Issuu on Google+


Hotline Service


Phone: 081257225755 082150002031 SMS: 085347259955

t os

anak P nti

Berlangganan & Pengaduan




Pontianak Post

Selasa 12 Maret 2013 M / 29 Rabiul Akhir 1434 H

Memilih Pimpinan, tidak hanya pandai, yang diutamakan integritas dan antusias

Dollar US

Dolar SGD

Ringgit MYR




Kurs Rupiah 11 Maret 2013


Eceran Pontianak Rp. 3.000


Catur Brata Penyepian Tak Terpengaruh Lingkungan PONTIANAK—Perayaan Nyepi Tahun Baru Saka 1935 yang jatuh pada hari ini, juga dilakukan umat Hindu di Kalimantan Barat. Banyak rangkaian acara dikerjakan. Ritual keagamaan pun tak terbatasi oleh lingkungan sekitar. Ketua Parisada Hindu Dharma Indonesia Kalimantan Barat, Putu Dupa Bandem, mengatakan Kalbar merupakan salah satu provinsi di Indonesia yang menerima dengan baik umat Hindu. Sebab selama pelaksanaan perayaan Nyepi, tidak pernah ditemukan permasalahan. “Mulai dari pengarakan Ogoh-ogoh sampai pelaksan-


aan rangkaian perayaan Nyepi, umat Hindu tidak pernah mendapatkan gangguan, bahkan kami selalu didukung dan dihargai masyarakat di lingkungan sekitar,” jelas Putu kemarin (11/3). Putu mengatakan, hiruk pikuk lingkungan di sekitar tempat tinggal umat Hindu diharapkan tidak menjadi halangan dalam pelaksanaan Catur Brata Penyepian. Karena menurut dia, Catur Brata Penyepian merupakan aplikasi perbuatan yang menghasilkan sesuatu yang baik, bagi diri sendiri maupun bagi orang lain. ‹Ke Halaman 7 kolom 1

Kapok Ketemu Napi Brutal CYNTHIARA Alona akhirnya bisa keluar bui atas kasus kepemilikan paspor palsu. Perasaan bintang film Susuk Pocong dan Hantu Budeg ini langsung bercampur aduk. “Aku jadi mengenal dunia penjara seperti apa. Jadi susah banget diungkapkan. Karena aku di sini nggak lama. Aku cuma dapat aktivitas pembelajaran iman, agama itu yang paling penting mereka terapkan,” ucap Alona. Ya, Alona bisa menghirup udara bebas, keluar dari Lembaga Pemasyarakatan Wanita Tangerang Banten, Minggu lalu. Kini, eks model majalah Playboy ini belum mau menerima pekerjaan, baik bernyanyi ataupun menerima tawaran film. “Aku mau istirahat dulu. Aku mau menetralisir aura negatif dari penjara,”kata Alona. Banyak pengalaman yang dirasakannya selama di dalam penjara. Masuk ke dalam penjara adalah peristiwa menyakitkan ‹Ke Halaman 7 kolom 5


ARAK OGOH-OGOH: Umat Hindu di Kalbar mengarak Ogoh-ogoh di Pura Giripati Mulawarman Jalan Adisucipto Kabupaten Kubu Raya, Senin (11/3). Arak-arakan tersebut merupakan rangkaian upacara Tawur Agung Kesanga sebelum pelaksanaan hari Nyepi yang jatuh pada hari Selasa (12/3).

Tak Semua Mau Aklamasi Kunci Ketum Demokrat di Tangan DPD dan DPC JAKARTA – Kongres luar biasa (KLB) Partai Demokrat yang kabarnya digelar pada 20 Maret mendatang menjadi

Cynthiara Alona


Soft Loans untuk Infrastruktur Kalbar


INVESTASI infrastruktur merupakan sektor strategis yang akan meningkatkan pertumbuhan ekonomi dan meningkatkatkan daya saing suatu negara. Keterbatasan infrastruktur merupakan penyebab dari rendahnya pertumbuhan ekonomi Indonesia. Laporan World Economic Forum (WEF) mengenai

Anwar Azazi*

‹Ke Halaman 7 kolom 1

ADVERTORIAL Anda Berisiko Kena Kanker Hati?

Konsumsilah Kulit Manggis SALAH satu penyakit yang banyak menyerang saat ini adalah kanker hati. Kanker ini muncul dari organ hati sendiri, bukan akibat keganasan organ lain yang menyebar ke hati. Gejala klinisnya antara lain hepatomegali atau pembesaran hati, sakit perut, atau gangguan hati lain. Hati adalah ‹Ke Halaman 7 kolom 5

perhelatan politik yang superpanas. Meskipun sudah ada sinyal bahwa majelis tinggi akan memunculkan calon ketua umum yang diharapkan bisa dipilih secara aklamasi, situasi di bawah justru menunjukkan respons berbeda.

