t the newest of technological advances in scrubber drier cleaning but it does continue to surprise me how often people choose to purchase machines without this optional extra given that it removes the opportunity for chemicals to be used at stronger than recommended concentrations, ensures chemical damage will not be caused to a machine’s internal componentry, and guarantees the scrubber drier chemical will deliver continuous cost-in-use benefits. While the name of the Quick Fill system - featured on the Wetrok Duomatic and Drivematic series of machines - might at first glance lead you to believe it facilitates speedier filling of the scrubber drier, what it in fact allows is for the operative to carry out other tasks whilst filling is taking place. The Quick Fill system is an integrated hose coupling on the machine which has a cut off device meaning that the operative can connect their hose to the coupling, turn on the water and go about doing other things without fear that the machine will overflow. As you can appreciate when we are talking about filling machines with capacities of over 55 litres, this feature can help improve efficiency by utilising labour that would otherwise be consumed watching a machine fill with water. Wetrok’s patented Power Whirl technology, again featured on the Duomatic and Drivematic series of machines, significantly improves suction as a result of innovative design modifications to the squeegee assembly. The results are so good and the floors so dry post-clean that it does make you query at first whether the machine is in fact putting any water down. Obviously it is, but the drier floors provide increased safety and reduced resoiling by nature of the fact that wet or even damp floors will re-soil more quickly underfoot. Once the machine is powered up, the Touch ‘n’ Clean handle, featured on Wetrok’s Duomatic series, allows for it to start operation automatically once the operative touches the handle and stop automatically when it is released. This feature combined with the ‘drawbar’ handle height adjustment puts ergonomy at the core of the machine’s design and significantly reduces operator fatigue whilst considerably increasing manoeuvrability. I have no doubt that technology in cleaning is well worth the investment on the proviso that it delivers measurable benefits in efficiency, cost in use, longevity, and reduced service costs. www.jigsawcleaningsystems.co.uk


 Industry News

British Institute of Cleaning Science

Don’t let the bedbugs bite Stan Atkins, CEO of BICSc, reports.

If you’ve been travelling this summer, make sure your holiday souvenirs aren’t the only thing you’re bringing back home with you. It may come as a surprise, but bedbug prevalence is on the rise, and hotel rooms are amongst their favourite hangouts. A 2015 ‘Bugs Without Borders’ study found that bedbug cases are significantly higher than they were 15 years ago, and New York City hotels alone saw a 44% increase in infestations for January of this year compared to 2015 (and that even included fivestar hotels). So what can you do to prevent a bedbug infestation coming back home with you? To minimise your risk of picking up these unwelcome visitors, experts say you should never set your luggage on a hotel bed or floor. Bedbugs can easily hitch a ride on your luggage and clothes without being noticed so it is best to avoid the risk of contamination if you can. When unpacking it is best to use luggage racks to hold your luggage and when returning home, unpack directly into a washing machine and inspect your luggage carefully before allowing it near your bedroom. "Bedbugs are least likely to be found in the bathroom," said Missy Henriksen, vice president of public affairs for the National Pest Management Association. "They don't like the tile floors, and there aren't as many hiding places.” When you arrive at your hotel room, it is a good idea to put your luggage in the shower or bathtub while you inspect the room for any signs of an infestation. Check under the bed sheets, all of the way around and under the mattress as well as behind the headboard. If you see any suspicious signs, alert the hotel staff immediately. But what do you do if you are the hotel staff? If you’re involved in cleaning hotels, then these statistics will probably alarm you, but there are plenty of things you can do to help prevent a bedbug infestation taking over your hotel. Although bedbugs have not been directly linked to poor cleanliness, maintaining good levels of hygiene has been found to reduce the instances and level of infestation. Poor housekeeping can make it harder to identify bedbugs before they get out of control. The NHS advises: “Keep bedrooms tidy and remove clutter, especially from the floor and under the bed. This will reduce the amount of places for bedbugs to hide in.” It is also a good idea to regularly vacuum and clean mattresses to remove any dead skin cells and dust which may attract these insects. The best thing you can do is make sure all of your cleaning operatives are correctly trained in these procedures to reduce the chance of an infestation. To find out more about BICSc accredited cleaning training, visit: www.bics.org.uk. 10 l C&M l OCTOBER 2016 l www.cleaninghub.net

Putting pledges on staff welfare into practice Facilicom UK has followed up on its pledges as part of the Equality and Human Rights Commission’s (EHRC) Cleaning Taskforce campaign to improve the working conditions of those employed in the industry. To ensure everyone who works there is aware of their rights and responsibilities, Facilicom has distributed the material developed by the Taskforce to colleagues across their business. This encompasses a: • Know Your Rights guide, included within the recent ‘In Touch’ company magazine to ensure all staff have visibility. • Dignity and Respect posters in the cleaning cupboards. All the materials are available on the EHRC website: www.equalityhumanrights.com Lisa Sheppard, director of development at Facilicom, said: “We have played a key role representing the contract cleaning industry as part of the EHRC Cleaning

Taskforce, and are keen to ensure the campaign is not something that is launched with a big fanfare and then consigned to a shelf. We are passionate about improving the working conditions of those employed in the cleaning industry. Making sure our colleagues have copies of this material is just one of the ways we are continuing to support this important campaign.” Facilicom has committed to improving the conditions

in which cleaning operatives are expected to work by endorsing the EHRC’s campaign and pledging to: • Promote employers’ compliance with employment law and improve understanding of employment rights. • Improve the impact of public and private sector procurement of cleaning services on employment conditions in the sector. • Encourage the respectful treatment of cleaning operatives. Johnson Obweku, a cleaning team member at Facilicom, said: “I enjoy working at Facilicom as the company does a lot to show it values us. This includes extensive training and paying the Living Wage whenever possible. The information they are giving to me and my colleagues who work in cleaning will help us all to know our rights and be treated with dignity and respect.” www.facilicom.co.uk

Monthind raises £2000 for Macmillan With over 135 customer sites in Norfolk and employing over 190 staff in the county, Norfolk has always been an important region in Monthind’s portfolio. The opportunity to support a local fundraising event, whilst raising money for its chosen charity, Macmillan Cancer Support, led the company to join over 2500 cyclists of all ages and abilities and enter a team in the Tour De Broads. Between them, Simon Biggs, Tony Payne and Chris Brown raised an impressive £2000 for the charity. Monthind’s sales and marketing business manager, Tony Payne, said: “The Tour de Broads is a fantastic event - you can choose to ride just three miles or up to 100 miles, and the longer routes incorporate 16 Broads, four rivers and countless beautiful Broads National Park villages. The hardest part is not stopping off to enjoy your surroundings for a few hours, but it opens your eyes to the amazing countryside on our doorsteps, and I now have a long list of day trips planned. It is important to us, as a company, to balance our corporate goals with our social responsibilities - we involve ourselves in local events, and raising money for a national charity that brings benefits to local people is a high priority for us.”

Middlesex University continues with ISS Middlesex University has confirmed the continuation of its contract for cleaning services with ISS. ISS will deliver cleaning and associated services at the Hendon Campus of the university for an additional three years, with further scope for extension. Jamie Smith, deputy director, estates and facilities services at Middlesex University, said: “After a comprehensive open tender process for cleaning and associated services for Middlesex University, I am pleased to confirm that ISS Education

has retained this contract for a further three years. The awarding panel assessed the final six companies on their ability to provide solutions for the services sought, their ability to work with the university on implementing the London Living Wage - as calculated by the Living Wage Foundation - and a competitive pricing structure. The ISS submission, presentation and a strong local leadership presence allowed the panel to conclude that ISS were the right company to take forward the new contract and

the university looks forward to continuing a successful and productive partnership.“ Mark Davies, managing director, ISS Education, said: “We have already worked with the university for some years and share their commitment to being a leading centre of excellence for a wide range of students and stakeholders. We’re delighted that the university liked our innovative proposals and agreed to continue the partnership in the next phase of their development.” www.uk.issworld.com


Industry News 

Mud, sweat and tears Caring partners

The Lyreco team after the Tough Mudder. Staff from Lyreco cleaned up for charity after completing two tough challenges in one weekend. A team of 17 runners braved six miles of mud and more than 15 brutal obstacles to take part in the Tough Mudder Half event at Cholmondeley Estate, Cheshire. France-based HR director, Morten Wiil, travelled to the UK to take part in the event in September, with the team raising funds for the firm’s worldwide education programme. While his colleagues were tackling the assault course in Cheshire, Lyreco sales manager, Richard Young, was facing his own challenge competing in a Half Ironman in Weymouth including an open water sea swim of 1.2 miles at 7 in the morning followed by a 56-mile bike ride, featuring more than 2000ft of hill climbs, and finally a 13.1 mile run. The fundraisers, including Telford-based managing di-

rector, Peter Hradisky, are on target to raise more than £4000 for Lyreco for Education, a programme that aims to give children living in poor conditions a better access to education. Hradisky said: “The Tough Mudder was just that - very tough and very muddy! We worked as a team and finished as a team, expertly guided by our Tough Mudder expert and marketing team member, Liam Forrester, who has completed the course more than 20 times. Not only did we successfully complete it, we enjoyed it too. For all of us to complete the race in one piece was a great achievement and we’re all very proud. Richard’s challenge was even tougher than ours and he has put many hours of hard work and training into preparing for the Half Ironman. For all of us, the motivation of raising money for Lyreco for Education helped spur us on to finish and we’re

delighted to have raised so much money to help more children into education.” Along with Peter and Morten, the Tough Mudder team was made up of staff from across the country including the field sales director Greg Fry, Chris Tame, the regional sales director for London and south east, and Goff Day, the firm’s regional sales manager in the south west. They were joined by the Telford based staff who were training manager Selina Jackson, internal communications manager Louise Hoffman, recruiter Steph Powell, Natalie Tait and Rob Marks from the training department, three marketing specialists Ali Hendy, Amy Williams and Liam Forrester, Luke Roberts from customer services, area sales manager Sean Clarke, Steve Moran, commercial sales support manager, and Helen Reid, Lyreco’s inside sales manager.

Axis recognised as fair employer The Living Wage Foundation has formally accredited two Axis Group companies, recognising its support of the Living Wage and to further best practice in the industry. Axis Security is now a Recognised Service Provider and committed to not only pay its head office staff the Living Wage but also promote the Living Wage to its clients. Sister-business Acuity provides a receptionist service to the London market and is a Living Wage employer that has always paid all employees far in excess of the Living Wage. Jonathan Levine, Axis Group’s CEO, explains that employees are at the centre of its service proposition, and that good customer service is derived from employees feeling valued and motivated: “People are the lifeblood of our business, and by investing in our people we will always be a good and fair employer. Our focus is on ensuring all employees will have a good work-life balance, which in turn increases productivity and ensures the business enjoys a strong corporate reputation. We are extremely proud to support and be a part of this group.” www.axis-security.co.uk

In-care c cleaning solutions Specially formulated to deal with urine contamination in carpets, Neutra-Soft® is just one in a range of Prochem products ideally suited to caring environments. Use with the Fivestar carpet cleaning machine for perfect results – caring for carpets and fabrics; caring for people.

