Page 1

Pontianak Post

Halaman 4&5

Sabtu 12 November 2011 M / 16 Zulhijjah 1432 H

Eceran Pontianak Rp.2.500

P er t ama da n Ter ut ama di Kal ima n t an Barat

Pembukaan SEA Games Spektakuler PALEMBANG--Perhelatan akbar SEA Games XXVI secara resmi dibuka di Palembang pada Jumat (11/11) malam. Meski diwarnai hujan, upacara pembukaan berlangsung meriah dan spektakuler. Upacara pembukaan di Stadion Gelora Sriwijaya, Jakabaring Sports City, dimulai tepat pukul 19.15 WIB. Atraksi u

Ke Halaman 7 Kolom 5

Thailand Kuasai Klasemen KARAWANG--Kondisi Thailand boleh saja belum pulih seratus persen dari terjangan banjir hebat yang melanda. Namun, hal itu malah seolah menjadi penyulut semangat bagi para atletnya saat tampil u

Ke Halaman 7 Kolom 1

Perolehan Medali No Negara Emas Perak Perunggu Jml 1






























Farid Fandi/Jawa Pos

PEMBUKAAN: Efek multimedia yang dipancarkan ke tengah lapangan begitu memukau pembukaan SEA Games Palembang, Jumat (11/11) malam.

Gidot Siap Bawa Perubahan Kalbar


Bursa Bakal Calon Gubernur Kalbar Terus Bertambah BENGKAYANG—Bursa bakal calon gubernur terus menggelinding. Setelah Cornelis, Mayjen

AYU TING TING: Pilih emas untuk investasi.

Pilih Emas daripada Saham KARIR Ayu Ting Ting yang melesat pesat belakangan ini memiliki implikasi yang berbanding lurus dengan pendapatannya. Meski mendadak mengantongi banyak uang hasil pekerjaannya sebagai penyanyi, dia tidak lantas berhura-hura. Gadis 19 tahun itu juga memikirkan investasi. Hal itu terungkap ketika dia mengisi acara IPO (Initial Public Offering) Visi Media Asia di Eicentrum Walk, Jakarta Selatan, kemarin (11/11). Karena merupakan acara penawaran umum perdana, dia diajak untuk berinvestasi saham. Tetapi, ternyata, dia tidak paham saham. Dia lebih suka berinvestasi dengan membeli emas. u

Ke Halaman 7 Kolom 5

Dana Pilkada

Banding Kandas, Susno Tak Dipenjara JAKARTA – Harapan mantan Kabareskrim Komjen Pol Susno Duadji untuk bebas dari jerat hukum sirna di Pengadilan Tinggi (PT) DKI Jakarta. Majelis hakim banding menguatkan putusan pengadilan tingkat pertama dengan menghukum Susno pidana penjara 3,5 tahun dan denda Rp 200 juta subsider empat bulan penjara. u

Subuh Dzuhur Asyar 04:04 11:28 14:51

Ke Halaman 7 Kolom 1

Maghrib Isya 17:32 18:44

Sumber : Kanwil Kemenag Kalbar


TNI Armyn Angkasa Ali Anyang, Milton Crosby dan Morkes Effendi, kini giliran Suryadman Gidot siap maju. Ketua DPD Partai Demokrat Kalbar itu mengaku siap maju bila survei yang dilakukan namanya tertinggi. “Kalau survei menyebutkan u

Ke Halaman 7 Kolom 1 Cornelis

Armyn A. Ali Anyang Milton Crosby

Kurir Ditangkap Bawa Satu Kilogram Sabu-sabu PONTIANAK--Gabungan aparat kepolisian Direktorat Narkotika Polda Kalbar dan Polda Metro Bandara Soekarno Hatta berhasil mengamankan satu kilogram sabu-sabu. Pelaku dibekuk saat hendak mengambil sebuah kotak mencurigakan di salah satu biro jasa penitipan barang di Jalan Tanjung Pura, kemarin (11/11) sekitar pukul 09.00 WIB. Sebelum penangkapan dilakukan, barang haram yang dikemas dalam sebuah kardus tersebut telah dibuntuti oleh Jajaran Polda Metro Bandara Soekarno Hatta. Kemudian pihaknya u

Ke Halaman 7 Kolom 5

Morkes Effendi

Suryadman Gidot

Panitia Terima Transfer Rp17 Miliar

Haryadi/Pontianak Post INTROGASI: Tersangka DO yang dimintai keterangan oleh Kabag Bin Ops Direktorat Narkoba Polda Kalbar saat dibekuk membawa satu kilogram

Peletakan Batu Pertama Mujahidin Usai Salat Jumat

Haryadi/Pontianak Post

INTROGASI: Tersangka DO yang dimintai keterangan oleh Kabag

PONTIANAK – Jumat (18/11) mendatang merupakan hari terakhir umat muslim di Pontianak dan sekitarnya beribadah di Masjid Raya Mujahidin. Setelah Salat Jumat, peletakan batu pertama pembangunan masjid itu dilakukan. “Silakan datang kalau mau Salat Jumat terakhir pada 18 November di Mujahidin. Usai salat akan dilakukan peletakan batu pertama selanjutnya pembongkaran bangunan lama,”

Bin Ops Direktorat Narkoba Polda Kalbar saat dibekuk membawa satu kilogram sabu-sabu.


Ke Halaman 7 Kolom 1

Jonru Ginting; Tularkan Kemampuan Menulis Melalui Sekolah Menulis Online

Frustrasi Jadi Orang Kantoran, Telurkan Puluhan Penulis Buku Ide mendirikan sekolah menulis online ditemukan Jonru dalam situasi terpepet. Embrionya adalah website yang selama enam tahun hanya menghasilkan Rp500 ribu. Kini puluhan penulis profesional telah dihasilkan. PRIYO HANDOKO, Jakarta HARI merambat sore. Namun, pria berperawakan sedang dengan sebaris jenggot di dagu itu masih belum terlihat akan mengakhiri pekerjaannya. Pandangan matanya tampak fokus ke arah laptop. Tangannya asyik memainkan mouse. Bersama seorang teman, Jonru tengah Priyo Handoko/Jawa Pos mematangkan format diskusi ’’kiat cepat men- SEKOLAH ONLINE: Pendiri sekolah menulis online pertama di Indonesia.

jadi penulis laris’’ yang akan diselenggarakan pada 26 November mendatang. Kebetulan Jonru menjadi pembicara. Dia akan dipanel dengan Arief Muhammad, penulis muda yang tengah naik daun berkat debut buku pertamanya: Poconggg Jadi Pocong. Hanya dalam setengah tahun, buku yang menyasar segmen remaja itu menjadi best seller dengan penjualan spektakuler menembus 200 ribu eksemplar. Bagi Jonru, berbicara mengenai teknik dan seni tulis-menulis di hadapan publik bukan hal baru. Namanya sudah cukup familier, terutama di kalangan komunitas penulis. Jonru-lah pendiri website yang mulai eksis awal 2001. Belakangan, melalui website itu, dia mengembangkan sekolah menulis online atau SMO. ’’SMO ini layanan belajar menulis lewat

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 3.000 *Ketapang & KKU Rp 4.000 *Kapuas Hulu Rp 3.000


Ke Halaman 6 Kolom 4

Jawa Pos Group Media ade.r


Pontianak Post Sabtu 12 November 2011

Pontianak bisnis Pontianak Post



Sabtu 12 November 2011

ASUS ZENBOOK: Seorang Model saat menunjukan produk Asus Zenbook di Megablitz, Grand Indonesia, Jakrta, Kamis (10/11). RANDY TRI KURNIAWAN/JPNN

Asus Zenbook Pelopor Era Ultra di Dunia JAKARTA—Asus Zenbook hadirkan era instan dalam dunia komputansi melalui teknologi Super Hybrid Engine II ASUS, sehingga pengguna dapat selalu masuk ke sistem hanya dalam 2 detik selayaknya mengoperasikan smartphone Peluncuran Asus Zenbook di Indonesia dihadiri pejabat Asus tingkat global dan Intel yakni Mr Rex Lee, Asus South East Asia Regional Director bersama Mr Santhosh Viswanathan, Intel Indonesia Chief Representative. “ASUS Zenbook hadir dengan tidak hanya memenuhi definisi Ultrabook pada umumnya. Tim riset dan pengembangan kami dengan disiplin mengaplikasikan empat prinsip utama Asus Zenbook sehingga dapat tampil demikian istimewa dan memancarkan keseimbangan yang sempurna antara keindahan dan kekuatan dalam sebuah Ultrabook. Empat prinsip utama yang mendasari pengembangan Asus Zenbook adalah pure design, kinerja tak tertandingi, ramah

lingkungandanaudiomenakjubkan,” ungkap Rex Lee. AsusZenbookmerupakanperpaduan antara seni dan teknologi. Lapisan panel luar berwarna perak dengan pola lingkaran konsentrik yang melambangkan bias lingkaran cahaya halo yang menghadirkan semangat. Dengan ketebalan hanya 0,11 inci (3mm) di bagian depan dan 0,35 inci (9mm) pada bagian belakang, garis ekterior yang elegan, menjadikan Zenbook sebagai ultrabook tertipis yang ada dan sempurna bagi para pengguna yang sering bepergian atau pun saat digunakan dalam ruangan. Asus Zenbook hadir sebagai notebook pertama di dunia dengan Panel NITS dengan tingkat kecerahan 450cd/m2 setara LCD TV dan membuat area yang gelap menjadi lebih terang dengan detail yang memukau. Selain itu Zenbook juga merupakan notebook 13,3 inci pertama di dunia dengan layar HD Plus beresolusi 1.600 x 900. Kinerja Tak Tertandingi Ze-

nbook dirancang untuk membawakan kenyamanan komputansi yang responsif seperti smartphone melalui fitur instanton yang dapat selalu masuk ke sistem hanya dalam 2 detik dan mampu standby hingga 2 minggu, empat kali lebih lama dari standar industri. Meskipun ramping dan tampil elegan, Zenbook dilengkapi sekumpulan terobosan-terobosan teknologi yang mengagumkan dan tidak tertandingi. Zenbook merupakan notebook pertama yang mengaplikasikan teknologi SATA Revisi 3.0 solid state storage (SSD) dengan kecepatan 6Gb/ detik dan daya tahan guncangan yang lebih kuat dibandingkan harddisk biasa (HDD). Diperkuat dengan prosesor Core generasi kedua terbaru dari Intel (optimal untuk penggunaan mobile), Bluetooth V4.0 and USB 3.0. Asus juga menambahkan teknologi USB Charger+, menggunakan port USB 3.0 untuk recharge perangkat portable dengan lebih cepat. (r/*)

JAKARTA - Gelombang penyegaran bisnis Badan Usaha Milik Negara (BUMN) mulai menyentuh sektor perhotelan. PT Hotel Indonesia Natour mulai disiapkan untuk makin agresif. Deputi Menteri BUMN Bidang Jasa dan Perbankan Parikesit Suprapto mengatakan, Hotel Indonesia Natour tengah menyiapkan sinergi dengan BUMN-BUMN lain. “Salah satu yang digarap adalah sinergi dengan Garuda Indonesia,” ujarnya di Kantor Kementerian BUMN kemarin (11/11). Dalam sinergi tersebut, Hotel Indonesia Natour akan meng-

gandeng Garuda dalam program marketing. Selain Garuda, hotel pelat merah itu juga akan menggandeng badan-badan turisme di wilayah yang terdapat jaringan Hotel Indonesia Natour. “Misalnya Bali Tourism Board,” katanya. Selain Hotel Indonesia di Jakarta yang kini dikerjasamakan dengan Kempinski, Hotel Indonesia Natour memiliki jaringan 12 hotel berbintang 3, 4, dan 5, yang tersebar di beberapa kota besar. Dua hotel bintang 5 terdapat di Bali, yakni Inna Grand Bali Beach (Sanur) dan Inna Putri Bali (Nusa Dua). Sedangkan yang

berbintang 4 ada hotel, yakni Inna Kuta Beach (Kuta), Inna Muara (Padang), Inna Garuda (Yogyakarta),danInnaSamudera Beach (Pelabuhan Ratu). Sedangkan 6 hotel lainnya berbintang 3, yakni Inna Shindu Beach (Sanur), Inna Bali (Denpasar),InnaSimpang(Surabaya), Inna Tretes (Jatim), Inna Parapat (Danau Toba), dan Inna Dharma Deli (Medan). Menurut Parikesit, untuk menggenjot kinerja BUMN perhotelan tersebut, posisi direktur utama yang saat ini masih kosong setelah pengunduran diri Hery Angligan. (owi)

BUMN Hotel Makin Agresif


Pontianak Post

Pontianak Post

Sabtu 12 November 2011


Romantic Barbeque Dinner MENIKMATI pemandangan keseluruhan Kota Pontianak dan momentum sunset sambil menyantap hidangan barbeque super lezat bersama keluarga yang dibuat oleh chef handal dengan harga ekonomis mungkin adalah impian semua orang. ISTIMEWA Oleh karena itu, RAMAH: Segenap karyawan dan manajemen manajemen Hotel Santika akan melayani dengan ramah dan proSantika Pontianak fesional sehingga Anda betah berlama-lama di berusaha untuk memenuhi impian terse- hotel ini. but dengan menyuguhkan promo dapatkan paket promo spa khusus ‘”Romantic Barbeque Dinner” untuk Traditional Massage untuk 2 orang, 4 orang hanya seharga Rp240.000- Paket ini dapst diperoleh dengan nett. Tidak hanya itu bagi Anda yang harga Rp240,000,-nett hanya di Hotel butuh rneralaksasi tubuh Anda yang Santika Pontianak, Jalan Diponegoro lelah setelah seharian beraktifitas, Nomor 46 Pontianak. (r/*)


Diskon 30% Dim Sum Setiap Hari ASTON Pontianak kembali menggelar promo bagi Anda penikmat kuliner dengan harga yang sangat terjangkau. Sebagai salah satu ikon dari Hotel bertaraf International di Kalimantan Barat, Aston Pontianak mempersembahkan diskon 30% untuk dim sum. Tak hanya apik meracik bumbu MUJADI/PONTIANAK POST masakan, para chef profe- MENARIK: Ruangan yang didesain mesional di Aston Pontianak narik pastinya menambah selera makan siap menyajikan menuAnda ketika bersantap di Aston. menu dim sum segar dengan kualitas terbaik. rangkaian waktu yang dikemas Bambang Wijanarko selaku Direc- sedemikian rupa promo dim sum tor of Sales & Marketing menegaskan, ini sangat cocok bagi Anda yang AstonPontianakmemangmengemas tidak sempat sarapan pagi di rumah. promo-promo sesuai keinginan kon- “Tak hanya sekadar untuk sarapan sumen dan meningkatkan predikat pagi, promo dim sum ini juga cocok Aston Pontianak sebagai hotel bin- bagi eksekutif muda yang bergelut tang empat di Kalimantan Barat. di dunia bisnis sebagai ajang ramah Promo dim sum ini dapat dinikma- tamah kepada klien,” ujar R Mulyadi, ti dari semua kalangan setiap hari public Relation Officer Hotel Aston mulai pukul 07.00-14.00. Dengan Pontianak. (bdi)

Sabtu 12 November 2011


manfaatkanlah kesempatan emas yang hadir setahun sekali ini untuk berbelanja atau mendapatkan penawaran diskon super hemat di tempat-tempat yang menjalin kerjasama menye-

BINGUNG mencari celana buat jagoan kecil Anda? Kini Mitra Anda hadir untuk memenuhi kebutuhan sang buah hati. Celana jeans dengan beraneka merek akan menjadi pilihan anda di Mitra Anda. Mulai dari owneer, ND kids, Zufano, Xtron dan masih banyak lagi merk yang ditawarkan. Semua dapat Anda pilih sesuai dengan kebutuhan jagoan kecil. Untuk model celana, Mitra Anda memberikan banyak pilihan, begitu juga dengan warna. Selain itu, harga yang ditawarkan pun tidak akan membuat Anda khawatir. Mitra Anda memberikan diskon 20 persen ke hampir semua celana jeans anak laki-laki. Jadi Anda tidak perlu takut dan bingung untuk mencari celana buat si jagoan kecil. Kunjungi saja Mitra Anda karena semuanya telah tersedia. (eci)



Tawarkan Banyak Pilihan

marakkan gawean ini. Dan jangan lupa. Kumpulkan juga bukti pembayaran/pembelian barang/ tiket di setiap tempat peserta PSF (yang ada di bagian bawah halaman ini).

PROMO maskapai penerbangan Kalstar masih berlaku. Walau hari jadi Pontianak berlalu, Kalstar memeriahkannyadengan berbagai promo. Salah

satunya Kalstar memberikan potongan harga bagi mereka yang tanggal kelahirannya sama dengan HUT Pontianak, yakni 23 Oktober. “Kalstar

akan memberikan harga spesial bagi yang lahir pada 23 Oktober. Mereka bisa membeli tiket Kalstar Pontianak-Jakarta dengan harga Rp240 ribu,”

Celana untuk Jagoan Kecil

PERMAINAN: Beragam jenis permainan hadir untuk mengisi waktu luang Anda bersama keluarga di Fun Station.

TIDAK sulit menemukan Hotel Gajahmada yang terletak di tengah Kota Pontianak, tepatnya di Jalan Gajah Mada Pontianak nomor 177-183. Waktu tempuh dari Bandara Supadio menuju hotel hanya berselang 25 menit. Posisinya yang strategis membuat hotel ini menjadi tujuan wisatawan maupun tamu yang berkunjung di Kota Pontianak. Tak hanya lokasi yang strategis, Gajahmada Hotel juga menawarkan berbagai fasilitas. Hotel Gajahmada memberikan harga promo kamar untuk menyambut ulang tahun ke-240 Pontianak. Pengunjung bisa mendapatkan kamar dengan harga mulai dari Rp280.140. Kendati menawarkan harga promo, Anda yang menginap di hotel yang berada di pu-

Dapatkan Potongan Harga


sat kota tersebut tetap mendapatkan pelayanan maksimal. Hotel Gajahmada memiliki 110 kamar yang modern. Interior kamar elegan, dan dilengkapi fasilitas sehingga membuat pengunjung dapat beristirahat dengan nyaman. Ada berbagai pilihan kamar, yakni Gajahmada Suite, family suite, eksekutif kamar, kamar superior, kamar standar, dan kamar moderat. Bagi pengunjung yang ingin berolahraga atau gym tersedia The Rox, yakni fitnes centre. The Rox disediakan bagi tamu hotel maupun pengguna regular yang menjadi member gym di Hotel Gajahmada. Anda menjadi member The Rox Fitnes Centre Gajahmada Hotel dengan harga Rp225 ribu perbulan. (den/eci)

Soalnya, jika Anda berbelanja setiap kelipatan Rp100 ribu, Anda bisa memenangkan hadiah utama satu unit Yamaha Mio dengan mengirimkan bukti itu plus kupon PSF belanja ber-


CELANA ANAK: Mitra Anda memberikan diskon 20 persen hampir semua celana jeans anak laki-laki.



PROMO: Hotel Gajahmada menawarkan berbagai fasilitas menarik selama promo Pontianak Shopping Festival ini.

PSF Besok Berakhir AJANG akbar Pontianak Shopping Festival (PSF) yang dihelat sebulan penuh guna menyemarakkan ulang tahun ke-240 Kota Pontianak akan berakhir besok (Minggu). Karena itu,


Games Asyik di Fun Station INGIN memanjakan dan menyenangkan anak-anak Anda? Fun Station tempatnya. Beragam jenis permainan hadir untuk mengisi waktu luang. Tidak hanya bagi anak-anak, orang dewasa pun dapat bersenangsenang disini dengan memanfaatkan fasilitas games yang menarik. Demi memeriahkan hari jadi ke240 Kota Pontianak, pihak pengelola terus memberi pelayanan menarik kepada seumlah pengunjung. Tidak hanya games menarik, pihaknya juga akan memberikan harga sesuai dengan ekonomi masyarakat Kalbar. Bingung untuk mengisi waktu liburan? Segera kunjungi Fun Station di lantai III Mal Matahari, Jalan Jenderal Urip. (rmn)

hadiah yang ada di sudut halaman koran kesayangan Anda ini. Kuitansi/bukti pembayaran/belanja yang telah dilampirkan kupon tersebut dimasukkan ke dalam kotak

yang ada di setiap supermarket/mal yang ada atau langsung ke Pontianak Post. Untuk itu, jangan lewatkan kesempatan emas ini sebelum waktu promo berakhir. (r/*)


HAMPIR seluruh aneka produk di Supermarket Garuda Mitra hadir untuk memanjakan konsumen menyambut hari jadi ke-240 Kota Pontianak. Lantaran hampir menyeluruh dijual dengan harga diskon. Maka harga pembelian dipastikan terjangkau karena lebih murah dari hari biasa. Tawaran yang diberikan yakni untuk produk aneka perabot. Antara lain seperti panci Jawa. Kisaran diskon mencapai 20 persen. Produk tersebut semua dipajang di lantai I. Dan, konsumen tinggal memilih. Sesuai keinginan dan selera dengan

harga yang lebih murah, dengan adanya diskon. Diskon juga untuk barang elektronik. Meliputi, telepon rumah ditawarkan dengan diskon sebesar 20 persen. Kemudian lampu bergaransi dan DVD diberikan diskon 10 persen untuk setiap pembeliannya. Sementara Departemen Store menyuguhkan diskon hingga 30 persen. Seluruh produk yang diinginkan ditawarkan jauh lebih murah ketimbang hari biasa. Sepenuhnya menjadi kesempatan bagi pelanggan dan sayang apabila harus dilewatkan. (stm)


ELEKTRONIK: Diskon untuk barang elektronik seperti lampu bergaransi, DVD, hingga telepon rumah.

ungkap Kepala Cabang Kalstar Pontianak Mursalin. Kalstar juga tengah menggelar promo besarbesaran. Penerbangan

yang dikenal tepat waktu ini menyiapkan lebih banyak tempat duduk untuk harga Rp334 ribu rute Pontianak-Jakarta. Pun dengan Pontianak-

Kuching, Kalstar hanya memasang harga Rp670 ribu pulang pergi. “Promo ini berlaku sejak 8 Oktober hingga 15 November,” paparnya. (hen)



Pontianak Post l Sabtu 12 November 2011

Tiongkok Tolak Beri Sanksi Iran BANJIR: Seorang bocah lelaki duduk dengan piring kosong di atas rakit darurat, di pinggiran Kota Bangkok. Ia dan warga lainnya menunggu bantuan makanan.

Reuters / Damir Sagolj

AS Kesampingkan Serangan Militer ke Iran AMERIKA-Menteri Pertahanan Amerika Serikat, Leon Panetta, mengatakan serangan militer ke Iran sangat mungkin menghasilkan konsekuensi yang tidak diharapkan. Panetta mengatakan hasil terbaik serangan militer hanya akan menghentikan program nuklir Iran untuk sementara maksimal selama tiga tahun. “Dan yang lebih penting, serangan militer bisa memberikan dampak serius untuk

kawasan dan kekuatan Amerika Serikat di Timur Tengah,” kata Panetta kepada wartawan. Panetta menambahkan serangan militer tetap dipikirkan sebagai opsi terakhir. Amerika Serikat, kata dia, lebih memilih pemberian sanksi yang lebih berat untuk Iran. “Sangat penting bagi AS untuk memastikan pemberian sanksi ekonomi dan tekanan diplomatik yang lebih kuat terhadap Iran agar negara itu mengubah

sikap,” kata Panetta. “Kami tengah mendiskusikan dengan para sekutu tentang sanksi tambahan bagi Iran,” sambung Panetta. Uni Eropa kemungkinan akan menyetujui sanksi terbaru untuk Iran dalam beberapa pekan ke depan setelah tim pencari fakta PBB menyatakan Teheran memang tengah mempersiapkan senjata nuklir. Sementara wartawan BBC di Washington Zoe Conway mengatakan pernyataan Panetta itu

bertentangan dengan sejumlah politisi AS yang menyetujui opsi serangan militer terhadap Iran. Spekulasi terus soal kemungkinan Amerika Serikat atau Israel melakukan serangan militer ke Iran terus merebak di media massa kedua negara. Sedangkan Iran terus membantah bahwa negeri itu tengah mengembangkan persenjataan nuklir. Iran menegaskan nuklir dikembangkan untuk keperluan damai. Dalam laporan terakhirnya,

Badan Tenaga Atom Internasional (IAEA) mengatakan telah mendapat informasi bahwa Iran telah melakukan tes yang diperkirakan untuk mengembangkan persenjataan nuklir. IAEA mengatakan penelitian itu termasuk model komputer yang hanya digunakan untuk mengembangkan pemicu peledak nuklir. Teheran menolak hasil laporan itu dan menuding hasil temuan IAEA sarat muatan politik.(bbc)

BEIJING - Iran kembali mendapat dukungan dari Tiongkok terkait program nuklirnya. Beijing menyatakan, penjatuhan sanksi tidak akan menyelesaikan masalah nuklir Negeri Para Mullah tersebut. Kementerian Luar Negeri Tiongkok mengimbau agar jalur dialog dikedepankan untuk menghindari efek negatif dari penjatuhan sanksi. “Sanksi tak akan menyelesaikan isu nuklir Iran secara mendasar. Dialog dan negosiasi adalah jalan terbaik,” jelas Juru Bicara Kementerian Luar Negeri Tiongkok Hong Lei. “Tekanan yang diperlukan saat ini adalah upaya diplomatik untuk meminta Iran duduk kembali berdialog dengan enam pihak (P5+1),” desak Hong yang merujuk dialog antara Teheran dan lima anggota permanen Dewan Keamanan PBB plus Jerman. Badan Energi Atom Internasional (IAEA), Selasa (8/11) mengungkapkan telah mendapatkan data intelijen terpercaya yang membuktikan bahwa Iran mempunyai kemampuan membuat senjata nuklir. Data tersebut untuk kali pertama mendukung klaim Israel dan Amerika Serikat. “IAEA harus mengklarifikasi laporan tersebut secara tepat dan objektif melalui kerjasama dengan Iran,” tambah Hong. AS, Rabu (9/11) mengancam bakal tekanan lebih kuat kepada Teheran terkait laporan IAEA tersebut. Sementara Rusia menegaskan menolak usulan penjatuhan sanksi baru.

“(Laporan) itu adalah dugaan serius, tuduhan serius, dan ini adalah kesempatan terakhir pemerintah Iran bisa berhubungan IAEA dengan cara transparan dan kredibel,” terang Juru Bicara Departemen Luar Negeri AS Mark Toner. Pemerintahan Presiden Barack Obama akan berkonsultasi dengan negara sekutu untuk mencari dukungan pemberlakuan sanksi tambahan kepada Iran. Toner menyatakan, Washington telah menyiapkan sejumlah opsi sanksi untuk Iran. Sementara, Prancis dan Inggris bergabung dengan AS untuk menyerukan penjatuhan sanksi lebih tegas kepada Iran. Iran telah mendapat sanksi melalui resolusi DK PBB sebagai buntut dari program nuklirnya. Sudah empat kali DK PBB mengeluarkan resolusi untuk menyansi Teheran. Yang terakhir pada Juni 2010, dalam sebuah resolusi yang memperluas embargo senjata dan melarang negera tersebut melakukan aktivitas sensitif, seperti pengayaan uranium. Sementara itu, Teheran menyatakan siap untuk kembali berdialog terkait program nuklirnya, selama mereka diperlakukan secara hormat dan setara. Sebelumnya, Presiden Mahmud Ahmadinejad menegaskan tidak akan mundur sejengkal pun untuk mempertahankan program nuklirnya. Dia kembali menyatakan bahwa program nuklirnya untuk tujuan damai dan memproduksi listrik bagi rakyat sipil. (AP/AFP/cak/ ami)

Prajurit AS Divonis Bersalah Taliban Rajam Dua Perempuan Sampai Tewas Bunuh Tiga Warga Afghanistan

AMERIKA-Mahkamah militer Amerika Serikat akhirnya memutuskan Sersan Calvin Gibbs bersalah dalam kematian tiga warga sipil Afghanistan, di Provinsi Kandahar, awal tahun 2010. Juri membutuhkan waktu hingga empat jam sebelum akhirnya memutuskan Gibbs bersalah dan dijerat 15 jenis dakwaan. Gibbs, 26, mengakui telah memotong dan menyimpan jari-jari tiga warga yang tewas itu sebagai kenang-kenangan. Namun dia bersikukuh hanya membalas tembakan dan tidak pernah melakukan pembunuhan warga sipil. Sejauh ini Gibbs yang berasal dari Billings, Montana adalah anggota militer dengan pangkat tertinggi yang divonis bersalah melakukan pembunuhan. Dengan keputusan pengadi-

lan ini, maka Gibbs terancam hukuman penjara seumur tanpa kemungkinan pembebasan bersyarat. Sebelumnya tiga rekan Gibbs sudah diadili dan mengaku bersalah. Dan dua orang diantaranya memberikan kesaksian yang memberatkan Gibbs. Tetapi, pengacara Gibbs mengatakan tiga rekan Gibbs itu bersekongkol melimpahkan kesalahan mereka kepada Gibbs. Penyelidikan atas kasus ini dimulai dengan menyelidiki Brigade Stryker ke-5, unit tempur Gibbs yang diterjunkan di Afghanistan. Jaksa menyatakan unit ini kemudian bertindak di luar kendali termasuk mengisap hasis, mengambil foto jenazah warga Afghanistan dan memukuli sesama prajurit yang melaporkan penggunaan obat-obatan terlarang.Salah satu anggota tim, Adam Winfield memberi tahu orang tuanya saat pembunuhan warga Afghanistan pertama terjadi dan mengatakan masih banyak pembunuhan akan di-

lakukan. Di muka pengadilan Winfield mengaku bersalah atas pembunuhan tak berencana dan menerima pengurangan hukuman. Dia juga bersaksi bahwa Gibbs akan membunuhnya jika tak terlibat dalam aksi kekerasan itu. Kesaksian lain diperoleh dari Jeremy Morlock yang menerima hukuman 24 tahun penjara atas aksi kekerasan itu. Menurut Morlock, saat Gibbs bergabung pada 2010, dia sudah berencana membunuh warga sipil.Morlock juga bersaksi Gibbs bahkan menggunakan granat terhadap kedua korban serta meletakkan senapan AK-47 di tubuh korban agar terkesan bahwa mereka adalah anggota kelompok bersenjata. Kejadian ini terjadi pada patroli rutin di Kandahar pada awal tahun 2010. Pada Maret 2011, sejumlah foto dipublikasikan menunjukkan para prajurit berpose dengan mayat warga Afghanistan yang baru saja mereka bunuh.(bbc)

GHAZNI-Sekelompok laki-laki bersenjata melempari seorang perempuan dan anak perempuannya dengan batu hingga tewas di provinsi Ghazni, Afghanistan kata pejabat keamanan setempat. Menurut pemerintah lokal, kelompok Taliban mendalangi aksi penyiksaan ini yang menuding dua korban tersebut melakukan tindak “kemerosotan moral dan perselingkuhan”. Insiden memilukan ini terjadi Kamis (10/11), di wilayah Kha-

waja Hakim kota Ghazni, lokasi dimana dua perempuan itu tinggal. Polisi mengatakan dua lakilaki telah ditahan terkait dengan pembunuhan ini. Menurut pejabat kemanan kejadian dimulai saat sekelompok pria bersenjata masuk rumah dimana seorang janda muda dan anak perempuannya yang naas itu tinggal. Mereka menyeret keduanya keluar rumah dan langsung merajam keduanya hingga tewas. “Tetangga tidak membela atau

memberitahu aparat pada waktunya,” kilah seorang pejabat. Menurut sejumlah pejabat setempat dalam beberapa bulan terakhir pemuka agama di kota itu telah mengeluarkan fatwa yang menyerukan agar warga melaporkan siapapun yang “terlibat perselingkuhan”. Bulan Oktober lalu, seorang perempuan yang dituduh melakukan pembunuhan terhadap ibu mertuanya dibunuh oleh pengikut Taliban di Ghazni.

Dalam tahun-tahun terakhir ini, pengikut Taliban di Ghazni mengalami peningkatan cukup besar. Kota ini terletak pada titik strategis antara Kabul dan Kandahar, di mana sebelumnya provinsi Ghazni adalah pusat dagang antar wilayah. Menurut wartawan BBC di Kabul, Bilal Sarwary, militan Taliban kini menguasai sebagian besar wilayah itu dimana hanya tujuh dari 18 distrik setempat dikontrol pemerintah Afghanistan.(bbc)

Frustrasi Jadi Orang Kantoran, Telurkan Puluhan Penulis Buku Sambungan dari halaman 1

internet yang pertama di Indonesia,’’ kata Jonru bangga. ’’ juga menjadi website penulis terbesar dengan pengunjung paling banyak,’’ imbuhnya. Sudah lama Jonru tertarik dengan aktivitas penulisan. Selama menjadi mahasiswa akuntansi di Fakultas Ekonomi Universitas Diponegoro, Semarang, Jonru yang lulus pada 1998 itu aktif di pers kampus. Banyak tulisannya, terutama cerpen, yang dimuat di koran dan majalah. Bahkan, pada 2005, dua buku Jonru sukses beredar di pasaran. Salah satu di antaranya adalah kumpulan cerpen Cowok di Seberang Jendela yang diterbitkan Lingkar Pena Publishing House dan novel Cinta Tak Terlerai diterbitkan Mizan. Perkenalannya dengan desain web dan grafis dimulai awal 2000 di Jakarta. Kebetulan dia diterima menjadi content editor untuk sebuah perusahaan internet service provider. Di sela-sela rutinitas kerja, Jonru ’’mencuri ilmu’’ untuk membuat web yang menarik. ’’Saya pernah bermimpi punya media sendiri. Tapi, untu media cetak modalnya kan besar sekali. Akhirnya, lewat internet, saya bikin portal sendiri. Makanya, lahirlah,’’ ceritanya. Lewat website, Jonru sekaligus merusaha mempromosikan bisnis pembuatan company profile. Cuma karena minim pengalaman dan belum punya portofolio yang cukup meyakinkan, bisnis yang dirintisnya itu tak berhasil meraih konsumen. Meski demikian, website tetap bertahan. Salah satu di antaranya karena Jonru sendiri yang rajin mem-posting tulisannya ke web tersebut. Sejak 2003, Jonru terpikir untuk menampung tulisan dari penulis lain. Kriterianya tak terlalu ketat. Yang penting ’’bisa dibaca’’. Temanya juga boleh apa saja, mulai soal politik hingga tip-tip unik. Hingga beberapa tahun, Jonru sempat kebanjiran artikel. Milis yang dibuatnya juga ramai dikunjungi. ’’Saking larisnya, se-

hari bisa sampai 20 orang yang kirim tulisan,’’ ungkap Jonru. Ketika blog sudah mewabah, artikel yang diterima Jonru terus menurun. ’’Sekitar 2010, dalam seminggu, paling dua tulisan yang masuk,’’ kata pria kelahiran Kabanjahe, Sumatera Utara, 7 Desember 1970, itu. Setelah tujuh tahun bekerja sebagai content editor di dua perusahaan yang berbeda, Jonru mencapai puncak rasa jenuhnya. Sebenarnya sudah tiga tahun rasa bosan itu menghantui Jonru. Namun, sang istri, Alifia Rasyida, belum merestui Jonru berhenti bekerja sebagai ’’orang kantoran’’. Jonru akhirnya mengalah. ’’Istri bilang jangan sekarang,’’ kenang ayah tiga anak itu. Menginjak 2007, Jonru semakin malas bekerja. Bukan gaji yang menjadi persoalan. Jonru pada dasarnya tidak suka bekerja untuk orang lain. Selain itu, pekerjaan sebagai content editor terasa monoton. ’’Kebanyakan tinggal copy paste artikel yang terkait perusahaan dan memasangnya di portal. Kalaupun ada tulisan sendiri, hanya sesekali. Keterampilan menjadi tidak optimal. Tidak ada tantangan,’’ ceritanya. Kinerja Jonru di perusahaan menurun drastis. Bahkan, dia sudah menerima surat peringatan dua kali. ’’Kalau tetap bertahan, paling September 2007 sudah di PHK. Nah, daripada di PHK, lebih baik keluar,’’ ujarnya, lantas tersenyum kecut. Keberanian Jonru meninggalkan pekerjaannya semakin termotivasi setelah dia mendapat tawaran dari seorang rekannya untuk menggarap proyek pembuatan website Departemen Agama. Merasa fee yang ditawarkan terbilang lumayan besar, Jonru memutuskan keluar dari perusahaannya. Hari bersejarah itu adalah 19 Maret 2007. Tapi, malang buat Jonru. Proyek yang dijanjikan tak kunjung konkret. Sementara website penulislepas. com belum memberinya income yang signifikan. Selama tujuh tahun berdiri baru sekali ada yang memasang iklan. Harganya pun hanya Rp 500 ribu. Oleh Jonru, uang itu lantas dibagikan ke se-

jumlah penulis yang rutin mengirimkan tulisan ke website. Tapi, Jonru tak mengeluh. Meski sempat bingung, dia tetap optimistis. Di tengah situasi yang terpepet dan uang tabungan menipis, Jonru mendapat ide mendirikan sekolah menulis online (SMO). Selama mengelola website, kata Jonru, banyak orang mengeluh mengapa latihan penulisan kebanyakan di Jakarta. Dia lantas terpikir untuk membuat pelatihan penulisan yang bisa menjangkau semua orang. ’’Sewaktu mulai dibuka pada Agustus 2007, yang daftar 35 orang. Karena masih baru dan belum tahu bakal laku, saya hanya mematok tarif Rp 95 ribu per bulan untuk setiap orang,’’ tuturnya. Durasi pelatihan sekaligus ’’pendampingan’’ dilakukan selama enam bulan. Kurikulum pelatihan dibuat berdasar pengalaman Jonru sendiri yang pernah mengisi sejumlah pelatihan menulis. ’’Saya kirim silabusnya lewat email. Kemudian, peserta pelatihan harus membuat tulisan yang dikonsultasikan kepada saya secara online,’’ tuturnya. Pada 2008, buku Jonru yang berjudul Menerbitkan Buku Itu Gampang dicetak penerbit Tiga Serangkai. Seperti judul buku itu, puluhan alumnus SMO yang ’’berguru’’ kepada Jonru juga sukses menerbitkan buku. Sebut saja Ning Harmanto, pendiri PT Mahkota Dewa, yang telah menulis 18 buku mengenai herbal. ’’Beliau angkatan pertama SMO tahun 2007,’’ kata Jonru. Ada juga Hartati Nur Wijaya, orang Indonesia yang tinggal di Yunani. Hingga sekarang, menurut Jonru, Hartati telah menerbitkan enam buku. Ada soal perkawinan antarbangsa, cara mencegah penyakit kanker, hingga cara mencegah selingkuh dan cerai. Sedangkan Syasya Azisya melahirkan buku berjudul Rich Mom, Poor Mom. ’’Buku Faiz Yusuf yang berjudul Rahasia Jadi Entrepreneur Muda juga langsung best seller,’’ ujar Jonru yang baru saja merilis buku keempatnya, Cara Dahsyat Menjadi Penulis Hebat.

