Page 1

Pontianak Post Selasa 14 Agustus 2012 M / 25 Ramadan 1433 H

Eceran Pontianak Rp. 3.000


Kecam Perburuan Enggang Gading Kebudayaan dan Pariwisata Provinsi Kalbar, Yusri Zainuddin mengatakan seluruh elemen masyarakat harus tanggap terhadap hal ini. Pasalnya burung yang dimaksud tersebut adalah maskot Kalbar yang akan selalu ditanya oleh pelancong saat mampir ke Kalbar. “Perburuan burung Enggang

Dua Wanita Tiongkok Dijebloskan ke Rutan PONTIANAK – Masyarakat Pariwisata Kalimantan Barat mengecam tindakan dua warga Tiongkok yang melakukan penyelundupan 96 mahkota Enggang Gading. Kepala Dinas

Gading ini jelas tidak elok dan berbahaya. Apalagi Enggang Gading adalah binatang langka dan terancam punah. Ini tentu tidak baik buat pariwisata kita, karena Enggang Gading adalah ikon kita,” ucapnya saat diwawancarai Pontianak Post di kantornya, kemarin (13/8). Yusri berharap semua pihak,

termasuk warga masyarakat dapat menjaga kelestarian burung yang bernama latin rhinoplax vigil tersebut. “Kita harus tanggap terhadap peristiwa ini. Semoga semua sektor dan instansi dapat berbuat untuk kelangsungan hidup hewan kebanggan Kalbar ini. Dan semoga penyelundupnya dapat

dihukum sesuai peraturan,” tandas dia. Hal serupa diungkapkan Ketua Association of the Indonesia Tours and Travel (Asita) DPD Kalbar, Hefni AS. Menurut dia kepunahan Enggang Gading ‹Ke Halaman 7 kolom 5

Mudik, Stok BBM Aman


Dua Hari 88 Tewas di Jalan, Sebagian Besar Pengendara Motor


Segera jadi Politisi SEJUMLAH artis tanah air akan bergabung dengan Partai Amanat Nasional (PAN) jelang pemilihan legislatif 2014 dan ajang pemilukada di beberapa daerah. “Artis juga manusia. Boleh juga jadi Anggota DPR,” kata Ketua Fraksi PAN di DPR, MUJADI/PONTIANAK POST

‹Ke Halaman 7 kolom 5

PADAT: Arus mudik sudah mendekati puncak kepadatan. Para calon penumpang kapal laut antar-pulau, harus berdesakan di halaman terminal penumpang di pelabuhan Kota Pontianak, Senin (13/8).

JAKARTA – Arus mudik Lebaran pada 2012 mulai terjadi akhir pekan lalu. Pemerintah memprediksi, puncak arus mudik terjadi pada H-3 dan H-2 Lebaran, yakni 16 dan 17 Agustus. ”Diperkirakan, puncaknya Kamis dan Jumat,” kata Dirjen Perhubungan Darat Kemenhub Suroyo Alimoeso setelah sidang kabinet paripurna di Kantor Presiden kemarin (13/8). Sidang kabinet yang dipimpin Presiden Susilo Bambang Yudhoyono (SBY) itu memang khusus membahas kesiapan menghadapi arus mudik dan Lebaran. Namun, menurut Suroyo, puncak tersebut diperkirakan tidak terjadi pada angkutan laut. Sebab, arus penumpang laut sudah mulai pada H-15. ”Jadi, mungkin yang peak itu ada di darat, kereta api, dan udara,” ujarnya. ‹Ke Halaman 7 kolom 5


Bulan Tafaqquh Fiddin


Moh. Haitami Salim

BUL AN ramadan sebagai bulan Tafaqquh fiddin adalah menjadikan ramadan sebagai momentum untuk tafaqquh fiddin, karena ramadhan juga disebut sebagai syahr uttarbiyyah (bulan pendidikan). Jika melihat bulan ramadan sebagai bulan tafaqquh fiddin, artinya ba ‹Ke Halaman 7 kolom 1


Batman Juga Manusia, Semua Bisa Jadi Superhero ANDA sudah menonton The Dark Knight Rises? Terus terang, saya me-review kembali Batman Begins dan The Dark Knight setelah ada penembakan brutal saat diputar midnight show seri penutup Batman-nya Christopher Nolan itu. Saya ingin tahu, kenapa sih kok ada orang segila James Eagan Holmes yang masih berusia 24 tahun hingga tega menembaki orang yang sedang asyik nonton

Dua Anggota Tim Arafah Tewas terjadi ketika mobil yang ditumpanginya tidak seimbang dan oleng di kawasan Lengkenet, 20 kilometer dari Kabupaten Sintang pada Senin (13/8) dini hari sekitar pukul 01.00. Dua korban ini meninggal setelah sempat mendapatkan perawatan medis. Selain dua korban meninggal, tiga tim Arafah lainnya juga mengalami luka-luka dan

Mobil Oleng Saat Ikut Sosialisasi PONTIANAK – Duka mendalam menyelimuti calon gubernur dan calon wakil gubernur Kalbar, Armyn A.AlianyangFathan A Rasyid dan tim Arafah lainnya. Dua anggota tim Arafah, Ida Rasida dan Farida Silfa meninggal dunia dalam kecelakaan mobil. Kecelakaan

Armyn A.Alianyang

...Memang ini musibah yang tidak terduga, inilah kehendak Allah yang tidak pernah kita duga,”

patah tulang. Menurut tim Arafah lainnya, Chandra yang juga sekretaris tim Arafah mengungkapkan, musibah itu terjadi murni karena kecelakaan. “Penyebab kecelakaan murni kecelakaan dan bukan terjun ke jurang. Dari informasi yang didapat, dikarenakan kurang keseimbangan sehingga mobil oleng,” kata Chandar, saat berkunjung ke rumah korban Ida Rasida, kemarin

(13/8). Rombongan tim Arafah ini berjumlah lima mobil. Rombongan hendak melakukan safari Ramadan dan sosialisasi kepada masyarakat. Sebelum terjadi kecelakaan, rombongan ini sudah melakukan safari Ramadan di Kabupaten Kapuas Hulu, Sintang dan Melawi. Setelah itu, rombongan ini berniat untuk melakukan safari di Kabupaten Sekadau. ‹Ke Halaman 7 kolom 5

Polisi Cari Bukti ke Bank Mandiri Transfer Dana Gelap Tender Simulator SIM ke Korlantas JAKARTA-Penyidik Mabes Polri tampaknya ingin membuktikan kemampuannya menuntaskan kasus korupsi simulator SIM Korlantas lebih cepat. Salah satu caranya dengan gencar melakukan pemeriksaan baik

terhadap tersangka maupun data dan bukti-bukti. Penyidik kini berusaha meminta salinan data transfer yang dilakukan Bambang Soekotjo, bos PT Inovasi Teknologi. Bambang mengklaim telah mengirim dana dengan transfer ke sejumlah rekening. Di antaranya rekening Primer Koperasi Korlantas Mabes Polri. “Kita masih menelusuri bukti-bukti, memang ada dari salah satu bank nasional yang kita minta datanya,” ujar Kepala Biro

Penerangan Masyarakat Mabes Polri Brigjen Boy Rafli Amar di Jakarta kemarin. Boy tak menyebut nama bank itu, namun dari pengakuan Bambang, dia menggunakan jasa Bank Mandiri. Bahkan, Bambang mentransfer uang sebanyak Rp15 miliar ke rekening Primkopol Korlantas dalam dua periode. Masing-masing Rp7 Miliar dan Rp8 Miliar. Dalam salinan bukti transfer

‹Ke Halaman 7 kolom 1













‹Ke Halaman 7 kolom 5

Dibalik Pembuatan Maskot Kalbar; Enggang Gading dan Tengkawang Tungkul

‹Ke Halaman 7 kolom 1

Bersaing dengan Ruai dan Arwana, Dipilih karena Filosofinya Sebagai maskot Kalimantan Barat, gambar Enggang Gading dan Tengkawang Tungkul mudah dijumpai dimana-mana. Terdapat pada lukisan di hotel-hotel, kantorkantor, hingga di seragam batik anak sekolahan. Tapi tahukah Anda bahwa membuatnya menjadi ikon Kalbar perlu perjuangan berat. ARISTONO EDI KISWANTORO, Pontianak ABDUL Halim Ramli ingat betul perdebatan penentuan maskot Kalbar pada tahun 1988 di Dewan Perwakilan Rakyat Daerah Kalbar. Waktu itu fraksi-fraksi dan para ahli saling adu argumen untuk



MASKOT KALBAR: Gambar yang menjadi maskot Kalbar ini dirancang Abdul Halim Ramli pada tahun 1992.

menjebolkan hewannya masing-masing. “Ada yang memilih Burung Ruai, Ikan Arwana dan lainnya. Masing-masing punya pandangan sendiri,” ungkap desainer maskot Kalbar; Enggang Gading dan Tengkawang Tungkul ini. “Namun yang paling dijagokan kala itu adalah Burung Ruai dan Enggang Gading,” sambung kakek 67 tahun ini. Sampailah perdebatan pada sejarah, filosofi dan mitologi dari kedua burung tersebut, dan akhirnya setelah digali, Enggang Gadinglah yang menang. “Walapun rupanya indah, Burung Ruai oleh sebagian sub-suku Dayak dianggap binatang yang tidak begitu istimewa. Bahkan ada yang pantang memakai bulunya sebagai hiasan kepala. Karena burung ini makan di tanah,” ucap dia. Keprihatinan Halim juga dikarenakan Enggang Gading adalah hewan yang dianggap suci oleh masyarakat Dayak, terutama Dayak Iban. Binatang yang dalam bahasa Iban disebut tajai ini adalah lambang dunia langit, sedangkan naga

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 4.000 *Ketapang Rp 4.000 *Kapuas Hulu Rp 4.000

‹Ke Halaman 7 kolom 1

Jawa Pos Group Media



Pontianak Post


Selasa 14 Agustus 2012


Nasionalisme di Midnight Sale SELALU ada cara untuk membujuk konsumen agar membelanjakan uangnya. Pengelola pusat perbelanjaan terus berinovasi, termasuk meramu program yang tak terbayangkan sebelumnya, misalnya belanja tengah malam (midnight sale). Melihat terus membesarnya program itu sehingga dilakukan oleh hampir semua pusat perbelanjaan di Indonesia pada hari-hari menjelang Lebaran, bisa disimpulkan midnight sale mengalahkan secara telak jam tidur di Indonesia. Fenomena midnight sale adalah fenomena dahsyatnya daya belanja konsumen kita. Midnight sale selalu berhasil menyulap kondisi pusat perbelanjaan menjadi penuh sesak seperti pasar murah. Banyak yang rela berdesak-desakan sampai saling berebut. Bahkan, tak jarang pula yang rela menunggu antrean di kasir sehingga sambil terkantuk-kantuk duduk di lantai. Kesuksesan program midnight sale tak hanya terlihat dari jumlah pengunjung mal yang membeludak, namun juga tingkat penjualan yang meningkat 3–5 kali lipat jika dibandingkan dengan hari biasa. Fakta menggiurkan itulah yang menjelaskan kenapa mal terus menambah daya tariknya. Misalnya, memberikan hadiah langsung bagi beberapa pembeli pertama dan tambahan diskon bagi yang membayar dengan kartu kredit tertentu. Dalam konteks makro, pemandangan di mal hari-hari ini adalah pertunjukan tentang betapa powerful-nya daya beli konsumen kita. Fenomena itu terekam dalam data Badan Pusat Statistik (BPS) pertengahan tahun lalu yang menunjukkan bahwa porsi konsumsi domestic di dalam gross domestic product (GDP) sudah mencapai angka 60 persen. Nilainya sudah mencapai Rp 3.500 triliun, sebuah angka yang luar biasa besar. Tingginya permintaan domestik itulah yang berpotensi menggerakkan industri dan perekonomian kita. Ketika industri kita menggeliat, penyerapan tenaga kerja dan peningkatan daya beli masyarakat akan terdongkrak pula. Juga, ketika daya beli naik, permintaan domestik yang makin besar itu semakin menggairahkan industri kita. Begitu seterusnya sehingga pertumbuhan ekonomi tersebut akan semakin terdongkrak naik. Tapi, itu semua terwujud dengan satu catatan. Yaitu, jika konsumsi domestik itu terserap oleh industri dan produk-produk lokal. Kalau konsumsi domestik tersebut diserap barang-barang impor, yang maju dan berkembang bukan industri dan produkproduk kita, melainkan industri dan produk-produk asing. Dalam konteks itu, kecintaan terhadap produk-produk lokal menjadi krusial. Nasionalisme konsumen menjadi harga mati kalau bangsa ini ingin menjadi bangsa besar. Kala konsumerisme mencapai puncaknya saat ini dan terjadi bersamaan dengan peringatan hari kemerdekaan ke-67, nasionalisme konsumen itu penting disuarakan. Memang ada yang meragukan, ketika kota-kota besar tanah air disesaki dengan mal-mal yang menjajakan berjibun merek global, apakah imbauan itu masih relevan? Ketika raksasa fast-food seperti McDonald’s dan KFC agresif melakukan penetrasi ke second city dan bersiap ke third city, apakah pemikiran tersebut masih laku? Sebagai warga negara yang mencintai negeri sendiri, kita harus tegaskan bahwa sampai kiamat pun nasionalisme konsumen akan tetap penting dan justru makin relevan. (*)

Manusia itu Bernama Jumena LELAKI tua bernama Jumena itu, duduk sendiri. Ia memandang sepi pada tali di hadapannya, yang disediakan untuk menggantung dirinya. Jumena lalu beranjak ke arah tali, dan bersiap-siap untuk mati sampai akhirnya ia berkata, “Kalau saya bunuh diri, sandiwara ini tidak akan pernah ada.� Lalu, lakon Sumur Tanpa Dasar, yang ditulis Arifin C. Noer, antara tahun 1960-1970 (terdapat berbagai versi mengenai ini), pun bermula. Semua alur dan jalinan konflik bertitik fokus

pada tokoh Jumena, tokoh yang berorientasi pada materi dan rasionalitas, yang mengabaikan relasi sosial (ia tidak mempercayai semua istrinya, termasuk istri keempatnya, Euis, karena beranggapan mereka bermaksud mendapatkan hasil dari timbunan hartanya; menuduh Marjuki, adik angkatnya, dan semua karyawannya, berniat menipu dirinya). Tokoh yang berteriak akan melawan malaikat dan setansetan yang berani mengganggu lemari uangnya. Dan tokoh

Oleh Abroorza Ahmad Yusra

yang bingung dengan eksistensinya. Karena itu, Jumena bisa dibilang mengidap krisis eksistensi. Krisis eksistensi Jumena tersebut yang menjadi pokok alur, dari awal hingga layar tertutup. Dan, tidak ada akhir konflik. Tidak ada penyelesaian konflik. Seakanakan, Jumena sesungguhnya tidak mati. Sebab, apa yang dialami Jumena memang tidak berdasar. Berputar-putar begitu saja. Jumena adalah manusia yang bimbang mengenai makna hidup sejati dan tidak pernah “mendapat apa yang dicari� atau tenggelam dalam “sumur tanpa dasar�. Dalam kerangka filsafat, hal tersebut amat bersentuhan dengan konsep eksistensialisme. Arifin memang pernah mengakui, ia ada dipengaruhi oleh pemikiran Freud dan beberapa pemikir eksistensialisme. Mungkin Albert Camus menarik perhatiannya juga, sebab beberapa teks lakon Sumur Tanpa Dasar mirip dengan Caligula, naskah besar si Camus. Dan Caligula itu, menekankan eksistensialisme yang absurd; bahwa hidup adalah sesuatu yang riddicolous, konyol. Atas dasar itu, Caligula pun merasa bebas untuk membunuh, memerkosa, dan merampok. Tapi Arifin bukanlah Camus. Jumena bukanlah Caligula. Tidak ada pembunuhan besar-besaran yang dilakukan Jumena. Tidak ada kematian tragis yang menjadi akhir riwayat Jumena. Arifin tidak ingin “mematikan� tokoh ini, sebab ia mengira-ngira bahwa Jumena akan selalu ada. Jumena hanya simbol ucapan selamat datang kepada era modern. Jumena diciptakan Arifin, terutama untuk Indonesia. “Saya melihat potret orang masa kini alias ‘modern’ dalam diri dan konflik Jumena Martawangsa, lelaki tua yang sukses tapi harus menghadapi suksesi itu.... dan yang lebih penting tokoh Jumena mewak-

ili orang Indonesia sekarang, yang merupakan ajang pertempuran antara masa-silam dan masa-depan, antara kekolotan dan kemajuan, antara kemapanan dan perubahan antara idealisme dan materialisme. Antara Tuhan dan Dajjal. Suatu pertempuran fikiran yang menyebabkan Jumena menjadi porak poranda sebagai manusia�. Arifin nampaknya benar. Sejak Indonesia beralih dari negara terjajah ke negara merdeka, lalu dari era Soekarno atau era Soeharto, dan era-era lainnya lagi, Indonesia tidak pernah lepas dari pertikaian ideologi, secara massal ataupun individual. Masing-masing berusaha mencari dirinya. Terus berlangsung hingga dekade dekat-dekat ini. Tentu, makna ideologi disini tidak sekadar isme-isme yang sering dibahas dalam pelajaran sejarah perpolitikan. Kecenderungan sosial dan budaya juga masuk dalamnya. Termasuk juga, kecenderungan untuk berlaku seperti Jumena yang berorientasi pada materi. Majalah Tempo, edisi 20-26 Februari 2012, mewartakan, lima puluh persen lebih penduduk Indonesia, secara statistik, adalah kaum menengah ke atas. Suatu hal yang menggembirakan jika dilihat dari sudut pandang ekonomi. Tetapi, eksistensi seseorang tentu tidak hanya ditandai oleh statistik finansialnya. Karena sering, orientasi materi hanya menutup mata seseorang terhadap keberadaan orang lain. Bukan perihal yang mengherankan jika suatu saat kita temui seseorang yang memiliki koleksi tas Hermes, baju Hugo Boss, atau bahkan mobil Alphard hanya untuk dipakai sesekali. Bukan hal yang aneh bila ada kita temui seseorang dengan berbagai macam koleksi sepatu dengan harga minimal sekian juta hanya untuk disimpan di almari. Dan saya pribadi, pernah kenal seseorang yang lebih rela berhutang buku kuliah demi pergi ke Singapura, menonton boy band Korea.

Sebagian bergerak dengan tujuan gengsi dan materi. Orientasi pada hal-hal itu muncul karena perkembangan budaya. Perkembangan budaya, banyak faktor yang turut andil di dalamnya. Pasar, gejala si Narcissus yang tidak tertahankan, pendidikan, dan macam-macam lagi. Kesemuanya, pada akhirnya, hanya menjadikan seseorang menjadi individualistis. Semakin nampak nyata bila mereka disandingkan dengan orang-orang yang bersusah payah hanya demi memenuhi kebutuhan, yang jumlah mereka tidak sedikit. Kalau keironisan tersebut tidak menggugah mereka, akan menjadi tidak masalah. Namun yang kerap terjadi adalah, masalah dan masalah. Memang hidup akan selalu diliputi masalah. Tinggal memilih saja, ingin masalah yang rada prinsipil atau konyol. Dan masalah yang ditimbulkan karena gengsi nampaknya sesuatu yang konyol. Ada orang yang terjerat utang hanya karena ngebet punya rumah baru. Ada orang yang jatuh miskin gara-gara belanja blak-blakan dengan kartu kredit. Ada orang yang terjerat kasus korupsi karena agar mendapat gelar haji. Akhirnya, yang tampak jelas dari mereka hanyalah kehadiran Jumena-Jumena baru. Lalu kita bertanya-tanya, bagaimanakah memenuhi impian agar meninggal dengan tenang, dikelilingi sanak tercinta, dihembus angin pantai, dan senyuman? Sebab, itulah impian terbanyak dari umat manusia, menunjukkan bahwa yang dicari manusia dari kehidupan adalah kebahagiaan. Lantas, kita pun melangkah ke dalam agama, ke dalam seminar enterpreneurship, ke dalam profesi, ke dalam buku-buku. Masing-masing dengan jalannya masing-masing. Masingmasing dengan keyakinannya masing-masing. Masing-masing ingin menghindari diri dari menjadi Jumena. Dan Arifin mencoba membantu. Katanya, setelah lama lakon itu ia tulis, kesalahan Jumena yang paling fatal adalah; tidak lagi sepenuhnya kepada Tuhan (Teater Tanpa Masa Silam, 2005:160). Namun, “eksistensi manusia� sama artinya dengan “semua bergantung pada manusianya�. Langkah kaki, tetap manusia yang melakukannya. Mungkin, bisa dimulai dari mencari makna sesungguhnya dari “ketenangan�. “Kalau saya bisa percaya, saya tenang. Kalau saya bisa tidak percaya, saya tenang. Kalau saya bisa percaya dan bisa tidak percaya, saya tenang. Tapi, saya tidak bisa percaya tidak bisa tidak percaya, jadi saya tidak tenang. Tapi juga, kalau saya tenang, tak akan pernah ada sandiwara ini� ujar Jumena. Dan begitulah realitas kehidupan (baca; sandiwara), dari rahim yang tenang, kita lahir untuk mencari ketenangan, sampai atau tidak sampai. ** Penulis, independent dan seniman, tinggal di Pasiran, Singkawang.

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Persetujuan Perubahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redaksi: (0561) 735070.Telepon Iklan/Pemasaran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: Penerbit: PT.Akcaya Utama PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Redaksi/Penanggung Jawab: B Salman. Redaktur Pelaksana: Khairulrahman, Muslim Minhard, Donatus Budiono, Basilius Sidang 5HGDNVL$EX6RÂżDQ6XUKDQ6DQL0HOD'DQLVDUL<XOÂż$VPDGL$QGUH-DQXDUGL0XUVDOLQ5REHUW,VNDQGDU(ISUL]DQ6HNUHWDULV5HGDNVL6LOYLQD6WDI5HGDNVL0DULXV$385RQDOG'HQ\+DPGDQL%XGLDQWR&KDLUXQQLV\D0.XVGKDUPDGL+DUL.XUQLDWDPD Jawa Pos Group +HQG\,UZDQGL3UDFHWDN$UWLVWLN$5L\DQWR .RRUGLQDWRU *UDÂżV6LJLW3UDVHW\R,OXVWUDWRU.HVVXVDQWR)RWRJUDIHU7LPEXO0XGMDGL6DQGR6KDIHOOD%LUR6LQJNDZDQJ=XONDUQDHQ)DX]L (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: (Jl P Anom Telp (0562) 392683) Biro Sanggau: Anto Winarno (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Achmad Fachrozi, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Wahyu Ismir. Pemasaran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Langganan per 1 Bulan dalam kota Rp 80.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 25.000,- spot colour Rp 30.000,- full colour Rp 37.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, maksimal 10 baris) pembayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Maâ&#x20AC;&#x2122;ruf No.4 Pasar Minggu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.

Pontianak Post

Pontianak Post



Selasa 14 Agustus 2012




Perketat Pengawasan ANGGOTA A Komisi C DPRD Kalimantan Barat Ali Akbar mendukung langkah kepolisian dalam upaya penindakan penyalahgunaan solar bersubsidi dan mengakibatkan kelangkaan. “Kita dukung penuh upaya aparat keamanan yang gencar melakukan pengawasan terhadap penyaluran solar bersubsidi ini. Tumpas hingga ke penampungnya. Ini sangat meresahkan,” kata Politikus PPP ini. Ia juga meminta ahar Pertamiana dan Pemerintah Kota Pontianak turut serta memperketat pengawasan. Apalagi, seminggu menjelang Lebaran ini, arus lalu lintas baik Ali Akbar penumpang maupun barang tengah padat-padatnya sehingga bahan bakar, khususnya solar, mutlak tersedia. “Jangan sampai arus transportasi tersendat karena kelangkaan solar. Bisa menimbulkan efek berganda nantinya,” kata Ali. Menurut Ali, kuota solar bersubsidi mungkin saja mencukupi untuk Kalbar, dengan catatan tidak digunakan untuk kebutuhan lain di luar aturan. Sementara terkait kartu kendali solar yang dibagikan di SPBU-SPBU, menurut Ali, merupakan salah satu upaya pemerintah dengan tujuan melancarkan penjualan bahan bakar bersubsidi tersebut. Namun yang dikeluhkan para sopir, dengan kartu kendali dan dijatah 80 liter untuk satu hari, tidak bisa digunakan untuk pulang dan pergi pada rute yang mempunyai jarak tempuh cukup jauh. “Misalnya saja untuk Pontianak-Sanggu, untuk pulang pergi itu tidak cukup dengan 80 liter. Mereka tidak bisa pulang bisa-bisa. Maka harus dua kartu kendali,” kata Ali. Pada Rabu (8/8) lalu, perwakilan sopir berunjukrasa ke Pertamina Pontianak. Sopir menuntut empat hal, yakni pengisian solar bisa dilakukan tanpa ada batasan, Pemkot Pontianak melakukan pengawasan di SPBU, batas waktu dihapuskan, dan menetapkan satu SPBU yang khusus melayani pengisian solar bagi truk dalam kota, yakni SPBU Parit Mayor dengan batas waktu yang pengisian solar bagi sopir truk dalam kota Pontianak dengan jatah pengisian solar 80 liter untuk satu hari, serta batas waktu pengisian sesuai dengan peraturan yang ada yakni dari pukul 10.00 hingga 20.00. Koordinator Aksi Warno mengatakan, selama ini permasalahan yang dihadapi sopir truk itu susahnya mendapatkan solar. Meski sudah mengantre sesuai dengan peraturan yang telah ditentukan Pemkot Pontianak masih tidak mendapatkan solar. Pihaknya menuntut agar pengisian solar dapat dilakukan seperti biasa, Pemkot maupun Pertamina harus melakukan pengawasan, batas waktu dihapuskan, dan menunjuk satu SPBU khusus melayani pengisian solar h beberapa tuntutan kita diterima,” bagi truk. “Alhamdulillah ucapnya. (zan)

EMAS LEBARAN: Pramuniaga salah satu toko emas di Jalan Nusa Indah, Pontianak, merapikan cincin di etalase, kemarin (13/8). Kenaikan transaksi mencapai puncaknya pada hari-hari terakhir menjelang Lebaran saat ini. Biasanya banyak yang membeli perhiasan untuk keperluan Lebaran dan dipakai saat silaturahmi dengan keluarga. SHANDO SAFELA/PONTIANAK POST

Stok Daging Aman Harga Melambung karena Permintaan Tinggi PONTIANAK-Melonjaknya harga daging sapi dan ayam di Kota Pontianak bukan karena stoknya sedikit, melainkan karena permintaan yang sangat tinggi selama Ramadan dan menjelang Lebaran. Kepala Dinas Peternakan dan Kesehatan Hewan Provinsi Kalimantan Barat, Abdul Manaf Mustafa mengatakan, stok sapi masih ada 31 ribu ton dan ayam 3,5 juta ekor dengan angka kematian 3 persen. “Dengan jumlah itu ketersediaan aman,” ungkapnya, kemarin. Diberitakan sebelumnya, di Pasar Kemuning Kota Baru, untuk harga daging

sapi sudah mencapai Rp85 masih terpenuhi. “Stoknya ribu perkilogram dari sebeada, keamanan pangan pun lumnya Rp75 ribu perkitidak terancam. Hanya itu logram. Sedangkan untuk saja yang kami lihat, kalau ayam Rp28 ribu perkiloharga bukan kewenangan gram yang sebelumnya pemerintah,” katanya. Rp20 ribu sampai Rp22 ribu Harga melambung kareperkilogram. Bahkan pedana permintaan sangat tinggi. gang memperkirakan harga Apalagi ada kecenderungan daging akan terus mengalapeternak menahan stoknya mi kenaikan hingga tembus sehingga ketersediaan di Rp 90 ribu perkilogram. pasar berkurang. “Jika stok Manaf mengungkapkan, Abdul Manaf Mustafa ditahan tentu harganya pihaknya tidak dapat berakan naik karena permintbuat apa-apa terhadap harga. Pemerin- aan tinggi,” ucap Manaf. tah hanya dapat memantau dari aspek Mencoba mengontrol harga dengan ketersediaan dan keamanan pangan. menyediakan stok cadangan pernah Dua aspek itu, menurut Manaf, saat ini, dilakukan dinas peternakan dan kes-

ehatan hewan pada 2010. Kala itu, kata Manaf, pihaknya mendatangkan ayam beku sebanyak 50 ton. Tujuannya, jika pun stok terbatas atau sengaja ditahan, ayam beku itu dapat menjadi alternatif sehingga harga tidak terlalu melonjak. “Tetapi ayam beku itu tidak laku di pasar,” ungkapnya. Kemudian setahun kemudian pernah juga disediakan ayam sekitar satu ton. Kembali barang tersebut tidak laku di pasaran. “Nah, kami tidak bisa apa-apa,” katanya. Manaf menegaskan, hari ini pihaknya akan mendatangi beberapa pasar untuk meninjau harga dan ketersediaannya di tingkat penjual. “Kami akan gelar sidak,” tegasnya. (hen)

Pajak Incar Badan Usaha dan Perorangan JAKARTA—Kementerian Keuangan sudah mulai ancangancang untuk mengumpulkan pundi-pundi pajak 2013. Intensifikasi dengan membidik badan usaha dan perorangan pun siap jadi andalan. Menteri Keuangan Agus Martowardojo mengatakan, satu hal yang menjadi concern pada pos penerimaan negara tahun depan adalah potensi turunnya Penerimaan Negara Bukan Pajak (PNPB). Sebagai kompensasi, pemerintah pun akan menggenjot penerimaan pajak. ‘Terutama di PPh (Pajak Penghasilan, Red), itu di badan usaha dan perorangan,” ujarnya, kemarin (13/8). Menurut Agus, potensi penurunan PNBP disebabkan akibat turunnya harga komoditas, terutama migas, serta beberapa komoditas sumber daya alam (SDA) lain. Sebab, harga komoditas alam tahun ini sudah berada di level tinggi sehingga diprediksi mulai melandai ta-

hun depan. “Penerimaan dari SDA itu yang diprediksi berpengaruh pada PNBP,” ucapnya. Karena itu, lanjut dia, optimalisasi penerimaan pajak menjadi target pemerintah. Selain PPh, pos lain yang akan digenjot adalah Pajak Pertambahan Nilai (PPN). “Dengan peningkatan PPh dan PPN, kita harapkan penerimaan pajak bisa tumbuh 16 persen,” katanya. Menurut Agus, penerimaan pajak dari pos PPh ditargetkan bisa naik seiring dengan program ekstensifikasi dengan bertambahnya jumlah Wajib Pajak (WP) badan dan perorangan. “Kalau untuk PPN, tahun ini kan sudah cukup baik, diharapkan meningkat tahun depan,” ujarnya. Tahun ini, dalam APBN-P 2012, pemerintah mematok target penerimaan pajak sebesar Rp885,03 triliun yang terdiri dari penerimaan PPh Rp513,65 triliun, PPN Rp336,06 triliun,

Pajak Bumi dan Bangunan (PBB) Rp29,68 triliun, dan Pajak Lainnya Rp5,63 triliun. Data Kementerian Keuangan menunjukkan, sepanjang semester I 2012, realisasi penerimaan pajak sudah mencapai Rp432,177 triliun atau merupakan 44,6 persen dari target dalam APBN-P 2012. Penerimaan pajak tersebut didukung oleh penerimaan PPh non migas dan Pajak Pertambahan Nilai (PPN) yang sampai dengan Juni 2012 mampu memberikan kontribusi masing-masing sebesar 46 persen dan 34,6 persen dari total penerimaan pajak. Dalam laporan kinerja APBN, realisasi penerimaan PPh semester I 2012 mencapai Rp 233,567 triliun atau 45,5 persen dari target APBN-P 2012. Realisasi tersebut terdiri dari penerimaan PPh migas sebesar Rp34,787 triliun dan PPh nonmigas sebesar Rp198,780 triliun. (owi)

Nasabah MNC Life Naik 2.000 Persen Karena UM Klaim JAKARTA A – Kemudahan klaim ternyata masih menjadi faktor penentu nasabah memilih asuransi. Buktinya, produk layanan Uang Muka (UM) Klaim yang merupakan inovasi MNC Life ternyata mampu mendongkrak penjualan polis, terutama produk Hario Siaga. Itu terbukti dari meningkatnya jumlah pemegang polis AGUS WAHYUDI /JAWA POS Hario Siaga yang tumINOVATIF: Brand Ambassador Nathania memperlihatkan kartu Uang buh 2.000 persen sejak diluncurkan pada Muka Klaim saat penyerahan penghargaan dari Muri kepada MNC Life Juli 2011. Saat ini pe- di acara Dahsyat di studio RCTI, Jakarta, Minggu (12/8). megang polis Hario Siaga hampir mencapai 1 juta Dahsyat di studio RCTI, Jakarta, yang didirikan pada 23 Novoucher. Minggu (12/8). vember 2010 itu sudah men”Saya optimistis pertumbuMuri memberikan peng- capai sekitar 110.000 nasabah. han MNC Life dalam beberapa hargaan atas terobosan MNC Pendapatan premi sejak Januari tahun ke depan berkembang pe- Life untuk produk layanan hingga akhir Juli lalu sudah sat dengan terus mengedepankk Uang Muka Klaim sebagai mencapai Rp74 miliar. Angka an inovasi baru dalam mem- inovasi yang pertama ada di melebihi total pendapatan preberikan layanan prima kepada bisnis asuransi di Indonesia. mi sepanjang 2011 yang sebesar nasabah,” ujar Direktur Utama Rolla mengakui, sejumlah ino- 56 miliar. ”Makanya, kami optiMNC Life Rolla Bawata setelah vasi yang dikeluarkan MNC itu mistis target perusahaan Rp150 menerima penghargaan dari mulai diterima masyarakat. miliar pendapatan premi hingga Museum Rekor Dunia IndoSaat ini jumlah pemegang akhir tahun ini bisa terpenuhi,” nesia (Muri) di sela-sela acara polis perusahaan asuransi jiwa kata dia. (wir/c10/kim) C




Pontianak Post Â&#x2021; Sabtu 11 Agustus 2012


EMPAT puluh satu tahun hidupnya diisi dengan aktivitas kepramukaan. Pramuka adalah energi positif yang bisa memberikan banyak ilmu dan pengalaman yang menjadikannya sosok perempuan berani, disiplin dan mandiri. Khusus memperingati Hari Pramuka 14 Agustus ini, For Her mewawancarai Dra. Endang Indri Listiani, M.Si (49 th). Dosen Fisip Untan ini dikenal akan keterlibatan aktifnya sebagai Pembina Pramuka dan Andalan Pramuka Kalbar.



Sejak kapan Anda ikut Pramuka, dan sudah berapa lama? Saya mengikuti pramuka sejak duduk di kelas 3 SD. Dimulai dari siaga, penggalang, penegak, pandega dan hingga kini saya sebagai Pembina pramuka. Berarti sudah sekitar 41 tahun saya bergelut didalam aktivitas kepramukaan ini. Sekarang ini, saya menjabat sebagai Andalan Pramuka Kalbar. Tugasnya antara lain memberi masukan, pendapat serta nasihat agar organisasi pramuka di Kalbar bisa terus berjalan dengan baik.

dian lebih terampil dengan mahir sandi morse, ataupun berkemah yang semakin mendekatkan saya pada alam. Pramuka memberi peluang saya kesempatan untuk belajar disiplin, dan menjadi sosok yang berani dan mandiri. Sehingga ketika saya terjun langsung ke tengah-tengah masyarakat seperti sekarang ini, ilmu yang didapatkan dari pramuka sangat membantu saya menjadi lebih baik lagi. Apa manfaat yang diperoleh dari kegiatan pramuka? Bagi saya, pramuka adalah sebuah organisasi yang memberikan kesempatan kepada generasi penerus bangsa untuk bisa belajar menjadi sosok pemimpin yang mandiri, yang selalu membiasakan menyelesaikan masalah dengan cara musyawarah mufakat. Pramuka adalah salah satu organisasi yang menerapkan lima pancasila, artinya dari sila pertama hingga sila kelima semuanya ada di dalam Pramuka. Kita diajarkan untuk berteman hingga belajar berorganisasi kepemimpinan. Dengan bergabung di pramuka, membuat saya bisa menerapkan apa yang ada di dalam Pancasila ke dalam kehidupan saya sehari-hari. Intinya, bila berbicara manfaat pramuka untuk hidup saya, tak akan pernah ada habisnya untuk diceritakan. Karena pramuka telah memberikan nilai positif bagi kehidupan saya secara pribadi maupun orang-orang di sekitar saya.

Di usia Anda yang hampir 50 tahun, kenapa masih tertarik bergabung di pramuka? Pramuka selalu memberikan pengalaman dan cara pandang yang baru. Tak ada ruginya saya aktif menjadi anggota dari organisasi pramuka. Bahkan jika saya tidak aktif di salah satu kegiatan pramuka, seperti ada yang hilang di dalam hidup saya. Tokh, usia tak membatasi seseorang dalam beraktifitas, apalagi jika aktifitas yang dilakukan adalah hal yang kita senangi. Rasanya seperti menghirup udara segar setiap waktu. Apa menariknya Pramuka dibanding aktivitas kegiatan lain? Dulunya waktu sekolah, saya memilih pramuka karena disini saya belajar banyak hal dalam mengembangkan kemampuan dan ketrampilan siswa. Misal, kegiatan menjelajah yang membuat saya jadi perempuan mandiri, kemu-


Pengalaman menarik dan




berkesan apa selama Anda mengikuti pramuka? Memiliki pengalaman yang luar biasa saat mengikuti jambore tahun 1977 di Sibolangit, Medan hingga sampai ke luar negeri (Singapura). Kemudian, mengikuti kegiatan Raimuna tingkat nasional di Karang Kates, Jawa Timur tahun 1978 adalah beberapa rangkaian pengalaman yang saya dapatkan selama aktif di pramuka. Kegiatan ini membuat teman saya bertambah banyak, dari dalam hingga luar negeri. Kami semua bersatu dalam satu wadah kepramukaan dan menjadi keluarga besar. Beda wilayah bahkan beda Negara bukanlah penghalang bagi kami. Bagaimana Anda membagi waktu dengan aktifitas di luar pramuka? Sejauh ini semua aktifitas yang saya jalani, baik aktif sebagai Andalan daerah Kalbar maupun menjadi Dosen Fisip Untan, bisa saya jalani dengan baik. Jika ada kegiatan yang bentrok, saya usahakan untuk tetap hadir walau sebentar. Mengingat tugas utama saya sebagai pendidik, jadi saya harus mengutamakan hal itu. Meski begitu, saya juga tak mengabaikan pramuka, karena ilmu yang saya peroleh di kepramukaan, juga saya teruskan kepada para generasi muda, khususnya yang bergabung sebagai anggota pramuka. Menurut Anda, bagaimana minat generasi muda sekarang terhadap pramuka?