BY APPOINTMENT TO HER MAJESTY THE QUEEN SUPPLIER OF CARPET CLEANING PRODUCTS PROCHEM EUROPE LIMITED CHESSINGTON SURREY

To discover the complete Prochem product range, including detailed specs and pricing, call us now on 020 8974 1515 or visit www.prochem.co.uk

www.cleaninghub.net l OCTOBER 2016 l C&M l 11


 Contracts

£2.4 million in additional cleaning £50 million Morrisons contracts secured contract awarded Maxim Facilities Management is going back to school after winning a number of new contracts in the education sector worth a total of £2.4 million. The company has secured the three-year contracts with a number of secondary and tertiary educational establishments around the UK, including in Kettering, Manchester, Lancaster, and its native North East. The contract wins have resulted from a strategic decision taken by the company two years ago to increase its focus on the education sector, which has seen the proportion of Maxim's overall business based on this sort of client rise from 10% to nearly 25% today. And it has also helped the Sunderlandheadquartered firm to grow the number of people it employs to over 800, with a number of people with education sector management experience being brought in to service the contracts that have been won. Graham Conway, founder and managing director at Maxim FM, said: "We saw the trend for more responsi-

bility for facilities management work being devolved to teams within educational establishments that already had wide-ranging responsibilities, and felt there were opportunities to increase the amount of business we did in this sector, a strategic approach which is now paying clear dividends. We've developed a sector-specific package that enables the schools and colleges with which we work to access the services they require in a cost-efficient and effective way, and the technology investments we've made give them the reporting insight they require into how and when our teams are carrying out their work. We think there is a

great deal more potential to be realised in this sector, particularly within the north east, and we'll be continuing to try to keep the proportion of our business that is focussed on the education sector at around 25% as it grows in the years to come. We have already grown to be the largest independent contractor in our field based in the north east region. We are now focussed on continued organic and acquisitive growth over the next five years to develop into a very substantial business - one that can compete with and succeed against the biggest players in our industry across the UK." www.maximfm.co.uk

Working at height specialism lands Olympic-sized challenge CAM Specialist Support’s expertise in high level cleaning has secured it a contract to clean the Here East building in The Queen Elizabeth Park, Stratford, London. Previously part of the London Olympic site, the building was used as the media centre during the 2012 games. Current tenants include BT Sports studios, Loughborough University and a number of new start up and retail clients. CAM conducts bespoke risk assessments for every job it carries out and selects the most appropriate work at height method, or methods, from its armoury. This includes rope access, mobile elevated work platforms and water-fed pole systems. Sean Canty, director at CAM Specialist Support, said: “I’m delighted to have won the contract for this showcase building. The client told us we were specifically selected due to our reputation for delivering quality service and our understanding of the specific and unique requirements of delivering a clean building when working at height.” www.camsupport.co.uk

NIC Services Group has been awarded a circa £50 million contract with Yorkshire based supermarket chain Morrisons. The contract will see NIC delivering services across the north of the England and Scotland. NIC was awarded the contract following a successful pilot scheme which was completed earlier this year. NIC’s innovative approach to cleaning and its knowledge of the retail sector ensured it was selected by Morrisons. John Spencer, group chairman at NIC, said: “We are extremely proud to be partnering with Morrisons. This award is particularly significant given that Morrisons has never outsourced its services before. I am sure our extensive experience in this sector will ensure the highest standards of service delivery for Morrisons and its customers and colleagues.” www.nicgroup.co.uk

Three year John Lewis contract Premium Support Services (PSS) has been awarded a three year contract with the John Lewis Partnership to provide cleaning services to its portfolio of properties in the Greater London region. This portfolio comprises 128 sites including distribution and corporate office buildings plus Waitrose and John Lewis stores. The services to be provided include core cleaning, periodic and window cleaning. PSS is a family owned and operated commercial cleaning contractor delivering cleaning services to corporate clients across London, the home counties and the south of England. www.premiumsupportservices.co.uk

Finger lickin’ good!

TC Facilities Management (TCFM) is now an added ingredient at over a quarter of KFC restaurants across the country. The contract being delivered by a team from TC Specialist Services, part of TC Facilities Management (TCFM), will provide window cleaning services to over 200 KFC restaurants, along with jet washing services to sites with ‘drive-thrus’. The contract will utilise jet washing technology along with innovative software which will help to deliver robust scheduling, monitoring and management reporting to KFC. Eric Dawson, business manager, TC Specialist Services, said: "We are delighted to become part of the team at KFC UK and Ireland. We’re looking forward to offering a fresh approach to make the dining experience, whether in the restaurant or at home, an enjoyable one.” www.tcfm.co.uk 12 l C&M l OCTOBER 2016 l www.cleaninghub.net


MEET ROBO 2 SERVICE THROUGH INNOVATION

AUTOMATED INNOVATION

The award-winning Robo 2 is available with guaranteed savings and efficiencies of up to 50%! Why choose the Robo 2? The Robo 2 is the most advanced fully autonomous industrial FOHDQLQJPDFKLQHLQWKHZRUOG7KDQNVWRLWnVXQLTXHDQGSUHFLVH QDYLJDWLRQV\VWHPWKHPDFKLQHLVLQGHSHQGHQWDQGKLJKO\ efficient. It detects its surroundings and automatically cleans the entire floor area. The Robo 2 is the only machine of its kind that will clean FRPSOH[DUHDVWKDQNVWRLWVXQLTXHODVHUDQGVHQVRUWHFKQRORJ\

5RER7KH%HQHILWV •&OHDQLQJFDQWDNHSODFHDWDQ\WLPHGD\RUQLJKW

,WRIIHUVXQOLPLWHGFOHDQLQJSDWWHUQVDQGFRQVLVWHQWFOHDQLQJULJKW XSWRWKHHGJH,WRXWSHUIRUPVDQ\RWKHUURERWLFPDFKLQHZKHQ FOHDQLQJWLJKWFRUQHUVHGJHVDQGFRPSOH[URRPV

•5RERFDQFOHDQFRQWLQXRXVO\IRUXSWRKRXUV

Ideal environments for the Robo 2

•8VLQJLWVVRQLFEXPSHUVHQVRUVDQGXQLTXHODVHUUDGDUWKH5RER FRPSOHWHO\DYRLGVVWDWLFWHPSRUDU\RUPRYLQJREVWDFOHV,WZLOO UHWXUQWRFOHDQDQ\DUHDVWKDWKDYHEHHQPLVVHGGXHWRWHPSRUDU\ REVWDFOHVEHLQJSODFHZLWKLQWKHFOHDQLQJDUHD

Retail :KHWKHULWEH6KRSSLQJ&HQWUHV)RRG5HWDLO6WRUHVRU+LJK 6WUHHWORFDWLRQV5RERnVXQLTXHFOHDQLQJV\VWHPLVVXLWDEOHIRU all retail environments. 7UDQVSRUW )URPRYHUJURXQGRUXQGHUJURXQGVWDWLRQVWRWKHODUJHVWRI WHUPLQDOKDOOV5RERKDVWKHVRSKLVWLFDWLRQDQGUREXVWQHVVWR ZRUNLQGHSHQGHQWO\LQWKHKDUVKHVWRIFOHDQLQJDSSOLFDWLRQVLQWKH WUDQVSRUWVHFWRU Education 6SRUWVKDOOVFRUULGRUVFDQWHHQVWKHIOH[LELOLW\RIWKH5RER cleaning system ensures it will be suitable for large schools, colleges and educational institutions. Healthcare /DUJHKRVSLWDOFRPSOH[HVDUHDKLVWRULFDOODERXULQWHQVLYH FOHDQLQJFKDOOHQJHGXHWRQRLVHSROOXWLRQDQGSDWLHQWFDUH 7KHORZQRLVHOHYHOVDQGoFOHYHUpRSHUDWLRQRI5RERPHDQV WKDWFOHDQLQJFDQWDNHSODFHGD\RUQLJKW7KLVHQVXUHVWKDW ODERXUFDQEHDWWULEXWHGWRPRUHLQGHSWKFOHDQLQJWDVNVDURXQG infection control and hygiene standards.

)RUSULFLQJDQGIOH[LEOHUHQWDORSWLRQVSOHDVHFRQWDFW us: ZZZLFHFOHDQFRP HQTXLULHV#LFHFOHDQFRP facebook.com/meetrobo2 #,&(FOHDQOWG

•5RERZLOOFOHDQFRQVLVWHQWO\DQGWKRURXJKO\HYHU\GD\ZHFDQ JXDUDQWHHWKDWFOHDQLQJDQGK\JLHQHUHVXOWVDUHPD[LPLVHG

•6DIHW\5RERLVHTXLSSHGZLWKDQHPHUJHQF\VWRS EXWWRQJXDUDQWHHLQJWKDWLWZLOOVWRSLPPHGLDWHO\LIWKHEXWWRQLV SUHVVHG7KHPDFKLQHDXWRPDWLFDOO\VORZVGRZQZKHQLWGHWHFWV DQ\REVWDFOHVFORVHE\DQGWKHEHDFRQRQWRSRIWKH5RER IODVKHVFRQWLQXRXVO\ZKLOVWLQRSHUDWLRQ7KHVHQVRUVDQGODVHU radar system ensure that the machine avoids stairwells and other GURSV •5HPRWHPDQDJHPHQW5RERLVILWWHGZLWK60$57WUDND WHOHPHWU\V\VWHPWKDWJLYHVFRPSOHWHYLVLELOLW\RIZKHUHLWLV ZKHQLWKDVEHHQXVHGDQGKRZORQJIRU7KLVJLYHVXQSUHFHGHQWHG management information that can be accessed remotely from a 3&WDEOHWRUVPDUWSKRQH


 British Cleaning Council

Sustainability in the cleaning industry...and a focus on ICMMA

By Simon Hollingbery, chairman, British Cleaning Council. Sustainability is a word we’re all used to by now and it remains a core value at the heart of the BCC mission statement. One of the Council’s biggest aims is to decrease the cleaning industry’s environmental impact by encouraging responsible policies and practices. Central to this, though, is the belief that national and local regulators should achieve compliance through education and advice, as opposed to through enforcement and punishment. Many other sectors have been

helped to go greener with grants, whilst the cleaning industry has come a long way in this area under its own steam. But It’s not just about doing the right thing, it’s also good for business, as many building owners and facilities managers now insist on more sustainable working practices. BCC members understand this and are signed up to operating as sustainably as possible, where it relates to their own business, whether it be production, contract cleaning or training. One area that has seen huge advancements over the years is chemical production. Cleaning products in the past were often highly toxic, but today, thanks to innovations the industry has embraced, products are less toxic, cheaper and in many cases now achieve better outcomes than before. This has helped the industry change its operational practices with all stakeholders benefiting. Schools, for instance, are now cleaner, safer and more Contact details

14 l C&M l OCTOBER 2016 l www.cleaninghub.net

environmentally sound due to greener cleaning. Numerous studies in the US and Europe show improved air quality in schools leads to big drops in absenteeism and better student results. These technological advancements are to be welcomed, and the Council supports taking a greener approach where it is practical. We recognise it is impossible to be 100% sustainable at all times, but the cleaning industry has made enormous strides to be environmentally sustainable and we welcome any new innovations that can help the industry be greener. Focus on ICMMA and its new BCC representative, Andrew Dunning The Industrial Cleaning Machine Manufacturers` Association (ICMMA) is the trade association of the manufacturers of industrial and commercial cleaning equipment. Its members represent the most prominent manufac-

turers, producers and distributors of cleaning machinery and equipment to the UK commercial cleaning and facilities management industries. This summer, ICMMA’s representative to the BCC, Kevin Day, stepped down and Andrew Dunning, distribution manager for Numatic International, was appointed to the role. Andrew has over 16 years’ experience in the cleaning industry and has the perfect skill set and industry knowledge to serve ICMMA’s member interests well. It’s the second time he has sat on the BCC Council, and he says it’s a great privilege to be asked to serve again: “These are exciting times for the UK cleaning industry and I’m really thrilled to be asked to represent ICMMA at the BCC. A few years ago I sat as the associ-

ation’s commercial chair on the Council and so I already know some of the members, but I’m really looking forward to meeting new associates.” Andrew started his career in the cleaning industry scrubbing toilets at Yeovil General Hospital as part of his original BICSc training, and this ‘baptism of fire’, he says, has always left him with a understanding and respect for those at the coal face. He says the recent Brexit vote means ICMMA members will have to adopt a truly international perspective and now look beyond Europe and move to form alliances with associations in other key territories, particularly the United States. But he thinks the future is exciting, particularly in the area of robotics: “We’re already seeing a lot of technological advancement in robotics and the Internet of Things and this will only get stronger in the coming years. Our aim is to be in on this from these initial early stages to help create standards.”