Kerja keras dan konsistensi Jonru kini mulai membuahkan hasil. Sejak awal 2011, SMO resmi melebur ke Manajemen Oxford Course Indonesia, sebuah lembaga penyelenggara kursus bahasa Inggris pertama di Indonesia. SMO lantas berubah nama menjadi Writers Academy dan Jonru langsung dipercaya menjadi CEO. Tapi, apa hubungan lembaga bahasa Inggris dengan pelatihan penulisan? Jonru menjelaskan, Bambang Marsono, pendiri Manajemen Oxford Course Indonesia, memang memiliki passion di bidang pendidikan. Semua usahanya bahkan bergerak di bidang itu. Ketika mendengar kiprah SMO, Bambang merasa tertarik. ’’Kapan lagi bisa bekerja sama dengan perusahaan besar. Maka, jadilah,’’ kata Jonru, lantas tertawa lepas. Sekarang konsep website telah dirombak. Kalau dulu tulisan apa saja bisa masuk, kini temanya khusus terkait penulisan saja. Konstributor tulisan juga dibatasi hanya untuk alumni SMO dan Writers Academy yang sudah menerbitkan buku. ’’Sebagai kompensasi, saya beri keleluasan kalau mau promosi bukunya, tidak bayar,’’ ujarnya. Dengan berubah menjadi Writers Academy, fokus Jonru sekarang adalah kelas tatap muka. ’’Sekarang saya tidak bingung tempat lagi. Saya bisa menggunakan cabang Oxford Course se-Indonesia.’’ Kelas online tetap dibuka, namun bukan lagi prioritas. Apalagi, pesaing pelatihan menulis secara online sudah semakin banyak. Di lain sisi, orang yang ingin belajar menulis secara online terus berkurang. ’’Banyak alumni SMO yang sekarang juga mendirikan bisnis yang sama,’’ kata Jonru. Sejak SMO berubah nama menjadi Writers Academy, Jonru sudah mengadakan empat angkatan pelatihan menulis. Peminatnya lumayan banyak. Untuk kelas pemula, tarifnya Rp 495 ribu. ’’Sementara pelatihannya masih di Jakarta. Jangka panjang se-Indonesia,’’ ujarnya.(nw)

Pontianak Post



Sabtu 12 November 2011


Nazaruddin Terancam Kasus Pencucian Uang JAKARTA – Komisi Pemberantasan Korupsi (KPK) menyatakan bahwa Muhammad Nazaruddin tidak dijerat UU Tindak Pidana Pencucian Uang (TPPU) dalam kasus suap wisma atlet. Namun, lembaga yang dipimpin Busyro Muqoddas itu telah mempersiapkan UU itu untuk kasuskasus Nazaruddin yang lain. ’’Kasus suap wisma atlet sudah jelas penyuapan. Tidak bisa didorong ke tindak pidana pencucian uang,’’ kata Juru Bicara KPK Johan Budi di kantornya kemarin (11/11).

Menurut dia, KPK memang sangat berhati-hati menerapkan pasal pencucian uang kepada para tersangka, termasuk Nazaruddin. Johan lantas menerangkan, berdasar undang-undang, sebelum menerapkan pasal pencucian uang, penegak hukum harus menemukan apakah ada uang negara yang dikorupsi itu digunakan untuk hal-hal lain. Kalau memang uang yang digunakan untuk mengeruk keuntungan dengan menggunakan cara lain itu berasal dari uang korupsi,

KPK akan menerapkan UU TPPU. Nah, karena itu, pihaknya kini menanti pengembangan kasus suap wisma atlet. Sebab, apabila nanti terbukti uang yang diperoleh dari kasus suap wisma atlet itu digunakan Nazaruddin untuk hal-hal lain, tidak tertutup kemungkinan KPK bakal menggunakan pasal pencucian uang. Salah satu yang ditunggutunggu KPK adalah pengembangan persidangan Nazaruddin yang tidak lama lagi digelar di Pengadilan Tindak Pidana

Korupsi (Tipikor) Jakarta. Sebab, selain meneruskan penyelidikan kasus Nazaruddin, di persidangan biasanya akan terungkap hal-hal yang selama ini ditutup-tutupi. ’’Meski bukan fakta hukum, fakta persidangan akan tetap kami kembangkan,’’ kata Johan. Sementara itu, Ketua KPK Busyro Muqoddas meminta Nazaruddin mengungkapkan semua yang diketahuinya dalam persidangan. ’’Mudahmudahan dia mau blak-blakan di persidangan,’’ kata Busyro kemarin. Selama diperiksa,

catatan waktu 4 menit, 16 detik. Setelah itu, kolaborasinya dengan Anwar Tarra di nomor cano 2 putra 1000 meter juga berhasil memberikan keping emas bagi Merah Putih. “Cuaca sangat terik. Ini jauh sangat melelahkan. Bukan saja harus mengalahkan musuh, tetapijugakondisiairdanangin,” ucap Eka. Berkat dua emas itu, untuk sementara Eka mengantongi bonus Rp 400 juta. Namun, dia tak mau jemawa dengan hasil manis tersebut. Dia ingin terus memberikan emas bagi Indonesia di sisa nomor yang masih akan diikutinya. “Saya belum tahu akan diapakan uang ini. Saya belum memikirkannya. Pikiran saya saat ini masih ada di pertandingan,” tambah Eka. Ketum PB PODSI Ahmad Sutjipto menambahkan, dua emas yang diraih di hari pertama kemarin sebenarnya meleset dari hitung-hitungannya. Pasalnya, dia menargetkan mampu meraih minimal tiga emas. Salah satunya diharapkan datang dari nomor kayak 4. Namun,

tim kayak 4 Indonesia rupanya hanya mampu merebut perak. “Ini yang namanya pertandingan. Kami sudah membuat hitung-hitungan di atas kertas. Ternyata hasil di lapangan berbeda. Tapi Thailand memang lebih bagus. Para atletnya memiliki otot yang lebih tebal. Sementara atlet kita belum,” terang Pak Cip, sapaan karibnya. Meski begitu, kegagalan di hari pertama tak menyurutkan Indonesia untuk merebut gelar juara umum di cabang tersebut. Lelaki berkaca mata itu mengatakan, target menyabet 14 dari 36 emas yang diperebutkan merupakan hal yang tak bisa ditawar-tawar lagi. Jika hal itu tercapai, anak asuh Suryadi tersebut bisa dipastikan akan menjadi juara umum. “Kalau hanya bisa merebut 10 emas tentu terlalu sedikit. Kami ingin 14 emas. Para atlet juga mesti memiliki target yang tinggi meski lawan juga hebat. Kalau atlethebatpastiakanmengharapkanlawanyangkuat.Kalauatlet tarkam pasti harapannya mendapatkan lawan yang enteng,” tegas Sutjipto.(ru)

ada kekurangan Rp30 miliar untuk penyelesaian pembangunannya,” paparnya. OSO, lanjut Sutarmidji, sudah merealisasikan komitmennya. Panitia sudah menerima transfer dana sebesar Rp17 miliar, Sutarmidjiberharapuangitubertambah. “Kami sudah menerima transfer rekening dari Pak OSO. Berharap jumlahnya bertambah lagi,” katanya. Pembangunan masjid sendiri membutuhkan dana sekitar Rp100 miliar. Untuk pembangunan fisik saja harus ada Rp84 miliar. Jika pendanaan tidak ada masalah, Sutarmidji menargetkan Mujahidin dapat selesai dibangundalamwaktu1,5tahun. “Fisik memang butuh sekitar Rp 84 miliar, jumlah itu masih

kurang karena dibutuhkan dana untuk penataan lingkungan,” ucapnya. Mencukupi kekurangan dana itu, Sutarmidji berharap masyarakat Pontianak umumnya Kalbar membantu. Dengan sumbangan masyarakat tentunya mempercepat pembangunan masjid itu. “Nanti kita juga akan mengumpulkan donatur agar ada tambahan dana. Siapa saja bolehmenyumbang,masyarakat nonmuslim juga bisa,” katanya. Selama pembangunan masyarakat dapat melaksanakan ibadah dilingkunganitu.Telahdisiapkan tempat di belakang bangunan masjid untuk melaksanakan ibadah. “Muat dua hingga tiga ribuorangtempatsementaraitu,” tutur Sutarmidji.(hen)

Thailand Kuasai Klasemen Sambungan dari halaman 1 +

di SEA Games 2011. Indikasinya terlihat di hari pertama kemarin (11/11). Pasukan Negeri Gajah Putih tampil trengginas kala mampu bertengger di pemuncak klasemen dengan raihan tiga emas serta sekeping perunggu di nomor kano dan kayak. Indonesia sendiri hanya mampu nangkring di peringkat kedua dengan raihan dua emas, dua perak serta sekeping perunggu. Myanmar duduk di urutan ketiga dengan koleksi dua perak. Thailand pun menjadi lawan yang harus diwaspadai Indonesia dalam perebutan gelar juara umum SEA Games 2011. Pesta Thailand dimulai saat Wichan Jaitieng mampu merebut emas di nomor kayak 1 putra1000meterdengancatatan waktu 3 menit 55,59 detik. Dia dibayangi atlet Singapura Lucas Teo yang membukukan catatan 04 menit 00,63 detik. Indonesia sendiri hanya mampu merebut perunggu lewat Muchlis yang mencatatkan waktu 04 menit 02,87detik.Duatambahanemas

Thailandlainnyadisumbangkan PiyaphanPhaophat/Nathaworn Waenphrom di nomor kayak 2 putra 1000 meter serta tim kayak 4 putra 1000 meter. “Ini pertandingan yang sangat ketat. Selalu tidak mudah untuk mengalahkantuanrumah.Emas ini untuk negara kami,” terang Piyaphat Phaopat, salah satu anggota tim kayak 4 putra 1000 meter Thailand saat ditemui setelah pertandingan kemarin. Indonesia sendiri mengawali kejuaraandengankurangbagus. Muchlis yang digadang-gadang mampu merebut emas ternyata gagalmenjawabtantanganberat tersebut. “Dia (Muchlis) sebenarnya bisa bersaing memperebutkan emas. Tapi ada yang salah dengan gaya bertandingnya. Mungkin karena dia bertanding pertama. Apalagi juga dia masih muda,” terang Mohammad Suryadi. Untungnya, Indonesia memiliki Eka Octarorianus. Dia akhirnya mampu menjadi penyelamat muka Indonesia kala merebut emas nomor kano 1 putra 1000 meter dengan

Panitia Terima Transfer Rp17 Miliar Sambungan dari halaman 1

ungkap Wali Kota Pontianak Sutarmidji yang jua ketua harian pembangunan Masjid Mujahidin. Ketua umum atau penanggungjawab pembangunan, Oesman Sapta Odang (OSO). Sempat tertunda setelah rencana awal peletakan batu pertama dilakukan pada 18 Ramadan lalu, kali ini dipastikan Sutarmidji hal itu tidak terulang. Dia yakin pekan depan peletakan batu pertama dilakukan. “Peletakan batu pertama sama saja dengan mulainya pembangunan. Sekarang tidak akan ditunda lagi,” katanya. Sutarmidji beralasan, tertunda beberapa bulan karena menunggu penandatanganan

kontrak antara panitia dengan kontraktor pelaksana. Sekarang tanda tangan kontrak sudah dilakukan dan perusahaan pelaksanapembangunanPTAdiKarya siap memulai pekerjaan. “Betul juga pemikiran Pak OSO, kalau belum tanda tangan kontrak pembangunan jangan dimulai dulu. Sekarang tidak ada masalah, kontrak sudah ditandatangani,” ucapnya. Saat ini panitia mengantongi uang lebih dari Rp20 miliar. Namun ada beberapa pihak yang sudah berkomitmen membantu pembangunanmasjidterbesardi Kalbar itu. Komitmen tersebut datang dari Pemprov Kalbar, Pemkot Pontianak dan OSO. “Dari tiga komitmen itu panitia akan punya Rp50 miliar, masih

Gidot Siap Bawa Perubahan Kalbar Sambungan dari halaman 1


saya tertinggi, pasti saya maju. Siapa yang tak mau jadi gubernur,” kata Gidot kepada Pontianak Post, kemarin diselasela pembukaan Pesparawi ke III Kabupaten Bengkayang di Sanggau Ledo. Sampai saat ini, Gidot mengaku, sudah enam puluh persen siap maju. Tinggal 40 persen masih menunggu survei dan DPP Partai Demokrat termasuk dari Dewan Pembina Partai Demokrat, Presiden SBY. Gidot mengaku aspirasi arus bawah menghendaki dirinya maju dalam pemilihan gubernur terus mengalir. “Ya, ada suara masyarakat yang menghendaki. Kita pun saat ini merekam suara masyarakat.Kalausudahdidukung oleh masyarakat, tentu kita siap maju dan siap menang. Tentu masyarakat inginkan ada perubahandiKalbar,”katapolitisi

yang memulai karier politik di legislatif Bengkayang ini. Sejumlah elemen masyarakat sudah bersiap-siap untuk memproklamirkan dukungan dan meminta agar Gidot bersedia mencalonkan diri. Desakan itu berasal dari kepala desa, tokoh masyarakat, tokoh pemuda, organisasi kepemudaan, kalangan akademisi dan lainnya. Mantan Wakil Bupati Bengkayang yang berpasangan dengan Jacobus Luna lima tahun lalu menjelaskan, siapa pun berhak menggunakan perahu Partai Demokrat, bila survei tinggi dan menjadi harapan masyarakat. Yang diusung adalah orang yang terbaik. Sebelumnya, Bupati Sintang Milton Crosby menegaskan, dia akan maju sebagai calon gubernur, bukan calon wakil gubernur. “Kalau saya maju, tetap KB 1. Kalau jadi wakil, lebih baik saya

tak maju,” kata Milton. Dia mengatakan, pilihan maju sebagai calon gubernur dikarenakan dirinya sudah memiliki konsep untuk membangun Kalbar. “Konsep pembanganan Kalbar sudah dibenak saya, apa modelnya.Makanya,sayaberniat maju sebagai calon gubernur,” ungkapnya. Sedangkan perwira Staf Ahli Tingkat III Bidang Komunikasi Sosial Panglima TNI, Mayjen TNI Armyn Angkasa Ali Anyang sudah menyatakan kesiapannya maju. “Saya prajurit. Kalau prajurit ikut kata komandan. Kalau komandan mengizinkan, saya siap,” tegasnya. Bagaimana peluang Morkes Effendi? Partai Golkar kini sedang melakukan inventarisasi dan menjaring tokoh-tokoh yang dianggap berpeluang untuk dicalonkan sebagai calon gubernur dan calon wakil gubernur dalam

pemilukada 2012. Selain itu, meskipun partai ini memiliki 10 kursi di DPRD Kalbar dan berhak mengusungpasangancalon,partai ini tetap terus mengupayakan adanya koalisi. Mengenai calon gubernur yang akan diusung, wakil ketua Bidang Kaderisasi dan Keanggotaan DPD Partai GolkarKalbar,AndryHudayaWijaya mengatakan, dalam forumforumresmi,dukunganterhadap Ketua Umum DPD Partai Golkar, Morkes Effendi terus mengalir dengan deras. Bahkan, atas dorongan dari para kader, yang bersangkutan pun telah menyatakan siap mencalonkandiri.Internalpartai berlambang pohon beringin ini menganggapbahwafigurMorkes Effendi adalah kader unggulan partai yang mumpuni dan sangat pantas menduduki posisi orang nomor satu di Kalbar. (zrf/zal/ ron/hen)

Banding Kandas, Susno Tak Dipenjara Sambungan dari halaman 1

”Putusan dikuatkan karena dianggap sudah benar dan tepat,” kata Ahmad Sobari, juru bicara PT DKI, di Jakarta kemarin (11/11). Putusan tersebut dikeluarkan ketua majelis hakim Roosdarmani dengan hakim anggota Widodo, As’adi Al Ma’ruf, Sudiro, dan Amiek Sumindriyatmi. Vonis itu hampir sama dengan putusan yang dikeluarkan Pengadilan Negeri (PN) Jakarta Selatan. Yakni 3,5 tahun penjara, denda Rp 200 juta, dan uang pengganti Rp4 miliar.Bedanya,hukumanpenggantijikatidakmembayardenda diturunkan dari enam bulan menjadi empat bulan. Selain itu, uang pengganti yang sebelumnya Rp4 miliar ditingkatkan menjadi Rp 4,2 miliar. cmyk

Sobari mengatakan, peningkatan uang pengganti tersebut didasarkan pada dakwaan yang disampaikan jaksa penuntut umum (JPU). Menurut dia, bisa jadi majelis hakim PN Jakarta Selatan belum secara terperinci menentukan uang pengganti. ”Majelis hakim PT menguraikan kerugiannegaralebihmendetail daripada dakwaan,” katanya. Susno, mantan Kapolda Jawa Barat itu, terbelit kasus korupsi pada penanganan perkara PT Salmah Arowana Lestari dan dana pengamanan pilkada Jawa Barat. Saat kasus tersebut mencuat, Susno menuding dua kasus itu sebagai rekayasa untuk membungkam dirinya. Alasannya, kasus dana pengamanan sudah beres dengan hasil audit dariBadanPemeriksaKeuangan (BPK) yang menyatakan tidak

ada masalah. Susno didakwa melanggar pasal 11 Undang-Undang (UU) Nomor 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi sebagaimana diubah dalam UU 20/2001 dan pasal 3 jo pasal 18 UU 31/1999 sebagaimana diubah dalam UU 20/2001 jo pasal 55 ayat ke-1 KUHP. Meski begitu, kata Sobari, majelis hakim tidak memerintahkan eksekusi terhadap putusan bernomor 35/PID/ TPK/2011/PT DKI tersebut. Karena itu, Susno belum akan ditahan. ”Kami tidak memerintahkan penahanan karena alasan kemanusiaan. Tapi, kalau sudah inkracht, mau tidak mau harus dieksekusi,” terangnya. Di bagian lain, pengacara Susno,ZulArmainAziz,mengatakan bahwa pihaknya akan mengaju-

kan kasasi ke Mahkamah Agung (MA). Namun, dia masih menunggu salinan putusan tersebut. ”Kalau benar begitu, kami akan kasasi. Kami akan cek ke PT DKI Jakarta,” tandasnya. Sementara itu, Mabes Polri masih menunggu sikap resmi Susno untuk menindaklanjuti putusan tersebut. Kadivhumas Mabes Polri Irjen Pol Saud Usman Nasution mengatakan, pihaknya siap membekingi Susno melalui Divisi Hukum Mabes Polri. ”Semua keputusan atas putusan banding itu bergantung kepada Susno sebagai terdakwa. Apakah mengajukan kasasi atau tidak. Kami siap membantu upaya hukumnya. Kami juga akan berkoordinasi dengan pengacaranya,” jelas Saud di Jakarta kemarin. (aga/ agm)

Nazaruddin terus bungkam. Hingga akhirnya, KPK tidak lagi memintai keterangan mantan bendahara umum Partai Demokrat itu. Menurut dia, keterangan Nazaruddin di persidangan

sangat penting bagi pengembangan beberapa kasus yang selama ini membelitnya. Meski begitu, kata Busyro, fakta-fakta yang ada di persidangan tidak bisa mentahmentah ditelannya. KPK, kata

dia, harus terus menelusuri keterangan itu dengan mengumpulkan bukti-bukti pendukung. ’’Jadi tidak otomotis keterangan jadi fakta hukum,’’ kata mantan ketua Komisi Yudisial itu. (kuh/iro)

Pembukaan SEA Games Spektakuler Sambungan dari halaman 1

kembang api, pengibaran bendera merah putih, dan lagu Indonesia Raya di awal acara menggelorakan seisi stadion berkapasitan 40 Ribu penonton tersebut. Acara dilanjutkan dengan serangkaian pertunjukan tari kolosal yang melibatkan sekitar 4500 penari bertema Musi-The Heart of The City karya Hartati. Dalam seremonial pertama ini mengisakan awal mula Sriwijaya. Sejak awal pertunjukkan ini, efek multimedia yang dipancarkan ke tengah lapangan begitu memukau. Tanah tampak begitu nyata retaknya, pohon dan rumput kering. Lalu berganti dengan mengalirnya sungai Musi yang membelah kota Palembang dan beberapa kota lain di Sumsel hingga kemudian ada aktivitas di pinggran Musi. Diiringi musik yang dipandu composser sekaligus arransement top Indonesia, Erwin Gutawa menjadikan penampilan ratusan penari ini begitu hidup. Tema kedua yang ditampilkan, Sriwijaya-The Golden Peninsula dengan koreografer Alex Hasyim. Ratusan penari berpakaian prajurit kerajaraan membawakan tarian dengan gerakan yang lincah dan indah. Sebagian penari menggunakan busana tradisional melakukan tarian diiringi Gending Sriwijaya dan beberapa lagu lainnya. Setelah itu tampilan Merajut Nusantara karya Dedi Puja yang menurunkan sekitar 1.000 penari. Menampilkan tarian melayu, Jawa, Boerno, dan Papua. Sepanjang penampilan taritarian ini, electric canvas yang dipasang diatas rumpun stadion Gelora Jakabaring terus berpedar. Menyajikan beragam motif, mulai dari tanah kering, air, rumput dan pepohonan hingga songket dan peta Indonesia. Acara dilanjutkan dengan pertunjukkan Reach Of The Dream Meraih Impian juga inspirasi Hartati. Melibatkan ratusan pelajar SD dari berbagai sekolah di Palembang. Mengisahkan bagaimana anak-anak ini menge-

jar impiannya menjadi pemain bola yang berlaga di kejuaraan dunia. Pada pertunjukkan itu, Indonesia menang 2-0, persis sama dengan kemenangan Timnas U-23 atas Singapura dalam pertandingan, kemarin. Setelah itu, semua yang hadir di stadion Gelora Jakabaring dihibur dengan penampilan IDEA Percussion. Tabuhan 20 beduk besar berdiameter 1,5 meter dengan berat sekitar 90 Kg mengiringi kemunculan tiga diva Asia Tenggara. Agnes Monica, KC Conception (Filipina) dan Jaclyn Victor (Malaysia), pukul 20.20 WIB. Penampilan ketiganya membawakan lagu berjudul Together We Will Shine disambut histeris puluhan ribu penonton. Lagu Yovie Widianto ini diiringi arransement musik Erwin Gutawa. Setelah penampilan ketiga diva diva, masuklah parade bendera 11 negara peserta SEA Games. Diikuti kemunculan parade ornamen dan kontingan negara-negara peserta. Dimulai dari Brunei Darussalam yang pada SEA Games 2009 di Laos berada di peringkat 10. Lalu Camboja (peringkat 9), lalu Laos (peringkat 7), Malaysia (peringkat 4), Myanmar (peringkat 8), Filipina (peringkat 5), Singapura (peringkat 6), Thailand (juara umum SEA Games XXV), Timor Leste (peringkat 11), Vietnam (peringkat 2) dan Indonesia (peringkat 3). Saat parade kontingen SEA Games inilah, hujan deras mulai turun membasahi Jakabaring sport City (JSC). Terpaksa, Ketua KONI/KOI pusat, Rita Subowo dan Menpora Andi Mallarangeng melaporkan kesiapan SEA Games dan perjuangan Indonesia menggelar event olahraga Asia Tenggara ini sambil hujan-hujanan. Meski begitu, acara pembukaan tetap berlanjut. Sebagian kecil penonton yang tak kuasa menahan hujan memang meninggalkan stadion, tapi itu tak mengurangi antusiasme penonton lain yang bertahan. Apalagi sebelumnya panitia memang telah menyediakan payung dan jas hujan sebagai souvenir pembelian tiket. Ditambah Parade kontingen

peserta SEA Games mendapat sambutan sangat meriah dari penonton. Puncaknya adalah saat kontingen Indonesia muncul di penghujung parade. Seisi stadion bersorak dan mengeluelukan rombongan atlet dan ofisial ‘Merah Putih’. Dalam sambutannya, Presiden Susilo Bambang Yudhoyono berharap ajang SEA Games ini bisa mengangkat harkat dan martabat bangsabangsa Asia Tenggara di mata dunia internasional. “Hari ini kita hadiri peristiwa bersejarah bersama-sama. Indonesia sangat bersyukur kembali dipercaya menjadi tuan rumah,” kata SBY. “Saya ucapkan selamat datang dan selamat bertanding. Dengan semangat persaudaraan dan persahabatan, mari kita sukseskan SEA Games,” tandas dia. Selanjutnya, acara yang paling dinanti pun tiba, yakni penyalaan api caldron (obor raksasa). Yang membuat prosesi ini makin menawan adalah cara penyalaannya oleh mantan ratu bulutangkis Indonesia, Susi Susanti. Dari tengah lapangan, Susi memanjat kapal Sriwijaya, lalu dia terbang menuju kaldron sambil membawa tombak yang di ujungnya menyala api SEA Games. Di bagian akhir, peraih medali emas Olimpiade 1992 ini melemparkan tombaknya dan menyala-lah api di kaldron. Keseluruhan rangkaian acara selama sekitar 2,5 jam ini ditutup dengan lagu United and Rising ciptaan SBY yang dinyanyikan oleh Joy Tobing plus pesta kembang api spektakuler. Bersatu dan Maju’, lagu ciptaan Presiden Susilo Bambang Yudhoyono (SBY) bergema di acara pembukaan SEA Games ke-26 di Stadion Gelora Sriwijaya, Palembang, Sumatera Selatan. Lagu itu menjadi penutup acara pembukaan SEA Games. Lagu yang muncul dalam album bertajuk Harmoni tersebut dinyanyikan oleh bintang Indonesian Idol Joy Tobing. Di podium VVIP, SBY tampak asyik menyimak suguhan penampilan Joy. Sementara, Ibu Negara Ani Yudhoyono sibuk memotret dengan kameranya. (mad/jpnn)


Pilih Emas daripada Saham Sambungan dari halaman 1

“Tadi kan saya nyanyi di sini dua lagu. Saya terus disuruh ikut saham gitu. Saya nggak ngerti itu apaan. Saya cuma ikut manajer saja tadi,” papar Ayu. Penyanyi yang tenar dengan lagu Alamat Palsu tersebut mengungkapkan bilang lebih suka investasi emas. Orang tuanya mendidik demikian. Apalagi, dia suka perhiasan.

Menurut Ayu, dengan membeli emas, dirinya bisa mendapatkan dua manfaat sekaligus. Emas bisa dipakai sebagai aksesori sekaligus sebagai alat investasi. “Daripada dipakai untuk beli barang yang nggak jelas, mending uangnya dipakai buat beli emas,” katanya.Ketika ditanya berapa banyak emas yang sudah dibeli, Ayu menyatakan tidak menghitung. Kalau ingin beli, dia tinggal beli. Yang

biasanya dipilih adalah emas putih. “Saya suka emas putih. Kalau berlian, saya malah nggak suka,” ujarnya. Sebagian pendapatannya bakal dikembangkan lagi melalui bisnis rumah makan. Menurutdia,sangayahsukamemasak. “Masakan ayah saya enak, lho,” tuturnya. Dia merilis single di Singapura akhir tahun ini serta meluncurkan album tahun depan. (jan/any)

Kurir Ditangkap Bawa Satu Kilogram Sabu-sabu Sambungan dari halaman 1

langsung berkoordinasi dengan pihak kepolisian Direktorat Narkotika Kalimantan Barat. Sampaisaatini,pembawabarang haram tersebut masih dimintai keterangan terkait dengan kepemilikannya. Do (24), warga asal Kecamatan Pontianak Timur ini mengaku hanya melayani jasa pengiriman barang haram tersebut. Dia mengatakan, sudah kali ketiga mengambil kotak mencurigakan. Setelah itu diberikan kepadasangpemilik.“Sayahanya disuruh mengambil barang itu di tempat biro penitipan. Saya diupah Rp500 ribu hingga Rp700 ribu setiap mengambil kotak ini,” terangnya. Untuk isi dari kemasan tersebut,pelakumengakutidakmengetahuinya. Bahkan baru mengenal sang pemilik sabu melalui jaringan ponsel. “Saya disuruh oleh Kasinah. Dia bilang, jika barang tersebut sampai ke tangannya, maka saya diupah Rp500 ribu,” kata pelaku, yang sehariharinya bekerja sebagai penyelam. Kendati demikian, sesuai dengan hukum yang berlaku, Do tetap akan diberikan sanksi tegas, terkait perantara dan membawa barang haram itu. Hingga berita ini diturunkan, pihak kepolisian masih melakukan penyelidikan secara mendalam. Kabag Bin Ops, Direktorat Narkotika Polda Kalbar, Kompol

Kariman Saragih mengatakan, pelaku diringkus saat hendak mengambil sebuah kotak mencurigakan. Dengan menggunakan sepeda motor, pelaku dengan sigap ingin segera mengirim barang haram itu kepada pemiliknya. Namun belum sempat beranjak dari tempat biro jasa pengiriman barang, dia langsung dibekuk polisi. Setelah petugas menyita kotak mencurigakan, ditemukan juga dua bingkai lukisan, yang diduga untuk menetralisir hasil scaner di bandara.Walaumampumenerobos alat pengecekkan, akhirnya kotak berisi 1 Kg sabu berhasil diamankan oleh aparat kepolisian setempat. “Narkotika jenis sabu itu pasti akan diedarkan di wilayah Kalbar,” ujar Saragih. Untuk sementara, kasus ini masih dilakukan penyelidikan secara mendalam. Jajaran Direktorat Polda Kalbar masih melakukan olah TKP, terutama terhadap barang bukti tersebut. “Kami masih melakukan pengembangan, terutama untuk identitas kepemilikan barang ini. Tersangka akan dijerat pasal 112, 115Undang-undangNo.35tahun 2009 tentang narkotika dengan ancaman hukuman diatas 10 tahun penjara,” tandasnya. Perketat Peredaran Kapolda Kalbar Brigjen Pol Unggung Cahyono memberikan apresiasi khusus kepada jajaran

anggotanya atas keberhasilan ini. Kabag Humas Polda Kalbar, AKBP Mukson Munandar menambahkan penggagalan pengiriman satu kilogram sabu-sabu ini karena aparat terus memperketat sejumlah kawasan yang menjadi pintu pasut peredaran narkotika. Kepolisian juga memberikan atensi khusus terhadap perayaan hari besar. Seperti halnya memasuki Tahun Baru 2012, jajaran pihak kepolisian telah ditugaskan sesuai dengan fungsi dan prosedur kerja yang ada. Tidak hanya itu, aparat juga akan memperketat jalur masuk antar negara dan provinsi. “Jalur udara, darat, dan laut akan terus kita siagakan. Karena peredaran narkotika partai besar sangat licikdalammenjalankanaksinya. Kita berusaha penuh untuk selalu memberikan pengamanan,” jelasnya. Apabila memang ada objek yang mau ditangkap, sambungnya, jajaran kepolisian akan selalu bekerjasama. Tindakan ini demi mempersempit jaringan para pelaku tindak kriminal. Seperti pada peredaran narkotika ini. “Kapolda telah berkomitmen, jaringan narkoba termasuk kasus yang menjadi atensi. Perlu ditekankan lagi, narkoba itu bisa kapan saja peredarannya. Bukan hanya pada hari-hari besar. Untuk itu, akan kita perketat terus pengamanannya,”tuturMukson. (rmn)



Pontianak Post

Sabtu 12 November 2011

Kamtibmas KY Sadap Hakim Tipikor Membangun Bersama Masyarakat Kerja Sama dengan KPK

JAKARTA—Komisi Yudisial (KY) akan memaksimalkan kewenangan barunya untuk melakukan penyadapan sesuai dengan ketentuan Undang-Undang 18/2011. Sasaran pertama adalah para hakim tindak pidana korupsi (tipikor). KY akan bekerja sama dengan Komisi Pemberantasan Korupsi (KPK) untuk melakukan penyadapan itu. ”Sekarang undang-undang sudah memberikan kewenangan, tidak ada halangan bagi KY (melakukan penyadapan),” ujar Taufiqurrahman Syahuri, komisioner KY, setelah diskusi di gedung parlemen, Jakarta, kemarin (11/11). Menurut Taufiq, KY memiliki alasan kuat untuk menyadap hakim tipikor. Saat ini sejumlah

hakim tipikor di daerah mendapat sorotan tajam karena telah memberikan vonis bebas kepada terdakwa koruptor. Penyadapan tersebut diperlukan untuk mengetahui integritas para hakim ad hoc itu di luar sidang. ”Tidak semua hakim tipikor disadap, hanya hakim yang terindikasi,” ujarnya tanpa menyebut nama. Sesuai dengan aturan UU yang baru tersebut, KY wajib bekerja sama dengan penegak hukum dalam melakukan penyadapan. Karena konteksnya adalah hakim tipikor, KY tentu harus bekerja sama dengan KPK. Nanti KPK yang melaksanakan permintaan KY itu untuk melakukan penyadapan. ”Kami (KY) nggak menyadap, tapi melalui penegak hukum,” jelasnya. Taufiq menambahkan, dalam waktu dekat KY menyampaikan putusan atas dugaan pelanggaran hakim tipikor di

Bandung. Seperti diketahui, Pengadilan Tipikor Bandung telah memvonis bebas Wali Kota Bekasi nonaktif Mochtar Muhammad. KY terlebih dahulu membentuk panel terkait dengan hakim tipikor di Bandung karena sudah memiliki rekaman sidang dari KPK. ”Dalam satu atau dua minggu ini akan ada putusan,” ujar Taufiq. Selain di Bandung, KY melakukan investigasi atas putusan hakim tipikor di Surabaya, Lampung, dan Kutai Kartanegara. Taufiq menegaskan, jika nanti terbukti pembebasan terdakwa korupsi berdasar siasat-siasat, KY tidak akan tinggal diam. KY akan segera merekomendasikan sanksi kepada MA. Kali ini MA tidak bisa berkelit untuk tidak memberikan sanksi. Ketentuan pasal 22E UU KY yang baru memberikan tenggat selama 60 hari kepada MA

untuk melaksanakan putusan KY. ”Jika tidak dilaksanakan, otomatis putusan KY berlaku,” tuturnya. Sementara itu, KPK merespons positif langkah KY yang ingin menggandeng pihaknya dalam hal penyadapan para hakim. Menurut juru bicara KPK Johan Budi, tidak ada alasan bagi pihaknya menolak permintaan KY untuk menyadap hakim tipikor. ”Tapi, yang perlu diingat, permintaan itu harus sesuai dengan prosedur yang berlaku,” kata Johan. Dia melanjutkan, dalam UU KY yang baru telah diatur bahwa KPK berwenang untuk membantu penyadapan terhadap hakim-hakim khusus pelaku korupsi. Menurut dia, berdasar undang-undang tersebut, pihaknya akan terus bekerja sama dengan KY untuk berupaya memberantas praktik-praktik korupsi di dunia peradilan. (bay/kuh/c7/iro)

Kunjungan Kapolda ke MABM PONTIANAK—Mewujudkan kampung aman dengan program satu desa satu bintara menjadi prioritas pihak kepolisian. Kendati demikian kepedulian dan masyarakat menjadi polisi bagi diri sendiri paling diharapkan. Hal itu menjadi salah satu topik yang diperbincangkan saat keluarga besar Polda Kalbar yang dimpimpin Brigjen Pol Unggung Cahyono, bersilaturahmi dengan Majelis Adat Budaya Melayu Kalbar. Suasana kunjungan kental dengan nuansa kekeluargaan. Kedua belah pihak mengupas masalah keamanan dan ketertiban masyarakat. Permasalahan keamanan yang tidak datang dengan sendiri. Melainkan ba-

Unggung Cahyono

nyak faktor pemicu. Maka membutuhkan penyelesaian bersama supaya suasana kondusif terus terpelihara. Adapun langkah kepolisian mewujudkan hal tersebut yakni menempatkan seorang bintara di setiap desa. Harapannya, komunikasi antara kepolisian dan masyarakat kian dekat. Segala bentuk gangguan kamtibmas dapat teratasi secara dini. Kendati demikian, program penempatan bintara sulit berja-

lan optimal bila tanpa dukungan masyarakat. Maka sinergisitas antara keduanya begitu diharapkan. Saling padu membangun kamtibmas.Sehinggalingkungan masyarakat selalu tercipta rasa aman dan nyaman. Sementara gangguan paling rawan di tengah masyarakat yakni kejahatan konvensional. Kapolda sendiri tidak memungkiri hal tersebut. Menyikapinya, polisi akan terus mengintensifkan patroli. Mulai narkotika, senjata tajam, api dan narkotika. Ketua MABM Kalbar Chairil Effendi turut menyampaikan mengenai ancaman kejahatan jalanan. Kerawanan tersebut banyak menimpa kalangan perempuan. Kemudian kasus pencurian barang berharga dengan modus pemecahan kaca mobil. Menjadi sorotan Chairil yakni kasus demikian kini bahkan mengancam lingkungan kampus. “Ada pemecahan kaca mobil dosen. Incarannya biasa laptop,” kata mantan Rektor Universitas Tanjungpura ini. (stm)

TKI Jabar Pulang Lewat Jalan Tikus Kemalingan di Dalam Bus Kuching PONTIANAK—Tenaga Kerja Indonesia asal Desa Taman Jaya, Kabupaten Sukabumi, Jawa Barat, terpaksa harus pulang dengan tangan kosong. Karena harta bendanya habis dilarikan pelaku tindak kriminal. Terpaksa dia harus pulang melewati jalur tikus di perbatasan Kalbar-Malaysia untuk sampai ke Indonesia. Lia (27), terdampar di wilayah Kalimantan Barat. Uang senilai 100 ringit, handphone, beserta tas yang dibawanya hilang saat berada di dalam bus. Kejadian tersebut di negara tempatnya mengais rezeki, Kuching. Untungnya, ada warga Indonesia yang mau membantu. Namun ia tak bisa pulang ke Indonesia melalur jalur resmi, pasalnya paspor juga ikut raib. Akhirnya ia pun memilih jalan tikus, melewati perkebunan sawit untuk kembali ke Indonesia. Dia mengatakan, sudah tujuh tahun bekerja di Malaysia. Enam tahun bekerja di Johor, dan satu tahun bekerja di Sarawak. Banyak pengalaman yang diambilnya, salah satu pekerjaan tersebut sebagai pelayan di warung kopi. Bukan karena

diperlakukan secara kasar tapi karena uang gaji yang ia terima terbilang kecil. “Saya kerja di warung kopi, gajinya sekitar 350 ringgit. makanya saya berhenti dan memilih kerjaan lain,” tuturnya. Menurut Lia, ia pun sudah mencoba menanyakan perihal gajinya itu. Namun sang majikan tak bisa memenuhi pemintaannya. Lantaran gaji seperti itu sudah sesuai dengan prosedur tenaga kerja. Akhirnya ia memilih berhenti dan permintaannya itu dudukung oleh majikannya. Sang majikan malah membantu untuk membelikan tiket pulang ke Indonesia. Namun di tengah perjalanan ia malah bernasib apes. Uang 100 ringit, handphone, dan beserta tas yang dibawanya hilang dilarikan maling. ”Uang senilai 100 ringgit itu sekitar Rp3 juta,” tukasnya. Selang beberapa hari kemudian, akhirnya Lia membulatkan tekadnya untuk pulang ke Indonesia, walau tidak mempunyai paspor. Jalan perkebunan sawit pun menjadi alternatif utama ibu beranak dua ini. ”Saya ditolong orang Sidas. Dan dua minggu nginap di sana,” ujarnya lemas, sembari mencari kantor polisi terdekat untuk meminta pertolongan. (rmn)

Calon Perawat Perangi DBD PONTIANAK – Memasuki musim pancaroba, penderita demam berdarah dengue di Pontianak meningkat. Untuk mengurangi sekaligus mencegahnya, Sekolah Tinggi Ilmu Keperawatan (STIK) Muhammadiyah Pontianak melakukan penyuluhan kesehatan (penkes) peduli DBD. Kegiatan ini dilaksanakan Jumat (11/11). Penkes ini diikuti seluruh civitas akademika yang berjumlah 50 dosen dan karyawan STIK. Serta sepuluh wilayah kerja Puskesmas di Kota Pontianak dan sebagian Kabupaten Kubu Raya. Kegiatan ini juga diikuti oleh seluruh mahasiswa STIK Pontianak yang berjumlah 1.112 yang langsung terjun ke lapangan.