Saya melihatnya sekarang ini, minat pemuda pemudi untuk ikut pramuka memang berkurang ya. Jelas ini menjadi keprihatinan tersendiri bagi kami para Pembina pramuka. Kalau ditanya penyebabnya apa, bisa jadi karena mereka berpikir pramuka itu kegiatan yang lebih banyak dihabiskan di luar ruangan sehingga mereka takut tubuhnya gosong terkena paparan sinar matahari seharian dan bikin badan lelah. Sehingga mereka memilih untuk bermain game di rumah, atau ngadem di mal saja yang jauh lebih menyenangkan. Nah disinilah tantangan bagi saya dan teman-teman agar bagaimana caranya mencari terobosan agar generasi muda mau ikut bergabung di pramuka. Membuka pikiran mereka akan positifnya kegiatan kepramukaan. Saya yakin bila pemuda pemudi bangsa ini sungguhsungguh mengamalkan prinsip kepanduan dalam kehidupan mereka sehari-hari, maka seluruh remaja akan menjadi generasi muda yang baik dan berguna bagi bangsa ini. Di Hari Pramuka ini, apa makna dan harapan Anda? Saya berharap pramuka dapat terus memberikan energi positif, pengalaman baru serta hal-hal yang menarik bagi generasi muda. Dengan tidak takut untuk mencoba hal-hal positif, percayalah bahwa Anda tidak akan pernah rugi menjalani kehidupan. Pramuka terus jaya dan melahirkan generasi muda yang berprestasi pastinya! **

Pontianak Post


Selasa 14 Agustus 2012




Global TV Pukul 14.00 WIB




06.30 Mamah Dedeh Keliling Masjid 07.30 Curious George 08.30 Friends 11.30 Topik Siang 14.30 Chhota Beem aka Bima Sakti 15.00 Dodos World 17.00 Pesbukers 19.00 Catatan Si Olga 23.00 Jakarta Punya Cerita

06.30 08.00 11.30 13.30 16.00

06.30 09.30 10.00 11.30 17.00 19.00 22.00 22.30

Dug Dug Dor

18.00 19.00 21.00

Disney Club Serial Pilihan Lintas Siang I Drama Upin dan Ipin Berbuka Puasa Tendangan Si Madun Aladin Raden Kian Santang

Yamada Berkisah tentang seorang pengembara dan pendekar pedang Jepang Yamada Nagamasa yang hidup di zaman Ayothaya. Pengembara ini kemudian menjadi disegani di Thailand dan menjadi gubernur Nakhon Si Thammarat, sebuah provinsi di selatan Thailand. (*)


Ada komedian superlucu yang bakal ngasih stand up comics buat orang-orang tertentu di tempat komunitas di Jakarta. Kerja samanya tentu aja bareng orang terdekat korban. Coba tengok kiri-kanan, siapa tahu kamu yang jadi korbannya. (*)

07.00 10.00 12.00 12.30

Inbox FTV Pagi Liputan 6 Siang FTV Siang

16.30 17.33 22.00 23.30

Cinta Bersemi di Putih Abu-Abu Mengetuk Pintu Hati dan Azan Magrib Si Biang Kerok FTV Utama

Indosiar Pukul 23.30 WIB


Apa Kabar Indonesia Pagi Kabar Pasar Pagi Coffee Break Kabar Siang Kabar Petang Kabar Utama Menyingkap Tabir Kabar Arena

06.30 12.00 13.00 14.30 15.30 17.00 20.00 22.00

Redaksi Pagi Selebrita Siang Laptop Si Unyil Brownies Jejak Petualang Bukber Opera Van Java Bukan Empat Mata RCTI Pukul 06.45 WIB

The Incredibles

METRO TV 08.05 11.30 13.05 16.05

8 Eleven Show Metro Siang Wideshot Ensiklopedia Islam

20.30 21.30 23.05 23.30

Bicara Konstitusi Today’s Dialogue Genta Demokrasi Metro Sports

Keluarga superhero yang galau. Si bapak perkasa yang merasa tak berguna, si ibu sakti yang risau melihat suaminya galau, serta anak-anak hebat yang tengah memasuki fase puber dan butuh perhatian. Dan penjahat gila yang terobsesi menjadi superhero. (*)

Penutupan Olimpiade Bertabur Bintang AFP PHOTO

LONDON—Spice Girls, Jesse J, Muse, Beady Eye, Take That dan George Michael hanyalah beberapa dari sekian banyak bintang yang memeriahkan penutupan Olimpiade 2012. Dalam upacara yang disaksikan langsung oleh 10.000 atlet dan 80.000 penonton di stadion itu, api Olimpiade dipadamkan secara dramatis. Setiap negara akan menerima satu dari 204 helai kauldran. Ketika kembang api menghiasi langit di atas stadion, grup the Who membawakan lagu My Generation dan stadion menjadi lautan konfetti berwarna merah, putih dan biru. Acara terakhir yang dimulai dengan dentang lonceng Big Ben, memamerkan musik, fashion dan budaya Inggris. Pangeran Harry mewakili Ratu Elizabeth pada upacara yang berlangsung di panggung berbentuk bendera union jack dan didukung oleh 3.500 sukarelawan. Pertunjukan itu juga me-

nampilkan reuni Spice Girls yang membawakan Spice Up Your Life dari atap lima taksi London, dan penampilan kejutan dari Take That, yang membawakan hit mereka Rule the World. Awalnya grup itu diduga tidak akan tampil karena Gary Barlow masih berduka cita setelah anak perempuannya meninggal saat dilahirkan Sabtu lalu. Sejumlah artis kenamaan lainnya asal Inggris juga memeriahkan acara. Beady Eye misalnya. Band pecahan Oasis dan digawangi oleh Liam Gallagher ini tampil menawan. Mereka membawakan lagu klasik Oasis, Wonderwall. Penampilan ciamik lainnya yakni aksi Brian May dari Queen yang berduet dengan atis fenomenal saat ini Jesse J. Mereka menghentak panggung dan membawa penonton ikut bernyanyi klantang di lagu We Will Rock You. Pengarah artistik Kim Gavin juga menyatukan beberapa artis populer termasuk George Michael, Jessie J, Emeli Sande,

MERIAH: Penampilan aktraktif para artis pada penutupan olimpiade. Gitaris Queen Brian May dan Jesse J beraksi lewat lagu We Will Rock You (kiri bawah). Pertunjukan itu juga menampilkan reuni Spice Girls yang membawakan Spice Up Your Life dari atap lima taksi London (atas). Sementara Beady Eye, tampil menawan lewat lagu klasik Oasis, Wonderwall (kanan bawah).

Madness, the Pet Shop Boys, One Direction, Ray Davies dan Liam Gallagher, sebagai perwakilan musisi terbaik Inggris. Dalam salah satu bagian

upacara, bendera Olimpiade dikibarkan oleh Wali Kota London Boris Johnson dan diserahkan pada Walikota Rio, Eduardo Paes. Lagu kebangsaan Brasil

bergema dan stadion berubah warna menjadi hijau dan kuning sesuai warna bendera Brasil. Dunia mode Inggris juga diwakili dengan penampi-

lan supermodel Kate Moss dan Naomi Campbell yang mengenakan karya mendiang desainer Alexander McQueen, sedangkan sisi eksentrik Inggris diwakili

dengan komedian Russel Brand yang menyanyikan lagu Beatles ‘I am the walrus’ dari atas bus bertema psychedelic, sebagai representasi era 1960an. (bbc/r)

Aniston Terima Pinangan Kekasih LOS ANGELES—Justin Theroux superbahagia saat merayakan ulang tahunnya yang ke-41 Jumat lalu (10/8). Jennifer Aniston, sang kekasih yang berusia dua tahun lebih tua, menerima pinangannya. Hal itu dibenarkan juru bicara pria yang juga sutradara film Mulholland Drive tersebut. “Pesta ulang tahun Theroux sangat istimewa Jumat lalu. Hadiah dari kekasihnya sungguh istimewa, yakni penerimaan lamaran,” demikian pernyataan juru bicara Theroux seperti dilansir People. Pertunangan itu dikait-kaitkan dengan rumor tak terkonfirmasi tentang pernikahan mantan suami Aniston, Brad Pitt. Sebelumnya, dikabarkan Brad Pitt berencana menikahi Angelina Jolie di Prancis. Aniston dan Theroux kali pertama muncul bersama di hadapan publik sekitar Mei 2011. Dua bulan kemudian, aktris pemeran serial Friends tersebut menjual mansion-nya di Beverly Hills. Pada Januari lalu, Aniston pindah

Jennifer Aniston dan Justin Theroux





ke sebuah rumah mewah di LA Bel-Air bersama Theroux. Rumah itu dibeli senilai USD 22 juta (Rp 208 miliar). Ayah Aniston, John, mengaku belum mengetahui kabar pertunangan tersebut. “Saya baru tahu dari Anda (media). Saya harus browsing berita dulu. Kalau sudah dapat banyak, saya beri tahu,” kata aktor Days of Our Lives berusia 79 tahun tersebut dengan nada bercanda seperti dikutip dari Daily Mail. Meski begitu, John tampaknya tidak keberatan dengan calon menantunya tersebut. “Justin adalah pria yang sangat menarik. Dan, melamar di hari ulang tahun adalah hal yang romantis,” katanya. John yakin, keduanya akan menjadi pasangan suami-istri yang menakjubkan. Melanjutkan pertunangan itu, pernikahan bagi Aniston semakin dekat. Namun, tidak dijelaskan kapan mereka berencana mengikat janji. (c6/ayi)



Pontianak Post

Selasa 14 Agustus 2012

Annisa Maharani; Sudah Berceramah Sejak Sekolah Dasar

SMS RAMADAN SMS ke: 0811571700 DIASUH OLEH: Dr. H. Wajidi Sayadi, M.Ag. (Ketua Jurusan Dakwah STAIN Pontianak)

Baca Alfatihah Ass wr wb Ustaz, mohon kejelasan jika kita makmum apa perlu baca fatihah lagi setelah imam?(082159533xxx). Wa’alaikumussalam. Wr. Wb. Bagi makmum tetap wajib membaca surat al-Fatihah setelah imam membaca al-Fatihah. Rasulullah SAW. bersabda: “Tidak sah salat bagi orang yang tidak membaca surat al-Fatihah. (HR. Bukhari). Atas dasar hadis inilah para ulama merumuskan bahwa membaca surat al-Fatihah merupakan rukun salat. Baik sebagai makmum maupun sebagai imam tetap wajib membaca surat al-Fatihah.

Annisa Maharani baru duduk di bangku kelas 3 SMP. Tetapi siapa sangka gadis berusia 13 tahun ini sudah aktif berdakwah. Mulai belajar berceramah sejak sekolah dasar.

Nuzulul Quran

HERIYANTO, Pontianak

Ass wr wb Ustaz. Saya ingin nanya berdasarkan salah satu firman Allah yang artinya bahwa sesungguhnya Alquran diturunkan pada malam Lailatul Qadar dan salah satu hadist dari Rasullulah yang artinya carilai malam Lailatul Qadar pada 10 malam-malam terakhir bulan Ramadhan. Yang saya tanyakan mengapa umat Islam di Indonesia mengingat turunnya Alquran pada malam 17 bulan Ramadhan? apakah ada dasar hadistnya? Terima kasih. (081256235xxx). Wa’alaikumussalam. Wr. Wb. Pengertian Lailatul Qadr ada dua macam; pertama, lailatul Qadr dalam pengertian turunnya al-Qur’an pertama kali, yaitu 17 Ramadhan. Kedua, lailatul Qadr dalam pengertian turunnya para malaikat beserta Jibril membawa salam (kedamaian), inilah yang biasanya pada 10 terakhir dari bulan Ramadhan yang disebutkan dalam hadis. Penetapan 17 Ramadhan sebagai Nuzulul Quran (turunnya al-Qur’an pertama kali) oleh para ulama ‘Ulum al-Qur’an mendasarkan pada firman Allah. “Jika kamu beriman kepada Allah dan kepada apa yang Kami turunkan (alQur’an) kepada hamba Kami (Muhammad) di hari Furqaan, yaitu di hari bertemunya dua pasukan. (QS. Al-Anfal/8: 41). Bertemunya dua pasukan, yaitu pasukan umat Islam dan pasukan orang-orang kafir musyrik Quraisy yaitu pada perang Badar. Para ahli sejarah menyebutkan bahwa perang Badar terjadi pada 17 Ramadhan tahun II H. Hanya berbeda tahunnya sedangkan tanggal dan bulannya sama, yaitu 17 ramadhan tahun 41 sejak kelahiran Nabi SAW. bertepatan tanggal 6 Agustus 610 M. (*)

SETIAP sore wajah Annisa Maharani atau biasa disapa Rani muncul di televisi lokal PonTV. Dai yang beranjak remaja ini memberikan ceramah menjelang buka puasa. Bahasa Arabnya fasih. Suara juga khas seorang dai. Selain di PonTV, Rani juga sering memberikan ceramah di TV lokal lainnya dan di sejumlah masjid. Rani mengaku sudah belajar berceramah sejak masih sekolah dasar. Hampir setiap hari Rani berlatih berceramah. Ayah Rani, Nasran Djafar mengatakan, anaknya itu memang sudah berbakat berceramah sejak masih kecil. Nasran memang kerap membawa anaknya itu ke berbagai ceramah di masjidmasjid. Dari situlah Rani mulai meniru-niru orang yang ceramah. Rani sudah belajar bahasa arab sejak masih sekolah di Madrasah Ibtidaiyah Swasta Bawari. Pelajaran


BERSAMA KELUARGA: Rani bersama ibu dan ayahnya saat ditemui di kediamannya di Gang Selamat I, Pontianak.

agama kemudian diperdalam di MTS Negeri 1 Pontianak. Di sekolah ini Rani mendapatkan bimbingan khusus dari guru agama. “Di sekolah, guru sering mengajarkan cara-cara berceramah. Ada Pak Fauzan dan Pak Ma’syum yang kerap membimbing saya,” ujar anak keempat dari 5 bersaudara ini. Ibunda Rani, Lilis Khairani mengatakan, anaknya sering berlatih berceramah di rumah. “Di rumah, anak saya ini juga mengajar les. Muridnya ada 15 orang. Biasanya usai pelajaran, Rani kerap memberikan ceramah agama pada anak muridnya. Ini sekaligus praktik ceramah,” ujar Rani yang bercita-cita jadi dokter tersebut. Rani adalah tergolong anak berpretasi. Gadis yang menginja\k remaja ini kerap menjuarai lomba berceramah agama. “Saya pernah

juara 3 lomba dai-daiyah se-Kalbar,” ujar siswa yang kerap juara kelas ini. Untuk materi ceramah, Rani mengaku banyak membaca dari bukubuku agama. “Saya ini suka sekali baca. Kalau mau ceramah saya biasa cari bahannya di buku,” ujarnya. Di rumahnya, Rani memiliki banyak koleksi buku agama. Ke depan, Rani berencana memperdalam agama di sekolah agama. Tetapi dia belum memutuskan apakah akan masuk pondok pesantren atau sekolah umum. “Mungkin masuk ke madrasah aliyah saja,” ujarnya. Orangtua Rani mengaku sangat bangga punya anak seperti Rani. “Semoga nanti ilmunya bisa bermanfaat untuk orang banyak,” ujar Lilis saat ditemui di rumahnya di Jalan H Rais A Rahman, Gang Selamat I, Sungai Jawi Dalam, Pontianak ini. (*)

KAHMI Gelar Buka Puasa Bersama

Ajak Kader Sukseskan Pemilukada Kalbar PONTIANAK—Korps Alumni Himpunan Mahasiswa Islam Kalimantan Barat (KAHMI Kalbar) menggelar kegiatan buka puasa bersama di ruangan teater UPT STAIN Pontianak, kemarin. Sekitar 80-an kader HMI maupun alumni HMI Cabang Pontianak menghadiri kegiatan tersebut. suasana keakraban terbangun dari masing-masing generasi HMI itu. Tampak hadir dalam kesempatan itu para Pengurus KAHMI Kalbar, para mantan Ketum Cabang, Ketua KAHMI Kota Pontianak Viryan Aziz dan Ketua KAHMI Kab. Kubu Raya, Kasiono Az. Hadir pula Ketua Umum HMI Cab.Pontianak dan Ketua Umum HMI Sambas serta beberapa perwakilan dari HMI Cabang se-Kalbar. Selain menjalin silaturahmi antar generasi HMI se-Kalbar dengan menggelar buka puaa bersama. Acara tersebut juga sebagai upaya KAHMI Kalbar untuk mengingatkan kader-kader HMI agar dapat bereperan dan menyukseskan pemilihan umum kepala daerah (Pemilukada) Kalbar yang akan diselenggarakan September mendatang. Ketua KAHMI Kalbar, Dr. H. Hamka Siregar, M.Ag, mengatakan bahwa buka puasa bersama yang diselenggarakan KAHMI Kalbar merupakan kegiatan rutin setiap tahun dilaksanakan. Dan tahun ini adalah keempat kalinya diselenggarakan buka puasa bersama anatara KAHMI Kalbar dan kader HMI se-Kalbar. Menurut Ketua STAIN Pontianak itu, tujuannya diadakannya acara buka puasa bersama tersebut tidak lain adalah untuk memperkokoh silaturahmi diantara kader dan alumni HMI, sehingga terbangun hubungan kekeluargaan antaran alumni dan kader HMI. Selain itu, Hamka juga menyinggung tentang posisi KAHMI pada Pemilukada Gubernur Kalbar yang akan dihelat pada September mendatang. Dimana menurutnya, KAHMI Kalbar secara institusi tidak memihak pada kandidat tertentu. Karena KAHMI tidak berpolitik praktis. “Jika orang perorang silakan saja. Karena alumni HMI itu menyebar kemana-mana, termasuk ke hampir semua parpol ada alumni kita. Silakan saja bekerja secara profesional,” terangnya. Hamka mengimbau kader HMI se-Kalbar ikut menyukseskan pemilukada secara baik. HMI dan KAHMI mesti memberikan suaranya pada pemilukada mendatang, jangan masuk pada kategori golongan putih. “Pandangan KAHMI jelas, kepentingan kebangsaan dan keummatan lebih diutamakan,” katanya dengan semangat. (adg)

Pengasuh: H SULAIMAN

Zakat Fitrah Anak 9,5 Bulan PERTANYAAN: Assalamualaikum ustaz, saya mempunyai anak bayi 9,5 bulan. Apakah saya sudah wajib membayar zakat fitrah atas anak bayi saya? Terima kasih. +6281345359*** JAWABAN: Wa’alaikumsalam Wr. Wb Zakat fitrah, zakat yang wajib dikeluarkan muslim menjelang Idulfitri pada bulan Ramadan. Besar zakat ini setara dengan 2,5 kilogram/3,5 liter makanan pokok yang ada di daerah bersangkutan. Dari Ibnu Umar ra berkata: “Rasulullah saw mewajibkan zakat fitrah satu sha’ kurma atau gandum pada budak, orang merdeka, lelaki perempuan, anak kecil dan orang dewasa dari ummat Islam dan memerintahkan untuk membayarnya sebelum mereka keluar untuk salat id. ( Mutafaq alaih ). Hadis riwayat Ibnu Umar ra.: Bahwa Rasulullah saw. memerintahkan agar zakat fitrah diberikan sebelum manusia berangkat untuk salat Ied. (Shahih Muslim



No.1645). Zakat Fitrah harus diberikan sebelum shalat id. Misalnya 1 atau 2 hari sebelum shalat id. Jika lewat dari salat id, maka jatuhnya sebagai sedekah. Dari Ibnu Abbas ra bahwa Rasulullah SAW mewajibkan zakat fitrah sebagai pembersih bagi orang yang berpuasa dari perkataan yang tidak berguna dan kotor, dan sebagai makanan bagi orang-orang miskin. Maka barang siapa yang mengeluarkannya sebelum salat, ia menjadi zakat yang diterima dan barang siapa mengeluarkannya setelah salat, ia menjadi sedekah biasa. Riwayat Abu Dawud dan Ibnu Majah. Abu Said Al-Khudry ra berkata: Pada zaman Nabi SAW kami selalu mengeluarkan zakat fitrah satu sha’ makanan, atau satu sha’ kurma, atau satu sha’ sya’ir, atau satu sha’ anggur kering. Muttafaq Alaihi. Dalam suatu riwayat lain: Atau satu sha’ susu kering. Abu Said berkata: Adapun saya masih mengeluarkan zakat fitrah seperti yang aku keluarkan pada zaman Nabi SAW Dalam riwayat Abu Dawud: Aku



selamanya tidak mengeluarkan kecuali satu sha’. Besarnya zakat fitrah menurut ukuran sekarang adalah 2,5 kg atau 3,5 liter. Sedangkan makanan yang wajib dikeluarkan yang disebut nash hadits yaitu tepung, terigu, kurma, gandum, zahib (anggur) dan aqith (semacam keju). Untuk daerah/negara yang makanan pokoknya selain 5 makanan di atas, mazhab Maliki dan Syafi’i membolehkan membayar zakat dengan makanan pokok yang lain. Dari hadits di atas, bayarlah zakat fitrah Anda dengan makanan yang biasa Anda makan. Jika Anda membayarnya dengan uang kertas rupiah, maka jumlah uang di kalangan bawah bertambah. Ini menyebabkan nilai rupiah turun/inflasi dan harga-harga barang naik. Apalagi saat Lebaran di mana para pedagang banyak yang mudik, maka harga beras yang mulainya Rp6000/kg bisa naik jadi Rp10.000/kg sehingga mereka kesulitan membeli makanan. Pembayaran zakat menurut jumhur ‘ulama :

Waktu wajib membayar zakat fitrah yaitu ditandai dengan tenggelamnya matahari di akhir bulan Ramadan Membolehkan mendahulukan pembayaran zakat fitrah di awal. Berikut adalah syarat yang menyebabkan individu wajib membayar zakat fitrah : Individu yang mempunyai kelebihan makanan atau hartanya dari keperluan tanggungannya pada malam dan pagi hari raya. Anak yang lahir sebelum matahari jatuh pada akhir bulan Ramadan dan hidup selepas terbenam matahari. Memeluk Islam sebelum terbenam matahari pada akhir bulan Ramadan dan tetap dalam Islamnya. Seseorang yang meninggal selepas terbenam matahari akhir Ramadan. Jadi kalau kita melihat syarat orang yang wajib mengeluarkan zakat berarti anak bayi 9,5 bulan terkena untuk membayar zakat fitrah. Terimakash semoga bermanfaat Wallahu ‘a’lam. (*)

Pontianak Post



Selasa 14 Agustus 2012




Galang Dana saat Pentas

Pulang untuk Puasa

PENCIPTA dan penyanyi lagu religi Aunur RofiqLilFirdausaliasOpickpunyacaratersendiriuntukmengumpulkandanabagianak-anak yatim piatu. Dalam setiapshow-nya, pria kelahiran Jember, Jawa Timur, 16 Maret 1974, itu secara spontan menggalang dana kepada penonton. Misalnya, yang terjadi di halaman sebuah pusat perbelanjaan di kawasan Klender, Jakarta Timur, Minggu, 12/8. Di sela menyenandungkanlagu-laguislami,Opickmengajak para penonton untuk beramal. ’’Mumpung masih Ramadan, mari kitaperbanyakamal.Karenainibulan Ramadan, pahalanya akan dilipat-

DALAM dua bulan terakhir, Ratu Downhill Indonesia Risa Suseanty berlatih keras di Belgia dan Belanda. Tetapi, setelah Ramadan berjalan beberapa hari, Risa memutuskan untuk kembali ke kampung halamannya di Bandung. Risa mengaku, sebagai atlet berat bagi dirinya untuk menjalankan puasa di Eropa sembari melahap materi latihan keras tiap hari. ”Bayangkan, di Eropa puasa pada summer time, imsaknya pukul 04.30 dan baru buka pukul 22.30,” ujar Risa. Karena panjangnya waktu berpuasa itulah, Risa mengaku di awal Ramadan

gandakan,” ujar Opick yang mengenakan kostum khasnya berwarna putih-putih. Dalam acara yang diadakan menjelang berbuka puasa itu, terkumpul uang sekitar Rp 4 juta. Selanjutnya,Opickmenyerahkannyakepadapanitia (Starmag) untuk disumbangkan ke panti asuhan terdekat. Penggalangan dana tersebut selalu dilakukan Opicksetiapkalipentas.Ramadantahunini,priayang saat ini gencar mempromosikan album kedelapan itu memiliki jadwal show yang padat ke seluruh penjuru tanah air. Sehari sebelum tampil di Klender, pria yang pada 1990-an memulai karir bermusiknya lewat band beraliran cadas bernama Timor Band tersebut manggung di Makassar. Keesokannya, dia menghibur publik Kota Malang. (ali/c7/ttg)

lalutidakberpuasa.”Sayaakanmenggantinya di lain hari,” katanya. Atlet kelahiran Bandung, 25 Oktober 1980, itu saat ini fokus berlatih menyongsong PON XVIII Riau bulan depan. Bersama pembalap kawakan Tonton Susanto, dia tetap menjadi andalanJawaBaratuntukmendulang medali emas. Untuk saat ini, masih sulit mencari kompetitorRisadiIndonesia,bahkan diAsiaTenggara.Diaselalumenyabet emas ajang SEA Games. Mulai SEA Games Indonesia 1997, Brunei 1999, Malaysia 2001, Laos 2009, dan Indonesia 2011. (ali/c13/ttg)




Anand Khrisna Segera Dieksekusi JAKARTA – Upaya pengacara Anand Khrisna untuk menunda penahanan bakal menemui jalan buntu. Kejaksaan Negeri Jakarta Selatan sebagai eksekutor putusan kasasi Mahkamah Agung (MA) menegaskan tetap akan memenjarakan terpidana kasus pencabulan tersebut. ’’Begitu salinan sudah sampai di tangan kami, akan langsung dieksekusi,’’ tegas Kepala Kejaksaan Negeri Jakarta Selatan Masyhudi di Jakarta kemarin (13/8). Dia menyatakan, putusan kasasi sudah inkracht alias berkekuatan hukum tetap. Kendati bakal mengajukan permohonan peninjauan kembali (PK), tidak berarti pelaksanaan hukuman buat Anand harus ditunda. Sebagaimana diketahui, dalam sidang di tingkat pertama, Anand dibebaskan majelis hakim Pengadilan Negeri Jakarta Selatan. Majelis yang diketuai Albertina Ho menyatakan bahwa lelaki bernama panjang Krisna Kumar Tolaram Gang Tani itu tidak terbukti berbuat asusila. Jaksa lantas mengajukan kasasi ke MA dan dikabulkan. Majelis hakim agung yang terdiri atas Zaharuddin Utama, Achmad Yamanie, dan Sofyan Sitompul mengganjar Anand dengan vonis penjaraduatahunenambulan.Ananddianggap terbukti melakukan perbuatan cabul terhadap muridnya, Tara Pradipta Laksmi. Dia dijerat pasal 294 ayat 2 KUHP juncto pasal 64 ayat 1 KUHP tentang perbuatan cabul. Pengacara Anand, Humphrey Djemat, menegaskan bahwa pihaknya akan mengajukan PK sekaliguspenangguhanpenahanan.Alasannya, dirinya menjamin Anand akan kooperatif dan tidak kabur. Anand saat ini masih berada di Indonesia. Kabarnya, dia kini berada di Bali. Masyhudi mempersilakan Anand atau pengacaranya mengajukan upaya hukum. Namun, eksekusi tidak bisa ditunda. Pihaknya harus melaksanakan perintah majelis hakim begitu salinan putusan sudah diterima. Masyhudi menegaskan tidak risau atas kemungkinan Anand untuk kabur. ’’Anand sudah dicekal dari bepergian ke luar negeri. Dia tidak bisa kabur,’’ katanya. (aga/c5/ttg)


Hartati Mundur dari Demokrat


JAKARTA-Hartati Murdaya memilih untuk tidak melibatkan partainya terlampau jauh dalam kasus suap Bupati Buol Amran Batalipu yang menjeratnya sebagai tersangka. Dia memutuskan untuk mengundurkan diri dari keanggotaan di Dewan Pembina Partai Demokrat. Sekretaris Dewan Kehormatan Partai Demokrat T.B. Silalahi mengakui adanya pengunduran diri itu begitu Hartati ditetapkan sebagai tersangka oleh Komisi Pemberantasan Korupsi (KPK). “Dia menghadap saya dan mengundurkan diri sebagai anggota dewan pembina.Itujarang(terjadi),”kataT.B.Silalahisetelah menghadiri acara penyerahan tanda jasa oleh Presiden Susilo Bambang Yudhoyono (SBY) di Istana Merdeka kemarin (13/8). Seharusnya, lanjut dia, sesuai dengan AD/ART partai dan kode etik, status Hartati adalah diberhentikan sementara. Status itu bisa berubah jika yang bersangkutanmenjaditerdakwaatausudahdivonis bersalaholehpengadilan.“Tapi,inisesuatuyang baik,adakaderyangmemilikikesadarandengan mengundurkan diri. Dewan kehormatan sudah menandatangani,” terangnya. Surat keputusan tersebut kemudian disampaikan kepada ketua dewan pembina yang dijabat SBY. “Keputusan itu sudah final,” tegas dia. Lantas, bagaimana respons SBY atas kasus yang membelit kader partai berlambang Mercy itu? T.B. Silalahi mengungkapkan, SBY menjunjung tinggi hukum dan menyerahkan sepenuhnya kasus itu kepada proses hukum. “Saya juga berharap semua kader Partai Demokrat tidak perlu ditindak dewan kehormatan, seharusnya sadar tidak membawa-bawa partai,” tutur dia. Tidak hanya mundur dari keanggotaan di dewan pembina, melalui pernyataan tertulis Hartati menegaskan nonaktif sebagai anggota Partai Demokrat. Bahkan, dia juga mundur dari Komite Ekonomi Nasional (KEN). Hartati menuturkan bahwa dirinya menjadi anggota Dewan Pembina Partai Demokrat karena diminta untuk berkontribusi memajukan partai. Begitu juga ketika diminta menjadi anggota KEN, Hartati mengaku menerimanya sebagai tanggung jawab seorang warga negara. (fal/pri/bay/c11/agm)


Miranda Yakin Dakwaan Jaksa Tak Akan Terbukti JAKARTA – Terdakwa kasus suap cek perjalanan terkait dengan pemilihan deputi gubernur senior Bank Indonesia (DGS BI), Miranda S. Goeltom, kembali mengungkapkan optimismenya bakal divonis bebas. Sebab, dia menilai keterangan sejumlah saksi yang dihadirkan jaksa penuntut umum (JPU) justru menguntungkan dirinya. Miranda pun yakin seluruh dakwaan JPU tidak terbukti. ’’Saya tersenyum bahagia karena akhirnya publik tahu dari persidangan hari ini (kemarin) maupun persidangan kemarin (kemarin lusa) terbukti bahwa tidak ada satu pun dakwaan jaksa yang terbukti,’’ ujar Miranda seusai menjalani sidang di Pengadilan Tipikor Jakarta kemarin (13/8). Dia menegaskan, tidak ada saksi dari Komisi IX DPR 2004 yang mengakui adanya pertemuan dengan dirinya di rumah terdakwa lain kasus tersebut,

Ketiganya juga membenarkan menerima cek perjalanan seusai pemilihan DGS BI. Namun, mereka kompak mengaku tidak tahu maksud pemberian cek tersebut. ’’Kami datang ke kantor di Jalan Riau (Jakarta), terima cek, dan langsung pulang,’’ ujar Udju. Guru besar Fakultas Ekonomi Universitas Indonesia (UI) tersebut menambahkan, tak ada seorang pun saksi yang mengaku pernah dijanjikan sesuatu oleh dirinya. Saksi juga menyangkal dirinya memberikan perintah untuk memilih. Para saksi juga tak tahu-menahu asal cek perjalanan yang mengalir seusai pemilihan DGS BI 2004 tersebut. Miranda pun memastikan seluruh saksi berikutnya tidak akan mengatakan bahwa mereka diminta untuk memilih dirinya. ’’Tidak ada yang mengatakan bahwa dirinya pernah meminta mereka memilih saya, bahwa saya pernah menawarkan atau menjanjikan

Nunun Nurbaeti, di Cipete, Jakarta Selatan. Beberapa saksi juga membantah pernah dikenalkan dengan Miranda melalui Nunun. ’’Tidak ada pertemuan di Cipete. Tidak ada proyek ’thank you.’ Tidak ada saya diperkenalkan kepada siapa pun oleh Bu Nunun,’’ tegas Miranda. Kemarin, majelis hakim meminta keterangan kepada tiga saksi dari Komisi IX DPR Fraksi TNIPolri periode 1999–2004. Mereka adalah Udju Djuhaeri, Darsuf Yusuf, dan Suyitno. Ketiganya memberikan keterangan yang menguntungkan terdakwa. Mereka kompak mengaku tidak pernah menerima arahan dari Miranda untuk tidak bertanya soal keluarganya dalam uji kepatutan dan kelayakan dalam pemilihan DGS BI 2004. ’’Tidak ada arahan langsung. Kita boleh tanya apa pun,’’ ungkap Suyitno saat bersaksi dalam sidang Miranda kemarin.

apa pun kepada mereka. Bahkan, Udju yang tidak memilih saya serta Endin yang tidak memilih saya pun menerima uang itu. Jelas uang itu tidak ada hubungannya dengan saya,’’ tegasnya. Miranda menilai, dirinya seharusnya bebas karena keterangan saksi-saksi tidak mendukung isi dakwaan jaksa. Dia pun berharap majelis hakim bisa memutus perkara dengan adil. ’’Dakwaan itu tidak terbukti dan seharusnya saya dibebaskan, kalau pengadilan ini benar dilaksanakan dengan benar, dengan hati nurani,’’ imbuh dia. S ebagaimana diketahui, Miranda didakwa bersama Nunun memberikan suap berupa cek perjalanan kepada anggota Komisi IX DPR periode 1999– 2004 terkait dengan pemilihan DGS BI 2004. Atas perbuatannya, dia didakwa melanggar pasal 5 ayat 1 huruf b atau pasal 13 UU Pemberantasan Tindak Pidana Korupsi. (ken/c5/ttg) +

Mantan Menkes dan Wamen ESDM Terima Tanda Jasa JAKARTA – Pemerintah memberikan tanda kehormatan kepada sejumlah tokoh dalam rangkaian peringatan HUT Ke-67 Proklamasi RI di Istana Merdeka kemarin (13/8). Termasuk di daftar penerima menteri kesehatan Kabinet Indonesia Bersatu (KIB) jilid II yang meninggal dunia karena kanker paru-paru, Endang Rahayu Sedyaningsih. Endang memperoleh tanda kehormatan Bintang Mahaputra Adipradana. Tanda kehormatan yang disematkan oleh Presiden Susilo Bambang Yudhoyono (SBY) itu diterima suami Endang, Reanny Mamahit. Selain Endang, mantan Wakil Menteri Energi dan Sumber Daya Mineral (ESDM) Widjajono Partowidagdo juga menjadi salah satu penerima tanda kehormatan. Widjajono yang meninggal dalam pendakian di Gunung Tambora, Nusa Tenggara Barat (NTB), 21 April lalu itu mendapat tanda kehormatan Bintang Mahaputra Utama. Dia diwakili istrinya, Ninasapti Triaswati. ”Penghargaan kepada beliau dari pemerintah merupakan suatu penghormatan bagi kami,” kata Nina setelah acara.


TANDA JASA: Presiden SBY menyematkan Tanda Kehormatan Republik Indonesia di Istana Merdeka Jakarta, Senin (13/8)

Penerima lain tanda kehormatan yang sama adalah Gubernur Bali Made Mangku Pastika dan Gubernur NTB Zainul Majdi. Namun, Made Mangku Pastika tidak menghadiri acara penyerahan tanda kehormatan itu karena tengah menjalani perawatan di C


ALQURAN RAKSASA: Al Quran Al Akbar dengan ukiran khas Palembang resmi. Alquran ini dalam pembuatannya mengabiskan dana sekitar Rp 1,07 miliar, merupakan ide dari putra Sumsel, Sowatillah Mohzaib. Alquran ini dibuat 2002 dan selesai 30 Juni 2006. Alquran berukuran 177 x 144 cm, dengan ketebalan setiap keping 3-4 cm, dan jumlah keeping 315 keping. Foto diambil Senin (13/8).




rumah sakit. ”Statusnya tetap mendapat (tanda kehormatan) seperti ibu SMI (mantan Menkeu Sri Mulyani Indrawati) tahun lalu,” ujar Menko Polhukam Djoko Suyanto yang juga ketua Dewan Gelar, Tanda Jasa, dan Tanda

Kehormatan. Tahun lalu Sri Mulyani yang mendapat tanda kehormatan Bintang Mahaputra Adipradana juga tidak hadir saat penyerahan penghargaan di Istana Merdeka. Penerima tanda kehormatan lainnya, yakni Bintang Jasa

Utama, adalah Sekretaris Kementerian Sekretariat Negara Lambock V. Nahattands, Sekjen Kemendagri Diah Anggraeni, dan Kepala Badan Geologi Kementerian ESDM Sukhyar. Kemudian, peneliti utama pada Balai Besar Litbang Pengolahan Produk dan Bioteknologi Kelautan dan Perikanan Endang Sri Heruwati dan Bupati Kutai Barat (Kaltim) Ismael Thomas memperoleh Bintang Jasa Pratama. Sementara itu, penerima Bintang Budaya Parama Dharma adalah Letjen TNI (pur) T.B. Silalahi yang juga sekretaris Dewan Kehormatan Partai Demokrat dalam kapasitasnya sebagai ketua dewan pembina Yayasan Soposurung. Kemudian, pujangga Raden Ngabehi Yosodipuro I (almarhum) juga mendapat Bintang Budaya Parama Dharma. Selain itu, Bintang Jasa Nararya diberikan kepada Rinaldi Firmansyah (Dirut Telkom 2007–2012), Lely Sampoerno (atlet menembak), Imron Rosadi (pendiri, atlet, dan pelatih klub angkat besi TOVO), Utut Adianto (pelatih catur), serta William Gommies (pelatih tinju). (fal/ c11/ttg)

METROPOLIS Pontianak Post


SELASA 14 Agustus 2012

Warga Jangan Teledor Kasus Kebakaran Meningkat Tajam


Gula Malaysia Ganti Karung PONTIANAK - Direktorat Reserse Kriminal Umum Polda Kalbar berhasil mengamankan ratusan karung gula ilegal. Mereka turut menggiring empat orang pekerja di tempat dan waktu berbeda. Pertama, aparat penegak hukum menggiring 650 karung gula ilegal di gudang Jalan Parit Mayor, Desa Kapur, Kabupaten Kubu

Raya, Sabtu (11/8). Diduga gula asal Malaysia ini bakal dipasarkan di Kota Pontianak seiring meningkatnya kebutuhan gula pasir menjelang Lebaran. Kemudian, aparat bergerak di kawasan Pontianak Barat, Gg Pala. Di sana, mereka menemukan ratusan gula yang telah dikemas ke sebuah truk bernomor polisi KB 9342 SA,

Resmob Polda Kalbar mengamankan truk bermuatan gula ilegal asal Malaysia di Jalan Martadinata, Pontianak.

Senin (13/8). Karena tidak mampu menunjukkan dokumen resmi, pemilik turut diamankan berserta barang buktinya di Mapolda Kalimantan Barat. Kabid Humas Polda Kalbar AKBP Mukson Munandar mengatakan, upaya penyelundupan gula ilegal ini berhasil digagalkan berawal tertangkapnya 1 unit truk membawa 160 karung gula. Sekitar pukul 11.45, truk dengan nopol KB 8903 AM tersebut membawa gula


asal Malaysia tanpa dilengkapi dokumen. Kemudian, lanjut Mukson, anggota melakukan pengembangan kasus dengan mengecek gudang lokasi penyimpanan gula tersebut. Alhasil, ‡ke halaman 15 kolom 2

PONTIANAK - Kasus kebakaran di Pontianak dan sekitarnya terus terjadi dalam beberapa hari terakhir ini. Tidak hanya kabakaran di lahan gambut, juga di kawasan pemukiman warga. Berdasarkan data Badan Penanganggulangan Bencana Daerah Kota Pontianak, dari Januari hingga kemarin (13/8) terjadi 42 kasus kebakaran di Pontianak. Sebagian besar kebakaran terjadi di pemukiman penduduk Paling parah terjadi pada

Agustus ini, belum belum sampai pertengahan bulan saja sudah terjadi 9 kasus kebakaran. Bandingkan dengan Agustus tahun 2011, hanya terjadi 5 kali kasus kebakaran. Cuaca panas dan kering serta rendahnya adalah pemicu hal tersebut. Secara tahunan pun, jumlah kasus kebakaran di Pontianak menunjukan grafik naik. Sepanjang tahun 2010 telah terjadi 76 kasus kebakaran. ‡ke halaman 15 kolom 5

Kasus Kebakaran 2010 76 kasus

2011 82 kasus

2012 42 kasus * * per 13 Agustus 2012 Sumber : BPBD Kota Pontianak



Iklim Investasi Baik IKLIM investasi di Pontianak cukup menjanjikan. Hal itu terbukti dengan hasil survey Majalah Swa yang menempatkan Kota Pontianak lebih baik dari Denpasar, Manado, Yogyakarta dan kota lainnya. Wali Kota Pontianak Sutarmidji mengatakan, investasi di kota ini memang kian besar dari tahun ketahun. Ada dua bidang yang mengalami peningkatan investasi cukup signifikan, yakni perhotelan dan Sutarmidji

Tenaga Medis Harus Siaga PONTIANAK - Kepala Dinas Kesehatan Kalbar Andy Jap mengatakan, selama Ramadan dan Idulfitri dokter harus tetap ada di rumah sakit maupun puskesmas. Terutama, di pos pelayanan yang telah disediakan dari pihak terkait. “Paling tidak, harus ada satu dokter umum yang standby melayani masyarakat,” katanya. Dia mengatakan, pihaknya telah memberi surat edaran di puskesmas dan rumah sakit. Menjelang Hari Raya Idulfitri nanti, dokter yang bertugas selalu siap jika ada pasien. Begitu halnya di posko-posko kesehatan, petugas harus siaga melayani masyarakat yang mudik ke kampung halaman. “Kami telah berkoordinasi dengan pihak kepolisian. Pertama, dalam pos pelayanan

Paling tidak, harus ada satu dokter umum yang standby melayani masyarakat

PONTIANAK - Menjelang lebaran, banyak pusat perbelanjaan yang memberikan diskon besar-besaran. Namun, pengamat ekonomi dari Universitas Tanjungpura Eddy Suratman menilai strategi pemasaran yang dijalankan sebagian besar pusat perbelanjaan di Pontianak menjelang lebaran itu sudah tidak wajar. Strategi pemasaran yang dimaksud adalah

Andy Jap

‡ke halaman 15 kolom 2 ‡ke halaman 15 kolom 5


Ekonom Kritik Praktik Diskon Jelang Lebaran pemberian diskon dengan memark-up (meninggikan) harga asli. ”Saya kemarin menemani istri belanja di sebuah pusat perbelanjaan. Di sana banyak sekali diskon yang ditawarkan. Ada diskon 50 persen plus 20 persen. Setelah saya lihat, misalnya baju koko, harganya sangat mahal sekali Rp500.000. ‡ke halaman 15 kolom 2


Sarana Angkutan yang Terancam Hilang Kapal bandong kini jumlahnya kian sedikit. Di seluruh Kalbar diperkirakan hanya tersisa 30 buah saja. Kini tak ada lagi orang yang mampu membuat kapal ini. Kayu belian sebagai bahan pembuatnya sudah susah dicari. Akan hilang di masa depan. HERIYANTO, Pontianak DULU sebelum ada jalan-jalan dibangun, kapal bandong adalah satu-satu moda transportasi yang digunakan untuk mengangkut barang hingga ke pedalaman. Terutama ke Kapuas Hulu yang merupakan kabupaten terjauh dari

Pontianak. Kapal bandong bentuknya unik, menyerupai rumah. Di dalamnya ada kamar untuk anak buah kapal, dapur untuk memasak, dan ruang santai. Berbagai fasilitas juga tersedia, seperti televisi, kulkas, dan video. Sungai Kapuas adalah jalur yang dilewati kapal-kapal bandong. Setiap berangkat kapal ini mampu mengangkut hingga seratus ton barang. Muatannya beragam, mulai dari beras, minyak goreng, bawang merah, hingga gula. Pokoknya semua barang yang dibutuhkan masyarakat. Sekembali dari Kapuas Hulu, mereka mengangkut berbagai hasil bumi seperti karet dan lada. Perjalanan dengan menggunakan kapal bandong ini cukup lama. ‡ke halaman 15 kolom 2








Kapal bandong tengah bersandar untuk mengisi muatan barang.