For further information on the British Cleaning Council and details of its members contact: The General Secretary, BCC Ltd, PO Box 10362, Syston, Leicester, LE7 2WJ, UK E: info@britishcleaningcouncil.org W: www.britishcleaningcouncil.org


People 

People Elevance Renewable Sciences Inc, a high-growth company that creates novel speciality chemicals from natural oils, has hired Karl Schoene as the company’s president and chief technology officer. In this role, Schoene will help the company continue to focus on accelerating commercialisation activities and revenue growth, and focus on building world-class business development and technology capability. “Karl’s experience in business-to-business markets and process manufacturing industries, including chemicals and renewable energy, makes him an excellent addition to our leadership team,” said Elevance CEO, Tony Parnell. “In this position, Karl will work closely with me and the other members of the leadership team to continue our focus on commercialisation activities and revenue growth, and provide leadership to the technology and business development organisation. We are excited to welcome him to our company.” Prior to joining Elevance, Schoene was president and CEO of Accutest Laboratories, a network of seven labs and 14 service centres across the US. In this role, he led nearly 700 employees through a major performance turn-around and M&A process, culminating in a sale this year to SGS, where he continued to lead the acquired business through a successful post-M&A integration. Previously he held several positions, including president, COO and CEO of InEnTec, and prior to that, held several positions at AkzoNobel Polymer Chemicals, including vice president and global SBU manager, general manager and global business manager in organometallic specialties, polymer chemicals and agriculture applications. Schoene also held executive leadership positions at Crompton Corporation and Witco Corporation, was a manager at Amoco Corporation and Albemarle Corporation Olefins and Derivatives Division, and was a senior R&D specialist and chemist with Ethyl Corporation. He also serves at board-level and in advisory board roles to several start-ups in diverse industries, including speciality chemicals, pharma and medical devices.

Jo Fidge has joined the Robert Scott and Sons national sales team as regional manager for the south east. Fidge, who lives in Kent, has been involved with sales for the past 14 years working for a number of high profile companies including Arco, WF Electrical and Tennants Distribution. Before that she worked for Glaxo for 13 years as a manufacturing operative.

Jo Fidge. Gill Ireson, Robert Scott Group’s sales manager, said: “Jo’s experience and drive will be important qualities for the sales team and she has already begun to make her mark with our customer base across the south east. This is a very busy time for us with both established and new customers - our range of products and services are in great demand across all sectors particularly in healthcare, hotel and catering, and commercial organisations. Jo will be a great addition to the team.” Dave French, former business development manager and corporate account manager at Duplex Cleaning Machines, has left the company to establish an infection control and cleaning equipment division at The Dodge Company. Dodge is currently a supplier of equipment and supplies into the funeral care, crematoria and mortuary markets. French will be looking to extend its current range in terms of equipment and chemicals and branch out into other business sectors. Dave French.

G4S FM has announced the appointment of Deanne Le Gresley as managing director of overall business operations for Jersey and Guernsey. G4S offers a complete service range for secure environments from cash transit to security, facilities management and logistics. As managing director, Le Gresley leads the senior leadership team, in addition to managing Channel Islands hard FM services, Channel Islands health and safety, and Ports of Guernsey working across the public and commercial sectors. She is responsible for the main business processes, as well as the continuing development of the service delivery model for the Channel Islands. Le Gresley has been with G4S FM for two years, was most recently MD of the Guernsey business and reports to the UK FM national customer services director, Mike Jones, who said: “Deanne’s industry and regional experience is a real asset to G4S. Her challenge is to continue to grow our business in the public sector, financial services and tourism industries in Jersey and Guernsey, as well as develop our workforce.” In order to spearhead the transition from its existing individual business units to become Ecobat Battery Technologies, parent company Ecobat Technologies and the Ecobat group has recruited Philippe Desnos as vice president and managing director of the new pan-European entity. Desnos has good aftermarket pedigree, having worked for a number of prominent companies within the automotive industry beginning with Lucas in 1995, followed by Lucas TRW and then Delphi where, since 2013, he has been president of the aftermarket operation. “Taking the helm at this exciting time is both a great privilege and an opportunity,” said Desnos. “We have to ensure that the existing businesses, all of which have operated very successfully within the wider group, continue to grow from their excellent foundations. In order to allow them to do so, we are developing our partnership philosophy, which brings multiple benefits across all our business relationships from supplier to manufacturer to recycler but, most significantly, to our customers, who will continue to be our primary concern and therefore, our most important partners.”

Just add the operator Everything else is taken care of

3 Years Fully Inclusive Service and Maintenance Package • 4 annual maintenance visits • Breakdown coverage • 24 hour response time • Extended warranty • Spare parts and consumables included • Loan machines available

3 Years Fixed Cost With no hidden surprises, know exactly how much this machine is going to cost over the next 3 years

3

Years Peace Of Mind

www.nilfisk.co.uk · Tel. 01768 868995 mail.uk@nilfisk.com Follow us on Twitter

and Facebook

Search ‘NILFISK UK IE’

www.cleaninghub.net l OCTOBER 2016 l C&M l 15


 Golden Service Awards

Golden Service Awards 2015 Top of the class at Inverkeithing School Inverkeithing Primary School in Fife is a credit to its staff and pupils, and the great job its cleaning team from FES FM does as part of that team has been recognised with a win in its category at the 2015 Golden Service Awards, sponsored by KimberlyClark Professional. The category which FES FM won was ‘Small Education Establishment - Best Cleaned Premises’. “The judges were really impressed with the job done by the team at Inverkeithing Primary School,” said Peter Oliver, general manager UK, France and Ireland, Kimberly-Clark Professional. “FES staff are a vital part of the school community.” FES FM is responsible for cleaning the school, which has a school roll of 280, under a 30-year Public Private Partnership contract, which commenced when the premises opened on 31 October 2006. The school’s 15 classrooms are cleaned by three FES staff on a flexible basis. “It’s important to be adaptable,” said Michael Kenny, soft services manager at FES FM. “The work is done on the basis of an output specification that requires the whole school to be clean and ready for use every day.” The school facilities are all located in one ground floor building ensuring access for all. There are 15 classrooms with wet areas, along with a diverse array of rooms including a community lounge, dining hall, separate gym hall with changing rooms, tutorial rooms, a music room, and IT/Library room, a medical suite, administration offices and reception area, soft rooms, and a sensory room, which requires extra special attention. The building is open from 7.00am to 6.00pm with cleaning carried out from 7.00-8.30am and 3.00-6.00pm. FES’s site supervisor is Elaine Wright, who has worked at Inverkeithing Primary School for the nine years since the contract started. She was also a pupil in the old school. She has overall responsibility for the practical organisation of the day to day cleaning operation and works in consultation with the area cleaning supervisor and soft services manager to maintain a clean teaching and support environment within

Sponsored and Supported by:

The team at Inverkeithing School.

Receiving the award from host John Culshaw and Kimberly-Clark Professional’s Stephen Kerr.

the set annual budget. She also organises appropriate BICSc training for all cleaning staff who have their Licenses to Practice, as well as other relevant tasks. “Elaine works closely with the school’s head janitor,” said Michael Kenny. “Together they make sure the premises are ready for any school events or lettings. She is also in constant contact with the school representative to ensure client satisfaction. She checks all areas on a daily basis and makes sure daily cleaning logs are filled in to give a complete record of the work carried out.” Elaine Wright said: “From the day to day routine of cleaning and paperwork, including ordering stock, asset management, stock takes, checklists and team management, to the interaction with school staff and children alike, I can honestly say I love my job! My passion for all things crafty also comes in handy when assisting with making props and costumes for school plays.” Michael Kenny continued: “We operate an 'open door policy' where members of staff are encouraged to have open and honest discussions at any time with their line manager and put forward suggestions for improvement. Our ethos is fostering effective team work. We believe that the team operates more effectively when all pulling in the same direction and properly guided

by an effective leader who coaches employees, generates enthusiasm, and develops people, and I believe that the team at Inverkeithing falls into this category. They are a pleasure to work with and as the head teacher’s testimonial confirms, they are an integral part of the school community. Another indicator of a contented team is that the absence rate is around 1%, which is a figure generally unheard of in the cleaning industry.” Caroline Gardiner, head teacher, said: “I would like to take this opportunity to let you know about the excellent service we receive from the FES team here at Inverkeithing. As head teacher I feel it is crucial that the right school environment is the key to creating the right school ethos and at Inverkeithing we are very fortunate to have excellent facilities that are so well taken care of by our FES team. I am always very proud when showing round potential new pupils and their families or visitors to our school. Our values are ‘Look Smart, Think Smart, Act Smart’ and this starts the minute you enter the school car park and then walk through the main entrance. The FES team really make this happen.” Peter Oliver concluded: “A primary school must be clean, safe and well managed. FES FM plays an integral role in making that happen at Inverkeithing Primary School.”

The Golden Service Awards Further information from: 0203 468 0923

gsa@suzannehowe.com

www.goldenserviceawards.co.uk

Together We Create Exceptional Workplaces s

cleaning equipment services PART OF

16 l C&M l OCTOBER 2016 l www.cleaninghub.net


AY TO W L A N O I S S E F THE PRO IPS

R T D N A S P I L S D AVOI

FiMOP is the ideal daytime cleaning partner; perfect for use in leisure centres, hotel lobbies, retail environments and food outlets.

NO MORE WET FLOORS DRIES AS IT SCRUBS FOR A SAFER WORKPLACE

TRIAL IT FOR FREE FOR A WEEK*

LITHIUM BATTERIES

CALL US ON

LIGHTWEIGHT

0845 6028271 OR EMAIL roc@reintec.com *T&Cs apply

LITHIUM BATTERY CHARGES LIKE YOUR MOBILE PHONE

COMPACT, LIGHTWEIGHT AND EASY TO USE

SAFE & CLEAN CLEAN WATER TANK MEANS NO CROSS CONTAMINATION

TIME SAVING SAVES TIME LETTING YOU CONCENTRATE ON YOUR BUSINESS

reintec.com / 0845 6028271 Safety / Value / Availability / Support


 Healthcare & Hospital Hygiene

What will persuade medical staff to wash their hands? Jamie Wright from Tork manufacture SCA looks at ways in which healthcare facilities are attempting to improve hand hygiene compliance, and considers whether any of these methods are actually working.

The link between poor hand hygiene and the spread of infections in hospitals has been understood for more than 160 years. It was Austrian physician Ignaz Semmelweis who first made the connection between medical students attending expectant mothers straight from the pathology lab, and a steep rise in childbirth deaths. That was in 1847 and since then the message has been clear: healthcare personnel need to wash their hands between patients to reduce the risk of cross-contamination. But however clear the message, it is not getting through. Hand hygiene compliance varies from country to country but the average level globally is just 38.7% according to the World Health Organisation [1]. In other words, more than 60% of medical professionals around the world are not washing their hands between patients. Various methods have been used in recent years to convince staff to wash their hands. In some healthcare facilities, for example, stickers and posters have been placed on walls and on dispensers to act as an easy reminder for staff. But these prompts can easily be ignored if no-one is watching. A recent study revealed that medical staff were twice as likely to wash their hands if they knew they were being watched. Researchers collated more than 4000 hand hygiene observations at a medical facility in San Jose, California, for the study. The volunteers who knew they were under scrutiny were found to be twice as likely to wash their hands compared with those who had no idea they were being monitored. It was also noted that compliance rates went up by another 30% if the staff in question actually knew the person watching them. In some cases, the mere perception of being watched can be sufficient to improve hand hygiene. In a trial carried out at a Miami teaching hospital in 2015, a group of healthcare workers were 18 l C&M l OCTOBER 2016 l www.cleaninghub.net

Hand hygiene compliance can be boosted in healthcare facilities in any number of ways. But one of the simplest and most effective of them all is by providing user-friendly hand hygiene facilities for medical personnel - and then encouraging staff to use them.