Dari jumlah ini dibagi dan diposisikan diberbagai tempat yang sudah ditentukan untuk kegiatan penyuluhan. Seperti dipersimpangan jalan, puskesmas, dan sekolah. Kegitan ini juga dilakukan secara door to door dan dilakukan pembagian abate dan leaflet gratis. Pembagian leaflet juga dibagikan kepada pengguna jalan di beberapa titik persimpangan jalan. “Kami memilih tema tentang DBD menyambut Milad Muhammadiyah 102 di STIK ini, karena pada musim pancaroba seperti saat ini, terjadi banyak penderitanya yang menyerang masyarakat Kota Pontianak dan sekitarnya,” ujar Ketua STIK Muhammadiyah Pontianak Ns Wuriani. (afi)


Pontianak Post

Sepuluh ruko di komplek Pasar Tebas ludes dilalap api pada Jumat (11/11). Tidak ada korban jiwa, namun kerugian ratusan juta rupiah. Penyebab kebakaran diduga korsleting listrik.


Sejak hujan mulai sering turun, jalan raya SintangPontianak kilometer empat sering tergenang. Warga bahu membahu membuka saluran air. Itu respon lambatnya perhatian pemerintah.

Warga Gotong Royong Buka SalurAN Air


Api Hanguskan 10 Ruko di Pasar Tebas

Warga pasar baru Ngabang dihebohkan dengan perampokan toko perhiasan Sinar Mas di Jalan Pasar Baru Ngabang. Pelaku berhasil membawa kurang lebih 100 gram perhiasan.


Metropolis halaman

Toko Sinar Mas Dirampok, 100 Gram Dibawa Kabur



SABTU 12 November 2011

Demo Bangun Kampung Budaya PONTIANAK - Puluhan massa mengatasnamakan Aliansi Masyarakat Cinta Damai berunjukrasa menuntut realisasi pembangunan kampung budaya. Sekaligus menyayangkan sikap pihak yang menolak pembangunan tersebut, Jumat (11/11) di DPRD Provinsi Kalimantan Barat. Selain berorasi para pengunjukrasa melengkapi diri dengan pamflet bertuliskan pemban-




Naik Rp50 Juta KEPALA Badan Lingkungan Hidup Kalimantan Barat, Darmawan mengungkapkan bahwa anggaran untuk instansi ini di tahun 2012 diperkirakan akan bertambah. Berdasarkan patokan dalam Prioritas Plafon Anggaran Darmawan

• ke halaman 15 kolom 1


Massa mengatasnamakan Aliansi Masyarakat Cinta Damai berunjuk rasa menuntut realisasi Pembangunan Kampung Budaya, kemarin (11/11) di DPRD Provinsi Kalimantan Barat.

gunan kampung budaya sebagai identitas dan penting bagi daerah. Selain bertuliskan kecewa dengan Fraksi Golkar dan PPP. Mempertanyakan sikap kedua fraksi itu yang seakan tidak setuju dengan adanya pembangunan kampung budaya. Padahal Kalbar merupakan daerah yang memiliki keragaman etnik. Maka sudah sepantasnya kekayaan budaya dapat diimplementasikan dengan membangun kampung budaya. Mendirikan perkampungan untuk etnik Melayu dan etnik Dayak serta Plaza Kebudayaan. • ke halaman 15 kolom 1

Sulit Tata Parkir Liar Jukir Terima Seragam Baru PONTIANAK - Sekitar 300 juru parkir mendapat baju baru dari Dinas Perhubungan Komunikasi dan Informatika Kota Pontianak, kemarin (11/11). Baju tersebut diserahkan Wali

Kota Pontianak Sutarmidji kepada koordinator dan perwakilan jukir. Sutarmidji mengatakan, pembagian baju baru itu sebagai upaya penertiban dan pembinaan jukir. “Kami ber-

harap juru parkir lebih tertib mengatur kendaraan. Jangan

paksakan kalau tempatnya sudah penuh sehingga menyebabkan kemacetan,” ungkapnya. Koordinator parkir juga diminta Sutarmidji memperhatikan potensi dan terget retribusi yang ditetapkan Pemkot. Koordinator mesti membantu • ke halaman 15 kolom 5


Amankan Kayu Dokumen Fiktif Nota Keuangan RAPBD 2012 Dari hasil penyelidikan didapati fakta SPPT atas nama Heri Widodo Copy Paste fiktif sebagai dasar penerbitan SKAU. Sehingga seluruh kayu yang ditarik segera diamankan Mukson Munandar PONTIANAK - Tim gabungan Mabes Polri dan Polda Kalbar mengamankan kayu berdokumen fiktif dalam penerbitan Surat Keterangan Asal Usul Kayu.

Barang bukti kini sudah disita dan kasusnya masih diselidiki secara intensif. Adapun barang bukti yang disita sebanyak 556 batang kayu bulat. Guna kepentingan penyelidikan, lokasi penemuan termasuk barang bukti telah dipasangi garis polisi. Pihak yang bertanggung jawab atas kepemilikan kayu juga turut diamankan dan telah menjadi tersangka, yakni berinisial Sy. Kabid Humas Polda Kalbar AKBP Mukson Munandar, Jumat • ke halaman 15 kolom 5

PONTIANAK - Fraksi PPP DPRD Kalimantan Barat sedih dan prihatin karena naskah nota keuangan RAPBD 2012 yang disampaikan wakil gubernur tidak berbeda dengan naskah nota keuangan RAPBD 2011. “Sebagian besar copy paste,” kata Suhardi, jurubicara Fraksi PPP saat menyampaikan pan-

dangan umum fraksi dalam sidang paripurna terhadap nota keuangan RAPBD 2012, kemarin. Atas kondisi ini, FPPP tidak mau berkomentar banyak dalam pandangan umumnya karena apa yang akan dikomentari dinilai tidak akan jauh • ke halaman 15 kolom 1

Mereka yang Menikah dalam Balutan Angka Satu ILUSTRASI : KEKES

Pasangan Membeludak, Pria 72 Tahun Turun Tangan Tanggal 11 November 2011 merupakan tanggal cantik untuk pasangan pengantin. Bagaimana tidak, selain cantik tangal 11 November 2011 juga gampang diingat. Tapi bagaimana dengan penghulu? Karena dari lima Kantor Urusan Agama di Pontianak, jumlah pasangan yang menikah pada hari itu berjumlah 103 pasang. DESI TRIANI, Pontianak “HEY… hey…,” suara seorang anak kecil yang bermain di jalan masuk gang melengking memanggil temannya. Bukan hanya



Nanda dan Chairunniya saat melangsungkan pernikahan pada tanggal 11 November 2011.

dia, ada sekitar belasan anak yang bermain menyemarakkan pernikahan. Hari ini (kemarin) sejumlah pasangan melangsungkan pernikahan. Salah satunya, Wahyu Ismir dan Winda, juga Chairunnisya dan Nanda. Suasanasoresangatbersahabat,tidakhujan, tidak pula panas. Kediaman Winda dihadiri banyak tamu. Maklum hari ini, 11-11-2011 ia menikah. Tenda yang didominasi warna biru menjadi saksi pernikahan mereka. “Sebetulnya tidak ada rencana, karena awalnya tanggal 22 Januari 2012. akan tetapi dari pihak keluarga menyuruh cepat, yah dipilihlah hari Jumat dan kebetulan dapat tanggal cantik,” ucap Wahyu yang sedang menggunakan pakaian pengantin putih. • ke halaman 15 kolom 1

kubu raya


Pontianak Post

Bongkar, Ganti Rugi


Cetak Generasi Sehat dan Aktif Plt Bupati Kubu Raya, Drs. Andreas Muhrotien Msi mengatakan Peringatan rutin Hari Kesehatan Nasional (HKN) dilakukan setiap 12 November ke 47 hendaknya sebagai tonggak peringatan pentingnya kesehatan dalam berbangsa dan bernegara. Apalagi kesehatan merupakan salah satu pilar pembangunan sumber daya manusia untuk mewujudkan masyakat Indonesia yang tangguh, kuat, pandai, beradab, mampu bersaing dengan bangsa lain dan unggul di bidang ekonomi, teknologi dan sosial budaya. “Untuk itu kita memerlukan manusia Indonesia yang sehat, cerdas, aktif dan produktif,” ujarnya menyampaikan sambutan Menkes dr.Endang Rahayu Sedyaningsih. Menurut Andreas peringatan HKN juga bisa dijadikan i momentum untuk meningkatkan pelaksanaan Gerakan Nasional Kebersihan Indonesia yang diamanatkan bapak presiden. Sebagai tema dari HKN ke-47 tahun adalah Indonesia Cinta Sehat dimaksudkan mengajak seluruh komponen bangsa melakukan gerakan dan tindakan nyata dalam mencapai hidup bersih dan sehat. “Tema ini mencerminkan bahwa bangsa Indonesia mencintai kesehatan, mau dan mampu berperilaku sehat, menjaga lingkungan agar tetap sehat serta mengupayakan pelayanan kesehatan yang bermutu, adil dan merata bagi masyarakat,” ungkap dia. Ia menambahkan pelaksanaan pembangunan yang komprehensip akan berdampak. Misalnya kecenderungan peningkatan derajat kesehatan dan ditandai menurunnya angka kematian bayi, kematian ibu melahirkan juga meningkatnya status gizi masyarakat dan angka harapan hidup waktu lahir dan pencapaian sasaran MDG’s. Pada tahun 2011 ini, sambungnya, pemerintah memberikan imunisasi tambahan campak pada lebih dari 11,9 juta anak dan Polio pada lebih dari 14,1 juta anak di seluruh Indonesia untuk menyukseskan pencapaian Eradikasi Polio dan Eliminasi Campak. Selain itu upaya eliminasi Malaria,filariasis dan kusta sedang dilaksanakan secara intensif di seluruh Indonesia termasuk di Kalbar. Sepanjang tahun 2010-2011, lanjutnya, secara kumulatif diharapkan 5.500 desa akan mendapatkan sarana air bersih dan sanitasi dasar melalui program sanitasi total berbasis masyarakat (STBM). (humas/den)

Sabtu 12 November 2011

Polemik Tambak Kuala Karang MUJADI/PONTIANAK POST

LEBIH TERTIB: Setelah dipasang pembatas, simpang empat Ahmad Yani lebih tertib. Namun masih ada sebagian menyerobot, membuat kaget pengedara lain.

Komisi B Kembali Undang Perusahaan Sawit Suprapto: Tidak Hadir karena Alasan Krusial SUNGAI RAYA—Meskipun Rapat Dengar Pendapat (RDP) kemarin hanya diikuti 13 perusahan dari 23 undangan, Komisi B DPRD Kubu Raya merasa tidak dilecehkan perusahaan perkebunan sawit tidak hadir atau hanya mengirimkan perwakilannya. “Kami merasa tidak dilecehkan. Hanya saja akan lebih baik perusahaan menghargai dan menghormati undangan dewan,” ungkap Suprapto kemarin siang dihubungi via telepon. Menurutnya,denganketidakhadiran pimpinan perusahaan, maka tidak akan menjawab beragam permasalahan investasi sawit yang kerap terjadi di kabupaten termuda di Kalbar ini. Makanya akan ada undangan kembali dikirimkan kepada mereka. “Kami berharap mereka semua dapat hadir Senin mendatang untuk mencari solusi

dan menyusun format persoalanpersoalan perkebunan. Sebab, sebagai investor suara mereka wajib kita dengar. Jadi kalau pihak perusahaan kembali tidak hadir, maka kita tidak akan tahu apa yang menjadi kendala mereka selama ini,” tuturnya. Ia menambahkan masuknya investasi perkebunan sawit di Kubu Raya sebetulnya secara tidak langsung sudah membantu daerah Kubu Raya. Salah satunya membuka daerah terisolir yang tidak dapat terakomodir di dalam APBD atau APBN. “Jelas keberadaan investor membantu kita,” ungkap dia. Politikus Golkar Kubu Raya sebetulnya agak kecewa ketidakhadiran pemilik 10 perusahaan lainnya. Namun ia bisa memahami setelah mengetahui ketidakhadiran mereka karena adanya kesibukan yang tidak dapat ditinggalkan. “Mereka sudah menjelaskan dengan alasan krusial. Mudah-mudahan Senin mendatang, mereka hadir semua,” ujarnya berharap. Dewan sendiri dalam RPD dengan pihak eksekutif dan perusahaan

sebetulnya ingin mengetahui alasan beberapa perusahaan yang tidak melakukan aktivitasnya, sementara telah mengantongi izin lengkap. “Ini juga akan kita tanyakan. Sangat disayangkan kalau itu terjadi. Daerah justru yang akan merugi dan masyarakat terkena dampaknya. Roda perekonomian tidak jalan dan berputar karena lahan yang diijinkan tidak digarap sehingga menjadi lahan terlantar,” ungkap dia.. Manajer Umum PT. Palm Dell, Thaha dihubungi terpisah memastikan pihaknya akan hadir memenuhi undangan RDP dari DPRD Kubu Raya pada hari Senin mendatang. Bagi perusahaannya, agenda tersebut sangat penting. Bukan hanya bagi pengusaha melainkan juga bagi pemerintah dan pihak terkait. “Apalagi dalam dialog tersebut akan ada penyampaian aspirasi dari pengusaha,” ucapnya. Ditanya apakah yang akan hadir pada RDP pimpinan perusahaan. “Mungkin saya yang akan mewakili karena kebetulan pimpinan sedang naik haji,” kata dia.(den)

SUNGAI RAYA— Ketua Advokasi Lingkungan dan Kehutanan Kubu Raya, Syaifullah meminta dinas teknis bertindak tegas melakukan pembongkaran tambak ikan Kuala Karang menyusul pernyataan pemilik tambak yang meminta ganti rugi apabila terjadi pembongkaran. ”Sangat tidak mungkin kalau Pemkab harus mengganti. Mereka saja menanamkan investasinya tidak berizin ke pemerintah atau dinas teknis setelah dijabarkan Kepala Dinas DPK beberapa waktu lalu. Kalau nantinya dilakukan pembongkaran, sertakan aparat kepolisian. Kalau nanti indikasi memang berada di areal kawasan hutan lindung, seret dan adili pemilik tambak,” katanya menanggapi pemberitaan para pemilik tambak kemarin. Menurut dia sudah seharusnya dengan kesadaran sendiri para pemilik tambak melakukan pembongkaran. Apalagi tambak-tambak tersebut ditengarai tidak berizin dan diduga sedang berada di kawasan yang tengah diperjuangan menjadi hutan lindung sejak beberapa tahun lalu. ”Kalau nantinya, surat dari Kementeriaan Kehutanan turun dan terbukti merupakan hutan lindung pidanakan dengan undangundang kehutanan. Tetapi kalau tidak murnikan nama

baik pemilik tambak dan bina investasi mereka,” ungkap dia. Sebelumnya pemilik tambak ikan di Desa Kuala Karang Kecamatan Teluk Pakedai tidak keberatan kalau aktivitas tambaknya dihentikan bahkan dibongkar untuk selamanya. Itupun kalau kompensasi ganti rugi yang sewajarnya selama membuat. “Tidak masalah. Silahkan saja dibongkar. Kami tidak keberatan. Tapi harus ada ganti ruginya. Sebab sudah banyak yang kami investasikan,” ungkap H. Ishak salah satu pemilik tambak kepada Pontianak Post via telepon. Ia bersama pemilik modal lainnya sudah jenuh dan bosan dengan kasus tambak Kuala Karang yang sejak tahun 2008 hinggga sekarang terus menjadi polemik tanpa henti. Ia sendiri mengakui tambak-tambak ikan yang dibuat mereka memang tidak berizin. Namun waktu itu, ketika mereka ingin mengurusnya terbentur berbagai persoalan.”Akan tetapi yang menginginkan keberadaan areal tambak adalah masyarakat sendiri,” ungkapnya. Ia menambahkan awal pembangunan tambak, tidak pernah muncul persoalan. Bahkan, lanjutnya,sejumlahpemiliktambak ikut membantu pembangunan desa dengan membuat akses jalan darat untuk mempermudah transportasi. “Awalnya Desa Kuala Karang belum ada jalan. Akan tetapi sekarang sudah bagus. Kalau mau dihentikan dan dibongkar tambak kami tidak masalah, asalkan ada ganti rugi,” tuturnya. (den)

Lahirkan Bayi Pada 11/11/11 Ida Inginkan Anaknya Jadi Polisi SUNGAI RAYA—Pasangan Tugiyanto (28) dan Ida Maryana (24) warga Parit Bugis, Desa Arang Limbung, Kecamatan Sungai Raya tidak menyangka anak keduanya berkelamin lelaki lahir di waktu yang istimewa. Tepat pada pukul 02.00 Jumat subuh, tanggal 11 bulan 11 tahun 2011, anaknya lahir dengan selamat di klinik sekaligus rumah Bidan Ira Silviawati AMDk di daerah Parit Bugis. ”Waktu melahirkan tidak ada tanda-tanda seperti kebanyakan. Sebab, sebelumnya diperkirakan dokter adalah sekitar tanggal 20-11-2011. Tetapi alhamudillah sudah lahir duluan,” katanya kepada Pontianak Post yang menemuinya di tempat kelahiran. Menurut dia perasaannya sangat bahagia karena sudah melahirkan anak keduanya dengan selamat. ”Saya tidak soalkan tanggal dan bulannya. Yang terpenting anak saya selamat. Tetapi ini benar-benar momen istimewa bagi keluarga saya, karena lahir di waktu yang cantik,” ungkap dia. Ida yang profesinya sebagai

Waktu melahirkan tidak ada tanda-tanda seperti keba-nyakan. Sebab, sebelumnya diperkirakan dokter adalah sekitar tanggal 20-11-2011. Tetapi alhamudillah sudah lahir duluan ibu rumah tangga ini tidak menduga akan melahirkan anak pada hari Jumat subuh. Pasalnya satu hari sebelumnya, ia masih sibuk dan berkutat dengan pekerjaan rumahnya memasak dan mencuci. Terlebih suaminya, Tugiyanto bekerja sebagai pembuat batako di daerah sekitar. ”Ya, tidak menyangka bisa cepat. Sebelumnya saya masih menjalankan kewajiban sebagai seorang istri menyiapkan menu makanan untuk suami yang pulang kerja. Dan itu

rutin,” kata dia. Karena sudah terlanjur lahir cepat, Ida hanya berharap anaknya akan membawa manfaat dan berkah bagi keluarga, daerah dan bangsanya. ”Mudah-mudahan setelah besar nanti dapat berguna. Itu saja harapan saya sebagai orang tua,” ujarnya. Meskipun demikian, ia mengakui bersyukur anak keduanya memberi rasa komplit bagi keluarga. Sebab, sebelumnya Ida dan pasangannya sudah memiliki anak perempuan yang berumur sekitar 4 tahun. ”Sudah lengkap. Bagi saya dua saja sudah cukup. Yang terpenting, saya dan suami berkomitmen memberikan pendidikan secara lengkap sebisa kami,” ujarnya. Khusus untuk anak lelakinya yang baru lahir, Tugiyanto-Ida memiliki harapan besar sekali setelah besar nanti. Ia menginginkan anaknya yang belum diberi nama tersebut menjadi polisi dan harapan keluarga. ”Mudah-mudahan bisa menjadi aparat. Saya bangga sekali kalau anak saya bisa menjadi polisi,” ungkap dia.(den)

Pontianak Post


Sabtu 12 November 2011

halo Publik


Belajar dari Sejarah Setiap tanggal 10 Nopember, bangsa Indonesia memperingati Hari Pahlawan. Memperingati perjuangan para pahlawan dalam merebut dan mempertahankan kemerdekaan merupakan suatu keniscayaan. Sebab bangsa yang besar adalah bangsa yang menghargai jasa para pahlawannya. Bung Karno, sang founding fathers yang dikenal sebagai “Singa Podium”, pernah mengingatkan kepada bangsa ini dalam pidatonya bahwa: “Jangan sekali-kali melupakan sejarah” atau populer dengan singkatan “JAS MERAH”. Sejarah bukan seni bernostalgia, tapi sejarah adalah ibrah, pelajaran yang bisa kita tarik ke masa sekarang, untuk mempersiapkan masa depan yang lebih baik. Demikian ditulis A.Fuadi (2010:112) dalam novelnya yang fenomenal ”Negeri 5 Menara.” Pepatah mengatakan, bahwa “Pengalaman adalah guru yang terbaik.” Dengan membaca dan memahami sejarah, maka kita bisa belajar dan berguru pada orang-orang yang telah mendahului kita. Sejarah, baik yang berupa kesuksesan maupun kegagalan, dapat dijadikan sebagai bahan evaluasi dan inspirasi. Dengan demikian, kita harus mengambil keteladanan dari sejarah, agar ke depan kita lebih baik lagi. Belakangan ini, tampaknya masyarakat Indonesia telah lupa akan Indonesia masa lalu. Kebanyakan kita telah mengidap amnesia sejarah, mengaburkan dan menguburkan sejarah. Negara ini tak akan pernah ada, bila tanpa perjuangan orangorang yang bergerilya di rimba hutan belantara. Pengorbanan ribuan pahlawan yang terpanggang oleh tank baja penjajah. Semua mereka lakukan hanya satu tujuan untuk merebut dan mempertahankan kedaulatan negara.

Simpang Pal 3

Saya warga jalan Puskesmas Pal 3 Sungai Jawi melaporkan kepada pak wali bahwa di jalan simpang pal 3 itu berlubang, sudah lama tidak di perbaiki. Apakah jalan itu tidak bertuan? Jadi mohon adanya perhatian dan perbaikan da ri pemkot. (082149159545)

Siagakan Polantas Halo pak polantas kab Ketapang, di jalan Penembahan Airmala, samping kantor Bupati ada 4 sekolahan yang setiap pagi jam masuk sekolah terjadi kemacetan di simpang tiganya. Tapi tak ada Polantas, mohon kiranya disiagakan petugas untuk mengatur lalu lintas kendaraan agar aman dari kecelakaan. Bandingkan dengan lokasi di dekat situ yang hanya ada satu SD saja, tapi dua Polantas selalu siaga. (089693468599)

Coba renungkan, apa yang sudah kita korbankan untuk negara ini? Justru tak jarang oknum-oknum anak negeri yang mengorbankan negara untuk kepentingan pribadi. Memperingati Hari Pahlawan, tidak cukup sebatas kegiatan seremonial. Ataupun mengadakan acara lomba ini dan itu. Ada hal yang lebih penting dan esensi yang harus kita lakukan segera. Kalaupun kita belum sanggup mengorbankan nyawa untuk negarabangsa ini, paling tidak kita harus mau

dan mampu meneladani semangat kepahlawanan; pengorbanan, persatuan, kebersamaan, saling menolong, mengutamakan kepentingan umum ketimbang pribadi dan hal-hal positif lainnya. Semangat kepahlawanan inilah yang mendesak dimiliki anak bangsa untuk membangun negarabangsa Indonesia. Aspari Ismail Pengurus Forum Lingkar Pena Kalbar.

Jembatan Bikin Stres Saya sangat prihatin dengan dibangunnya lima jembatan di Sei. Nipah, Jungkat dan Wajok sekaligus. Apa tidak sebaiknya mana yang benar-benar diprioritaskan dibongkar dulu? Mengingat yang ada sekarang menimbulkan kemacetan luar biasa. Orang yang mengatur buka tutup jalan sepertinya tak memahami teknis pengaturan jalan, seenaknya saja. Pak Gubernur, mohon diinstruksikan kepada kontraktornya untuk mempercepat kerjanya. Ini khan jalur utama bagian utama Kalbar. Solusinya bisa dengan kerja siang dan malam agar cepat selesai dan tidak menganggu kenyamanan pemakai jalan. (081257492463)

komunikasi bisnis


Zulfadhli Kunjungi Penerima Beasiswa Polnep

Terbitkan Sampul Peringatan dan Prangko Prisma


DIALOG: Anggota Komisi X DPR RI Dapil Kalbar Ir H Zulfadhli saat berdialog dengan mahasiswa penerima beasiswa Bidik Misi.

sekitar 350 mahasiswa menerima beasiswa Bidik Misi tersebut. Terdiri dari, Universitas Tanjunpura sebanyak 300 mahasiswa dan Politeknik Negeri Pontianak sebanyak 50 mahasiswa yang berasal dari kabupaten/kota se-Kalbar. Lebih lanjut, dikatakan mantan anggota DPRD Kalbar ini, meskipun Kalbar mendapat jatah 350 mahasiswa, namun jumlah ini tidak proporsional dengan jumlah masyarakat kurang mampu yang ada di kalbar, terlebih bagi mereka yang tinggal di daerah terisolir dan pedalaman. “Insyah Allah, dalam pembahasan Bidik Misi kedepanya, selain Komisi X DPR RI meminta kuota ditambah menjadi 3.000 mahasiswa. Saya akan berjuang  agar Kalbar mendapat jatah tambahan sebanyak 500 mahasiswa,” terang  Zulfahdli. Ia  berharap, kepada penerima

Sabtu 12 November 2011

Kantor Pos Pontianak

Targetkan 2012 Bidik Misi 30 Ribu Mahasiswa ANGGOTA Komisi X DPR RI dari Daerah Pemilihan Kalimantan Barat Ir H Zulfadhli, pada masa Reses tahun 2011-2012 ini, Jumat (11/11) pagi mengunjungi Politeknik Negeri Pontianak. Dalam kunjungnya kali ini, anggota DPR RI dari Fraksi Partai Golkar ini bertemu dan berdialog dengan puluhan mahasiswa penerima beasiswa Bidik Misi tahun ajaran 2011-2012, di ruang rapat Direktur Politeknik Negeri Pontianak. Zulfadhli mengatakan, di tahun ajaran ini dari hasil kerja keras teman-teman Komisi X DPR RI kepada Kementerian Pendidikan Nasional, pihaknya berhasil menggolkan sebanyak 20  ribu  mahasiswa penerima beasiswa Bidik Misi di seluruh Indonesia. Menurut dia, program bidik misi ini oleh teman-teman Komisi X DPR RI diharapkan dapat membantu para  lulusan SMA sederajat yang berasal dari keluarga tidak mampu, dan tinggal di daerah yang terisolir untuk dapat mengenyam pendidikan di perguruan tinggi. Namun, sebelumnya para lulusan SMA sederajat ini harus melalui seleksi dari pihak sekolah hingga ketingkat panitia Bidik Misi di Kemendiknas RI. Zulfadhli mengungkapkan,  khususnya Kalbar tercatat

Pontianak Post


beasiswa ini agar dapat mengelola keuangan dengan sebaik-baiknya, serta meminta agar para mahasiswa dapat meningkatkan prestasi akademiknya, terlebih saat ini Kalbar indeks pembangunan manusianya masih rendah, yakni urutan ke-28 dari 33 provinsi. Direktur Politeknik Negeri Pontianak, Mahyus SPd, SE MM mengatakan, penerima beasiswa Bidik Misi total jumlahnya mencapai 123 mahasiswa, terdiri dari 48 mahasiswa tahun ajar 2010-2011 dan 75 mahasiswa tahun ajar 2011-2012. “Selama mengenyam pendidikan di Polnep ini, biaya perkuliahan mahasiswa penerima beasiswa Bidik Misi kami gratiskan. Tidak hanya kuliah, mahasiswa juga digratiskan biaya tinggal di Rusunawa, serta mendapat uang jajan sebesar Rp600 ribu yang diberikan tunai setiap bulanya,” tandasnya.(d3/ser)

KEMARIN, tepat pukul 11.11, Kantor Pos Pontianak resmi menerbitkan Sampul Peringatan dan Prangko Prisma momen tanggal unik 11 November 2011 (11-1111:11), ditandai penandatanganan Sampul Peringatan dan Prangko Prisma oleh Kadis Kebudayaan dan Pariwisata Kota Pontianak Utin Hadidjah. Desain Sampul Peringatan berisi gambar Tugu Khatulistiwa, Keraton Kadariah, dan Meriam Karbit. “Saya sangat berterimakasih pada PT Pos Indonesia dan jajarannya. Momen tanggal unik 11-11-11:11 Sampul Peringatan mengangkat ikon wisata Kota Pontianak. Ini hanya satu kali terjadi, sekali seumur hidup,” ujar Utin Hadidjah. Ia menilai, momen tanggal unik 11 November 2011, sebagai beautiful day, termasuk bagi dirinya yang lahir di bulan November. “Bahagia sekali rasanya. Mudahmudahan tahun depan bisa 12-1212,” katanya. Agung Swa Yuwono, Kepala Kantor Pos Pontianak menyatakan, telah menjadi kebiasaan PT Pos Indonesia mengabadikan momen unik, even lokal, maupun nasional dalam Prangko Prisma, Kartu Pos, dan Sampul Peringatan. Ia menyampaikan, even kali ini diprakarsai Pimpinan PT Pos Indonesia, secara nasional PT Pos Indonesia meluncurkan seri Kartu Pos SEA Games, karena 11 November 2011, bertepatan pembukaan SEA Games ke-26 di Indonesia.


TERIMA: Utin Hadidjah menerima Prangko Prisma foto dirinya dari Agung Swa Yuwono usai meresmikan penerbitan Sampul Peringatan dan Pranko Prisma di Kantor Pos Pontianak.

“Satu seri SEA Games ada tiga kartu pos dan dicetak 11.111 pucuk yang disebarkan hanya di 11 kota seIndonesia, termasuk Pontianak. Ini salah satu momen yang monumental bagi PT Pos Indonesia,” ujarnya. Ia menambahkan, sebelumnya PT Pos Indonesia telah meluncurkan Submarine Post Box (Kotak Pos) bawah laut pertama di dunia yang berada di Karang Asem, Bali. Kantor Pos Pontianak hanya menyediakan 500 set kartu pos, satunya Rp11 ribu. Sama dengan Sampul Peringatan yang hanya dicetak 111 buah. “Siapa cepat dia dapat, karena ini limited edition,” katanya. Kartu pos, Sampul Peringatan, dan

Prangko Prisma yang bisa mengunakan foto pribadi atau logo instansi dapat diperoleh di Kantor Pos Pontianak, Jalan Sultan Abdurahman No.49 atau hubungi marketing di 0561-7066633. ”Prangko Prima dengan foto pribadi, kami layani hingga akhir November 2011, hanya untuk cap pos hari ini (kemarin) saja,” ujarnya. Sementara itu, Kantor Pos Pontianak Jl Sultan Abdurahman saat ini juga sudah dapat melayani pembayaran rekening PDAM, disamping rekening-rekening lainnya. Ini membuat masyarakat jauh lebih mudah membayar tagihan-tagihan rutin. (d1/biz)

Memotret Sikap Konsumen Asia di Tengah Ekonomi Global yang Tak Menentu

Konsumen Optimistis setelah India dan Saudi KOSUMEN adalah raja. Tak hanya bermanfaat dalam memacu pelayanan, moto lawas itu juga mendorong lembaga survei untuk mengetahui sikap konsumen di Asia di tengah perekonomian dunia yang dibayangi krisis. Indonesia menduduki posisi ketiga setelah India dan Arab Saudi dalam indeks kepercayaan konsumen di dunia pada kuartal ketiga 2011. Optimisme konsumen Indonesia itu diketahui dari hasil survei Nielsen terhadap 500 responden melalui akses internet yang diumumkan, kemarin. Managing Director Nielsen Indonesia Catherine Eddy mengatakan, indeks kepercayaan konsumen pada kuartal ketiga mencapai angka 114. Ada kenaikan dua poin jika dibandingkan dengan kuartal kedua tahun ini. Indonesia berada di bawah India dengan indeks kepercayaan 121 dan Arab Saudi dengan indeks kepercayaan 120. “Memang, kondisi ekonomi global membuat konsumen merasa di dalam kondisi tidak

menentu. Namun, pertumbuhan ekonomi dalam negeri membuat konsumen optimistis jika dibandingkan dengan di negara lain,” terangnya kemarin (9/11). Dijelaskan Chaterine, survei tersebut mencakup job prospects dalam 12 bulan ke depan. Sebanyak 69 persen konsumen menyatakan prospek pekerjaan di Indonesia masih bagus dengan kenaikan 13 persen, jika dibandingkan dengan kuartal kedua 2011. Menurut dia, keyakinan itu merupakan salah satu faktor yang mendorong indeks kepercayaan konsumen. Sedangkan dari kondisi keuangan, sekitar 86 persen meyakini keuangan mereka akan baik dan luar biasa sampai setahun ke depan. Ada kenaikan 7 persen, jika dibandingkan dengan kuartal kedua tahun ini. “Indonesia termasuk sepuluh negara paling optimistis terhadap kondisi keuangan pribadi,” ujarnya. Kendati sebagian besar menyatakan optimistis, masih ada kecenderungan berhati-

hati dalam membelanjakan uang. Itu terlihat dari jumlah responden yang menyatakan keinginan berbelanja barang yang diinginkan hanya 38 persen. Padahal, pada kuartal kedua lalu, itu mencapai 54 persen. “Turunnya persepsi berbelanja lebih banyak disebabkan faktor konsumen yang menjadi sasaran survei. Yang bias mengakses internet umumnya kalangan up market,” ungkapnya. Meski meyakini resesi tidak berkepanjangan, konsumen memilih menahan belanja rumah tangga. Sejumlah 77 persen menyatakan mengubah pola belanja mereka dengan melakukan penghematan. Konsumen rumah tanggadiIndonesiayangmemilihmengurangi bepergian 48 persen, dan melakukan liburan 36 persen. Saat ingin berhemat, konsumen Indonesiayangberencanamenabunguangmereka 68 persen. Selain menabung, konsumen memiliki rencana menghabiskan uang untuk berlibur, melunasi utang maupun kartu kredit, dan membeli produk terbaru.(res/fat)

TERUS BELANJA: Konsumen memborong barang di sebuah event diskon.


Pontianak Post

komunikasi bisnis

Sabtu 12 November 2011



Lomba Penulisan Artikel Dinas Perkebunan Kalbar

DALAM rangka HUT ke-55 Pemerintah Provinsi Kalimantan Barat, 1 Januari 2012, Dinas Perkebunan Provinsi Kalimantan Barat mengadakan Lomba Penulisan Artikel Membangun Perkebunan yang Sinergis dengan Kondisi Masyarakat Lokal’. Perebutkan Total Hadiah Rp10 juta. Juara I Rp3 juta, juara II Rp2,5 juta, juara III Rp2 juta, juara harapan I Rp1,5 juta, dan juara harapan II Rp1 juta. Syarat Lomba; Terbuka untuk umum. Artikel ditulis dalam bahasa Indonesia yang baik dan benar. Artikel harus asli, bukan terjemahan/ saduran. Mengacu pada tema. Belum pernah dipublikasikan. Tidak sedang diikutsertakan dalam lomba lain. Artikel yang masuk tidak dikembalikan dan menjadi milik panitia. Keputusan juri mengikat, serta tidak

dapat diganggu gugat. Ketentuan Teknis; Setiap peserta hanya boleh mengirimkan satu artikel. Naskah diketik di atas kertas berukuran A4 dengan jarak 1,5 spasi. Jenis huruf Times New Roman ukuran 12. Panjang artikel maksimal 5 halaman. Naskah dibuat 5 rangkap dan dimasukkan ke dalam amplop tertutup. Di halaman depan naskah dilampirkan latar belakang dan ringkasan isi artikel, biografi singkat penulis dan fotocopy KTP, serta nomor handphone peserta. Naskah dikirim langsung atau via pos ke panitia lomba penulisan artikel di Ruang Perpustakaan / Bidang Pengelolaan, Pemasaran, dan Kelembagaan Dinas Perkebunan Provinsi Kalimantan Barat Jalan Moh. Hambal No.3 Pontianak. Naskah diterima panitia mulai

tanggal 16 November 2011 sampai dengan 7 Desember 2011 paling lambat pukul 15.00 WIB. Kontak Person: Odik 0821-4804-0428. PengumumanPemenang;Dilaksanakan pada akhir Desember 2011. Pemenang lomba rencananya bakal menerima hadiah dalam Upacara Hari Jadi ke-55 Provinsi Kalimantan Barat, tanggal 1 Januari 2012. Para pemenang akan diumumkan melalui siaran TVRI Pontianak. Pelaksanaan lomba dilatarbelakangi masih rendahnya kepedulian masyarakat (public awerness) terhadap pentingnya subsektor perkebunan dalam pembangunan dan peningkatan kesejahteraan rakyat, khususnya masyarakat Kalbar, sehingga diperlukan upaya untuk meningkatkan kepedulian masyarakat tersebut. Salah satu upayanya adalah menyelenggarakan ’Lomba Penulisan Artikel Perkebunan’. Kegiatan ini juga dalam rangka memperingati Hari Jadi ke-55 Provinsi Kalimantan Barat, 1 Januari 2012. Lomba ditujukan untuk meningkatkan kepedulian masyarakat, khususnya masyarakat Kalbar, terhadap pentingnya peran subsektor perkebunan dalam pembangunan dan peningkatan masyarakat. Serta diperolehnya artikel yang mencerahkan dan dapat memberikan sumbangan pemikiran konstruktif yang dapat digunakan dasar dalam penentuan program pembangunan perkebunan di Kalbar. (d1/biz)

Kisah Nyata Ny Camelia Talaar

Kanker Stadium 4, Sembuh Lewat Shinse Husein SEBENARNYA, penyakit diidap Ny Camelia Talaar sejak kecil adalah asma. Setelah menikah dengan Rudy Talaar pada 1960 dan melahirkan anak pertama, sakit sesak pernafasan itu sirna. Tapi 7 tahun lalu, dia terserang sakit maag sangat parah, terjadi pendarahan, sehingga ususnya harus dioperasi. “Sejak itu, saya sehat-sehat saja tidak merasakan gangguan kesehatan apapun,” kata Camelia. Namun, awal Juni 2002, Camelia terserang sakit tipus dan demam berdarah, sehingga menjalani perawatan di sebuah rumah sakit ternama di Jakarta. Saat dalam perawatan, dia rasakan fisiknya kian hari melemah, seluruh badannya terasa sakit. “Mulai dari ujung kaki hingga kepala sakitnya luar biasa. Apalagi disentuh orang atau bersenggolan benda keras, sakit sekali,” katanya. Padahal, berdasarkan hasil laboratorium, tipus dan demam berdarah yang diidap sudah sembuh. Kemudian dokter melakukan deteksi yang lebih dalam, melibatkan beberapa dokter ahli termasuk ahli kanker dan syaraf. Ternyata hasil CT Scan dan beberapa peralatan canggih lainnya menunjukkan, bahwa Camelia mengidap kanker stadium 4. Penyakit ini telah bersarang di tubuhnya sejak lama dan mengganas ketika kondisi Camelia sedang melemah, yakni ketika mengidap tipus dan demam berdarah tersebut. Diobati Shiense Husen

Melihat kondisi Camelia terus melemah, dokter yang menangani menjadi bingung. Tapi syukurlah, lewat seorang keluarga ditemukan alamat Sinshe Husein Kartawijaya, ahli pengobatan China di perumahan Muara Karang blok B-4 Barat No. 45 Jakarta Utara. “Langsung kami bawa ibu ke sana. Oleh pak Husein diberi obat Seabuckthom yang berasal dari sari buah pohon shachi. Atas inisiatif kami sekeluarga, obat-obatan dokter kami stop. 24 jam setelah minum Seabuckthom, Ibu terlihat tenang, tidurnya nyenyak dan tak gelisah lagi. Dalam waklu seminggu, terlihat perubahan besar. Ingatannya mulai membaik, bicaranya terarah, dan kini sudah normal. Kami berterimakasih kepada Tuhan, menyelamatkan ibu lewat Sinshe Husein dengan obat Seabuckthom,” ucap Natalia. Alamat praktik Shinse Husein; Perumahan Muara Karang blok B-4 Barat No.45 Jakarta Utara, telp (021) 6678649. Konsultasi gratis hubungi: 0816903378 dan obat bisa juga didapatkan di Sinar Mutiara Jl. Gajahmada No. 3, telp (0561) 738566- 7061088 Pontianak. Penyalur: TO Mulia Jl. A Yani No.21Sanggau Kapuas. TO Tiara Jl. Jendral Sudirman No.7-8 Sintang. TO Swallow Jl. Koper Makmur No.2 Singkawang. TO Aman Jl. Mohamad Hambal Pemangkat. TO Ceria Jl. Pasar Baru blok D No. 1 Sei Pinyuh. TO Duri Jl. Raya No.16 Sei Duri. TO Tulus Budi Jl. A Yani No. 74C Ketapang. TO Sinar Abadi Jaya Jl. Gajahmada 37/199 Pontianak. Ijin praktik Depkes No.