Pontianak Post


Terima Satu Aduan

Prihatin Remaja Jarang ke Masjid WAKIL Wali Kota Pontianak Paryadi mengaku prihatin banyaknya masjid yang sepi kegiatan di bulan puasa ini. Jika pun ada yang menggelar kegiatan dan ibadah di masjid sebagian besar orang tua. “Dari tahun ke tahun sepertinya terjadi pergeseran suasana Ramadan,” Paryadi ungkapnya. Salah satu yang menjadi kebiasaan umat Islam ketika Ramadan adalah tadarus di masjid. Jika dulu, kata Paryadi, yang tadarus adalah anak-anak, remaja maupun pemuda, sekarang sulit menemukannya. Usia mereka yang tadarus tidak kurang dari 50 tahun. “Susah cari remaja sekarang tadarus di masjid. Sisa orang tua saja,” tuturnya. Selain tadarus, kegiatan keislaman lainnya pun mulai jarang dilakukan di masjid. Mestinya, kata Paryadi, masjid dijadikan pusat kegiatan Islam. Baik itu oleh remaja maupun orang tua. Jika masjid sudah menjadi pusat kegiatan Islam, Paryadi yakin perkembangan iman dan taqwa remaja akan membaik. “Itu masalahnya, karena masjid hanya digunakan untuk salat. Kalau dulu kan setiap kegiatan keislaman digelar di masjid, sehingga sejak anak-anak sudah merasa dekat dengan masjid,” katanya. Hal ini diketahui Paryadi setelah melakukan safari setiap tarawih dan salat subuh dari masjid ke masjid selama Ramadan. Banyak juga warga yang mengeluhkan kondisi ini kepadanya di sela-sela safari. Menurutnya, banyak faktor yang menyebabkan berkurangnya remaja dan pemuda tadarus di masjid ketika Ramadan. Antara lain, kekhawatiran orang tua terhadap keselamatan anaknya. Paryadi mengatakan, jika dulu orang tidak membatasi jika anaknya akan ke masjid walau jaraknya dari rumah tidak dekat. “Sekarang kan beda, orang tua banyak yang tidak berani melepas anaknya sendiri, apalagi di kota. Wajar saja khawatir, karena memang tindak kriminalitas meningkat,” paparnya. Sebab lainnya, lanjut Paryadi, kurangnya peran sekolah. Dikatakannya, peran sekolah sangat penting dalam meningkatkan keimanan dan ketaqwaan siswa. Walau tidak diawasi langsung, sekolah sebetulnya dapat meminta siswa tarawih dan tadarus di masjid selama Ramadan. “Jika sekolah berperan aktif saya rasa banyak remaja yang beraktivitas di masjid selama bulan puasa,” ucapnya.(hen)

Selasa 14 Agustus 2012


TERDESAK PEMUKIMAN: Kok Fung Moi (47) yang menggarap lahan pertanian didapat turun-temurun dari keluarganya ini mulai merasa resah. Alih fungsi lahan pertanian untuk menjadi ruko dan perumahan di perkotaan/pinggiran perkotaan akan mematikan sejumlah para petani lokal untuk mengarap persawahan.

Pencuri Isi Kapal Diringkus PONTIANAK - Satu diantara lima spesialis tindak pidana pencurian di kapal yang sedang sandar di dermaga, diringkus aparat kepolisian. Pelaku berinisial Den (25), diamankan ketika berada di Jalan Panglima Aim, Gang Irama, Kecamatan Pontianak Timur, Minggu (12/8) sekitar pukul 21.00. “Dasar penangkapan pelaku, atas laporan korban dengan nomor LP/3530/ VIII/2012/Kalbar/Resta/Sek Sei Raya pada 12 Agustus 2012 lalu. Tersangka yang merupakan warga Jalan Tanjung Raya II, Gang Karya, Pontianak Timur ini terlibat aksi pencurian dengan pemberatan (curat) bersama empat temannya,” kata Kasat Reskrim Polresta Pontianak Kompol Puji Prayitno, kemarin (13/8). Modus operandi komplotan ini, kata dia, dengan cara membongkar kapal ponton dan mengancam penjaga kapal untuk menyerahkan barang. Bukan hanya itu, mereka juga dengan sigap membongkar harta benda penghuni

kapal. Aksi pencurian dilakukan komplotan ini terjadi sekitar pukul 06.30 Wib, di perairan Sungai Kapuas. Menggunakan sampan bermesin, mereka menyatroni dek Kapal Anguan yang sedang sandar di dermaga PT Rimba Ramin. Mereka terlebih dahulu melumpuhkan penjaga kapal agar tidak melakukan perlawanan. Kemudian dengan leluasa mereka membongkar isi ponton guna menemukan barang bernilai jual untuk diambil. “Dari tangan pelaku berhasil diamankan barang bukti berupa 1 jeriken solar, besi diatas ponton, ponsel, satu sampan bermesin, 8 batang kayu balok ukuran 8X8 cm,” ujar Puji. Dia merincikan, melalui hasil penyelidikan, dan mendapat informasi dari masyarakat terkait keberadaan pelaku, anggota Reskrim langsung bergegas mendatangi lokasi persembunyiannya. Alhasil, tersangka diamankan tanpa perlawanan dan langsung dibawa untuk

menjalani pemeriksaan. “Sedangkan empat rekannya yakni Tut, Jul, Pan dan Iwn masih dalam pengejaran pihak berwajib. Untuk Den, akan terancam pasal 363 KUHP tentang pencurian dengan pemberatan (curat), ancaman pidana penjara diatas 5 tahun,” tegasnya. Menurut tersangka, Den, jika beraksi tidak pernah sendiri. Bersama empat orang rekannya, dia melakukan tindak pidana pencurian itu dengan tugas yang sudah disepakati. Satu orang menunggu di sampan, dan yang lain berpencar mencari barang incarannya. “Kami juga membekali diri dengan senjata tajam. Apabila diketahui penghuni kapal, kami akan mengancam mereka untuk tidak melakukan perlawanan. Saat mereka diam, kami mengambil semua barang berharga. Dan menggiring semuanya ke sampan. Saat ini saya tidak tahu keberadaan teman saya. Mungkin mereka telah melarikan diri,” pungkasnya. (rmn)

PONTIANAK - Sepekan menjelang hari raya Idulfitri, posko pengaduan tabungan hari raya yang dibuka Dinas Sosial dan Tenaga Kerja Kota Pontianak baru menerima satu pengaduan. Kadis Sosnaker Kota Pontianak Syaiful Racman mengatakan bahwa hingga pekan keempat Ramadan pihaknya baru menerima laporan pengaduan oleh salah seorang karyawan harian lepas, terkait belum diberikan atau dibayarkannya THR oleh perusahaan. “Laporan pengaduan itu, kami terima pada pekan ketiga Ramadan,” katanya, Senin (13/8). Menurut Syaiful, berdasarkan aturan yang ada, masyarakat yang dipekerjakan, meski dalam kategori karyawan harian lepas, perusahaan harus tetap memenuhi kewajibannya. Dalam hal ini, memberikan THR. Untuk menindaklanjuti laporan tersebut, pihaknya sudah menunjuk sejumlah petugas untuk turun kelapangan, agar dapat memastikan apakah laporan tersebut benar. Jika benar, maka pihak perusahaan akan dipanggil untuk dimintai keterangan dan diminta untuk memenuhi kewajibannya. Memasuki sepekan jelang lebaran, lanjut Syaiful, pihaknya belum menerima kembali adanya laporan dari masyarakat terkait pembagian THR. Dari data laporan pembayaran THR oleh perusahan, secara umum telah memenuhi kewajibannya, bahkan dari batas waktu yang telah ditentukan. Syaiful mengimbau kepada karyawan perusahaan swasta di Pontianak apabila merasa perusahaan tidak memenuhi kewajibannya dalam hal ini adalah pembayaraan THR, agar segera melapor ke posko pengaduan di Kantor Dinsosnaker Kota Pontianak. Sehingga dapat segera diselesaikan. sedangkan bagi perusahaan, sesuai dengan aturan yang ada bahwa hari ini (kemarin) adalah batas waktu pemenuhan kewajiban untuk membayarkan THR kepada karyawan. “Paling lambat pekan ini THR harus sudah disalurkan, dan tidak ada lagi masalah,” tegasnya. (adg)

Warga Terbantu 3.000 Paket Murah PONTIANAK - Asosiasi Pengusaha Indonesia Kota Pontianak bekerjasama dengan beberapa mitra kerjanya, dan Universitas Panca Bhakti menggelar pasar murah di Halaman Kampus UPB Pontianak, Senin (13/8). Panitia pelaksana menyediakan 3.000 paket sembako yang diperuntukan bagi warga sekitar Kampus UPB Pontianak. Acara secara resmi dibuka oleh Wakil Wali Kota Pontianak, Paryadi, dan penyerahan paket sembako kepada warga tidak mampu sebagai tanda dimulainya pasar murah.

Wakil Wali Kota Pontianak Paryadi, mengatakan, pasar murah yang diselenggarakan Apindo dan mitra kerjanya pada dasarnya patut diapresiasi, karena telah berusaha meringankan beban masyarakat Ketua Apindo Pontianak Andreas Acui Simanjaya mengatakan, pasar murah yang tujuan dari digelarnya pasar murah tersebut adalah untuk membantu masyarakat agar dapat membeli kebutuhan menjelang lebaran dengan harga yang relatif murah. Acui mengatakan, pihaknya berencana akan menggelar pasar

murah dibeberapa daerah lainnya. sehingga pasar murah dapat membantu masyarakat yang memang membutuhkan. “Kalau paket yang kita sediakan tidak habis, akan kita jual kepada warga tidak mampu di daerah lain. Sehingga warga tidak mampu dapat merasakan harga kebutuhan yang murah ini,” katanya. Ketua Panitia, Yogi Sayogiyo mengatakan, pada dasarnya terselenggeranya pasar murah dilatarbelakangi dengan keprihatinan pihaknya terhadap masyarakat tidak mampu. Jika, sebagian orang saat ini sedang sibuk membeli ke-

butuhan menyambut lebaran, tidak dengan meraka yang tidak mampu yang masih kebingunan untuk membeli kebutuhan sehari-hari apalagi kebutuhan untuk lebaran. Pasar murah Ramadan ini, lanjut Yogi, diperuntukan bagi warga tidak mampu. Dimana pihaknya telah menyediakan 3000 paket murah yang dibagi kedalam kategori paket dengan komposisi yang berbeda-beda, yakni paket Rp20 ribu komposisinya 1kg gula pasir, 1kg tepung terigu, mentega 200gram dua bungkus, paket b Rp30 ribu 1kg gula pasir, 1kg minyak goreng, 1kg

tepung terigu, dua bungkus mentega 200gram, dan paket c Rp40 ribu, sirup satu boto, 1kg gula pasir, 1kg tepung terigu, mentega200gram dua bungkus. “Ini bentuk pengabdian kepada masyarakat yang dilakukan perguruan tinggi, maupun perusahan swasta,” ucapnya. Yogi mengatakan, pasar murah akan dilaksanakan selama dua hari, yakni dari Senin (13/8) hingga Selasa (14/8) hari ini. Dan waktu pasar murah akan dimulai sejak pagi hingga sore hari. Bagi masyarakat yang hendak mendapatkan paket murah, harus terlebih dahulu

membeli kupon di tempat yang telah disediakan panitia dan dapat ditukar kepada panitia. Salah seorang warga, Alifah, mengaku dirinya sengaja datang ke pasar murah untuk menukar kupon yang dibelinya. Baginya, keberadaan pasar murah sangat membantu warga tidak mampu, kerana harga yang ditawarkan sedikit lebih murah jika dibandingkan dengan harga sembako di pasaran. “Alhamdulillah, semoga kedepan ada lagi pasar murah yang meringankan beban masyarakat tidak mampu,” ucapnya. (adg)

Pontianak Post


Selasa 14 Agustus 2012



Tingkatkan Nasionalisme melalui Pramuka TANGGAL 14 Agustus hari ini, merupakan hari Pramuka. Hari itu merupakan hari yang bersejarah bagi anggota Pramuka di Indonesia. Gerakan Pramuka merupakan lembaga pendidikan non formal dan memiliki tujuan mulia. Selain itu gerakan Pramuka ini juga dapat melatih Bela Negara dan menumbuhkan jiwa Nasionalisme Bangsa. Banyak sekali kegiatan yang dilakukan dalam Pramuka. Selain itu juga Pramuka juga sering mengadakan pelatihan bagi anggotanya untuk mengembangkan keterampilan yang ada dalam anggotanya masing-masing. Di Indonesia, Gerakan Pramuka adalah organisasi yang sangat baik untuk dikembangkan di sekolah-sekolah maupun di luar sekolah. Karena Pramuka ini merupakan kegiatan yang melatih kedisiplinan. Kegiatan pramuka ini juga dapat melatih peserta didik dalam mengembangkan

bakat dan ketrampilannya. Misal, dalam perkemahan. Perkemahan merupakan kegiatan yang paling menantang bagi peserta didik. Karena dalam perkemahan banyak sekali kegiatan di dalamnya. Misalnya membangun tenda, upacara, senam pramuka, P3K, LKBB, sandi, Morse dan penjelajahan. Dari sebagian dari kegiatan tersebut bisa menumbuhkan rasa kebersamaan dan kekompakan antar peserta didik. Kegiatan upacara, misalnya. Upacara ini merupakan serangkaian kegiatan untuk mengingat dan menghargai para pahlawan yang telah gugur. Selain itu juga mengingat susahnya menaikkan bendera Merah Putih

Indonesia untuk merdeka. Dari sinilah timbul rasa peduli dan cinta akan tanah air Indonesia tercinta. LKBB (lomba ketangkasan barisberbaris). Kegiatan ini untuk melatih ketangkasan dan kedisi-

plinan peserta didik. Peserta didik dilatih harus rapi, selalu siap dan tegap dalam barisan. Penjelajahan, kegiatan ini yang paling menantang dalam Pramuka. Halang rintang, disinilah peserta

didik diuji kemampuan untuk melewati semua halang rintang yang telah di buat. Dengan cepat, tangkas, disiplin, kompak dan sesuai aturan yang diberikan. Melalui hari Gerakan Pramuka yang diperingati setiap tanggal 14 Agustus, maka jangan hanya sekedar peringatan. Karena di sekolah-sekolah sudah diwajibkan adanya Pramuka, maka pihak sekolah harus membina dan mengembangkan Pramuka di sekolahnya masing-masing. Ini sesuai dengan Program Pemerintah untuk menggalakkan pendidikan karakter. Salah satunya dengan mengembangkan Pramuka di sekolah. Melalui hari Pramuka, mari kita tingkatkan rasa nasionalisme bangsa! Gusanto Dewan Kehormatan Pramuka STAIN Pontianak Jur. Tarbiah.



Tumbuhkan Budaya Baca di Masyarakat SEKARANG masyarakat seakan lupa dengan budaya baca, membaca pada era sekarang berubah sebagai beban, masyarakat tidak lagi peduli dengan buku. Buku hanya menjadi pajangan di dalam lemari sehingga buku tersebut diselimuti debu yang tebal. Peran orangtua sangat dibutuhkan, mengingat orangtua adalah sebuah teladan di rumah. Sebagai orangtua kita harus memberi inspirasi dan motivasi kepada anak-anak kita sehingga anak-anak kita akan terbiasa oleh budaya membaca.Sarana-saranayanmendukungjugadiperlukan, seperti membangun perpustakan di rumah, menyediakan fasilitas-fasilitas yang bermanfaat. Selain orangtua, peran guru juga sangat mempengaruhi sikap psikologis para anak didiknya. Sebagai pengganti orangtua di sekolah, guru sangat bertanggung jawab atas perkembangan para muridnya. Disinilah dibutuhkan keterampilan seorang guru untuk mengajak para siswa agar senantiasa mencintai buku, bukan hanya untuk dijadikan hiasan di lemari, namun dapat dijadikan sebagai sumber utama mencari ilmu pengetahuan. Pada beberapa waktu lalu saya sempat mengunjungi perpustakaan daerah Pontianak, saya melihat sekumpulan mahasiswa yang berkumpul di depan perpustakaan tersebut hanya untuk berfoto-foto. Ini merupakan masalah yang membuat kita prihatin, seharusnya mereka masuk dan membaca, bukan untuk berfoto-foto. Ini membuktikan kesadaran bagi setiap individu masing-masing juga sangat diperlukan agar dapat tercipta masyarakat yang

memiliki tingkat intelektual yang tinggi. Pemerintah juga diharapkan dapat melakukan sebuah perubahan agar masyarakat, terutama masyarakat yang ada di kalangan akademisi mampu menjadi mutiara bangsa, dan dapat meraih impian mereka dengan membaca buku, sebagai mana ungkapan sang ovuntunir kita. Sebuah ungkapan yang terakhir, yang saya ungkapkan pada tulisan saya ini, agar tulisan saya ini dapat berguna untuk yang membacanya. â&#x20AC;&#x153;Lewat katalah aku hidup, lewat kata pula ingin kutiupkan pada orang yang putus asa bahwa aku hidup di mana-mana. Di setiap sudut kota Pontianak lewat tulisan-tulisanku, aku ingin gairah hidupku merasuki setiap hati pembaca tulisan-tulisanku. Kata memberiku banyak makna. Itulah yang ingin aku berikan pada orang lain, bahwa kata yang menjadikan hidupku lebih bermakna. Kata bagiku adalah kekuatan yang membuatku terus bangkit saat terjatuh kata, kata seperti jantung hidup terus berdetak dan jangan biarkan tak bermakna.â&#x20AC;? Itulah kata-kata yang dapat saya utarakan agar semua pembaca tulisan ini dapat terinspirasi untuk lebih membudayakan budaya membaca. Sama halnya semangat saya ini, saya berharap agar semangat ini dapat mempengaruhi bagi masyarakat yang Insya Allah adalah merupakan generasi penerus bangsa dan yang akan mengharumkan nama bangsa kita. Rahmat Sudiro Mahasiswa KPI STAIN Pontianak.

Aspal Lembek PAJAK Bumi dan Bangunan kami bayar, pajak kendaraan kami bayar, pokoknya semua pajak lunas. Tapi kenapa Jalan Bengkayang tampe atas aspalnya masih lembek? Mohon perhatian pemerintah Kabupaten Bengkayang. (085751922797)

Kapan Aer Ngalir? KAPAN.. kapan. aer ledeng nie ngalirrrrr? Subuh-subuh harus ngangkot aer, udah 6 bulan ndak ngalir, beban bayar terus. Kenapa tempat lain lancar saja. Di daerah Sui Jawi lancar, Gajah Mada lancar.... kok Kotabaru ngadat ? Setengah tahun tak ngalir. Tolong dong PDAM, dengar keluhan kami. Solusinya bagaimana diuruslah. Kalaupun ada yang rusak, masa sih setengah tahun belum kelar. Alamak sampai kapan harus begini ? (085651919868)


Kehilangan Sri Kadarwati SRI Kadarwati, telah meninggalkan dunia. Kehilangan ini perlulah diganti dengan segera. Saya menginginkan sesegera mungkin, seorang Putri Indonesia yang bermutu tinggi akan menampilkan dirinya, sebagai pengganti beliau. Ibu Sri semenjak puluhan tahun silam telah membulatkan tekadnya mengikuti suaminya (alm) Aspar Aswin yang ditugaskan ke bumi khatulistiwa. Ia telah membina dan mengelola dengan baik sejumlah organisasi dan kegiatan seperti Dekranasda, PKK, Gerakan Nusantara Orang Tua Asuh dan Palang Merah Indonesia. Saya mempunyai sebuah keyakinan bahwa teman seperjuanganku ini, pantaslah ditetapkan sebagai seorang srikandi yang ikut berjuang untuk kepentingan masyarakat di propinsi ini. (081256124570)


C cmyk







Pontianak Post

Selasa 14 Agustus 2012

Tangkal Serangan Asma

Atasi Penyakit Kulit yang Menahun

Minum Susu Kambing Milkuma

Dengan Damar Propolis

KETIKA asma menyerang, saluran nafas mengalami penyempitan karena hiperaktifitas terhadap rangsangan tertentu, sehingga menyebabkan peradangan. Pada penderita asma, penyempitan saluran pernafasan merupakan respon terhadap rangsangan pada paru-paru normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Setelah lama berobat ke dokter, akhirnya Bahrianti yang akrab disapa-Barah, seorang ibu rumah tangga tertarik mencoba Milkuma, minuman serbuk susu kambing yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu kambing peranakan ettawa segar dan gula aren. “Sudah 20 tahun saya menderita asma. Aktivitas sering terganggu karenanya. Kalau sudah kambuh, bernafas sering terasa sesak dan mendengik. Untunglah kini saya minum Milkuma. Alhamdulillah sekarang keluhannya sudah berkurang,” terang wanita berusia 41 tahun tersebut. Ia menceritakan, sudah 2 bulan minum Milkuma. Wanita yang tinggal di Samarinda, Kalimantan Timur ini pun mengajak orang lain untuk merasakan manfaat Susu Kambing Milkuma ini. “Mari kita sehat bersama Milkuma,” ajak ibu 2 orang anak tersebut. Sebenarnya, banyak masyarakat kita belum mengetahui tentang manfaat terkandung dalam Susu Kambing Milkuma. Berbeda dengan susu sapi, sesungguhnya susu kambing memiliki kandungan gizi lebih unggul, baik dari segi protein, energi, maupun lemak mendekati Air Susu Ibu (ASI). Selain mengandung

Riboflavin, vitamin B yang penting untuk produksi energi, susu kambing pun jarang menyebabkan alergi, sehingga aman dan bermanfaat untuk penderita asma. Satu gelas susu kambing memasok 20,0% dari nilai harian Riboflavin. Selain itu, mengkonsumsi Milkuma sebanyak 3 gelas sehari, bermanfaat menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu kambing bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh, serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang mengkonsumsinya. Selain diproses secara alami, pakan ternak diberikan pun organik, sehingga menghasilkan susu lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan gula aren bemutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan dan berolahraga, serta mengkonsumsi air putih paling sedikit 8 gelas/hari. Informasi lengkap tentang Milkuma di www.milkuma. com. Saat ini, Anda bisa mendapatkan Milkuma di apotek dan toko obat terdekat di kota Anda, atau hubungi Kalbar: 082112248682, Pontianak: Apt Mandiri 2 Jl. Wahid Hasim, Apt Bintang Jl. Gajahmada, Apt Megasari Farma Jl. Veteran, Apt Matahari Jl. Tanjungpura, Apt Sejahtera Jl. Panglima Aim, Apt Amelia Jl. Sui Raya Dalam, Apt Siantan Jaya Jl. Khatulistiwa. Singkawang: Apt Merdeka Jl Diponegoro, Apt Singkawang Jl. Sudarso. Terdaftar di Depkes RI No. PIRT 6.09.3328.01395.(e5/biz)

dan kulit yang kemerahan akibat kurap juga sudah mulai mengering,” tutur warga Samida, Garut yang memiliki profesi sebagai wiraswasta dan kini menyarankan orang lain mengkonsumsi Damar Propolis untuk mengatasi segala macam penyakit. (Itang-Garut) Damar Propolis adalah suatu zat yang dihasilkan oleh lebah madu yang dikumpulkan dari pucuk daun muda untuk kemudian dicampur dengan air liurnya. Damar Propolis bersifat disinfektan yang dapat membunuh semua kuman. Sebagian besar penyakit dapat ditumbangkan oleh zat yang dihasilkan oleh lebah ini. Bahkan untuk penyakit menahun seperti Kelenjar Payudara Asam Urat dan Kolesterol dapat diobatinya, karena kandungan zat yang berfungsi sebagai antibiotik dan antimikroba tersebut tidak diragukan lagi. Damar Propolis dibuat dari propolis murni sehingga memiliki takaran dan komposisi yang tepat tanpa campuran alkohol, dan inilah yang membedakan dengan produk sejenisnya. Damar Propolis dengan kandungan 250 mg per ml, sangat efektif mengatasi berbagai keluhan penyakit Damar Propolis memiliki lebih dari 60 manfaat positif bagi tubuh dan lebih dari 300 jenis penyakit dapat diobatinya. Damar Propolis dapat di konsumsi setelah makan sahur dan setelah berbuka puasa. Untuk Info lebih lanjut silahkan kunjungi www. Atau menghubungi no: tlp. : 0561-791-3933 / 0812-5324-9757. Bagi anda yang membutuhkan Damar Propolis bisa didapat di apotek/ toko obat terdekat di kota Anda: seluruh apotek/toko obat Kota Pontianak. Kab. Pontianak (Mempawah): Apt Mempawah. Kota Singkawang: Apt Singkawang 1. Kab Landak (Ngabang): TO Sehat, TO Baru, Apt Mariba. Bodok: TO Cemara. Sosok: Apt Sawit Farma. Kab. Sintang: TO Setia Budi. Kab. Kuburaya: Apt Murni, Apt Sei Raya, TO Batara.(a2/biz)

Aspekindo Pererat Silahturahmi

Metode Efektif Atasi Diabetes hingga Tuntas

Buka Puasa Bersama Pengurus Kalbar & Pontianak

Pengobatan Sinshe TCM yang Manjur, Satu-satunya di Pontianak HONGKONG Medistra TCM Pontianak, adalah pengobatan dengan metode TCM (Traditional Chinese Medicine) yang ternama, merupakan gabungan dari pengobatan, penelitian TCM, pencegahan penyakit kronis dan terapi penyembuhan. Didukung oleh konsultan sinshe ahli TCM ternama dari Tiongkok yang sudah sangat berpengalaman; memanfaatkan resep TCM dan teknologi tinggi yang menghasilkan obat tradisional TCM yang manjur dan efektif ; dengan sistem diagnosa TCM yang tepat; obat tradisional terkini dari Tiongkok dan pengobatan elektroterapi, tilik nadi, akupuntur, tuina, terapi lainnya, sangat efektif, khususnya bagi pasien yang menderita penyakit kronis. Waspadalah! Jumlah penderita diabetes di Indonesia terus meningkat tajam, diprediksi ada jutaan orang terkena diabetes (kencing manis). Jika tidak diobati sedini mungkin secara tepat dan efektif, beresiko merusak organ penting tubuh lain seperti: hati, paru-paru, ginjal, limpa, reproduksi, dan sistem syaraf, juga bisa menyebabkan uremia. Itulah sebabnya data WHO terkini menyatakan persentase angka kelumpuhan maupun kematian akibat penyakit diabetes dan berbagai macam komplikasi menakutkan ini terus meningkat pesat. Untuk mengatasi penyakit diabetes dan komplikasinya, Hongkong Medistra TCM Pontianak menggunakan metode TCM yang terdepan yakni “Bai Wei Hu Yi Liao Fa”, mengatasi penyakit dengan ramuan herbal yang disesuaikan jenis & kondisi penyakit penderita, dihasilkan dari 33 jenis obat berharga ditambah 28 jenis obat organik, daya serap obat tinggi, rata-rata penderita diabetes setelah diobati sekitar 5-10 hari, gula darah menurun, gejala seperti kaki tangan kesemutan, seluruh badan tidak bertenaga, insomnia (susah tidur)

LUKMAN (52 tahun), warga Samida, Garut ini mengaku sudah 3 tahun menderita flu menahun, juga penyakit kulit seperti kurap dan panu. Upayanya ke dokter untuk sembuh hingga kini belum membuahkan hasil, sedangkan obat diminumnya hanya meredakan sesaat setelah itu kambuh lagi. “Kalau lagi kambuh, kulit rasanya gatal-gatal. Belum lagi flu ini yang tidak sembuh-sembuh, hampir tiap saat saya bersin terus. Tapi sejak minum Damar Propolis, sekarang gatal-gatal sudah tidak terasa lagi, dan flu juga mulai reda,” ujar ayah dengan 3 anak yang berprofesi sebagai wiraswasta. (Lukman-Garut) Sementara itu, Itang (32 tahun) juga memiliki keluhan alergi dan penyakit kulit yang telah dideritanya selama 2 tahun. Ayah dengan 2 orang anak ini mengaku sering merasa gatal-gatal di sekujur tubuh, juga kulit memerah dan gatal akibat penyakit kurap. “Saya sudah ke dokter tapi alergi dan penyakit kulit ini tidak sembuh juga,” katanya. “Namunsejaksayaminum Damar Propolis, sekarang gatal-gatal sudah hilang,

dan lain-lain berkurang secara nyata. Rata-rata setelah 40-60 hari, gula darah stabil, gejala komplikasi menghilang, daya tahan tubuh meningkat, keseluruhan tubuh membaik, sebagian pasien bisa berhenti konsumsi obat, fungsi insulin & sistem sekresi normal kembali, fungsi reproduksi pria kembali normal, sudah bisa kembali merasakan kehidupan sehat yang normal. Sudah banyak penderita merasakan khasiat mujarabnya; tidak ada efek samping, tidak menimbulkan ketergantungan, tidak pengaruh penderita menderita 10-20 tahun, kondisi penyakit parah/ringan, setelah diobati bisa menurunkan gula darah dan gula kencing hingga normal & seimbang, sesudah diatasi hingga keakar-akarnya tidak mudah kambuh. Hongkong Medistra TCM mengadakan promosi khusus untuk masyarakat yaitu diskon khusus untuk obat herbal sebesar 30%. Untuk konsultasi dan pengobatan, hubungi: Hongkong Medistra TCM Jl. Agus Salim No. 126 Pontianak, telpon (0561) 733268, 0821 52797 888. (Hari Minggu & libur tetap buka).(a2/bn)

PENGURUS DPP Aspekindo Kalimantan Barat dan DPK Aspekindo Kota Pontianak semakin mempererat tali silahturahmi. Mereka menggelar buka puasa bersama di Hotel Grand Kartika, belum lama ini. “Dengan kegiatan itu, para pengurus dan anggota Aspekindo se-Kalbar semakin pererat dan jalin tali silahturahmi. Kita berharap dalam bulan suci ramadan ini bisa dapat rahmat dan hidayah dari Allah SWT,” ujar H Syafruddin Nasution SH MH (Kabang), ketua Umum DPP Aspekindo Kalbar via telepon, kemarin (13/8). Kabang tidak bisa ikut serta dalam kegiatan tersebut karena pada hari yang sama ia berada di Jakarta. Kegiatan buka puasa bersama tersebut dihadiri Ketua Umum DPK Aspekindo Kota Pontianak Ir H Indrawan MM dan seluruh pengurus Aspekindo Kota Pontianak, serta pengurus DPP Aspekindo Kalbar. Mewakili Ketum DPP Aspekindo Kalbar, H Ishak Sulaiman menyampaikan, acara buka puasa bersama pengurus DPP dan DPK Aspekindo sangat tepat untuk menjalin tali silahturahmi bagi pengurus. Terlebih dalam keseharian di bulan ramadan


DENGAR TAUSIYAH: Pengurus DPP Aspekindo Kalbar dan DPK Aspekindo Kota Pontianak mendengarkan tausiyah dari ustadz Lukman Nul Hakim.

mereka sering disibukkan dengan aktivitas pekerjaan, sehingga waktu untuk bertemu dengan teman satu profesi dan asosiasi sangat minim. “Acara ini diharapkan dapat lebih mempererat keakraban sesama pengurus Aspekindo Kalbar dan Kota Pontianak,” katanya. Sementara itu, dalam tausiyah ramadan, ustadz Lukman Nul Hakim menyampaikan, manusia hidup di dunia bagaikan seorang saudagar yang memiliki empat istri. Isti pertama adalah amal ibadah. Isti kedua adalah pangkat dan jabatan. Istri ketiga adalah keluarga dan sahabat. Sedangkan istri keempat

Atasi Lonjakan Kalori saat Lebaran

Cara Lain Kurangi Risiko Diabetes Tipe 2 3.200 laki-lali berlatih mengangkat beban seperti yang banyak ditemui di pusat kebugaran dan diteliti. Ternyata hasilnya bukan hanya membuat otot menjadi kekar namun bisa mengurangi risiko diabetes tipe 2 bahkan hingga lebih dari tiga kali. Dalam studi yang dipublikasikan dalam jurnal Archives of Internal Medicine, mereka menemukan 30 menit latihan beban setiap hari, lima kali seminggu, bisa mengurangi risiko diabetes hingga 34 persen. Akan tetapi menurut peneliti, jika latihan tersebut kurang dari lima kali dalam seminggu, akan berpengaruh terhadap penurunan risiko hingga 12 persen. Meski demikian, latihan aerobik masih tetap lebih baik dengan aktivitas yang reguler karena mengurangi hingga separuh risiko. Menurut peneliti, jika kedua jenis olahraga ini dilakukan (aerobik dan latihan beban), efeknya lebih baik lagi karena mampu mengurangi hingga 59 persen. “Kebanyakan orang mengalami kesulitan menjalani latihan aerobik. Penelitian baru ini menunjukkan bahwa latihan beban bisa menjadi alternatif,“ ujar ketua penelitian, Anders Grontved (BBC).(*/mi)

adalah harta benda. Bila saudagar itu meninggal maka pangkat, jabatan, dan harta benda akan ditinggalkan, sedangkan keluarga dan sahabat hanya sampai mengantar di pintu kubur. Hanya amal ibadah yang menemani manusia menghadap sangat pencipta Allah SWT. “Perbanyak amal ibadah kita, karena hanya itulah yang menjadi bekal manusia kelak di akhirat,” ajaknya pada seluruh undangan. Pada akhir kegiatan, seluruh undangan menyantap hidangan yang disediakan secara bersama. Setelahnya, mereka melakukan salat magrib berjamaah. (d1/ser)

WAJAR jika Lebaran adalah momen dimana banyak orang kerap menyediakan beragam penganan lezat. Meski menggugah selera makan, kebanyakan hidangan mengandung banyak kalori. Sebut saja opor ayam, sayur berkuah santan, bahkan hingga kepingan kue dengan rasa yang sangat manis. Perlu diketahui, kebutuhan manusia akan kalori per hari hanya berkisar 1.500-1.900 kkal

pada perempuan, dan 1.900-2.400 kkal pada pria. Kalori merupakan satuan yang digunakan untuk menyatakan jumlah energi. Pada umumnya kalori digunakan untuk menunjukkan jumlah energi yang terkandung dalam makanan. Kalori sendiri dapat diperoleh dari asupan karbohidrat, lemak, dan juga protein. Jumlah kalori dalam makanan diperlukan untuk memperhitungkan keseimbangan energi. Apabila jumlah kalori yang dikonsumsi lebih kecil dari kalori yang digunakan, berat badan akan berkurang karena cadangan energi dari lemak akan digunakan. Sebaliknya, apabila jumlah kalori yang masuk lebih besar dari kalori yang digunakan, berat badan akan meningkat. Kelebihan energi pun akan disimpan sebagai lemak. Adapun penumpukan lemak yang berlebihan dapat meningkatkan resiko terjadinya hipertensi, obesitas, penyakit jantung, stroke, dan diabetes. Nah, tunggu apalagi. Batasi kebutuhan kalori dalam tubuh Anda, terutama saat Lebaran. Jangan lupa untuk tetap berolahraga. Sekecil apapun bentuk olahraga, seperti berjalan kaki, sudah mampu memangkas kalori dalam tubuh. (*/mi)

Olahraga Bareng Menjamin Kestabilan Berat Badan MELAKUKAN olahraga secara bersama-sama dengan teman ternyata bukan hanya menyenangkan, namun terbukti lebih mampu menjaga berat badan pada remaja. Demikian seperti yang disebutkan dalam hasil penelitian yang dikeluarkan jurnal Pediatrics, seperti yang dikutip dari CNNHealth, Selasa (31/7). Dalam penelitian, para ilmuwan melakukan survei kepada lebih dari 1.700 siswa. Ilmuwan menanyakan kepada para relawan mengenai seberapa banyak mereka beraktivitas dalam olahraga tim, serta aktivitas olahraga lainnya yang mereka lakukan. Dilihat dari hasil penelitian, remaja yang berolahraga secara tim diklaim sebanyak tiga sampai empat kali dalam setahun memiliki kecenderungan untuk kelebihan berat badan hanya 27 persen. Sedangkan mereka yang melakukan aktivitas fisik secara individu memiliki kecenderungan kenaikan berat badan bahkan hingga 39 persen. Para ilmuwan meyakini bahwa olahraga yang dilakukan secara tim, terutama yang mengharuskan adanya

latihan secara kompetisi, dapat mengurangi kecenderungan remaja untuk memiliki kelebihan berat badan. Pasalnya, jenis olahraga tim seperti basket, sepak bola, voli, dan lainnya membutuhkan stamina yang penuh dan juga menguras keringat. (*/mi)

Pontianak Post


Selasa 14 Agustus 2012


Hunian Strategis di Pusat Kota Pontianak

KOTA Pontianak makin berkembang pesat. Hunian baru menjadi kebutuhan warga Pontianak terutama di pusat kota. Salah satu hunian yang layak dimiliki adalah Al Faridz Residence. Lokasinya sangat strategis. Berada di Jl. Sepakat II, A Yani. Hunian berkelas ini memiliki jalan utama 8 meter. Lokasi hunian berjarak 400 meter dari Jl. A. Yani. Selain itu, hunian ini

dekat dengan pusat pendidikan, pemerintahan, kesehatan dan niaga. Misalnya Megamal, Hotel Mercure, SPBU, Rumah Sakit Anugerah Khatulistiwa/Anugerah Bunda, Kantor Gubernur Kalbar hanya berjarak 150 meter, Untan yang hanya berjarak 200 meter demikian juga Universitas Muhammadiyah dan TK-SD-SMP Al Azhar berjarak 400 meter dan lainnya. Hal ini memberikan keun-

tungan bagi para pemilik hunian Al Faridz Residence. Secara umum, hunian memiliki beberapa tipe menarik, cuma sekarang tinggal satu tipe. Didukung jalan aspal lebar 5 meter dan drainase yang berada di setiap sisi jalan. Secara khusus tiap hunian memiliki 2 lantai terdiri dari ruang tamu, ruang keluarga, 5 kamar tidur, dapur dan 2 kamar mandi, dan dilengkapi dengan garasi. Tiap hunian menggunakan pondasi beton cakar ayam dengan struktur rangka kolom praktis, dengan cerucok 12 meter, dinding batako plaster luar dalam dan cat, lantai dengan cor warmes geranit, untuk rangka atap menggunakan rangka baja ringan, seng metal, plapon dengan gipsum, lesplang dengan GRC. Fasilitas pendukung hunian Al Faridz Residence diterangi listrik 2.200 watt (voucher), PDAM dan sebagai tambahan tiap hunian dilengkapi pagar samping, depan dan belakang, kanopi, pintu folding gate garasi, dilengkapi dengan mushala dan taman bermain serta sistem keamanan dilengkapi dengan CCTV 24 jam. Pasti Anda berminat bukan? Informasi lebih lengkap segera hubungi kantor pemasaran kami langsung di Komplek Al Faridz Residence Nomor 2 A Pontianak dan dapatkan penawaran terbaik kami. Contact Person Silvia 081256907079. (a6/biz)

Panti Asuhan Al-Amien Butuh Perhatian PANTI Asuhan Al-Amien didirikan oleh Mahlan Yani pada 2002. Saat ini dengan 40 anak asuh yang terdiri dari anak yatim piatu, anak duafa, anak mualaf, dan anak broken home. Dari 39 yang sekolah ada satu anak yang tidak sekolah dikarenakan cacat ganda dan gangguan gizi buruk, di samping sekolah mereka juga diberikan kegiatan extrakurikuler, beladiri tarung derajat, les privat mata pelajaran, dan keilmuan keagamaan (Islam). Di samping itu ada enam anak yang dikirim ke Jogja untuk sekolah dan empat anak yang dikirim ke Pesantren Al Bina, Bekasi (SD dan SMP). Panti Asuhan Al-Amien juga dapat bantuan dari Kementrian Sosial RI untuk pemenuhan kebutuhan pokok dasar, sebesar Rp3.000 per anak per hari. Jika satu anak per harinya makan 3 kali, berarti 1 kali makan dianggarkan Rp1.000. Ini diterima pertengahan tahun. Di samping itu juga ada 40 donator tetap per bulan yang jika terkumpul semua sekitar Rp3 jutaan. Alhamdulillah sekalipun masih jauh dari pemenuhan kebutuhan yang ada, namun sudah dapat meringankan dari beban yang ada. Terima kasih para donator Al-Amien yang selama ini sudah membantu, serta para tamu secara insidentil sudah membantu.