exposed to a photograph of a man’s staring eyes above an alcohol gel dispenser. It emerged that these members of staff were 30% more likely to use the alcohol hand gel dispenser than their colleagues who were not shown the image. Interestingly, a photo of female eyes had much less of an effect on medical staff with only 10% of people exposed to this cue going on to use the hand gel. While such findings are important, most hospitals are too busy to employ hand hygiene ‘monitors’ to check up on staff. However, some facilities have tried video monitoring instead. One such facility - the intensive care units of New York’s North Shore University Hospital - used a motion sensor to activate a video camera whenever a medical worker entered the intensive care unit. Footage of the employee washing their hands or otherwise was then sent to an assessment centre where data was collected. At the end of each shift, hand washing compliance rates were displayed on a digital scoreboard. This system had impressive results with compliance going up from around 6.5% to 80-90% after the scoreboards were installed. So it seems that some methods of persuading healthcare staff to wash their hands can be very effective. But before instigating any changes in a hospital, the crucial question should be asked: what are the reasons behind poor hand hygiene in the first place? When WHO carried out a poll into this issue some years ago, a number of common themes cropped up. Some healthcare workers said they were too busy to wash their hands while others claimed they had not been told about the importance of hand hygiene by their superiors. A shortage of soap and hand towels was another reason given for poor hand hygiene compliance. Many respondents complained that the sinks at their healthcare facility were too

few and far between. And yet others said that frequent hand washing irritated their skin or caused excessive dryness. To corroborate these findings, WHO collated the results of various global initiatives at healthcare facilities that had been designed to boost hand hygiene [1]. They noted that compliance rates leapt from 29 to 43% in one medical intensive care unit where education, posters, badges and brochures were supplemented with wallmounted hand sanitiser dispensers. In three further hospitals, hand hygiene rates rose from 17 to 58% when more sinks were provided and more education and reminders supplied to staff. And another hospital saw an improvement from 48 to 67% when hand hygiene posters, staff feedback and administrative support were all backed by the introduction of alcohol rubs. It seems clear that education, visual prompts and feedback are all helpful tools in helping to boost hand hygiene. However, these work even more effectively when combined with practical changes. So hospitals should be equipped with the right tools for optimum hand hygiene. Besides a sufficient number of sinks, there should also be a continuous supply of mild soaps and soft hand towels that will not cause soreness and chapping of the skin. Tork Extra Mild foam and liquid soaps, for example, are particularly suitable for frequent use since they help to protect the hands from dryness, particularly when used in conjunction with a moisturising lotion. And Tork Soft Singlefold Hand Towels have been designed to provide a gentle and effective hand dry. As a result these towels have remained a bestseller within the NHS for many years. To supplement good hand hygiene compliance, a sanitising product should be made available to staff in a convenient format. Tork Alcohol Gel Hand Sanitiser, for example, can be clipped to the patient’s bed or kept in the medical worker’s pocket where it will always be on hand when required. There are other ways in which the importance of hand hygiene can be communicated. We at Tork stage roadshows in which we educate healthcare staff about the importance of hand hygiene. We also provide signs and dispenser stickers for hospital trusts focused around our ‘Clean hands, healthy hands’ campaign. And we offer elearning as part of our hand hygiene package, enabling healthcare staff to remind themselves about the importance of hand hygiene at a time to suit themselves according to their shift patterns. Hand hygiene compliance can be boosted in healthcare facilities in any number of ways. But one of the simplest and most effective of them all is by providing userfriendly hand hygiene facilities for medical personnel - and then encouraging staff to use them. www.tork.co.uk [1] http://apps.who.int/iris/bitstream/10665 /70126/1/WHO_IER_PSP_2009.07_eng.pdf


SprayPro Inox Professional spray mopping

SprayPro Inox is the professional, ready-to-use floor cleaning system. Just fill the handle with solution, attach the mop of your choice and you are ready to clean. No buckets and presses are required as everything is contained within the handle, making it ideal for sites with limited storage. Wet, damp or dry mopping? Washing facilities or not? No problem! SprayPro Inox is compatible with all leading single and multi-use floorcleaning systems, allowing easy adaptation of your on-site conditions and needs. With no need for wringing of mops or filling/emptying heavy buckets SprayPro Inox is simple and easy to use making it ideal for use by both professional and semi-professional cleaners. Tel: 01706 759597 Email: vileda.professional.uk@fhp-ww.com www.vileda-professional.com/en-GB


 Healthcare & Hospital Hygiene

Training for cleaners programme rolled out While training for care home personnel is increasingly broad-based, its focus is on establishing and maintaining best practice in patient care terms. National care home provider, Quantum Care, has been tackling the training of its cleaning personnel in a new initiative with solutions and technology specialist, Prochem. As part of the Health and Social Care Act 2008, Care Quality Commission (CQC) registration requires care home providers to comply with essential standards of quality and safety that include risk of exposure to infections. Consequent national cleanliness specifications provide a framework for providers of care homes to demonstrate to the CQC how they ensure their premises are clean and safe and meet the required standards. Clearly, effective prevention and control of infection should be part of everyday practice and applied consistently by everyone. Since 2001 for hospitals and 2009 for ambulance trusts, a national specification for cleanliness has been available to assist home providers in ensuring they provide a cleaning service which meets the required standards. Over recent years, Welwyn Garden City-based group Quantum has been sourcing cleaning products for its 26 homes from Prochem, which is also a provider of training to cleaning professionals, whether independent, contracted or in-house. “Most of our homes use a blend of Prochem products ranging from deodorisers to walk-behind hot water extraction machines,” said Quantum’s head of cleaning

As part of the Health and Social Care Act 2008, Care Quality Commission (CQC) registration requires care home providers to comply with essential standards of quality and safety that include risk of exposure to infections. Consequent national cleanliness specifications provide a framework for providers of care homes to demonstrate to the CQC how they ensure their premises are clean and safe and meet the required standards. Clearly, effective prevention and control of infection should be part of everyday practice and applied consistently by everyone.

A healthy contract win for OCS OCS has been awarded a new three year contract by NHS Property Services. The contract is to provide cleaning services for around 900 separate locations across England. This major contract deal, which is the largest secured by the business in the UK, in conjunction with other significant wins in the sector, has effectively doubled the size of OCS’s healthcare business. “We are delighted to welcome OCS as our new cleaning supplier,” said Dennis Markey, NHS Property Services chief operating officer. “Our company ensures that the environments and facilities available to NHS staff and patients are safe, efficient and sustainable, and we are confident that OCS, with their in-depth knowledge and experience of the market, can help us deliver.” Working in partnership with NHS Property Services, one of OCS’s main aims will be to implement a standardisation of service and method across all sites to guarantee best practice and performance excellence. “We are absolutely delighted to secure this contract, which is one of the biggest that OCS has entered into,” said Bob Taylor, CEO of OCS UK. “Along with other major wins in the sector we have seen a doubling of our healthcare business over the last two years. This is particularly pleasing given our strategic reorganisation which set out focus on five key sectors, of which healthcare is a cornerstone.” www.ocs.co.uk 20 l C&M l OCTOBER 2016 l www.cleaninghub.net

and catering, Donna Steeden. “We buy these either directly from Prochem itself or from appointed distributors, notably Nursing & Hygiene in West Sussex. The reason we stick with Prochem as a brand is that it offers a wide range of solutions specifically designed for the kind of spills and stains that we encounter in our day-to-day operations and provide first-rate service support.” Quantum favours Prochem’s Fivestar extraction machine but also buys in the larger Polaris 500 extractor and its LW30 floor scrubber driers. The compact and manoeuvrable FiveStar is ideal in delivering the features of a larger walk-behind machine in a much smaller package. Fast working and easy-to use, it’s a popular choice in homes offering 45 beds or more. The powerful, higher-capacity Polaris 500 makes corridor carpet cleaning simple and, fitted with the appropriate Prochem accessory, is next ready to tackle challenging hard floor tiled areas and bathrooms. A complementary solutions system devised for care home and healthcare use falls within most home cleaning schedules, comprising Prochem Neutra-Soft, Citrus Gel, Stain Pro, and Natural Carpet Deodoriser chemicals. “We like how Prochem can tailor solutions to meet our needs,” continued Steeden. “Sanitisers, neutralisers, stain removers, pre-spotters and detergents have been carefully matched to the requirements of hospitals and care homes. And they offer a range of odour control products in a handy guide to identifying and sourcing a solution

to any stain or odour problem encountered in what after all can be very demanding environments." Quantum recognises the importance of training to a safe and effective home. So how does this translate in real terms to cleaning? “We’ve embarked on a series of seminars at our headquarters that go above and beyond the machine training our homes get as part of their installation service,” said Donna Steeden. “A seminar held for 15 heads of housekeeping from various Quantum homes tackled the use of products and machines and a further event is planned for later this year. Prochem holds a series of cleaning training events at a dedicated training academy in Surrey all year round, so they know how to reveal best practice and educate cleaners into effecting it.” Prochem plans to extend its dedicated inhouse training to the care home sector during 2017. Phil Jones, Prochem’s sales manager, said: “We recognise it’s not always possible to get healthcare cleaners out to day-long courses like ours so exporting our training and its related materials into the homes themselves is making good sense. Healthcare environments make very specific challenges to cleaning operatives and knowing what to use, how and when, can only bring faster, more effective and safer practices to the sector. We are happy to arrange product awareness and training seminars for any other healthcare provider, be that a group or independent.” www.prochem.co.uk

Catalogue launched specifically to meet healthcare sector demand Jangro has launched a catalogue specifically for the healthcare sector. Suitable for all healthcare related environments including hospitals, hospices, care homes, dentists, rehabilitation facilities, and assisted living accommodation, the range covers: protective wear and patient care; laundry care; housekeeping; beds and mobility equipment; washroom equipment; medical supplies and equipment; and assisted dining care and kitchen hygiene. Available to anyone that is responsible for purchasing products and equipment in the healthcare sector, the catalogue is free of charge. With free online solutions to help clients manage staff training, company budgets and health and safety legislation requirements, as well as complementary downloads for essential wall charts, becoming a Jangro customer has many benefits. There are 42 Jangro distributors across the UK and Ireland, and the group’s buying power means that customers get the benefits of competitive prices and a local service. Joanne Gilliard, operations director at Jangro, said: “We are delighted to be launching our new healthcare catalogue, which has national coverage and contains everything needed to ensure smooth running of a wide variety of facilities. We have been supplying quality products into this industry for many years and we have now brought all our prestigious offering, along with additional essential items, all together in one place. The catalogue is free of charge and can be ordered by calling 01204 795 955, emailing enquiries@jangrohq.net or through any of our 42 distributors, who are conveniently located across the UK and Ireland.” www.jangro.net


Safely cleans indoor windows or glass, without steps or ladders - even in restricted areas. The professionals choice, for cleaning hard-to-reach internal windows or glass.

CLEANO Bucket-Free Indoor Window Cleaning System

For more information call:

01457 819494

sales@robert-scott.co.uk www.robert-scott.co.uk

CLEANING AND MAINTENANCE THE INDUSTRY’S NUMBER 1 CHOICE

ESTABLISHED SINCE 1953 AND ALWAYS REACHING YOUR RIGHT AUDIENCE Cleaning and Maintenance magazine handed out at the entrance to The Cleaning Show - del ivered to in exces s of 10,0 0 0 hard copy reader s and reachi ng in excess of 26,000 digital readers - the bi gges t read withi n the cl eani ng & s uppor t s er vi ces s ector Make sure you reach your audience and advertise with us. For further details please contact: Vanessa VanSanten - Smith Sales Manager C&M magazine TEL: +44 1737 855041 • MOB: +44 7944 277598

THE

CLEANING SHOW WWW.CLEANINGSHOW.CO.UK

Follow us on Twitter @CleaningHub Published by

Join us on LinkedIn Cleaning & Maintenance magazine

www.cleaninghub.net


 Healthcare & Hospital Hygiene

Healthcare infection control: within tight budgets Hygiena International takes a look at current challenges facing the healthcare sector. According to Hygiena International, the inadequate assessment of cleaning procedures within hospital environments is the biggest source of on-cost with lost opportunities to save money as well as improve infection control. The patient environment is known to be closely associated with infection risks and superbugs are now resistant to almost all antibiotics. Hygiena International states that its ATP cleanliness monitoring equipment can provide a simple, low cost solution to driving down infection rates. Everyone accepts that a high standard of hygiene is an essential primary preventative measure in the fight against infection. The patient environment and high count touch surfaces are recognised as reservoirs of contamination. However, cleaning is often considered a low skilled task and a burdensome on-cost that is often treated as a soft target for cost cutting, which can be subsequently prove to be a false economy. Effective cleaning is a science that requires attention to detail, but it is frequently taken for granted and its importance also under-estimated. Cleaning is sometimes out-sourced to the lowest cost provider and is thus frequently inconsistently delivered, inadequately measured and also undervalued. Failure to clean properly, however, has a huge cost. The NHS spends £725 million per year on cleaning of which 90% is the labour cost and there is only one opportunity to get it right. Research also shows

Measurement is the first step that leads to control and eventually to improvement. If you can’t measure something, you can’t understand it. If you can’t understand it, you can’t control it.

that only 40% of cleaning is delivered against policy, resulting in a potential 60% wasted resource costing £435 million per year. The cost benefit of effectively cleaning has been calculated at £57,000 per ward per year excluding lost bed days. However, the NHS Productivity review 2016 showed that there is a saving of £93 million from an improvement in cleaning alone. The direct cost of an HCAI is £10,000 per incident and the WHO estimates that 300,000 patients in

the UK are affected by HCAI, costing £1 billion. The NHS Litigation Authority pays out >£1 billion a year in compensation. Indirect costs associated with HCAI include additional bed days costing £400 per day as well as lost bed days. It is calculated that saving an average one day per hospital stay would save >364,000 bed days per year with a cost of >£15 million. Visual assessment of cleaning is commonly used but it is subjective and only detects gross lapses in practice that results in a false sense of security that undermines infection control strategies. Measureable standards for cleaning have been lacking until the recent recognition and acceptance of a simple, well proven method called ATP bioluminescence. Measurement is the first step that leads to control and eventually to improvement. If you can’t measure something, you can’t understand it. If you can’t understand it, you can’t control it. If you can’t control it, you can’t improve it. ATP bioluminescence is a simple rapid method for measuring for organic soil. It specifically measures adenosine triphosphate (ATP) which is the universal energy molecule present in all living things. The procedure requires a small hand held instrument and an all-in-one sample collection and testing device, these generating a numerical result in 15 seconds. This provides an objective yardstick and benchmark to describe and communicate levels of contamination and demonstrate what cleanliness really means. The use of ATP bioluminescence for cleaning verification is well established, and has the highest Continued on Page 24.