Mau Usaha Buka Bengkel Mobil atau Motor

Ayo…Belajar di Bintasik KEPALA Diklat Yayasan Bintasik, Nambah Rengganingsih, SH mengatakan, usaha untuk menjadi mandiri di usia muda adalah awal yang baik untuk modal kita membaur di masyarakat nantinya. Sebab, kemandirian adalah modal awal kita terjun ke masyarakat. “Bila kita mandiri otomatis kita memiliki bekal dalam menghadapi tantangan pekerjaan di masa yang akan datang. Di mana persaingan semakin tinggi untuk kita bisa masuk dalam sebuah perusahaan negeri atau swasta. Kemandirian juga tidak bisa berjalan dengan maksimal, tanpa adanya keterampilan yang mendukung kita untuk maju melangkah,” kata Nambah Rengganingsih. Sejalan dengan itu, Lembaga Diklat Otomotif Yayasan Bintasik Pontianak memberikan kesempatan kepada masyarakat untuk mengikuti kursus otomotif. Yayasan Bintasik merupakan lembaga pendidikan keterampilan berbasis kompetensi. Kurikulum Yayasan Bintasik disusun berdasarkan pengalaman kerja puluhan tahun oleh para pendiri lembaga yang dipadukan dengan kurikulum dari Depnaker dan Diknas, serta kebutuhan para pengguna jasa mekanik otomotif. Kurikulum ini terbukti menjadi kurikulum yang mampu meluluskan mekanik yang tepat guna, siap pakai, dan mandiri. Jurusan yang ditawarkan antara lain: Mekanik Mobil Bensin dan Solar, Mekanik Motor 2 dan 4 Tak, Pengelasan Body dan Las Ketok, Pengecatan Cat

Peluang Usaha Pendidikan Bergaransi Profit Dibatasi 3 Outlet Tiap Kota untuk Opening Maret 2012 Gymnastic English & Mathematics Totemo Benkyo SETELAH berkembang pesat di Jakarta, Jawa Barat, Bali, Palembang dan Kalimantan Timur, kini Manajemen (baik AyoPinter Kids dan AyoPinter BimBel) membuka peluang sebesar-besarnya kepada masyarakat di Kalimantan Barat, untuk bergabung dalam kemitraan (franchise). Bagi yang memiliki lokasi strategis atau sanggup untuk sewa tempat strategis, dapat menghubungi marketing AyoPinter di 081326529509 untuk disurvei terlebih dahulu. Prosedurnya adalah ketik sms: nama_usia_ profesi_(sudah/atau belum punya tempat), lalu mengirimkan biaya survei (refundable jika tidak terpilih) sebesar Rp2.800.000 (sudah termasuk transportasi Jakarta-Pontianak PP, dan akomodasi) paling lambat 20 November 2011. Detail kemitraan

dapat diperoleh saat suvei. Pilihan paket investasi franchise, antara lain: Pertama, Paket AyoPinter Kids (Mathematics Totemo Benkyo, Gymnastic English, dan Direct Reading Tanpa Eja). Kedua, Paket AyoPinter BimBel (Klinik Bimbingan Belajar, International Class, Olympiad Prepatory, dan Kelas Jaminan). Ada 5 alasan berbisnis AyoPinter: Pertama, baru buka langsung BEP. Kedua, net profit di awal: 16-19 juta/ bulan. Ketiga, garansi jumlah siswa dengan sistem full pendampingan berlapis. Keempat, bisa berjalan tanpa Anda secara penuh; karena operasional yang computerised, guru sudah disediakan. Kelima, metode belajar yang unik dan jaminan mutu layanan pelanggan. Keunggulan belajar di AyoPinter adalah: di AyoPinter Kids, siswa usia

3,5 hingga 12 tahun diajarkan Bahasa Inggris sambil senam, Matematika dengan konsep Jepang, dan Baca Tulis tanpa mengeja (jaminan bisa baca koran dalam waktu 1 tahun). Sementara di outlet AyoPinter Bimbel: siswa SD-SMP-SMA bebas datang setiap hari dengan jadwal yang bebas. Konsep belajar ini disebut Klinik Bimbel: di mana 1 siswa akan ditangani oleh 1 guru secara bergantian, sementara siswa yang lain sedang di-drill dengan quiz di ruang workshop. Konsep ini mirip dengan konsep Poliklinik. Setiap guru, sesuai dengan keahliannya, akan menempati ruang matematika, ruang fisika, dan seterusnya. Siapa yang cocok berbisnis AyoPinter: Pertama, pengusaha yang ingin menambah revenuenya, dan kedua, profesional yang ingin memiliki bisnis namun dapat berjalan nyaris tanpa kehadirannya 100%. Segera hubungi 081326529509, hanya terbatas 3 peluang outlet.(a2/bn)

Maaf Lelaki Hidung Belang Dilarang Baca HASIL penelitian seorang dokter dari Amerika Serikat, menyebutkan bahwa gangguan kesehatan seksual laki-laki 85% dipengaruhi oleh faktor psikologis. Lelaki memerlukan furostanol dalam tubuh yang berfungsi merangsang saraf androgen di otak untuk kembali aktif bergairah, dan bergairah lagi serta menjaga kesehatan psikis seksual laki-laki. Tribulus hc terbuat dari Tribulus Terrestris yang di ambil dari varietas terbaik dari 3 varietas yaitu varietas tipe Afrika, yang merupakan tanaman asing dan langka yang hanya tumbuh didaerah Afrika. Tribulus Terrestris sudah di akui kehebatannya oleh badan kesehatan dunia (WHO), maka sering diresepkan untuk laki-laki yang mengalami; impotensi, ejakulasi dini, mani encer, susah punya keturunan, untuk menguatkan otot bahkan untuk menstabilkan tekanan darah. Kapsul Tribulus hc boleh di adu dengan obat kuat lakilaki lainnya.Sungguh tidak ada obat herbal stamina pria yang sehebat kapsul Tribulus hc. Tribus hc sangat efektif membangkitkan keperkasaan pria, meningkatkan stamina dan mencegah pengerasan pembuluh darah pada penis. Dibuat khusus dan terpilih serta ditangani 2 orang opoteker dari alummi Gajah Mada Yokyakarta. Satu botol dapat menjaga gangguan seksual selama 3 bulan, aman dan justru baik bagi penderita darah tinggi. Kami memberikan bukti bukan janji:.. untuk konsultasi hubungi Konsultan Pasutri Hp.081329062513. Sariman yang berdomisili di Bekasi adalah salah satu dari sekian banyak laki-laki yang sudah membuktikan akan kehebatan dari kapsul Tibulus hc. Hampir 20 tahun ia menikah tapi tidak mempunyai keturunan, dan sudah 3 tahun lebih ia tidak pernah berhubungan

dengan pasagannya, karena mister X-nya tidak pernah bangun. Berbagai macam obat dan pengobatan alternative sudah dicoba tetapi hasilnya nihil. Kapsul Tribulus hc dikenal dari seorang rekannya yang sebelumnyamempunyai problem yang sama. Kini Sariman dan istrinya dipenuhi keceriaan atas kehadiran seorang anak lelaki yang sudah sekian lama ia nantikan, dan mister x nyapun selalu terbangun siap tempur. Kapsul Tribulus Hc sudah terdaftar di POM. Dengan No.TR.103312931, tersedia di apotek dan toko obat di kota Anda. Pontianak: Apt Gajah Mada, Apt Makmur 1 dan 2, Apt Merdeka Timur, Apt Mulia, Apt Mandiri 1 dan 2, Apt Agung, Apt SR Dalam, Apt Amelia, Apt Imam Bonjol, Apt Sehat, Apt Sahabat, Apt Bersama, Apt Abadi, Apt Pretty, Apt Sejahtera, Apt Utama, Apt Bintang, Apt Kimia Farma. Apt T. Pura, Apt MS Farma.TO Batara, TO Paris, TO Murni, TO Fajar, TO S.Lestari, TO Jenaka, TO Sinar Abadi 1 dan 2, TO Timur. Mempawah: Apt Mempawah. Sanggau: Apt Yoga Jl. Ayani. Singkawang: Apt Merdeka, Asean, Genesha dan Apt Singkawang. Sambas: TO The Santos. Ketapang: Apt Mulia, Apt Lestari Farma dan TO Sumber Sehat. Dicari agen untuk daerah. Informasi hubungi 081352022980.(d2/biz)

Pelatihan Kebugaran Seksual & Kualitas Hidup Di Hotel Mahkota, Minggu (11 Desember 2011)

PRAKTIK: Siswa sedang melaksanakan praktik mobil.

Duco dan Oven, Jahit Jok dan Interior, Ketangkasan Mengemudi+SIM A. Persyaratan untuk menjadi siswa sangat mudah, walaupun tidak tamat SD atau SMP tetap bisa diterima. Lama pendidikannya adalah 2 bulan hingga 6bulantergantungdarijurusandipilih. Setelah lulus, siswa akan mendapatkan sertifikat dan bisa kerja di bengkel atau buka usaha bengkel sendiri. Bagi siswa yang belum mempunyai ijazah SMA akan diikutsertakan dalam ujian kesetaraan SMA (paket C) setara SMA. Biaya pendidikan di Yayasan Bintasik juga bisa diangsur dan sangat terjangkau bagi masyarakat. Yayasan Bintasik telah meluluskan sebanyak 1.486 siswa, 95% diantaranya telah bekerja maupun buka usaha bengkel sendiri. Lulusannya juga berpeluang untuk bekerja di Dinas Perhubungan, PLN, Kepolisian dan lain-lain. Bahkan baru-baru ini, pihak Dinas Perhubungan merekomendasikan kepada calon pegawainya

untuk kursus dahulu di Yayasan Bintasik. Selain itu, Yayasan Bintasik juga mengadakan kerjasama dengan Yayasan Rantai Kasih yang beralamat Jl. WR Supratman membina 10 orang anak putus sekolah dan miskin. Metode ini terbukti mampu membuat siswa lebih mudah mengerti, karena siswa dihadapkan langsung pada komponen yang sebenarnya (tidak pakaimenggambarkomponen).Pihak Yayasan memberikan garansi sampai bisa, dengan kualifikasi siswa mampu bongkar pasang mesin hingga bisa normal kembali hidup mesinnya, dan ini disampaikan oleh Nambah Rengganingsih, SH sebagai Ketua Kepala Bagian Diklat Yayasan Bintasik. Informasi lebih lanjut hubungi Yayasan Bintasik, dengan alamat baru Jl. Prof. M Yamin, No.5 depan Masjid Al-Asyarf Simpang Ampera Kotabaru Pontianak, telpon (0561) 767508,081522562229,085750606162, 081345708984.(d2/biz)

SAAT ini sudah bukan barang tabu jika membicarakan masalah seksualitas, kenikmatan seksual dan kepuasan seksual. Tentunya jika hal ini dimengerti secara positif untuk meningkatkan hubungan interpersonal suami-istri, dan motivator peningkatan kinerja dalam bekerja. Aktivitas seksual bukan hanya melulu masalah hubungan seksual. Hal lebih mendasar dari setiap pasangan keluarga adalah dapat memberikan kasih sayang, memberikan keturunan, menciptakan kebahagiaan dan mempertahankan kesehatan baik bagi diri sendiri maupun bagi pasangan dan keluarganya. Hubungan seksual suami-istri yang dapat saling memuaskan dapat mencapai orgasme bersama akan membuat pasangan menjadi lebih erat, bahagia dan menyenangkan. Hasilnya akan memotivasi lebih giat dalam bekerja. Bagaimana kita dapat selalu merasakan sehat dan bahagia, sehingga tercipta keharmonisan dalam keluarga, maka kita harus berupaya menciptakannya. Menciptakan tubuh yang sehat dan bugar tidaklah sulit untuk dilakukan, jika kita selalu termotivasi dan melaksanakannya dengan gembira. Salah satu aktivitas yang dapat meningkatkan kebugaran tubuh, adalah latihan

Alex Pangkahlia

kebugaran seksual secara benar dan rutin. Pelatihan kebugaran seksual ini telah dilakukan penelitian secara fisiologis dalam bidang kesehatan dan kedokteran, sehingga sangat bermanfaat bagi kesehatan dan kebugaran jasmani. Pelatihan ini akan memperkuat otot-otot panggul, sehingga pada wanita akan bermanfaat untuk mencapai orgasme dan memberikan kenikmatan bagi pasangannya dalam hubungan seksual, mencegah terjadinya kekeringan vagina (sulit terangsang) saat melakukan hubungan seksual, mencegah turunan kandungan dan mencegah ngompol di usia lanjut. Sedangkan bagi pria akan ber-

manfaat mempertahankan dan mengontrol ejakulasi saat berhubungan seksual, sehingga tidak terjadi ejakulasi dini, mencegah disfungsi ereksi, mencegah dan memperlambat terjadinya pembesaran prostat terutama diusia lanjut, dan mencegah terjadinya sindroma ngompol (tidak dapat menahan kencing) di usia lanjut. Pelatihan akan diberikan secara intensif, sehingga diharapkan peserta akan mampu melatih dirinya secara benar bahkan dapat melatih orang lain (bagi instruktur senam). Manfaatkan kesempatan baik ini bagi diri dan pasangan Anda sehingga tercipta keluarga harmonis, bebas dari perselingkuhan karena dapat saling memuaskan dan bersemangat dalam bekerja. Segera daftarkan diri Anda bersama pasangan dalam pelatihan kebugaran seksual (tempat terbatas) di Hotel Mahkota, Jl. Sidas Pontianak, pada Minggu, 11 Desember 2011 jam 18.30-20.30 dan dilatih langsung oleh pakar kesehatan seksual Prof. Dr.dr. Alex Pangkahila, Sp.And dan team. Bagi peserta dianjurkan memakai pakaian training dan sepatu kets. Bersertifikat terakreditasi IDI bagi peserta dokter, kompetensi bagi trainners. Hubungi: 0561-3068786, 082148248936, 081345706611.(d2/ biz)

Pontianak Post


Sabtu 12 November 2011

TANGGAL cantik 11-11-11 kemarin

menjadi pilihan dari banyak pasangan yang memutuskan untuk menikah. Pemilihan tanggal pernikahan menjadi salah satu topik yang dirundingkan oleh pasangan menuju momen sakral tersebut. Tak hanya soal pemilihan waktu menikah, banyak hal lain yang perlu dibicarakan dan disepakati antara pasangan, terutama saat telah menjadi suami istri, tinggal serumah dan merasakan suka duka bersama mengarungi kehidupan berumah tangga.


adadasarnya, menikah adalah sebuah upacara pengikatan janji nikah yang dirayakan atau dilaksanakan oleh dua orang dengan maksud meresmikan ikatan perkawinan

By : Anggita Anggriana secara hukum agama, hukum negara, dan hukum adat. Menurut Isyatul Mardiati, M.Psi Psikolog menjawab For Her, semuanya itu memerlukan persiapan yang matang, terutama dalam mempersiapkan mental ke­dua calon mempelai

sebelum naik ke pelaminan. Kesiapan mental perlu dimiliki oleh pasangan yang akan menikah, karena menikah adalah seperti melangkah ke gerbang kemandirian. Menikah adalah awal hidup baru, yang sangat jauh berbeda dari kehidupan sebelumnya, yang selalu terlindung dari orangtua dan keluarga lainnya. Biasanya di masyarakat kita, dalam acara pernikahan akan selalu ada peran dan tanggung jawab dari pihak keluarga dalam proses berjalannya acara sakral. Mereka tak segan-segan untuk turut membantu jalannya acara ini hingga berlangsung sukses, seperti yang diharapkan. Namun hal itu tetap harus diperhatikan dan diatur secara rapi agar tugas dan tanggung jawab yang diberikan terbagi dengan jelas. “Tentukan siapa yang akan menjadi wakil keluarga dari kedua pihak pengantin dan

semua itu harus benar-benar diperhatikan dengan detail,” kata perempuan kelahiran tahun 1981 ini. Biasanya ada pasangan yang memiliki kepercayaan tentang arti tanggal bulan dan tahun yang dipilih untuk menikah, tapi semua itu bukanlah jaminan bahwa

nantinya pernikahan Anda dan pasangan bisa berjalan mulus tanpa ada kendala. Karena semua itu balik lagi ke Anda dan pasangan dalam menjalaninya nanti. Tak hanya bicara mengenai pernikahan yang merupakan proses penyatuan dua pribadi yang berbeda, tetapi lebih dari itu banyak hal yang perlu di­sepakati dengan pasangan sebelum mengikat janji sehidup semati. “Anda dan pasangan baru saling bertemu setelah dewasa. Banyak hal yang telah membentuk kepribadian Anda dan pasangan selama bertahuntahun, misalnya kebudayaan, pendidikan dalam keluarga, lingkungan serta sifat yang ada dalam diri masingmasing,” demikian Isya mengingatkan. Menikah, walau telah mengenal calon pasangan dengan baik, tapi tetap ada sifat-sifat yang belum terlihat, yang memerlukan penyesuaian. “Ka­rena itulah diperlukan proses adaptasi. Penyesuaian ini kadang terlaksana dalam waktu dekat, tapi ada juga yang butuh waktu bertahuntahun untuk saling menyesuaikan,” ujar Dosen STAIN Pontianak ini. Akan banyak hal yang diperdebatkan dan dipertentangkan, namun ini bukan karena tidak adanya kecocokan, tapi lebih untuk mendapatkan persepsi yang sama. Karena itulah Isya menyarankan untuk selalu mengomunikasikan kepada pasangan jika ada hal-hal

yang mengganggu mengenai perbedaan sifat ini. “Bicarakan dalam suasana yang santai dan hangat. Janganlah tersulut emosi agar komunikasi berlangsung efektif,” beber penghobi nonton ini. Mungkin lanjut Isya, hal ini kurang disadari saat sebelum menikah, namun setelah menikah, salah satu masalah krusial mengenai keuangan bisa menjadi penyebab konflik yang paling banyak terjadi. Berani menikah, berarti berani hidup sendiri tak bergantung

Bukan mustahil setelah menikah nanti, baru terungkap semua perbedaan masingmasing. Hal-hal yang tadinya tak menjadi masalah, bisa menjadi persoalan besar setelah menikah. Karenanya diperlukan proses adaptasi untuk lebih mengenal pasangan, bahkan setelah berumah tangga sekalipun” Isyatul Mardiati, M.Psi Psikolog

pada orang tua. Walaupun sama-sama cinta, tak berarti menikah hanya didasarkan oleh cinta saja, karena untuk membiayai rumah tangga diperlukan keuangan yang cukup agar rumah tangga terselenggara dengan baik. Banyak hal yang menjadi faktor dalam masalah keuangan, sehingga ada baiknya hal mengenai keuangan dibicarakan secara terbuka antara Anda dan pasangan. “Pilih cara pengaturan keuangan yang paling sesuai untuk Anda berdua. Usahakan untuk berhati-hati dalam mengeluarkan uang dan komunikasikan pada pasangan jenis pengeluaran apa yang dapat dilakukan tanpa didiskusikan dahulu dan apa yang harus dibicarakan dulu berdua. Dengan adanya perundingan seperti ini akan membuat Anda dan pasangan lebih siap untuk melangkah ke jenjang pernikahan,” urai Magister Profesi Psikologi UNPAD Bandung ini. **

Yang Harus

Diketahui Sebelum

Menikah Kehidupan pernikahan yang sudah dibayangkan, ternyata tak seindah kenyataannya. Hal tersebut dirasakan beberapa orang, mungkin termasuk Anda. Untuk yang akan menikah, berikut ini lima hal yang perlu diketahui agar tak menyesal kemudian, seperti dilansir Family Time.

Anda dan pasangan adalah orang-orang egois

Mungkin sulit bagi Anda menerima kenyataan di poin nomor satu, namun itulah yang terjadi. Saat sudah menikah, Anda akan terkaget-kaget betapa sebenarnya si dia bisa berubah egois atau sebaliknya. Lebih baik tunjukkan sifat egois yang kadang muncul itu sejak sebelum menikah dan komunikasikan dengan pasangan bagaimana mengatasi hal tersebut.

Tidak semuanya tentang Anda

Pernikahan bukan hanya untuk kebahagaiaan Anda. Bukan juga hanya karena kebutuhan Anda terpenuhi. Menikah adalah bagaimana Anda dan pasangan melayani satu sama lain. Menikah adalah bagaimana Anda dan si dia menjadi sebuah keluarga. Ketika memutuskan menjadi sepasang suami-istri, Anda dan pasangan berkomitmen untuk terus saling mencintai dan menyayangi dalam suka maupun duka. Terdengar klise, tapi memang begitulah adanya. Menerima keburukan dan kelebihan pasangan begitu juga sebaliknya. Harus ada kerjasama dan komunikasi yang baik untuk mewujudkan sebuah pernikahan bahagia.

Orang yang paling Anda cintai bisa jadi orang yang paling membuat sakit hati

Poin ketiga ini adalah risiko yang harus Anda terima saat sudah menikah. Tersakiti di sini bukan berarti Anda menerima saat dia melakukan KDRT. Maksud poin ketiga adalah, ketika seseorang yang Anda cintai melakukan sesuatu yang membuat Anda sedih, tentu hal itu membuat Anda sakit hati dan merana. Jika hal itu terjadi, bukan berarti Anda tidak cocok dengannya. Komunikasikan dulu dan carilah solusi dari masalah yang terjadi.

Anda tidak bisa melakukannya sendiri

Sebuah pernikahan, tidak bisa dipertahankan sendiri. Harus ada kerjasama dengan pasangan untuk membuat pernikahan itu berhasil. Jika ternyata hanya satu orang saja yang berusaha, bersiaplah menghadapi keretakan rumah tangga.

Jangan berhenti menikmati kebersamaan berdua

Ketika belum menikah, Anda rutin pergi berduaan saja dengan pasangan. Saat sudah menjadi pasangan suamiistri, kebiasaan itu jarang dilakukan atau bahkan tidak ada sama sekali. Tidak perlu mengeluarkan uang banyak untuk melakukan poin kelima ini. Anda bisa melakukannya kapan saja dan di mana saja, seperti makan bersama, nonton film favorit, atau menikmati obrolan yang jadi rahasia Anda dan si dia. Nikmati semua hal kecil yang ada dalam hidup bersama si dia. **

Pontianak Post

aneka pontianak

Sabtu 12 November 2011

Diknas Siap Bantu Science Film Festival PONTIANAK - Kepala Dinas Pendidikan Kota Pontianak, Mulyadi menyatakan kesiapannya membantu pemutaran film bertajuk lingkungan yang digelar Goethe Institute, WWF Indonesia Program Kalbar, dan Aliansi Jurnalis Independen Pontianak pada 17 – 19 November mendatang. “Biar kami (diknas) yang mengundang siswa,” tegasnya saat bertemu pengurus AJI Pontianak.Dia mengaku senang dengan kegiatan yang akan dilaksanakan

tersebut. Menurutnya, kegiatan itu dapat sebagai pelajaran tambahan, pembangunan karakter siswa. “Kegiatan seperti ini bagus sekali. Saya senang karena sifatnya membangun karakter siswa,” ungkapnya. Mulyadi berharap, usai menonton film lingkungan itu ada tindaklanjut dari guru pendamping. Guru pendamping mesti menjadikan tontontan sebagai bahan diskusi di sekolah. “Saya akan suruh guru IPS yang mendamping, nanti

di sekolah didiskusikan lagi,” ujarnya. Tidak hanya di Pontianak, Science Film Festival 2011 juga dilaksanakan pada tanggal 7-30 November di Thailand, Kamboja, Indonesia, Filipina, Malaysia dan Vietnam. Untuk Indonesia ada beberapa daerah yang sudah dipilih antara lain Bandung, Yogyakarta, Goa, Jakarta dan Ambon, juga Pontianak. Ketua AJI Pontianak Budi Miank sekali mengatakan, selain WWF Indonesia Program Kalbar dan

AJI Pontianak, pemutaran film ini juga bekerjasama dengan Goethe Institute Jerman. “Satu hari dijadwalkan 12 film. Di sela-sela film diadakan juga diskusi dengan pelajar tentang lingkungan,” ungkapnya. Ketua panitia, Basilius Andreas mengatakan, dinas pendidikan tidak perlu khawatir dengan muatan film yang akan diputarkan. Ada klasifikasi sesuai usia dan tingkat pendidikan. “Ada film untuk TK dan SD ada juga yang untuk SMP dan SMA. (hen)

Pasangan Membeludak, Pria 72 Tahun Turun Tangan Sambungan dari halaman 9

Bukan hanya Wahyu Ismir dan Winda yang mengabadikan tanggal 11-11-2011 menjadi hari pernikahan mereka. Akan tetapi masih ada 102 pasang pengantin yang melakukan hal yang sama. Menjadikan tanggal cantik untuk hari bahagia. Ketika kebahagiaan menyelimuti pasangan pengantin yang berjumlah 103 orang untuk Pontianak, bagaimana dengan penghulu? Apakah ia juga merasakan bahagia seperti pasangan pengantin atau malah merungut menahan letih. Badan tua itu berjalan lambat mengikuti pengantin. Ia merunduk melihat lantai dibantu dengan kacamata tuanya. Bebrerapa kertas yang dibungkus map senan-

tiasa didekap menggunakan tangan kanannya. Dialah bapak yang telah menikahkan pasangan Wahyu Ismir dan Winda. Saat bertemu sejujurnya timbul keraguan dalam diri. Apakah memang benar bapak tua ini yang menjadi penghulu? Jikalau iya, apakah sudah tidak ada lagi anak bangsa yang siap untuk menjadi penerus penghulu? Saat ditanya, dengan jujur ia menjawab bahwa ia bukanlah penghulu melainkan hanya pembantu penghulu. Hal ini dilakukan karena mengingat sibuknya penghulu menikahkan pasangan pengantin yang menikah pada tanggal cantik hingga mengharuskan ia untuk turun tangan. Bapak tua yang menggunakan kopiah hitam selaras

dengan bajunya itu bernama H. Azzan SF. Suaranya bergetar saat menjawab pertanyaan yang dilontarkan. Maklum saja, sekarang usianya sudah masuk usia senja, 72 tahun. Walaupun sudah memasuki usia senja, tapi ia tetap bersemangat untuk menikahkan orang. “Saya sangat suka karena akan mempererat tali silaturahmi. Selain itu, kita akan lebih mengenal banyak orang,” tutur bapak sambil memperlihatkan foto orang yang dinikahkannya. Hari ini ia telah menikahkan dua orang mempelai. Kalau dilihat jumlah memang sedikit, tapi untuk bapak yang berusia 72 tahun, hal tersebut cukup melelahkan. Bagaimana tidak, untuk hari biasa ia hanya menikahkan dua sampai lima orang sebu-

lan. Akan tetapi sekarang ia telah menikahkan dua orang dalam satu hari. “Biasanya saya menikahkan dua orang sebulan. kadang lima orang,” ucapnya sambil menghapus keringat dengan sapu tangan putih. Setelah beberapa pertanyaan kudapatkan, aku pun pulang setelah bersalaman dengan pembantu penghulu. Di perjalanan timbul banyak pertanyaan muncul di benak. Kemana anak-anak muda yang menjadi penerus dan menggantikan penghulu? Apakah tidak ada lagi yang berminat menjadi penghulu sehingga bapak tua dengan usia 72 tahun harus turun tangan? Seharusnya sekarang ia sudah menikmati masa tuanya bersama anak cucunya. Tinggal anak cucunyalah yang bekerja untuk dirinya. (*)

Demo Bangun Kampung Budaya Sambungan dari halaman 9

‘’Mengapa beberapa fraksi masih menolak pembangunan perkampungan budaya. Padahal ini menyangkut identitas kita selaku rakyat Indonesia dan Kalbar. Apakah beberapa fraksi itu tidak memiliki budaya. Kalau memang mereka merasa tidak memiliki budaya lebih baik angkat kaki dari bumi khatulistiwa,’’ kata Ya’ Suparman dalam pernyataan sikapnya. Para pengunjukrasa juga secara tegas mengutuk tindakan anggota DPRD Provinsi Kalbar yang menolak pembangunan kampung budaya. ‘’Kami meminta agar anggota DPRD Kalbar yang menolak pembangunan kampung budaya supaya turun dari jabatannya,’’ kata Suparman. Sementara aksi unjuk rasa kali ini disambut unsur pimpinan DPRD Provinsi Kalbar. Kecuali wakil ketua dari Partai Golkar dan PPP. Ketua DPRD Kalbar Minsen mengatakan pembangunan kampung budaya yang menelan dana Rp54 miliar itu sudah siap dilaksanakan. Pengalokasiannya Rp22 miliar masing -masing untuk mem-

bangun kampung budaya Melayu dan Dayak. Sedang Rp10 miliar digunakan sebagai pembiayaan membangun plaza budaya. “Untuk penganggaran, badan anggaran DPRD dan tim eksekutif sudah menyekapati Rp54 miliar. Setelah dana disepakati tidak bisa dilaksanakan dalam satu tahun anggaran. Nomenklatur di dalamnya terdapat pengembangan rumah melayu dan betang. Rencanya dibangun satu komplek. Mengarah ke arah bundaran kota baru,” kata politisi PDI-P, ini. Sekretaris Fraksi PPP DPRD Kalbar Retno Pramudya menilai, pihaknya tidak pernah menolak program pembangunan kampung budaya. FPPP hanya mempertanyakan tentang pembangunan rumah budaya yang secara tiba-tiba dijadikan sebagai program multiyears mulai 2011- 2012. “Fraksi PPP hanya menginginkan agar konsep pembangunan rumah budaya harus dirombak. Soalnya, Kalbar multietnis. Sementara, konsep yang diajukan tidak jelas. Kami dari pembahasan APBD 2011 lalu tidak pernah menolak. Kami hanya menawarkan

konsep dan menjaga agar tidak ada ketersinggungan,” ungkap Retno kepada sejumlah wartawan di ruang kerjanya, Jumat (11/11). Dalam APBD 2011, menurutnya dana untuk pembangunan kampung budaya tidak terlaksana karena kesibukan pihak eksekutif dan legislatif. Kemudian, anggaran tersebut dialihkan ke APBD 2012 dengan konsep multiyears tanpa ada perundingan terlebih dahulu. “Dalam pembahasan APBDP 2011, sama sekali tidak ada penjelasan dari gubernur mengenai anggaran rumah budaya yang masuk dalam multiyears. Tiba-tiba muncul anggaran rumah budaya dengan sistem multiyears. Ini yang menjadi faktor keberatan kami dalam persetujuan paripurna lalu karena itu tidak sesuai dengan mekanisme dan menyalahi aturan,” jelasnya. Fungsi dan manfaat dari pembangunan rumah budaya juga dipertanyakan oleh Fraksi PPP. Pihaknya berharap pembangunan rumah budaya sebagai icon budaya di Kalbar dapat dikaji kembali. Sebab, anggaran Rp54 miliar tersebut

dinilai sangat besar, terkesan berlebihan serta tidak mendesak untuk dibangun. “Masih ada program pembangunan lain yang lebih urgen misalnya di bidang pendidikan, kesehatan dan lainnya,” ujar dia. Sebagai contoh adalah di Kabupaten Landak. Kabupaten ini masih kekurangan sekolah dan sebagian sekolah yang ada juga dalam keadaan memprihatinkan. Kondisi ini hendaknya dapat menjadi tolok ukur pemprov dalam mengelola APBD. Selain itu, ia pun mempertanyakan niat pemprov untuk mendongkrak pembangunan pariwisata di Kalbar dengan pembangunan rumah budaya. Ia berharap ada pengkajian ulang terhadap pembangunan rumah budaya, apakah fasilitas ini nanti mampu mendongkrak pariwisata Kalbar atau tidak. Sebab, ada banyak potensi wisata Kalbar yang selama ini justru tidak terkelola dengan baik. Padahal, jika dikelola dengan baik, potensi-potensi yang ada itu sudah bisa menarik wisatawan, baik lokal maupun mancanegara secara lebih optimal.(stm/ron)

adipura. Kemungkinan, kata Darmawan, dana tambahan sebesar Rp50 juta akan digunakan untuk pembayaran rekening listrik BLH selama 2012. “Sekarang rekening listrik BLH masih bergabung dengan pol pp dan ada rencana untuk dipisahkan. Jadi, mungkin tambahan itu hanya untuk bayar listrik saja di tahun depan,” katanya. Sementara itu, saat menyampaikan pandangan umum Fraksi D emokrat terhadap nota keuangan RAPBD Kalbar 2012, Mijino meminta pemprov untuk mengkaji ulang anggaran belanja langsung dari bi-

dang lingkungan hidup dan penanggulangan bencana. Penganggaran hendaknya dapat disesuaikan dengan kebutuhan nyata pada bidang-bidang tersebut. Hal ini dinilai penting guna mengantisipasi dampak dari perubahan iklim yang sangat ekstrem. Akhir-akhir ini, perubahan iklim (cuaca) yang sangat ekstrem tersebut juga dirasakan di Kalbar misalnya curah hujan yang tinggi sehingga mengakibatkan banjir, angin puting beliung dan gempa bumi. “Fraksi Demokrat mengharapkan pemprov mampu mengantisipasi dampak dari perubahan iklim,” ujarnya. (ron)

Naik Rp50 Juta Sambungan dari halaman 9

Sementara (PPAS) RAPBD 2012, anggaran untuk BLH dialokasikan sebesar Rp4,080 miliar. Jumlah ini meningkat dibandingkan dengan tahun lalu. Di tahun 2011, kata Darmawan, anggaran BLH hanya Rp4,030 miliar. “Jadi naiknya sekitar 50 juta, dari PPAS,” katanya kemarin. Darmawan mengakui, kenaikan tersebut tidak signifikan. Karena itu, tidak banyak program baru yang dapat dilaksanakan oleh BLH di tahun depan. Sebagian besar masih berupa program yang hampir sama dengan tahun sebelumnya.

Adapun program-program tersebut meliputi kegiatan wajib tentang lingkungan hidup sebagai standar pelayanan minimal lingkungan hidup seperti pemantauan kualitas air, pemantauan kualitas udara dan penanganan pengaduan masyarakat tentang pengelolaan lingkungan hidup. Pengaduan lingkungan hidup itu contohnya tentang kegiatan perusahaan yang mencemari sungai dan sekitarnya. “Pengaduan-pengaduan seperti itu yang prioritas untuk kita tangani,” ujar dia. Selain itu, ada pula program pemilihan duta lingkungan hidup, sekolah adiwiyata dan

Nota Keuangan RAPBD 2012 Copy Paste Sambungan dari halaman 9

b e r b e d a d e n ga n n o t a keuangan RAPBD 2011. Dalam pandangan umumnya ini, F PPP bahkan melampirkan copy naskah nota keuangan RAPBD 2011 yang disampaikan tahun 2010 lalu. “Kami berharap agar rapat-rapat membahas RAPBD 2012 nanti bisa lebih detail dan intensif, juga naskah rincian RAPBD 2012 hendaknya tidak copy paste juga,” ujarnya. Di sisi lain, FPPP tetap memberikan apresiasi yang tinggi atas peningkatan pendapatan asli daerah yang ditargetkan mencapai Rp1,07 triliun (meningkat dari tahun lalu). Hanya saja, fraksi ini priha-

tin karena dalam nota keuangan, argumentasi terkait peningkatan PAD 2012 yang disampaikan dalam nota keuangan juga copy paste dengan peningkatan PAD tahun 2011 lalu. Ada tiga alasan di tahun 2011 yang menyebabkan PAD meningkat. Alasan yang sama juga disampaikan untuk tahun 2012, antara lain masuknya objek kendaraan dinas termasuk kendaraan TNI dan Polri ke dalam wilayah pajak sehingga meningkatkan penerimaan pajak kendaraan bermotor (PKB). Bahkan, alasan ini juga sudah ada di nota keuangan RAPBD 2010 yang disampaikan di tahun 2009. “Argumentasi copy paste,” ujarnya.

Karena itu, FPPP mempertanyakan grafik pertambahan jumlah kendaraan bermotor, baik roda dua maupun empat, setiap bulan dalam tiga tahun terakhir. Hal ini untuk memastikan bahwa penambahan jumlah kendaraan bermotor tersebut signifikan dengan penerimaan daerah khususnya dari sektor pajak kendaraan bermotor. Sementara Syarif Izhar Assyuri, dari Fraksi PAN mengkritisi tentang struktur RAPBD 2012, khususnya dari sisi belanja. Belanja RAPBD 2012 dianggarkan Rp1,99 triliun terdiri atas Belanja Tidak Langsung sebesar Rp1,078 triliun (54.17%) dan belanja langsung sebesar Rp911,9

miliar (45.83%). Fraksi ini prihatin karena belanja tidak langsung masih selalu jauh lebih besar dari belanja langsung (belanja pembangunan). “Seyogyanya belanja langsung/ belanja pembangunan dapat dialokasikan lebih besar agar program-program yang pernah tertunda dan sangat dibutuhkan oleh masyarakat dapat kita penuhi,” katanya. Apalagi jika program tersebut berkaitan erat dengan upaya untuk meningkatkan kesejahteraan masyarakat, mengurangi pengangguran, menciptakan lapangan kerja, meningkatkan kualitas sumberdaya manusia dan pelayanan kepada masyarakat Kalbar.(ron)


Sulit Tata Parkir Liar Sambungan dari halaman 9

Pemkot merealisasikan target dalam APBD. “Koordinator harus sinergis dengan Pemkot dalam merealisasikan target, namun tetap memperhatikan kepentingan umum seperti kemacetan,” pintanya. Pelaksana harian Kepala Dinas Perhubungan Komunikasi dan Informatika Kota Pontianak, Zulkifli mengatakan, baju yang telah dibagikan harus dikenakan jukir. Pun dengan kartu, Dishubkominfo sudah membagikannya, pengguna jasa wajib menerimanya sebagai bukti pembayaran parkir. “Kartu yang sudah kami bagikan silakan diberi pada pengguna jasa parkir. Jangan difotokopi,” tegasnya. Seluruh jukir di Pontianak berjumlah 700-an orang, namun baru 300 yang mendapatkan baju baru. Jumlah jukir tersebut, kata Zulkifli, tersebar di 177 lokasi parkir yang resmi. Sejauh ini retribusi parkir untuk PAD terus meningkat, dari yang sebelumnya Rp900 juta, tahun ini menjadi Rp1 miliar. “Dari 177 titik tersebut tidak semuanya berpotensi. Untuk itu kami akan melakukan uji petik di sejumlah lokasi untuk mengetahui potensi dan target,” paparnya. Zulkifli mengingatkan, koordinator parkir untuk mengawasi ketat para jukir. Dia meminta koordinator turun ke lapangan agar parkir tidak semerawut sehingga membuat lalu lintas macet. “Koordinator harus turun ke lapangan, pantau anak buahnya,” ucapnya.