GRAND VILLA SEPAKAT Lokasi Strategis dan Harga Terjangkau A New Hope For Family Living In Harmony

HUNIAN baru kini hadir di Kota Pontianak, lokasinya sangat strategis, berada di Jalan Sepakat II Jalan A Yani, hunian berkelas tapi harga sederhana yang terdiri dari Type 54 dan type 60. Mengapa lokasi hunian ini sangat strategis? Karena dekat dengan kawasan pendidikan pemerintahan, kesehatan dan niaga. Misalnya saja Kantor Gubernur Kalbar, A Yani Mega Mall, Universitas Tanjungpura, TK-SD-SMP Al-Azhar Pontianak, Hotel Mercure, Rumah Sakit Anugerah Khatulistiwa/Anugerah Bunda, dan lainnya. Hal ini memberikan keuntungan luar biasa bagi pemilik hunian di Grand Villa Sepakat karena berada di kawasan strategis dan mudah diakses. Selain lewat Jalan A Yani, Sepakat II, perumahan juga bisa diakses melalui Jl. Parit H Husein II

dan Jl. Perdana. Secara umum, tiap hunian memiliki ukuran 10 m x 20 m, sementara jalan aspal dengan lebar 6 meter dan didukung drainase lebar setengah meter berada di sisi kiri dan kanan jalan.

BRISyariah Santuni Anak Panti Gelar Buka Puasa Bersama


PENGHUNI PANTI: Bangunan Panti Asuhan Al-Amien sedang dikerjakan.

Semoga amal ibadah kita diterima Allah SWT, menjadikannya sebagai investasi akhirat, dan semoga Allah menyelamatkan dunia dan akhirat kita, amin. Alamat Jalan Danau sentarum, Komp. Ari Karya Indah 3 B10-11, telepon0561-6588553,HP0813-45185002 atau 0811-571-2666. Bagi yang ingin bertisipasi memberikan bantu-

an dapat mentransfer bantuannya ke RekeningBankKalbarNo.1521024930 atas nama Pa. Al-Amien; Rekening Bank BRI No.3047-01-002929-50-8 atas nama Pa Al-Amien; Rekening BCA N0.0290962099 atas nama Mahlan Yani; Rekening Bank Mandiri Syariah N0.0257088955 atas nama Mahan Yani. Atau kunjungi www. (a2/ser)

PIMPINAN dan seluruh karyawan Bank BRISyariah Cabang Pontianak menggelar buka puasa bersama 45 anak dan pengurus Panti Asuhan Baitul Hikmah Jl Tanggul Laut Desa Sungai Rengas, Jumat, 10 Agustus 2012. Kegiatan dipusatkan di Kantor BRISyariah Cabang Pontianak Komp Pontianak Mal. Arjanto Bobihoe, pimpinan BRISyariah Cabang Pontianak dalam sambutannya menyampaikan, selamat datang pada pengurus dan anak-anak panti. Ia pun memohon maaf jika ada yang kurang berkenan dengan penerimaan dari BRISyariah Pontianak. “Alhamdulilah

ini buka puasa kita yang kedua. Mudah-mudahan kegiatan seperti ini bisa membawa banyak hikmah,” ujarnya. Ramli AR, pimpinan Panti Asuhan Baitul Hikmah sangat berterimakasih atas perhatian BRISyariah Pontianak pada mereka. Ia berharap BRISyariah Pontianak terus mendukung mereka. “Kami juga mengharapkan bantuan dari pihak lain,” ujarnya. Ramli membutuhkan Rp18 juta per bulan, sedangkan pemasukan tetap hanya Rp4 juta per bulan dari donatur tetap, seperti Depsos dan BRISyariah Pontianak. Pada Pontianak Post Arjanto menyatakan, kegiatan tersebut wujud rasa syukur BRISyariah Pontianak yang telah diterima dengan sangat baik masyarakat Kalimantan Barat, khususnya Kota Pontianak.


Wisuda ABA Pontianak XIV

Jurusan Bahasa Inggris (DIII& Dl) Konsentrasi: * Bisnis & Office Management * Perbankan * Tour & travel * Pengajaran (guru TK+,SD) Prospek Karir Lulusan Tenaga profesional di perbankan, travel, perkantoran, staf PR/humas perusahaan, event organizer,

Secara khusus tiap hunian terdiri dari ruang tamu, ruang keluarga, satu kamar utama, satu kamar biasa, dapur dan satu kamar mandi. Tiap hunian menggunakan pondasi beton cakar ayam dengan struktur rangka kolom praktis, dinding batako plaster luar dalam dan cat, lantai dengan cor warmes keramik, untuk rangka atap menggunakan rangka baja ringan, seng metal, plapon dengan gipsum, lesplang dengan GRC. Bagaimana dengan fasilitas pendukungnya? Grand Villa Sepakat diterangi listrik 1.300 watt (voucher ) dan PDAM, (disiapkan apabila jaringannya sudah ada). Menariknya lagi Grand Sepakat dilengkapi dengan lapangan bulu tangkis. Pasti Anda berminat bukan? Informasi lebih lengkap segera hubungi kantor pemasaran kami langsung di Grand Villa Sepakat, contact person Angela 085246570870. Grand Villa Sepakat A New Hope For Family Living In Harmony. (a6/biz)

customer relation, presenter TV/ radio, guru, corporate perusahaan dan lain-lain (yang menekankan penguasaan bahasa Inggris) Persaingan yang ketat di dunia kerja, menuntut tenaga yang trampil. Tiada pilihan lain, mampu berbahasa INGGRIS merupakan salah satu cara terpenting yang dapat memenuhi tuntutan dunia kerja tersebut.

Ijin Penyelenggaraan : SK Dirjen Dikti Depdiknas No 4870/D/T/K-IX-2010 dan SK Mendikbud No 73/D/O/94

Kampus ABA Indonesia Imam Bonjol, bangunan beton megah berlantai 5

Informasi dan Pendaftaran Kampus ABA * Jalan Gajahmada No. 38 telp. 0561- 734762,739168 Pontianak Jalan Imam Bonjol No. 82-88 telp. 0561-761307,761309 Pontianak www.ABA-PTK.AC.ID

Gratis satu buah HP untuk akses informasi akademik mahasiswa/i, dan lain-lain.

Beasiswa pendidikan Rp.500.000 untuk mahasiswa/i baru (selama bulan September 2012)

Tes Masuk ABA 3 September 2012

Kurikulum ABA Jurusan Bahasa Inggris disusun sedemikian rupa serta memiliki ciri khas sebagai berikut: 1. Mahir berbicara, membaca, menulis dalam bahasa Inggris. 2. Mampu mengoperasikan komputer sesuai bidang tuqasnya. 3. Di ABA, baik jenjang DIII maupun DI, selain dibekali kemampuan bahasa Inggris, anda juga dibekali penguasaan bahasa Asing II yang dapat dipilih (bahasa Mandarin/ bahasa Jepang/bahasa Jerman dan lain-lain). 4. Memiliki ketrampilan dalam salah satu bidang yang merupakan paket pengetahuan terpadu atau Spesialisasi di bidang Bisnis & Office Management, perbankan tour & travel & pengajaran dll. Mengapa memilih kuliah di ABA Pontianak: 1. ABA Pontianak, Jurusan Bahasa Inggris telah terakreditasi B (Baik) Badan Akreditasi Nasional/BANPT SK. No. 006/BAN-PT/AK-VI/ DPL-III/VII/2006 2. Biaya kuliah di ABA Pontianak, sangat terjangkau oleh mahasiswa/i (SPP Rp 280.000, per bulan) 3. Semua ruang kuliah ber AC dan tidak ada ujian negara. 4. Lokasi kampus ABA Pontianak terletak sangat strategis di tengahtangah kota dan tepi jalan protokol (Jalan Iman Bonjol No. 82-88 dan Gajahmada No. 38 Pontianak) sehingga akan sangat menghemat biaya transportasi mahasiswa selama menempuh perkuliahan di ABA Pontianak.(d2/biz)

SANTUNI: Arjanto Bobihoe menyantuni anak-anak Panti Asuhan Baitul Hikmah usai buka puasa bersama.

“Perkembangan kami di sini sangat mengesankan,” ujarnya. BRISyariah Pontianak jadi kantor cabang terbaik di Pulau Kalimantan. “Alhamdulilah, aset kita jika naik hingga 600 persen dibandingkan awal spin off tiga tahun lalu,” katanya. BRISyariah Pontianak pun tetap bisa membukukan profit hingga 1000 persen dari sejak spin off, meski produk tabungannya memberikan banyak fasilitas gratis. “Nasabah tidak kami kenakan biaya kartu dan lain sebagainya. Bahkan kami tidak kenakan biaya transfer ke bank lain,” ujarnya. BRISyariah Pontianak sudah sangat baik dalam menunjang usaha cabang, sekitar 70 dana yang ada berupa tabungan. “Dana pihak ketiga dan pembiayaan kami tumbuh 10 kali lipat dari tiga tahun lalu,” katanya. Ia menegaskan, penerimaan dan kepercayaan sangat baik dari masyarakat Kalbar tidak mereka sia-siakan. Dana yang diperolah dari masyarakat Kalbar seluruhnya digunakan untuk mengembangkan bisnis di Kalbar. “Bahkan kami juga meminjam dana dari pusat untuk pengembangan di sini,” ujarnya. BRISyariah juga memiliki dua kantor cabang pembantu di Ahmad Yani dan Siantan. Tahun ini, BRISyriah bakal menambah KCP di Singkawang, Sanggau, dan Kota Baru. “Kami segera membuka kantor layanan syariah di 12 titik kantor cabang BRI di Kalbar tahun ini. Tahun depan saya targetkan membuka lima KCP lagi,” pungkasnya.(*/bn)

Gauss Jadi Ancaman Pengganti Flame SEBUAH perusahaan keamanan dunia maya, Kaspersky Lab menyatakan telah menemukan virus komputer varian baru untuk menyerang data dan akses masuk pada beberapa bank di Lebanon. Virus baru tersebut diduga kuat disponsori negara lain. Menurut Kaspersky Lab, “Gauss” ditulis programmer yang sama yang menciptakan virus Flame. Sebuah virus yang ditemukan untuk memata-matai komputer di Iran pada Mei tahun ini, serta terkait dengan Stuxnet, yaitu virus yang mengganggu pekerjaan pengayaan uranium di Iran pada 2010. Virus Gauss telah menginfeksi pada 2.500 komputer, sebagian besar di Lebanon. Tujuannya untuk memperoleh login account pesan e-mail dan instant, jaringan sosial dan terutama rekening di bank tertentu. Fungsi tersebut biasanya ditemukan di program berbahaya yang digunakan penjahat cyber mencari uang. Para peneliti mengatakan bank yang menjadi sasaran termasuk beberapa bank terbesar Lebanon seperti Bank of Beirut, Blom Bank, Byblos Bank, Kredit Libanais, Citibank, dan sistem pembayaran online PayPal. “Kami tidak pernah melihat ada


BERBAHAYA. Para pemakai komputer di timur tengah sedang mewaspadai serangan virus Gauss yang sudah menyerang beberapa bank.

sasaran malware seperti ini yang spesifik menyerang bank,” kata Costin Raiu, Kaspersky’s director of global research and analysis kepada Telegraph, Jumat 10 Agustus. Umumnya, penjahat cyber memilih bank sebanyak mungkin untuk memaksimalkan keuntungan finansial. Tetapi serangan ini adalah spionase cyber yang fokus menargetkan pengguna tertentu dari

sistem perbankan online. Para ahli komputer Libanon menduga aksi ini dilakukan Amerika dan diarahkan pada sistem perbankan Lebanon. Dugaan ini masuk akal, mengingat Washington sendiri pernah memperhatikan bahwa bank-bank negara itu digunakan sebagai saluran keuangan untuk pemerintah Suriah dan para pejuang Hizbullah. (jpnn)




Pontianak Post


Selasa 14 Agustus 2012

DPRD Minta Dipercepat

Usman Ketuai Demokrat


BERFOTO BERSAMA: Para pengurus DPC Partai Demokrat Kabupaten Kubu Raya berfoto bersama dengan pengurus DPD Partai Demokrat Provinsi Kalbar, usai pelantikan kepengurusan, Minggu (12/8).


USMAN kembali terpilih menjadi sebagai ketua Dewan Pimpinan Cabang (DPC) Partai Demokrat Kabupaten Kubu Raya periode 2012 – 2017. Ini merupakan kali kedua, wakil Ketua DPRD Kabupaten Kubu Raya ini, dipilih kembali setelah tahun 2008 – 2012. Proses pelantikan dilakukan langsung ketua Dewan Pimpinan Daerah (DPD) Partai Demokrat Kalimantan Barat, Suryadman Gidot, di Hotel Randayan Sungai Raya, Minggu (12/8). Ketua panitia pelantikan, Teguh Wibowo, menuturkan selain pelantikan ketua DPC Partai Demokrat Kubu Raya, juga pelantikan jajaran pengurus, ranting, kader, dan simpatisan Partai Demokrat Kubu Raya. Kegiatan pelantikan ini adalah rangkaian dari pada hasil Musyawarah Cabang (Muscab) Partai Demokrat Kubu Raya. “Mudah-mudahan dengan kepengurusan ini mampu membawa Partai Demokrat menjadi lebih baik lagi di masa-masa yang akan datang. Saya optimis di bawah kepengurusan baru, Partai Demokrat mampu bersaing dan kompetitif juga tetap eksis di Kubu Raya dan menjalankan berbagai program yang telah disusun dengan baik,” katanya. Ketua DPC Partai Demokrat terpilih, Usman, menuturkan dalam rangka konsolidasi internal dalam waktu dekat, di mana partai berlambang bintang mercy ini akan bersosialisasi ke tingkat kecamatan hingga tingkat desa. “Kita akan melakukan pembenahan dalam tubuh kepengurusan dari tingkat atas hingga tingkat bawah, karena sebelum dilantik, saya tidak bisa berbuat apa-apa untuk melakukan pembenahan, karena belum ada pelantikan yang sah,” ungkapnya. Usman berjanji ke depan pihaknya akan berusaha mendapatkan kursi lebih banyak dari yang ada saat ini di DPRD Kubu Raya. Di lembaga legislatif, Demokrat Kubu Raya baru mendapatkan empat kursi. ”Ke depan kami berharap Partai Demokrat mendapatkan delapan kursi di Pemilu Legislatif 2014. Untuk DPC Demokrat, pelantikan difokuskan untuk Pemilu Legislatif 2014,” tuturnya. Di samping itu, Demokrat Kubu Raya juga sudah berwacana dengan Ketua DPRD dan Ketua KPU dalam melakukan pemekaran wilayah Kecamatan Sungai Raya supaya bisa ideal. (den)


PAKET LEBARAN: Ketua DPC PDI Perjuangan Kubu Raya Sujiwo membagi-bagikan paket lebaran kepada warga, terutama kaum duafa, di Desa Kuala Dua, Sungai Raya, kemarin (13/8) pagi.

Bagikan 12 Ribu Paket Lebaran PDIP Peduli Duafa Jelang Idulfitri SUNGAI RAYA – Menyambut lebaran, DPC Partai Demokrasi Indonesia Perjuangan (PDIP) Kubu Raya peduli kepada kaum duafa. Lebih dari 12 ribu paket dibagikan di beberapa titik tersebar di kabupaten ini. Salah satunya di Desa Kuala Dua, Sungai Raya, Senin (13/8) pagi, yang dikunjungi penuh sesak penerima paket bantuan. Ketua DPC PDIP Kubu Raya, Sujiwo, menuturkan bahwa paket ini dibagikan kepada mereka yang berhak dan membutuhkan, untuk menyambut Hari Raya Idulfitri yang tidak lama lagi dirayakan kalangan umat muslim. “Ini adalah agenda tahunan PDIP Kubu Raya, dalam berbagi kasih kepada warga yang berhak di bulan suci Ramadan. Paket ini juga sudah dibagikan ke sejumlah daerah di Kubu Raya,” kata Sujiwo kepada wartawan di sela pembagian paket Ramadan di Desa Kuala Dua, kemarin pagi. Dijelaskan dia bahwa sejumlah daerah telah mendapatkan pembagian paket Ramadan dari partai dengan lambang banteng bermoncong putih tersebut. Misalnya di Desa Tebang Kacang, Desa Rasau Jaya, Sungai Ambawang, dan Sungai Kakap, di mana paket yang dibagikan berupa sembako, beras, minuman kaleng, dan uang tunai. “Pembagiannya ada yang menggunakan kupon dan langsung diserahkan kepada warga,”

katanya. Menurut Sujiwo, bantuan ini terkumpul berkat sumbangsih para kader dan simpatian PDIP di Kubu Raya. Entah itu kader, simpatisan, pengurus, di mana mereka bersama, satu sama lain, mengumpulkan bantuan untuk masyarakat yang kurang mampu menjelang lebaran ini. Meski hanya berupa paket, bantuan ini diharapkan dia, setidaknya dapat meringankan beban masyarakat yang memiliki ekonomi lemah. Bantuan ini pun, menurut dia, tidak hanya diberikan ke masyarakat muslim yang akan merayakan lebaran, tetapi juga nonmuslim. “Kita tetap lakukan seleksi untuk pemberian bantuan ini. Artinya tidak sembarang bantuan ini disalurkan. Tetapi tidak hanya buat masyarakat yang beragama muslim tetapi juga nonmuslim,” jelasnya. Sujiwo menyatakan ke depanya pembagian bantuan paket jelang lebaran ini akan dijadikan agenda tahunan. Karena ini merupakan bentuk kepedulian yang diberikan partai pemenang pemilu di Kabupaten Kubu Raya tersebut, kepada masyarakat yang berekonomi lemah. “Ini sudah tahun ke empat kita lakukan kegiatan seperti ini. Untuk tahun lalu, ada 8 ribu kita bantuan paket yang kita bagikan. Alhamdulillah, tahun ini ada 12 ribu yang kita bagikan. Kita berharap doanya dari masyarakat,” kata dia. Dia menuturkan pembagian paket ini menunjukkan gambar kemiskinan di Kubu Raya yang


sebenarnya masih tinggi. Namun, kondisi tersebut justru terbalik dengan data yang dipaparkan oleh pemerintah pusat. “Inilah yang menyentuh perhatian kami di PDIP untuk membantu warga yang membutuhkan,” ujarnya. Di tempat yang sama, wakil Ketua DPD Taruna Merah Putih Kalbar, Paulus, menuturkan bahwa kegiatan ini sebagai salah satu bentuk kepedulian keluarga besar PDIP beserta organisasi sayap terhadap kaum duafa. “Apalagi hari raya tak lama lagi, tentunya mereka (kaum duafa, Red) pasti membutuhkan. Jadi sudah sewajarnya kami memberikan sedikit rezeki yang kami kumpulkan secara swadaya, antarpengurus dan kader,” tuturnya. Sementara itu, dewan PertimbanganDPCPDIPKubuRaya,Andreas Muhrotien, begitu mengapresiasi kegiatan tersebut. Ia berharap dengan pembagian ini tentunya dapat meringankan warga yang menjalankan ibadah puasa maupun yang akan merayakan Idulfitri, terutama warga miskin. “Apalagi kita tahu, masih banyak masyarakat miskin yang membutuhkan uluran tangan. Karena itu sudah sepatutnya keluarga besar PDIP membantu untuk meringankannya,” ungkap Wakil Bupati Kubu Raya tersebut. Di tempat terpisah, salah satu warga yang menerima bantuan, Lisna, mengaku senang atas pembagian paket ini. “Alhamdulillah, semoga tahun depan bisa ada lagi. Untuk tahun ini, saya dapat 5 kilo beras,” katanya. (den)

SUNGAI RAYA – DPRD Kabupaten Kubu Raya meminta pemerintah daerah segera mengusulkan Kebijakan Umum Anggaran – Plafon Prioritas Anggaran Sementara (KUA-PPAS) untuk secepatnya dibahas menjadi RAPBD tahun anggaran 2013. ”Kita memang sudah meminta pembahasan KUA-PPAS dipercepat. Pasalnya kita takutkan banyak agenda lain terlambat,” ungkap Musni Khalib, wakil Ketua DPRD Kabupaten Kubu Raya di sela-sela mengikuti kegiatan Pengembangan Sumber Daya Manusia di Hotel Milennium Jakarta, 10 – 13 Agustus. Menurut dia, DPRD sebetulnya sudah meminta pembahasan KUA-PPAS, di mana tidak boleh telat kembali. Pasalnya, diingatkan dia, bisa berakibat terhadap keterlambatan pada APBD. “Makanya kita beritahu. Apalagi aturan Permendagri Nomor 37 Tahun 2012 mengamanahkan pembahasan KUA-PPAS paling telat akhir Juni,” ujarnya. Dengan jenjang waktu tersebut, menurut dia, sebetulnya Pemkab-DPRD masih memiliki masa tenggang waktu hingga Juli lalu. KUA-PPAS sendiri bisa dibahas dan dikupas bersama, untuk dipersiapkan mengarah kepada pembahasan RAPBD Kubu Raya. ”Namun, hingga Agustus kita masih menunggu penyampaian KUA-PPAS. Kita hanya berharap refleksi APBD tersebut dapat dibahas bersama kawan-kawan. Diakui atau tidak, kita sendiri sudah molor satu bulan karena sudah masuk bulan Agustus,” ungkapnya. Anggota DPRD lainnya, Darmawansyah, di tempat yang sama, menuturkan bahwa pembahasan KUA-PPAS memang harus mengacu kepada aturan baku. Salah satunya, menurut dia, yakni tentang Permendagri Nomor 37 Tahun 2012 yang terbaru, menyangkut pembahasan KUA-PPAS. Di dalamya diperjelas tentang rentang waktu pembahasan KUA-PPAS. Ia kembali menuturkan jika terjadi keterlambatan pemba-

Musni Khalib

hasan KUA-PPAS, mungkin pada tahun anggaran 2014 sampai akhir Juni – Juli, laporan bisa diteruskan kepada Gubenur Kalbar dan Kemendagri. ”Dan kita harapkan pemerintah bersamasama DPRD sudah membahas secepatnya,” kata politikus dapil Sungai Raya ini. Ditempat berbeda Masdar AR, wakil Ketua DPRD Kabupaten Kubu Raya berharap agar penyusunan RAPBD jangan terulang dan terjadi keterlambatan. Sebab, diingatkan dia bahwa dampaknya adalah kepada program dan bisa terjadi keterlambatan. “Makanya kita sangat berharap ke pemerintah daerah dan SKPD memiliki ketegasan menyusun KUA-PPAS,” ucapnya. Ketua DPD Partai Golkar Kabupaten Kubu Raya ini, menuturkan mengenai keterlambatan yang sebetulnya memang dapat ditoleransi. Namun, ditambahkan dia bahwa itu dimaksudkan untuk menghindari program kerja dan hal-hal tak diinginkan, seperti program dan kerja fisik. Untuk tahun ini saja, menurut dia, hingga memasuki Agustus, APBD terserap untuk kegiatan fisik mungkin baru sebagian. Sementara itu, dijelaskan dia, pada satu sisi, penyerapan APBD harus konsen. Tidak lama lagi, diingatkan dia bahwa pembahasan ABT akan segera dimulai. Sementara di sisi lain, ditambahkan dia, KUA-PPAS belum juga dikupas. Dia meminta agar jangan sampai pada tahun 2012 ini, penyerapan anggaran minim dan program banyak dikerjakan di ujung tahun. ”Yang pasti, kita sama-sama berharaplah sinkronisasilah,” tuturnya. (den)



C cmyk




Pontianak Post Selasa 14 Agustus 2012


Sarana Angkutan yang Terancam Hilang

Warga Jangan Teledor

Sambungan dari halaman 9

Sambungan dari halaman 9

Dari Pontianak ke Kapuas Hulu ditempuh selama 5 hari. ”Itu jika nonstop (terus menerus). Siang dan malam jalan. Kalau kita sering berhenti, perjalanan bisa memakan waktu 10 hari,” ujar Hendra Gunawan, pemilik kapal bandong Cahaya Borneo yang saat ditemui sedang duduk-duduk di depan kapalnya. Perjalanan bandong melalui sungai sangat ditentukan oleh pasang surut air sungai. Saat air surut mereka tak berani berangkat. Sebab jika memaksa bisa-bisa kapal kandas. ”Kalau bodi kena batu, kapal bisa bocor. Ini bahaya,” ujar pria yang sudah puluhan tahun memiliki kapal bandong ini. Karena itu dalam setahun paling hanya ada 6 rate. Di bulan-bulan ini, air sungai sedang dalam kondisi surut. Karena itu sejumlah kapal bandong hanya sandar saja di dermaga Kapuas Indah. Pagi kemarin ada 4 buah kapal yang sedang sandar. Pagi itu, para pemilik kapal kebetulan sedang nongkrong di kapal bandong Cahaya Borneo. Pemilik kapal ini Hendra Gunawan banyak bercerita tentang kapal bandong. Bandong memiliki peran yang sangat penting di masa lalu. Saat itu jalan belumlah seperti sekarang. Jalan ke Putusibau masih belum ada. “Dulu itu kalau kita nggak angkut barang, bisa-bisa

warga di Kapuas Hulu tak beli sembako,” ujarnya. Kapal bandong dibuat dari kayu-kayu kualitas terbaik, seperti belian, tekam, dan penyauk. Tetapi yang paling sering digunakan adalah kayu belian, karena lebih tahan lama. Kapal Banding yang terbuat dari belian ini bisa tahan hingga 50 tahun. Tetapi sekarang kayu belian sudah langka. Dengan panjang mencapai 20 dan lebar 7 meter pembuatan kapal bandong memerlukan kayu yang tidak sedikit. Karena semakin menipisnya bahan baku, saat ini sudah tidak ada lagi orang yang membuat kapal bandong. Bandong yang ada saat ini adalah kapal buatan puluhan tahun lalu. ”Jadi bisa dibilang, setelah kapal bandong yang ada sekarang ini musnah kita tidak akan melihat kapal bandung lagi,” ujar Hendra. Kartadinata, pemilik Kapal Sinar Raya mengatakan pengangkutan barang dengan kapal bandong sebenarnya lebih menguntungkan ketimbang penggunaan truk. Ukuran kapal ini mencapai 100 grosston. Jadi bisa mengangkut banyak barang. ”Ketimbang pakai truk masih lebih hemat pakai bandong. Pakai truk lebih mahal sebenarnya. Daya angkut juga sedikit,” jelasnya. Karena itu, meski sekarang jalan sudah jadi, penggunaan kapal bandong masih diperlukan. Perawatan kapal dilakukan setiap tiga

bulan sekali. Yakni dengan mengecet dan menambal sejumlah kebocoran. Para pemilik bandong sudah memiliki pelanggan di Kapuas Hulu. Mereka biasa memesan sejumlah barang untuk di antar ke sana. Barang-barang yang dipesan dibeli di pasar tengah. ”Kami terima ongkos angkut saja,” ujar Suryanto, pemilik kapal Usaha Bersama. Tetapi kapal ini tergolong boros. Dalam sekali perjalanan menuju kapuas hulu, dibutuhkan tak kurang dari 3600 liter solar. Ini yang jadi kendala, solar untuk kapal bandong ini sulit didapatkan. Mereka memang belum memiliki stasiun pengisian bahan bakar khusus. “Ada satu buah, tetapi jaraknya cukup jauh. Yakni didaerah kumpai, puluhan km dari dermaga. Kadang solar tidak tersedia di sana. Ada sih yang jual di tempat lain, tapi harganya mahal,” ungkap Eddy Koi, pemilik kapal Harapan Kapuas. Jika mereka membeli solar dengan harga yang mahal, yang dirugikan adalah masyarakat. Karena tentu saja harga barang yang dijual akan lebih tinggi. Karena itu mereka mengharapkan pemerintah memperhatikan masalah BBM bagi kapal bandong ini. “Kami tidak tahu harus m e n y a m p a i k a n k e ma na masalah ini. semoga pemerintah mendengar keluhan kami,” harapnya. (*)

Iklim Investasi Baik Sambungan dari halaman 9

“Yang jelas barang jasa mengalami peningkatan, karena memang dua hal itu yang dapat dikelola di Kota Pontianak,” ujarnya, kemarin (13/8). Sutarmidji juga tidak menamping, iklim investasi di Kalbar berpengaruh juga di Kota Pontianak. Pasalnya, dari banyak perusahaanperusahaan yang tersebar di daerah kantor pusatnya ada di Pontianak. “Jadi sedikit banyak berpengaruh pada penilaian investasi di kota ini,” katanya. Selain itu, kebijakan pemerintah juga menurutnya berpengaruh besar pada iklim investasi. Dia memaparkan, beberapa waktu lalu Pemkot Kota Pontianak mencanangkan izin gratis dan satu hari untuk SITU, SIUP dan TDP. Untuk izin lainnya terus dikurangi dan dipermudah. “Kita upayakan terus melakukan percepatan dan kemudahan untuk dunia investasi,” ucapnya. Bagi investasi tertentu

Pemkot Pontianak bahkan memberikan insentif. Tidak hanya kemudahan perizinan tetapi juga potongan biaya pun diberikan. “Akan kami beri insentif bagi investasi yang menyerap banyak tenaga kerja,” tutur Sutarmidji. Menurut Sutarmidji, properti dan tanah merupakan investasi paling baik saat ini di Kota Pontianak. Pasalnya, harga tanah bisa naik 100 persen dalam waktu tiga bulan. “Menurut saya itu investasi yang baik, apalagi jika diikuti properti di atasnya,” katanya. Tidak hanya pada iklim investasi yang membaik, ekonomi warga Kota Pontianak juga terus meningkat. Salah satu baromoternya, simpanan di bank. \Di salah satu bank swasta, Kota Pontianak menempati peringkat keenam simpanan terbesar se-Indonesia. “Kalau kita lihat dari perkembangan volume APBD dan PAD yang meningkat empat kali lipat dalam empat tahun terakhir ini menunjukan perekonomian Kota Pontianak

bagus,” ucap Sutarmidji. Ketua Komisi C DPRD Kota Pontianak Pramono Tripambudi mengatakan, diamati perubahan di Kota Pontianak dengan munculnya tempat-tempat kegiatan ekonomi bisa dikatakan investasi swasta sedang berkembang. Namun, kemudahan birokrasi bukanlah faktor utama berkembangnya investasi. “Proses birokrasi hanya sebagai mekanisme legalitas berupa perizinan,” katanya. Pramono memisalkan investasi rumah sakit. Pada satu sisi masyarakat kesehatannya lemah atau membutuhkan pelayanan kesehatan yang maksimal, sehingga investor memilih menggarap sektor ini. Contoh lain, masyarakat ingin mempercantik diri, maka muncul lah investor usaha jasa kecantikan. “Jadi birokrasi hanya faktor pendukung, tapi perbaikan birokrasi perizinan adalah tanggung jawab Pemkot,” ungkapnya.(hen)

Gula Malaysia Ganti Karung Sambungan dari halaman 9

ditemukan 490 karung gula tersimpan di sebuah gudang terletak di Jalan Parit Mayor, Desa Kapur, Kabupaten Kubu Raya. Hingga kini, kasusnya masih diselidiki secara intensif Dirkrimum dan Dirkrimsus Polda Kalbar. “Barang bukti berupa 650 karung gula asal Malaysia tersebut kita sita dan kini telah diamankan ke Mapolda Kalbar. Setelah melakukan pengembangan, pada Senin (13/8) di Pontianak Barat, juga mengamankan ratusan karung gula yang telah dikemas ke truk untuk dipasarkan,” katanya.

Menurut dia, pengungkapan kasus gula tersebut merupakan hasil penyelidikan anggota Polda Kalbar. Setelah menerima laporan masyarakat terkait aksi penyelundupan gula asal Malaysia. Dari hasil pemeriksaan sementara, gula yang diamankan merupakan milik Ibnu. Mukson menuturkan, modus pelaku yakni mengganti karung gula asal Malaysia tersebut bermerk dalam negeri. Untuk mengelabui pengawasan petugas ketika barang ilegal tersebut dibawa untuk dipasarkan. Mengingat polisi menaruh perhatian secara serius jalur darat dalam mengantisipasi

penyelundupan gula ilegal. “Pihak yang bertanggung jawab, akan dijerat pasal 8 ayat 1 butir (g), dan (i) UU Nomor 8/1999 tentang perlindungan konsumen,” jelasnya. Mukson menambahkan, kepolisian akan selalu tegas terhadap tindak kejahatan ilegal. Sekaligus mengingatkan seluruh jajaran serius menangani kasus tersebut dalam mempersempit ruang penyelundupan. Sebab wilayah Kalbar secara geografis amat rentan aksi penyelundupan. Karena mempunyai lintas batas antar negara secara langsung yang dapat dilalui menggunakan jalur darat maupun laut. (rmn)

Ekonom Kritik Praktik Diskon Jelang ... Sambungan dari halaman 9

Itu kalau didiskon jatuhjatuhnya harganya Rp200.000. Kalau saya lihat dari kualitasnya, baju koko itu memang harganya ya di kisaran Rp150.000-200.000. Artinya memang tidak ada diskon di situ,” katanya pada Pontianak Post, Senin (13/8). Menurut Eddy, strategi pemasaran yang dijalankan pusat-pusat perbelanjaan itu tergolong praktek yang tidak jujur. “Saya menduga harga yang didiskon itu sudah ditinggikan harganya. Itu praktik yang tidak jujur dan tidak beretika. Bisa dikategorikan penipuan pada konsumen,” ujarnya dengan tegas. Eddy mengimbau kepada para pengelola pusat perbelanjaan agar memberikan harga dengan benar. ”Menjelang lebaran kan permintaan akan pakaian tinggi.

Masyarakat banyak menyerbu ke supermarket-supermarket. Jadi janganlah kondisi ini dimanfaatkan untuk memperoleh keuntungan sebanyakbanyaknya dengan cara yang tidak beretika,” ujarnya. Sebenarnya dengan harga yang biasa saja, menurut Eddy, pengelola sudah mendapatkan keuntungan yang besar. ”Karena permintaan meningkat, tidak masalah ada kenaikan harga. Itu wajar saja. Tetapi bukan dilakukan dengan menipu konsumen,” tambahnya. Jikapun para pengelola pusat perbelanjaan hendak memberikan diskon, hal itu menurut Eddy lebih baik. ”Tapi diskon yang diberikan harus benar. Harus dihitung dari harga yang sebenarnya, jangan mark-up. Tentu gak usah ditulis diskon sampai 70 persen. Yang wajar-wajar saja,” jelasnya.

Konsumen adalah pihak yang paling dirugikan dari sistem pemasaran seperti ini. ”Banyak konsumen dari daerah, mereka beli banyak banyak karena tergiur diskon itu. Mereka merasa senang. Sampai berebutan beli pakaian. Padahal sebenarnya mereka dirugikan,” jelasnya. Eddy mengimbau kepada para konsumen untuk berhati-hati dan tidak mudah tergiur dengan diskon besarbesaran itu. Yang lebih penting, lanjutnya, pemerintah juga harus membuat aturan tegas mengenai pemberian diskon ini. ”Harus dibuat aturan mengenai pemberian diskon seperti ini. Aturan ini untuk melindungi konsumen,” ujarnya. Yayasan Lembaga Konsumen Indonesia juga diminta mengawasi berbagai praktik pemasaran yang dinilai sudah merugikan konsumen. (her)

Angka ini meningkat lagi di 2011, sepanjang tahun itu ada 82 kali kasus kebakaran. Berdasarkan data BPBD juga, sebagian besar kebakaran itu terjadi karena hubungan arus pendek, lalu disusul ledakan tabung gas elpiji, kelalaian manusia dan lain-lain. Kepala Pelaksana BPBD Kota Pontianak Sunarto SM menyebut hubungan listrik arus pendek semakin mendominasi seiring dengan tumbuhnya pemukiman, kios dan warung. “Kebanyakan mereka melakukan sambungan listrik yang tidak sesuai dengan standar atau asal-asalan. Atau kabelnya tidak sesuai dengan besaran tenaga listik. Selain itu peralatan listrik yang sudah seharusnya diganti juga dibiarkan,” ungkapnya. Sementara untuk kasus kebakaran di lahan gambut pun dikatakan dia kebanya-

kan juga dikarenakan ulah manusia. “Rata-rata karena keteledoran membakar sampah di dekat lahan gambut. Sebaiknya kalau mau bakar sampah jangan di lahan gambut karena mudah merembet apinya,” tandas dia. Bulan Agustus ini pun diyakini Sunarto menjadi bulan yang rawan kebakaran lantaran aktivitas warga yang meningkat jelang Hari Raya Idulfitri 1433 Hijiriah. Biasanya ancaman terjadinya kebakaran akan meningkat pada akhir Ramadan atau menjelang Lebaran. Karena aktivitas warga di dapur untuk membuat berbagai kebutuhan Lebaran,” ucapnya. Ditambah lagi, tingkat kewaspadaan warga juga cenderung menurun pada saat ini plus musim kemarau yang panas dan kering. Sementara itu, Manajer PT PLN (Persero) Cabang Pontianak Achmad Ismail meminta kepada para pelanggan-

15 nya agar tidak main-main dengan peralatan listrik. “Kami mengimbau kepada semua pelanggan dalam menambah instalasi listrik di rumah atau kantor atau lainnya agar menghubungi instalatir resmi,” kata dia. Pemasangan sambungan yang tidak sesuai standar, lanjut Ismail sangat berpotensi menyebabkan terjadinya hubungan arus pendek. “Pemasangan sambungan harus sesuai standar untuk menghindari akibat yang tidak kita inginkan. Jadikanlah listrik sebagai kawan bukan sebagai lawan,” sebutnya. Cukup berbahaya juga, menurut dia, adalah menggunakan listrik ilegal atau mencuri sambungan listrik. Selain merugikan PLN, sambungan lsitrik langsung itu dilakukan secara sederhana dan dengan standar pengamanan yang rendah. “Pemakaian listrik secara ilegal dapat merugikan kita semua,” pungkasnya. (ars)

Tenaga Medis Harus Siaga Sambungan dari halaman 9

dan pengamanan Operasi Ketupat 2012 ini. Semua petugas kesehatan telah diperintahkan untuk menjalankan kinerja sesuai prosedur,” tuturnya. Andi menegaskan, mereka akan bertugas melayani pasien yang mendapat musibah. Contoh kecilnya, terhadap pemudik yang menjadi korban lakalantas. Di sana, petugas harus siap memberi pertolongan pertama sesuai prosedur medis. “Apabila pasien tersebut dinyatakan kritis, maka langsung dirujuk ke rumah sakit terdekat.