Reducing infections and improving outcomes The new Vericlean service from Diversey Care is an evidence-based surface disinfection and cleaning validation programme that provides healthcare organisations with the insight and expertise to reduce the risk of hospital acquired infections and improve patient outcomes. At its heart is a verification tool that makes the invisible visible by allowing managers to check critical surfaces have been cleaned properly to remove potential sources of infection. Additional components of the service cover process development and optimisation, product selection, and training and applications support so that healthcare organisations can introduce and sustain continuous performance improvement. Vericlean is based on the simple concept that effective infection prevention requires regular and effective cleaning of critical frequent-touch points. This is important because many common pathogens found in healthcare settings are spread by personal contact or touching contaminated surfaces. Frequent-touch surfaces such as door handles, light switches, beds, telephones and TV remote controls all harbour pathogens that can be passed easily from person-to-person if not removed. 22 l C&M l OCTOBER 2016 l www.cleaninghub.net

Vericlean is based on the simple concept that effective infection prevention requires regular and effective cleaning of critical frequent-touch points. This is important because many common pathogens found in healthcare settings are spread by personal contact or touching contaminated surfaces. Frequent-touch surfaces such as door handles and light switches all harbour pathogens that can be passed easily from person-to-person if not removed.

To audit the effectiveness of their processes infection prevention managers or cleaning team leaders mark critical surfaces with an invisible dye that only shows up under ultra-violet light. After cleaning staff have completed their rounds supervisors check that the dye has been removed by shining a special torch on the surfaces. Using a dedicated app running on a secure mobile device supervisors can collect information about the target surfaces and whether the dye was present, partially removed or absent during the post-cleaning checks. The absence of dye shows that the surface has been cleaned properly and pathogens removed. Alternatively, the service can be used to record and verify visual and ATP monitoring methods. A wide range of reports is available on a secure web portal to enable analysis of performance by room, critical surface, team member, and many other factors. Supervisors quickly build a profile of their operations and how well critical surfaces are being cleaned. They can identify good and bad performance, upward and downward trends, unusual patterns, and emerging issues. Using this insight they can make

informed decisions on improvements to processes or requirements for additional staff training and education. In each case the service supports evidence-based decisions that lead to efficient performance improvement. It also provides valuable insight into the cleaning issues that can contribute to patient ratings and satisfaction scores. Alongside the auditing tool Vericlean comprises three additional components that together enable organisations to achieve high levels of hygiene and infection prevention. First, Diversey Care works with customers to help them develop and implement simple, effective and sustainable processes for each part of their facility. Second, it offers advice on suitable products to meet the required objectives whether these be from its own range or from independent suppliers. Third, training is provided to supervisors to show them how to use the tool and support materials. Customers also have access to a wide range of application guides, process flowcharts and product documentation as well as the company’s technical and consulting expertise. www.diversey.com


ďĞƩĞƌǁĂLJƚŽŵĂŶĂŐĞĐůĞĂŶŝŶŐ͕ ŵĂŝŶƚĞŶĂŶĐĞĂŶĚŽƚŚĞƌĐŽŵƉůŝĂŶĐĞ ŝŶƐƉĞĐƟŽŶƐ͕ĂƵĚŝƚƐĂŶĚƌĞƉŽƌƚƐ 50% quicker from inspection to report compared to the typical paper-based process Trusted by over 100 hospitals and care homes across the UK, Australia & NZ Easy-to-produce and easy-to-read management reports, including graphical summaries Increased field staff utilisation

ŽŶƚĂĐƚƵƐĨŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶ or to arrange a demo 020 7739 8060 www.purcellradio.com

In the next issue Scrubber Dryers and Sweepers application and case studies, Sweepers Machine Guide EDITORIAL Neil Nixon • Editor T: +44 (0) 7957 713316 • neilnixon@quartzltd.com SALES Vanessa VanSanten - Smith • Sales Manager T: + 44 (0) 1737 855041 • vanessamartinet@quartzltd.com Jamie Anderson • Regional Sales Manager T: +44 (0) 1737 855086 • jamieanderson@quartzltd.com

Find us online at: www.cleaninghub.net

info@purcellradio.com


 Healthcare & Hospital Hygiene

Clean hands are safe hands Paul Mulready, marketing manager at Northwood Hygiene Products, reports. With the ‘flu season soon to be upon us, now is an especially good time to evaluate existing hand hygiene provision and procedures amongst healthcare professionals. Why? Because though it is a simple concept, improving hand hygiene compliance by healthcare staff will help save lives. A big statement, but one which the National Patient Safety Agency makes based on scientific evidence that it describes as being completely overpowering. Studies going back to the 1950s and 60s show that the bacteria that cause healthcare associated infections (HCAI) are most frequently spread from one patient to another on the hands of healthcare staff. So it’s not just applicable to acute hospital wards, but wherever patients and service users receive care. Infection control professionals in the community recognise that changes in the way care is delivered now demand that a standard hand hygiene approach is established across the healthcare economy to ensure consistency in delivering patient safety. Compliance is still, however, at a disappointingly low level and has shown little general improvement over the years. The reasons are thought to include the pressures of having very busy periods of activity, staffing levels, lack of role models, and sometimes a lack of organisational support for hand hygiene. Health Protection Scotland recommends that hands of health professionals are thoroughly washed and dried before eating, after using the toilet, after coughing and sneezing, and in addition to those perhaps more widely accepted occasions, after handling rubbish and before and after visiting a hospital ward. All of which sounds eminently sensible and necessary, but it can’t

Health Protection Scotland recommends that hands of health professionals are thoroughly washed and dried before eating, after using the toilet, after coughing and sneezing, and in addition to those perhaps more widely accepted occasions, after handling rubbish and before and after visiting a hospital ward. All of which sounds eminently sensible and necessary, but it can’t happen unless the provision of adequate hand washing and drying facilities are in place. Those facilities need not only to encourage compliance by being conveniently located, the units themselves need to be of the highest standards.

happen unless the provision of adequate hand washing and drying facilities are in place. Those facilities need not only to encourage compliance by being conveniently located, the units themselves need to be of the highest standards. Leonardo soap dispensers incorporate the very latest developments in touchless electronic soap dispensing. Easy to clean and maintain, their versatility is such that they can dispense lotion or foam soap or even hand sanitiser, with equal ease. The 700ml packs have replaceable pumps, are available in perfumed and unperfumed variants, both of which are anti-bacterial,

and are dermatologist approved. Not only suitable for those with skin complaints, they are also hypoallergenic and allergen free and being paediatrician approved are suitable for nurseries and children’s wards. Should the battery fail, these dispensers feature an alert which allows users to ‘push the cover’ and dispense manually until the batteries are replaced. The hand towel Leonardo dispensing systems are both well-known and proven in the healthcare arena, being specified in hospitals and healthcare facilities across the UK. Like the soap dispensers, they too are designed to be intrinsically easy to maintain and they have delivered measurable cost in use benefits. With a range that includes the Compact dispensers, they can be simply fitted into what sometimes may initially appear to be otherwise difficult locations. Disposable hand towels are recommended within NHS guidelines as the best way to dry hands and reduce the spread of bacteria in hygiene sensitive areas and Leonardo dispensing systems successfully meet that requirement. Of course not all locations require the very highest of hand hygiene standards and the Leonardo range is able to reflect those differing needs by supplying dispensers from those that feature sophisticated electronic hands free dispensing to those with a manual lever operation with a Bio Kleen coating for added protection. Encouraging compliance with hand hygiene procedures is ongoing and very difficult and it is impossible not to have sympathy with hard pressed health professionals as they seek to deal with real life and death situations. However, the case for hand hygiene is proven and when Leonardo is specified, the provision of first class soap and hand towel dispensers is not an issue. www.northwood.co.uk

Healthcare infection control: within tight budgets Continued from Page 22. recommendation by the Rapid Review Panel of the Department of Health and Public Health England in support of the fight against HCAI. The test is also recognised by the CDC in USA and is written into a standard for cleaning procedures in Denmark and Sweden. Early adopters such as North Tees and Hartlepool NHS Trust have shown a consistent and marked improvement in cleanliness and reduction in infection rates since its introduction in 2008. The results have shown a >20% improvement in pass rates and a large reduction in fail scores to fewer than 5% with a corresponding decrease of 35% in C. difficile cases and a 39% reduction in infections per 10,000 occupied bed days. Monitoring officers, independent from nursing and environmental services staff, are assigned to act as project champions for individual facilities, reporting to departmental managers wherever poor cleaning was discovered and where corrective action is required. Monthly reports are circulated for cross-functional team meetings of nursing, facilities and infection control 24 l C&M l OCTOBER 2016 l www.cleaninghub.net

ATP bioluminescence is a simple rapid method for measuring for organic soil. It specifically measures adenosine triphosphate (ATP) which is the universal energy molecule present in all living things. The procedure requires a small hand held instrument and an all-in-one sample collection and testing device, these generating a numerical result in 15 seconds.

staff. This allows for open discussions on all cleaning and maintenance related issues and stimulates actions for improvement. The Southport and Ormskirk Hospital NHS Trust has obtained impressive results in its drive to continuously monitor cleaning processes, so helping it reach its target of a clean and safe hospital. Several departments and services at this establishment have been helped to achieve their aims by the utilisation of ATP cleanliness monitoring equipment as supplied by Hygiena International. This equipment, SystemSURE Plus, has associated software to store reports for up to 5000 programmable test locations, together with the creation of charts, graphs and reports. The Hygiena ATP monitoring system was introduced at the Southport and Ormskirk hospital over five years ago, to help in its efforts to drive down infection rates. Andrew Chambers, consultant nurse and deputy director of infection prevention and control, said: “The results of ATP monitoring are incorporated into weekly infection prevention and control performance reports which are circulated trust-wide. It is there to encourage people and make them aware, and also adds a

competitive edge to drive everyone to achieve a low score. If they’re doing a good job, it’s a low score and the staff are delighted. The benefit is that with ATP we can react immediately to the results on site and put any necessary interventions into immediate effect. That way we’re safeguarding patients which is what it is all about.” All cleaning personnel are now very proactive and keen to embrace technology that provides an objective measurement of cleaning performance. This not only helps to safeguard patient welfare but also ensures the value for money of good cleaning performances. The ATP test is also used in sterile services and endoscopy to replace the protein test and to ensure the highest standards of cleaning are achieved. It is also used by dentists, ambulance and emergency vehicles, care homes and within the catering industry. It is essential to diagnose and monitor cleanliness anywhere that hygiene matters. A copy of the healthcare applications booklet and further information is available on. www.hygiena.com


THE UK’S LARGEST DEDICATED CLEANING & HYGIENE EVENT NEW DATES ANNOUNCED

THE

CLEANING SHOW 2017 14 –16 MARCH

Organised by

In association with

Official media partners

EXCEL • LONDON

THE MUST-ATTEND EVENT FOR ALL CLEANING, HYGIENE AND FACILITIES PROFESSIONALS This free-to-attend exhibition and conference offers essential business workshops, legislative advice and products for anyone with responsibility and purchasing authority within this sector.