Koordinator parkir di kawasan Nusa Indah, Mahmud Abubakar mengungkapkan, pihaknya selalu siap bekerjasama dengan Pemkot Pontianak. Selama ini, dia mengaku mendukung apa pun kebijakan Pemkot terkait perparkiran. “Seperti target retribusi parkir Pemkot kami selalu dukung. Apa pun kebijakan pemerintah kami jalani,” kata Mahmud yang juga Ketua Forum Peduli Perparkiran Kota Pontianak. Di lain pihak, Dinas Perhubungan Komunikasi dan Informatika Kota Pontianak mengaku kesulitan mengatasi parkir liar di Jalan Kom Yos Sudarso, dekat Pelabuhan Dwikora. Mobil derek milik Polda Kalbar tidak sanggup memindahkan kendaraan yang parkir liar karena ukurannya terlalu besar. “Kami sudah pernah coba mendereknya tetapi tidak bisa. Sebagian besar di tempat itu yang parkir tronton,” kata Plh Kepala Dishubkominfo Kota Pontianak, Zulkifli, kemarin (11/11). Namun pihaknya, tegas Zulkifli, tidak putus asa. Parkir tersebut meresahkan masyarakat dan merusak fasilitas umum, mesti ditertibkan. Dishubkominfo telah berkoordinasi dengan Polda Kalbar, Polresta Pontianak serta Pelindo. “Kami terus berkoordinasi dan akan ambil tindakan,” ucapnya. Perlu koordinasi, paparnya, karena parkir liar tersebut tidak dapat hanya ditangani Dishubkominfo. Polisi melalui satuan lalu lintas juga mesti terlibat,

apalagi Pelindo yang punya wilayah, harus ada tindakannya. Zulkifli mengaku pihaknya juga merasa resah, apalagi sudah menjadi tugas Dishubkominfo menertibkan parkir liar seperti di Jalan Kom Yos Sudarso itu. “Kami juga merasa resah. Kami tidak akan tinggal diam,” tegasnya. Kendaraan roda empat tidak ada masalah bagi Dishubkominfo menertibkannya. Dapat dipindahkan dengan derek. Namun Dishubkominfo tidak habis akal menangani kendaraan roda enam dan tronton. Caranya dengan dikempeskan. “Sementara ini begitu saja caranya, bagi tronton kami kempeskan bannya,” kata Zulkifli. Sejauh ini Dishubkominfo sudah mengempeskan 15 kendaraan. Semuanya kendaraan besar, seperti truk dan tronton. Mulai dari Jalan Pak Kasih sampai sebagian Kom Yos Sudarso. Pekan depan, Zulkifli berencana melakukan penertiban lagi kalau kendaraan tersebut masih bandel. “Kalau dua jam ditunggu tidak ada pemiliknya akan kami kempeskan ban kendaraan tersebut,” tuturnya. Parkir tersebut diakui Zulkifli dapat mengganggu lalu lintas dan merusak jalan. Namun, kata dia, ada hal lain yang dirisaukan masyarakat Pontianak selama ini tentang sumber kemacetan. “SPBU yang menjual solar bersubsidi juga menjadi penyebab kemacetan. Untuk itu dalam waktu dekat kami akan lakukan dialog dengan Pertamina,” ujarnya. (hen)

Amankan Kayu Dokumen Fiktif Sambungan dari halaman 9

( 1 1 / 1 1 ) , m e n gat a k a n , pengamanan ratusan batang kayu bermula ketika tim gabungan menyelidiki dua buah kapal motor (KM). Yaitu KM Aman Jaya dan Karya Jaya. Kedua kapal menarik rakit kayu log berbagai ukuran dari Kapuas Hulu. Karena curiga, polisi kemudian meminta awak kapal menunjukkan dokumen angkutan. Mengenai asal usul, pemilik dan tujuan kayu. Sekilas kayu yang ditarik mempunyai kelengkapan izin. Dengan adanya kepemilikan SKAU. Setelah diperiksa secara intensif pihak berwajib menemukan kejanggalan. “Dari hasil penyelidikan

didapati fakta SPPT atas nama Heri Widodo fiktif sebagai dasar penerbitan SKAU. Sehingga seluruh kayu yang ditarik segera diamankan,” kata Mukson. Sementara barang bukti diamankan ketika telah berada di areal salah satu industri yang berada di Sungai Asam Kecamatan Sungai Raya Kabupaten Kubu Raya. Asal usul kayu tersebut terus didalami. Kini tersangka dipersangkakan telah mengangkut, menguasai atau memiliki hasil hutan tanpa dilengkapi dokumen sah. Dan bakal dijerat Pasal 50 ayat (3) huruf f atau h junto pasal 78 ayat (7) UU Kehutanan Nomor 41/1999. Menurut Mukson kini jajaran Polda Kalbar menaruh

perhatian serius terhadap kasus ilegal logging. Memerangi pembalakan liar yang merusak sumber daya alam hutan. Sekaligus tidak akan mentoleransi terhadap para pelaku. Apalagi wilayah geografis Kalbar mempunyai banyak kawasan hutan yang harus dilindungi. Sebagai penyangga bagi daerah. Mengingat dampak kerusakan hutan cukup berisiko mendatangkan bencana. Ia pun meminta peran aktif masyarakat. Memberi laporan bila mendapati aktifitas pembalakan liar. “Segera laporkan ke pihak berwajib. Sebagai langkah bersama menanggulangi illegal logging,” kata Mukson. (stm)

Peningkatan Anggaran Pendidikan Sambungan dari halaman 16

kunci untuk keluar dari ketertinggalan Kalbar selama ini. Penambahan anggaran pendidikan dapat dilakukan dengan beberapa cara. Salah satunya adalah dengan mengupayakan peningkatan pendapatan yang masih memungkinkan untuk menutupi kekurangan anggaran pendidikan, mengurangi atau menghemat belanja tidak langsung yang tidak terlalu mendesak, konsumtif serta kurang berdampak pada kepentingan rakyat secara langsung atau dengan mengurangi program-program yang tidak jelas sasarannya. Dapat pula dilakukan melalui pengurangan programprogram dengan alokasi anggaran cukup besar di setiap unit kerja yang belum menggambarkan peningkatan kinerja birokrasi dan pelayanan pemerintah kepada publik. Selain itu, bisa juga dengan pelaksanaan reformasi birokrasi sehingga beban ang-

garan daerah berkurang. Di samping anggaran sektor pendidikan secara umum, DPRD juga meminta supaya alokasi anggaran yang khusus di Dinas Pendidikan dapat ditingkatkan. Sebab, dalam prioritas plafond anggaran sementara (PPAS) belanja langsung tahun anggaran 2012 hanya dianggarkan sebesar Rp31,2 miliar. “Itu perlu ditingkatkan sesuai dengan prioritas pembangunan Kalbar 2012, khususnya untuk meningkatkan kecerdasan SDM Kalbar,” kata Mijino dari Fraksi Demokrat. Suprianto, dari Fraksi Gerindra Sejahtera Baru juga meminta supaya dana untuk Dinas Pendidikan ditingkatkan. Peningkatan dana ini antara lain dapat digunakan untuk memberi bantuan/insentif kepada guru yang mengajar di daerah terpencil, memberi bantuan beasiswa prestasi bagi siswa atau mahasiswa yang berasal dari wilayah perbatasan guna menumbuhkan rasa nasionalisme serta

untuk memperbaiki sarana prasarana. Sebelumnya, Wakil Gubernur Kalbar Christiandy Sanjaya mengatakan, Kalimantan Barat kesulitan untuk memenuhi proporsi anggaran sektor pendidikan 20 persen dari total APBD. “Untuk mencapai 20 persen agak berat. Kalau volume APBD kita Rp2 trilun lebih, berarti Rp400 miliar, sedangkan kita tidak membina SD dan SMP yang (pembinaannya) paling banyak di kabupaten/kota,” ujarnya. Christiandy menerangkan, dana fungsi kependidikan yang dimaksudkan dalam undang-undang tidak hanya berada di Dinas Pendidikan tetapi juga terdapat di sejumlah SKPD lain. Jadi, dana fungsi pendidikan adalah komulasi dari dana-dana tersebut. Ia mengakui bahwa walaupun semua dana di SKPD-SKPD itu digabungkan, Kalbar belum dapat memenuhi proporsi 20 persen dalam APBD 2012.(ron)

Ubah Karet Lokal jadi Unggul, Ekonomi ... Sambungan dari halaman 16

wawasannya supaya mereka semakin mencintai pekerjaannya sebagai petani karet sekaligus tidak mudah menyerahkan lahannya kepada pemodal luar yang semakin menguasai tanah masyarakat. Hal ini juga searah dengan program pemerintah

pusat dan daerah yang mau membangun perbatasan. Salah satu cara membangun perbatasan adalah melatih masyarakat untuk mengembangkan potensi lokalnya yang selama ini kurang diperhatikan. Setelah pelatihan ini banyak peserta semakin antusias untuk mengembangkan karet unggul di kampungnya masing-

masing. PSE KAP berkomitmen untuk terus mendampingi kelompok-kelompok tani karet unggul. Pelatihan tersebut menjadi awalnya. PSE berharap semua pihak dapat bekerja sama untuk mensukses program memajukan perokonomian masyarat yang saat ini masih kalah dengan Malaysia. (*/r)

Telan Rp1 Triliun Sambungan dari halaman 16

Jalan lingkar luar diharapkan dapat mengurangi kepadatan lalu lintas di Pontianak dan Kubu Raya. Menurut Jakius, jalan dan kanal lingkar luar tersebut mempunyai panjang 19,94 kilometer dengan lebar pembebasan ratarata 50 meter. Adapun total lahan yang akan dibebaskan mencapai sekitar 100 hektar. Sumber dana untuk pemb ebasan lahan ini akan diperoleh dari Pemkab Kubu

Raya Pemkot Pontianak dan pemprov. Kanal dan jalan lingkar luar itu dibagi dalam lima segmen. Segmen pertama sepanjang 4,48 kilometer, segmen kedua 5,4 kilometer, segmen ketiga 4,24 kilometer, segmen keempat 1,82 kilometer dan segmen kelima sepanjang 3,99 kilometer. Jalur dari jalan dan kanal lingkar luar itu merupakan bagian dari Jalan Trans Kalimantan melalui bundaran arteri Supadio melewati Jembatan

Kapuas II kemudian menyusuri kawasan perbatasan antara Pontianak dengan Kubu Raya. Khusus untuk pembangunan fisik jalan dan kanal lingkar luar, pemprov optimistis akan mendapat dukungan dana dari pemerintah pusat. Bahkan, kata Jakius, pemerintah pusat sudah siap untuk memberikan dukungan dana. Hanya saja, kucuran dana itu masih menunggu proses pembebasan lahan.(ron)



Pontianak Post

Peningkatan Anggaran Pendidikan


Telan Rp1 Triliun PEMBANGUNAN outer ring road dan outer ring canal (jalan dan kanal lingkar luar) di Pontianak dan Kubu Raya diperkirakan akan menelan dana sebesar Rp1 triliun. Untuk pembebasan lahan saja, kira-kira perlu dana sekitar Rp300 miliar (Rp100 miliar untuk jalan lingkar dan Rp200 miliar untuk kanal). Kepala Dinas Pekerjaan Umum Kalimantan Barat, Jakius Sinyor mengatakan, pembangunan jalan dan kanal lingkar luar ini diprediksi akan memakan waktu dua Jakius Sinyor tahun. Saat ini proses pembangunannya sedang memasuki tahap sosialisasi. Setelah sosialisasi selesai, akan dilanjutkan dengan tahap pembebasan lahan. “Tahap studi kelayakan, analisa mengenai dampak lingkungan, dan desainnya sudah, tinggal pembebasan lahan,” ujarnya. Ia berharap pembebasan lahan sudah dapat dilaksanakan pada tahun 2012 dan segera dilanjutkan dengan pembangunan fisik. Kedua fasilitas ini dinilai sangat urgen dan sudah sejak lama direncanakan. Jalan dan kanal lingkar luar ini bahkan telah termasuk dalam rencana pembangunan jangka menengah pemprov.


TROTOAR: Kenyamanan pejalan kaki mulai mendapat perhatian. Apalagi jika setiap trotoar dibuat seperti ini, selain tak ada pedagang informal juga menambah keindahan kota.

Ke Halaman 15 kolom 5

Ubah Karet Lokal jadi Unggul, Naikan Ekonomi Rakyat Senin pagi saat embun masih bergantung di rerumputan, sekitar pukul enam pagi, akhir Oktober 2011. Sekitar 27 orang menyusuri jalan setapak menuju lahan yang ditumbuhi karet berusia satu tahun lebih. Pada areal setengah hektar itu, mereka mengokulasi karet yang dipandu dua petani dari Nyarumkop. Berikut catatan Pastor Alfred Dino OFM Cap, pastor rekan di Paroki Kristus Raja Sambas. KEDUAPULUH tujuh orang tersebut merupakan utusan kelompok-kelompok tani karet unggul binaan Pengembangan Sosial Ekonomi Keuskupan Agung Pontianak, yang tersebar di tujuh kampung

Sabtu 12 November 2011

ya k n i Batu Hitam,

Sawah, Batang Air, Tanjung, Ngole’, Tapang dan Aping. Pusat pelatihan pengokulasian karet di Kampung Batu Hitam, Desa Sanatab, Kecamatan Sajingan, Kabupaten Sambas. Pelatihan ini menjadi solusi yang masuk akal bagi keluhan masyarakat perbatasan yang berekonomi lemah dibandingkan

dengan Malaysia. Malam sebelum pelatihan, Johan dan Eben, pelatih menjelaskan teknik mengubah karet lokal menjadi karet unggul. Johan mengungkapkan, “Dulu orang hanya menerima bibit karet tapi mereka tidak diberi tahu cara membuat karet unggul. Kini kami datang untuk memperkenalkan dan melatih para saudara dan saudari menjadi seorang petani karet yang profesional. Semuanya ini diawali dengan pelatihan mengubah karet lokal menjadi karet unggul.” Karet lokal yang sudah berumur satu tahun itu diokulasi dan dalam waktu dua bulan karet itu akan berubah menjadi karet unggul. Johan menuturkan bahwa lebih baik kita merugi lima tahun dan untung dua puluh lima tahun daripada rugi lima tahun dan rugi dua puluh lima tahun. Karet lokal yang berumur enam bulan sampai lima tahun bisa disulap

menjadi karet unggul. Para peserta mengikuti pelatihan ini dengan antusias. Di antaranya ada dua ibu yang dengan penuh perhatian mengikuti penjelasan dan praktek ini. “Saya ingin menjadi petani karet yang sukses, tapi selama ini saya hanya pingin menerima bantuan langsung dari pemerintah. Sekarang saya sendiri menciptakannya. Ini yang membuat saya bersemangat. Saya akan mengajak ibu-ibu lain untuk menjadi petani karet unggul,” papar Anatasia dari Kelompok Tani Kampung Sawah. Pengembangan Sosial Ekonomi Keuskupan Agung Pontianak (PSE KAP) Pastor Faustus Bagara OFM Cap mengatakan bahwa PSE KAP akan membina masyarakat lemah untuk meningkatkan ekonominya. PSE KAP mengembangkan karet unggul sebab tanaman ini sudah dikenal oleh masyarakat bertahun-tahun. Sekarang mereka hanya dibuka Ke Halaman 15 kolom 5

PONTIANAK - Dalam pemandangan umumnya, fraksi-fraksi di DPRD kembali mendesak agar pemerintah provinsi meningkatkan anggaran pendidikan, baik anggaran sektor pendidikan secara umum maupun anggaran yang khusus di Dinas Pendidikan. Mereka antara lain Fraksi Demokrat, Fraksi PAN dan Fraksi Gerindra Sejahtera Baru. Pemprov diingatkan bahwa berdasarkan amanat konstitusi, anggaran pendidikan ditetapkan sebesar 20 persen dari keseluruhan anggaran APBD. “Plafond anggaran pendidikan yang direncanakan pemprov pada APBD 2012 justru mengalami penurunan dari total APBD jika kita bandingkan dengan APBD 2011. Hal ini sangat jauh dari apa yang diamanatkan oleh konstitusi,” kata Syarif Izhar Assyuri dari Fraksi PAN. Dengan anggaran yang minim itu, fraksi ini mempertanyakan upaya percepatan peningkatan sumber daya manusia (SDM) di Kalbar. Fraksi PAN meminta pemprov untuk menambah anggaran khusus di bidang pendidikan di luar pendidikan kedinasan dalam APBD 2012. Sebab, bagaimanapun pendidikan dipandang sebagai Ke Halaman 15 kolom 5


pro-kalbar Pontianak Post


Sabtu 12 November 2011


Sarana Minim OTONOMI daerah atau desentralisasi kekuasaan di Kabupaten Sekadau masih lemah, karena masih minim sarana dan prasarana . Hal ini juga menjadi salah satu factor penghambat investasi. Bupati Sekadau Simon Petrus menkui hal tersebut dalam menyampaikan nota pengantar laporan keterangan pertanggungjawaban (LKPj) tahun anggaran 2010, rancanSimon Petrus gan peraturan daerah (Raperda) tentang perubahan nomenklatur Dinas Kependudukan dan Catatan Sipil, serta Raperda tentang Rencana Pembangunan Jangka Menengah Daerah (RPJMD) kepada DPRD Sekadau. Dikatakan dia, pelaksanaan desentralisasi, tugas pembantuan, dan tugas umum pemerintah daerah tahun 2010, terdapat banyak permasalahan yang menghambat pelaksanaan Ke Halaman 23 kolom 1


LENGANG: Salah satu SPBU di Ketapang yang tutup awal karena suplai BBM terlambat. Di eceran harga langsung meroket, mencapai Rp10 ribu per liter.

BBM Ketapang Langka Lagi


Ciprina: Suplai Terlambat KETAPANG – Beberapa hari terakhir ini, sebagian besar warga di Ketapang sulit mendapatkan bahan bakar minyak (BBM) jenis bensin (premium). Selain


LUKA: Korban Eta Kurniaty di RSUD Lan­dak.­

Tewas Ditabrak Motor JALAN Raya Km 9 Ngabang kembali memakan korban. Eta Kurniati (18), Siswi kelas XII SMA Negeri 1 Ngabang tewas di lokasi kejadian usai mengalami kecelakaan lalu lintas di km 9 Ngabang. Siswi tersebut hendak berangkat ke sekolah berboncengan dengan rekannya. Menurut keterangan kepolisian, kejadian laka lantas terjadi sekitar pukul 09.00 wib. Motor honda KB 3222 LG yang dikemudikan Oktavianus (17) melaju dengan kecepatan tinggi dari arah Ngabang menuju Pontianak. Ke Halaman 23 kolom 3


Tak Rampung WAKIL Ketua Komisi A DPRD Sekadau, Muhmmad mempertanyakan tiga buah bangunan masing-masing tiga bangunan kesehatan (dua puskesdes, satu poslindes) yang tidak diselesaikan pengerjaanya. Bangunan tersebut di ketahui mulai kerjakan pada tahun 2008 lalu di salah satu Desa Kecamatan Belitang Hulu. “Ini hasil laporan kadesnya pada kita Muhammad saat reses bulan lalu di dapil tiga,” kata Muhammad tanpa menjelaskan Desa mana yang ia maksud. Bulan lalu, diceritakan dia, tujuh wakil rakyat asal pemilihan Dapil tiga, di tiga Belitang melakukan reses guna melihat langsung proses pembangunan serta menyerap aspirasi dari masyarakat. Berbagai macam laporan mereka terima. Termasuk, tentang tidak selesainya dua puskestu dan satu sekolah tersebut. Ke Halaman 23 kolom 3

terlihat antrean panjang terlihat dalam beberapa hari terakhir, warga pun mulai mengeluh. Di tingkat eceran bensin langsung melambung, Rp 8000-Rp 10 ribu per liter. Pantauan akan langkanya BBM beberapa waktu terakhir juga dilakukan Anggota DPRD Ketapang, Almuhammad

Yani yang mengatakan, susahnya mendapatkakn BBM tidak hanya di tingkat eceran, namun di beberapa SPBU juga mengaku beberapa waktu belakangan ini,persedian BBM nya terbatas. “Agar kelangkaan BBM tak kembali terjadi berkepanjangan seperti sebelumnya, saya harap pihak Pertamina

maupun Pemkab lebih cepat dan tanggap mengatasi kelangkaan BBM yang terjadi beberapa waktu belakangan ini,”ujarnya. Karena lanjutnya, sulit didapatnya BBM merupakan suatu hal yang sangat vital. Karena sambungnya, jika Ke Halaman 23 kolom 1

Toko Sinar Mas Dirampok 100 Gram Dibawa Kabur NGABANG - Jumat (11/11) warga pasar baru Ngabang dihebohkan dengan perampokan toko perhiasan Sinar Mas yang terletak di jalan pasar baru Ngabang. Pelaku berhasil membawa kurang lebih 100 gram perhiasan. Pemilik toko, Acun alias Anderson (70) mengatakan kerugian diperkirakan 40 juta kurang lebih 100 gram diantaranya berupa 20 kalung (5-10 gram) dan 15 gelang (3-10 gram). Saat kejadian, toko perhiasan tersebut baru saja buka. Pemilik toko hendak makan sebentar ke dapur, saat itulah kawanan perampok menggasak perhiasan di dalam kotak kaca milik Acun. Menurut keterangan saksi mata, Endang (18), ia melihat dua orang pria dengan menggunakan sebuah motor Revo berwarna hitam dengan plat kendaraan sementara KB 2700 xx berada di depan toko tersebut sekitar pukul 07.30 wib “Pria yang digonceng menggunakan jaket berwarna hitam, sedangkan yang menggonceng berpakaian biasa.Nomor platnya masih sementara, KB 2700 xx. Kejadian pukul setengah 8,” jelas Endang saat diwawancarai wartawan. Kasat Reskrim Polres Landak, AKP Andi Oddang Riuh, SIK saat dihubungi Pontianak Post menghimbau agar masyarakat meningkatkan kewaspadaan, terutama bagi mereka yang menggeluti bisnis perhiasan khususnya. Kamera CCTV juga sangat penting untuk Ke Halaman 23 kolom 3

Ke Halaman 23 kolom 1

RAMPOK: Suasana toko Sinar Mas Ngabang usai kejadian perampokan.

Telantarkan Lahan Segera Angkat Kaki NGABANG - Kadis Perkebunan dan Kehutanan Kabupten Landak, Vinsensius mengungkapkan bahwa dari hasil verifikasi pihak BPN bersama dengan tim di lapangan, terindikasi ada lahan Hak Guna Usaha (HGU) milik beberapa perusahaan yang di telantarkan. Data tersebut sudah disampaikan ke BPN propinsi maupun BPN pusat.

“Hasil verifikasi yang dilakukan BPN dan Disbunhut Kabupaten Landak beberapa waktu lalu terdapat banyak temuan atas terlantarnya lahan milik beberapa perusahaan yang tergolong ditelantarkan,” katanya. Ia menjelaskan, terlantar dalam hal ini adalah lahan milik mereka tidak dikelola. Ke Halaman 23 kolom 1


Pecat Karyawan Nakal SINTANG– Penanggung Jawab SPBU Dodo yang berlakasi di Tugu BI Sintang, Gulam Murtaza, mengatakan kalau pihaknya tidak mentolerir tindakan nakal yang dilakukan anak buahnya di SPBU. “Kalau ada karyawan nakal, sanksinya adalah dipecat. Dalam memberikan pelayanan untuk masyarakat, Kami ingin karyawan yang jujur,” kata Murtaza, pada wartawan, Kamis (10/11).

Murtaza menambahkan, dalam memberikan pelayanan pada masyarakat, pihaknya tetap melayani pera pengantri. Namun, pengantri tersebut dibatasi dalam membeli minyak. “Mareka hanya diperkenankan untuk membeli minyak paling banyak 40 liter. Mareka akan kita layani dengan sewajarnya. Kalau pengantri tujannya untuk menimbun minyak, Ke Halaman 23 kolom 1

Bertabur Angka 11 di Pesparawi Bengkayang

Ajang Meningkatkan Kualitas Keimanan


BERSIHKAN LAHAN: Supaya padinya subur, petani di Sekadau ini membersihkan lahan dari gulma dan rumput pengganggu.

PESTA paduan suara gerejawi (Pesparawi) ke III Kabupaten Bengkayang, Jumat (11/11) dibuka Bupati Bengkayang, Suryadman Gidot. Istimewanya, pembukaan yang berlangsung di lapangan sepakbola Kecamatan Sanggau Ledo dibuka tepat pukul 11.00 WIB. Artinya, pembukaan ini bertabur angka 11 yakni, pukul 11, tanggal 11, bulan 11 dan tahun 2011. Zulkarnaen,Sanggau Ledo


PESPARAWI III: Bupati Bengkayang Suryadman Gidot memencet tombol menandai dimulainya Pesparawi III Bengkayang. Semua dimulai di angka 11.

PANITIA pelaksana Rudi mengatakan, Pesparawi menjadi media untuk pengembangan bakat dan minat umat kristiani dalam memuji dan meninggikan nama tuhan. Selain itu, kata Rudi yang juga Kepala Sekolah SMA 1 Bengkayang ini, untuk menggali potensi, bakat serta talenta yang dimiliki anak anak tuhan dalam rangka pengembangan gerejawi. “Yang terpenting dalam kegiatan ini adalah dalam rangka peningkatan kualitas imam umat kristiani,” kata Rudi saat memberikan kata sambutan. Dia mengatakan, Pesparawi III Bengkayang diikuti enam belas kecamatan dari tujuh belas Kecamatan yang ada. Kecamatan yang tidak ikut dalam Pesparawi tersebut adalah Kecamatan Suti Semarang. “Harapan kita Kecamatan Suti Semaarang dapat berpartisipasi dalam Pesparawi ke empat mendatang,” jelas Rudi. Hal senada juga diungkapkan salah satu Ke Halaman 23 kolom 1



Sabtu 12 November 2011


Tingkatkan Kualitas JAJARAN Dinas Kesehaatn selayaknya mampu memaksimalkan pelayanan kesehatan masyarakatnya. Layak disambut baik, keinginan Pemda yang berencana melakukan renovasi dan meningkatkan kualitas peralatan medis yang ada di Puskesmas. Yakni di Puskesmas Sui Pinyuh dan Jungkat. Sebab, masalah kesehatan merupakan hal yang penting di masyarakat. Mulai dari pelayanan “Meningkatkan pekesehatan ditingkat ka- l a y a n a n k e s e h a t a n bupaten yakni di rumah masyarakat adalah salah satu tugas pemerintah. sakit hingga di tingkat Mulai dari pelayanan kesehatan ditingkat kabupaten kecamatan dan desa yakni di rumah sakit hingga melalui puskesmas di tingkat kecamatan dan desa melalui puskesmas,” Ria Norsan kata Bupati Pontianak, Ria Norsan, kemarin.Menurut dia, puskesmas memiliki peranan dan fungsi yang strategis dalam memberikan pelayanan kesehatan di masyarakat. Sebab, puskesmas merupakan akses utama dan terdekat yang mudah dijangkau masyarakat. Sebelum masyarakat tersebut dirujuk atau mendapatkan perawatan lanjutan di rumah sakit.“Pentingnya peranan puskesmas ini, maka keberadaannya perlu ditunjang dengan sarana dan prasana yang memadai. Seperti kondisi ruangan dan bangunan puskesmas, begitu juga perlengkapan peralatan medis dan tenaga medis yang terampil. Supaya pelayanan yang diberikan puskesmas lebih optimal,” tuturnya. Kedepan, Norsan berharap agar pelayanan kesehatan yang diberikan puskesmas kepada masyarakat lebih baik dan maksimal. Agar tidak ada lagi keluhan dari masyarakat terkait pelayanan kesehatan yang didapatnya di puskesmas yang ada dilingkungannya masing-masing. “Perbaikan kualitas puskesmas ini tidak bisa dilakukan secara serentak. Melainkan bertahap disesuaikan dengan anggaran yang ada. Jika memungkinkan, maka renovasi dan perbaikan kualitas peralatan medis itu akan kita lakukan untuk dua puskesmas yakni di Sungai Pinyuh dan Jungkat,” ujarnya. “Mudah-mudahan, renovasi dan perbaikan kualitas puskesmas itu akan berdampak positif terhadap peningkatkan pelayanan kesehatan di masyarakat Kabupaten Pontianak ini,” tukasnya. (ham)


ANTRE: Antrean panjang pada pembangunan jembatan di Jungkat. Pengendara berharap agar jembatan secepatnya dirampungkan. Setidaknya ada lima jembatan yang belum kelar.

Minta Copot Dirut RS Rubini MEMPAWAH-Melihat manajemen RS DrRubini Mempawah yang membuat suatu kebijakan dinilai merugikan dalam hal pelayan public, memunculkan rasa keprihatinan kalangan dewan. Sebab, wakil rakyat melihat kebijakan RS Rubini yang menutup ruangan HCU (High Care Unit) dinilai tidak memberikan solusi yang positif. Karenanya, H Amin HAM, Wakil Ketua DPRD Mempawah mendesak Bupati Ria Norsan mengganti Direktur Rumkit. Sebab, kebijakan itu dinilai mengabaikan pelayanan kesehatan masyarakat. “Sewajarnya, rolling dilakukan untuk memperbaiki manajemen Rumkit Mempawah. kita sudah toleransi berbagai permasalahan yang ada selama ini. Kebijakan menutup ruang HCU itu sudah tidak bisa ditoleransi. Jelas-jelas mengabaikan kepentingan masyarakat,” tandasnya. Amin kurang setuju dengan ulah dan kebijakan yang diambil manajemen rumkit. Bukan kali ini rumah sakit menimbulkan masalah. Sejauh ini berbagai persoalan dapat diredam untuk kepentingan kesehatan masyarakat. “Banyak masalah di Rubini, dari masalah anggaran obat, tabung oksigen, infus hingga keluhan masyarakat terh-

adap pelayanan yang diberikan Selalu diberikan peluang dengan harapan adanya perbaikan kinerja manajemen. Nyatanya, tidak pernah terealisasi bahkan semakin memburuk seperti kebijakan menutup ruang HCU,” kata dia. Karenanya, Legislator Dapil Sungai Pinyuh-Anjongan ini menyarankan agar Bupati Pontianak melakukan perombakan terhadap manejemen RS Rubini Mempawah. Termasuk melakukan pergantian terhadap Direktur Utama (Dirut) maupun pejabat rumkit lainnya yang dinilai tidak beres dan bermasalah. “Kami akan selalu mendesak bupati untuk melakukan perubahan besar terhadap manajemen rumah sakit. Kita bersihkan rumkit dari penyakit-penyakit yang selama ini menjadi virus bobroknya kinerja rumah sakit itu sendiri,” tuturnya. Sebab, pihaknya mendambakan Rumkit Rubini Mempawah tumbuh menjadi rumah sakit yang dapat memberikan pelayanan kesehataan yang baik dan prima kepada seluruh masyarakat Kabupaten Pontianak. “Kita juga mendapatkan keluhan dari beberapa dokter spesialis di rumkit rubini mempawah tentang kinerja manajemen saat ini. Untuk itu, kami

akan mengatur waktu yang tepat untuk menyelesaikan masalah rumkit rubini ini dengan bupati. Secepatnya akan kita lakukan perubahan untuk kepentingan masyarakat dan daerah Kabupaten Pontianak,” janjinya. Sementara itu, Aktifitas Pemuda Kota Mempawah, Iswandi mengaku sependapat dengan desakan dewan untuk mengganti Dirut Rumkit Rubini Mempawah. Sebab, menurut dia, berbagai permasalahan yang muncul merupakan kebijakan yang salah oleh pimpinan rumah sakit milik Pemerintah Kabupaten Pontianak itu. “Setiap kebijakan itu tentu datang dari pimpinan. Tidak mungkin kebijakan bisa dilakukan oleh seorang kabid tanpa diketahui oleh pimpinannya. ‘ Karenanya, setiap pimpinan harus mempertanggungjawabkan kebijakannya. Seperti halnya kebijakan menutup ruang HCU ini,” pendapat Iswandi. “Kebijakan itu jelas salah dan tidak dapat dibenarkan. Karenanya, kami sangat sependapat dan mendukung apabila dilakukan pergantian manajemen rumkit. Terutama mengganti Dirut rumkit itu sendiri. Agar kinerja rumkit lebih baik dan maksimal,” tukasnya. (ham)

Sengketa Tanah Terus Berlanjut NGABANG - Belum puas dengan hasil putusan majelis hakim Pengadilan Negeri (PN) Mempawah yang memenangkan tergugat I, AY Suparman dan tergugat II, Narto Bin Daeng Labas terhadap perkara sebidang tanah yang terletak di Ilung Bunut jalan Munggu-Ngabang Dusun Ray, Desa Raja Kecamatan Ngabang Kabupaten Landak, pihak penggugat Gusti Edi Mariadi cs kembali melayangkan gugatan terhadap kedua tergugat ke

PN Mempawah dalam kasus yang sama. Gugatan Gusti Edi Mariadi cs tersebut diserahkan sepenuhnya kepada kuasa hukumnya F.A. Aftarin Lanyo dengan nomor surat gugatan No. 10/PDT/6/2011/PN.MPW tanggal 26 April 2011. Guna menanggapi surat gugatan tersebut, Jumat (11/11) untuk kesekian kalinya majelis hakim PN Mempawah menggelar sidang lapangan bertempat dilokasi tanah yang disengketakan. Sidang yang digelar secara terbuka itu dihadiri pihak penggugat, pihak tergugat dan para saksi baik dari penggugat maupun dari tergugat. Sidang inipun disaksikan langsung Kepala Desa (Kades) Raja, Zulkarnain dan kuasa hukum penggugat, F.A. Aftarin Lanyo dengan pengamanan dari Mapolsek Ngabang. Sebelumnya, pihak tergugat sempat dinyatakan menang oleh PN Mempawah dengan menolak eksepsi tergugat seluruhnya. PN Mempawah juga menghukum penggugat untuk membayar biaya perkara yang ditaksir Rp. 5.404.000. Namun pada kenyataannya pihak penggugat belum puas dengan keputusan majelis hakim PN Mempawah dan kembali melayangkan gugatan dengan perkara yang sama ke PN Mempawah. Sidang lapangan tersebut dipimpin hakim ketua, Agung Iriawan dengan hakim anggota I, Victor, hakim anggota II, Herdin, Panitera, Samsudi dan juru sita Samuel Ishak. Usai menggelar sidang, Agung Iriawan menjelaskan bahwa hasil dari persidangan lapangan ini, pihaknya akan merangkum dari hasil sidang lapangan tersebut dalam suatu lapaoran atau Berita Acara. “Untuk itu nantinya kita akan bermusyawarah terhadap hasil sidang lapangan ini. Jadi kita belum bisa menyampaikan keseimpulan dari hasil sidang lapangan ini,” ujarnya. Menurut Agung, dalam sidang lapangan yang digelar kemarin, majelis hakim sudah melihat semua batas-batas tanah yang disengketakan melalui arah dari mata angin. Para pihak yang bersengketapun sudah menunjukan arah mata angin, baik batas sebelah utara, selatan, timur dan sebelah barat. (Sgg)

Pontianak Post

Sabtu 12 November 2011




Minimalisir Dalam meminimalkan korban kecelakaan. Satlantas Polres Singkawang akan melakukan pemasangan rambu peringatan di jalan raya. Petugas juga akan memberikan imbauan kepada masyarakat. Kapolres Singkawang, AKBP Prianto melalui Kasatlantas, AKP Bagio Erianto menyebutkan pihaknya akan terus melakukan upaya tekan angka laka lantas. Ini dilakukan dengan memasang peringatan-peringatan di titik-titik jalan yang ramai. “Sekarang sudah ada rambu-rambu peringatan, namun akan kita tambah lagi ke depannya, kemudian juga akan memberikan imbauan kepada masyarakat,” kata AKP Bagio Erianto, kepada wartawan. Menurutnya, jalan-jalan di Kota Singkawang. Terutama di hari-hari besar. Kepadatan akan semakin terlihat. Keadaan ini, memungkinkan bertambahnya korban di jalan raya. “Banyaknya tempat tujuan wisata, membuat banyak warga berkunjung. Sehingga menambah kepadatan lalulintas,” katanya. Disebutkan Bagio, ada beberapa titik rawan kecelakaan yang harus diwaspadai warga saat berkendaraan. Diantaranya daerah Pasir Panjang, Tikungan Lirang, daerah 1001, Simpang PU, Depan Gereja Diponegoro, Kaliasin, dan Simpat Vit.“Warga diharapkan lebih waspada saat berlalulintas di jalan-jalan tersebut, karena memang, sudah ada korban di jalan-jalan itu,” katanya. Sebelumnya, Polres juga telah menyampaikan Surat Nomor B/3519/X/2011 tertanggal 14 Oktober 2011 kepada Walikota Singkawang mengenai perubahan arah lalulintas. (fah)

SANTUNAN: Santunan Jasa Raharja Singkawang kepada keluarga korban kecelakaan.