Dan di sinilah peran si dokter untuk menangani langsung,” paparnya. Menurut Kapolda Kalbar Brigadir Jenderal Unggung Cahyono, memang telah membuat kesepakatan dengan dinas dan instansi terkait. Itu dimaksudkan, agar pihak kepolisian dapat berkerja maksimal. Jajaran Satlantas misalnya, personil yang standby di sana harus selalu berkoordinasi dengan petugas kesehatan. “Jadi, jika ada pengguna jalan yang mendapat musibah karena kecelakaan, kita dapat segera menanggulanginya. Terutama, untuk memberikan

pertolongan pertama kepada si korban. Kemudian, kemacetan dapat segera dinetralisir,” kata Kapolda, kemarin (13/8). Untuk itu, pihaknya berharap kepada seluruh lapisan masyarakat selalu waspada. Untuk pengendara, baik yang mengemudikan kendaraan roda dua dan roda empat, jangan ugal-ugalan. Patuhi selalu rambu-rambu lalulintas di sepanjang jalan. “Jika hendak mudik, bawa perlengkapan secukupnya. Jangan membawa harta benda berlebihan, karena dapat memancing aksi tindak kriminalitas,” imbaunya. (rmn)

Waspada Kejahatan Sambungan dari halaman 16

Ia mengatakan, kepolisian turut meningkatkan kewaspadaan dalam rangka mengantasipasi tindak kejahatan. Sebagai bentuk pencegahan sebelum aksi kriminalitas tersebut terjadi. Melibatkan 2.797 personel kepolisian untuk melakukan pengamanan. Dengan membangun 68 pos pengamanan di titik lokasi yang dianggap rawan kejahatan dan kemacetan arus lalu lintas. “Upaya menekan tindak kejahatan menjelang lebaran sebenarnya telah dilakukan. Melalui Operasi Cipta Kon-

disi yang dilanjutkan dengan Operasi Patuh dan digelarnya Operasi Ketupat,” ungkap Mukson. Mantan Kabag Ops Serse Narkoba Polda Kalbar ini menegaskan, penindakan kejahatan jalanan menjelang lebaran menjadi perhatian khusus guna terciptanya kondisi keamanan yang kondusif. Selain itu, aspek kelancaran lalu lintas turut menjadi prioritas utama. Untuk memberikan rasa nyaman dan aman bagi masyarakat yang hendak memenuhi kebutuhan lebaran di pusat perbelanjaan. “Kelancaran lalu lintas tentu kita antisipasi, jangan sampai kemacetan itu menggang-

gu kenyamanan masyarakat pengguna jalan,” katanya. Mu k s o n m e n g i m b a u , masyarakat selalu bersikap waspada. Perhatikan kunci pengaman kendaraan dengan memasang kunci ganda ketika akan parkir. Pilih lokasi parkir yang aman dengan tidak menyimpan kendaraan disembarang tempat. “Peningkatan tindak kejahatan menjelang Lebaran disebabkan banyak faktor. Biasanya niat muncul karena adanya kesempatan, maka hindari hal-hal yang dapat memancing munculnya niat pelaku kejahatan beraksi,” pungkasnya. (rmn)

Sekda Tolak Tudingan Terlibat Politik Praktis Sambungan dari halaman 16

seperti sekarang ini, peraturan-peraturan yang berbicara tentang desa itu begitu banyak dan selalu berubah. Salah satu contohnya seperti sekarang ini yang sedang dipersiapkan RUU desa. Selain itu, PNPM juga ada di desa. Kewenangan itu ada di desa. “Sekarang pertanyaannya, jika sekarang kewenangan itu akan ‘menghajar’ desa, apakah desa itu sudah siap untuk menjalankan kebijakan

dan kewenangan-kewenangan itu? Apakah SDM-nya suah siap? Apakah itu tidak menjadi bom waktu? Nanti, semuanya urusan ke desa. Jika desa tidak siap, ujung-ujungnya masuk penjara semua,” ujar M Zeet. Sementara itu, desa juga akan diberikan kewenangan untuk mengelola keuangan. Dengan demikian, berarti ada administrasi keuangan di desa dan itu berfungsi sebagai pengguna anggaran. “Nah, ini tidak gampang seperti yang orang katakan, oleh karena itu

saya jelaskan jangan anggap semua ini remeh,” pintanya. Zeet mengimbau kepada seluruh perangkat desa seperti kades dengan BPD, untuk selalu harmonis. Menurut Zeet, untuk mengingatkan dan menghimbau semua itu adalah peran sekda. Sebelum dia menutup wawancara dengan wartawan, dia juga menegaskan, kalau wartawan tidak boleh berpolitik praktis. “Imbauan kepada seluruh PNS tidak boleh berpolitik atau netral,” pungkas Zeet. (afi)

Pemudik Meningkat Sambungan dari halaman 16

badan jalan, membuat arus lalulintas macet. Dilirik data tersebut, pihaknya tetap berusaha untuk menekan angka kemacetan dan lakalantas di wilayah hukum Kalbar. Terutama, menentukan target operasi yang harus dicapai sebagai indikator keberhasilan kegiatan Operasi Ketupat 2012 ini. Latif merincikan, pengarahan

terhadap personil sudah sesuai topoksi. Mereka pun telah berkoordinasi dengan dinas terkait, dalam melayani para pemudik yang berkendara dengan kendaraan pribadi. Itu ditujukan untuk menekan angka lakalantas yang terjadi setiap tahun. Sementara sopir angkutan umum, lanjutnya, harus tetap prima. Karena, membawa orang banyak. Untuk itu, tes urine dilakukan agar mengetahui kondisi sopir itu sendiri. Apakah

di dalam tubuh sopir mengandung zat-zat berbahaya, yang dapat mempengaruhi fisik dan psikologinya. “Apalagi ada yang terbukti mengonsumsi narkoba, sudah pasti tidak diperbolehkan. Untuk itu, kita juga meminta dukungan terhadap perusahaanperusahaan pelayanan jasa angkutan umum untuk berkerjasama. Ini dilakukan, demi keselamatan kita bersama,” imbaunya. (rmn)

BPKP Awasi Rapat APBD Sambungan dari halaman 16

orang petugas BPKP usai rapat. Menurutnya, langkah ini untuk menjamin supaya proses pembahasan anggaran menjadi lebih transparan. Berdasarkan surat dari BPKP Perwakilan Kalbar pada 23 Juli 2012, diketahui bahwa hal ini terkait dengan Surat Perintah Tugas Pimpinan KPK pada 17 Juli 2012 tentang Koordinasi dan Supervisi Pencegahan Korupsi. Jadi, BPKP melakukan supervisi dan monitoring dalam kegiatan perencanaan dan penganggaran APBD. Kegiatan tersebut akan dilaksanakan selama 20 hari kerja terhitung mulai 23 Juli. Seluruh biaya kegiatan ditanggung oleh KPK. Di samping mengawasi perencanaan dan penganggaran APBD,

para petugas juga memelototi pengadaan barang dan jasa di lingkungan pemprov dan DPRD Kalbar. Kepala Biro Pengelolaan Keuangan dan Aset Daerah Kalbar, Christianus Lumano membenarkan bahwa keterlibatan BPKP itu adalah kali pertama terjadi. “Baru tahun ini. Tahun lalu tidak ada,” katanya. Namun, sambung Lumano, hal ini tidak hanya berlaku di Kalbar tetapi juga di provinsi-provinsi lain di seluruh Indonesia. Pihaknya tidak mempersoalkan adanya petugas BPKP yang ikut masuk ke dalam ruang pembahasan anggaran. “Kita sih welcome saja kalau memang ada dasarnya. Kata mereka, dasarnya ada,” ujar Lumano. Anggota Badan Anggaran

DPRD Kalbar Suprianto menyambut baik keterlibatan petugas BPKP dalam mengawasi proses pembahasan anggaran. Sebab, menurutnya ada banyak dampak positif yang dapat dipetik, termasuk bagi DPRD sendiri. Paling tidak dengan ini maka persepsi negatif atau prasangka buruk yang mungkin muncul di masyarakat tentang proses pembahasan anggaran bisa ditepis. “Kita senang sekali karena ini bagus untuk pencegahan korupsi, supaya anggaran lebih efektif, efisien dan tepat sasaran. Dengan begini, orang juga tidak lagi menganggap DPRD itu korupsi,” katanya. Hal ini juga dapat membuktikan bahwa dalam proses pembahasan anggaran DPRD tidak sekadar cap stempel dari pemerintah. (ron)



Pontianak Post

Selasa 14 Agustus 2012


Waspada Kejahatan MASYARAKAT mesti meningkatkan kewaspadaan ketika berada di pusat perbelanjaan agar tidak menjadi korban kejahatan jalanan. Sebab aktifitas pusat perbelanjaan pada H-6 semakin disesaki masyarakat yang hendak memenuhi kebutuhan lebaran. Kondisi ini disinyalir turut mengundang pelaku kejahatan untuk melancarkan aksi kriminalitas. “Menjelang lebaran ancaman kriminalitas pada umumnya mengalami peningkatan. Untuk itu, masyarakat Mukson Munandar diharapkan waspada jika berbelanja. Bawa uang secukupnya dan tidak menggunakan perhiasan yang berlebihan agar tidak memancing niat orang lain untuk melakukan kejahatan,” ujar Kabid Humas Polda Kalbar AKBP Mukson Munandar, Senin (13/8) di Pontianak. Ke Halaman 15 kolom 5


Pemudik Meningkat DIREKTUR Lalulintas Polda Kalbar Kombes Lhotaria Latif mengatakan, dari data yang dihimpun, pemudik di Indonesia meningkat setiap tahunnya. Sehingga, volume kendaraan menjadi tidak seimbang dengan kapasitas jalan raya. Berbagai permasalahan pun timbul, seperti ketertiban, keamanan, dan keselamatan. Seperti pada 2011, jumlah masyarakat di Indonesia yang menggunakan angkutan darat sebesar 5,6 juta jiwa. Sementara untuk Lhotaria Latif angkutan air, sebanyak 4,9 juta jiwa. Sedangkan angkutan jalur udara tercatat 3,3 juta jiwa. “Angka ini tiap tahun kian meningkat,” ujarnya, kemarin (13/8). Sehingga, kata dia, arus lalulintas menjadi tersendat jika saat menjelang Idul Fitri. Selain itu, faktor lainnya adalah penyempitan jalan, perbaikan ruas jalan yang belum rampung saat memasuki hari raya. Belum lagi aktivitas pasar tumpah yang banyak mengambil Ke Halaman 15 kolom 5


PADAT: Puluhan kendaraan bergerak lambat di Jalan Tanjungpura kemarin. Kepadatan kendaraan di Pontianak mulai terasa, terutama saat jam sibuk menjelang siang.

PNS Jangan Ikut Berpolitik PONTIANAK - Anggota DPRD Kalbar Andry Hudaya Wijaya menyesalkan tentang tindak tanduk Sekretaris Daerah Kalbar Zeet Hamdy yang diduga telah berpolitik praktis dalam sebuah acara di Sintang belum lama ini. Sebab, keterlibatan PNS dalam politik praktis adalah suatu bentuk pelanggaran aturan dan dapat dikenai sanksi tegas. Keterlibatan PNS dalam politik praktis melanggar UndangUndang Nomor 32 tahun 2004 tentang Pemerintahan Daerah dan Peraturan Pemerintah Nomor 53 tahun 2010 tentang Disiplin PNS. Di sisi lain, tambah Andry, hal itu juga dinilai sangat bertolak belakang dengan isi pembicaraan sekda di banyak kesempatan sebelumnya. “Sekda sering mewanti-wanti supaya PNS tidak berpolitik praktis. Kenapa justru sekda tidak konsisten dengan pembicaraannya sendiri,” kata Sekretaris Fraksi Golkar itu, kemarin. Sebagai PNS

dengan pangkat tertinggi di daerah ini, sambungnya, sekda semestinya dapat menjadi panutan bagi para PNS lain, bukan malah memberikan contoh yang tidak baik. “Jangan sampai terjadi guru kencing berdiri, murid kencing berlari,” ujarnya. Menurut Andry, pihaknya akan menindaklanjuti masalah ini dan mencoba mencari informasi yang lebih akurat di lapangan. Apabila terdapat fakta yang membuktikan aduan masyarakat tersebut, pihaknya akan mendorong agar ada sanksi tegas bagi sekda. “Kita akan tindaklanjuti ini. Kita ketemu dulu dengan fraksi-fraksi dan mencari fakta. Setelah ada kesimpulan, mungkin kita akan koordinasi juga dengan Panwaslu,” katanya. Saat dikonfirmasi, Ketua Panwaslu Kalbar Hawad Sriyanto mengatakan, sampai kemarin sore, pihaknya belum mendapatkan laporan tentang dugaan politik praktis yang dilakukan oleh Sekda Kalbar. Namun, ia mengaku sudah mendengar informasi tersebut dari media. Lantas, apa tindak lanjut Panwas? “Itu lo cus delicti-nya di Sintang. Kita lihat dulu adakah

laporan dari masyarakat, dari yang melihat atau mendengar tentang itu di Panwas Sintang. Sesuai lokasi, Panwas Sintang yang menangani,” jelasnya. Anggota Panwas Bidang Penindakan Ruhermansyah menambahkan, apabila dugaan politik praktis itu terbukti benar, maka itu adalah pelanggaran atas UU/32/ 2004 jo UU/12/2008. Ada sanksi pidana yang bisa dijatuhkan kepada pelaku. “Sekarang belum ada laporan. Tetapi kalau ada pihak lain yang melapor, kami akan segera tindak lanjuti. Kami siap,” tegasnya. Sebab, kata dia, setiap peserta pemilu atau pasangan calon, tim kampanye dan semua masyarakat yang mempunyai hak pilih berhak untuk menyampaikan laporan tentang dugaan pelanggaran. Ruhermansyah juga menerangkan, penindakan Panwas terbagi atas dua, yaitu kasus yang berasal dari temuan Panwas hasil pengawasan aktif di lapangan dan berdasarkan pengaduan. “Kalau laporan di Sintang sesuai locus delicti-nya, bisa Panwas Sintang yang tangani. Tetapi kami di Panwas Kalbar tidak akan tinggal diam. Kami akan lakukan supervisi. Kalau dilaporkan ke Panwas Provinsi, bisa kami yang tangani atau kami limpahkan ke kabupaten,” jelasnya. (ron)

BPKP Awasi Rapat APBD PONTIANAK - Aparat dari Badan Pengawasan Keuangan dan Pembangunan diterjunkan untuk memantau proses perencanaan dan pengganggaran APBD Perubahan 2012 Kalbar. Hal ini demi upaya pencegahan korupsi yang diprakarsai oleh Komisi Pemberantasan Korupsi. Sedikitnya ada empat petugas BPKP yang ikut masuk ke dalam ruangan tempat pembahasan anggaran yang sedang berlangsung di DPRD Kalbar, Senin (13/8). Biasanya rapat pembahasan anggaran seperti itu bersifat tertutup. Tidak ada pihak luar yang diperkenankan masuk kecuali tim anggaran eksekutif dan badan anggaran DPRD. “Baru tahun ini. Kami di sini hanya mengamati, tetapi tidak ikut memberikan pendapat,” kata se Ke Halaman 15 kolom 5

Sekda Tolak Tudingan Terlibat Politik Praktis PONTIANAK – Sejumlah kepala desa dan lembaga nonpemerintah di Sintang yang menganggap Sekretaris Daerah Kalbar berpolitik praktis, dibantah langsung oleh Zeet Hamdy Assovie. Menurutnya, politik yang dijalankan bukan politik praktis, melainkan politik administrasi negara. “Orang yang mengaggap itu sebagai politik praktis, sebetulnya mereka tidak paham, bahwa saya menjalankan politik administrasi pemerintahan. Itu politik juga, tapi politik administrasi negara bukan politik praktis,” kata Zeet, kemarin (13/8). Sekda merasa perlu menjelaskannya terkait tudingan pidato berbau kampanye yang dihadiri sekda dalam kegiatan. Sekda juga





dituding telah melibatkan diri dalam politik praktis, padahal ia sebagai pimpinan PNS tertinggi mestinya tidak melakukan hal tersebut. Selain itu, kegiatan yang dilakukan oleh sekda penuh dengan rekayasa. Hal itu dapat dilihat dari permintaan mendatangkan kepala desa/lurah dan ketua BPD se-Kabupaten Sintang secara mendadak. Menanggapi hal ini, sekda membantah secara keras kalau kegiatan itu tidak bersifat mendadak, melainkan sudah direncanakan selama satu tahun. “Acara itu sudah dirancang oleh biro pemerintahan provinsi dan itu merupakan program tahunan semua kabupaten/kota. Itu Raker (rapat kerja) kepala desa. Dan

apabila kepada daerah tidak bisa datang, bisa diwakili oleh wagub, jika tidak bisa maka diwakili oleh sekda, dan kalau tidak bisa melalui asisten,” jelas Zeet. Zeet mengungkapkan, dalam kegiatan tersebuit banyak di antara mereka yang bertanya tentang roda pemerintaha dan seputar permasalahan desa. Kemudian mereka juga bertanya seputaran peraturan desa. Selanjutnya mereka juga bertanya bagaimana untuk membangun bandara, dan juga menanyakan PKL. “Jadi sifatnya administratif dan kami jelaskan secara administratif. Kami tidak berani berpolitik, kami tegas. Jadi, itu tidak benar,” tegasnya. Zeet menjelaskan, di era otonomi Ke Halaman 15 kolom 5

PRO-KALBAR Pontianak Post

Selasa 14 Agustus 2012

3 17

Buah Ujong KETIKA musim buah tiba, terutama musim durian, maka istilah “buah ujong” mengemuka. Istilah yang kerap dijadikan kata untuk menggambarkan kondisi buah yang di penghujung musim, yang mana buah ujong identik dengan buah yang tidak baik (rusak) dan harganya mahal. Dar i gambaran singkat mengenai buah ujong ini, maka dapat kita ambil oleh: H. Anang Nurkhalis hikmah dalam kita melaksanakan ibadah ramadhan. Ramadhan adalah sebuah bulan untuk kompetisi. Dalam hal ini kompetisi melawan hawa nafsu, godaan syaitan dan manusia, layaknya sebuah kompetisi, maka semakin akhir adalah yang mempunyai kualitas yang tinggi. Beda dengan buah ujong tadi, sama-sama sebagai predikat yang terakhir akan tetapi beda dalam hal kualitas. Selain itu pula, di akhir Ramadhan, Allah SWT memberikan













Berlaku : 14 - 15 Agustus 2012

Penjual Sayur Tewas Dirampok saat Jualan

Ke Halaman 23 kolom 5



NASDEM: Pengurus Nasdem saat mendaftar.

Serahkan Berkas DEWAN Pimpinan Daerah Partai Nasional Demokrat (Nasdem) bersama jajaran pengurus, Jum’at (10/8), mendatangi kantor KPU Kabupaten Sanggau dalam rangka melakukan penyerahan berkas dokumen untuk verifikasi Parpol tahun 2012. Kehadiran mereka sekitar pukul 10.00 Wib itu disambut baik oleh Ketua KPU Kabupaten Sanggau, Mugiono Pramono. Dari Nasdem, hadir dalam penyerahan berkas tersebut diantaranya; Ketua Dewan Pembina Daerah Nasdem, F Hugo Agato dan anggota. Ketua Dewan Pimpinan Daerah, Irenus Nius. Wakil Ketua Internal, Abang Amri. Sekretaris, Andreas Sisen. Bendahara, Ferry. Ke Halaman 23 kolom 5


ENGGANG GADING: Burung Enggang Gading di habitatnya di Melawi. Burung besar ini yang kini seakin diburu untuk diambil kepalanya.

Melawi Daerah Perburuan Satu Kepala Enggang Rp2,5 Juta MELAWI- Penyelundupan 96 paruh burung Enggang Gading (Buceros rhinoceros) yang digagalkan Balai Konservasi Sumber Daya Alam

(KSDA) Kalimantan Barat, Kamis lalu banyak mendapat perhatian dari berbagai pihak, tak terkecuali dari kalangan pencinta lingkungan dari Kabupaten Melawi. Apalagi nama Kabupaten Melawi disebut-sebut sebagai sumber dari penyeludupan tersebut. Salah seorang aktivis lingkungan dari Kabupaten Melawi, Efiantono

berpendapat informasi penyeludupan kepala burung Enggang memang sudah lama terdengar di Kabupaten Melawi. “Ada yang bilang kepala burung Tajak sejenis Enggang, tapi saya yakin yang diburu itu adalah burung Enggang hanya saja istilahnya saja burung Tajak supaya tidak banyak yang tahu kalau itu Ke Halaman 23 kolom 1


Pemeliharaan Jalan KEPALA Dinas Pekerjaan Umum (PU) Kabupaten Sanggau, Abang Syafarudin, Senin (13/8) kemarin kepada Pontianak Post mengatakan bahwa Bupati Sanggau, Setiman H. Sudin telah mengeluarkan instruksi kepada pihak kontraktor agar menghentikan aktifitas pemeliharaan jalan dengan alat berat di jalan Kota Sanggau. “Surat Bupati menginstruksikan agar H-3 sudah tidak ada Abang Syafarudin lagi kegiatan alat berat untuk pemeliharaan dan pelebaran jalan sampai dengan selesai cuti bersama dalam kegiatan pemeliharaan jalan kota,” ujarnya. Menurutnya, ada beberapa jalur jalan yang jadi prioritas pemeliharaan di dalam Kota Sanggau.Lima ruas jalan yang dikerjakan Ke Halaman 23 kolom 1

Mobil Boks Terbakar SINGKAWANG- Mobil boks bernopol KB 9783 CF milik warga Gang Nagasari Rt59 RW I Singkawang, sekitar pukul 12.30 Wib (siang hari) mesinnya terbakar. Percikan api sempat membesar hingga membuat panik pemilik, beberapa mobil pemadam kebakaran pun sempat berdatangan mendengar informasi tersebut. Anak pemilik Mobil, Cantona mengatakan mobil boks tersebut awalnya di parkir di garasi dekat dengan rumahnya. Pada saat itu, karena mobil truk datang, mobil boks tersebut harus dirapikan agar keduanya bisa diparkir. Namun si sopir ini (awalnya mengendarai truk yang baru datang) tidak tahu bahwa penyaring minyak di mobil boks Ke Halaman 23 kolom 1

TERBAKAR: Truk miniboks terbakar di bagian mesin.


Rp25 Miliar untuk Dry Port SANGGAU-Bupati Sanggau, H. Setiman H. Sudin mengatakan pada September 2012 akan dilakukan peletakan batu pertama pembangunan Dry Port di Entikong. Pelatakan batu pertama tersebut bertepatan dengan ulang tahun BNPP. Dikatakannya, Dry Port tersebut direncanakan dibangun selama satu tahun dengan anggaran Rp. 25 Miliar yang berasal dari pihak swasta dengan luas 16 hektar. Namun, kemungkinan luas tersebut masih bisa bertambah lagi. “Sebenarnya Dry Port itu tidak begitu berat. Sekarang kan sudah gunakan kontainer-kontainer, jadi tidak perlu gunakan gudang yang tertutup. Cuma prosedurnya harus dipagar keliling dan yang keluar masuk pun dibatasi. Hanya orang tertentu saja. Sehingga tidak terjadi penyusupan,” jelasnya. Setiman menjelaskan Dry Port tersebut akan digunakan untuk kebutuhan ekspor atau impor barang seperti gula yang legal. Sehingga gula-gula seperti dari Malaysia tidak ada masalah lagi. “Jika kita mengekspor barang, itu akan di

Wakil Bupati Serahkan Bantuan Alat ke Kelompok Tani

Harap Mampu Dorong Kemajuan Peternakan Masyarakat

SUTAMI, Sintang


Ke Halaman 23 kolom 1

Ke Halaman 23 kolom 1

Potensi peternakan Sintang diyakini sangat besar. Hanya saja belum tergali secara maksimal. Kedepan pertumbuhan peternakan diharapkan bisa tumbuh 60 hingga 70 persen

TAK MENINGKAT: Jumlah penumpang pesawat dari Sintang tak mengalami lonjakan di musim mudik seperti sekarang.

KETAPANG – Sakino, 22 tahun seorang pedagang sayur, ditemukan tewas, Minggu (12/8) sekitar pukul 10.00 di sebuah pondok di dusun Pematang Gadong, Kecamatan Matan Hilir Selatan (MHS). Menurut Kasat Reskrim Polres Ketapang, AKP Andi Oddang Riuh, SIK, mengatakan saat ditemukan kondisi tubuh korban terlentang dengan leher terjerat tali yang Andi Oddang Riuh diikatkan di salah satu tiang pondok. Terdapat luka lembam di dada korban serta luka tusuk di leher yang tembus hingga ke tengkuk. Kasat menduga leher korban ditusuk dengan obeng. “Karena lukanya tidak begitu besar. Tapi tembus hingga ke belakang leher,” terangnya. Kasat mengatakan tak jauh dari pondok itu, ditemukan sandal, topi, botol minuman energi yang diduga milik korban. Melihat kondisi yang ada, kuat dugaan korban sempat melawan

WAKIL Bupati Sintang Ignasius Juan menaruh harapan besar kepada dunia peternakan. Peningkatan produksinya akan terus dipacu. Pemberian bantuan dan kemudahan kepada peternak juga intens diprogramkan pemerintah. Pencapaian yang diinginkan adalah minimal mampu menutupi kebutuhan daging di Kabupaten Sintang. Impian Wakil Bupati bukan tanpa alasan. Pasalnya kebutuhan daging di Sin-


NAIK TOSA: Wakil Bupati Sintang Ignasius Juan naik Tosa. Kendaraan petani itu diharapkan mampu menjadi sarana pendongkrak kemajuan peternakan di Sintang.





tang selama ini masih harus dipasok dari luar daerah. Produksi lokal masih belum mampu memenuhi permintaan masyarakat. Tanda demikian sebetulnya merupakan potensi besar yang harus digali dan dikembangkan secara masif. “Potensi luar biasa. Pemerintah daerah selalu mengupayakan pengembangan peternakan,” kata Wakil Bupati. Bertempat di pendopo kediamannya, Wakil Bupati bertemu dengan kelompok petani ternak yang ada di Sintang, kemarin (13/8). Pertemuan tersebut dimanfaatkan untuk membicarakan soal peternakan. Pembicaraan sepenuhnya menyangkut kendala dan peluang yang dihadapi para peternak. Banyak masalah sebetulnya yang dirasakan peternak. Salah satunya adalah kendala di lapangan, untuk angkutan pakan ternak. Maka satu unit sepeda motor puso dan seperangkat alat peternakan langsung diserahkan Wakil Bupati kepada peternak. Alat tersebut Ke Halaman 23 kolom 1



Pontianak Post

Selasa 14 Agustus 2012

PELAJAR Terima Santunan KELUARGA besar SMP Negeri 2 Ngabang, khusus dewan guru, staf Tata Usaha dan para pelajar, Sabtu (11/8) menggelar kegiatan buka puasa bersama bertempat di lapangan SMPN 2 Ngabang. Sebelumnya, digelar juga siraman rohani yang disampaikan Ustadz Robi Setiawan. Menurut Kepsek SMPN 2 Ngabang, Mariyani mengatakan, selain dilaksanakan kegiatan buka puasa bersama dan penyampaian tausiyah, dihari itu juga dilaksanakan kegiatan tadarus Al Quran. “Pada kegiatan tadarus Al Quran ini, para siswa kita bagi perkelompok. Setiap kelompok kita minta untuk mengkhatamkan Al Quran 30 juz. Tadarus inipun dibimbing oleh guru agama Islam dan pembina kesiswaan,” ujarnya. Pada kesempatan itu juga, Mariyani memberikan santunan kepada 9 orang pelajar SMPN 2 Ngabang yang yatim piatu. Santunan berupa uang tersebut merupakan dari gaji Mariyani sendiri. “Saya berharap kepada peserta didik yang menerima santunan ini bisa memanfaatkan uang tersebut dengan sebaik-baiknya, terutama dalam memenuhi kebutuhan lebaran. Sayapun meminta supaya santunan ini jangan dilihat dari besar kecilnya jumlah santunan,” pintanya. (wan)

GOTONGROYONG Sudah Langka BUPATIKabupaten Landak Adrianus Asia Sidot, Jumat (10/8) mencanangkan bulan bhakti gotong royong masyarakat tingkat Kabupaten Landak bertempat di Desa Ringo Lojok Kecamatan Banyuke Hulu. Adapun tema bulan bhakti gotong royong masyarakat tersebut, melalui bulan bhakti gotong royong masyarakat, kita tingkatkan semangat persatuan dan kesatuan serta partisipasi masyarakat menuju kemandirian bangsa. Dalam arahannya, Bupati mengatakan, dari tema tersebut, pelaksanaan bulan bhakti gotong royong masyarakat merupakan upaya untuk lebih menggelorakan semangat gotong royong dan peran aktif masyarakat dalam pembangunan. “Namun, sejujurnya saya katakan dan merasakan melihat bahwa semangat gotong royong masyarakat kita di Landak ini sudah merupakan barang langka yang hampir punah,” ungkap Bupati. Oleh karena itu, setelah pencanangan bulan bhakti gotong royong masyarakat tersebut, ia berharap kepada setiap Camat untuk meneruskan pencanangannya disetiap Kecamatan dan Desa. “Saya berharap kegiatan ini jangan hanya dilaksanakan sebagai kegiatan seremonial belaka. Tetapi bagaimana kegiatan ini dikemas sedemikian rupa, sehingga bermanfaat bagi masyarakat,” ujarnya, seraya meminta kepada masyarakat supaya jangan hanya jadi penonton dalam kegiatan bulan bhakti gotong royong masyarakat ini. “Mari kembali kita bersama-sama dengan Pemerintah, pengusaha dan lembaga kemasyarakatan yang ada untuk kembali mewujudkan perkembangan semangat gotong royong kita yang sudag pudar terkikis oleh perkembangan zaman,” ajak Bupati. (wan/humas)

PARKIR: Pegawai dari Dishub Mempawah menertibkan masalah perparkiran di pasar Mempawah. Semakin dekatnya lebaran, pasar semakin ramai.


Lebaran Listrik Aman MEMPAWAH- Pihak Perusahaan Listrik Negara (PLN) Wilayah Kalbar, khususnya area kantor PLN Mempawah mengaku bersyukur, lantaran janji Jenderal Manager (JM) yang berharap selama Ramadan hingga lebaran aman kondisi aman seertinya bakalan terjadi. Padahal, sebelum ramadan tiba tidak sedikit harapan, keinginan konsumen khusnya dan masyarakat umumnya yang mengharapkan selama Ramadan tidak mengalami gangguan. “JM menekankan kebawa perang yang ada agar maksimal memberikan pelayanan. Jaga sekecil apapun yang namanya gangguan untuk cepat diatasi. Usahakan, selama rama-

dan tidak terjadi gangguan byerpet, terlebih menjelang maghrib hingga sholat tarawih,” terang Donny ST, Kepala PLN Ranting Mempawah. Dikatakan Donny, pelayann listrik itu haruslah satu atap. Halnya mengatasi semua persoalan juga harus satu sumber yang boleh menjelaskan. “Kami berpegang teguh kepada harapan JM, kondisi yang baik itu uterus dipertahankan,” sebutntya. Selain itu lsitrik itu kan pelayanan dalam bentuk jaringan yang dinikmati konsumen dalam bentuk penerangan dan untuk kebutuhan lainnya. Mengharapkan pelayanan saja baik, masyarakat konsumen tidak memberikan

Tambah 1 Unit Mesin PLTD NGABANG-PT. PLN (Persero) Ranting Ngabang, Senin (13/8) mendatangkan satu unit mesin Pembangkit Listrik Tenaga Diesel (PLTD) yang didatangkan dari Jakarta. Mesin PLTD yang didatangkan tersebut akan ditempatkan di PLTD Plasma II Ngabang. Menurut manajer PT. PLN (Persero) Ranting Ngabang, Urbanus mengatakan, penambahan mesin baru ini bertujuan untuk menambah daya kekuatan listrik yang ada sekarang ini. “Untuk saat ini para pekerja tengah bekerja siang dan malam guna menempatkan mesin PLTD yang baru itu ditempat semestinya. Kita berharap Kamis (16/8) pekerjaan itu bisa selesai. Bahkan, kalau dimungkinkan Rabu (15/8) bisa selesai. Sebab kita akan mengejar hari raya Idul

Fitri,” ujar Urbanus, Senin (13/8) di PLTD Plasma II Ngabang. Dijelaskannya, dengan adanya penambahan satu unit mesin PLTD baru yang berkekuatan 1 mega lebih, total kekuatan listrik yang ada saat ini sebesar 6,5 mega. “Dengan demikian kita akan menjamin listrik di Landak ini normal jika mesin yang ada tidak rusak. Makanya kami tetap berusaha untuk merawat kondisi mesin PLTD yang ada sekarang ini,” katanya. Hanya saja sambung Urbanus, jika terjadi gangguan alam, PLN tidak akan menjamin apakah listrik tetap hidup atau padam total. “Kita tidak bisa mengelak dengan terjadinya gangguan alam ini. Apalagi di Landak ini pengaruh alam masih banyak mengganggu keadaan listrik. Kalau ada pohon tumbang atau kabel yang terkena ranting, kemungkinan besar listrik akan padam,” jelasnya. (wan)

dukungan. Tentu harapan itu tidak bisa berjalan mulus. Jika ada pepohonan tanam tumbuh yang mengenai jaringan listrik harus ditebang atau dipangkas. Si pemilik pohon harus merelakan demi kebersamaan. “Itu salah satu contoh kecil dari kondisi yang acap kali terjadi salama ini,” cerita Dony. Pelayanan untuk Kabupaten Mempawah dan beberapa area sekitarnya dari pelayanan GI Senggiring. “Saat ini masuk lagi mesin berkekuatan 10 Mega sama dengan 10.000 kw. Penambah untuk mencukupi jika ada gangguan terjadi. Pelayanan jaringa

listrik di Kabupaten Mempawah dan sekitarnya dari Senggiring satu arah Sui Kunyit. Senggiring empat arah Pinyuh dan sekitarnya. Pelayanan area Mempawah meliputih Menjalin, Karangan, hingga Darit serta pelayanan jalan arah Mandor. Menurut Donni ST, yang namnya pelayanan selalau melayani 24 jam. Hanya dengan rumah sakit. Tentu suatu ketika nanti kondisi jaringan listrik semakin membaik. “Semoga ganguan-gangua yang terjadi semakin berkurnag jumlahnya,” harapnya. Yang pasti, JM memastikan hingga lebaran listrik aman.(ham)

Waspadai 4 Kawasan Rawan KAPOLRESLandakAKBP Hotma Victor Sihombing mengingatkan kepada para pemudik yang menggunakan jalan darat untuk mewaspadai sejumlah kawasan yang rawan banjir dan longsor. Hal ini bertujuan demi keamanan dan kenyamanan para pemudik dalam rangka perayaan hari raya Idul Fitri. Menurut Kapolres, kawasan-kawasan rawan tersebut yakni Desa Tembawang Bale Kecamatan Menyuke yang rawan banjir. “Kemudian, kawasan rawan banjir juga ada di pasar Darit Kecamatan Menyuke, pasar Menja-

lin Kecamatan Menjalin, pasar Sebadu Kecamatan Mandor, pasar Senakin Kecamatan Sengah Temila dan tanah longsor dikawasan Gunung Sehaq,” jelas Kapolres pekan lalu di kantornya. Selain mewaspadai daerah-daerah rawan tersebut, Kapolres juga meminta kepada para pengguna jalan raya supaya bisa mematuhi segala peraturan lalulintas. “Kalau pengendara merasa letih atau ngantuk, bisa beristirahat sejenak. Lagipula kita sudah menempatkan 4 pos pengamanan yakni di depan Citra Swalayan Ngabang, di pasir panjang

Mandor, kawasan Gunung Sehaq dan di Karangan dekat Polsek Mempawah Hulu,” ujarnya. Tidak hanya itu saja, para pemudik lebaran juga dimintakan Kapolres supaya bisa mengamankan rumahnya. Artinya, jika hendak mudik, setidak-tidaknya rumah tersebut bisa dititip ke tetangganya. “Jangan biarkan rumah dalam kondisi yang rawan pencuri. Sebelum mudik, sebaiknya cek kembali apakah pintu dan jendela sudah dikunci. Kemudian, apakah aliran listrik sudah dicabut. Ini untuk menghindari dari bahaya kebakaran,” katanya. (wan)

PPK Sosialisasi ke Sekolah NGABANG - Kegiatan sosialisasi yang dilakukan terhadap pemilih pemula adalah merupakan tahapan dalam kegiatan KPU yang di lakukan oleh Panitia Pemilihan Kecamatan (PPK ) di seluruh kecamatan yang ada di Kalbar. Khusus di Kecamatan Ngabang Kabupaten Landak, Jongki, Ketua PPK Kecamatan Ngabang mengatakan tahapan sosialisasi terhadap pemilih pemula yang dilakukan disekolah -sekolah khususnya di tingkat SMA dan SMK sudah di laksanakan dari tanggal 10-11 Agustus. “Ini merupakan tahapan -tahapan kegiatan dalam pemilihan Gubenur dan wakil gubenur Kalbar 2012 yang mana sosialisasi kepada pemilih pemula yang kuta lakukan di sekolah

yakni di SMA dan SMK yang ada di kota Ngabang, “ ujarnya. Dikatakannya, adapun kegiatan yang di lakasanakan pada tanggal 10 agustus lalu diikuti oleh SMA dan SMK Maniamas, SMAN 1,MAN Ngabang, SMA Pelita,SMKN 1 Ngabang, yang mana setiap sekolah mengirimkan masing -masing 10 peserta sedangkan pada tanggal 11 Agustus kegiatan dilaksanakan di gedung Swadaya Ngabang yang di ikuti oleh SMAN 2 Ngabang dan SMA Makedonia bertempat di SMAN 2 Ngabang dengan jumlah keseluruhan peserta 130 peserta. Adapun tujuan kegiatan ini tidak lain adalah untuk mensosialisasikan UU pemilu dan peraturan KPU tentang tahapan pemilukada gubenur dan wakil gubenur Kalbar tahun 2012. Dengan demikian melalui kegiatan ini juga sekaligus memberikan bimbinga kepada para pemilih pemula yang notabene masih berada pada usia sekolah khususnya tingkat SMA dan SMK.(wan)

Pontianak Post


Selasa 14 Agustus 2012



Arus Mudik Naik

17 Kelompok SEBANYAK 17 kelompok perikanan se Kota Singkawang terdiri dari kelompok penangkapan, pengolahan, pemasar dan budidaya ikan dikukuhkan pemerintah. Sebelumnya, kegiatan verifikasi data dan penilaian kelompok telah dilakukan. “Kegiatan pengukuhan didahului proses verifikasi data dan penilaian kelompok. Selanjutnya diusulkan untuk dikukuhkan sebagai kelompok perikanan,” kata salah satu panitia pengukuhan yang juga merupakan Penyuluh Perikanan Kota Singkawang, Ary Ariefin, Senin (13/8). Dikatakan Ary, kelompok - kelompok perikanan yang sudah dikukuhkan merupakan kelompok yang betul-betul terjamin keberadaan dan kebenaran nya. Bukan merupakan kelompok yang dibentuk tibatiba dengan anggota yang tidak jelas dan hanya ada pada saat akan datang program bantuan pemerintah kemudian selanjutnya bubar. “Semua kelompok perikanan ini masih dalam tingkatan kelas Pemula, belum termasuk dalam tingkatan kelas Madya atau Utama. Di tingkat Pemula, piagam pengukuhan ditanda tangani Lurah di Kelurahan tempat kelompok tersebut, Kalau Madya dan Utama yang mengukuhkan dan menandatangani piagam nya adalah Camat dan Walikota,” katanya. Kegiatan Pengukuhan Kelompok Perikanan Se-Kota Singkawang yang dilaksanakan Kantor Penyuluh Pertanian, Perikanan, Kehutanan dan Ketahanan Pangan Kota Singkawang. dihadiri perwakilan Badan Penyuluhan Provinsi Kalimantan Barat, dan para Lurah.(fah)


TES KESEHATAN: Mendekati lebaran, para sopir diharuskan untuk melakukan tes kesehatan gratis di Singkawang. Tujuannya agar mampu membawa penumpang ke tempat tujuan dengan selamat.