EXHIBITION STAND SALES NOW OPEN This event sold out in 2015. If you would like to participate we encourage you to contact us now to receive your exhibition pack and reserve space now. Vanessa Van Santen - Smith, Sales Manager +44 (0)1737 855 041 / vanessavss@quartzltd.com

THE EVENT BRINGING TOGETHER 10,000 • Contract cleaners • Facilities managers • Healthcare estate managers • Hospitality, leisure and retail managers • Public service providers • Local government • Product and service providers

WWW.CLEANINGSHOW.CO.UK


 Healthcare & Hospital Hygiene

When visually clean means hygienically clean Thomas Stuecken, chairman of OspreyDeepclean, reports. Good hospital hygiene is vital to any strategy for preventing HCAIs within a healthcare environment. There is a whole body of clinical evidence derived from case reports and outbreak investigations that suggests an association between poor environmental hygiene and the transmission of microorganisms causing HCAIs. Furthermore the National Institute for Health and Care Excellence (NICE) estimate that MRSA and C. difficile contribute to as many as 15,000 patient deaths each year, 5000 of which are a direct result of the patient contracting a superbug. NICE concludes that these figures are unacceptable and that many of the deaths could be avoided if staff simply washed their hands regularly. But is it really that simple and how can you tell visually clean is hygienically clean? Much of the focus, quite rightly, is about personal and general hygiene. However, dealing with forms of bacteria that are becoming increasingly resistant to the very chemicals employed to kill them means at best a haphazard result and, at worst, dis-

CleanCard PRO, a fast and easy selfmonitoring tool. After sanitising, simply spray the surface, wipe and wait. The simple traffic light system instantly verifies the level of cleanliness. Selfmonitoring of an effective cleaning regime in accordance with the view to control HCAIs is an absolute must for every hospital and healthcare environment, and the CleanCard PRO is an effective and innovative tool for this.

aster for the infected patient. A far more reliable and therefore safer alternative to the broad use of chemicals and one growing in favour with many hospitals and residential care homes is the use of steam sanitising equipment. Using only cold tap water superheated to 180°C, dry steam quickly penetrates deep into surfaces without causing destruction or damage over any length of time and leaves little scope for antimicrobial resistance. Pathogens and their biofilms, including MRSA, Acinetobacter, Klebsiella and C.Difficile, are quickly removed via vacuum extraction and/or microfibre. Surfaces are left sanitised, decontaminated, dry and ready for immediate use, thus avoiding unnecessary downtime associated with other cleaning methods. It is for these reasons that dry steam is being incorporated more and more in the ‘back to basics’ approach to cleaning - back to a time when good old fashioned deep cleaning practises were the norm and HCAIs were not mainstream news. Dry steam vapour is very much a modern tool

within these traditional cleaning practises but will continue to have a very prominent place within these regimes. But how do you know that visually clean is hygienically clean? The OspreyDeepclean dry steam technology, for example, is proven to achieve a 99.9% reduction in contamination of surfaces but to the naked eye a contaminated surface and a sanitised surface could appear exactly the same. Microbiological tests are almost always not suitable for fast monitoring purposes. The results are not available within a suitable time frame to then be able to take corrective action in the event of deviation from the desired state. To overcome this time delay the newest offering is the CleanCard PRO, a fast and easy self-monitoring tool. After sanitising, simply spray the surface, wipe and wait. The simple traffic light system instantly verifies the level of cleanliness. Self-monitoring of an effective cleaning regime in accordance with the view to control HCAIs is an absolute must for every hospital and healthcare environment, and the CleanCard PRO is an effective and innovative tool for this. www.ospreydc.com

FM contract at Barnsley Hospital extended to include security G4S has announced an extension to the FM contract with Barnsley Hospital to deliver a three-year security service. The new contract won by the company’s Secure Solutions business, is worth £960,000 and adds to the cleaning services G4S FM already provides on site. The security team will carry out manned guarding and car park management throughout the 350 bed hospital, which serves 250,000 people in the Barnsley area. Doug Hewitson, regional managing direc-

The new contract won by the company’s Secure Solutions business, is worth £960,000 and adds to the cleaning services G4S FM already provides on site.

Helping to prevent infection and cross-contamination A range of colour coded brushes (red, yellow, green and blue, plus the standard black) are available from Rotowash to help prevent cross contamination in healthcare facilities. Rotowash offers a fast and productive floor cleaning solution, cleaning both carpets and hard floors. The machine dries as it goes, is light to use, and free operator training for the life of the machine is available. The company claims that the system uses up to 90% less water and chemical, and is supplied with a three year warranty. www.rotowash.com 26 l C&M l OCTOBER 2016 l www.cleaninghub.net

tor, Secure Solutions UK, said: “We are delighted to have extended our relationship with Barnsley Hospital and now have the opportunity to build on the partnership the facilities management team has established over the past two years. We have recently implemented specialist training with the Yorkshire relief team to provide planned and unplanned absence cover. Our teams have a good understanding of patient needs, especially working with vulnerable patients. With the hospital treating over 78,000 patients a year in the emergency de-

partment alone and renowned for its friendly culture, as their chosen service provider we will ensure our employees do the best possible job.” Lisa Corbridge, local security management specialist from the Hospital Foundation Trust, said: “Given the excellent working relationship and service provided by G4S FM cleaning staff at Barnsley Hospital, we look forward to working with the security team and have full confidence in their ability to reflect the Trust’s values.” www.g4sfm.com

Introducing the Lape Collection hand care range Diversey Care has announced the launch of the Lape Collection - the latest high-quality, sustainable hand care offering from its Personal Care portfolio. The Lape Collection consists of a range of hand washes and lotions. The presentation and delicate scent of the products make them an attractive hand care offering for a range of environments. The Lape Collection also accommodates any skin type, as the products contain mild formulations to reduce the risk of allergic reactions, and all products are phthalate, paraben and triclosan free. The range is also environmentally viable as the bottles and outer packaging are entirely recyclable. The 300ml bottles of hand wash and hand lotion are available in two scents - Oriental Lemon Tea and Honey Vanilla. The hand wash cleanses and hydrates, whilst the hand lotion effectively moisturises, softens and reconditions the hands. Diversey Care has also introduced a

spillage-free refill solution for its products. This reduces cost-in-use and plastic waste, and enhances the washroom experience by always having bottles which are full. Diversey Care reinvests a percentage of sales from the Lape Collection back into communities through Soap for Hope - an initiative by Sealed Air to save lives, enhance livelihoods and reduce waste. Diversey Care is offering customers access to signage to communicate the support provided to Soap for Hope. Dr. Ilham Kadri, president of Diversey Care, said: “The Lape Collection offers a complete guest hygiene solution for the hospitality sector as it provides a range of high quality products which not only considers skin safety and cost, but is environmentally viable. This collection demonstrates that luxury and eco-consciousness do not have to be mutually exclusive.” www.diversey.com


THE UK’S LARGEST DEDICATED CLEANING & HYGIENE EVENT NEW DATES ANNOUNCED

THE

CLEANING SHOW 2017 14 –16 MARCH

Organised by

In association with

Official media partners

EXCEL • LONDON

THE MUST-ATTEND EVENT FOR ALL CLEANING, HYGIENE AND FACILITIES PROFESSIONALS This free-to-attend exhibition and conference offers essential business workshops, legislative advice and products for anyone with responsibility and purchasing authority within this sector.

EXHIBITION STAND SALES NOW OPEN This event sold out in 2015. If you would like to participate we encourage you to contact us now to receive your exhibition pack and reserve space now. Vanessa Van Santen - Smith, Sales Manager +44 (0)1737 855 041 / vanessavss@quartzltd.com

THE EVENT BRINGING TOGETHER 10,000 • Contract cleaners • Facilities managers • Healthcare estate managers • Hospitality, leisure and retail managers • Public service providers • Local government • Product and service providers

WWW.CLEANINGSHOW.CO.UK


 Computer Systems

Saving money with integrated contract management software Rick Stoor, MD of Templa, explains why an effective software interface with external systems is just as important as internal integration in the search for cost savings. The adoption of contract management software has really gathered pace in the last year, with the majority of the UK’s top 100 companies now running their businesses with the help of a cleaning industry specific contract management system. From what clients tell us, the reasons are clear. Despite economic growth, margins in cleaning are still under enormous downward pressure from clients demanding cost efficiencies. Combined with upward pressure on costs due to the National Living Wage, it’s not surprising that contractors are looking to technology to reduce their overheads and improve their chances of retaining contracts.

How does internal and external integration work in practice?

No integration - no benefits To increase their likelihood of reducing costs by using integrated software, however, contractors should think long and hard about that word ‘integration’. At Templa, when we talk about an integrated contract management system we mean two things. Firstly that all of its business processing modules share the same data source - that’s one version of the data held in a single, central contracts database. And secondly that this seamless sharing of data also extends out to external

Templa’s dynamic integration diagram.

‘Work & Accrue’ simplifies zero-hour holiday calculations Vanquish Integrated People Solutions has introduced a new formula to its time management software to support organisations in accurately calculating the amount of annual leave and holiday pay that workers on zero-hours contracts are entitled to. The new ‘Work & Accrue’ holiday function automates the complex calculation process to help organisations enforce regulatory compliance and maintain an accurate payroll process. Zero-hours contracts are popular in industries such as hospitality, contract cleaning and manufacturing - providing employers with the flexibility to scale up or down their staff resource to meet demand. But whilst zero-hours contracts may be seen as a costeffective staffing solution, the irregularity of the employment adds to the administration burden facing HR and payroll teams. This is because the pay and holiday entitlements that zero-hours workers receive, normally set out in an employment contract for fulltime workers, are instead based on the number of hours actually worked, resulting in more complicated and time consuming calculations. Workers typically accrue 7.24 minutes of holiday for every full hour worked based on the statutory entitlement of 5.6 weeks or 28 days a year. The ‘Work & Accrue’ feature developed for Vanquish automates this formula and operates in real-time so administration staff can see at a glance the amount of holiday days accumulated as the hours are recorded. Self-service functions allow employees to better manage their own time too. Meanwhile, with full transparency of employee attendance data to hand, organisations are better placed to average out the worker’s pay rate over the last 12 weeks, as per guidance where employees are not on a fixed pay rate (for example, doing different types of work at different rates). Improvements in payroll accuracy are achieved by using Continued on Page 30. 28 l C&M l OCTOBER 2016 l www.cleaninghub.net

ery to client premises. This is often done by administration staff placing an order on a supplier’s website, keying the detail into a budgeting spreadsheet, then again into the purchase ledger to raise an official supplier order, and one final time to generate a client invoice - the same transaction recorded in four separate systems and all requiring manual reconciliation. Contrast that with the time and money saved by the interface between TemplaCMS and Merlin Business Software, used by most janitorial suppliers selling in to contractors, where the single keying of the quantities into TemplaCMS takes care of the whole process from order through to invoice.

systems, such as time and attendance, or cleaning product suppliers. Case Study: Saving money on product ordering Take the situation where a cleaning contractor issues literally thousands of individual orders for cleaning materials and consumables to its key supplier(s) for deliv-

Take a look at the dynamic integration diagram to understand how the system delivers an integrated solution based on the single, central database of contract data. Our clear objective in product design is for dynamic integration of data and software whenever possible, as manual file export and import is unreliable and time consuming. As well as being more accurate, dynamic integration saves valuable time both in field operations and administration. It makes information more immediately available to the right people at the right time, presenting a professional image to staff and clients alike. www.templacms.co.uk