Proses Cepat Asuransi Jasa Raharja

Proaktif Mendatangi Keluarga Korban KECELAKAAN di jalan raya banyak merenggut nyawa. Pihak pemerintah menyediakan asuransi untuk korban. Prosesnya cepat. Tidak seperti dibayangkan banyak orang

Sore itu, dua orang laki-laki datang di Kantor asuransi Jasa Raharja Perwakilan Singkawang, Jalan Alianyang. Kepala Perwakilan, Muhammad Noor pun menyambut ramah. Dua tamu itu adalah Apui dan Ajan. Apui adalah orang tua Lukas Than sedangkan Ajan adalah pamannya. Wajah Apui, masih terlihat murung. Sebab, anaknya yang masih duduk di bangku sekolah Kelas 10 SMK Pratiwi Singkawang, meninggal akibat kecelakaan usai pulang dari sekolah, Jumat (4/11) lalu di Jalan Alianyang Singkawang. Kemudian Noor mempersilahkan Apui menandatangani berkas. Uang pun ditransfer ke rekening keluarga korban. “Uangnya Rp25 juta,” kata Noor menjelaskan. Noor menjamin, tidak ada potongan sepeser pun. “Bila ada pegawai saya yang minta, laporkan saja,” kata Noor yang baru empat hari bertugas di Kota Singkawang ini. Menurut Noor, pihaknya harus proaktif mendatangi keluarga korban. Mencairkannya pun tidaklah susah. Kalau pun terlambat biasanya bukanlah dari kita melainkan dari keluarga korban. Misalnya, tidak ada KTP, KK atau persyaratan lainnya. Kita harus menunggu mereka melengkapinya. Menurut Noor, mekanisme untuk pengajuan klaim sangatlah sederhana. “Kita memperoleh berita acara dari kepolisian dan langsung kita proses. Selanjutnya, kita datangi keluarga korban meminta persyaratan. Kita tak mau membebani mereka lagi,” kata Noor. Noor berharap, dengan proses cepat ini bisa mengurangi rasa sedih yang mendalam dari keluarga yang ditinggalkan. Noor mengatakan, sebenarnya ada dua korban ayng diurus asuransinya yakni kecelakaan yang terjadi di Sui Jaga Kecamatan Sui Raya Kabupaten Bengkayang, Ahad (6/11), atas nama Safira. Anak laki-laki yang berumur sembilan tahun tewas diseruduk mobil. “Karena bapaknya masih berduka dan masih trauma melihat mobil, akhirnya kita yang datang ke rumahnya. Bapaknya menandatangani administrasi yang diperlukan,” kata Noor. Paman Lukas Than, Ajan memuji proaktifnya Jasa Raharja tersebut. Mereka yang proaktif, proses cepat, tidak berbelitbelit dan tidak ada potongan sama sekali,” kata Ajan yang juga salah satu penjahitterkenal di Kota Singkawang ini. (*ser)

Ruang Wako Siap Akhir Tahun SINGKAWANG- Ruangan Walikota dan Wakil Walikota yang berada di Kantor Pemkot baru, Jalan Firdaus, dipastikan bisa ditempati pada akhir tahun ini. Hal tersebut diungkapkan Kepala Dinas Tata Kota, Pertanahan dan Cipta Karya Kota Singkawang, Muslimin. ”Gedung utama dan gedung satunya, dipastikan bisa ditempati pada akhir tahun ini. Termasuk ruangan Walikota dan Pengecatan sendiri Wakil Walikota sudah hampir seSingkawang, termasuk ruang lesai, hanya tingrapatnya,” kata gal beberapa yang Muslimin, kepada wartawan. masih kurang, untuk Muslimin pun gedung utama dan menjelaskan, gedung yang ada di pembangunan terus di lakukan. belakangnya, Pa ra p e k e r ja Muslimin sekarang ini, ada yang menyelesaikan pengecatan di beberapa bagian. Pengerjaan ornamen, pembenahan interior. Kemudian juga membuat saluran air serta jalan kantor Pemkot. ”Pengecatan sendiri sudah hampir selesai, hanya tinggal beberapa yang masih kurang, untuk gedung utama dan gedung yang ada di belakangnya,” katanya. Kalau nanti ada dana, lanjutnya, selanjutnya akan dibangung Musholla dan juga kantor Sekretaris Daerah. Proses pengerjaan komplek Kantor Walikota Singkawang ini terdiri atas gedung utama, gedung belakang, musholla, kantor setda serta halaman, pagar, saluran, dan lainnya. Tetapi yang selesai dibangun baru gedung utama, karena menunggu kucuran dana dari pusat. “Karena musholla belum dibangun, jika nanti sudah ditempati. PNS beragama Islam dapat salat di Masjid Agung yang letaknya tidak terlalu jauh. Atau nanti bisa disediakan satu ruang khusus untuk salat,” katanya. Dana yang dibutuhkan secara keseluruhan, sesuai desain awal, adalah antara Rp43 hingga Rp45 miliar. Tapi sekarang ini, dana yang sudah dipakai sebesar Rp26 miliar. Sehingga wajar kalau ini belum selesai. Dana Rp26 miliar, lanjutnya, adalah dari alokasi 2009 dan 2010. Dan memang sesuai kontrak, secara fisik bangunan sudah selesai. Kemudian untuk pekerjaan lanjutan. Seperti halnya pengecatan dan lainnya. Akan di back up dari dana APBD 2011 sebesar Rp1 miliar. Sementara itu, Walikota Singkawang, Hasan Karman beberapa waktu lalu mengatakan telah rindu ingin menempati kantornya. Karena semenjak menjabat menjadi Wali Kota, dirinya belum memiliki kantor untuk melaksanakan tugas.(fah)


20 terigas

Sadar Sehat Melalui Harkesnas PEMERINTAH Daerah Kabupaten Sambas siap mendukung terwujudnya Gerakan Nasional Kebersihan Indonesia yang diamanatkan Presiden RI. Tema Hari Kesehatan Nasional ke-47, Indonesia Cinta Sehat, dijelaskan Bupati Sambas Juliarti Djuhardi Alwi, saat membacakan Sambutan Menteri Kesehatan RI Endang Rahayu Sedyaningsih, pada peringatan harkesnas yang digabung dengan peringatan hari pahlawan di Halaman Kantor Bupati Sambas, Kamis (10/11). Peringatan hari tersebut dimaksudkan untuk mengajak seluruh komponen bangsa melakukan gerakan dan tindakan nyata dalam mencapai hidup bersih dan sehat. “Tema ini mencerminkan bahwa bangsa Indonesia mencintai kesehatan, mau dan mampu berperilaku sehat, menjaga lingkungan agar tetap sehat, serta mengupayakan agar masyarakat mendapatkan pelayanan kesehatan yang bermutu, adil, dan merata,” jelas dia. Kesehatan, terang dia, merupakan salah satu pilar pembangunan SDM dalam mewujudkan manusia Indonesia yang tangguh, kuat, pandai, beradab, mampu bersaing dengan bangsa lain, dan unggul dalam bidang ekonomi, teknologi, dan sosial budaya. “Untuk itu kita memerlukan manusia Indonesia yang sehat, cerdas, aktif, dan produktif,” tegasnya. Indonesia Cinta Sehat, lanjut Juliarti, mencerminkan pelaksanaan amanat Undang-Undang Dasar 1945, yang menyatakan bahwa setiap orang berhak hidup sejahtera lahir dan batin, bertempat tinggal dan mendapatkan lingkungan hidup yang baik dan sehat, serta berhak memperoleh pelayanan kesehatan. Amanat itu, tuturnya, dijabarkan dalam Undang-Undang Nomor 36 Tahun 2009 tentang Kesehatan dengan pernyataan bahwa pembangunan kesehatan harus ditujukan untuk meningkatkan kesadaran, kemauan, dan kemampuan hidup sehat masyarakat yang setinggi-tingginya, sebagai investasi bagi pembangunan SDM. Dengan pelaksanaan pembangunan kesehatan yang komprehensif dan berkesinambungan dalam beberapa tahun terakhir ini, menurut Juliarti cenderung terjadi peningkatan derajat kesehatan masyarakat dan pencapaian sasaran millenium development goals. Di samping itu, tambah dia berbagai program terobosan meningkatkan akses masyarakat pada pelayanan kesehatan yang bermutu juga telah dilancarkan. (har)

Pontianak Post


Sabtu 12 November 2011

Api Hanguskan Sepuluh Ruko Subuh Membara di Pasar Tebas TEBAS – Sedikitnya sepuluh ruko di komplek Pasar Tebas Jalan Sinar Baru, Tebas Sungai, Tebas, ludes dilalap si jago merah, Jumat (11/11) sekitar pukul 04.10 WIB. Kebakaran ini menghanguskan bagian atas lantai ruko yang semuanya berlantai dua tersebut. Meski tak ada korban jiwa, diperkirakan kerugian materil mencapai ratusan juta rupiah. Diduga penyebab kebakaran adalah korsleting listrik. Menurut salah satu pemilik ruko, Bong Coi Lim (67), dia dikagetkan dengan api yang menjalar begitu cepat. Pada saat itu ia dan keluarganya masih tertidur lelap, namun sebelum kebakaran, ia telah tejaga. Teriakan api dari luar ruko pun terdengar ke telinganya dan ia pun segera keluar, namun api sudah menjalar. “Saya keluar dari ruko, ternyata api sudah masuk ke ruko kami. Jadi spontan me-

nyelematkan barang beharga dari ruko,” jelasnya usai kejadian. Tak tahu pasti dari mana asal api, namun menurut yang terlihat, sumber panas tersebut berasal dari ruko paling ujung, dari sepuluh ruko yang berdampingan satu blok tersebut. “Sepertinya api dari ujung ruko,” katanya. Spontan warga sekitar membantu. Dengan peralatan seadanya mereka memadamkan api. Jalan Raya Tebas persis di depan ruko pun macet karena kerumunan warga. Untung pemadam kebakaran setempat, Pemangkat dan sekitarnya, datang menjinakkan api, sehingga tak menjalar ke mana-mana. Bahkan sebagian warga sibuk membantu korban kebakaran mengeluarkan barang-barang dari dalam ruko, agar tak tebakar. Bahkan setelah usai api dijinakkan, rombongan Bupati Sambas Juliarti Djuhardi Alwi, Kapolres AKBP Pahala HM Panjaitan, Ketua DPRD Masud Sulaiman, pun mampir mengunjungi lokasi kebakaran di Pasar Tebas. Jajaran pimpinan Muspida Sam-


TERBAKAR: Suasana kebakaran di komplek Pasar Tebas Jalan Sinar Baru, Tebas Sungai, Tebas, yang setidaknya menghanguskan sepuluh ruko, Jumat (11/11) kemarin sekitar pukul 04.10 WIB.

bas ini bertemu langsung korban dan membesarkan hati mereka, serta memberikan motivasi agar tabah dan bersabar atas musibah yang terjadi. Sementara itu, Kapolsek Te b a s A K P Mu l y a d i y a n g terjun langsung melakukan

pengamanan dan evakuasi korban kebakaran, mengaku belum mengetahui s e cara pasti penyebab kebakaran. Dugaan sementara, menurut dia, adalah korsleting listrik. Kini kepolisian masih mendalami penyebab kejadian

tersebut. “Dugaan sementara korsleting listrik, tapi ini masih kita dalami, untuk mendapatkan kepastian penyebab kebakaran. Kini kita sudah mem-p oliceline ruko yang terbakar untuk pengamanan,” ungkapnya. (har)

Momentum Satu untuk Bersatu Tangkal Isu SARA Jelang Pilgub PEMANGKAT – Forum Komunikasi Pimpinan Daerah Kabupaten Sambas dan Kota Singkawang bersama Forum Kerukunan Umat Beragama dan Berbudaya dari kedua wilayah menggelar silaturahmi dalam upaya menciptakan suasana kondusif menjelang Pemilihan Gubernur (Pilgub) 2012 di Gedung Fulca Pemangkat, Jumat (11/11). Tanggal 1 bulan 11 tahun 2011 menjadi momentum untuk seluruh masyarakat bersatu, sepakat menjaga ketertiban dan keama-

nam, dan meredam isu-isu yang dapat memecahbelah persatuan dan meresahkan masyarakat. Silaturahmi yang digagas Polres Sambas ini menghadirkan tokoh lintas agama dan masyarakat, hingga pemuda. Hadir di antaranya Bupati Sambas Juliarti Djuhardi, Ketua DPRD Sambas Masud Sulaiman, Wakil Wali Kota Singkawang Edy R Jacoub, Wakil Bupati Sambas Pabali Musa, Kapolres Sambas AKPB Pahala HM Panjaitan, Kapolres Singkawang AKBP Prianto, Dandim Singkawang Letkol Wawan Setiawan, Ketua MABM Sambas Burhanuddin A Rasyid, mantan Wali Kota Singkawang

Awang Ishak, Tokoh Tionghoa Singkawang Bong Chi Nen, Pastur Amandus Ambot OPM CAP, ICMI, Ketua DAD Sambas Bartolomeus, MUI, FKUB, Kemenag Sambas dan Singkawang, serta tokoh lintas agama lainnya dari kedua wilayah. Bupati Sambas di hadapan undangan meminta untuk menanggapi permasalahan yang muncul dengan pikiran positif dan jernih. Diingatkan dia agar jangan mudah terpancing, setiap isu yang ada disaring dan dikroscek kembali kebenarannnya, dan jangan cepat mengambil kesimpulan. “Apa yang terjadi baru-baru ini seperti keja-

dian di Gereja Tebas, tolong jangan diisukan yang tidak benar. Marilah kita cerna masalah ini dengan pikiran jernih,” ungkapnya. Meski tidak ada dialong, hanya pemaparan pandangan tokoh lintas agama dan masyarakat, silaturahmi ini berjalan lancar dan tertib. Dari pemaparan sejumlah tokoh masyarakat dan agama dari Kabupaten Sambas dan Kota Singkawang, tersirat ajakan untuk bahu membahu membangun daerah, tanpa terusik hal-hal yang dapat meruntuhkan keharmonisan, kerukunan, serta persatuan umat beragama dan bermasyarakat. “Mari kita

sama-sama jaga kerukunan umat beragama, karena semua agama mengajarkan kebaikan bukan sebaliknya,” ujar Pastur Amandus Ambot OPM CAP. Begitu juga yang disampaikan perwakilan warga Tionghoa Bong Ci Nen. Hal senada diungkapkan Wakil Bupati Sambas Pabali Musa. Dia meminta agar masyarakat jangan terpancing isi yang meresahkan, apalagi mengarah mengganggu harmoniasi kerukunan umat beragama. “Jika ada selebaran, sms, atau apalah bentuknya, langsung laporkan dan koordinasi dengan aparat pemerintah setempat,” imbaunya. (har)

Pontianak Post


Sabtu 12 November 2011


Pertanyakan Dana Rp20 M ADANYA persoalan dana pinalti PT Citra Mineral Investindo (CMI) sebesar Rp20 miliar, menjadi salah satu kritikan sekaligus pertanyaan yang disampaikan legislatif terhadap kinerja pemerintah daerah. Hal tersebut disampaikan dalam penyampaian pandangan umum (PU) RAPBD 2012, beberapa waktu lalu. Anggota Fraksi PPP Abdul Sani mengungkapkan Abdul Sani bahwa pihaknya telah mendapatkan informasi dari berbagai sumber yang sangat menghebohkan. Diceritakan dia bahwa pada 2010, anak perusahaan pertambangan besar di Ketapang yang bernaung di bawah PT Harita Pratama Abadi Mineral (HPAM) mendapat pinalti atas penggarapan lahan di luar area sebesar Rp20 miliar. Namun, dia mempertanyakan bahwa sampai saat ini dana tersebut belum disetor dan belum tergambar dalam sumber pendapatan lainnya di nomenklatur APBD Ketapang. Sani memandang saat ini di Ketapang sering terjadi pembebasan lahan masyarakat, yang memiliki potensi tambangnya di luar area izin pertambangan. “Jika ini terus terjadi tanpa adanya pengawasan dari instansi teknis, sama haln y a d e n g a n p e m b i a r a n ,” u c a p n y a . Selain itu, mewakili Fraksi PPP, Sani juga mempertanyakan pengawasan pemerintah terhadap alat berat perusahaan di jalur Marau – Manis Mata. Akibatnya, menurut dia, tidak sedikit infrastruktur jalan dan jembatan yang rusak. Karena itu pihaknya meminta agar Bupati selaku kepala daerah memberikan sanksi dan meminta kompensasi terhadap perusahaan yang telah merugikan daerah tersebut. Menanggapi PU tersebut, Bupati Henrikus berjanji dalam waktu dekat akan segera menggelar rapat dengan jajaran SKPD, terhadap saran dan kritikan yang dilayangkan para legislator tersebut. “Saya sangat menyambut baik adanya masukan dan saran yang diutarakan para legislator, saat penyampaian pemandangan umum, karena memang itulah yang menjadi pembahasan dengan SKPD beberapa waktu lalu,” pungkasnya. (ash)



Investor Tebu Lirik Ketapang Ja d i k a n S e n t r a Pabrik Tebu Kalbar KETAPANG – Setelah perkebunan kelapa sawit, kembali investor melirik pengembangan perkebunan tebu di Kabupaten Ketapang. Lokasi kebun tebu yang dilirik adalah Kecamatan Muara Pawan dan Matan Hilir Utara. Rencana pengembangan perkebunan tebu dengan pola kemitraan tersebut terungkap dalam ekpose PT Bina Muda Perkasa (BMP) di Pendopo Bupati Ketapang, Jumat (11/11). Rencana pengembangan perusahaan perkebunan tebu tersebut dibuka Bupati Ketapang diwakili Sekda Andi Djamiruddin, didampingi Asisten I Setda Pemkab Ketapang F Sungkalang. Menurut Djamiruddin, ekpos awal berdasarkan prasurvei yang dilakukan perusahaan, merupakan langkah awal yang dilalui, untuk mendapatkan perizinan selanjutnya. Pemkab sendiri, menurut dia, begitu merespon positif rencana pengembangan perkebunan tebu, khususnya dalam upaya meningkatkan lapangan kerja. Apalagi, ditambahkan dia, jika teralisasi, sektor perkebunan tebu akan menyerap tenaga kerja 5 – 6 kali lebih banyak dibanding perkebunan kelapa sawit. Karena sektor perkebunan tebu dinilai padat

karya dan padat modal, sehingga menjadikan sektor riil berputar di Kabupaten Ketapang. Dalam pengantar Bupati yang disampaikan Sekda, adanya ekpos tersebut sesuai dengan surat dari PT BMP pada 6 Oktober lalu, di mana perusahaan ini tergabung dalam PT Fasipik Agro Sentosa Group. Mereka sudah melakukan survei di dua kecamatan, dengan rencana seluas lebih kurang 14 ribu hektar. ”Sesuai Peraturan Bupati (Nomor) 23 Tahun 2010, tata cara perizinan perkebunan, diwajibkan untuk lakukan prasurvei, ekpos yang dihadiri Wakil Ketua DPRD, Komisi II DPRD, (jajaran) Muspika Kecamatan Muara Pawan, MHU, kepala desa, dan BPD Kuala Tolak, Tanjung Baik Budi, Sungai Putri, Tempurukan, dan Sungai Awan Kiri ini sebagai sosialisasi awal. Sebab berita acara ekspos sebagai salah satu syarat untuk izin penerbitan lokasi. Secara umum kita menyambut baik rencana pengembangan perkebunan tebu di Ketapang,” kata Djamiruddin. Kepala Dinas PU Ketapang melalui Kabid RTRW Rahmat Triharto mengatakan bahwa maksud pengembangan perkebunan tebu di wilayah Kecamatan Muara Pawan dan MHU ini, selain sosialisiasi awal, juga meminta masukan terkait rencana kebun tersebut. Lokasi kebun tebu yang dimaksud


INVESTOR TEBU: Sekda Ketapang Andi Djamiruddin didampingi Asisten I Setda Pemkab Ketapang F Sungkalang saat memimpin pertemuan rencananya pengembangan perkebunan tebu di Pendopo Bupati Ketapang, kemarin (11/11).

adalah lokasi eks Sungai Putri Agro. Di mana izin perkebunan sawit tersebut dicabut sesuai dengan SK 101 Tahun 2011 tanggal 8 April 2011. Perkebunan tebu yang dimaksud juga masuk dalam hutan produksi konversi, sehingga perlu dilakukan pelepasan status kawasan ke Menteri Kehutanan RI sebelum

dilakukan operasi. “Jadi tahapannya masih cukup panjang,” kata Rahmat. Selanjutnya, managemen Pasific Agro Santosa Group menjelaskan alasan mereka membangun perkebunan tebu di antaranya begitu banyak masyarakat yang sudah menanam tebu sebagai tanaman

PDAM Sering Terima Keluhan KETAPANG – Direktur PDAM Ketapang M Taufik mengaku hingga sekarang mereka terus menerima keluhan dari para pelanggan. Keluhan-keluhan yang sampai ke meja mereka seperti air ledeng yang tak mengalir

hingga kualitas air yang kotor. “Selain datang langsung ke kantor, sebagian pelanggan juga sering mengutarakan keuhannya melalui sms (layanan pesan singkat, Red),” ungkapnya. Kata taufik, ada mekanisme yang disiapkan PDAM M Taufik untuk pengaduan beragam masalah pelanggan yang dihadapi, terkait pelayanan mereka. “Kami menyediakan formulir pengaduan untuk pelanggan. Setelah formulir tersebut diisi, petugas pengaduan akan mencatat tentang keluhan tersebut. Selanjutnya petugas bagian pengaduan membuat laporan dan mendistribusikannya ke bagian distribusi untuk mengecek di lapangan,” paparnya. Ditanya berapa banyak jumlah pelanggan yang mengeluh ke PDAM, dalam sehari, menurut Taufik, setidaknya mereka menerima lima hingga tujuh keluhan pelanggan. “Saat ini pelanggan sms saja itu saya anggap pengaduan. Orang sms: Pak, ledeng tidak lancar. Itu langsung saya follow up. Begitu juga dengan aduan soal

keruhnya air PDAM,” ungkapnya. Selain banyak menerima keluhan pelanggan, Taufik juga juga mengungkapkan masih banyaknya water meter milik pelanggan yang bermasalah. Jumlahnya pun fantastis, 500 unit. Kebanyakan water meter tersebut buram lantaran sering terkena air kotor. Akibatnya, keakuratan pencatatannya meragukan. Karena itu diprediksi dia, paling tidak hingga akhir tahun ini semuanya sudah dapat diperbaiki. “Sampai akhir desember ini kita memprioritaskan di wilayah I, II, dan VI. Karena di wilayah itu, wilayah lancar. Kita lihat, jika ada water meter yang rusak akan kita perbaiki. Sudah kita identifikasi, ada sekitar 500 water meter yang bermasalah. Banyak yang buram, terbenam, atau rusak. Kebanyakan buram karena air kotor. Akibatnya pencatatan jadi tidak akurat,” papar dia. Meski masih menemukan banyak keluhan pelanggan dan berbagai permasalahan di internal PDAM, bagi Taufik hal tersebut bukan suatu hambatan. Justru, diyakini dia, menjadi motivasi bagi salah satu BUMD ini untuk bergerak cepat dan meningkatkan kualitas pelayanan bagi para pelanggan. “Kami juga terus berupaya untuk dapat memberikan pelayanan yang baik bagi semua pelanggan. Jadi semua keluhan yang datang dapat segera ditindaklanjuti,” ucapnya. (ash)

penopang ekonomi keluarga. Dengan membangun kawasan perkebunan tersebut, mereka yakin akan memberi lapangan kerja yang memadai bagi masyarakat sekitar perkebunan dan menjadi penggerak perekonomian keluarga, memberikan efek positif pada sektor lain. (ads)

Pening katan Keimanan dan Ketakwaan USAI menggelar salat iduladha beberapa waktu lalu di Masjid Al-Amri Ketapang, keluarga besar SMP Negeri 3 Ketapang juga melakukan pemotongan hewan kurban. Dalam kesempatan tersebut Kepala SMP Negeri 3 Ketapang Effendi mengatakan bahwa kegiatan penyembelihan hewan kurban merupakan suatu bentuk latihan berkurban, sesuai dicontohkan Nabi Ibrahim AS dan Nabi Ismail AS, ketika mendapat perintah dari Allah SWT yang terdapat dalam Al-Quran. “Pemotongan hewan kurban ini merupakan program yang telah diagendakan dalam pembinaan Imtaq SMP Negeri 3 Ketapang. Dari hasil pemotongan hewan kurban kemudian disalurkan kepada siswa dan siswi, warga sekolah, dan masyarakat sekitar yang berhak menerima sesuai syariat yang telah ditentukan,” paparnya. Dengan adanya kegiatan tersebut, Effendi berharap agar peningkatan keimanan dan ketakwaan di SMP Negeri 3 Ketapang dapat lebih meningkat, sesuai yang diharapkan dalam visi dan misi sekolah yang dipimpinnya tersebut. (ash)

22 petuah

Kurangnya Sosialisasi SERINGKALI terjadinya aksi demo warga dengan cara memblokir jalan di sejumlah daerah, terkait masalah lahan kebun, khususnya di Kecamatan Kendawangan, membuat prihatin banyak pihak. Hal ini menunjukkan adanya indikasi masih kurangnya sosialisasi pihak perusahaan atau kesadaran perilaku masyarakat itu sendiri. Syarif Abdullah, tokoh masyarakat Kendawangan menilai faktor tumpang tindih lahan mendominasi kasus yang terjadi di perusahaan perkebunan di Kendawangan. Akibatnya banyak warga yang mengklaim bahwa tanah tersebut miliknya. Padahal, menurut dia, sejak kapan tanah itu digarap, ditambah dengan beberapa oknum dengan kekuasanya sengaja memperjualbelikan tanah ke pihak luar. “Apapun masalahnya, hendaknya agar dapat Syarif Abdulah diselesaikan secara bijak, dengan jalan musyawarah dan mufakat mudah-mudahan setiap masalah bisa diselesaikan dengan baik,” katanya. Pria yang akrab disapa Haji Dolah ini menambahkan bahwa di sisi lain, tak dapat dipungkiri bahwa multiffliereffect akan hadirnya investor, baik investor kebun maupun tambang, telah mampu mendongrak perekonomian serta kesejahteraan masyarakat Kendawangan. Dia menggambarkan bagaimana itu terlihat ketika para pekerja atau buruh dan karyawan kebun maupun tambang, saat setelah menerima gaji bulanan. Mereka sudah pasti membelanjakan uangnya pada minggu pertama di awal bulan. Hal itu belum lagi didukung oleh pendapatan di sektor lain. (ash)

kayong utara

Pontianak Post


Sabtu 12 November 2011

Bupati Lantik 15 Kades KETAPANG – Bupati Ketapang Henrikus melakukan kunjungan kerja ke enam kecamatan. Salah satu agendanya adalah melantik 15 kepala desa (kades), 9 – 13 Nopember. Kecamatankecamatan tersebut yakni Simpang Hulu, Simpang Dua, Sungai Laur, Sandai, Hulu Sungai, dan Nanga Tayap. Sementara itu, M Fauzi, kepala Desa Sukabangun Dalam yang sekitar 5 bulan terpilih juga dilantik Sekda Ketapang Andi Djamiruddin, 10 November lalu.“Sedianya Bupati Ketapang yang akan memimpin ekpos pengembangan perkebunan tebu, saya sampaikan permohonan maaf Beliau karena harus melantik 15 kepala desa di beberapa kecamatan,” ujar Sekda, Jumat (11/11) siang, saat bertemu investor perkebunan tebu, PT Bina Muda Perkasa (BMP) di Pendopo Bupati Ketapang. Kabag Humas Setda Pemkab Ketapang Suhaimi via telpon seluler membenarkan kegiatan pelantikan kepala desa yang dilakukan Bupati dalam kun-

jungan kerja ke kecamatan. Berdasarkan data dari A Rahman, kasubbag Peliputan, Dokumentasi, dan Pelaporan Bagian Humas Setda Pemkab Ketapang melalui layanan pesan singkatnya, pada 9 November Bupati melantik empat kepala desa di Simpang Hulu. Mereka adalah Kades Semandang Kiri, Kades Paoh Concong, Kades Legong, dan Kades Semandang Hulu. Dalam pengarahannya Bupati mengatakan agar pemerintahan di desa bisa berjalan baik, maka para kades dan masyarakat setempat harus menjaga dan memupuk hubungan yang harmonis antar pemerintahan desa dengan BPD. Terutama dalam fungsi membahas dan menetapkan perdes, serta harmonisasi dalam menampung dan menyalurkan aspirasi masyarakat. “Lakukan sesering mungkin konsultasi berkenaan dengan dinamika kehidupan masyarakat, sehingga melahirkan kesepakatan bersama, sehingga kebijakan desa ses-

uai kepentingan masyarakat desa secara keseluruhan,” kata Bupati. Henrikus juga berpesan agar pengelompokkan semasa pilkades dapat segera dihilangkan. Dia mengimbau semua aparatur pemerintahan desa,

termasuk warga bersatu padu membangun desa. Selain itu, Bupati juga meminta agar kades terpilih mampu mengemban tugas yang dipercayakan masyarakat dengan sebaikbaiknya dan bisa menjalankan tugas dengan penuh rasa tang-

gung jawab. “Terimakasih kepada kades yang telah menjabat di periode sebelumnya dan juga terima kasih kepada ketua BPD dan panitia pilkades yang telah bekerja keras, sehingga pilkades kali ini berjalan sukses,” kata Bupati.(ads/ash)


PENGAMATAN: Tenaga ahli program percepatan pembangunan sanitasi pemukiman bersama Pokja Sanitasi Kabupaten Ketapang ketika melakukan pengamatan langsung di lapangan, seperti di TPI Rangga Sentap dan PDAM Ketapang, beberapa waktu lalu.

Perang Belangkait; Kisah Heroisme Ki Anjang Samad SELAMA pertempuran terjadi dalam rangkaian perang ini, muncul tokoh-tokoh pejuang dari Tanah/ Negeri Simpang. Salah satu tokoh yang masyhur dalam peperangan ini adalah Legenda Ki Julak Laji, seorang pejuang yang berdasarkan cerita tutur, konon selalu membawa cucunya dalam bertempur. Dengan menggendong (mengamben) cucunya di belakang, Ki Julak Laji maju dalam tiap pertempuran. Sang cucu berperan untuk mengisi peluru timah yang dibulat-bulatkan untuk senapang (setinggar/lantak) sang datok. Dan, konon karena memiliki kekebalan, maka peluru pasukan Belanda tiada telap (tak mempan) menembus Ki

Julak Laji. Masih menurut cerita lisan, Ki Julak Laji wafat karena terserang demam panas, akibat sering berendam dalam air jika tertembak bertubi-tubi oleh pasukan Belanda. Tokoh lainnya yang juga sering diceritakan oleh masyarakat Simpang adalah kehandalan seorang tangan kanan Ki Anjang Samad, bernama Mok Rebbi. Beliau kerap berperang di dalam rawa-rawa (payak), sehingga tak bisa ditangkap oleh Belanda. Tokoh yang lain adalah Panglima Ligat/Legat, seorang panglima rakyat Simpang yang berani. Dalam kisahnya, beliau pernah menyerbu ke muka berhadapan dengan komandan Belanda di tengah pa-

sukan Belanda seorang diri. Berhasil menetak Komandan Belanda dengan mandau/pedangnya, tapi tak dapat menewaskannya, karena ternyata Komandan Belanda menggunakan baju besi/zirah yang melindungi tubuhnya. Konon beliau sempat tertangkap oleh Komandan tersebut, tapi dapat lepas dan menghilang dalam satu teriakan. Memang dalam perang ini akhirnya perlawanan rakyat Simpang dapat dihentikan, terutama ketika Belanda berhasil mendekati tokoh-tokoh Negeri Simpang lainnya, seperti Kyai Naim dari Pulau Kumbang (Kyai Naim pun mendapat bintang emas dan gelar Dewa Dewangsa Negara dari Belanda atas jasanya) dan seba-

gainya. Tapi Belanda pun akhirnya gagal menerapkan pajak belasting. Dampak perang ini, kejayaan kekuasaan Gusti Panji menurun. Beliaupun menyuruh para pengikutnya untuk eksodus keluar dari kampong-kampong di pehuluan Negeri Simpang. Terjadilah eksodus besar-besaran ke wilayah pesisir sampai akhirnya pusat kerajaanpun menjadi sepi. Ditambah lagi dengan seiring tumbuh dan berkembangnya pusat kekuasaan baru sebagai pusat Kerajaan Simpang di Teluk Melano (sekarang ibukota Kecamatan Simpang Hilir, Kabupaten Kayong Utara) di bawah pimpinan Panembahan Gusti Muhammad Rum. (habis)

Pontianak Post


Sabtu 12 November 2011

Tak Rampung Sambungan dari halaman 17

Akibat dari tidak selesainya bangunan milik pemerintah yang dikerjakan kontraktornya, para petugas yang seharusnya mendapatkan tempat untuk melaksanakan tugas di sana harus menumpang rumah warga setempat.

“Bayangkan saja, sampai di tampung warga karena tempat yang seharusnya tidak bisa mereka gunakan,”lanjut dia. Dengan adanya laporan ini, pihaknya selaku wakil rakyat merasa kecewa dikarenakan kinerja yang diberikan para petugas dan guru disana tidak dapat maksimal kepada

masyarakat. Muhammad, sampai saat ini mengaku masih bertanda tanya besar siapa yang akan bertanggung jawab akan hal tersebut, bahkan pada saat penyampaian pemandangan umum praksi di paripurna, Kamis kemarin, di akhir penyampaian hal ini juga ia

ungkapkan di depan wakil Bupati dan sejumlah SKPD yang hadir. “Juga ada laporan penyegelan sekolah oleh oknum masyarakat tolong secepatnya di selesaikan agar para pelajar dapat menerima haknya untuk belajar,” pungkas legislator PAN Sekadau itu. (nie)

kan ke RSUD Landak dan mendapat perawatan intensif. Sedangkan Eta tewas ditempat kejadian. Warga yang menyaksikan kejadian tersebut langsung mengevakuasi korban ke RSUD Landak. Oktavianus mengalami luka dibagian wajah dan patah dibagian paha kaki kiri. Rekan yang diboncengnya, Byen Tomo (17) mendapat jahitan di wajah. Sementara rekan Eta, Susilawati (15) mengalami memar dibahu dan luka diwajah. Pihak kepolisian

lalu lintas mengamankan surat-surat identitas keempat pelaku tabrakan dan dua unit kendaraan yang terlibat. Guru SMA Negeri 1 Ngabang, Mahfuzah, S.Pd saat ditemui Pontianak Post di RSUD Landak mengatakan mengaku prihatin dengan kejadian tersebut. Ia berharap kejadian seperti ini tidak terulang kembali dan berharap pelajar lainnya bisa lebih berhati-hati dalam berkendara dijalan raya. Sementara itu, rekan kor-

ban, Intan Pertiwi yang juga kelas XII di SMAN 1 Ngabang mengaku terkejut mendengar berita tersebut. Dalam pengakuannya, Eta dikenal sebagai sosok sahabat yang selalu ceria. Dengan kejadian ini, mereka mengambil pelajaran berharga agar bisa lebih berhati-hati berkendara dijalan raya. Untuk penanganan kasusnya, kepolisian masih memeriksa saksi-saksi yang menyaksikan kejadian tersebut. (sgg)

(SDM), baik secara kualitas maupun kuantitas. Ditambah lagi minimnya anggaran dalam APBD untuk membangun prasarana fisik pemerintah dan pelayanan publik, makin menghambat desentralisasi Pemkab Sekadau.“Rendahnya pemahaman masyarakat akan pentingnya menjaga kelestar-

ian lingkungan dan belum ditetapkannya standard operating procedure, juga merupakan kendala dalam menjalankan kepemerintahan,” papar Simon.Kendatipun demikian, kata dia, Pemkab Sekadau tetap mengupayakan strategi untuk mengatasi permasalahan tersebut. Di antaranya

pembenahan sarana dan prasarana publik, pembenahan aspek sumber daya yang diarahkan pada pemenuhan kebutuhan pegawai negeri sipil (PNS).“Yang masih belum ada atau kurang akan kita perjuangkan untuk menunjang pembangunan,”janjinya. (nie)

Yani menilai soal fenomena kelangkaan BBM yang sering terjadi pada akhir tahun, lebih pada ulah spekulan. Karena itu ia meminta jika sampai terjadi penyimpangan terhadap langkanya BBM di ketapang, Pertamina wajib menindak tegas semua penyimpangan penyaluran distribusi BBM di ketapang. “Untuk mengantisipasi agar BBM di Ketapang tidak kembali langka secara berkepanjangan, maka rencanya, minggu depan kita akan mengadakan rapat evaluasi dengan dinas dan instansi terkait, untuk membahas kembali langkanya BBM di Ketapang,”ungkapnya, kemudian berharap evaluasi tersebut dapat mengatasi langkanya BBM yang kembali terjadi beberapa waktu belakangan ini. Hingga saat ini belum ada kejelasan soal penyebab kelangkaan BBM yang terjadi. Ketika wartawan koran ini mencoba mendatangi Jober Ketapang, salah seorang Sat-

pam Jober mengatakan jika Pengawas Pertamina Ketapang, Mahyudin, tak berada di tempat. Ia juga keberatan memberikan nomor kontak Mahyudin. Saat di konfirmasi Pontianak Post melalui ponsel , Kadis ESDM Ketapang, Cipriana Lestari juga enggan memberikan komentar banyak, lantaran dia masih berada di Sandai untuk melakukan kunjungan kerja. “Masalah BBM yang sulit didapat sekarang ini, bukan karena terjadi kelangkaan, namun karena lambat datangnya stock BBM di Ketapang. Dan kalau tidak ada halangan sore atau malam ini (11/11) stok BBM sudah sampai di Ketapang dan akan langsung dibongkar serta disalurkan seperti biasa, pihak kepolisian juga sudah kami minta bantuannya untuk melakukan penertiban, dan kalau ada perkembangan selanjutnya nanti akan saya sampaikan,”jelasCiprianamelalui pesan singkat (sms). (ash)

Tewas Ditabrak Motor Sambungan dari halaman 17

Sesampainya dijalan km 9, kendaraan tersebut mendahului sebuah mobil yang tidak diketahui identitasnya disebuah tikungan. Dari arah berlawanan muncul kendaraan motor Honda Beat yang dikemudikan oleh Eta (17), dengan jarak yang sangat dekat membuat kedua kendaraan tidak dapat menghindari tabrakan. Akibat laka tersebut, empat orang pelajar tersebut dilari-

Sarana Minim Sambungan dari halaman 17

pemerintahan. Permasalahan tersebut di antaranya adalah belum memadainya sarana dan prasarana pada beberapa satuan kerja perangkat daerah (SKPD) dan unit pelaksana teknis (UPT), keterbatasan sumber daya manusia

BBM Ketapang Langka Lagi Sambungan dari halaman 17

kelangkaan BBM dibiarkan berlarut-larut, tentu saja kelangkaan BBM yang terjadi akan menganggu kelancaran mobilisasi masyarakat. Karena, masyarakat harus antre berjam-jam untuk mendapatkan premium. Padahal kata dia, kuota BBM untuk Ketapang sudah ditambah. “Beberapa waktu lalu, juga ada kesepakatan penambahan pasokan BBM dari pihak pertamina, untuk mengatasi langkanya BBM di Ketapang. Intinya bukan

masalah penambahan pasokan BBM, namun bagaimana cara pemrintah dan instansi terkait menjaga lancarnya arus distribusi BBM hingga kemasyarakat,” terangnya. Disinggung soal jumlah kendaraan yang terus bertambah di Ketapang, Yani menegaskan pertambahan kendaraan bukan hanya di Ketapang tapi juga di daerah lain. “Kalaupun ada penambahan jumlah kendaraan di Ketapang tentu juga ada kendaraan yang berkurang,” imbuhnya.