Minta THR, Nama Kapolres Dicatut SINGKAWANG- Ada-ada saja akal orang untuk mendapatkan Tunjangan Hari Raya (THR). Nama pejabat, khususnya dari kepolisian pun dilibatkan untuk melicinkan aksinya. Kapolres Singkawang, AKBP Prianto mengatakan baru-baru ini telah ada laporan dari warga mengenai adanya orang yang datang ke rumahnya, mengatasnamakan Kapolres Singkawang dengan maksud meminta Tunjangan Hari Raya kepada warga tersebut. “Warga tersebut didatangi ses-

eorang yang mengatasnakan Kapolres Singkawang untuk meminta sejumlah uang sebagai THR,” kata Kapolres Singkawang, AKBP Prianto, kepada wartawan. Atas kejadian tersebut, AKBP Prianto langsung menyampaikan dan menjelaskan kepada warga yang bersangkutan mengenai aksi penipuan tersebut, Dirinya menegaskan tidak akan pernah Kapolres berbuat demikian. “Baik itu perintah langsung atau

tidak, kita tidak akan memerintah anggota untuk meminta THR, dan itu tidak akan pernah,” katanya. Prianto mengimbau, masyarakat terutama para pengusaha yang sering dijadikan sasaran dari aksi penipuan tersebut. Selalu waspada jika ada orang yang melakukan aksi ini, dan bisa saja mengkroscek ke pejabat yang bersangkutan untuk kebenaran nya. “Masyarakat bisa melaporkan kejadian itu ke Mapolres untuk ditindaklanjuti,” katanya.(fah)

Lagu Singkawang Diluncurkan

Ingin Terkenal Seperti Jogya

Singkawang, Sebuah Harmoni Di pantai putih, di pesisir Nusantara Kujejak pasir dan memandang laut Natuna Terbentang gunung melingkari datarannya Singkawang kota sejarah bersama Demikian lirik lagu “Singkawang Sebuah Harmoni” hasil karya ciptaan Katon Bagaskara, musisi dan penyanyi yang karyakaryanya banyak dikenal penikmat musik Indonesia, serta mempunyai perhatian besar terhadap kebudayaan Indonesia. Melalui salah satu putra daerah setempat, Lio Kurniawan, lagu ini dipersembahkan Katon bagi masyarakat Kota Singkawang dan juga bagi masyarakat Indonesia pada umumnya.

Lagu ini menceritakan keindahan alam Kota Singkawang dan pluralisme kehidupan masyarakat setempat dengan beragam latarbelakangnya dan merupakan ungkapan nadanada sarat cinta kasih yang hadir dari getaran-getaran jiwa yang tumbuh timbul karena kesederhanaan, kelembutan, keramahan serta rasa hormat yang tinggi masyarakatnya terhadap alam, tradisi dan keragaman.Ide awal terciptanya lagu ini dimulai dari perbincangan dengan beberapa putra daerah yang mempunyai pandangan dan pemikiran yang sama terhadap pluralisme dan kebudayaan Indonesia, yang sedianya dipublikasikan dalam perayaan festival Cap Go Meh Singkawang dalam konteks kebudayaan diawal tahun 2012 lalu.

Katon Bagaskara bahkan menyempatkan diri berkunjung ke Singkawang. Begitu menginjakkan kaki di bumi Kota Seribu Kelenteng, Katon Bagaskara merasa tertarik dengan suasana kehidupan setempat yang khas. Dari situ timbul adanya ikatan bathin yang kuat sehingga Katon Bagaskara berniat untuk menciptakan lagu ini. Di selasela kunjungan, Katon Bagaskara juga berbagi waktu berkumpul bersama masyarakat setempat di Rumah Tua Hiap Sin dengan penuh keakraban. Masyarakat setempat sangat senang dan merasa terhibur dengan kunjungan tersebut dan sangat berterima kasih atas apresiasi Katon Bagaskara yang luar biasa untuk Kota Singkawang, mengingat ini adalah lagu kedua yang khusus diciptakan Katon


PERJANJIAN: Teken perjanjian dari lagu Singkawang Sebuah Harmoni.

Bagaskara untuk suatu daerah dengan judul dan tema kota setempat setelah “Yogyakarta” yang sudah terkenal dan akrab dengan telinga insan seantero bumi pertiwi Indonesia. Ahad, 12 Agustus 2012, “Singkawang Sebuah Harmoni” disiarkan secara resmi melalui stasiun

radio daerah . “Saya mewakili masyarakat Kota Singkawang menyampaikan terima kasih yang setulus-tulusnya dan apresiasi yang setinggi-tingginya atas kebesaran hati dan kepedulian yang luar biasa dari mas Katon untuk Kota Singkawang yang disampaikan melalui lagu ini.” (*)

SINGKAWANG- Jelang lebaran yang tinggal beberapa hari, arus mudik di angkutan umum dalam kota di Singkawang sudah terlihat. Bahkan kejadian adanya peningkatan jumlah penumpang terjadi sejak satu minggu lalu. Hal tersebut diakui salah satu sopir angkutan kota Singkawang – Lirang, Iwan. Dirinya mengaku telah terjadi kenaikan jumlah penumpang, tapi tidak signifikan. Hanya saja, setiap hari dirinya harus Pulang Pergi (PP) rata- rata empat kali. “Kalau dilihat jumlahnya sih ndak tentu berapa kenaikan penumpang, tapi empat kali PP dalam sehari itu mobil angkot saya selalu full,” kata Iwan, kepada wartawan, Senin (13/8) ditemui di Terminal Pasiran Kota Singkawang. Namun kondisi berbalik, yakni tidak terjadi lonjakan atau malah jumlah penumpang menurun dirasakan bus jurusan Singkawang- Pontianak. Bahkan hal tersebut bukanlah kali pertama, tapi sudah memasuki tahun ke empat sepinya penumpang di saat jelang lebaran. “Tidak ada peningkatan, penurunan malah ada meskipun jelang lebaran,” kata salah satu sopir bus jurusan Singkawang-Pontianak, Sugeng. Dikatakan Sugeng, penurunan tersebut dikarenakan beberapa faktor, diantaranya banyaknya pemilik kendaraan bermotor sekarang ini dibandingkan empat tahun lalu. Kemudian banyaknya angkutan umum jenis lainnya yang beroperasi mengangkut penumpang juga menyebabkan penurunan omset sopir bus. “Kemudian penyebab lainnya ada kekhawatiran para penumpang jika bus jurusan Pontianak – Singkawang turun di Terminal Batulayang, itu dikarenakan banyaknya aksi kriminalitas ditempat tersebut,” kata Sugeng. Baik Iwan maupun Sugeng yang bekerja sebagai sopir, berusaha sebaik-baiknya membawa penumpang hingga tempat tujuan. Kedua sopir bersama beberapa pengemudi lainnya yang berada di Terminal Pasiran

Kota Singkawang, bersedia mengikuti tes kesehatan yang dilaksanakan pihak Jasa Raharja dan Kepolisian, termasuk tes urine. Kepala Perwakilan Jasa Raharja Singkawang Muhammad Noor mengatakan bersama pihak kepolisian dalam hal ini Dokkes Polres Singkawang dan menggandeng Dishubkominfo melaksanakan tes kesehatan kepada para sopir. Ini sebagai bentuk upaya memberikan rasa aman dan nyaman kepada para penumpang saat melaksanakan mudik lebaran. “Kondisi sopir yang fit, sangat menentukan keselamatan dari kendaraan yang membawa orang banyak ini,” kata M Noor, ketika turun langsung dalam kegiatan tes kesehatan yang dilaksanakan di Terminal Pasiran, Senin (13/8). Tes kesehatan semacam ini, lanjut Noor, dilaksanakan selama satu minggu (12-18 Agustus 2012) di dua tempat yakni di Pasiran serta di Sui Duri Kabupaten Bengkayang, bekerja sama dengan Puskesmas (Dinas Kesehatan Kabupaten Bengkayang). “Kita juga memberikan pelayanan kepada para calon penumpang, jika memang ditemukan sakit akan diberikan pelayanan, namun kalau tidak bisa kita rujuk langsung ke Rumah Sakit terdekat,” katanya. Ditambahkan Noor, demi menciptakan keselamatan transportasi, khususnya angkutan kota di Kota Singkawang. Para sopir diharap beristirahat jika kondisi mengantuk, dan tidak membawa (menyopir) angkot jika kondisi badan tidak memungkinkan. “Kalau terjadi hal yang tidak kita inginkan, kecelakaan misalnya karena sopir mengantuk. Yang rugi bukan sopir saja, tapi seluruh jiwa dan keluarga penumpang akan berduka,” katanya. (fah)



MAKNA lailatul Qadar ( Abd Rahman, 2009:48) adalah, pertama:“Qadar” penetapan pengaturan (QS.Ad-Dukhan 44:3-5). Malam lailatul Qadar merupakan malam penetapan Allah bagi perjalanan hidup manusia (Khittah). Kedua, “Qadar” berarti kemuliaan (QS Al-An`am 6:91). Malam Lailatul Qadar merupakan malam yang dimuliakan tiada banding karena terpilih sebagai malam diturunkannya Al-Qur`an dan amal-amal dilipatgandakan. Ketiga, “Qadar” berarti sempit (QS Ar-Ra`d 13:26), malam Lailatul Qadar merupakan malam yang sempit karena pada saat itu banyak malaikat yang turun ke bumi (QS Al-Qadar 97:4) (lihat M.Quraish Shihab, 2000:536). Amalan-amalan yang dapat dilakukan dalam menyambut Lailatul Qadar diantaranya: 1). Lebih bersungguh-sungguh beribadah, siang, dan malam. 2). Aktivitas apapun yang Nuraini dilakukan selama demi karena Allah, maka ia merupakan ibadah. Bantulah yang butuh, bacalah yang bermanfaat, dan bekerjalah dengan tekun. Ciptakan kedamaian dengan Allah, dengan berzikir, dengan diri beristighfar, dengan sesama lewat sikap yang baik. Lailatul Qadar penuh kedamaian dan insya Allah mampir kepada yang hidup damai, walaupun sedang mengalami haid atau uzur (M Quraish Shihab, 20012:131). 3). Melakukan i`tikaf terutama sepuluh malam terakhir bulan Ramadhan. sebagaimana sabda Rasulullah saw yang artinya “ Carilah lailatul Qadar pada malam ganjil dari sepuluh malam terakhir bulan Ramadhan”.(HR.Bukhari). 4). Melakukan Qiyamul Lail, seiring dengan sabda Nabi saw yang artinya “ Barang siapa yang beribadah pada malam Lailatul Qadar karena iman dan mengharap pahala, niscaya diampuni dosa-dosanya yang telah lalu”. (HR. Syaikhan dari Abu Hurairah ra). 5). Berzikir dan membaca Al-Qur`an. 6). Memperbanyak do`a. Doa tersebut adalah “ Allahumma innaka `afuwwun tuhibbul `afwa fa`fu`anna” yang artinya “ ya Allah, sesungguhnya Engkau maha pemaaf dan memaafkan, maka maafkanlah aku”. (HR. Ahmad, Ibnu Majah, dan Tirmidzi dari Aisyah ra). Berharap kepada Allah SWT untuk selalu memudahkan langkah dan niat kebaikan kita sehingga kita mampu meraih kemuliaan Lailatul Qadar. Amiin. Allahu `a`lam. (Nuraini, guru MIN Sekuduk)


BBM Dijamin Aman MENTERI ESDM Jero Wacik memastikan pasokan BBM selama arus mudik, lebaran dan arus balik, aman. Stok BBM di seluruh Indonesia secara bervariasi cukup mengatasi kebutuhan masyarakat. Untuk Premium, stok mencukupi untuk 17 hari ke depan. Kerosen, untuk 75 hari. Solar untuk 18 hari. Pertamax untuk 67 hari. Pertamax plus untuk 65 hari. Avtur untuk 19 hari. LPG kebutuhan rumah tangga cukup untuk 17,.5 hari. Begitu pula dengan pasokan listrik, dipastikan mampu menahan beban puncak hingga 19 ribu MW. “Jadi kesiapan BBM dan listrik saya rasa sudah cukup siap,” kata Jero di Kantor Presiden, Senin (13/8). Untuk distribusi, khusus truk pengangkut BBM masih boleh lewat di H-1. Karena ada peraturan truk tidak boleh melewati jalan utama mulai H-4, namun Pertamina sudah mengantisipasinya sejak jauh hari. Distribusi BBM paling besar terjadi di Pulau Jawa, Kalimantan dan Bali. Sementara itu untuk antisipasi bencana geologi, Kementrian ESDM telah mengirimkan surat edaran ke seluruh Bupati dan Walikota mengenai titik rawan gempa bumi. (afz/jpnn)

Selasa 14 Agustus 2012

Jelang Idulfitri, Bupati Tinjau Pasar


Menyambut Lailatul Qadar

Pontianak Post

Harga Ayam Bersih Rp38 Ribu Perkilogram


BERDIALOG: Bupati Sambas Juliarti Djuhardi Alwi berdialog dengan salah seorang pedagang ayam, dalam sidak bersama sejumlah instansi di Pasar Sambas, kemarin (13/8).

SAMBAS – Bupati Sambas Juliarti Djuhardi Alwi, Senin (13/8), bersama Dinas Koperasi, UMKM, Industri, dan Perdagangan (Diskumindag); Dinas Pertanian dan Peternakan (Distanak), Dinas Kesehatan (Dinkes), Dinas Perhubungan (Dishub), dan Pol PP melaksanakan inspeksi mendadak (sidak) sembako di Pasar Sambas. Saat sidak, Bupati sempat melakukan dialog langsung

bersama pedagang yang dihampirinya. Salah satunya Benyamin, seorang pedagang ayam. Dalam dialog tersebut, Bupati menanyakan langsung berapa harga ayam perkilogramnya, termasuk juga jumlah kenaikan dan keluhan yang dirasakan para pedagang, serta darimana mereka mendatangkan stok ayam ke pasar tersebut. Menjawab pertanyaan Bu-

pati, Budi, pedagang lainya yang ditanya mengatakan, “Harga ayam sementara, bersih perkilonya Rp38 ribu, sedangkan ayam utuh yang masih belum dibersihkan Rp35 ribu. Kalau untuk stok ayam kita masih menggunakan stok Sambas. Tidak seperti tahun sebelumnya, kita mengonsumsi ayam dari Kota Singkawang, kadang juga dari Anjungan. Sekarang ini untuk stok ayam tidak masalah,

dalam sehari kita bisa menjual sekitar 50 ekor ke atas hingga 100 ekor ke atas. Yang dikhawatirkan menjelang hari besar, kebutuhan stok ayam akan meningkat,” papar Benyamin panjang lebar. Dijelaskan dia, pada bulan Ramadan seperti sekarang ini, peminat daging ayam semakin ramai dan jumlahnya terus bertambah. Sedangkan untuk harga, menurut dia, masih belum mengalami perubahan. Untungnya, dia menambahkan, peternak ayam daerah semakin meningkat, sehingga stok ayam masih terpenuhi. “Kami berharap kepada instansi terkait dapat melakukan pemantauan ternak ayam, sehingga ayam selalu dalam kondisi baik dan terus berkembang untuk memenuhi kebutuhan masyarakat, terutama lebaran,” jelasnya. Menyikapi ini, Bupati meminta para pedagang agar tidak menghawatir masalah pasokan barang dan pemantauan ternak ayam. Pasalnya Pemkab Sambas sudah melakukan antisipasi, agar ternak ayam dalam kondisi baik. Namun yang terpenting, menurut dia, para pedagang jangan menaikkan harga barang karena kesempatan dan tidak melakukan penimbunan barang. “Upayakanlah dapat menghargai sesama, sehingga masyarakat mudah mencari kebutuhan yang diperlukan-

nya,” imbaunya. Di tempat yang sama, kadis Kumindag, Uray Tajuddin, menjelaskan bahwa sidak yang dilakukan tersebut untuk mengontrol kenaikan harga barang, serta melihat persiapan kebutuhan sembako, menghadapi Idulfitri 1433 H. “Harga ayam bersih perkilonya Rp38 ribu, ayam utuh Rp35 ribu, sedangkan harga telur ayam perkilonya Rp22 ribu,” jelasnya. Menurutnya, sidak dilakukan agar konsumen merasa aman belanja di pasar, harga barang tetap stabil, dan kebutuhan pokok yang dicari tetap ada, sehingga tidak terjadi penimbunan ataupun peredaran barang-barang kadaluarsa di Kabupaten Sambas. “Dalam sidak tersebut, kita akan berdialog dengan pemilik toko, apa keluhannya dan jenis barang-barang apa saja yang naik? sehingga kita bisa mengantisipasi dan segera mengusulkannya,” ujarnya Mantan Kadispenda Kabupaten Sambas ini berharap sidak yang dilakukan tersebut dapat membantu konsumen memenuhi kebutuhan pokok menjelang lebaran. “Kepada pedagang yang telah membuat berita acara, tidak akan menjual barang-barang kadaluarsa agar mentaatinya, sehingga konsumen merasa aman dalam berbelanja. Dengan adanya kerjasama ini, diharapkan dapat membantu masyarakat,” pungkasnya. (har)

Warga Tionghoa Pasang Bendera Merah Putih dan Ketupat SAMBAS – Dalam rangka meningkatkan kerukunan dan keharmonisan antaretnis dan antarumat beragama di Kabupaten Sambas, dalam memperingati Hari Ulang Tahun (HUT) ke-67 RI dan Hari Raya Idulfitri 1433 H, Badan Pemadam Kebakaran (BPK) Sambas, yang terdiri dari warga Tionghoa, memasang miniatur Bendera Merah Putih dan ketupat di lokasi Pasar Sambas. “Sambas dikenal artinya dikalangan masyarakat Kabupaten Sambas dengan sebutan tiga suku bangsa, hal ini telah terjalin dengan baik

di Kabupaten Sambas. Agar hubungan antaretnis dan agama semakin baik, BPK Sambas dalam memperingati HUT RI dan Hari Raya Idulfitri bagi umat muslim, berinisiatif masang miniatur Bendera Merah Putih dan ketupat di pasar secara bersama-sama,” ungkap inisiator pemasangan ketupat dan Bendera Merah Putih, Yakob Pujana, kepada Pontianak Post, Minggu (12/8) di Sambas. Ditambahkannya, pengadaan dan pemasangan miniatur Bendera Merah Putih dan ketupat tersebut dilakukan secara swadaya, serta berkat bantuan pengusaha. Anggota BPK Sambas yang memasang secara bersamasama, menggunakan tangga mobil BPK, dan dukungan dari Bank Syariah Mandiri, Bank Mandiri, Bank Mega, serta Bank BCA Sambas. Terpisah, Bupati Sambas Juliarti Djuhardi Alwi usai kegiatan buka puasa bersama

Tim JPM se-Kabupaten Sambas, menilai bahwa partisipasi masyarakat Tionghoa yang tergabung dalam Yayasan BPK Sambas tersebut, sebagai hal yang harus disikapi dengan baik. Pasalnya, bagi kepala daerah, apa yang dilakukan mereka semata-mata untuk meningkatkan hubungan yang baik antar umat beragama. “Ini harus kita respon baik, sehingga hubungan keakraban dapat terjalin dengan baik,” ajak Bupati. Sementara itu, ketua Majelis Adat Budaya Melayu (MABM) Kabupaten Sambas, Burhanuddin A Rasyid, yang juga hadir pada acara buka puasa bersama JPM tersebut, merespon baik upaya BPK Sambas dalam memperingati HUT RI dan Idulfitri, dengan memasang miniatur Bendera Merah Putih serta ketupat. “Partisipasi seperti ini diharapkan dapat menin-


BENDERA DAN KETUPAT: Warga Tionghoa bersama BPK Sambas memasang miniatur Bendera Merah Putih dan ketupat di Komplek Pasar Sambas, dalam rangka menyongsong Hari 3URNODPDVLGDQPHQ\DPEXW,GXO¿WUL LQVHW <DFRE3XMDQD

gkatkan hubungan yang baik antaretnis dan agama, seperti apa yang kita harapkan, sehingga Kabupaten Sambas bisa menjadi contoh daerah lain

dalam membina kerukunan umat beragama yang cinta damai,” harap mantan Bupati Sambas dua periode tersebut. (har)


Pontianak Post Selasa 14 Agustus 2012


Bupati dan TP-PKK Kunjungi Ponpes dan Panti Asuhan


Inginkan Lapangan Sepakbola TINGGINYA animo masyarakat Kecamatan Kendawangan akan olahraga, khususnya sepakbola, membuat warga berinisiatif membuat lapangan sepakbola alternatif. Hal ini dilakukan mengingat Kecamatan Kendawangan sampai saat ini belum mempunyai lapangan sepakbola yang refresentatif, yang bukan saja untuk tempat olahraga jenis ini, akan tetapi bisa untuk tempat kegiatan dan hiburan lainnya. Seperti yang dilakukan Pusar, warga Kampung Sukun Desa Kendawangan Kiri, yang memprakarsai pembuatan lapangan sepakbola seluas 2,5 Ha di tanah miliknya, bersama tiga rekan lainnya, semata-mata untuk pengembangan dunia olahraga, khususnya sepakbola. “Kami bersama teman-teman membuat lapangan sepakbola beserta lapangan bolavoli yang cukup sederhana. Ini semata-mata untuk memajukan olahraga di Kecamatan Kendawangan, agar dapat mencari bibit-bibit muda berbakat, yang kelak bisa mengharumkan nama daerahnya, juga lapangan yang sedang dibangun ini diharapkan bisa menjadi ajang even pertandingan-pertandingan sepakbola maupun bolavoli, baik tingkat kecamatan maupun tingkat kabupaten,” ungkapnya panjang. Sementara itu, Andoriadi, ketua KONI Kecamatan Kendawangan, memberi apresiasi terhadap warga yang perduli dengan dunia olahraga. Karena diakuinya, selama ini Kecamatan Kendawangan belum mempunyai lapangan atau indoor khusus untuk olahraga. “Pemerintah Kabupaten Ketapang pernah merencanakan pembuatan indoor di jalan lingkar Desa Kendawangan Kiri seluas 7 hektar, bahkan tahap pembebasan lahan milik warga pun sudah diselesaikan pihak Pemda. Tinggal pelaksanaan pembangunan fisik indoor yang sampai saat ini belum ada terealisasi. Mudah-mudahan secepatnya Pemerintah Daerah Ketapang dapat segera merealisasikan karena indoor dinilai penting, baik untuk sarana olahraga, maupun untuk kegiatan lainnya, seperti upacara bendera 17 Agustus yang tiap tahun dilaksanakan di halaman Kantor Camat yang tempatnya dinilai sudah semakin sempit,” harapnya panjang. (ash)


Dua Kasat Berganti

Berbagi Kebahagiaan di Ramadan dan Menjelang Idulfitri KETAPANG – Untuk meningkatkan jalinan silaturahmi, kemarin (13/8) Bupati Ketapang, TP- PKK Kabupaten Ketapang, beserta rombongan, melakukan silaturahmi Ramadan ke sejumlah pondok pesantren dan panti asuhan dalam Kota Ketapang. Kunjungan itu juga merupakan salah satu bentuk kepdulian dan upaya peningkatan tali silaturrahmi antara Pemerintah Kabupaten (Pemkab) Ketapang beserta jajaran, dengan pondok pesantren dan panti asuhan. “Kedatangan kami untuk menjalin silarurrahmi, berbagi kasih antara Pemkab Ketapang dan pondok pesantren maupun panti asuhan,” ujar Bupati Ketapang Henrikus. Menurutnya, sebagai wujud kepedulian yang mendalam, Pemkab Ketapang juga menyerahkan sejumlah bantuan bagi pondok pesantren dan yayasan. Kendati jumlah bantuan yang di berikan tersebut tidak banyak, namun Bupati berharap paling tidak, diharapkan dapat meringankan pihak ponpes dan panti asuhan dalam merayakan Hari Raya Idulfitri 1433 H. “Manfaatkanlah bantuan ini dengan sebaik baiknya, mudah-muda-

han bantuan yang diberikan dapat meringankan beban anak-anak panti dan pondok pesantren pada Idulfitri ini,” pesan Henrikus. Memasuki hari ke-24 Ramdan, Henrikus berharap semoga di bulan suci umat muslim yang penuh rahmat dan maghfirah ini, masyarakat Ketapang, terutama yang menjalankan ibadah puasa, bisa selalu diberikan kekuatan, kesehatan, dan selalu mendapatkan bimbingan dari Allah SWT. “Mari kita berlomba-lombala dalam berbuat kebaikan untuk mencapai kebahagiaan hidup di dunia maupun di akhirat,” imbuhnya. Henrikus menjelaskan bahwa Pemkab Ketapang tetap komitmen dalam hal pembinaan umat beragama, yakni melalui bantuan yang diberikan. Seperti melalui bantuan program pemerintah maupun melalui aspirasi bupati. Bantuan untuk pembinaan umat beragama itu, diungkapkan dia, tentunya disesuaikan dengan anggaran yang tersedia dan sesuai skala prioritas. “Karena anggaran yang terbatas, harap dimaklumi, jadi tidak semua ponpes dan panti asuhan dapat bantuan. Kita upayakan bertahap dan men-


SILATURAHMI BUPATI: Bupati Ketapang Henrikus beserta rombongan, kemarin (13/8) saat melakukan kunjungan silaturahmi ke beberapa panti asuhan dan pondok pesantren yang ada di Ketapang.

dahulukan yang prioritas,” ungkap Bupati kembali. Di samping Pemkab Ketapang melalui Bupati yang menyerahkan bantuan ke ponpes dan panti asuhan, hari itu juga ketua TP-PKK Kabupaten Ketapang, Ny Riniwati Henrikus, juga tampak meny-

erahkan bingkisan untuk lima pondok pesantren dan panti asuhan. Masing-masing pondok pesantren dan panti asuhan tersebut seperti Nurul Iman Kelurahan Sukaharja, Al-Akbar Desa Kalinilam, Alhidayah Desa Sampit, Yatama Kelurahan Kauman, serta Dar-

ussalam Desa Mekar Sari. Mendapingi Bupati, hadir juga dalam kunjungan tersebut sekda Ketapang, Andi Djamirudin, para asisten, serta para kepala dinas, instansi terkait, dan juga para pengurus TP- PKK Kabupaten Ketapang. (ash/ser)

Mulai 30 Agustus, KPPS Segera Dibentuk ISTIMEWA

SERTIJAB: Kapolres AKBP I Wayan Sugiri menyalami para perwira yang melakukan sertijab mereka, Jumat (10/8).

PERGANTIAN perwira kembali terjadi di jajaran Polres Ketapang. Setelah serah terima jabatan Kasat Reskrim, Kasat Lantas, Kapolsek Sukadana, Kapolsek Delta Pawan, dan Kapolsek Sui Laur, Jumat (10/8) lalu, dilanjutkan dengan buka puasa bersama dan salat berjamaah di Masjid Nur Ilahi Komplek Mapolres. Sertijab perwira tersebut langsung dipimpin Kapolres Ketapang AKBP I Wayan Sugiri di Aula Mapolres Ketapang. Adapun perwira yang melakukan serah terima jabatan di antaranya AKP Sudarsono yang menyerahkan jabatan Kasat Reskrim yang sebelumnya diemban dia, kepada AKP Andi Hal serupa juga diOdang Riuh. lakukan AKP Efos Satria yang menyerahkan jabatan Kasat Lantas kepada AKP Anggu Dedy. Kapolres Ketapang menegaskan bahwa pergantian pewira di jajaran Polres tersebut bertujuan untuk meningkatkan pelayanan. Karena itu ia mengucapkan selamat bertugas kepada pejabat yang baru. Tak lupa ia juga mengucapkan terima kasih kepada pejabat lama yang telah dengan baik dalam memberikan pelayanan kepada masyarakat, serta mengucapkan selamat bertugas kepada pejabat lama di tempat yang baru. Harapan dia agar pelayanan kepolisian kepada masyarakat selalu ditingkatkan. Untuk itu, diingatkan dia mengenai pentingnya menjalin kemitraan secara terus menerus dengan masyarakat. (ads)

KETAPANG – Komisi Pemilihan Umum (KPU) Ketapang segera membentuk kelompok penyelenggara pemungutan suara (KPPS). Kasubbag Teknis Pemilu dan Hubungan Partisipasi Masyarakat Sekretariat KPU Ketapang, Jabidi Erwan, mengatakan bahwa pembentukan KPPS ini sesuai dengan jumlah tempat pemungutan suara (TPS). “KPPS yang akan dibentuk ini akan sama jumlahnya dengan TPS. Jumlahnya pada Pemilu Gubernur Kalimantan Barat sebanyak 1.066,” katanya. Ia menyebutkan untuk Kabupaten Ketapang, maka masyarakat yang terlibat menyukseskan Pemilu Gubernur dan Wakil Gubernur sebanyak

7.462 petugas. Karena, kata dia, kewenangan mengangkat satu TPS beranggotakan tujuh KPPS, namun mesti dilaporanggota KPPS. kan kepada KPU kabupaten/ “Sesuai dengan kota. Jabidi menUndang-Undang jelaskan bahwa Nomor 15 Tasyarat yang harus hun 2011 tentang dipenuhi untuk Penyelenggara menjadi anggota Pemilu, anggota KPPS yakni WNI, KPPS ini sebanberusia paling renyak tujuh orang, dah 25 tahun, setia terdiri dari satu kepada Pancasila orang ketua mersebagai dasar angkap anggota, negara dan UUD dan enam orang 1945, dan cita-cita lainnya meruProklamasi 17 pakan anggota. Agustus 1945. Jabidi Erwan Anggota KPPS di“Syarat lain yaitu angkat dan dibermempunyai integhentikan oleh PPS atas nama ritas, pribadi yang kuat, jujur ketua KPU kabupaten/kota,” dan adil, tidak menjadi anggota papar Jabidi. partai politik yang dinyatakan Menurutnya, PPS diberi dengan surat pernyataan yang

sah atau sekurang-kurangnya, dalam jangka waktu lima tahun. Selain itu, tidak lagi menjadi anggota partai politik yang dibuktikan dengan surat keterangan dari pengurus partai politik bersangkutan, berdomisili dalam wilayah kerja KPPS, mampu secara jasmani dan rohani, dan tidak pernah dipidana penjara berdasarkan putusan pengadilan, yang telah memperoleh kekuatan hukum tetap, karena melakukan tindak pidana yang diancam dengan pidana penjara lima tahun atau lebih,” papar pria yang pernah bertugas di Kelurahan Sampit ini panjang lebar. Jabidi mengatakan dalam hal pembentukan KPPS, KPU Ketapang telah mengirimkan radiogram kepada PPS melalui PPK,

untuk segera menjaring petugas yang memenuhi syarat dan agar berkoordinasi dengan kades/ lurah setempat. Dia berharap agar nanti lebih mengutamakan pengurus RT/RW atau mantan petugas pemutakhiran data pemilih (PPDP), yang telah selesai melakukan pemutakhiran data Pemilih Pemilu Gubernur, untuk diangkat menjadi anggota KPPS adalah. “Tenggang waktu pembentukan KPPS ini cukup singkat, selama 14 hari, mulai 30 Agustus, sesuai tahapan dan jadwal yang telah ditetapkan. Aturan mengenai pembentukannya akan kami sampaikan sesegera mungkin, mengingat daerah yang jauh dan kesulitan akses komunikasi,” pungkas Jabidi. (ash)

Jelang 17 Agustus, Paskibra pun Menggunting Rambut KETAPANG – Perjalanan bangsa mengisi kemerdekaan ternyata cukup panjang. Tanpa terasa, ternyata kemerdekaan bangsa Indonesia kini sudah mencapai 67 tahun. Hari Kemerdekaan ke 67 republik ini yang tahun pada tahun ini, walaupun dalam suasana Ramadan 1433 H/2012, tetap diperingati dengan penuh khidmat. Menjelang peringatan Hari Kemerdekaan ke-67 RI, panitia pelaksana sudah melakukan persiapan matang. Mulai dari melatih Pa-

sukan Pengibar Bendera (Paskibra) Merah Putih, sampai kesiapan lainnya dilakukan dengan baik. Semakin dekat peringatan Hari Proklamasi yang jatuh setiap tanggal 17 Agustus tersebut, maka kesemarakan kian terasa. Termasuk juga sejumlah instansi dalam melakukan persiapan, seperti menghias kantor dengan asesoris merah putih dan lain-lain. Demikian juga dengan kesiapan Paskibraka. Selain mematangkan latihan baik pagi dan petang, mulai kemarin (13/8) para siswa yang

terpilih menjadi anggota Paskibra tingkat Kabupaten Ketapang, melakukan pemotongan rambut. Pe m o t o n ga n ra m b u t tersebut dilakukan sebagai tahap akhir dari rangkaian kegiatan latihan mereka. Setelah dilakukan pemotongan rambut, para anggota paskibra ini akan dikukuhkan, di mana selanjutnya akan melakukan tugas mengibarkan dan menurunkan Bendera Merah Putih pada 17 Agustus mendatang. Dengan latihan panjang, para Paskibra Ketapang ini harus siap melaksanakan

tugas yang mereka pikul. Pada sesi pemotongan rambut Paskibra ini, menjadi salah satu kebanggaan Syahran. Pasalnya sejak beberapa tahun terakhir ia bersama rekannya dipercayakan memotong rambut para anggota Paskibra tersebut. “Pada saat pemotongan rambut, setiap tahunnya dilakukan tanggal 13 Agustus setiap tahunnya, tanggal ini sangat bermakna bagi saya, karena merupakan hari kelahiran saya,” kata Syahran yang ditemui di sela-sela memotong rambut salah satu anggota Paskibra.

Sosok kelahiran 1967 ini mengaku sangat bangga telah diberikan kepercayaan untuk selalu memotong rambut para anggota Paskibra. Menurut pemilik Salon Nora tersebut, hari kemerdekaan memiliki makna penting dalam perjalanan bangsa. Kemerdekaan yang menurut dia, sudah mencapai 67 tahun ini, tentunya harus diisi, agar menjadikan bangsa ini maju, adil, dan sejahtera, sehingga semakin disegani oleh negara-negara di dunia ini. (ads)



Pontianak Post Selasa 14 Agustus 2012

Gawat, Danau Najam Tercemar Pupuk


BERBUKA BERSAMA: Wakil Ketua DPRD Kalbar, Ahmadi Usman, di tengah masyarakat dalam acara buka puasa

Merajut Semangat Kebersamaan SUASANA buka puasa bersama di kediaman Wakil Ketua DPRD Provinsi Kalbar, H Ahmadi Usman, ditandai dengan semangat kebersamaan. Ratusan warga sekitar Desa Arang Limbung, Sungai Raya, Kubu Raya menghadiri acara tersebut, yang menghadirkan penceramah Ustaz Anas, 12 Agustus lalu. “Puasa menjadi perekat bagi kita dalam merajut semangat kebersamaan, salah satu contoh buka puasa bersama ini, kita bisa duduk bersama, bersilaturrahmi, yang pada hari-hari biasa kita disibukkan dengan urusan duniawi,” ujar Ustaz Anas. Maka dari itu, ustadz Anas mengecam adanya sikap dari orang-orang yang dapat memancing perpecahan di antara umat dengan lemparan tudingan ‘bid’ah membid’ahkan. “Apalagi sekarang zaman SMS, ada yang hanya kutip-kutipan hadits, lalu mengatakan hal ini bid’ah, hal itu bid’ah, dan lain sebagainya. Padahal, ia hanya mencaplok hadits bukan menelaah hadits, sudah mengatakan beberapa tuntunan dalam amaliah Ramadan ini sebagai perbuatan bid’ah,” jelas Ustaz. Oleh karena itu, diimbau kepada umat Islam untuk tidak mencaplok begitu saja hadits di buku-buku tapi lebih baik dilakukan telaah dan kajian, agar tidak menimbulkan perpecahan di antara umat Islam. Pada kesempatan tersebut Ustaz Anas juga mengingatkan umat Islam di hari-hari terakhir Ramadan ini, untuk menggiatkan amal ibadah. Karena kesempatan untuk bertemu Ramadan lagi di tahun mendatang, pun tidak tahu dengan usia yang diberikan oleh Allah SWT. “Sangat sayang sekali jika kita sampai menyia-nyiakan kesempatan yang diberikan oleh Allah untuk mendapatkan malam kemuliaan, lailatul qadar, malam yang lebih baik dari seribu bulan, bulan diampuni semua dosa oleh Allah SWT,” tuturnya. Sementara pihak tuan rumah, Ahmadi Usman, yang juga Wakil Ketua DPRD Provinsi Kalimantan Barat, menyatakan acara buka puasa bersama ini menjadikan ajang silaturrahmi dengan masyarakat. “Selama ini kita hidup di lingkungan yang sama, namun karena kesibukan setiap warga berbeda, maka pada hari-hari biasa sibuk dengan aktivitas masing-masing. Momen Ramadhan ini telah mempertemukan kita untuk berkumpul dan bersilaturrahmi. Semoga Allah memberikan berkah pada pertemuan ini,” ujarnya. (den)

SUKADANA – Rencana proyek air bersih layak konsumsi untuk warga Kecamatan Simpang Hilir, mendapat penentangan dari sejumlah warga. Berdalih sumber bahan baku air itu dekat dengan areal pertanian, sehingga air residu atau sisa limbah pupuk itu tidak layak dikonsumsi warga. “Danau Najam di TR-9, di bawah TR-8 ada lahan pertanian warga. Saat ini airnya mengambil di TR-7 makin turun ke bawah. Jadi bahan baku air itu terkena sisa dari limbah pupuk lahan pertanian di kawasan itu,” ungkap Syafi’i M, petani asal Rantau Panjang di Gedung DPRD Kabupaten Kayong Utara, didampingi salah seorang legislator, Yulisman, Senin (13/6). Dikatakannya, pengerjaan instalasi air bersih tersebut sudah mencapai dua mingguan. Akan tetapi, plang nama proyek tersebut tidak terpampang di lokasi pekerjaan. “Seakan-akan ini proyek siluman,” sindirnya. Ia menjelaskan bahwa sebagian petani tidak setuju dengan proyek air bersih di Danau Najam dikarenakan dekat dengan lokasi lahan pertanian. Seharusnya, dia menyarankan, berada di atas

jauh di lahan pertanian. “Banyak petani di sekitar Danau Najam tidak berani membuka lahan sawah baru, dikarenakan di kawasan itu direncanakan akan dibangun kebun sawit dari perusahaan Sukadana Sawit Plantation (SSP). Kalau kebun sawit milik SSK jadi dibangun di areal Danau Najam, limbah pupuknya makin banyak. Jadi airnya makin tidak layak untuk dikonsumsi warga,” tegasnya. Dia mengulas, limbah pupuk pertanian itu merupakan bagian dari bahan kimia yang tidak bisa dinetralkan. Dia khawatir jika sampai dikonsumsi manusia terus-menerus, walaupun sedikit-sedikit, akan menimbulkan dampak buruk bagi manusia. “Belum lagi kalau musim air laut pasang, air di Danau Najam jadi payau. PDAM Ketapang saja sampai saat ini masih belum bisa menetralkan air payau. Sedangkan di musim penghujan, airnya menjadi keruh karena gambut,” kupasnya. Tantangan pemenuhan air bersih Danau Najam, dia berharap agar dipikirkan masakmasak. Supaya, menurut dia, tak menimbulkan masalah di


DANAU NAJAM: Aliran sungai Rantau Panjang dari Danau Najam ini sebentulnya bersih, namun di bawahnya begitu banyak areal pertanian, sehingga limbah pupuk pertanian pun PHQJRWRULQ\D LQVHW 6\D¿¶L0

kemudian hari. “Dikarenakan mengganggu areal pertanian, jelas petani tak setuju kalau penghidupannya diganggu. Namun kita sedang carikan solusi, supaya petani tetap bertani dengan tenang dan warga Simpang Hilir menerima air bersih layak konsumsi,” timpalnya. Sebelumnya pada 7 Agustus lalu, Dinas Pekerjaan Umum (PU) Kabupaten Kayong Utara melayangkan surat ke Camat

Sukadana dan Simpang Hilir. Salah satunya ditembuskan ke Kepala Desa (Kades) Rantau Panjang, Simpang Hilir. Surat itu berisi pemberitahuan pada tahun 2012, di mana Pemkab Kayong Utara mendapat bantuan pembangunan SPAM IKK dari pemerintah pusat. Sumber dana pembangunan tersebut berasal dari anggaran pendapatan dan belanja negara (APBN). SPAM IKK dibangun dalam

rangka menunjang kebutuhan air bersih di ibu kota kecamatan. Masih menurut isi surat tersebut, pembangunan instalasi pengolahan air bersih (IPA) 10 liter perdetik, lengkap dengan bangunan penunjang dan pemasangan jaringan perpinaan kurang lebih 9 kilometer. Pengerjaannya berlokasi di Jalan Parit Timur dan TR-8 Desa Rantau Panjang, Simpang Hilir. (mik)

Bulan Ini, Warga Lapas Panen Remisi Remisi HUT Kemerdekaan dan Idulfitri KETAPANG – Kepala Lapas Kelas 2B Kabupaten Ketapang, Sukaji, mengatakan Agustus tahun 2012 ini, merupakan berkah para narapidana yang berkelakuan baik. Pasalnya, selain mendapat remisi umum di hari parayaan hari ulang tahun kemerdekaan Republik Indonesia pada 17 Agustus mendatang, selang dua hari kemudian beberapa penghuni lapas juga mendapatkan remisi khusus dalam rangka perayaan Idulfitri 1433 H. “Yang pasti remisi diberikan bagi para penghuni Lapas yang berkelakuan baik, dan telah menjalani masa tahanan lebih dari enam bulan,”

katanya, kemarin (13/8), saat ditemui diruang kerjanya. Sukaji merasa bersyukur karena dari 98 napi yang diajukan, mendapat remisi umum, di mana semuanya disetujui Kemenkumham. “Enam di antaranya langsung bebas, dan sisanya masih menjalani sisa masa tahanan,” ucapnya, kemudian menambahkan untuk jumlah napi yang mendapatkan remisi khusus Idulfitri di Lapas kelas IIB Ketapang sebanyak 66 orang. Namun, dia kembali menambahkan bahwa tidak ada yang langsung bebas, melainkan hanya mendapat potongan masa tahanan saja. Semua remisi yang diberikan, dikatakan dia, juga termasuk remisi bagi sejumlah kasus yang berhubungan dengan Peraturan Pemerintah (PP) Nomor 28 Tahun 2006 tentang kasus-kasus

khusus seperti ilegal loging, ilegal mining, trafficking, dan sejenisnya. “Sebanyak 19 napi yang terkena kasus khusus juga telah kita ajukan remisi, juga kita ajukan untuk mendapat remisi, namun hingga sekarang belum keluar SK-nya, tetapi akan tetap diusahakan asalkan yang bersangkutan memenuhi syarat untuk mendapatkan remisi,” terangnya. Menanggapi mengenai peningkatan kesejahteraan dan kualitas skill napi yang ada di tahanan, Sukaji juga mengharapkan adanya peningkatan perhatian dari pemerintah, untuk turut membantu memberikan pelatihan skill bagi para napi. “Kita inginnya setelah mereka (para napi, Red) bebas, bisa hidup lebih mandiri dengan kemampuan dan kaulitas skill yang dimiliki,” harapnya.