Closing the loop between noncompliance and corrective action Over the course of the last 20 years Purcell Radio Systems has built strong, lasting relationships with estates and facilities departments within many NHS acute hospitals, as well as with many of the big players in facilities management, contracted to provide support services in acute healthcare. Purcell’s fast response task management system, CARPS, is one of the ICT systems able to effectively manage the high volume of tasks demanded from busy hospital support services teams including porters, domestics, cleaners, and reactive maintenance engineers. CARPS software works across two-way radio and Android smart device platforms. To compliment CARPS, TopCat was created to handle the large volume of cleaning audits and inspections performed in hospitals. Initially designed with NHS cleaning standards in mind, TopCat is now in use for areas of environmental compliance ranging from cleaning and infection control to groundkeeping, food safety and planned preventative maintenance. TopCat is known to reduce the time taken from audit to report and, like CARPS, provides value as a stand-alone solution. To enhance the value proposition of the two systems, Purcell has recently developed an integration which means that service providers using both CARPS and TopCat can close the loop between the discovery of a non-compliance during an inspection, and the reactive work required to correct the issue. Having the TopCat and CARPS systems talk to each other means that the corrective task request is logged automatically at the moment that a non-compliance is discovered. For example, if a cleaning audit is being carried out and a spillage is discovered, as soon as the completed audit is submitted over Wi-Fi or 3G/4G, a corresponding corrective task will automatically pop up in CARPS, pre-populated with the location and nature of the work required, to be assigned to an appropriate staff member. This not only saves the auditor time, as there is no need for them to request the corrective action separately, it removes the possibility of the corrective task request being forgotten altogether. The corrective task bears the reference of the audit which discovered the issue, meaning that everything is traceable - the reactive work itself as well as any follow up inspection required once the corrective action has been carried out. www.purcellradio.com


BATTERIES – They’re in our DNA

The Power of Partnership The new group name for Hefra, Manbat France and Manbat UK is ECOBAT Battery Technologies

• We are the world’s number 1 experts in lead technology • And we’re the world’s number 1 lead manufacturer • Our Pan-European network makes us Europe’s number 1

• We use closed-loop production to ensure 1st class environmental responsibility

• Because you are our number 1 priority

battery supplier P R E V I O U S LY T R A D I N G A S

B AT T E R Y T E C H N O L O G I E S


 New Products

Buyers urged to check standards Hybrid sweeper for indoor and outdoor use BPI Recycled Products is urging buyers to look for CHSA certified refuse sacks to make sure they always benefit from products that conform to the highest industry standards. The company is one of Europe’s leading manufacturers of refuse sacks, recycling 65,000 tonnes of scrap polythene each year and supplying over 270,000 tonnes of polythene products to customers worldwide. Too often buyers of plastic refuse sacks have not received what they paid for - for example, refuse sacks are described as ‘heavy duty’ but in reality fall short of this claim. The CHSA represents all the major manufacturers and distributors supplying cleaning and hygiene products in the UK. It has driven up standards, making it possible for buyers of cleaning products like refuse sacks to be sure when they buy accredited products that ‘what’s on the box is in the box’. Lorcan Mekitarian, commercial director at BPI Recycled Products, said: “We believe it’s vitally important for buyers to have confidence in the quality of the sacks that they are purchasing and that they don’t fall foul of misleading their customers. Regardless of which supplier they purchase them from, buyers can easily check with the CHSA the ranking of that particular supplier within the scheme and the number of audits carried out on its sacks. When you buy refuse sacks from any CHSA accredited member, like BPI Recycled Products, you can be confident you will get exactly what you pay for. There are some company-led standards for refuse sacks but none of them meet the industry-led CHSA standards, which have

transformed the market. Other standards don’t have the same stringent criteria, including rigorous independent assessment and auditing, which the industry should be adhering to in order to get the best products into the hands of our customers. As a strong advocate of the CHSA Accreditation Scheme, BPI Recycled Products’ entire Green Sack is manufactured to the exacting CHSA standards. All CHSA members adhere to the code of practice and, where relevant, the manufacturing standards accreditation schemes for soft tissue products, plastic refuse sacks and industrial cotton mops make sure customers get what they pay for. Each scheme guarantees: • Consistency of supply -

customers receive what they order. • Accurate labelling - customers know what is inside the packaging. • Fully audited manufacturers - customers get what they pay for. Crucially, application to one of the accreditation schemes doesn’t guarantee membership as applicants are only admitted if they pass the initial audit of all their products, labels and quality control procedures conducted by the scheme’s independent inspector. New members are audited four times in the first year of membership and at least twice annually thereafter. If they fail to meet the standard, they lose their accreditation membership. www.bpipoly.com

Website showcases scientific cleaning Innovation in cleaning takes centre stage in a new website recently launched by Denis Rawlins Ltd. The company’s site is designed to showcase a range of technologies that can help facilities managers and contract cleaners save cleaning time and thus reduce costs while also improving performance. Denis Rawlins has drawn on its extensive research of the global cleaning equipment market, and distilled four decades’ experience supplying and supporting clients, in developing its online resource. www.rawlins.co.uk

‘Work & Accrue’ simplifies zero-hour holiday calculations Continued from Page 28. biometric data capture ‘clocking’ terminals to collate accurate data, whilst direct integration with payroll software means organisations can streamline the entire process and remove human error. Christian Berenger, operations director at Vanquish Integrated People Solutions, said: “The introduction of the new ‘Work & Accrue’ holiday function demonstrates how we listen to our customers and develop solutions to make their lives easier. The feedback we received from employers is that whilst they like the flexibility of zero-hours workers, they create a real administrative headache when trying to work out holiday entitlements. For employers still relying on manual timesheets it is almost impossible and can mean spending hours trawling through paperwork to make a calculation which should take seconds. The ‘Work & Accrue’ feature removes the laborious process in its entirety so organisations can gain peace of mind that they are paying workers correctly and giving them the holiday rights they deserve whilst reducing valuable admin time.” www.vanquish-ips.com 30 l C&M l OCTOBER 2016 l www.cleaninghub.net

Nilfisk has launched the new SW5500 sweeper that boasts hybrid capability and reduces the total cost of ownership. The SW5500 is available in battery, LPG and diesel versions and has a working width of 850mm, enhanced with two side brooms to 1500mm. The new models have a range of innovative features: • Main broom adjustment system: Normally as a broom wears the sweeping performance is reduced in line with the deterioration in the brush. The new Nilfisk adjustment system means that the distance between the end of the bristle to the debris always remains the same. This simple adjustment feature ensures that optimum sweeping performance is maintained at all times. A low bristle length warning light is also included on the unit’s dashboard. • Hybrid options: The Hybrid option allows you to use the same machine inside and out, switching between engine and battery power at the touch of a button. The optional hybrid technology reduces emissions and noise levels, resulting in a true multipurpose sweeper. • Service options: A range of service options are available, from standard service with two annual maintenance visits to all inclusive, fixed cost packages that include replacement machines to protect against critical breakdowns.

All sweeping functions are activated by pressing one button and the drive pedal. Additional features include an energy saving, all functions auto stop when the unit is not being driven. A powerful drive wheel means that the unit can climb and sweep a 20% gradient. Speed is automatically reduced on slopes minimising the risk of tilting and improving safety. Speed control is provided on side brooms too, eliminating dust and providing a useful solution for sweeping up against gravel edges. The Nilfisk Dustguard misting system sprays water on side brooms reducing dust. All main components and filters can be quickly and easily replaced without the need for tools minimising downtime and service costs. www.nilfisk.co.uk

Washroom dispensers launched The introduction of an integrated set of washroom dispensers has come after a worldwide search for products that were well engineered and would minimise the use of paper. Throughout the new range - introduced by Freedom First Hygiene - well designed products offer savings, but without a high initial cost. Freedom First Hygiene is the UK sole supplier of this integrated set of towel, toilet tissue and soap dispensers and each dispenser type is available in both transparent and chrome. Freedom First Hygiene’s Paul Guy said: “Our integrated range has been engineered to keep cost in use to a minimum. Our towel and toilet tissue dispensers truly offer single sheet at a time dispensing, which is ideal for service providers, showing real cost savings for your end users. Extremely hygienic, only touch the sheet that you use, and no more clutching or wasting up to six sheets at a time.” Freedom First Hygiene is looking primarily for service companies or similar to become distributors. For more information please contact Paul Guy on 07709 358606. www.freedom-first.co.uk


GOODBYE

*When using two batteries. 30 minutes per battery when used 25% in scrub mode and 75% in wash/dry mode.

MOP?

VCSD-03 CORDLESS HARD FLOOR SPOT CLEANER Ideal for washrooms, kitchen areas and cafés, the VCSD-03 cordless hard floor spot cleaner is the perfect alternative to the mop and bucket. Delivering a more hygienic, less labour-intensive clean, the VCSD-03 only uses clean water, rather than spreading dirty water around. It effortlessly removes dirt and spills and leaves hard floors instantly dry. Plus, it’s cordless, so you get up to 60 minutes* cleaning without the restriction of a cable or fear of tripping. Is this goodbye mop?

FOR A FREE DEMO OR FOR MORE INFORMATION, PLEASE CONTACT VAX COMMERCIAL: 0330 0264 275

sales@vaxcommercial.co.uk

vaxcommercial.co.uk

@vaxcommercial


CLEANING AND MAINTENANCE THE INDUSTRY’S NUMBER 1 CHOICE

ESTABLISHED SINCE 1953 AND ALWAYS REACHING YOUR RIGHT AUDIENCE Cleaning and Maintenance - the official publication to The Cleaning Show and the only magazine handed out at the entrance to The Cleaning Show - delivered to in excess of 10,000 hard copy readers and reaching in excess of 26,000 digital readers - the biggest read within the cleaning & support services sector

Official show magazine of

Published by

THE

CLEANING SHOW 2015 WWW.CLEANINGSHOW.CO.UK

Make sure you reach your audience and advertise with us. &ORFURTHERDETAILSPLEASECONTACT 6ANESSA6AN3ANTEN 3MITH 3ALES-ANAGER#-MAGAZINE 4%, s-/" 

Follow us on Twitter @CleaningHub Join us on LinkedIn Cleaning & Maintenance magazine

www.cleaninghub.net


New Products 

Truck-mount power Fenton - new washroom in a portable package paper range launched Cleaning chemicals and technology specialist Prochem Europe has enjoyed increased uptake of its extraction machines from continental European customers in the first half of 2016. Topselling is the latest upgrade to the Endeavor range which effectively delivers small truck-mount performance in a fast, high power portable model with the flexibility to reduce solution pressure for smaller jobs and upholstery cleaning. The Endeavor 500 comes loaded with an induction motor-driven Cat pump, fully pressure-adjustable with gauged control from 50psi to 500psi. Its single 8.4 inch long-life, low-noise Lamb vacuum motor gives good air movement. It also incorporates a slide-in, modified version of Prochem’s successful ‘heat-and-run’ in-line stain-

less steel heat exchanger, giving heat up to 60 deg C. The latest benefit is the low voltage float switch incorporated into the waste tank, enabling the vacuum to shut down when the waste tank is full, and so protecting the vacuum motor from ingress of waste water or foam. www.prochem.co.uk

New approach to electrical safety training ‘vital to saving lives’ With more than 1000 electricity-related accidents still reported every year, a new approach to training is vital to save lives, warns specialist training provider Develop Training Limited (DTL). Most accidents are caused by contact with energised and exposed live conductors. Faulty equipment or unsafe working practices can also cause death or severe injuries from electric shock and arc flash, especially where this leads to falls, burns, fire, and explosion. DTL’s new whitepaper ‘Electrical Safety at Work: Developing competence for compliance’ - highlights how traditional training methods fall short and calls for a continuous learning approach. Each year, companies are fined vast sums of money for incorrect health and safety procedures. The report highlights that while there are some

basic rules for good practice which apply in most situations, there is a vast array of different standards and codes of practice governing how these should be applied to suit specific systems in different industries and environments. Steve Braund, marketing manager at DTL, said: “The key to ensuring safe working with electricity is ensuring the competence of staff at all levels in the tasks they should be undertaking, and in understanding what they should not do. Competence means having suitable training, skills and knowledge, and this cannot be achieved by just attending a course it must involve tailored instruction, practical experience and individual assessment.” To download a free copy of the whitepaper, please visit: http://bit.ly/2bOAYCi. www.developtraining.co.uk