Toko Sinar Mas Dirampok Sambungan dari halaman 17

antisipasi kejahatan, dan jangan sekali-sekali meninggalkan toko dalam keadaan kosong. “Masyarakat perlu antisipasi, harus waspada dengan orang yang tidak dikenal, waspada dengan gerak gerik

orang yang mencurigakan. Biasanya, menjelang hari raya angka kriminalitas akan semakin meningkat. Jadi perlu kewaspadaan yang tinggi dari masyarakat. Kepolisian tetap akan melakukan pengawasan terhadap titik rawan kriminalitas,” jelasnya. (sgg)

Telantarkan Lahan Segera Angkat Kaki Sambungan dari halaman 17

Artinya dari luasan lahan yang ada dan seharusnya dikelola tetapi tidak dimanfaatkan oleh perusahaan. “Berdasarkan hasil tersebut dan sesuai dengan peraturan yang ada maka kalau sudah diberikan peringatan ternyata tidak juga dilaksanakan, maka dapat saja ijin perusahaan dicabut. Sebenarnya ada delapan

perusahaan yang terindikasi menelantarkan lahan HGUnya, hanya saja dua perusahaan sudah melaksanakan kegiatan dan ini masih kami berikan kesempatan untuk memperbaiki kinerjanya,” ujarnya. Dikatakannya, dengan adanya hasil verifikasi yang sudah dilakukan oleh tim dari BPN tersebut, maka untuk proses selanjutnya akan diserahkan sepenuhnya kepada

aturan yang berlaku, sesuai dengan tahapannya. ‘Ke depan jangan sampai terjadi hal tersebut, sehingga sesuai dengan ketentuan dan aturannya maka perusahaan yang tidak serius akan gugur atas ketidakseriusannya,” tegasnya. Sebelumnya, Kepala BPN Landak, H. Muhammad Menos Erry mengatakan BPN telah melakukan sidang panitia terhadap 8 perusahaan yang

menelantarkan lahan yang ada di Kabupaten Landak. “Cuma untuk mengetahui persis berapa hektar luas lahan yang ditelantarkan 8 perusahaan tersebut, tim identifikasinya ada di Kanwil BPN Kalbar. Mereka yang mengukur berapa lahan yang diterlantarkankan. Terhadap tanah yang terlantar itulah yang nantinya akan dipangkas,” ujar Menos. (sgg)

harus memberikan pelayanan yang terbaik. “Utamakanlah pelayanan pada masyarakat. Jaga hubungan baik dengan semua pihak,” pesannya. Bupati Sintang, Milton Crosby mengharapkan keberadaan SPBU baru bisa menjadi solusi atau paling tidak mengurangi antrian BBM yang sering terjadi di Sintang. Ia juga menuturkan kalau kebaradaan SPBU memi-

liki peranan penting untuk membangun Sintang, apalagi Sintang sedang berbenah menyongsong PKR. “Kebaradaan SPBU baru merupakan kebanggan bagi kita semua. Makanya saya berharapkan agar pengelola SPBU bertindak jujur dalam memberikan pelayanan. Untuk masyarakat, belilah minyak sesuai dengan kebutuhan, jangan melakukan penimbunan,” pintanya.(zal)

Pecat Karyawan Nakal Sambungan dari halaman 17

kami tidak akan melayani,” katanya. Ia mengklaim, SPBU miliknya sangat didukung oleh masyarakat Tanjung Puri. Dukungan tersebut dikarenakan warga sangat mendambakan antrian BBM yang terjadi selama ini, bisa teratasi dengan adanya SPBU baru di Jantung Kota. “Untuk mengawasi pembelian BBM, kami sangat

mengharapkan peran semua pihak salah satunya aparat. Kami tidak ingin, hukum yang ada dilanggar dan yang melanggarnya adalah penegak hukum sendiri,” harapnya. Putut Adrianto, Sales Area Manager Regional VI Kalbar mengharapkan kebaradaan baru SPBU bisa membantu masyarakat untuk mendapatkan BBM dengan harga normal. Ia juga meminta, dalam memberikan pelayanan, SPBU

Ajang Meningkatkan Kualitas Keimanan Sambungan dari halaman 17

panitia pelaksana, Martinus Khiu. Menurut dia, sedikitnya ada 1208 orang peserta yang mengikuti kegiatan tersebut. “Semua itu terdiri dari para peserta, dan lainnya,” kata Khiu. Ketua LPPD Pesparawi Provinsi Kalimantan Barat, AB Tangdililing, memberikan apresiasi terhadap pelaksanaan Pesparawi III Kabupaten Bengkayang ini. Dia mengaku, Pasparawi tingkat kabupaten ini lebih ramai bila dibandingkan dengan pelaksanaan Pesparawi tingkat Provinsi. Mantan Dekan Fisip Untan ini berharap, semua peserta yang tampil tidak asal tampil. Peserta yang tampil harus dipersiapkan semaksimal

mungkin. Dibalik pertadingan yang dilakukan, Tangdililing meminta kepada semua peserta untuk saling mendukung, yang menang jangan arogan dan jangan mengolok kontingen lain. Sebaliknya yang belum menang jangan pesimis. “Anggap kekalahan tersebut sebagai suatu keberhasilan yang tertunda,” kata pengamat politik Untan ini. “Perinsip ini harus dipegang oleh semua kontingan. Kehadiran kita disini untuk memuji tuhan. Yang patut kita hormati adalah Tuhan. Penghormatan pada manusia hanya sementara. Karena jabatan pada manusia hanya sementara,” kata Tangdililing. Bupati Bengkayang, Suryadman Gidot mengharapkan,

Pesparawi III dijadikan sebagai ajang untuk menumbuhkembangkan iman. Pesparawi, menjadi pemicu peningkatan iman yang lebih mantap pada tahun 2015 sesuai dengan visi misi Kabupaten Bengkayang 2010-2015. “Dengan Pesparawi ini, kita berharap terwujudkan masyarakat sejatera, cerdas, sehat, beriman, demokratis dan mandiri dalam keberagama. Kesejahteran itu sempurna bila masyarakat bisa menjalankan agamanya masing masing dengan tenang,” ujarnya. Kata bupati yang bakal meramaikan bursa Gubernur Kalbar ini, sikap saling tolong menolong, bahu membahu harus didahulukan untuk menjalankan kepercayaan

gama masing masing. Peparawi III Kabupaten Bengkayang semakin bermakna karena dilaksanakan bertepatan dengan bulan sebelas, tanggal sebelas, tahun dua ribu sebelas dan jam sebelas. “Hari ini waktu yang bertuah, mengandung semangat yang dalam. Dengan angka satu, kita wujudkan Kabupaten Bengkayang menjadi Kabupaten yang disegani. Kita juga mengakui tuhan itu satu. Dan dibuka oleh KB 1, dengan tujuan untuk mewujudkan yang terbaik dimasa sama mendatang,” tambah Gidot. Lebih seribu peserta dan undangan hadir diantaranya Kapolres Bengkayang, AKBP Veris Septiansyah yang baru saja beberapa hari menjabat. (*)


MTQ 24 Kabupaten Siap Gelar PUTUSSIBAU–musabaqah tilawatil Quran (MTQ) tingkat Kabupaten Kapuas Hulu ke 24 benar-benar menjadi ajang pemanasan bagi para qori/ qoriah terbaik kabupaten ini. Salah satunya adalah kafilah dari Kecamatan Putussibau Utara yang siap bertarung. Jumat (11/11) kemarin, tim atau kafilah Kecamatan Putussibau Utara menggelar rapat pemantapan. Rapat yang di gelar di aula kantor kecamatan Putussibau Utara

itu di hadiri Camat Putussibau Utara, Ledung, S.Sos. Ketua LPTQ Kecamatan Putussibau Utara, Ade Hamsin, dalam laporannya mengatakan kekuatan kafilah Kecamatan Putussibau Utara terdiri atas 33 orang. Tim ini akan mengikuti sejumlah cabang yang dilombakan. Diantaranya tilawah dewasa, tilawah remaja dan anak-anak. Kemudian tartil anak, tartil usia emas, syahril, fahmil dan khotil quran.

“Hanya cabang hafalan yang tidak kita ikuti,” kata Ade. Sementara itu, Camat Putussibau Utara, Ledung, S.Sos, berharap seluruh anggota kafilah dapat menjaga kondisi kesehatan. Sehingga saat berlangsugnya pertandingan dapat mengiktuinya dengan baik. “tentu kita berharap prestasi terbaik yang di persembahkan untuk masyarakat Putussibau Utara,” kata Ledung. (w@Nk)

Sekadau Cari Dokter Spesialis KETUA Ikatan Dokter Indonesia Kabupaten Sekadau dr.Libra mengakui sampai saat ini Rumah Sakit Umu Daaerah dan tenaga Fungsional Medis Kabupaten Sekadau masih belum memiliki Dokter spesialis. Samapai saat ini dokter yang bertugas di “bumi lawangkuari” berjumlah 24 orang dan berstatus dokter umum. “Tidak satupun dokter spesialis dari jumlah yang ada,”ucap Libra saat di temui,

belum lama ini. Diakui Libra, keberadaan dokter spesialis dalam sakala Kabuapten pada dasarnya sangat-sangat di perlukan. Terlebih di rumah sakit umum daerah (RSUD) guna memberikan pelayanan kepada masyarakat yang membutuhkan pengobatan dan perawatan. Empat spesilis yang dirasakan sangat mendasar disebutkanya masing-masing Spesilis Anak, Penyakit dalam,

Bedah dan kebidanan. Sementara itu ia juga mengakui beberapa waktu lalu Sekadau sudah mendatangkan dokter spesialis dalam. Namun, karena berbagai persoalan yang bersangkutan keluar dari Sekadau. Sejuah ini Libra mengatakan ia selaku kapasitas ketua IDI Sekadau juga terut membantu pemerintah Kabupaten untuk memperuangkan adanya dokter spesialis. (nie)

Serius Tangani Listrik SINTANG – Pemadaman bergilir yang dilakukan pihak PT Perusahaan Listrik Negara (Persero) masih berlangsung, masyarakat meminta PLN benar-benar serius membenahi masalah listrik di Sintang sehingga ke depan setiap ancaman gangguan sudah bisa diperkirakan dan bisa segera diatasi. “Kami sangat berharap ada keseriusan dalam mengurus listrik kita, jangan sampai ketika sudah terjadi kerusakan baru kalang kabut memperbaikinya sehingga butuh waktu lama,” kata Adrianto, pengurus DPD Lira Kabupaten Sintang, Rabu (09/11) di Sintang. Menurutnya, kondisi saat ini tentunya membuat warga sangat kesal karena pemadaman terjadi sudah diluar jadwal yang ditetapkan PLN sehingga

wajar saja ada masyarakat yang datang ke PLN melakukan unjuk rasa. “Saya kira sah-sah saja warga datang ke PLN berunjuk rasa karena memang pemadaman sudah diluar batas yang bisa ditoleransi, apalagi jika dibandingkan dengan kewajiban pembayaran dimana telat sehari saja pelanggan sudah kena denda,” tukasnya. Terlepas persoalan kendala pada mesin, sudah selayaknya pihak manajemen PLN yang ada di Sintang ini benarbenar serius mengelola energi listrik yang disalurkan ke masyarakat. “Kalau memang tidak mampu, saya yakin karyawan lain yang lebih mampu dan bisa lebih serius melaksanakan tugasnya banyak dimiliki PLN, cari orang yang benar-benar

bisa meyakinan pimpinan di level atas bahwa masalah listrik di Sintang benar-benar krisis sehingga bisa cepat ditanggulangi,” ujarnya. Ia mengatakan jika kendala listrik di Sintang tetap seperti ini maka kegiatan pembangunan akan terhambat, pertumbuhan ekonomi melambat dan upaya pemerintah meningkatkan kesejahteraan masyarakat pun sulit tercapai. “Listrik sudah menjadi salah satu kebutuhan utama, makanya sangat diharapkan masalah listrik di Sintang segera dibenahi, butuh keseriusan para pihak dan tentunya semua berharap masalah listrik ini cepat tuntas, tak ada lagi pemadaman dan wilayah yang belum teraliri bisa segera merasakan listrik,” ucapnya. (mus)

Hibah Rumah Singgah Bapas SINTANG – Bupati Sintang, Milton Crosby mengaku puas dengan pengelolaan dana hibah untuk rumah singgah di Balai Pemasyarakatan (Bapas) karena dengan dana terbatas, ternyata hasil pekerjaannya cukup memuaskan. “Tidak menyangka hanya dengan dana Rp 302 juta, bangunan ini jadinya cukup baik, Bapas Sintang memang professional mengelola hibah ini. Kalau seperti ini, pemerintah tidak ragu memberikan kucuran dana,” ujar Milton, Jumat (11/11) di Sintang. Setelah menerima dana hibah, proses tiga bulan pembangunan dilalui, pagi kemarin, bangunan yang diperuntukkan bagi Klein Pemasyarakatandi lima kabupaten diwilayah timur Kalbar tersebut diresmikan penggunaannya oleh Bupati Sintang.

Acara peresmian tersebut dihadiri Kepala Kantor Wilayah (Kakanwil) Hukum dan HAM Kalbar, Harry Purwanto beserta unsur forkompinda Kabupaten Sintang dan sejumlah undangan lainnya termasuk Kepala Lapas Klas II B Sintang, H Effendi Yulianto dan Kepala Rutan Putusibau, Suhartomo. Dijelaskan Milton, dengan wilayah kerja Bapas di lima kabupaten timur Kalbar, tentunya sudah sangat pas dengan rencana pemekeraran Propinsi Kapuas Raya. “Dengan adanya rumah singgah Bapas Klas II Sintang, sudah merupakan dukungan terbentuknya PKR,” ujarnya. Ditempat yang sama, Kakanwil Hukum dan HAM Kalbar, Harry Purwanto mengucapkan terima kasih kepada Pemerintah Kabupaten Sintang yang telah membantu

Kementerian Hukum dan HAM berupa hibah untuk pembangunan rumah singgah ini. “Dengan bantuan Pemkab Sintang ini setelah terbangun, akan dimanfaatkan semaksimal mungkin untuk menunjang kerja Bapas Klas II Sintang. Dukungan bagi terbentuknya PKR merupakan wujud nyata dengan wilayah kerja Bapas Klas II Sintang,” jelasnya. Kepala Bapas Sintang, Djoko Setiawan mengatakan kerja Bapas adalah membina para warga binaan yang menjalani proses Cuti Bersyarat (CB), Pembebasan Bersyarat (PB) maupun Cuti Menjelang Bebas (CMB). “Warga binaan yang disebut klein setelah menjalani dua pertiga hukuman di Lapas akan diberikan fasilitas seperti CB, PB maupun CMB,” ucapnya.(mus)

Cafe Delon...Zz Datangkan Wali Band Sambungan dari halaman 24

Pontianak-Kalbar, kini giliran Bumi Ale-Ale (Ketapang) yang akan di pukau oleh Wali Band Live in Concert. Selain suguhan musik dari Wali Band, ditampilkan juga Samsaka Band sebagai band pembuka untuk memeriahkan kesempurnaan event Wali Live in Concert. Menurut Kevin, sebagai EO-Penyelenggara Event, dengan adanya konser Wali Band ini diharapkan dapat memberikan suguhan hiburan bagi masyarakat dengan antusias dan animo yang tinggi, terh-

adap hiburan oleh artis-artis papan atas/ibu kota yang sudah sekian lama tidak pernah lagi di adakan di Bumi Ketapang. Selain itu, menurut Kevin, dapat menunjukan kepada masyarakat luas baik di dalam maupun di luar daerah Ketapang dengan berasumsi, bahwa Bumi Ale-Ale (Ketapang) merupakan kota/kabupaten yang aman, nyaman, asri dan kondusif. Wali Band Live In concert yang akan dihadirkan di kota Ketapang ini juga tak lepas dari dukungan penuh Rokok Bheta yang merupakan Sponsor Utama, yang telah lama eksis

di Ketapang. Sebagai Sponsor Utama (Rokok Bheta), memberikan support secara full untuk kesuksesan Wali Band Live In Concert. Dan diharapkan dengan event besar ini dapat menyedot penonton untuk kota Ketapang pada umumnya, dan Rokok Bheta semakin eksis di Ketapang. Selain sponsor utama dari Rokok Bheta, acara ini juga didukung oleh Pemda Ketapang, Dispenda Ketapang, Disbudparpora Ketapang, Hotel Aston Ketapang, Aviastar, HS 68, RSPD, Vinka FM dan tentunya masyarakat Ketapang.(a2/biz)

Sesalkan Jalan Sintang Senaning Nonstatus Sambungan dari halaman 24

lindung, Lasarus meyakini, kalau permasalahan tersebut tetap ada jalan keluarnya. Mengingat, pembangunan jalan untuk kepentingan publik. “Kalau jalan mulus, maka lalu lintas barang dan orang

juga akan mendapatkan kemudahan,” jelasnya. Sementara itu, Bupati Sintang Milton Crosby mengatakan, kalau terkait perubahan status jalan Sintang-Senaning, pihaknya sudah mengusulkannya sejak satu tahun yang lalu. Namun sampai sekarang, belum ada putusan terkait pe-

rubahan status jalan yang nonstatus yang dimaksud menjadi jalan nasional. “Kita memang mengharapkan jalan SintangSenaning statusnya berubah menjadi jalan nasional agar bisa dianggarkan melalui APBN. Perubahan status jalan itu sudah lama kita usulkan,” kata Milton.(zal)

Warga Gotong Royong Buka Salur Air Sambungan dari halaman 24

kondisi jalan yang sudah mulai rusak itu tidak semakin rusak dan tetap nyaman dilalui

masyarakat. “Ini kan jalan utama dan satu-satunya. Kita ingin masyarakat tetap nyaman melalui jalan ini,

makanya kami gotong royong dan mudah-mudahan bisa segera diperbaiki oleh instansi terkait,” imbuhnya. (mus)


PRO-KALBAR Pontianak Post

Sabtu 12 November 2011

Sesalkan Cafe Delon...Zz Datangkan Wali Band Jalan Sintang Senaning Hibur Masyarakat Ketapang

SINTANG--Anggota Komisi V DPR RI, Lasarus, menyesalkan jalan Sintang-Senaning yang sampai saat ini nonstatus. Seharusnya, ruas jalan tersebut masuk dalam jalan strategis nasional yang ditangani oleh APBN. “Akibat jalan tersebut nonstatus, maka APBN tidak bisa intervensi. Padahal, kalau status jalan tersebut sudah menjadi jalan nasional, maka dana dari APBN juga akan turun,” kata Lasarus, ketika berada di Sintang. Ia mengatakan, selama status jalan tak jelas dan berada di kabupaten, maka jalan tersebut akan menjadi kewenangan kabupaten. Dan sudah sangat jelas, jalan yang statusnya jalan nasional akan dibiayai oleh APBN, jalan provinsi dibiayai APBD provinsi dan jalan kabupaten di biayai APBD kabupaten. “Khusus untuk ruas jalan Sintang-Senaning, sesuai dengan kesepakatan Sosek Malindo, jalan tersebut merupakan jalan strategis nasional. Mengingat, jasa ditetapkan menjadi salah satu daerah yang akan dibangun border,” tuturnya. Lasarus menilai, keterlambatan kepengurusan status jalan tersebut menjadi jalan nasioanal, mengakibatkan dana APBN tak bisa dikucurkan ke ruas jalan Sintang-Senaning yang dimaksud. “Kondisi ini membuat pembangunan ruas jalan tersebut tak optimal, dan hingga sekarang masih rusak. Apalagi, kita semua tahu, APBD provinsi dan kabupaten sangat terbatas. Padahal, kalau jalan tersebut diubah menjadi jalan nasional, dana APBD yang selama ini dianggarkan di ruas jalan tersebut, bisa dialihkan ke sektor lain. Makanya, saya minta Pemkab Sintang cepat mengurus perubahan status jalan ini,” pintanya. Politisi PDIP ini menuturkan, dengan optimalnya pembangunan ruas jalan Sintang-Senaning, sangat membantu masyarakat empat kecamatan yang dilintasi jalan itu. Kalaupun ada kendala hutan Ke Halaman 23 kolom 5

SETELAH sekian lama masyarakat Ketapang tidak pernah disuguhi sebuah pagelaran besar sekelas konser, kini Cafe Delon...Zz dengan manager Kevin akan menyuguhkan event yang memang ditunggu kalangan penikmat hiburan di Kabupaten Ketapang. Tak tanggung-tanggung artis yang akan didatangkan yaitu Wali Band yang memang sekarang berada dipuncak popularitas. Event yang bertajuk Wali Live in Concert ini disponsori oleh Rokok Bheta, dan akan diselenggarakan di Stadion Tentemak Ketapang, pada Selasa (22 November 2011), pukul 19.00 WIB. “Kami sengaja mendatangkan grup Band Wali untuk memberikan sebuah hiburan artis papan atas untuk masyarakat Kabupaten Keta-

pang. Dengan demikian kita layak disejajarkan dengan daerah lain, baik itu dari berbagai sisi termasuk parameter Ketapang yang kondusif,” kata Kevin, selaku promotor dan pemilik Cafe Delon kepada Koran ini, kemarin. Pada pagelaran tersebut akan disuguhkan pula band pembuka yaitu Samsaka Band. “Samsaka Band sendiri memang terdengar asing di dunia hiburan tanah air, namun kami memilihnya karena Samsaka mempunyai potensi yang bagus kedepan dengan mengusung aliran country balad,” ungkap Kevin. Sebagai informasi untuk penjualan dan pembelian tiket melalui Ticket Box yang telah dibuka dan disediakan di berbagai lokasi, antara lain; Cafe Delon...Zz, MM. Cipta Ba-

hagia, Radio Vinka FM, RSPD Ketapang, Muara Express, Tk. Mas Iren (Sandai), Meubel Jefri (Nanga Tayap) dengan nomor info: 082149792575 (@ Facebook: Forum Event Ketapang atau @ Wali Live In Concert). Cafe Delon...Zz Present Setelah sukses dengan event yang sebelumnya pernah mendatangkan penyanyi papan atas (Diva Indonesia) yaitu Titi DJ, kini Cafe Delon...Zz Present dengan mempersembahkan konser Wali Band diusung kembali oleh Kevin (EO-Cafe Delon...Zz) untuk kehadirannya, dan akan mengguncangkan Bumi Ale-Ale dengan aliran musik yang khas. Yang mana sebelumnya Wali Band telah melakukan RoadShow di berbagai kota di Ke Halaman 23 kolom 5

BUKA SALUR AIR: Drainase buruk, gorong-gorong sumbat, warga pun gotong royong membuka salur air di Jalan Sintang-Pontianak kilometer 4.


Warga Gotong Royong Buka Salur Air Sebagai Respon Atas Lambannya Penanganan Pemerintah SINTANG--Sejak hujan mulai sering turun, jalan raya Sintang-Pontianak kilometer empat sering tergenang. Bahkan, akibat genangan air, kondisi jalan mulai rusak, wargapun bahu membahu membuka saluran air. Itu dilakukan, sebagai reaksi cepat atas respon lambat yang diperlihatkan pemerintah. Pagi kemarin, puluhan warga berkumpul di jalan yang tak jauh dari Pondok Bunga dengan membawa berbagai perlengkapan kerja. Merekapun memerhatikan dengan seksama mengapa air tidak cepat hilang dari jalan ketika hujan, ternyata masalahnya adalah pada gorong-gorong. Dalam rombongan warga yang akan bergotong royong itu, terlihat Lurah Kapuas Kanan Hulu, Jumanudin bersama beberapa staf yang ikut membantu warga. Pantauan koran kemarin, drainase di sekitar jalan tersebut memang buruk. Belum lagi posisi jalan yang lebih rendah dari halaman ruko dan rumah warga, air tergenang sementara gorong-gorong yang berfungsi mendistribusikan air ke tempat yang lebih rendah dalam

keadaan tersumbat. Tak pelak, kondisi itu membuat genangan setiap kali hujan turun lambat hilang, kerusakan jalan pun tak terhindari lagi. “Kalau pas lewat sini memang harus berhati-hati, karena di bawah genangan air itu sudah banyak lubang, kalau tak hati-hati bisa jatuh,” ujar Joko, salah seorang warga yang kerap melintas di jalan tersebut. Ia sangat berharap pemerinah daerah atau instansi yang bertanggungjawab terhadap jalan tersebut bisa segera turun tangan melakukan perbaikan. “Kalau dibiarkan lama-lama, jalan ini akan semakin rusak, padahal ini jalan satu-satunya dari Pontianak untuk masuk ke kota Sintang,” tukasnya. Upaya untuk membuka jalur air di gorong-gorong yang tersumbat ternyata sulit, lantaran warga tidak bisa mengetahui apa saja yang menyumbat goronggorong itu, meski material tanah yang diduga menyumbat gorong-gorong sudah diangkut, tetap saja sumbatan itu sulit dibuka. “Sebenarnya beberapa waktu lalu kami sudah pernah menyampaikan ini ke pihak terkait mengenai kondisi jalan tersebut, tetapi sampai sekarang belum ditanggapi,” ujar Jumanudin. Gotong royong tersebut, menurut dia, merupakan upaya dari warga agar Ke Halaman 23 kolom 5


Pontianak Post

Sabtu 12 November 2011






Inggris Tak Minder Hadapi Spanyol

LATIHAN : Para pemain Inggris bersama manajer Fabio Capello memasuki area latihan. Tim Inggris akan berhadapan dengan Spanyol dalam laga persahabatan atau uji coba di stadion Wembley, London. AFP PHOTO / GLYN KIRK

Pelatih : Fabio Capello





Stadion : Wembley, London

LONDON - Inggris memang dike- saya,” kata Capello ketus di situs resmi nal sebagai tim dengan nama besar FA (Federasi Sepak Bola Inggris). sepak bola di Eropa. Namun, sudah Capello tidak salah karena titel sekian lama Three Lions (sebutan pertandingan adalah uji coba. Pelatih Inggris) tidak lagi menuai prestasi. asal Italia itu juga ingin melihat sepak Yakni, sejak memenangi Tournoi terjang Inggris apabila tanpa Wayne de France 1997, sebuah turnamen Rooney, Steven Gerrard, dan John segi empat menyambut Piala Dunia Terry. Nama terakhir telah diputuskan 1998. Capello absen lawan Spanyol sehingga Kondisi itu bertolak belakang ban kapten Inggris diserahkan kepada dengan Spanyol. La Furia Roja (sebu- rekanseklubnyadiChelsea,FrankLamtan Spanyol) boleh dibilang pard. sebagai timnas terbaik ”Tapi, dia (Terry) tetap di di Eropa saat ini, bahkan bench. Dia baru tampil lawan dunia. Setelah memenangi Swedia (uji coba juga di ajang regional di Euro 2008, Wembley, 15/11, Red),” Siaran Langsung La Furia Roja melengkapijelas Capello. MNCTV nya dengan Piala Dunia 2010 di Berbeda dengan IngPukul 00.00WIB gris, Spanyol datang ke Afrika Selatan. Tapi, berhadapan dengan juara Wembley dengan skuad dunia tidak lantas membuat Inggris terbaiknya. Kiper sekaligus kapten gentar. Inggris ingin membuktikan Spanyol Iker Casillas bahkan sengaja bahwa mereka tidak kalah dari menunda rekor caps ke-126 (caps Spanyol dalam bentrok di Stadion terbanyak Spanyol) dengan absen Wembley, London, dini hari nanti lawan Skotlandia di akhir kualifikasi (siaran langsung MNCTV mulai Euro 2012. Itu karena Casillas ingin menorehkannya di Wembley. pukul 00.00 WIB). ”Ini bukan laga uji coba, melainkan Dengan background gengsi dan prestise itulah, pelatih Inggris Fabio salah satu laga terpenting kami. SpaCapello dikritik fans karena ingin nyol sangat serius menghadapi Inggris,” ”main-main” menghadapi Spanyol. kata Xabi Alonso, gelandang bertahan Capello berencana mengandalkan Spanyol, kepada The Sun. Untuk diketahui, uji coba di Wembarisan muda seperti Kyle Walker (21 tahun), Phil Jones (19 tahun), bley seharusnya dimainkan kemarin Jack Rodwell (20 tahun), Daniel Stur- (11/11). Namun, RFEF (Federasi Seridge dan Theo Walcott (keduanya pak Bola Spanyol) meminta diundur sehari dengan alasan mepet dengan 22 tahun). Gabriel Agbonlahor, 25, sebenar- laga Barcelona kontra L?Hospitalet nya juga diharapkan turun. Namun, di leg pertama babak 32 besar Copa striker asal Aston Villa itu dipastikan del Rey (9/11). Itu mengingat mayogagal mencatat caps keempat setelah ritas pemain inti Spanyol berasal dari cedera hamstring dalam latihan. Barcelona. “Kami akan memainkan tim terAgbonlahor pun sudah dipulangkan baik karena kami menginginkan ke klubnya kemarin. ”Saya bisa saja menurunkan sebe- kemenangan,” tandas entrenador las pemain yang berbeda, bisa mela- Spanyol Vicente del Bosque. (dns/ kukan enam pergantian. Itu terserah bas)












Xavi Xabi Alonso


Fabregas Busquets







Pelatih : Vicente Del Bosque

Lima Bentrok Terakhir 12/2/09 Spanyol v Inggris 2-0 (Friendly) 7/2/07 Inggris v Spanyol 0-1 (Friendly) 17/11/04 Spanyol v Inggris 1-0 (Friendly) 28/2/01 Inggris v Spanyol 3-0 (Friendly) 22/6/96 Spanyol v Inggris 0-0 (Kualifikasi Euro) Lima Laga Terakhir Inggris (2 menang, 3 seri) Spanyol (4 menang, 1 kalah)

Motivasi Ekstra Bunga Poppy INGGRIS dan FIFA terlibat berkonflik jelang uji coba di Wembley dini hari nanti. Itu setelah FIFA melarang Inggris memasang emblem bunga poppy di kostum mereka sebagai peringatan Rememberance Sunday. FIFA beralasan sebagai komitmen mencegah isu politik di sepak bola. Setelah dikritik Perdana Menteri Inggris David Cameron dan diwarnai aksi dua fans Inggris yang memanjat atap gedung FIFA di Zurich, FIFA akhirnya melunak. FIFA mengizinkan Inggris memasang emblem bunga poppy di ban hitam yang dikenakan di lengan pemain. Pemain seperti Ashley Cole dan Theo Walcott bahkan sengaja memesan sepatu khusus dengan hiasan bunga poppy. ”Kami berterima kasih kepada FIFA atas izin yang mereka berikan,” kata juru bicara FA (Asosiasi Sepak Bola Inggris) kepada Reuters. ”Kami juga diizinkan membawa karangan bunga poppy akan dibawa ke tengah lapangan oleh perwakilan dari militer saat pemutaran lagu kebangsaan Inggris. Dilanjutkan dengan mengheningkan cipta selama satu menit,” imbuhnya. Sebagai pengingat, Rememberance Sunday adalah hari mengenang pahlawan Ingggris yang gugur dalam pertempuran melawan Jerman di Perang Dunia I. Rememberance Sunday diperingati setiap hari Minggu di pekan kedua November. Tahun ini, Rememberance Sunday diperingati pada 13 November. Di sisi lain, bunga Poppy lantas dijadikan simbol peringatan karena bunga berwarna merah itu banyak tumbuh di area pertempuran. Bunga Poppy merupakan simbol kehidu-

pan, harapan, keceriaan, dan hiburan bagi mereka yang berjuang kala itu. ”Bisa mengenakan bunga Poppy adalah suatu kehormatan.

Bunga Poppy akan memberi motivasi ekstra bagi kami untuk mengalahkan Spanyol,” kata defender Inggris Phil Jones kepada Daily Telegraph. (dns)

World soccer


Brasil Bekuk Gabon Pertandingan Persahabatan Libreville - Brasil berhasil memetik kemenangan 2-0 saat dijamu Gabon, dalam laga ujicoba yang berlangsung Jumat (11/11) dinihari WIB. Pertandingan yang berlangsung di Libreville tersebut berlangsungdiataspermukaan lapangan yang kondisinya buruk, akibat guyuran hujan lebat yang turun sebelum kick-off. Dengan permukaan lapangan seperti itu, ditambah dengan tekel-tekel keras dari tim tuan rumah, Brasil dapat dibilang cukup beruntung dapat menyudahi laga dengan keme-

nangantanpaadacederaserius yang membelit pemainnya. Brasil sendiri memimpin saat laga baru berjalan 12 menit. Ketidaksigapan kiper Gabon, Didier Ovono, dalam mengantisipasi bola membuat Sandro berhasil menyambut bola rebound dan bikin tim tamu memimpin. Sepuluhmenitsebelumjeda turun minum, sepakan keras Jonas hanya bisa ditinju oleh Ovono. Sial untuk Gabon, bola justru menuju arah Hernanes yang lantas menanduk si kulit bundar ke dalam gawang. Brasil tengah menjalani serangkaian laga ujicoba. Setelah menghadapi Gabon, tim Samba sudah ditunggu Mesir dan Qatar.(int)

Pontianak Post


Sabtu 12 November 2011

Romario Desak FIFA Tuntaskan Kasus Suap





Dibayangi: Pemain Brazil Lucas Leiva (kanan) dibayangi pemain Gabon Levy Madinda pada pertandingan persahabatan internasional di the Stade de l’Amitie (10/11), dimana tahun 2012 Piala Afrika antara negara benua Afrika akan di gelar di Libreville.

SAO PAULO-Mantan striker tim nasional Brazil Romario ingin agar citra negaranya bersih dalam menyelenggarakan Piala Dunia 2014. Pria yang sekarang menjadi anggota konggres itu mendorong agar rekan-rekannya melakukan investigasi terkait kejanggalan yang melibatkan FIFA dan presiden federasi sepakbola Brazil Ricardo Teixeira. Pahlawan Brazil di Piala Dunia 1994 itu berjanji mendesak otoritas FIFA untuk mengeluarkan dokumendokumen pelanggaran hukum dan etika yang melibatkan Teixeira. Terutama tuduhan

PEnETaPan HaRga TanDan bUaH SEgaR (TbS) Hasil Rapat Tim Pengkajian dan Kesepakatan Penetapan Harga TbS Kelapa Sawit Produksi Petani Kalbar bln OKTObER 2011 PATOKAN HARGA / KG TBS KELAPA SAWIT PRODUKSI PETANI KALBAR SBB : • Umur Tanaman 3 tahun Rp. 1.099,74,-

Harga CPO/ Kg Rp. 7.287,14

• Umur Tanaman 4 tahun Rp. 1.183.77,-

(tidak termasuk PPN)

• Umur Tanaman 5 tahun Rp. 1.270.35,• Umur Tanaman 6 tahun Rp. 1.314.73,• Umur Tanaman 7 tahun Rp. 1.359,87,• Umur Tanaman 8 tahun Rp. 1.404.25,-

Harga Kernel/Kg : Rp. 3.216,94,- (tidak termasuk PPN) Indeks “K” : 87.47 %

• Umur Tanaman 9 tahun Rp. 1.449.40,• Umur Tan. 10 s/d 20 tn Rp. 1.495,18,TiM PEnETaPan HaRga PEMDa TingKaT i KaLbaR


bahwa pria 64 tahun itu pernah menerima uang dari partner marketing FIFA pada tahun 1990-an. Romario berjanji akan berupaya keras membuka catatan-catatan pengadilan terkait kasus tersebut. Apalagi ISL yang menjadi partner FIFA itu terbukti tidak kompeten. Perusahaan itu akhirnya bangkrut pada 2001 lalu. “Kami meminta Swiss untuk mereview kembali file dan catatan pengadilan terkait isu tersebut. Isu ini menjadi krusial untuk Piala Dunia. Agar ajang di negara ini menjunjung kemurnian dan

HaRga KOMODiTi Dan PaKan TERnaK Di POnTianaK

Komoditi Doc Broiler FS/Ekor Broiler Hidup/kg Ayam Buras hidup/kg Daging Sapi/Kg Daging Babi/Kg Karkas Kambing/Kg Telur Ayam Ras/Kg Pakan Petelur Stater/Kg Pakan Petelur Grower/Kg Pakan Layer/Kg Pakan Pedaging Starter/ kg Pakan Pedaging Finisher/kg Kulit Sapi / Kg Kulit Kambing / Lembar

Harga Rp. 4.250,Rp. 20.000,Rp. 40.000,Rp. 72.000,Rp. 55.000,Rp. 80.000,Rp. 17.000,Rp. 5.700,Rp. 5.600,Rp. 4.500,Rp. 6.500,Rp. 6.000,Rp. 7.500,Rp. 20.000,-


kejujuran,” katanya kepada Associated Press. BBC melaporkan bahwa dokumen pengadilan tersebut menyebut dua nama pejabat bola berpengaruh dari Brazil telah menerima uang suap sebesar USD 7 juta dari partner marketing tersebut. Selain Teixeira, mantan presiden FIFA Joao Havelange juga dituding menerima aliran uang tersebut. Bulan lalu, presiden FIFA Sepp Blatter berjanji akan membuka kembali skandal korupsi yang sudah berusia sepuluh tahun tersebut. Baltter ingin agar FIFA serius

melakukan reformasi yang terkait dengan penyuapan, jual beli suara, dan penipuan pemasukan tiket. Blatter rencananya akan membincang lagi kasus ISL ini pada pertemuan komite eksekutif FIFA di Tokyo, Jepang 16-17 Desember mendatang. Nah, saat ini Romario aktif mendorong pengungkapan kasus tersebut. Di tahun pertamanya sebagai anggota parlemen, mantan bintang Barcelona tersebut aktif dalam pengawasan Piala Dunia 2014 dan Olimpiade Rio de Janeiro 2016. Pria 45 tahun itu ingin agar

even akbar tersebut terlaksana sesuai waktunya dan uang rakyat tersalurkan dengan semestinya. “Saya dipilih oleh ribuan orang untuk duduk di kursi ini,” kata Romario. “Saya tidak ingin melawan FIBA atau federasi sepakbola Brazil. Namun sebagai anggota parlemen saya punya tanggung jawab untuk mempertahankan kedaulatan negara saya. Saya akan berjuang sampai saya dapat FIFA dapat membereskan kasus ini,” imbuh pencetak 55 gol bagi Brazil tersebut. (nur)

PERKEMbangan HaRga RaTa-RaTa bEbERaPa baHan POKOK PEnTing Di KOTa POnTianaK

04 OKTObER 2011

nO. 1 2 3 4 5 6 7 8 9 10 11 12 13

naMa baRang baHan KEbUTUHan POKOK Beras Lokal/Kampung Beras IR64 Gula Pasir Minyak Goreng Bimoli Minyak Goreng Curah Daging Sapi Murni Daging Ayam Ras Daging Ayam Kampung Telur Ayam Ras Susu Kental Manis Bendera Susu Bubuk Putih Cap Bendera Jagung Pipilan Kering Garam Beryodium





naMa baRang


HaRga KET.


7.000 7.375 1.300 31.500 15.000 45.750 15.750 16.000 4.125 7.000 32.125 18.000 8.000


7.500 8.125 9.625 Luar negeri 14.125 10.125 71.500 Kualitas a 21.250 42.500 16.750 8.175 27.125 6.250 7.000

14 15 16 17 18 19 20 21 22 23 24 25 26

Tepung Terigu Segitiga Biru Kacang Kedelai Mie Instan (Indomi Rasa Kaldu Ayam) Cabe Merah Besar (Biasa) Bawang Merah Ikan Asin Teri Kacang Hijau Kacang Tanah Ketelah Pohon Minyak Tanah Telur Ayam Kampung Cabe Keriting Bawang Putih

Sumber Data : Dinas Perindag Prop. Kalbar



Pontianak Post


Sabtu 12 November 2011

USIR Si Cowok



"Hampir separo minggu ini kamu habiskan dengan diskusi berat. Obrolan dengan topik sangat sensitif itu sebaiknya tidak dibahas."


(20 Januari-18 Februari)

"Cinta memang penuh misteri dan intrik yang menyenangkan. Kamu nggak bisa remehin cerita cinta sekalipun pedih."