Selain itu juga ia mengharapkan agar masyarakat luas bisa kembali menerima kehadiran para mantan penghuni lapas. “Agar ke depan

dalam yang bersangkutan (mantan penghuni lapas, Red) bisa kembali menata kehidupan yang lebih baik,” ucapnya. (ash)

Pontianak Post


Selasa 14 Agustus 2012


Seratus Personil Amankan Lebaran Serahkan Berkas Sambungan dari halaman 17

Wakil Bendahara, Regina Rockyani dan perwakilan dari Ketua tiga DPC (Kecamatan) m diantaranya; Yan Kalis (Kapuas), H Lomon (Tayan Hulu), Bambang Joko (Kembayan). Beberapa dokumen yang diserahkan diantaranya; buku data pengurus dan anggota sebanyak 2 buah dan copydata 1 buah. Dokumen DPD 1 buah, DPC 15 buah, DPRt 169 buahn dengan rincian 163 Desa dan 6 Kelurahan. 37 Desa di Kecamatan Tayan Hulu, Tayan Hilir dan Kembayan. Dari data tersebut, Ketua Dewan Pimpinan Daerah,

Irenus Nius menyampaikan, secara keseluruhan anggota yang tergabung dalam Nasdem se-Kabupaten Sanggau sebanyak 2.649 orang. Jumlah itu dari KTA yang didasari oleh KTP yang diserahkan kepada KPU. “Kami berharap jika dalam verifikasi nanti, terdapat kekurangandatainformasiyang dibutuhkan, mohon kepada KPU segera menginformasikannya kepada kami,” ujarnya disela-sela penyampaian berkas. Sementara itu Ketua KPU, Pramono Mugiono menyampaikan penyerahan berkas dokumen verifikasi parpol 2012 tersebut sebagai syarat untuk melakukan verifikasi

pendaftaran Parpol sebagai peserta Pemilu Legislatif pada tahun 2014 mendatang. “Kalau dari hasil verifikasi sementara yang kita lakukan hari ini, secara administratif untuk jumlah KTA sudah lengkap, karena menurut UU KPU nomor 7 tentang verifikasi Parpol, ketentuanya cukup 1000 anggota, dari Nasdem menyerahkan sebanyak 2.649,” katanya. Penerimaan berkas yang dilakukan pihaknya tersebut, terang Pramono, selanjutnya akan ditindaklanjuti kepada tahapan verifikasi faktual oleh KPU Kabupaten, pada tanggal 4 s/d 24 September di KPU

Kabupaten. Setelah itu dilakukan pemberitahuan kepada Parpol yang bersangkutan pada tanggal 25 s/d 30 Oktober. Selanjutnya dilakukan tahapan terhadap perubahan data verifikasi pada tanggal 31 Oktober sampai 7 November. “Sehabis itu, dilakukan verifikasi perubahannya tangga 8 s/d21 November dan penyusunan berita acara 22 s/d 25 November,” jelasnya. Setelah itu dilakukan, lanjut Pramono, data tersebut kemudian diserahkan kepada KPU Provinsi pada tanggal 26 s/d 30 November, dari Provinsi langsung diserahkan ke KPU pusat. (sgg/*)

Sanggau. Terkait keluhan warga Sanggau yang mengeluhkan kondisi jalan berdebu di daerah Bunut dan sekitarnya akibat perbaikan jalan oleh propinsi, Abang mengungkapkan bahwa Bupati mengharapkan agar ada aktifitas penyiraman oleh kontraktor

agar debu tidak berterbangan dan mengganggu kesehatan warga sekitar. “Bupati juga minta ada penyiraman di sepanjang jalur tersebut, mengingat banyaknya keluhan warga di sepanjang lintas jalan perbaikan yang dilakukan propinsi,” katanya. (sgg)

kebakaran telah berdatangan dan setelah melihat kejadian, beberapa saat kemudian kembali lagi ke markas masingmasing. Mobil box yang terbakar, di beberapa sudut nampak hitam bekas terbakar. Disekitarnya, genangan air sisa penyemprotan pemadaman masih terlihat. Ketua DPRD Kota Singkawang, Tjhai Chui Mie yang rumah kediamannya prib-

adinya tidak jauh dengan korban mengatakan sempat kaget mendengar adanya musibah tersebut. Saat kejadian dirinya memang tidak berada di rumahnya, kemudian mendapatkan telepon dari orang memberitahukan kebakaran tersebut. “Sempat kaget, karena informasinya ada di dekat rumah, saya langsung pulang,” kata Tjhai Chui Mie ketika berada di lokasi kejadian.(fah)

Enggang Gading masih ada di kawasan Taman Nasional Bukit Baka dan Bukit Raya. Namun jika perburuan ini terus berlangsung, jangan kepalanya, Enggang Gading sendiri akan punah akibat ulah oknum yang tidak bertanggung jawab,” ucapnya. Menurutnya, jika perburuan ini tidak dicegah maka jumlah atau populasi Enggang di kawasan hutan alam Kabupaten Melawi Provinsi Kalbar kini semakin terancam. Oleh sebab itu, pria yang aktif dalam organisasi pencinta alam ini meminta Balai Konservasi Sumber Daya Alam (KSDA) Kabupate Melawi untuk menindaklanjuti informasi tersebut, sebab jika tidak maka eksploitasi besar-besaran terhadap hewan untuk dijadikan bahan perdagangan dan perburuan menyebabkan

semakin banyaknya hewan langka yang ada di Kabupaten Melawi akan punah. Cara melakukan pencegahan adalah dengan menjaga lingkungan, kemudian cara lain untuk menjaga agar tidak terjadi kepunahan dari hewan langka ini adalah membuat peraturan yang melindungi keberadaan habitat alami serta populasinya. Pelarangan penebangan liar dan tidak terkendali dan perburuan terhadap hewan langka serta perdagangan hewan. Penegakan hukum harus diberlakukan kepada siapa saja yang melanggar ketentuan dan peraturan yang ditetapkan oleh pemerintah. Dengan kerjasama yang baik antara pemerintah dan masyarakat diharapkan mampu ikut melindungi hewan dari kepunahan . (nov)

Dia bilang ada bisnis, tapi tidak tahu bisnis apa dan dengan siapa. Tampaknya sebelum pergi itu korban mendapat telepon. Sayangnya kita kesulitan melacaknya karena HP korban juga raib,” ungkapnya. Di mata sahabat dan orang terdekatnya, Sakino adalah orang yang lugu dan mudah bergaul. Selama hidupnya pula, ia tak punya musuh. Kendati kasus tersebut dimasukkan dalam perampokan, namun bukan tidak

mungkin masuk dalam pembunuhan berencana. Lantaran kata AKP Andi Oddang Riuh, SIK uang ratusan ribu yang ada di dompet korban masih utuh. Selain itu selama ini pula, korban tak pernah pergi ke tempat tersebut. Aktivitasnya sebagai penjual sayur adalah kota Ketapang-Melano. “Tapi hingga kini kita masih berkesimpulan kasus ini masuk pasal 365, pencurian dengan kekerasan,” pungkasnya. (ash)

pat yang lebih wajar dan pemerintah akan mendapat pajak ekspornya. Begitu juga import yang melalui airland port dan dray port. Sehingga barang seperti import gula ini ketentuannya sampai pelabuhan. Apakah pelabuhan darat, laut atau udara sudah ada

ketentuannya. “Nah ini terpaksa semuanya harus dibongkar di Pontianak, mungkin kecuali di Entikong kalau ada pengecualian oleh Bea Cukai. Kalau tidak harus sampai ke pelabuhan Pontianak tentang imigrasinya,” ujarnya. (sgg)

Pemeliharaan Jalan Sambungan dari halaman 17

tersebut empat diantaranya dilakukan pemeliharaan dan satu pelebaran. Keempat ruas jalan yang dilakukan pemeliharaan yakni di Jalan Cermai, Jalan Sulaiman, Jalan Sutan Syahrir, Laverna. Sementara jalan yang dilakukan peleba-

ran yakni di Jalan H. Abbas Sanggau.“Semuanya tidak bisa dilakukan secara bersamaan, melainkan dikerjakan sesuai prioritas. Pengerjaan sendiri sedang dilakukan, sebagian sudah selesai, hanya tinggal menyelesaikan bagian yang belum saja,” katanya saat ditemui di Kantor Bupati

Mobil Boks Terbakar Sambungan dari halaman 17

tersebut sedang dilepas. “Sopir yang baru datang tersebut tidak tahu, kemudian dia pun menyalakan mobil boks. Tapi tiba-tiba semacam konsleting terjadi dengan seketika api juga keluar,” kata Cantona, kepada wartawan saat ditemui disela-sela kesibukannya membersihkan sisa kebakaran yang terjadi, Senin (13/8).

Akibat hal tersebut, dikatakan Cantona, mesin mobil box milik orang tuanya pun tidak bisa lagi di pergunakan lantaran terkena bakar. “Ya mesin ndak bisa lagi digunakan,” katanya. Atas kejadian tersebut, warga terus berdatangan di tempat lokasi. Hingga membuat jalan keluar masuk ke gang tersebut dipenuhi orang. Nampak beberapa mobil pemadam

Melawi Daerah Perburuan Sambungan dari halaman 17

sebenarnya burung Enggang,” ungkapnya. Informasi tentang perburuan kepala burung Enggang ini sebenarnya sudah mulai merebak di Kabupaten Melawi sejak bulan Mei lalu, katanya diyakini kepala burung ini memiliki khasiat tertentu. Harga per satu kepala burung Enggang dihargai Rp 2,5 juta. Namun tidak semua kepala burung ini berharga, hanya kepala burung Tajak yang memiliki batu lah yang dihargai dengan jumlah tersebut. “Saya yakin kalau itu hanya kedok saja, kenyataan yang terjadi dari pemberitaan yang saya terima beberapa hari ini, saya yakin bukan khasiatnya yang diambil tapi yang diburu adalah paruhnya,” kata anggota Pencinta Alam Ciwan-

adri, Melawi ini. Mendengar adanya informasi tersebut, banyak warga dari pedalaman Kabupaten Melawi berlomba berburu burung tersebut di hutan, mereka tidak segan membunuh burung hampir punah ini hanya ingin mendapatkan Rp2,5 juta. Ditempat terpisah, Ketua Pencinta Alam Ciwanadri, Adang Wahyudi sangat menyayangkan maraknya perburuan terhadap burung Enggang Gading ini apalagi melibatkan sindikat Internasional, karena menurutnya hal tersebut bisa dipastikan akan membuat Enggang Gading mengalami kepunahan. “Kini populasi Enggang Gading hanya ada di Kabupaten Sintang, Kabupaten Melawi dan Ketapang. Kalau di Kabupaten Melawi sendiri burung

Pejual Sayur Tewas Sambungan dari halaman 17

sebelum dibunuh. “Lokasi tempat sandal korban ditemukan itu, lokasinya acak-acakan. Kemungkina korban dibunuh di situ,” katanya, kemudian menambahkan Hp, dan motor merek Yamaha Vega ZR milik korban raib. Diduga korban sempat melakukan perlawanan sebelum dibunuh. AKP Andi Oddang Riuh, SIK menerangkan, mayat korban pertama kali ditemu-

kan Ignatius alias Acui, 25, warga sekitar. Saat hendak pergi ke tempat kerjanya. Hingga sekarang sudah dua saksi yang diperiksa, yakni Ignatius, dan salah seorang teman korban, Suryono. Polisi juga masih mendalami kasus tersebut. Kasat mengatakan informasi terakhir yang didapat, korban sempat bertemu dengan Suryono sebelum berangkat pada pagi sebelum ditemukan tewas. “Suryono sempat tanya, mau kemana.

Rp25 Miliar untuk Dry Port Sambungan dari halaman 17

proses dan dipaket, sehingga barang itu sudah terjamin mutunya dan kita bisa jamin dimana tempat kita mengekspornya kemana. Sehingga ada beberapa hal keuntungan dengan dibangunnya

Dry Port diantaranya memberikan lapangan pekerjaan tambahan, kualitas barang yang diekspor bisa dijamin,” jelasnya. SetimanmenambahkanJika harganya sudah terjamin dan dikoordinir oleh pemerintah. Maka, harganya bisa menda-

Harap Mampu Dorong Kemajuan Peternakan Masyarakat Sambungan dari halaman 17

diharapkan bermanfaat dan mampu menjawab kendala peternak. “Ini baru sarana pendukungnya. Harapan kita, bisa bawa pakan dan bawa pupuk. Harap masyarakat juga termotivasi untuk mengembangkan kemajuan peternakan dan pertanian,” kata mantan Kepala Dinas PU Sintang, ini. Wakil Bupati ikut menginginkan penerima bantuan menyamakan persepsi. Mampu menselaraskan untuk segala program pemerintah

dalam memajukan dunia ternak yang belum tergali maksimal. Pasalnya, cukup banyak potensi ternak di Sintang. Antara lain sapi, kambing dan babi. Wakil Bupati optimis bila semua pihak memberikan dukungan, Sintang bakal mampu berswasembada daging. Dukungan alam sudah dianggap tidak masalah. Bentangan kawasannya sangat luas. Sehingga bukan perkara sulit bila bicara untuk mendapatkan pakan ternak. Pemerintah disebutkan Wakil Bupati juga tidak tinggal diam serta lepas tangan

kepada peternak. Dukungan pemerintah tidak hanya sebatas menyangkut sarana. Namun mengenai peningkatan sumber daya turut diberikan. Sehingga segala lini diupayakan mampu mendongkrak kemajuan peternakan di Sintang. Langkah pemerintah adalah, melalui dinas pertanian, peternakan dan perikanan mengoptimalkan peran dari penyuluh peternakan untuk mendampingi peternak. “Nanti frekuensinya (penyuluhan) yang kita bagi. Karena jumlah penyuluh juga masih terbatas,” kata Wakil Bupati.

Sementara Ketua Kelompok Tani Sepantungku Kecamatan Kayan hilir Yuliantinus mengaku sangat terbantu dengan adanya bantuan dari Pemerintah.Dia berkeyakinan serta optimis dengan diberikanya bantuan tersebut akan mempermudah para peternak dalam mengembangkan ternaknya. “Bagaimanapun kita sangat terbantu. alat ini akan mempermudah kami dalam melakukan aktifitas pengembangan ternak,” kata pemimpin kelompok tani yang mempunyai 30 ekor sapi, ini. (**)

SANGGAU--Operasi Ketupat 2012 Polres Sanggau sedikitnya akan melibatkan 100 personil kepolisian dan melibatkan petugas dari instansi terkait. Personil tersebut akan dibagi dalam 15 pos ketupat, yang terdiri dari 6 pos pengamanan dan 9 pos pelayanan. Demikian diungkapkan Kepala Bagian Operasi (Bag Ops) Polres Sanggau, Komisaris Polisi (Kompol) Fajar Dani Susanto, belum lama ini kepada sejumlah wartawan di ruang kerjanya. “Ada 6 pos pengamanan diantaranya berada di Dermaga PT. Erna Djuliawati Sanggau, Terminal Bis Sanggau, Terminal Oplet Sanggau, Perbatasan Entikong-Tebedu, Simpang Tanjung, Simpang

Ampar. Total seluruh jajaran, ada 100 personil. Teknis penjagaan akan kita bagi. H-3 dan H+3 pengamanan akan dilakukan oleh personil yang tidak merayakan Idul Fitri,” tambahnya. Selain pos-pos penjagaan, Polres Sanggau juga menyiapkan pos pelayanan. Pos pelayanan akan ditempatkan di semua jalur lintas jalan utama yang terdapat 9 Polsek. Pos pelayanan tersebut ditujukan sebagai tempat untuk singgah masyarakat yang kelelahan saat sedang melakukan perjalanan jauh. “Kita lakukan kerjasama dengan puskesmas-puskesmas. Termasuk di tempattempat ramai selain jalur utama yang disinggahi, kita akan buat Pos Pelayanan

untuk masyarakat. Di situ masyarakat bisa istirahat, kita siapkan obat-obatan bahkan rencananya kita siapkan juga pijat gratis bagi masyarakat yang kelelahan,” ujarnya. Dani mengharapkan dengan adanya pos pengamanan dan pelayanan tersebut, perjalanan pemudik saat pulang dan arus balik bisa berjalan lancar dan bisa sepenuhnya di kontrol oleh petugas. Pelayanan tersebut diberikan demi kenyamanan masyarakat secara umum. “Pengamanan dan pelayanan kepada masyarakat memang sudah menjadi tugas dan tanggung jawab kepolisian. Karena itu, kami akan berikan semaksimal mungkin selama pelaksanaan operasi ketupat,” tegasnya. (sgg)

Kadisdukcapil Bantah Mesin Rusak SANGGAU--Kepala Dinas Kependudukan dan Catatan Sipil Kabupaten Sanggau, Aloysius membantah adanya masalah kerusakan pada mesin pembuat Kartu Tanda Penduduk elektronik (e-KTP) di Kantor Camat Kapuas. Masalah yang ada hanya terdapat kelelahan pada sistim mesin setelah sekian lama dipakai tanpa jeda pada harihari pertama pembuatan e-KTP. “Itu dari Skopindo yang setting alatnya. Kendala yang mana? Tidak ada kerusakan kok, mesinnya baik-baik saja,” kata Aloysius kepada wartwan,

Senin (13/8). Masalah yang muncul diantaranya tidak terbacanya sidik jari maupun iris mata yang dilaporkan sebelumnya oleh pihak Kecamatan, hal itu dimungkinkan karena dari sistim kerja mesin yang sangat sensitif, sehingga tidak boleh dipaksa jika dalam keadaan panas. “Mesinnya itu kalau panas memang tidak bisa, istirahatkan dulu sekian menit baru mulai lagi. Tidak ada masalah. Itu lumrahlah yang begitu. Manusia saja tidak mampu terus menerus kerja, kalau tidak istirahat,” katanya.

Terkait dengan keluhan lain yang juga dilaporkan kecamatan Kapuas tentang masih rendahnya tingkat kesadaran masyarakat dalam pembuatan e-KTP. Aloysius menyatakan, kepentingan pembuatan eKTP secara gratis itu, akan kembali lagi kepada masingmasing warga.”Saya tidak bisa katakan yang rugi masyarakat. Itu dari masing-masing. Kalau dia sadar rugi, dia pasti datang. Kita harapkan sesuai undangannya itu, ya datanglah. Mau datang-tidak datang itu urusan pribadi, kita juga tidak bisa maksa,” katanya. (sgg)

Jamsostek Serahkan Klaim SANGGAU--PT. Jamsostek Cabang Kalimantan Barat (Kalbar), Senin (13/8) kemarin menyerahkan klaim asuransi kepada dua orang warga Sanggau yang mengalami kecelakaan kerja di ruang Bupati Sanggau. Total pengajuan klaim mencapai Rp. 214.221.420 yang diserahkan langsung oleh Bupati Sanggau, H. Setiman H. Sudin kepada peserta Jamsostek dan ahli warisnya. Setiman mengatakan setiap perusahaan yang ada di Kabupaten Sanggau agar bisa memberikan jaminan kepada seluruh karyawannya dari empat program utama yang ada dalam Jamsostek yang mengacu kepada Jaminan Kecelakaan Kerja, Jaminan Hari Tua, Jaminan Kematian dan Jaminan Pemeriharaan Kesehatan. “Untuk seluruh perusahaan yang ada di Kabupaten Sanggau sudah kita cek, semuanya sudah menjadikan karyawannya sebagai peserta Jamsostek,” ujarnya. Hanya saja, memang belum semua perusahaan yang memberikan empat program

utama dalam Jamsostek itu kepada karyawan. “Makanya kita harapkan seluruh perusahaan bisa mengikutsertakan karyawannya dalam empat program yang ada pada Jamsostek, agar perusahaan bisa tenang dalam mempekerjakan karyawannya,” jelasnya. Sementara itu, Kepala PT. Jamsostek Cabang Kalbar, Lamsir Sianturi ditemui di Sanggau menyatakan dengan adanya pemberian klaim dan santunan dari Jamsostek, diharapkan dapat dimanfaatkan dengan baik bagi peserta yang mengalami cacat dan ahli waris yang ditinggalkan sebagai modal usaha. “Saya yakin, jika ini dikelola dengan baik oleh penerima klaim Jamsostek, maka modal awal itu bisa menjadi pemasukan lebih bagi penerimanya kedepan. Bahkan bisa dipastikan dengan modal awal yang besar itu, dapat menjadi aset seumur hidup bagi penerimanya,” tuturnya. Bantuan tersebut diberikan kepada Agus Marbiyanto, bagian operator PT. Zuti Jaya Mempawah yang mengalami

cacat lengan tangan akibat kecelakaan kerja dengan nilai klaim Rp. 118.100.000 dan kepada ahli waris dari Almarhum Andi Herman, karyawan PT. Artha Perkasa Mulya yang meninggal dunia saat bekerja degan total klaim Rp. 96.121.420. Kepala Dinas Sosial, Tenaga Kerja dan Transmigrasi Kabupaten Sanggau, Mangiring Simbolon mengatakan saat ini seluruh perusahaan yang ada di Kabupaten Sanggau sudah mengikut sertakan karyawannya sebagai peserta Jamsostek. Hanya saja, pihaknya mengakui, tidak semua perusahaan yang memberikan empat program utama yang ada pada Jamsostek untuk para karyawannya. “Kita sangat berterimakasi kepada PT. Jamsostek yang sudah sangat cepat memberikan klaim asuransi kepada warga kita yang terkena musibah saat bekerja. Kita harapkan klaim itu bisa dimanfaatkan dengan baik oleh penerimanya, sebagai modal usaha dalam memenuhi kebutuhan hidup setiap harinya,” ujarnya. (sgg)

Katsir dalam tafsirnya, pernah melakukan hitung-hitungan tentang hakikat seribu bulan itu. Beliau mengatakan: 1000 bulan = 84 tahun 3 bulan. 84 tahun 3 bulan merupakan angka usia terpanjang rata-rata manusia. Artinya, bila kita pikir-pikir ayat tersebut, kita akan segera mengambil kesimpulan bahwa beribadah pada malam lailatul qadr masih lebih hebat pahalanya dibanding dengan pahala ibadah sepanjang hidup. Tetapi maksudnya di sini bukan lantas mencukup dengan ibadah pada malam lailatul qadr kalau setelah itu tidak beribadah sepanjang hayat? atau sama ketika kita shalat di masjidil haram pahalanya 100 ribu kali dibandingkan ditempat lain. Ini salah. Akan tetapi maksudnya adalah pertama : bahwa kita secara normal menyadari bahwa masih banyak ibadah yang kurang maksimal, atau bahkan sangat kurang. Perlu adanya back up pahala, untuk menutupi kekurangankekurangan itu. Kedua, Kita seharusnya “selama hidup” selalu beribadah kepada Allah swt. untuk menutupi nikmatnikmat-Nya yang tidak pernah putus. Tetapi karena kesibukan yang demikian banyak, serta kelemahan iman yang kita punya, tentu banyak kondisi yang tidak bisa dipenuhi.

Allah swt. yang Maha Pengasih memberikan peluang agar kita bisa mengimbangi nikmatnikmat tersebut. Karenanya dibukalah malam lailatul qadr. Jelasnya, Ramadhan adalah nikmat agung, sekaligus tamu agung yang datang setahun sekali. Di dalamnya banyak kesempatan bagi orang-orang beriman untuk meningkatkan iman dan mencucikan dosa-dosa dengan memohon ampun kepada Allah swt. tidak hanya puasa, banyak ibadah Ramadhan yang diajarkan Allah swt. dan Rasul-Nya yang tidak kalah pentingnya dengan ibadah puasa. Seperti ibadah shalat malam, i’tikaf, banyak bersedekah, mengkhatamkan Al Qur’an dan lain sebagainya. Maka kita lawan istilah buah ujong yang selalu identik dengan hal-hal yang selalu jelek, berulat, mentah dan lain sebagainya. Maka kuncinya adalah menjadi akhir dari sebuah laga yang merupakan keinginan kita, kita siap menjadi “buah ujong” yang bisa membuat orang lain senang akan akhlak kita, kita dapat mengharumkan dan membhaktikan nilainilai ramadhan untuk kita amalkan di masyarakat.

Buah Ujong Sambungan dari halaman 17

bonus bagi orang yang bersungguh-sungguh menjalankan perintahnya. Dalam surah Al Qadr ayat 3-5 ini Allah SWT menerangkan adanya malam lailatul qadr yakni : “Malam kemuliaan itu lebih baik dari seribu bulan. Pada malam itu turun malaikatmalaikat dan malaikat Jibril dengan izin Tuhannya untuk mengatur segala urusan. Malam itu (penuh) kesejahteraan sampai terbit fajar.” Inilah malam yang sangat Allah swt. agungkan. Pada malam lailatul qadr ini, Allah swt. pernah menurunkan Al Qur’an. Bukan hanya itu, setiap malam lailatul qadr Allah memberikan kesempatan kepada hamba-hamba-Nya untuk menutupi kekurangan masa lalunya dengan beribadah menegakkan shalat, berdzikir dan membaca Al Qur’an. Bayangkan pahalanya khusus dan luar biasa. Tidak bisa dibandingkan dengan pahala beribadah selama 1000 bulan. Kata khairun pada ayat di atas menunjukkan makna lebih baik, bukan sama. Perhatikan betapa keutamaan ibadah pada malam lailatul qadr hendaklah diraih dengan sungguh-sungguh. Perhatikan kata khairun min alfi shahrin (lebih baik dari seribu bulan). Imam Ibn

Wallahu a’lam bishshawab.



Pontianak Post

Selasa 14 Agustus 2012

Sinar Mas Dukung Pasar Murah Disperindag dan TP PKK Kalbar PERKEBUNAN Sinar Mas kembali menjalankan kepedulian sosialnya bagi masyarakat Kalimantan Barat dalam rangka menyambut hari raya idulfitri 1433 H. Sinar Mas turut serta secara langsung dalam kegiatan pasar murah yang digelar Dinas Perindustrian dan Perdagangan (Disperindag) dan Tim Penggerak Pembinaan Kesejahteraan Keluarga (TP PKK) Kalimantan Barat. Kegiatan dilakukan di tiga lokasi terpisah. Pasar murah pertama, 26 Juni 2012, digelar di Desa Senakin, Kabupaten Landak. Pasar murah kedua, 4 Agustus 2012, dipusatkan di Kecamatan Sandai, Kabupaten Ketapang. Pasar murah ketiga, 7 Agustus 2012, digelar di Desa Sungai Enau, Kabupaten Kubu Raya. Paskaria Ema, Kabid Perdagangan Dalam Negeri dan Kemetrologian Disperindag Kalbar menyampaikan, pemerintah bersama TP PKK dan perusahaan swasta menggelar pasar murah untuk membantu meringankan beban masyarakat ekonomi lemah, terutama dalam menyambut idulfitri 2012. Menjelang lebaran, harga kebutuhan pokok cenderung naik, aksi tersebut menjadi solusi bagi warga untuk mendapatkan kebutuhan pokok dengan harga lebih terjangkau. Ia menyampaikan, keikutsertaaan Sinar Mas dalam menjual minyak goreng Filma dan mentega Filma dengan harga subsidi. â&#x20AC;&#x153;Warga antusias, barang yang ada ludes terjual. Kami tawarkan harga lebih murah dari harga pasar,â&#x20AC;? ujarnya. Pemerintah menyambut baik dukungan penuh dari Sinar Mas. â&#x20AC;&#x153;Partisipasi Sinar Mas sangat membantu kami. Mudah-mudahan perusahaan lain ada yang mau membantu seperti Sinar Mas,â&#x20AC;? katanya. Ia tidak membantah, cakupan pasar murah di Senakin, Sandai, dan Sungai Enau belum luas. â&#x20AC;&#x153;Cakupan kita masih sangat terbatas, sesuai dengan kemampuan yang ada,â&#x20AC;? ujarnya. Tapi jika ada perusahaan lain yang mau membantu langsung seperti Sinar Mas, ia yakin cakupan pasar murah bisa lebih luas. â&#x20AC;&#x153;Semakin banyak masyarakat bisa merasakan manfaat pasar murah ini secara langsung,â&#x20AC;? tegasnya. Mulfi Huda, CSR Officer Perkebunan Sinar Mas menyatakan, partisipasi Sinar Mas dalam pasar murah Disperindag dan TP PKK Kalbar sudah menjadi agenda rutin perusahaan. â&#x20AC;&#x153;Kami sangat senang bisa terlibat langsung membantu masyarakat Kalbar. Sambutan masyarakat untuk pasar murah ini pun sangat baik, mereka antusias,â&#x20AC;? katanya. Ia menambahkan, keberadaan perkebunan Sinar Mas tidak mengejar profit semata. Perusahaan ingin ikut serta membangun Kalbar lebih maju lagi, termasuk kehidupan perekonomian masyarakat. (*) Narasi: Made Frans (QVQHQVQ/WNĹż*WFC

SIMBOLIS: Ny Frederika Cornelis menyerahkan secara simbolis barang kebutuhan pokok yang dibeli warga saat pasar murah.

TERLIBAT LANGSUNG: Perkebunan Sinar Mas terlibat langsung dalam aksi pasar murah Disperindag dan TP PKK Kalbar.

TURUT MELAYANI: Ny Frederika Cornelis dan Ny Karyanti Sanjaya tidak canggung turun langsung ke lapangan dan turut melayani warga yang berbelanja.

DISERBU: Barang-barang kebutuhan pokok dalam pasar murah diserbu warga, termasuk minyak goreng Filma.





BELI MENTEGA: Warga berbondong-bondong membeli mentega Filma dan kebutuhan pokok lainnya untuk menyambut lebaran.

Pontianak Post

Selasa 14 Agustus 2012


Prospek Rekrutan Anyar Dua Raksasa

25 SUPERCUP : Para pemain Bayern Munich berselebrasi usai memenangi piala Supercup setelah menang atas Borussia Dortmund. Bayern menang 2-1.

Kegagalan Bayern Munchen meraih gelar dalam dua musim terakhir memaksa mereka untuk melakukan pembenahan. Sejumlah pembelian penting dilakukan. Namun, Borussia Dortmund juga melakukan langkah serupa. Bagaimana prospek para penggawa baru itu.


Bayern Munchen Mario Mandzukic Harga : 13 juta euro Posisi : Striker Usia : 26 tahun Keunggulan : - Bisa bermain sebagai target man ataupun second striker. - Kemampuan passingnya di atas rata-rata. - Jago bola atas dan piawai mencari posisi. Prospek : Berpotensi sebagai pemain utama. Claudio Pizarro Harga : Free transfer Posisi : Striker Usia : 33 tahun Keunggulan : - Kemampuan driblingnya oke. - Memiliki passing dan finishing yang hebat. Prospek : Pelapis bagi Gomez dan Mandzukic. Xherdan Shaqiri Harga : 9 juta euro Posisi : Winger Usia : 20 tahun Keunggulan : - Memiliki dribbling yang memikat. - Passing dan visi bermainnya bagus. - Masih muda dan penuh talenta. Prospek : Pelapis buat Franc Ribery atau Arjen Robben. Dante Harga : 4,5 juta euro Posisi : Bek tengah Usia : 28 tahun Keunggulan : - Memiliki postur ideal. - Bisa dimainkan sebagai bek kiri. - Berpengalaman bermain di Bundesliga. Prospek : Mengisi posisi inti di jantung pertahanan. Borussia Dortmund Marco Reus Harga : 17,5 juta euro Posisi : Striker/winger Usia : 23 tahun Keunggulan : - Jago dalam penguasaan bola dan passing. - Umpan silang dan tendangan bebasnya mematikan. - Mampu membantu pertahanan dengan baik. Prospek : Pemain utama di barisan serang. Julian Schieber Harga : Transfer tertutup Posisi : Striker Usia : 23 tahun Keunggulan : - Hebat dalam duel udara. - Tendangan jarak jauhnya kencang dan terukur. - Kemampuan driblingnya juga lumayan baik. Prospek : Jadi pelapis di lini depan. Oliver Kirch Harga : Transfer tertutup Posisi : Gelandang Usia : 29 tahun Keunggulan : - Bagus dalam melakukan intersep. - Mampu bertahan dengan baik di tengah. - Penguasaan bola bagus. Prospek : Pelapis di lini tengah.

Juara Piala Super = Gagal Juara Bundesliga? Sejak DFL Supercup kembali dimainkan setelah sempat absen selama 1997-2007 karena merger dengan Fuji Cup di bawah DFB Ligapokal, belum pernah ada juara DFL Supercup dan kemudian menjuarai Bundesliga. Paling banter finis di peringkat ketiga, seperti Werder pada 2009-2010 dan Schalke pada musim lalu. Juara DFL Supercup

Juara Bundesliga

2008 2009 2010 2011 2012

2008-2009 2009-2010 2010-2011 2011-2012 2012-2013

Borussia Dortmund Werder Bremen Bayern Munich Schalke Borussia Dortmund

VfL Wolfsburg Bayern Munich Borussia Dortmund Borussia Dortmund ?



2 V 1


BUKAN LAGI SANG PECUNDANG MUNCHEN - Bayern Munchen tampaknya sudah bosan dipecundangi rivalnya Borussia Dortmund. Setelah berhasil menghentikan kekalahan beruntun dari Dortmund, target berikutnya menghentikan dominasi sang rival di Bundesliga Jerman. Setelah selalu kalah dalam lima bentrok terakhir kontra Dortmund, kemenangan akhirnya diraih Bayern. Klub kebanggaan Bavaria tersebut menang dengan skor tipis 2-1 (2-0) atas Dortmund di DFL-Supercup alias Piala Super Jerman, kemarin dini hari. Bertanding di markasnya, Allianz Arena, Bayern langsung unggul cepat pada menit keenam melalui gol striker anyarnya Mario Mandzukic. Belum juga Dortmund sempat bangkit, Bayern menggandakan skor pada menit ke-11 lewat Thomas Mueller. Dortmund yang kehilangan Shinji Kagawa karena pindah ke klub Premier League Man-

chester United dan menyimpan Mario Gotze sebagai pengganti, mengalami kesulitan di babak pertama. Pemain debutan Marco Reus belum mampu membawa kemenangan. Permainan Dortmund lebih berkembang ketika Gotze, Ivan Perisic, dan Julian Schieber dimasukkan pada pertengahan babak kedua. Hasilnya, pada menit ke-75, striker asal Polandia Robert Lewandowski memperkecil ketertinggalan menjadi 1-2. Kemenangan yang menyuntikkan motivasi Bayern guna mengarungi musim ini. “Sekarang kami sudah memiliki satu gelar musim ini dan saya berharap gelar lainnya menyusul,” ujar Arjen Robben, winger Bayern asal Belanda, seperti dikutip Yahoo Sport. Setelah ketegangan demi ketegangan yang terjadi selama pramusim dengan banyaknya pertengkaran yang dialami di antara para pemain Bayern, hasil ini memberikan ke-

tenangan. ”Ini adalah tes yang bagus buat kami. Di babak pertama kami bermain hebat,” kata Jupp Heynckes, pelatih Bayern. Menurut dia, baik Bayern maupun Dortmund masih masih memiliki banyak ruang untuk berkembang dan kemenangan itu lebih berpengaruh pada kondisi psikologis pemain. ”Kemenangan melawan rival selalu menyuntikkan semangat,” kata Heynckes. Heynckesmelakukanbeberapaperubahan dalam tim ketimbang musim lalu. Paling kentara di benteng pertahanan. Badstuber diistirahatkan dan Dante diberikan kesempatan debut menemani Jerome Boateng di jantung pertahanan. Bayern memiliki prospek menjanjikan untuk mengakhiri dominasi Dortmund musim ini. Mereka memiliki tiga rekrutan anyar yang melakoni debut hebat. Mulai dari Dante, Can, hingga Mandzukic yang mencetak gol

pertama. Situasi berbeda dengan Dortmund. Rekrutan anyar Marco Reus belum bisa menutupi ruang kosong yang ditinggalkan Kagawa yang hijrah ataupun Gotze yang turun sebagai cadangan. Reus baru lebih efektif ketika Gotze masuk pada babak kedua. ”Dortmund membuat kami keringatan pada babak kedua dan organisasi permainan kami mulai memburuk dan kurang disiplin di pertahananan. Apapun itu, ini hanyalah Piala Super, masih pramusim, mereka bisa berkembang,” terang Heynckes. Di sisi lain, pelatih Dortmund Jurgen Klopp mengakui kesalahan pada awal pertandingan yang merusak permainan mereka. ”Kami ketiduran ketika pertandingan dimulai. Kami jauh lebih baik di babak kedua. Pada akhirnya menurut saya, kami masih imbang,” kata Klopp. (ham)

Borong Gelar Individual Terbaik Striker Anyar Ancam Posisi Gomez TANPA striker utamanya Mario Gomez yang baru saja naik meja operasi karena cedera engkel, daya serang Bayern Munchen tidak surut. Striker baru mereka Mario Mandzukic langsung beradaptasi dengan baik dalam tim asal Bavaria itu. Bahkan, Mandzukic berpotensi menggusur Gomez sebagai striker utama atau pelatih Bayern Jupp Heynckes mencari formulasi agar kedua penyerangnya itu bisa bermain berbarengan. Penyebabnya, performanya sangat menjanjikan. Saat bermain sebagai striker tunggal pada DFL Supercup, kemarin dini hari, dia mencetak gol pembuka Bayern. Sebelumnya, dia juga telah menyarangkan empat gol dalam sepuluh pertandingan pramusim Bayern. Performa yang menjanjikan. Musim ini, selain Mandzukic, Bayern mendatangkan striker veteran Claudio Pizarro dengan free transfer. Namun pemain asal Peru itu memang hanya disiapkan sebagai pelapis bagi Gomez atau Mandzukic. Usianya juga sudah 33 tahun. Mandzukic sendiri tidak gentar bila harus bersaing dengan Gomez yang selama ini menjadi pilihan utama. Apalagi, hanya satu posisi di lini depan yang tersedia lantaran

Heynckes lebih sering menerapkan formasi 4-2-3-1. ”Saya tidak bangga karena mendapatkan kesempatan bermain dengan cara seperti ini. Itu kehilangan yang besar, karena setiap pemain dalam tim ini sangat penting buat kami. Bagaimanapun saya siap untuk memberikan kemampuan terbaik bila dipilih,” kata Mandzukic di situs resmi klub. Musim lalu Mandzukic menyarangkan 12 gol untuk VfL Wolfsburg dari 33 penampilannya di Bundesliga Jerman. Bersama timnas Kroasia, dia menyarangkan tiga gol selama Euro 2012 lalu. Performa yang bikin Bayern terpikat. Heynckes mengakui, mendapatkan Mandzukic dan Pizarro pada bursa transfer awal musim ini sangat membantunya. Dia memiliki banyak opsi di lini depan dengan kualitas dan pengalaman yang bagus. Modal buat bersaing merebut kembali gelar Bundesliga yang lepas dua musim beruntun. ” Ma r i o Ma n d z u k i c t e l a h menunjukkan diri dia bisa menjadi striker tunggal dan Claudio Pizarro juga merupakan pilihan yang luar biasa, dia mampu mencetak 18 gol musim lalu dan konsisten selama 11 tahun terakhir. Mereka pembelian yang hebat,” kata Heynckes. (ham)





Marco Reus

BORUSSIA Dortmund gagal meraih trofi perdana awal musim ini. Namun, kabar positif mengiringi kiprah penggawa klub berjuluk Die Borussen tersebut di level individual. Di mana, bomber Dortmund Marco Reus dan pelatihnya Jurgen Klopp terpilih sebagai pemain dan der trainer terbaik versi wartawan olahraga Jerman. Penggawa Dortmund memang mendominasi ajang pemilihan ini. Dari lima pemain yang masuk nominasi, empat diantaranya berasal dari Dortmund. Reus menyabet gelar tersebut setelah mengumpulkan poling terbanyak. Pemain berusia 23 tahun itu mendapatkan 217 suara dukungan. Reus mengungguli tiga rekan setimnya. Yakni Mat Hummels yang mendapat dukungan 108 suara, Robert Lewandowski (95 suara), dan mantan pemain Dortmund yang kini berbaju

Jurgen Klopp

Manchester United (MU) Shinji Kagawa (66 suara). Reus menjadi pemain Dortmund kelima yang menerima penghargaan tersebut. Terakhir kali Dortmund menyabet gelar tersebut pada musim 1996-1997 atas nama Juergen Kohler. Reus sendiri sebetulnya baru bergabung dengan Dortmund awal musim ini. Nah, dia terpilih sebagai yang terbaik setelah tampil menawan sepanjang musim lalu bersama Borussia Moenchengladbach. ”Ini kehormatan besar bagiku. Gelar ini menambah motivasiku untuk bermain lebih bagus musim ini,” kata Reus kepada ESPN. Selama tiga musim bersama Moenchengladbach, Reus sudah membukukan 37 gol dari 99 kali penampilan. Prestasi itu membawanya masuk dalam skuad timnas Jerman di Euro 2012. Reus pun merasa

berhutang budi dengan pelatih Moenchengladbach Lucien Favre yang mengorbitkannya. ”Dia (Favre, Red) pelatih terbaik dalam sepanjang karirku sejauh ini. Tak lupa juga saya berterima kasih kepada Michael Frontzeck (mantan pelatih Moenchengladbach) yang selalu mendukungku ketika pertama kali di Moenchengladbach. Apa yang saya dapatkan ini hanyalah permulaan,” tutur Reus. Sementara bagi Klopp, dia terpilih setelah dua musim berturut-turut membawa Dortmund juara Bundesliga. Klopp meraih dukungan 496 suara. Dia jauh meninggalkan Lucien Favre (138 suara) dan pelatih Freiburg Christian Streich (108 suara). ”Hasil voting ini menunjukkan bahwa sebagai tim pelatih kinerja kami tidak terlalu buruk,” jelas Klopp. (ren/bas)



Pontianak Post

Selasa 14 Agustus 2012

Bisa Gabung Nyonya Tua TURIN - Juventus sudah melupakan Robin van Persie sebagai target mereka di bursa transfer musim panas ini. Sebagai gantinya, Juve memburu striker Athletic Bilbao Fernando Llorente. Kans Nyonya Tua “ sebutan Juve “ mendapatkan Llorente terbuka lebar. Setelah Llorente menginginkan pergi, Bilbao mengumumkan bahwa mereka gagal melobi striker 27 Robin van Persie tahun itu untuk meneken kontrak baru. Kontrak Llorente bersama klub yang dibelanya sejak 2005 itu memang habis tahun depan (30 Juni 2013). Alhasil, Bilbao dituntut menjual Llorente apabila ingin mendapatkan keuntungan materi. “Fernando Llorente tidak akan memperpanjang kontrak bersama Athletic Bilbao. Ini adalah pukulan telak bagi klub kami,” kata Presiden Bilbao Jose Urrutia dalam konferensi pers kemarin sebagaimana dilansir Marca. Pernyataan Urrutia tentu saja meningkatkan peluang Juve yang sudah menggelar negosisi dengan Bilbao sejak akhir pekan lalu. Bilbao kemungkinan juga menerima tawaran EUR 20 juta (Rp 232 miliar) yang sudah disodorkan Juve ketimbang ngotot meminta harga sesuai klausul pelepasan kontrak Llorente, yakni EUR 36 juta (Rp 417 miliar). (dns)

Wilshere Merindukan Rem LUTON - Jack Wilshere belum lepas dari nasib apes. Setelah harus melewatkan start musim ini karena cedera engkel berkepanjangan, Wilshere juga dirundung sial di luar lapangan. Gelandang muda Arsenal itu mengalami kecelakaan lalu lintas di Luton kemarin. Sebagaimana dilansir The Sun, mobil Mercedes SL500 milik Wilshere menabrak dari belakang mobil Toyota Yaris Jack Wilshere sales mobil bernama Lionel Acquah. Alhasil, bagian belakang mobil Acquah penyok. “Saya merindukan rem”. Demikian tulis Wilshere di akun Twitter-nya. Acquah membenarkan apabila Wilshere yang salah karena tidak sempat mengerem mobilnya. Yang menarik, Acquah yang mengeluh sakit pada leher seusai ditabrak itu tidak mengenal Wilshere. “Saya tidak terlalu mengikuti sepak bola,” ungkapnya. Sebagai ganti rugi atas kerusakan mobil Acquah, Wilshere harus merogoh biaya 4 ribu pounds atau lebih dari Rp 59 juta. Tapi, itu tentu bukan masalah bagi pemain 20 tahun tersebut mengingat gajinya per pekan di Arsenal mencapai 50 ribu pounds (Rp 740 juta). (dns)

GEMBIRA: Pemain Mancester City, Carlos Tevez meluapkan kegembiraannya setelah memenangi Community Shield di Stadion Villa Park (13/8), dengan menyemprotkan sebotol sampanye ke rekannya Sergio Aguero.