Castle (EU) Ltd, supplier of cleaning and hygiene solutions for washrooms and facilities, has announced the launch of a new brand of washroom paper for the away from home market in the UK. According to Castle, this brand will fulfil the requirements of offices and facilities throughout the UK, providing a range of products in keeping with the image that is essential in today’s demanding office environment at pricing levels which are often only accessible to high volume users of paper consumables. “After the uncertainty in the UK and European markets following the Brexit referendum, we see the launch of this new brand - Fenton - as a great opportunity and our Castle team is excited about being able to bring these products to the market,” said Castle’s managing director, Darren Gill. “This brand will help our commercial contract cleaning partners to provide the highest quality products to their clients whilst offering significant cost savings. The combination of price and quality means our partners are able to offer an alternative way to their clients to gain cost savings to help mitigate the living wage increase that has come in over the last couple of months. Marcus Gill, director of sales, continued: “Adding the Fenton brand offering will help us to continue to offer the value and expertise our clients have come to appreciate from Castle as their leading supplier of commercial janitorial and maintenance supplies and equipment. After months of trials we are pleased to bring this to the market and, combined with the recent London expansion, will put Castle at the forefront of washroom product innovation in the away from home market." www.castle.eu.com

Sales Executive Jamie Anderson jamieanderson@quartzltd.com Tel: 01737 855086

Lindström enters UK textile wiper sector

Production Manager Carol Baird carolbaird@quartzltd.com Tel: 01923 437619

Finnish multinational group Lindström has entered the UK textile wiper sector by acquiring Bradford-based Enviro Wipes, a company supplying recyclable industrial wipes. Lindström, which was already active in the wiper market in Finland and the Baltic states, has had a presence in the UK workwear services sector since 2001. The purchase fulfils the textile service group’s ambitions of expanding its operations and strengthening its position in Britain. Enviro Wipes, founded in 1992, provides, collects, launders, and delivers multi-use cotton wipes across the UK and Ireland. Its activities also include selling a range of products, such as soap, gloves, protective creams, and storage bins. The business had a turnover of £3.1 million during the last full financial year and has approximately 1500 customers. The acquired company’s operations will remain unchanged following the sale, with all the 40 staff being retained by the new owner. Directors George Parker, Alan Green and Phil Walker, who, with their wives, previously owned Enviro Wipes, will exit the business, with finance director Walker remaining in post during the next few months to help with the transition. Soresh Meeda, managing director, Lindström UK, said: “Joining forces with Enviro Wipes provides a great opportunity for us to start with a totally new service in the market. Our new partner has a solid foundation, great products and fantastic customers, including in the printing and packaging, automotive, manufacturing, and maintenance sectors.” www.lindstromgroup.com

Published by Quartz Business Media Quartz House 20 Clarendon Road Redhill, Surrey, RH1 1QX Tel: 01737 855086 www.cleaninghub.net

Editor Neil Nixon neilnixon@quartzltd.com Tel: 07957 713316 Sales Manager Vanessa Van Santen-Smith vanessavss@quartzltd.com Tel: 01737 855041

Managing Director Steve Diprose CEO Paul Michael Paid Subscriptions Elizabeth Barford subscriptions@quartzltd.com Tel: 01737 855028 Circulation Enquiries Circdata quartzmedia@circdata.com Tel: 01635 879303 Annual Subscriptions 12 copies per year UK: 1 yr: £122 2 yrs: £220 Rest of the world 1 yr: £170 2 yrs: £306 C&M is free for qualified readers in the UK .

C&M is a proud supporter of the following associations and events:

ISSN: 1473 723X © Copyright Quartz Business Media 2016 All rights reserved. No part of this publication may be reproduced in any form or by any means, without prior permission of the copyright owner. Printed by Pensord Press Ltd. www.cleaninghub.net l OCTOBER 2016 l C&M l 33


PRODUCTS AND SERVICES ACCESSORIES AND SPARES

CARPET & UPHOLSTERY CLEANING

COMPUTER SOFTWARE

R

CORE SYSTEM

The only UK Trade Association for the Cleaning of Carpets, Hard Floor Coverings and Soft Furnishing. For Professional Accreditation, Training, Problem Solving, News, Advice, Events and More.... Contact the Industry’s Experts www.ncca.co.uk Tel: 0116 271 9550 Email: admin@ncca.co.uk

|Contracts |Budgets |Pay |Workbills |Stores Control |Billing |Accounts Integration |Analytics |Asset Management |:RUNÁRZ 'RFXPHQWV

FULLY INTEGRATED SOFTWARE

FEMININE HYGIENE

FEMININE HYGIENE BINS

FOR CLEANING CONTRACTORS

Brimaid Ltd, Valley Mills Valley Road, Bradford BD1 4RU Tel: 01274 728837 Fax: 01274 734351 www.brimaid.co.uk

SERVICE POINT

GUM REMOVAL

|Mobile CMS |Quality Audits |Customer Service |Customer Portal

ADD-INS

ATTENDANCE HARDWARE AND SOFTWARE

PAY AS YOU G TIME & ATTENDANCE SINCE 1992 AND WE STILL HAVE OUR VERY FIRST CUSTOMER Find out if your staff haven’t turned up before your customers do Automate your old paper time-sheet process and reduce the amount of payroll errors Gain more control and lower your management costs Win more business by ensuring your customers know they are getting exactly what they are paying you for We use free phone numbers so there is no charge to your clients We have no contract costs or subscription fees, we simple ask that you pay for what you are using On sites that have no Caller ID such as Banks or Doctors Surgeries we have a One-Time-Passkey system that will ensure your cleaners are calling from the site you are expecting them to We have a pre-pay option with huge savings.

|Dashboard |Advanced Forms |Hygiene Services |Employee Portal (2016) |Award Interpretation

| Tel: +44 (0)1732 832888 | Email: businessteam@templa.com | Web: www.templacms.co.uk

HYGIENE SUPPLIES

Find out more about our pricing and other services online at our website, email info@telelog.co.uk or call us for a chat on 0800 014 8888 Don’t forget to ask about our

30 DAY FREE TRIAL

telelog staff Tracker telelog.co.uk

WHERE ARE YOUR STAFF RIGHT NOW? We’ve created a powerful telephone based clocking system that is cost effective, easy to use and puts you in control of workforce management. With no equipment or installation costs, come and find out how your business can benefit from our class leading clock in systems.

A SIMPLE IDEA. SUPERB RESULTS.

HYGIENE SUPPLIES

Our telephone based clock in system provides real time, multi-site, employee proof of attendance and with CLOUD technology it can be accessed by PC or tablet, anywhere. Easy. Powerful. Incredibly useful. Any business can take advantage of our simple to use, but highly advanced clock in systems. Find out more on 0800 808 7733 or visit www.teleattend.com For M2M/GPRS terminals come to www.timestandard.co.uk CLOTHS

CLEANING & CHEMICAL MANUFACTURER

sales@assuredsolutionsltd.co.uk

To advertise in this section please call:

CLEANING

Jamie Anderson on 01737 855086

or email jamieanderson@quartzltd.com

To advertise in this section please call:

Jamie Anderson on

National Distributor of cleaning, hygiene and janitorial products. Contact us to discuss your requirements. ¨ ĉ â

0800 999 5006 nexongroup.co.uk info@nexongroup.co.uk

01737 855086

or email jamieanderson@quartzltd.com


PRODUCTS AND SERVICES BUSINESS FOR SALE

INSURANCE

For Sale: Commercial Cleaning: Dorset & Hampshire (Due to retirement) Established 2004 Q Annualised turnover at current level £150k, with great potential Q 17 on-going contracts Q 30 Part -time Staff Golden opportunity as start off Business Empire or bolt on acquisition Q

Expert Advice, Individual Service Independent Insurance Brokers specialising in the Cleaning & Window Cleaning Industry Tailor-made Liability Insurance policies for Cleaners and Window Cleaners

Q

Exclusive, Unique benefit for WFP users – Courtesy Vehicle complete with Ionic Reach and Wash System

Services Daily Cleaning: Schools/Offices/Factory/Bingo Establishment. Supplies: Consumables to existing Customers. (Revenue not included in Turnover.} Window Cleaning: To existing Customers, Builders Cleans: Ad-hoc {revenue not included in Turnover)

FREEPHONE OUR TEAM on 0800 877 8751 TRAINING

Easily run Business with great potential for development by dedicated personnel experienced in the commercial cleaning business

Contact for further information: ribbon2@btconnect.com BUSINESS FOR SALE

0207 112 9135

WINDOW CLEANING AND ACCESS EQUIPMENT

WINDOW EQUIPMENT

South East

Outstanding janitorials distribution business, turnover £1.6m: £650k excellent margins, strong growth, energetic sales force and retainable management. Retirement sale.

Surrey/Berkshire

£180k JVTTLYJPHSVѝJLSLPZ\YLJVU[YHJ[Z3VUNLZ[HISPZOLKMHTPS`ÄYT

South

£75k+ turnover £200k: top brand distributorship, low operating costs, stock relocatable, problem free bolt on for trade buyer.

Contract cleaning turnover £400k+ Attractive portfolio of

Chemicals & janitorials distributor Wilts/Dorset/ Somerset

Hampshire/ Surrey

£30k 6ѝJLcleaning contracts, turnover £70k. Retained several years,

South

£80k

London 0207 112 9135 Brighton 01273 857530

Z[HISL]LY`NVVKTHYNPUZ:P[LZ[HќVUS` Contract cleaning turnover £180k.VVKZWYLHKVMJVTTLYJPHS SLPZ\YLPUK\Z[YPHSJSPLU[ZNP]PUN]LY`H[[YHJ[P]LTHYNPUZ3V^[\YUV]LY workforce, no legacy costs, relocatable..

REQUIRED: CONTRACT CLEANING, FM, JANITORIALS, SECURITY AND B2B SERVICES BUSINESSES OF ALL KINDS. Free business appraisal and valuation for owners considering sale or retirement.

Buying or selling? Register online at: www.businesslinkbrokers.com To advertise in this section please call:

Jamie Anderson on 01737 855086 or email: jamieanderson@quartzltd.com CHEMICAL CONCENTRATES

THE UK’S LARGEST DEDICATED CLEANING & HYGIENE EVENT THE

NEW DATES ANNOUNCED

CLEANING SHOW 2017

THE MUST-ATTEND EVENT FOR ALL CLEANING, HYGIENE AND FACILITIES PROFESSIONALS This free-to-attend exhibition and conference offers essential business workshops, legislative advice and products for anyone with responsibility and purchasing authority within this sector.

14 –16 MARCH • EXCEL • LONDON

EXHIBITION STAND SALES NOW OPEN This event sold out in 2015. If you would like to participate we encourage you to contact us now to receive your exhibition pack and reserve space now. Vanessa Van Santen - Smith, Sales Manager +44 (0)1737 855 041 / vanessavss@quartzltd.com

Organised by

In association with

Official media partners

THE EVENT BRINGING TOGETHER 10,000 • Contract cleaners • Facilities managers • Healthcare estate managers • Hospitality, leisure and retail managers • Public service providers • Local government • Product and service providers

WWW.CLEANINGSHOW.CO.UK The NOVEMBER issue of C&M will include the Sweepers Machine Guide Should you wish to list a machine please contact a member of the Sales Team: Vanessa Martinet on 01737 855041 Jamie Anderson on 01737 855086 or email: vanessamartinet@quartzltd.com email: jamieanderson@quartzltd.com


GOODBYE

*When using two batteries. 30 minutes per battery when used 25% in scrub mode and 75% in wash/dry mode.

MOP?

VCSD-03 CORDLESS HARD FLOOR SPOT CLEANER Ideal for washrooms, kitchen areas and cafés, the VCSD-03 cordless hard floor spot cleaner is the perfect alternative to the mop and bucket. Delivering a more hygienic, less labour-intensive clean, the VCSD-03 only uses clean water, rather than spreading dirty water around. It effortlessly removes dirt and spills and leaves hard floors instantly dry. Plus, it’s cordless, so you get up to 60 minutes* cleaning without the restriction of a cable or fear of tripping. Is this goodbye mop?

FOR A FREE DEMO OR FOR MORE INFORMATION, PLEASE CONTACT VAX COMMERCIAL: 0330 0264 275

sales@vaxcommercial.co.uk

vaxcommercial.co.uk

@vaxcommercial

Cleaning & Maintenance October 2016  
Read more
Read more
Similar to
Popular now
Just for you