PARASIT 1: minta kerjain PR Biasa deh, cowok suka ngerjain sesuatu mendadak. Alasannya kemarin capek habis main bola lah, nggak sempat lah, atau kemarin habis pergi dan pulang malam. Dia pun mencontek PR kita atau lebih parahnya kita yang mengerjakan PR-nya. # Weks, kebayang dong betapa malasnya dia. Urusan sekolah, sih, sendiri-sendiri, say. Apalagi menyangkut PR. Seharusnya dia malu kalau samapai PR saja harus kita yang negrjain. Nggak ada penjelasanm lain selain dia memanfaatkan kemampuan kita dalam mengerjakan PR. PARASIT 2: nggak mau rugi Dia nggak pernah atau jarang membalas SMS dengan alasan nggak punya pulsa. Dan ini kejadian yang super sering terjadi. Grrr! Tapi tetap…kita rela membelikan pulsa atau mentransfer pulsa ke nomor hape dia. # Jadi cowok, kok, nggak modal. Sekalikali boleh lah dia minta ditransfer pulsa. Tapi kalau udah berulang kali samapai bikin uang kita sekarat, ini dia yang disebut cowok parasit. Gals, kalau cowok naksir berat atau sayang sama cewek, dia bakal rela melakukan apa aja buat cewek itu. Cuma urusan pulsa doing ma gampil!!


(22 Desember-19 Januari)

Gita Gutawa pernah gerah sama cowok parasit. Katanya mending tuh cowok dehidrasi di Gurun Sahara, hilang di Segitiga Bermuda dan hiportemia di kutub utara. Mmang ada cowok tipe begini, nih. Yang doyan memanfaatkan kita dengan segala kelebihan yang kita punya. Bukan cma soal harta, tapi mereka juga suka memanfaatkan kepintaran dan kebaikan kita. Ups, jangan mau jadi korban si cowok parasit.


(19 Februari-20 Maret)

"Tak perlu terburu dalam mengambil keputusan penting, apalagi berhubungan dengan hati. Lihat yang sebenarnya kamu rasakan."


(21 Maret-19 April)

"Kamu emang ingin jadi nomor satu. Tapi, jangan sampe obsesi bikin nggak peduli sama pacar. Bikin prioritas, seimbangkan ambisi."


(20 April-20 Mei)

"Kalau merasa yakin dan nyaman saat bersama dia, kenapa harus menolak perasaan itu? Jangan buru-buru bilang nggak, deh."


(21 Mei-20 Juni)

"Kamu mampu jadi sosok yang bisa menyusun ide. Minggu ini kamu harus siap sibuk. Jangan lupa beberapa hal penting minggu ini."

PARASIT 3: minta dibayarin melulu Kita udah berusaha irit buat nabung, tapi nggak berhasil karena selalu habis buat jajanin pacar. Alasannya dia nggak punya uang atau malah udah habis. Setiapkali date, mulai dari makan, tiket bioskop, sampai tiket konser juga kita yang beliin. # Harusnya cowok model begini yang alasannya uang selalu habis sehingga nggak bisa mentraktir kita, bikin kita bertanya-tanya. Kira-kira uangnya buat apa aja, ya. Aneh banget, kan? Kita juga, kan, nggak makan makanan yang anehaneh alias yang mahal-mahal. Paling nggak gantian bayarin, deh. Who knows, jangan-jangan uangnya habis buat traktir cewek lain *curiga mode: ON*. Huh, kayak gini terus gimana kita bisa nabung buat liburan ke Bali bareng teman se-geng?! PARASIT 4: nggak mau susah Kebetulan kita selalu nyetir sendiri ke mana-mana karena punya mobil. Kita jadi suka berbaik hati ke pacar untuk menjemput dia sesekali kalau mau jalan. Kejadian ini awalnya cuma sesekali doing, tapi belakangan, kok, makin sering terjadi, ya. Kalau nggak dijemput, bisa-bisa kita malah nggak jadi pergi. # Kalau dia mau usaha, dia bisa ke rumah kita dulu baru habis itu jalan dari rumah. Enak banget jadi dia kalau mau jalan tinggal ongkang-ongkang kaki di rumah menunggu dijemput sama kita. Cantik-cantik bengini masa mirip sama sopir taksi. PARASIT 5: minta ini itu Kita pengin banget bikin pacar senang dan tambah sayang sama kita. Makanya tiap anniversary kita nggak pernah lupa


(21 Juni-22 Juli)

"Be aware! Sikap cool dan misteriusmu nggak selamanya jadi daya tarik. Ini saatnya kamu lebih ramah dan terbuka pada orang lain."


(23 Juli-22 Agustus)

"Kunci dari hubungan yang romantis adalah berhasil mengesampingkan ego. Mungkin, kamu terlalu fokus kesenangan diri sendiri."

beli hadiah. Meskipun dalam hati bete juga, sih, soalnya dia nggak pernah membelikan hadiah. Malah yang ada dia sering minta beliin barang-barang kebutuhannya. # Waduh, memang sih kita ngasih kado bukannya mengharapkan dikasih balik. Tapi ya, namanya sayang, kan bukan Cuma diomongin, mesti ada buktinya juga dong. Dan salah satunya adalah dengan mengingat hari-hari penting kita dan melakukan Imisal kasih kado) sesuatu buat mengenang hari tersebut. Setuju, nggak? (*/kwk)

KICK ‘EM OUT! Semakin dituruti, cowok parasit biasanya bakal makin menjadi-jadi. Kalau gitu, saatnya menendang dia jauh-jauh dengan cara ini:  Hapus nama dia dari HP, BBM, facebook, atau twitter biar dia nggak bisa hubungi kita lagi.  Jalan sama cowok lain di depan dia biar dia iri. Dia pasti bakal sakit hati dan bete karena merasa nggak bisa memanfaatkan kita lagi.  Pakai barang-barang yang dia minta ke kita, tapi nggak pernah kita beliin, hihihi. Syukuriiiiin nggak punya.  Cerita di blog tentang pengalaman kita di-parasitin. Jangan lupa sertakan fotonya biar dia malu sekalian.


(23 Agustus-22 September)

"Ada rasa cemburu besar yang menguasai kamu hingga pertengahan minggu ini. Jangan terlalu sensitif dan mudah tersinggung"


(23 September-22 Oktober)

"Minggu ini kamu sensitif dan mudah cemburu. Kalau kamu membiarkan hal itu terjadi, hubunganmu akan terasa membosankan."


(23 Oktober-21 November)

"Suasana hatinya sedang nggak baik lho, jadi jangan membicarakan hal-hal yang dapat mengacaukan hubunganmu dan dia."


(22 November-21 Desember)

"Kamu harus menerima kelebihan maupun kekurangan pasangan. Meskipun kamu merasa bahwa itu tidak adil dan dia bisa berubah."


Pontianak Post


Sabtu 12 November 2011







Pontianak Post



Jumat 12 November 2011

Bahagia di Tanggal Cantik 11-11-11

Denada Menikah Tahun Depan JAKARTA - Ribuan orang memanfaatkan tanggal cantik 11-11-11 (kemarin, Red), sebagai hari pelaksanaan momen istimewa. Termasuk para pelakon dunia hiburan di Indonesia. Alasannya, tanggal tersebut mudah diingat dan jarang terulang. Ada yang menikah. Ada juga yang melangsungkan lamaran. Kalau diurutkan, pagi diawali dengan pernikahan penyanyi Nindy dan Azka. Siang hari pesinetron Zee Zee Shahab dilamar kekasihnya, anchor Metro TV Prabu Revolusi. Denada dilamar Jerry Aurum yang berprofesi sebagai fotografer kemarin siang. Sore pesinetron April Jasmine dan Ustad Solmed mengikat janji. Malam giliran pesinetron Ema Waroka yang menikah di tanggal tersebut. Nindy dan Azka kemarin menggelar ijab kabul di kediaman Nindy, Pondok Pinang, Jakarta. Keduanya mengusung pernikahan adat Betawi. Pemilik nama lengkap Anindia Yandirest Ayunda itu dinikahi dengan maskawin 400 gram logam mulia. “Waktu dengar Azka ngucapin ijab kabul lancar, saya langsung teriak yes. Saya kan nggak disandingkan dengan dia. Saya dengar dari dalam,” katanya. Menikah dengan Nindy, Azka yang berprofesi sebagai pengusaha mendapatkan gelar dari keluarga besar Nindy yang berasal dari Sumatera Barat. “Gelarnya Baginda Batuah. Artinya pemimpin. Harapannya,




Azka bisa jadi pemimpin yang baik dan bertanggung jawab,” terang Nindy. Sementara itu, meski masih menjalani prosesi lamaran, Denada tetap bahagia dan terharu. Apalagi saat mengingat perjalanan Denada yang cukup panjang dalam menanti pasangan hidup. Pasangan Denada dan Jerry akan melangsungkan pernikahan pada Februari tahun depan. “Saya bersyukur karena proses hari ini lancar. Saya tidak menyangka proses ini bakal mengharu biru. Saya menangis saking bahagianya,” tutur Denada setelah lamaran di rumahnya di Pejaten, Jakarta Selatan. Hubungan Denada dan Jerry dimulai dari sebuah perkenalan 2,5 tahun lalu. Jerry mengajak Denada menjadi model fotonya. “Sebenarnya, saya juga belum kenal dia. Tapi, saya berani mengajak dia jadi model foto di kamarnya,” tutur Jerry. “Ini orang apa, ya” Belum kenal, kok tiba-tiba ngajak foto di kamar. Ternyata, setelah berteman, kami punya banyak kesamaan dan cocok,” kata Denada. Zee Zee dan Prabu tidak mau kalah. Acara lamaran dan pernikahan tidak berjeda lama. Pada 26 November mendatang mereka akan mengikat janji. Zee Zee yang mantan pacar komedian Bedu tersebut mantap menikahi Prabu, duda satu anak. “Saya tidak bermasalah dengan statusnya. Keluarga juga tahu, kok. Saya juga dekat dengan anak Mas Prabu,” tuturnya. Ustad Solmed dan April menikah di Masjid Al Muhajirin, Perumahan Larangan Indah, Ciledug, pukul 15. 30. Kabar pernikahan sejoli tersebut diberitakan banyak media sebelumnya. Pada hari-H banyak masyarakat yang datang untuk melihat pernikahan mereka. Akad nikah tertunda sebentar karena memasuki waktu salat Asar. Ustad Solmed yang terkenal lewat sinetron Pesantren Rock n Roll mengeluarkan air mata bahagianya. “Saya dan April sedang berbahagia. Kami berjanji untuk saling menyayangi. Terima kasih untuk doa dan spirit-nya. Saya mohon maaf bila menyinggung perasaan. Tolong dibuka pintu maaf sebesar-besarnya,” papar Ustad Solmed. (jan/c12/any)



Film Dokumenter Seniman Medan Diproduksi MEDAN - Biografi para pelaku seni kota Medan diproduksi dengan konsep film dokumenter oleh Lembaga Peduli Kebudayaaan dengan sutradara Rizal Siregar. Sosok yang didokumentasikan lewat film dokumenter tersebut adalah teaterawan D Rifai Harahap. Menurut Rizal Siregar rencananya ada sejumlah sosok seniman yang akan didokumentasikan lewat film dokumenter. Selanjutnya katanya akan memvisualkan lewat film dokumenter para pelaku senin lainnya. Pengambilan gambar untuk film dokumentasi D Rifai Harahap dilakukan pada Senin (7/11), selama tiga hari syuting dengan lokasi Medan dan sekitarnya. Syuting melibatkan para senieas Medan seperti Yondik Tanto (Co. Sutradara), Jali Kendi (Juru Kemera), Ayub Badrin ( Unit Manager), Iskandar Zulkarnaen (Pimpinan Produksi) dan anakanak Teater Imago Medan . Tujuan syuting film dokumenter ini salah satu upaya mendokumentasikan para seniman kota Medan yang pernah berkaya dalam bidang masing-masing. Sebab, tak banyak data dan dokumentasi yang bisa diperoleh baik di arsip daerah maupun di kantong-kantong seni yang ada di kota Medan. “Diera multi media sekarang ini, sudah saatnya dokumentasi para seniman Medan dibikin lewat media sinema. Saya terpanggil untuk mendokumentasikan para seniman Medan karena ketikaparasenimanMedanmeninggal, seperti Burhan Piliang, Buoy Hardjo, Raswin Hasibuan, NA. Hadian, Z. Pangaduan Lubis dan Ben M Pasaribu dan banyak lainnya tidak ada datanya


DOKUMENTER: Aktivitas syuting Film Dokumenter Seniman Medan di Titi Gantung Medan.

dalam bentuk visual,” kata Rizal Siregar yang juga pegiat film dan wartawan ketika break syuting di Titi Gantung, Medan, dua hari lalu. Teaterawan muda dari D’lick Theater Team, Yondik Tanto yang terlibat sebagai Co. Sutradara sangat mendukung produksi film dokumenter para seniman Medan. “Inilah salah satu upaya mewujudkan kepedulian seniman Medan terhadap para seniman yang pernah berkarya dalam berbagai disiplin kesenian. Terutama Seniman yang produktif ,” kata Yondik Tanto menjelaskan. D Rifai Harahap sangat apresiasi terhadap gagasan Rizal Siregar untuk mendokumentasikan para pelaku seniman Kota Medan. Baginya, dokumentasi itu sangat penting. Sebab terangnya, tidak banyak masyarakat yang peduli dengan nasib seniman, apa lagi mendokumentasikannya. “Rizal Siregar duluh aktif di

TeaterImagodan TeaterNasional Medan. Dia sosok seniman yang peduli akan pentingnya dokumentasi tentang para pelaku seniman Medan. Sikap peduli dari Rizal Siregar ini perlu diapresiasikan oleh para pekerja seni lainnya, Pemda Daerah, Pemerintah Pusat serta swsata,” Kata D. Rifai Harahap saat break syuting. Menurut Rizal Siregar secara moril Kepala Anjungan Sumatra Utara Taman Mini Indonesia Indah (TMII) Tatan Daniel telah memberikkan dukungan. Sebab katanya, Anjungan Sumut di TMII adalah salah satu pintu gerbang wisatawan lokal dan manca negara, namun sangat miskin dengan data-data para pelaku seni di Sumatera Utara, khususnya kota Medan. “Dalam pertemuan saya dengan Kepala Anjungan Sumut di Taman Mini Indonesia Indah, dia berharap tidak saja D Rifai Harahap yang akan didokumentasikan lewat film dokumenter, tapi juga pelaku pelaku seni lainnya.

Seperti Seni Rupa, Sastra, Tari, Musik dan Seni Pertunjukan,” ucap Rizal Siregar menirukan pembicaraan Kepala Anungan Sumut TMII, Tatan Daniel. Meski anggaran dengan swadaya, namun penggarapan film dokumenter D. Rifai Harahap dibikin secara profesional. Diharapkannya, setelah pasca produksi dan selesai editing film dokumenter D. Rifai Harahap akan diberikan kepada Pemda Sumatera Utara , Pemkot Medan, Pemda 30 Kabupaten/Kota yang ada di Sumut, Taman Budaya SumateraUtara, SinematekIndonesia dan Anjungan Sumut TMII dan kantong-katong kesenian lainnya. “Semoga saja pada masa mendatang,masyarakatSumatra Utara bisa lebih peduli kepada karya-karya seniman lokal. Dengan adanya film dokumenter para pelaku seni Kota Medan tetap keratif untuk memberikan warna dalam kesenian di Indonesia,” tutup Rizal Siregar.(*/r)



world sport


Dukung Penuh Riset Kanker


Sebagai salah satu penyakit mematikan di dunia, kanker mendapat sorotan utama dari seluruh warga planet bumi ini. Tak terkecuali bagi pesepakbola timnas Inggris Ashley Young. Empati pemain klub Manchester United itu diwujudkan dengan menyempatkan diri mengunjungi Pusat Penelitian Kanker di Withington, M a n c h e s t e r. Seperti diberitakan The Sun kemarin (11/11), Young memiliki kenangan pribadi terkait penyakit kanker. “S a l a h s a t u keluarga teman Ashley Young dekat saya meninggal gara-gara kanker payudara beberapa waktu lalu. Padahal usia ibu sahabat saya itu baru sekitar 40 tahun,” kata mantan pemain Watford dan Aston Villa itu. Mengingat besarnya angka probabilitas terjangkit kanker, satu berbanding tiga, tidak heran banyak pesepakbola Inggris menaruh perhatian yang besar. Dan tahun 2011 ini, para pemain Britania Raya memutuskan memberikan sumbangan dana ke Pusat Penelitian Inggris. “Yang dibutuhkan para penderita kanker adalah dukungan moril. Dengan menyediakan waktu luang anda dan ngobrol bersama mereka, itu akan sangat berarti buat mereka,” ucap Young. Karena itulah bapak dua anak itu bersama pemain lainnya acap kali berkunjung ke komunitas lokal penderita kanker di Manchester. Nah, ketika mengunjungi Paterson Institute, salah satu laboratorium penelitian kanker di Manchester, Young menuturkan mendapat banyak ilmu baru. Mulai bagaimana gejala awal kanker, perawatan terhadap penderita, hingga kerja keras para pekerja laboratorium. “Sungguh suatu pengalaman yang luar biasa. Saya berharap mampu menularkan ilmu yang saya dapat kepada orang-orang terdekat saya. Untuk mencegah kanker, lakukan diet, seringlah berolahraga, dan sadarlah pada kesehatan pribadi anda,” papar pemain berposisi winger itu. Young sudah berkecimpung dalam kegiatan amal sejak tiga tahun belakangan. Ketika masih berkostum Aston Villa, pernah suatu kali seluruh fee pertandingan didonasikan kepada Yayasan Kanker di kota Birmingham. (dra/aww)


Pontianak Post


Sabtu 12 November 2011

Pacman-Marquez Tepis Isu Doping



Siap Tarung: Juara Kelas welter versi WBO Manny Pacquiao (kiri) dari Filipina dan Juan Manuel Marquez dari Mexico diabadikan di The MGM Grand Hollywood Theatre saat konfrensi press di Las Vegas (9/11). Kedua petinju akan bertarung pada tanggal 12 November ini untuk perebutan juara Kelas welter versi WBO di The MGM Grand Gardens,Las Vegas.

LAS VEGAS - Terpaan isu doping menyertai tensi tinggi pertarungan Manny ‘Pacman’ Pacquiao melawan Juan Manuel Marquez. Kecurigaan muncul seiring peningkatan postur yang didapat kedua petinju jelang pertarungan yang dilangsungkan di MGM Grand Garen, las Vegas, besok WIB (13/11) itu. Doping menjadi isu sensitif bagi kedua petinju. Pacman sempat mendapatkan tuduhan terlibat doping dari kubu Floyd Mayweather Jr. Pertarungan kedua petinju yang sempat direncanakan pada 2009 tersebut gagal karena Pacman menolak

tes doping seperti yang diajukan kubu Mayweather. Sementara, tuduhan doping menerpa Marquez dalam sebulan terakhir. Figur sentral dari skandal doping besar di Amerika Serikat (AS) Victor Conte bersaksi bahwa pelatih fisik Marquez, Angel Heredia, terlibat dalam jaringan skandal. Imbasnya, nama Marquez masuk dalam pusaran. Tak urung, kubu kedua petinju pun sibuk menepis kabar tersebut. “Ada banyak cara berbeda untuk membuat seorang petinju jadi sangat kuat. Saya tak mengerti, mengapa ada orang

yang meragukan cara kami untuk mendapatkannya dengan benar,” ujar Ignacio Beristain, pelatih Marquez.Marquez pun tak kalah berang. Dia menegaskan bersedia melakukan tes doping dalam bentuk apa pun, setiap saat dan di mana saja. “Saya melakukan persiapan dengan bersih. Sungguh memalukan, seluruh kerja keras kami dianggap sampah oleh orang lain,” kata petinju Meksiko itu. Dalam keterangan tambahan, Beristain menyebutkan Marquez jadi lebih kuat dan berotot. Persiapan Marquez sangat istimewa menjelang pertarungan ketig-

anya melawan Pacman. Beristain mengakui, faktor gizi dan teknik kebugaran dari heredia berperan penting untuk hal itu. “Saya punya seorang petarung yang kuat. Juan tak melakukan hal ilegal, Juan tahu benar akan hal itu. Petinju Meksiko tak mengonsumsi sesuatu yang dilarang,” tegas Beristain. Sanggahan juga disuarakan pelatih Pacman, Freddie Roach. Tuduhan terhadap petinjunya sama sekali tak berdasar, mengingat Pacman melakukan segalanya tahap demi tahap. Seperti yang dilakukannya menjelang pertarungan mempertahankan gelar

kelas welter versi WBO kali ini. “Kami bekerja keras mempersiapkan segala sesuatunya hingga sampai seperti sekarang. Jadi, saya sudah lelah dengan segala omong koson tentang itu,” ucap Roach. Promotor Bob Arum pun tak kalah berang menyusul terpaan isu miring tersebut. Baginya, pertarungan Pacman melawan Marquez adalah pertarungan dua petinju terbaik yang memiliki masa keemasan dengan kerja keras dan talenta istimewa dalam dunianya. “Saya mendapatkan dua petinju yang bersih,” ujarnya singkat. (ady/diq)




Safani Ditantang PDAM AJANG Futsal bertajuk TVS Apache Competition yang berlangsung hari ini, Sabtu (12/11) di GOR Pangsuma Pontianak diprediksi akan berlangung alot dan menarik. Sebanyak 17 tim siap berlaga untuk meraih the best tim di ajang tersebut. Masing-masing adalah Safani, PDAM, Yayasan Immanuel, AJC di Pool A. Arsekon, Humas Polda, Pemkab Kubu Raya Arjuna Angkasa di Pool B. KONI Kalbar, Adira, BFC 2, PT Original dan BRI di Pool C dan terakhir adalah Hartosolo, Pondok Ale-Ale, Angkasa Pura dan Indosat di Pool D. “Laga babak penyisihan grup sudah dimulai Jumat kemarin ada lima tim yang berlaga. Dan hari ini laga penyisihan grup kembali akan berlangsung dan mempertandingkan delapan laga,” ungkap Aryo Sabrang selaku EO pelaksana dari Idea Entertaimnet kepada Pontianak Post kemarin. Laga hari ini, menurut dia, akan dimulai pukul 09.00 WIB antara KONI Kalbar kontra BFC 2. Kemudian laga kedua, akan berhadapan antara PT Original bentrok Britama. Di laga ketiga akan berduel antara Hartosolo Group dan Pondok Ale-Ale pada pukul 11.00 WIB. Dan pada pukul 12.00 WIB akan berjibaku antara Angkasa Pura berhadapan dengan Indosat. Sementara, ungkap Aryo, pada pukul 16.00 WIB, juga akan kembali bentrok antara pemenang Safani dan PDAM melawan pemenang antara Yayasan Immanuel melawan CV AJC. Pada pukul 17.00 WIB akan berjibaku pemenang antara Arsekon dan Humas Polda melawan pemenang antara Pemkab Kubu Raya dan Arjuna Angkasa. Pada pukul 18.00 WIB akan bertarung pemenang antara KONI dan BFC 2 melawan pemenang antara PT Original dan Britama. Kemudian kembali akan berjibaku pada pukul 19.00 WIB pemenang antara Hartosolo dan Pondok Ale-Ale melawan pemenang antara Angkasa Pura dan Indosat. (bdi)

METRO SPORT 100 Karateka Muda Siap Beraksi Kejuaraan Karate Pelajar Forki Kota Pontianak PONTIANAK—Hari ini, Sabtu (12/11), sebanyak kurang lebih 100 atlet karate dari berbagai sekolah di Kota Pontianak akan tampil dalam Kejuaraan Karate Pelajar, di Lapangan Tenis Indoor Dinas Kesehatan Kota Pontianak Jalan Abdul Hadi. Para karateka muda ini siap beraksi untuk meraih prestasi terbaik. Diungkapkan Supriadi Irawan SE, Sekretaris Forki Kota Pontianak kejuaraan yang digulirkan oleh Forki kota ini sebagai ajang pencarian bakat dan untuk memeriahkan HUT Kota Pontianak yang ke-240 tahun. Ajang ini diprediksi berlangsung alot dan meriah dengan tampilnya karatekakarateka muda dari berbagai perguruan karate dan sekolah di Kota Pontianak. “Ajang ini memang kita gulirkan untuk mencari karateka-karateka muda sebagai barometer pembinaan yang sudah dilakukan setiap perguruan dan setiap sekolahan,” ungkap Supriadi. Menurutnya ada tiga kategori yang akan dipertandingkan dalam kejuaraan kali ini. Yaitu, tingkat sekolah dasar (SD), tingkat SLTP dan tingkat SLTA. Untuk seluruh kategori peserta yang tampil cukup banyak dan seluruh sekolah cukup antusias mengikuti kejuaraan ini. Nomor-nomor yang diper-

Budianto/Pontianak Post

AKSI: Para karateka muda Kota Pontianak siap beradu nyali dan gengsi dalam kejuaraan karate pelajar Forki Kota Pontianak, mulai hari ini (12/11) dan Minggu (13/11) di Lapangan Tenis Indoor Dinas Kesehatan Pontianak.

tandingkanm, jelasnya, yakni, untuk putra, kata perorangan, komite -30 kg, komite -35 kg, komite -40 kg dan komite +40 kg. Untuk putri, kata peorangan putri, komite -25 kg, komite -30 kg, komite -35 kg dan komite +35 kg. Untuk tingkat SLTP, nomornomor yang dipertandinkan untuk putra yakni, kata peorangan, komite -35 kg, komite -40 kg, komite -45 kg, komite -50 kg dan komite +50 kg. Untuk putri, kata peorangan, komite -30 kg, komite -35 kg, komite -40 kg, komite -45 kg dan komite +45 kg. Sementara untuk tingkat SLTA nomor-nomor yang dipertandingkan dikategori putra yakni

kata peorangan, komite -50 kg, komite -55 kg, komite -60 kg dan komite +60 kg. Untuk putri, kata peorangan, komite -48 kg, komite -53 kg, komite -59 kg dan komite +59 kg. Di kejuaraan ini, lanjut Supariadi, setiap sekolah hanya diperkenankan mengirimkan satu wakilnya untuk satu kelas yang diperlombakan, selebihnya tidak bisa.”Kami juga mengajak masyarakat Kota Pontianak untuk bisa datang dan melihat langsung penampilan para karateka-karateka muda terbaik Kota Pontianak. Dengan banyaknya supporter yang datang antusias dan gaung kejuaraan ini akan lebih meriah dan menarik,” tandasnya. (bdi)

Pontianak Post Sabtu 12 November 2011

Atlet Renang Peluang Lolos PON PONTIANAK—Dua gan masyarakat atlet renang Kota PonKalbar untuk ketianak, masing-masing berhasilan kedua RZ Purwanda dan Suatlet tersebut. siana berpeluang lolos Sementara RZ ke PON XVIII Riau taPurwanda behun 2012 mendatang. berapa waktu lalu Hal itu diungkapkan mengungkapkan Sabli Potinga pelatih keinginannya unrenang Kota Pontianak tuk bisa berlaga beberapa waktu lalu di di ajang PON. Di Kolam Renang Oevang usianya yang Oeray. “Peluang kedua masih relatif sanperenang ini cukup begat muda, masih sar. Untuk di putra Purterbuka lebar pePurwanda wanda berpeluang dan luangnya untuk di putri Susiana juga demikian,” bisa lolos ke PON. Jika tidak di PON ungkap Sabli. tahun ini, mungkin empat tahun Menurutnya, lolosnya atlet mendatang. “Saya ingin prestasi renang di ajang PON mendatang saya tidak hanya di kejurda dan melalui beberapa tahapan Pra porprov. Saya ingin bisa berprestasi PON. Prakualifikasi pertama ber- di PON XVIII 2012. Tolong doakan langsung di Semarang bersamaan saya,” kata perenang yang mengabdengan KRAPSI pada 2010 lalu. dikan diri di Basarnas tersebut. Kualifikasi kedua di ajang Kejurnas Karena cita-cita itulah, PurRenang di Surabaya Mei lalu. Ke- wanda terus mengenjot catatan mudian di ajang Indonesia Open waktunya. Di pengujung tahun yang merupakan Pra-PON tahap ini, kesiapannya sudah ditunggu ketiga Agustus lalu. Terakhir ada- di Pra PON. “Saya harus mengalah KRAPSI (Pra-PON ke empat) sah limit waktu saya. Untuk bisa Desember 2011. lolos di PON, harus diukur dengan Menurut dia, pada tiga ajang limit waktu. Jika limit waktu saya di Pra PON sebelumnya, limit waktu bawah rata-rata, saya bisa gagal,” yang dicatat oleh RZ Purwanda dan tutur Purwanda. Susiana cukup baik. Dia berharap Pada Porprov Kalbar X lalu, di Pra PON terakhir, kedua atlet ini Purwanda juga sukses merebut bisa meraih limit terbaik sehingga tujuh medali emas. Dan rekor yang bisa lolos ke PON. “Saya cukup dibuat Purwanda di ajang tersebut optimis Purwanda bisa meraih terbilang luar biasa. Purwanda target yang dibebankan Pengprov merupakan satu-satunya atlet puPRSI, begitu juga bagi Susiana,” tra di Porprov yang mampu mereseraya berharap doa dan dukun- but tujuh medali emas. (bdi)



Incar Satu Emas Di Hari Pertama

Singapura Yakin Bisa Jawara PALEMBANG-Tim renang Indonesia berharap mampu meraih medali pertama pada perlombaan hari ini. Mereka optimistis medali emas bisa disumbangkan dari nomor 50 meter gaya kupu-kupu dari tangan Glenn Victor. ”Minimal hari ini kami yakin dapat satu emas pertama. Kalau lebih saya rasa berat, karena lawan-lawan yang kami hadapai cukup kuat,” ujar pelatih tim renang Albert C Sutanto saat ditemui di kompleks olahraga Jakabaring, kemarin (11/11). ” Peluang besar emas Indonesia menurut mantan atlet Nasional itu memang masih ada di tangan perenang-perenang putra. Alasannya, untuk sektor putri Singapura maupun Malaysia dua tahun terakhir masih sulit disaingi. ” Tapi, bukan berarti peluang emas tim merah putih di sektor putri tertutup seluruhnya.masih ada peluang di gaya dada dari Enny Susilowati yang terus menunjukkan peningkatan performa di nomor andalannya gaya dada.

” Pada hari ini, ada enam nomor yang akan dipertandingkan. Selain 50 meter gaya kupu-kupu, ada 100 meter gaya kupu-kupu , 400 meter gaya ganti putra, 200 meter gaya bebas, 200 meter gaya dada, estafet 4 x 100 meter gaya ganti. ” Sementara itu, tim terkuat di nomo renang Singapura optimistis bakal kembali menancapkan status jawaranya. Pasalnya, mereka membawa tim terbaik dan menarget bisa mengulang perolehan medali emas pada SEA Games Laos 2009 dengan torehan 14 emas . ” Pelatih tim Singapura David Lim Fong Jock menegaskan bahwa kedatangan Singapura ke Indonesia kali ini untuk menegaskan kembali status jawara renang Asia Tenggara. Dengan materi yang dibawa Negeri Singa kali ini, Dia optimistis mempu mencapai target yang dibebankan. ” Tim kami semakin baik, kami juga membawa mereka yang meraih emas pada 2009 lalu kesini. Jadi, kami kira target 14 emas adalah target yang realistis

bagi tim kami,” ucapnya. ” David menjelaskan bahwa target emas terbesar dari tim Singapura dibebankan dari tim putri. Pasalnya, pada 2009 lalu penyumbang emas terbanyak adalah tim putri dengan sebelas emas. Hanya, kali ini untuk target” medali di tim putri mulai diturunkan dan tim putra mulai dinaikkan. ” Untuk putri kami hanya mematok sembilan emas saja. Tapi, di putra kami ingin bisa mendapat lima emas. Kali ini harus meningkat karena pada 2009 hanya dapat tiga emas yang putra,” terang lelaki berusia 35 tahun tersebut. Mantan atlet nasional Singapura itu meyakinkan bahwa target yang disusungnya bakal tercapai dengan sukses. Sebab, hasil dari tryout mereka selama ini cukup meyakinkan dan masih bisa lebih baik dari sesame Negara Asia Tenggara. ” Kendati demikian, David mengaku mewaspadai kekuatan Indonesia untuk saat ini. Dia melihat pesaing terberat kali ini adalah Indonesia, bukan lagi Malaysia seperti 2009 lalu. Itu dikarenakan peningkatan performa perenang-perenang Indonesia dinilai meningkat dengan signifikan selama mereka pantau di kejuaraan-kejuaraan sebelumnya. ” Perenang yang paling disorot dan diwaspadai adalah Glenn Victor Sutanto yang mampu menyumbangkan dua medali emas bagi Indonesia pada 2009 lalu. ”Perenang Indonesia bagusbagus sekarang. Mereka cukup cepat, apalagi tuan rumah tentu semangatnya” juga sangat baik. Kami harus lebih baik dari 2009,” terangnya. Sementara itu, perenang andalan tim Singapura Tao Li saat ditemui terpisah juag mengiyakan jika dirinya cukup diharapkan bisa mengulang prestasi 2009. Dengan apa yang sdauh didapatnya selama ini, Tao Li optimistis bisa mencapai target yang dibebankan pelatih untuk mendapat enam emas dari tangannya. (aam)


Pontianak Post Sabtu 12 November 2011




Keasyikan Individu JAKARTA - Timnas Indonesia U-23 kembali meraih hasil sempurna, menghadapi Singapura di laga kedua SEA Games XXVI/2011 di Stadion Utama Gelora Bung Karno (SUGBK) kemarin siang tim besutan Rahmad Darmawan itu mengalahkan Singapura dengan skor 2-0. Tak hanya mengamankan tiga poin, hingga partai kedua gawang timnas U-23 yang dikawal Kurnia Meiga belum sekalipun kebobolan. Dengan kemenangan ini untuk sementara Indonesia kembali menempati posisi teratas klasemen sementara Grup A dengan poin enam. Tampil dibawah terik matahari pukul 14.00 WIB skuad Merah Putih langsung menggebrak. Berawal dari bola kik off kerjasama Diego Michiels, Egi Melgiansyah, dan Titus Bonai berhasil dikonversi menjadi gol oleh Patrich Wanggai ketika pertandingan baru berjalan 45 detik!. Unggul cepat membuat Egi Melgiansyah dkk makin bersemangat membombardir gawang Singapura yang dikawal Mohammad Izwan Bin Mahmud.Menit ke-10 dan 15 secara beruntun Patrich mengancam gawang Singapura. Sekali melenceng tipis dan sekali digagalkan kiper. Cuaca panas akibat sengatan matahri sepertinya juga menular ke emosi pemain. Beberapa kali dalam laga kemarin pemain kedua tim terlibat ”duel” yang dilanjutkan saling gontok-gontokan di lapangan dan harus dilerai wasit. Bahkan dimenit ke-22 Singapura harus bermain dengan 10 pemain setelah pemain depannya Navin Neil Vanu diusir keluar lapangan setelah menerima kartu kuning kedua. Unggul jumlah pemain timnas Merah Putih berhasil menggandakan keunggulan di menit ke-36 lewat aksi menawan Titus Bonai. Sayang setelah unggul 2-0 dan lebih dalam jumlah pemain pemarforma tim malah tidak main bagus. Sebaliknya ritme dan determinasi tim mengendur. ”Pemain sepertinya malah terbawa irama permainan Singapura yang mengubah formasi

MENANG : Pemain tim nasional Sea Games, Ferdinand Sinaga (kanan), dan pemain Singapura, Muhammad Shahir, dalam lanjutan babak penyisihan SEA Games 2011, di Stadion Utama Gelora Bung Karno, Senayan, Jakarta. Indonesia menang 2-0. 11 November 2011. HENDRA EKA/JAWA POS

dari 3-4-3 menjadi 4-4-1 setelah kehilangan pemain. Skuad Garuda Muda juga berkalikali terpancing emosinya oleh permainan cenderung kasar yang diperagakan Singapura. Di menit - menit akhir beberapa pemain timnas U-23 terlihat lebih memilih pamer skill individu daripada bermain sebagai tim. Akibatnya aliran bola yang mestinya jadi peluang bisa dengan mudah dibaca oleh barisan pertahan lawan. ”Saya bersyukur dengan hasil ini walau sempat mengalami rasa seperti kurang percaya diri setelah unggul 2-0. Tapi dibantu positioning saat kehilangan bola dan tampil cukup disiplin itu membuat Singapura tidak bisa menekan,” kata Rahmad Darmawan pelatih timnas U-23 dalam press conference usai pertandingan. Menurut Rahmad, di laga kemarin pemainnya juga sering melakukan pelanggaran di sepertiga daerah sendiri. ”Di babak kedua justru beberapa kali pemain kita keasyikan bermainan individu. Dribbling tidak efesisen dan kurang manfaatkan lebar lapangan,” beber Rahmad. Pemain timns era 80-an itu juga mengakui

pemainnya sedikti terpancing emosinya oleh permainan keras yang dilakukan pemain Singapura. ”Itu akan jadi catatan buat saya,” tegasnya. Sementara itu Slobodan Pavkovic menyatakan jika kekalahan timnya lebih disebabkan oleh kesalahan individu pemain. ”Kesalahan indivisu merusak semua persiapan dan strategi yang saya siapkan,” kata Slobodan Pavkovic. Menurutnya, gol cepat Indonesia disebabkan kesalahan barisan belakang. Dan kartu merah yang diterima Navin neil vanu ketika pertandingan baru berjalan 22 menit menurut Pavkovic membuat timnya makin kesulitan menandingi Indonesia. ”Apalagi sebelumnya kami baru menyelesaikan pertandingan jam Sembilan malam (Rabu malam) dan sekarang kami harus main jam dua siang. Itu menyulitkan kami,” papar pelatih asal Serbia ini. Kamboja Tersingkir Timnas Kamboja menjadi tim pertama yang pasti tersingkir dari persaingan di cabang sepakbola. Ini setelah tadi” malam tim besutan Taee Hoon Lee itu dihajar Thailand empat gol tanpa balas di Stadion Utama Gelora Bung karno (SUGBK).

Ini adalah kekalahan ketiga yang dialami Kamboja. Di dua laga sebelumnya Kamboja ditumbangkan Indonesia 6-0 dan menyerah 2-1 dari Singapura. Dengan hanya menyisakan satu pertandingan lagi Kamboja tidak mungkin bisa mengejar posisi kedua Grup A. Empat gol Thailand dicetak Natarid Thammroddodpon (18’), Attapong Nooprom (72), Kroekit Thawikan (76) dan Attapong Nooprom (82). ”Setelah kalah di laga pertama (dari Singapura) kami bertekat untuk bangkit dan memenangkan semua pertandingan berikutnya,” kata Kasem Jaliyawawong, manajer timnas Thailand usai pertandingan. ”Ini modal bagus bagi kami untuk merebut satu tiket ke semifinal,” sambungnya. Pelatih Kamboja Tae Hoon Lee mengakui jika timnya sulit bersaing di Grup A yang dihuni tim-tim bagus Asia Tenggara. ”Kami mendapat pengalaman berharga dari SEA Games kali ini. Semoga setelah SEA Games ini perfroma Kamboja bisa lebih bagus lagi,” kata Tae Hoon Lee. Di ajang SEA Games kali ini Kamboja datang membawa pemain-pemain dibawah usia 20 tahun. (ali)

Pontianak Post  
Pontianak Post  

12 November 2011