City Angkat Trofi, Mancini Puji Tevez BIRMINGHAM -Mancester City meraih trofi pertamanya musim ini usai mengalahkan Chelsea di ajang Community Shield. Atas keberhasilan tersebut, Roberto Mancini memberikan sanjungan tinggi pada Carlos Tevez. Tevez bermain sejak menit pertama saat City meladeni Chelsea di laga pembuka musim, Community Shield. Striker asal Argentina itu mencetak gol ketiga The Citizens, yang mengubah kedudukan jadi 3-1, dengan sebuah aksi indah melalui sepakan dari luar kotak penalti. Atas golnya itu, Tevez dapat sanjungan tinggi dari Mancini. Apalagi striker yang musim lalu sempat dianggap jadi biang masalah itu juga tampil mengesankan di beberapa laga pramusim yang sudah dijalani City.

"Saya sangat gembira karena Carlos tahun ini bekerja sangat baik di pramusim, penampilannya lebih baik dibanding tahun lalu," sahut Mancini usai pertandingan. "Juga, tahun ini dia ingin memainkan sepakbola. Untuk seorang pemain, sangat sulit saat dia tak bermain. Musim lalu dia tak main selama enam bulan, dan itu sulit," lanjut dia di Skysports. Di musim yang akan segera dimulai, Mancini berharap kontribusi mantan pemain West Ham United dan Manchester United itu bakal bertambah besar. Jika tidak kembali bermasalah seperti tahun lalu, Tevez disebutnya akan menjadi pemain besar. "Saya berharap dia jadi pemain besar. Dia pemain top jika dia punya keinginan

bermain. Musim lalu kami memainkan Tevez untuk 10 pertandingan terakhir dan itu penting karena dia mencetak lima atau enam gol." "Tapi dia tidak 100%. Tahun ini adalah kali pertama dalam lima tahun dia melakukan latihan pramusim dan, untuk setiap pemain, itu hal yang penting," lugas Mancio. Manchester City mengawali musim 2012/2013 dengan hasil gemilang usai menjuarai Community Shield. Meski cuma trofi minor, The Citizens tetap menyambut dengan kegembiraan besar. "Sekali lagi ini hari yang hebat buat klub. Tak peduli apa trofinya, kami akan merayakan," sahut kapten City, Vincent Kompany di BBC.

"Terkait kartu merah, jujur saja saya jauh dari tempat kejadian, yang saya bisa katakan adalah sebelum kejadian itu kami mendominasi penguasaan bola dan dari dua kesempatan yang dipunya, mereka berhasil membuat satu gol," lanjut sang bek. Terkait upaya mempertahankan gelar juara, Company sadar kalau hal tersebut akan sangat sulit dilakukan. Kemenangan atas Chelsea, yang didapat dengan susah meski lawan cuma diperkuat 10 orang, menunjukkan hal tersebut. "Ini akan menjadi liga yang sulit di musim ini karena Anda bisa melihat kualitas yang dipunya Chelsea. Tak peduli jika kami favorit, jika kami bisa berkembang dibanding musim lalu saya akan merasa gembira," tuntas dia. (int)

Hukuman Skorsing Terry Dikurangi LONDON - Kabar baik diterima Chelsea. Sang kapten John Terry bisa membela timnya di laga pembuka Liga Champions 2012-13 setelah hukuman skorsingnya dikurangi dalam banding yang digelar Senin (13/8). Terry dihukum skorsing tiga pertandingan setelah memperoleh kartu merah akibat mengasari Alexis Sanchez di semifinal leg kedua melawan Barcelona pada musim lalu. Dengan hukuman itu Terry sudah melewatkan laga final yang dimenangi

Chelsea atas Bayern Munich, Mei silam dan ia dipastikan absen dalam laga Piala Super Eropa menghadapi Atletico Madrid, akhir bulan ini. Setelah mengajukan banding, UEFA memutuskan untuk mengurangi sanksinya menjadi dua pertandingan, dengan catatan skorsing satu pertandingan lainnya ditangguhkan untuk masa percobaan selama tiga tahun. "Skorsing pemain Chelsea John Terry telah dikurangi dalam banding,"





tulis keterangan UEFA di situs resminya yang dikutip Reuters. "Meskipun bek tengah ini masih diskors selama tiga laga dalam pertandingan antarklub UEFA, laga ketiga dari hukuman itu ditangguhkan untuk masa percobaan selama tiga tahun." Ini artinya, Terry akan bisa tampil membela The Blues dalam laga grupyang akan dimulai pada September setelah terlebih dahulu diundi pada 30 Agustus mendatang.(int)

John Terry


Pontianak Post Ę Selasa 14 Agustus 2012 Nada Nada Nasyid (N3)


Sembari Berdakwah TIDAK banyak remaja memilih nasyid sebagai salah satu cara untuk menyalurkan bakat di bidang musik. Tapi hal itu tidak berlaku untuk para remaja yang tergabung dalam group nasyid N3 ini. Mereka mampu menyampaikan dakwah dan syariat Islam dengan menambahkan unsur acapella. BY: GHEA LIDYAZA SAFITRI


ENYAMPAIKAN dakwah dan syariat Islam dengan cara yang unik dan berbeda kerap ditampilkan oleh group nasyid yang memiliki nama Nada Nada Nasyid atau yang kerap disingkat N3, karena nama adalah doa maka makna N3 sendiri adalah sebuah harapan agar lantunan nasyid yang disampaikan dapat menghibur orang banyak serta mendakwahkan Islam melalui nasyid. N3 dibentuk oleh para remaja yang memiliki visi dan misi yang sama. Saat Ramadan seperti ini, N3 lebih sering menghibur pelajar SMAN 4 dalam acara buka puasa bersama selama 3 hari. N3 memang berdiri ketika personelnya masih tercatat sebagai siswa SMAN 4. Memang tidak mudah bergelut di dunia

nasyid, karena di setiap jalan yang dilalui pasti banyak menemukan rintangan. Bersyukur mereka justru lebih banyak mendapatkan manfaat, tidak hanya semakin paham akan syariat Islam, mereka juga mendapat pengalaman mengenai musik acapella dan belajar bekerjasama. N3 pernah mengikuti beberapa lomba nasyid, diantaranya yang diadakan SMAN 2, SMAN 3, STAIN dan Nasyid Community. Diantara even tersebut, lomba yang diadakan oleh SMAN 2 lah yang paling berkesan bagi mereka, karena di situlah mereka pertama kali tampil mewakili sekolah. Selain membuat mereka untuk berani tampil, mereka juga diajak latihan bersama nasyid Al-Asyraf. Meskipun saat ini hanya lima personil yang aktif karena dua personelnya sedang menempuh pendidikan di luar kota, N3 tetap semangat untuk berkarya. Buktinya kelima personel yang ada masih sering tampil mengisi acara-acara islami, mengikuti lomba-lomba nasyid, serta membuat lagu-lagu nasyid bernuansa acapella. **


KAYA WARNA: Jenius musik, Adam Young, coba suguhkan warna berbeda dalam Midsummer Station.

S E L A LU G ATA L B E R K A R YA Konsistensi Owl City dalam menelurkan album merupakan salah satu bukti bahwa Adam Randal Young sebagai frontman adalah musisi yang produktif. Empat studio album Owl City dirilis dalam rentang waktu yang singkat, menampung hasrat bermusiknya. Produser, song writer, dan multi instrumentalist asal Minnesota tersebut juga punya sejumlah musical project lain yang tak kalah keren! SKY SAILING Sky Sailing, solo musical acoustic project milik Young yang berkonsep akustik. Karya Sky Sailing direkam dengan piano dan gitar akustik. Brielle dan Flower of the Fields jadi andalan. PORT BLUE Port Blue bisa dikatakan proyek musik Adam Young yang paling sentimental. Musik Port Blue bernuansa melodic and instrumental music. Young menyebut ini cocok digunakan untuk VFRULQJÂżOP. WINDSOR AIRLIFT Windsor Airlift adalah sebuah pop punk band yang beranggota Adam Young, Andy Johnson, dan Anthony Johnson pada 2002. Mereka sempat merilis dua album selama ini. SWIMMING WITH THE DOLPHINS Inilah synthpop band yang dibentuk Adam Young bersama rekannya, Austin Tofte, pada 2008. Mereka merilis Ambient blue.

PERSONEL:,YDQ YRNDOXWDPD /XWKĂ&#x20AC; backing 1), Azmi (backing 2), Dilla (backing 3), Berriyandi (suara tengah), Bimo (beat box), Adit (bass)





ADAM Young, sepertinya, tidak rela penikmat musiknya menunggu lama karya terbarunya. Rencananya, 21 Agustus Hootowls-sebutan untuk penggemar Owl City-sudah bisa menikmati album keempat Owl City, The Midsummer Station. Meski syth khas Owl City masih terasa, jangan harap menemukan nuansa yang sama dengan tiga album sebelumnya. Di album ini Adam Young banyak melakukan eksperimen pada musiknya dengan banyak kolaborasi. The Midsummer Station akan menghadirkan taste yang berbeda di track yang menggaet Carly Rae Jepsen, penyanyi yang sedang naik daun asal Kanada dan Mark Hoppus, vokalis Blink 182. Tak hanya itu, dia juga berkolaborasi dengan â&#x20AC;?super produserâ&#x20AC;? yang pernah menangani nama besar seperti Rihanna, Ne-yo, dan Katy Perry. Sebut saja Dr. Luke, Relient Kâ&#x20AC;&#x2122;s Matt, Nate Campany, dan Emily Wright. Carly Rae Jepsen bisa dibilang jadi daya tarik terbesar. Nama Carly sedang panas di industri musik lewat hit single Call Me Maybe. Young dan Carly berduet dalam single Good Time. Dan benar saja, sambutannya sangat luar biasa begitu video klipnya rilis Juni lalu. Kolaborasi dengan Carly murni karena ketertarikannya terhadap suara Carly. Ternyata, Carly juga menyukai musik Owl City dan pernah menyaksikan live performance Adam Young di Vancouver. Kolaborasi yang tak kalah menarik di album tersebut ada di track Dementia. Adam Young berhasil menggaet vokalis Blik 182, Mark Hoppus. Untuk kolaborasi kali ini, Adam menyebutnya sebagai â&#x20AC;?dream come true colaborationâ&#x20AC;?. Sudah sejak lama Young menantikan kolaborasi tersebut. Sebab, sebenarnya, dirinya adalah penggemar berat Blink 182. â&#x20AC;?Saya belajar banyak hal selama proses rekaman dengan Mark. Sangat menyenangkan bisa bekerja sama dengannya. Rasanya seperti mimpi, Mark ada di studioku, menyanyikan laguku, itâ&#x20AC;&#x2122;s was awesomeâ&#x20AC;? ujar personel tunggal band elec-

tropop itu antusias. Young mengakui bahwa The Midsummer Station adalah tempat nya bereskperimen di musik Owl City. â&#x20AC;?Kreativitas berbicara tentang mencoba hal-hal baru yang belum dilakukan sebelumnya dan di album Owl City kali ini aku melakukannya,â&#x20AC;? paparnya. Dengan begitu banyaknya eksperimen dan kolaborasi, tak heran jika album yang berisi 11 track terbaru Owl City itu memperdengarkan sound yang sedikit berbeda daripada album-album sebelumnya. Untuk karya terbaru Owl City ini, Adam Young juga tak membiarkan para Hootowls bertanyatanya tentang konten di The Midsummer St ation. Tanggal 15 Mei lalu, sebagai pemanasan dia merilis mini album (EP) bertajuk Shooting Star yang berisikan empat track . Yaitu, Shooting Star, Dementia, Gold, dan Take It All Away. (*/det)


Owl City


Pontianak Post Selasa 14 Agustus 2012





Pontianak Post


Selasa 14 Agustus 2012


Pengurus PSSI Tak Kompak


JAKARTA - Banyaknya program PSSI pimpinan Djohar Arifin Husin yang tak berjalan semestinya membuat gerah jajaran kepengurusannya sendiri. Entah karena tak punya media untuk menyampaikannya langsung ke Ketua Umum Djohar Arifin, salah satu sosok yangnamanyatertulissebagaianggotaKomiteStudidanStrategi,Farid Mubarok, menumpahkan kekecewaannya dalam akun twitternya @ FaridMubarok. Dalam ocehannya di twitter Farid diantaranya mengingatkan seseorangyangdisebutnyadengan“Prof”untuktidakmain-main.”PSSI bukan organisasi gelap dan gak jelas. Ini organisasi penuh potensi dan gairah. Jangan main2 lah Prof,”. ”Kalaugakberanilobydanbanyakcingcong.Mundursaja..!Ngajar dikampus.JadidosenlebihterhormatKetua.Kitasudahcapekngikutin drama-drama ini.. Mana katanya era industri bola. Jangan-jangan ente gak faham ! Karena masuk jadi Ketum pun gak nyangka akan jadi Ketum. Ya begini.. Masih terkaget kaget. Tapi harus sadar, justru ini amanah,” demikian diantara kicauan Farid Mubarok. Farid juga mengkritisi gemuknya kepengurusan PSSI era Djohar Arifin yang sama sekali malah tidak efektif. ”Sudah diingatkan, jangan banyak2 kabinetnya, jangan pakai orang-orang lama yang telah buruk jejak rekamnya. Ini malah mbludak,” tulis Farid. Pria berkacamata ini menyoroti kinerja Komite-Komite yang ada di PSSI khususnya Komite Media. ”Utk ngurus media, PSSI punya Wasekjen bid Media & IT, Direktur Media, Juru Bicara, Komite Media.. Kurang apa lagi. Boro-boro koordinasi, tupoksi saja mungkin tidak tahu. Jabatan koq gengsi-gengsia.. FIFA hanya butuh ”media officer”. Titik. Bersertifikat,” bebernya. Farid juga mengaku malu dengan ranking Indonesia yang teros merosotbahkanmencapaiterendahsepanjangsejarah(saatiniposisi 159). ”Bicara fakta saja. Prestasi merosot. Kita diperingkat berapa di rangkingFIFA.GakyakinKetumtahu.Karenamemanggakmautahu. Malu Tuan Prof,” kata Farid. Banyaknya program yang sifatnya terkesan hanya ”pencitraan” juga membuat Farid geram. ”PSSI bikin MoU dengan Univesitas Gunadarma. Katanya website biar ciamik. Mana buktinya.. Website gitu ya malu-maluin lah. MoU dengan Bupati Purwakarta, mana lahannya.. Bikin capek saja dengernya. Lahan gak jelas digembar gemborkan. Coba tunjukkan mana Mou PSSI yang bermanfaat dan berguna ?!. Selain itu masih banyak lagi ocehan Farid Mubarok yang menandakan ketidakpuasannya terhadap kinerja pengurus PSSI pimpinan Djohar Arifin. Sementara itu Catur Agus Saptono, anggota Komite Disiplin PSSI yangsempatmengomentarikicauanFaridMubarokketikadihubungi wartawan mengatakan jika dirinya hanya sebatas berkomentar. ”Saya hanya menimpali apa yang Farid dan beberapa teman tulis di akun twitter. Coba ditanyakan saja kepada mereka kenapa mereka bisa menuliskan masalah itu di jejaring sosial,” kata Catur. (ali)



Perlu Restrukturisasi PBSI


JAKARTA - Suara - suara lantang yang diarahkan kepada pengurus PB PBSI (Persatuan Bulu Tangkis Seluruh Indonesia) kembali nyaring terdengar paska hasil mengecewakan di Olimpiade London 2012. Salah satu legenda bulu tangkis tanah air Icuk Sugiarto mengatakan kian melorotnya prestasi bulu tangkis dalam beberapa tahun terakhir disebabkan olahraga tepok bulu itu diurus oleh orang-orang yang tidak kompeten di bidangnya. Karena itu, ke depan PBSI harus diurus olehorang-orangyangmengerti dengan bulutangkis. Icuk menyatakan, agar bulu tangkis bisa kembali ke masa

kejayaan, ke depan PBSI harus diisi oleh para pakar bulutangkis yang benar-benar mengerti bulutangkis. Jika tidak, jangan harap dunia bulutangkis Indonesia akan bangkit dari keterpurukan seperti yang saat ini terjadi. “Sekarang Saatnya PB PBSI melakukan restrukturitasi kepengurusan. Diantaranya menata ulang pelatih dan pemilihan atlet yang berhak menjalanipelatnasdiCipayung. Masyarakat Indonesia sudah tidak dapat mentolerir hasil bulutangkis yang tidak membawa medali sama sekali dari Olimpiade London,” ujar Icuk. Juara dunia tahun 1983 ini


mengungkapkan, pemilihan orang-orang yang mengerti bulutangkis untuk mengurus PBSI tidak hanya di tingkat pimpinan tertinggi, tapi juga jajaran pengurus di bawahnya. Icuk menegaskan hanya orang-orang yang memiliki visi misi yang kuat yang bisa mengangkat bulutangkis dari keterpurukan. Dan itu hanya dimiliki oleh orang-orang yang selama ini memang mengerti bulutangkis. “Saat ini bulutangkis kita ditinggalkan oleh orang-orang yang selama ini perhatian terhadap bulutangkis. Mereka merasa tidak diperhatikan, se-

hingga memilih keluar dari lingkaran orang-orang yang sekarang menguasai bulutangkis,” beber Icuk. Sementara itu, disela menghadiri Diskusi Panel Olahraga Menyikapi Hasil Olimpiade London 2012, yang digelar oleh SIWO PWI Pusat, di Jakarta, Jumat (10/8) lalu. Menpora Andi Mallarangeng meminta agar bulu tangkis bangkit kembali untuk menghadapi event-event olahraga multicabang ke depannya. Belajar dari kegagalan di London, Menpora menyatakan Indonesia tidak boleh lagi bertumpu hanya pada bulu tangkis. Menurut Menpora, naik-turunnya

prestasi bulu tangkis akan berimbas pada naik-turunnya prestasi Indonesia di Olimpiade. “Ke depannya, harus ada cabang-cabang lain yang menjadi andalan untuk medali,” ujar Menpora. “Penurunan prestasi bulu tangkis tidak terjadi tahun ini saja, tapi sudah beberapa tahun belakangan. Bulu tangkis harus bangkit kembali,” sambungnya. Mantan juru bicara kepresidenan itu mengatakan, untuk bangkit kembali dari keterpurukan harus ada perubahan mendasar dalam tubuh PBSI. “Mulai dari pelatihan, rekrutmen atlet, dan regenerasinya,” tegas Andi. (ali)


C cmyk




30 Neuer Cedera, Jerman Tanpa Kiper Utama MUNICH - Timnas sepak bola Jerman bakal melakoni laga persahabatan melawan Argentina, Rabu (15/8) besok. Namun, sial bagi skuad Panser, julukan Timnas Jerman. Mereka terancam tak turun dengan kekuatan penuh, setelah kiper utama mereka Manuel Neuer mengalami cedera pinggul. Petaka ini didapat oleh Neuer saat membela Bayern dalam pertandingan Super Cup Jerman melawan Borussia Dortmund di Stadion Allianz Arena, Muenchen, Minggu (12/8) lalu. Dalam pertandingan itu, Bayern menang 2-1. Kepastian absennya Neuer ini datang langsung dari DFB (Federasi Sepak Bola Jerman). “Saya sangat menyayangkan hal ini. Padahal, saya benar-benar ingin berada dalam tim di laga besar ini. Tapi, saya berharap teman-teman se-tim saya tetap meraih kemenangan dalam laga ini walau tanpa ada saya di sana,” kata Neuer dalam situs resmi DFB. Tentunya, berita ini sangat mengganggukosentrasiJoachim Loew, pelatih timnas Jerman dalam meracik tim terbaik Manuel Neuer mereka. Namun, pelatih yang gagal membawa Jerman ke final EURO 2012 ini tak mau terlena dengan kabar pahit tersebut. Sebagai ganti, dia telah memiliki dua pengganti Neuer. Yaitu, Ron-Robert Zieler kiper kedua di timnas Jerman yang akan dipercayakan untuk masuk dalam line up-. Selain dia, ada juga Marc-Andre Ter Stegen, kiper muda yang saat ini berbaju klub Borussia Moenchenladbach. Namun, dengan alasa jam terbang, sepertinya pilihan terbesar akan jatuh kepada Robert Zieler yang dinilai lebih berpengalaman. Sementara penampilan Ter Stegen terlihat masih jauh dari kata istimewa. Apalagi, dalam laga ujicoba Jerman melawan Swiss pada Mei lalu, Ter Stegen, kebobolan lima gol. Jerman terus berusaha untuk mencari format terbaik bagi timnas sepak bola mereka jelang kualifikasi piala dunia nanti. Apalagi, Jerman saat ini mereka menduduki peringkat dua dunia setelah Spanyol, Sebagaiama diketahui, pertandingan melawan Argentina ini, adalah laga persahabatan pertama Jerman setelah EURO 2012 Juli lalu. (dik)

Saat Ujicoba Melawan Argentina


0 V 4

Pontianak Post

Selasa 14 Agustus 2012


Poldi Hero, RVP Di-Boo KOLN - Lukas Podolski memang baru sekali tampil bersama Arsenal. Podolski menjalani debutnya ketika Arsenal menjalani laga pemungkas pramusim melawan mantan klubnya, FC Koln, di RheinEnergi Stadion kemarin. Tapi, dia langsung menjadi pahlawan bagi Arsenal. Poldi “ sapaaan akrab Podolski “ mencetak dua gol dalam laga tersebut. Satu gol pertama dia cetak melalui eksekusi tendangan penalti pada menit ke-15. Sedangkan satu gol lainnya dia ciptakan setelah memanfaatkan umpan manis Kieran Gibbs tiga menit jelang babak pertama usai. Sebelum terjadinya dua gol Poldi, Thomas Vermaelen sudah lebih dulu mencetak gol cepatnya saat laga baru berjalan tujuh menit. Dan satu-satunya gol Gervinho yang terjadi pada menit ke-63 menjadi penutup pesta gol tim tamu kala itu. Awal manis bagi Poldi sekaligus menjadi pembuktian bahwa dia layak berada di dalam skuad anyar The Gunners musim ini. “Aku bangga bisa bermain di sini dan mengenakan kostum Arsenal. Aku sudah serasa menjadi bagian dari tim ini sejak hari pertama bergabung,” ujar Poldi seperti yang dikutip dari Telegraph. Resmi direkrut Arsenal dari klub Jerman Bayern Munich per tanggal 30 April lalu, Poldi memang baru kali ini menjalani laga bersama Arsenal. Torehan dua gol itu dianggapnya sudah cukup sebagai bekal untuk melakoni musim panjang

bersama Arsenal. “Pertandingan yang mengesankan, terlebih aku bisa menciptakan dua gol kemenangan. Bagaimanapun juga hasil di sini bisa menjadi bekal saat kami menjalani pertandingan perdana menghadapi Sunderland pekan depan,” imbuh Poldi. Walaupun bisa menciptakan dua gol kemenangan bagi Arsenal, tak lantas membuat Poldi mendapat sanjungan dari sang pelatih, Arsene Wenger. Malahan, Wenger masih menganggap penampilan bomber anyarnya itu belum maksimal. “Kondisinya masih belum 100 persen fit. Lihat saja larinya yang juga belum 100 persen. Tapi, kami masih mencoba menggenjotnya kembali. Semua orang pasti sudah tahu kalau dia memiliki naluri mencetak gol yang tinggi. Laga inilah buktinya,” ungkap Wenger dikutip dari Sportsmole. Untuk laga perdana Liga Primer Inggris nanti, Wenger belum berani memberi jaminan tempat utama bagi Poldi di Arsenal. “Dia akan berada dalam skuad. Namun, kami tidak bisa memberitahu apakah dia nanti bermain sebagai starter atau tidak,” jelas Wenger. Nasib berbeda 180 derajat justru dialami penyerang Arsenal Robin van Persie. Jika Poldi “diberi” sanjungan, van Persie malah mendapat cemoohan dari 15.000 pendukung Arsenal yang hadir di stadion tersebut. Itu dia dapatkan





Lukas Podolski

pada saat menggantikan Poldi pada menit ke-68. “Apapun yang aku katakan tentang dia (van Persie,

Red) mungkin itu masih ada sedikit kebohongannya, tapi bagaimana pun dia pemain kami. Dan hanya itu saja,”

ungkap Wenger. “Kami ingin tetap mempertahankannya di tim ini,” jelas Wenger. (ren)

METRO SPORT Tinggalkan PNS, Demi Suarakan Olahraga di Panggung Politik


Pontianak Post Selasa 14 Agustus 2012

Jangan takut berkorban demi cinta, karena cinta yang tulus memerlukan biaya yang tinggi. Jangan takut berkorban de mi mimpi, karena semua kesuksesan selalu berawal dari mimpi. Mungkin inilah kata yang pantas untuk melukiskan gambaran pengorbanan seorang olahragawan sejati sepeti Damianus Yordan. Tiga belas tahun berkiprah sebagai PNS, mantan juara tinju Asia ini siap melepaskan statusnya tersebut demi menyuarakan bidang olahraga di panggung politik. Urai Budianto, Pontianak

BERANGKAT dari latar belakang seorang anak jalanan yang harus beradu nyali demi bertahan hidup di Terminal Pasar Baru Ketapang tahun 1989 inilah kisah tersebut dimulai. Di umur yang masih begitu muda, Damianus sudah terjun sebagai petinju. Di pasar itulah dia bertemu dengan pelatih tinju Ketapang, Herman Wimpi yang juga tokoh masyarakat Bugis perantauan. Tempaan dan didikan dunia keras adu jotos membuat Dami, sapaan Damianus selama beberapa tahun, membuat dia bisa menjadi seperti sekarang ini. Sejak menjadi petinju hingga sekarang, Dami selalu berprinsip harus berani, loyal, bertanggugjawab, jujur dan ikhlas dalam mengarungi hidup didunia ini. Berbagai gelar telah diraihnya, mulai dari juara tinju kabupaten, juara tinju Kalbar, juara tinju nasional, juara tinju Asia bahkan juara tiga tinju dunia.

Damianus adalah putra pertama dari enam bersaudara, pasangan Than Lai Chun dan Natalia. Saat ini dirinya berkiprah sebagai pelatih tinju yang sukses melahirkan juara dunia Daud Yordan yang merupakan petinju terbaik kelima negeri ini. Menurut Dami, dari banyaknya gelar yang diraihnya tersebut ternyata tidaklah sepadan dengan penghargaan yang didapatnya dari pemerintah. Walaupun saat ini pengagum berat Presiden Iran Mahmud Ahmadinejab ini telah bekerja tahun sebagai PNS golongan II B, dia tetap melihat dan merasakan dunia olahraga tidak mendapat porsi yang sesuai pengorbanannya selama ini. Terlebih melihat para atlet serta mantan atlet yang saat ini hidupnya banyak terlunta-lunta akibat tidak adanya perhatian dari pemerintah. Dia mencontohkan rekannya yang dulu merupakan jawara atletik



sekarang bekerja sebagai pencari rumput untuk hewan piaraan. Masih banyak lagi cerita sedih tentang pahlawan olahraga negeri ini. “Seperti juara dunia Ellias Pycal, betapa dulu dipuja-puja, sekarang justru hanya menjadi pengantar surat di kantor KONI Pusat. Sungguh memprihatinkan,” ujar dia. Karena kesenjangan tersebutlah alumni Sekolah tinju “Boxeo De Cuba”, di Havana Cuba tersebur rela mengorbankan status PNS-nya untuk terjun ke kancah politik. Dirinya ingin menyuarakan suara komunitas olahraga dan pemuda di parlemen. “Sebagai PNS saat ini, saya hanya bisa bersuara tapi tidak punya kewenangan menentukan anggaran. Jika di parlemen saya bisa berbuat demi kemajuan olahraga,” katanya. Damianus juga mengatakan, langkah dia menuju pentas politik juga murni karena ingin bersuara




Damianus Yordan (tengah) diabadikan bersama Gubernur Kalbar Cornelis (kanan) dan Dr Oesman Sapta (kiri)

dalam kebijakan anggaran di dunia pemuda dan olahraga. Bayangkan saja, kata Dami, meskipun telah ada UU nomor 3 tahun 2005 tentang sistem keolahragaan nasional, tapi sampai enam tahun ini, undangundang tersebut justru jadi bantal di parlemen. Anggaran olahraga

masih menjadi nomor buncit yang paling diperhatikan di parlemen. “Mungkin ini bisa kita fahami, karena kebanyakan mereka di parlemen bukanlah kaum olahragawan maupun insan olahragawan, sehingga mereka tidak tergugah menyuarakan bidang olahraga,” tandasnya. (*)



Pontianak Post Selasa 14 Agustus 2012


Atlet-Atlet Belia, Debutan yang Mengejutkan di Olimpiade London 2012

Kandidat Rising Star Olimpiade Rio

Laura Trott

Masih Merasa Jadi Anak-anak

MEREKA datang ke Olimpiade London 2012 sebagai debutan. Meski begitu, prestasinya tidak bisa dipandang sebelah mata. Di usia

INGGRIS Raya memiliki pembalap-pembalap sepeda handal. Di antaranya adalah Victoria Pendleton dan Sir Chris Hoy. Olimpiade yang digelar di negeri itu, bisa jadi olimpiade terakhir bagi kedua pebalap tersebut.Namun Inggris Raya tidak perlu khawatir. Sudah ada pewaris yang akan meneruskan kejayaan Inggris di olahraga kayuh sepeda tersebut. Dia adalah Laura Trott yang berpartisipasi di Olimpiade London saat menginjak usia 20 tahun. Meski datang sebagai debutan, atlet yang berasal dari Cheshunt, Hertfordshire itu langsung menyumbangkan dua medali emas. Yaitu dari nomor omnium dan tim pursuit putri. Medali emas yang didapatkan Trott berasal dari perjuangan hebat. Selain berlatih keras Trott juga berjuang untuk mengatasi penyakit asma. Juga berperangmelawanmasalahkesehatannya yang terus menggerogoti tubuhnya. Namun segala hambatan itu tidak menghalangi Trott untuk mengejar prestasi olahraganya yang fenomenal. “Mendapat dua emas Olimpiade rasanya kok masih tidak nyata bagi saya,” ucapnya kepada BBC. “Saya masih tidak bisa percaya ini terjadi. Saya kira, saya ini masih anak-anak usia sepuluh tahun. Bukan bintang,” imbuhnya. (nur/ruk)

mereka yang rata-rata masih belasan tahun, sudah mampu menampakkan kecemerlangan. Kecermalangan yang sangat mungkin akan semakin berkilau pada penyelenggaraan olimpiade berikutnya di Rio de Janeiro, Brasil, 2016 mendatang. Inilah beberapa diantara para calon rising star yang prestasinya sudah terlihat di London dan layak dinanti perkembangannya di Olimpiade Rio empat tahun mendatang. Mereka telah memberi warna di London ketika masih belia. Tentu warna itu akan semakin berkilau di Rio saat usia mereka sudah matang untuk ukuran olahragawan. Misalnya saja Usianya masih 17 tahun, saat untuk pertama kalinya Missy Franklin berlomba di ajang renang Olimpiade London 2012.


Ruta Meilutyte

Emas Langka Lithuania DI London 2012, Lithuania hanya meriah dua emas. Satu emas disumbangkan oleh perenang berusia 15 tahun Ruta Meilutyte. Atlet yang juga berkewarganegaraan Inggris tersebut mendapatkan emas pada nomor 100 meter gaya dada. Meski memulai debut senior Internasional di Olimpiade 2012, Meilutyte terlihat sama sekali tidak keder. Di kolam renang gerakannya sangat eksplosif. Terlihat sekali dia sangat lapar gelar juara. Kalau melihat Meilutyte berlaga, tentu saja tidak menyangka bahwa itu dilakukan gadis berusia 15 tahun. ”Saya tidak percaya. Emas ini terlalu besar artinya untuk saja,” katanya kepada BBC. ”Tentu saja kemenangannya ini sangat berat dicapai. Juga sangat sulit. Saya tidak bisa terlalu banyak bicara soal itu. Namun intinya saya sangat bangga,” imbuhnya. Kalau konsisten, di Rio 2016, Meilutyte akan menjadi perenang gaya dada jarak pendek yang tak terkalahkan. (nur)

Penuh Kontroversi PUBLIK dunia terhenyak melihat prestasi fenomenal remaja Tiongkok berusia 16 tahun Ye Shiwen dari arena kolam renang. Dalam debut Olimpiadenya, Ye meraih emas nomor 400 meter gaya ganti perorangan. Dahsyatnya, gadis kelahiran Hangzhou, Provinsi Zhejiang tersebut mencetak rekor dunia baru. Dalam 50 meter menjelang garis finis, Ye bahkan lebih cepat dari perenang putra andalan Amerika Serikat Ryan Lochte. Hal inilah yang memantik kontroversi. Tim pelatih renang AS menuduh Ye menggunakan doping untuk mengerek prestasinya.

“Mereka (pelatih AS, Red) tidak fair dan tidak profesional ketika melontarkan tuduhan itu. Catatan waktu itu saya capai hasil kerja keras, bukan obat-obatan,” tutur Ye kepada Guardian. Meski diliputi kontroversi, Ye tidak galau dan merebut emas keduanya nomor 200 meter gaya ganti perorangan. “Terima kasih banyak kepada setiap orang yang mendukung saya !. Termasuk keraguan dari media barat,” tulisnya di situs microbloging Sina Wiebo miliknya. Empat tahun mendatang di Rio 2016, Ye akan matang dan menjadi bintang paling terang. (nur)






Tidak banyak yang menduga bahwa di usia sebelia itu Franklin mampu menyumbangkan prestasi fenomental untuk negerinya, Amerika Serikat. Setidaknya, empat medali emas yang diraihnya menunjukkan hal itu. Medali-medali emas itu diraihnya dari nomor 100 dan 200 meter gaya punggung, 4 x 200 meter estafet gaya bebas, dan 4 x 100 estafet gaya ganti perorangan. Masih ditambah dengan medali perunggu nomor 4 x 100 estafet gaya bebas. Prestasi itu membuat Franklin menyamai prestasi salah satu perenang hebat negeri Paman Sam, Michael Phelps. Phelps yang menjadikan Olimpiade London sebagai kesempatan terakhirnya, pertama kali meraih medali emas olimpiade pada usia 17 tahun. Prestasi Franklin sejatinya sudah mulai terlihat saat kejuaraan dunia 2011. Di even tersebut, remaja kelahiran Pasadena, California itu merengkuh lima emas. Di sisi lain, prestasi hebatnya di kolam renang memunculkan kegundahan. Dia sedang menimbangnimbang antara terus berkiprah di olahraga air tersebut atau melanjutkan studi Biologi Kelautan. Namun, menilik kehebatannya saat melaju di kolam renang, tampaknya Franklin akan tetap berenang empat tahun mendatang. ”Memilih antara berenang dan kuliah memang berat. Namun kalau melihat pengalaman di London, saya sekarang memiliki banyak persepsi tentang keputusan itu,” ucap perenang 185 cm itu kepada CNN. (nur/ruk)

Pontianak Post  
Pontianak Post  

14 Agustus 2012