Setiap elite Partai Demokrat (PD) sudah mulai memasang kuda-kuda. Di antaranya, kubu loyalis Anas Urbaningrum yang direpresentasikan sosok Wasekjen DPP PD Saan Mustopa. Anggota Komisi III DPR itu mengisyaratkan kesiapan-

nya untuk maju. Tetapi, secara diplomatis, dia menyatakan masih menunggu dan mempertimbangkan suara-suara dari DPD dan DPC. ”Kita akan pikirkan (kalau didukung, Red) dan Istikharah lah,” kata Saan di gedung DPR

kemarin (11/3). Dia mengaku sampai sekarang komunikasi dan silaturahmi dengan DPD dan DPC berjalan intensif. ”Soal ke depan bergantung DPD dan DPC,” tegasnya. ‹Ke Halaman 7 kolom 1

115 Kardinal Mulai Pilih Paus Baru KPK Sita SPBU VATIKAN – Hari ini 115 kardinal dari seluruh dunia dijadwalkan mulai melaksanakan pemilihan paus baru (konklaf ) di Kapel Sistine, Vatikan. Mereka akan memilih pemimpin baru umat Katolik pengganti Paus Benediktus XVI yang mengundurkan diri. Begitu para kardinal masuk Kapel Sistine, pintu langsung dikunci. Segala macam kontak dengan dunia luar bakal diputus. Tak ada koran, televisi, telepon seluler, atau sosial media seperti Twitter. Di sekitar gedung juga sudah dipasang pengacak sinyal untuk menjaga para kardinal dari intervensi pihak luar. Tradisi tutup pintu itu sudah dimulai pada 1268–1271 ketika para kardinal mengadakan pertemuan di ‹Ke Halaman 7 kolom 5

JAKARTA – Harta kekayaan Irjen Djoko Susilo ternyata jauh lebih banyak ketimbang yang diduga. Setelah 12 rumah di Jabodetabek, Solo, Semarang, dan Jogjakarta disita, kemarin ‹Ke Halaman 7 kolom 1


MENUNGGU PAUS BARU : Balkon di Basilika St Petrus menjelang pemilihan Paus Baru, di Vatikan.

Sekilas Tentang Konklav KONKLAV, ritual khas untuk memilih Sri Paus, sang Pemimpin tertinggi Gereja Katolik Roma, diadakan lagi Selasa mendatang, 12 Maret 2013, untuk memilih penerus Tahta Santo Petrus ke-265, setelah Paus Benediktus XVI secara resmi mengundurkan diri Kamis lalu, 28 Pebruari 2013 tepat jam 20.00 waktu

Oleh P. Markus Solo, SVD, Vatikan

Roma oleh karena umur dan kesehatan. Sejak itu Tahta Santo Petrus mengalami sede vacante“ (Latin, artinya Tahta Kosong). Di dalam masa ini para Kardinal di seluruh

dunia di bawah 80 tahun sejak sede vacante berkumpul di Vatikan untuk mengadakan konklav. Seperti yang telah diputuskan secara bersama-sama oleh para Kardinal pemilih, Selasa mendatang, ke-115 Kardinal pemilih akan

Menristek Realisasikan KIM LANDAK— Realisasi Pembangunan Mandor Industrial Estate atau Kawasan Industri Mandor (KIM) di Kecamatan Mandor, Kabupaten Landak dimulai. Senin (11/3) pagi peletakan batu

‹Ke Halaman 7 kolom 5

‹Ke Halaman 7 kolom 5

Mayat Gerilyawan Sulu Dibungkus Plastik 11: 55


18: 00



Malaysia Klaim Tanduo Dikuasai


pulang kembali ke kampung,” ujar Ketua Polisi Sabah Datuk Hamza Thaib pada wartawan kemarin. Dalam foto yang ditunjukkan oleh pihak kepolisian, gerilyawan Sulu itu dibawa dengan kantong-kantong plastik warna hitam. Hamza mengakui sebagian mayat itu sudah membusuk karena sudah beberapa hari belum bisa diambil. “Karena itu kami akan menunggu forensik untuk mengesahkan identitas mayat-mayat itu,” katanya. Hamza belum meastikan nama pimpinan yang disebut-sebut bernama Musa ikut tewas. “Kalau dari sisi pangkat memang dia jendral, tapi namanya kami masih menunggu forensik,” katanya. Polisi Malaysia juga sudah menangkap

TINGGALKAN DESA : Warga Tanjung Labian meninggalkan desa mereka, menyusul operasi daulat membersihkan wilayah dari gerilyawan Sulu, kemarin.

‹Ke Halaman 7 kolom 5

Operasi daulat memasuki tahap akhir. Polisi Malaysia mengklaim berhasil membersihkan Kampung Tanduo dari gerilyawan. Kampung ini yang dianggap sebagai basis terkuat mereka. KAMPUNG Tanduo adalah kampung pertama tempat mendarat para gerilyawan bersuku Tausug atau Sulu itu. Menurut Hamza, 22 mayat berhasil dievakuasi ke rumah sakit Tawau dan rumah sakit Lahad Datu. “Saat ini sudah tahap akhir dari operasi mopping di Tanduo. Insya Allah sebentar lagi warga dibenarkan Online: cmyk

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 4.000 *Ketapang Rp 4.000 *Kapuas Hulu Rp 4.000

Jawa Pos Group Media



1POUJBOBL1PTUrSelasa 12 Maret 2013

Bupati Henrikus Buka Imlek Bersama

LUAR biasa. Ribuan warga “membanjiri” hiburan Imlek Bersama yang bertemakan “Bersatu Dalam Kasih” di pentas seni dan budaya pendopo Bupati Ketapang, Sabtu (9/3). Kemeriahan Imlek Bersama ini merupakan yang kedua kalinya, setelah kegiatan serupa juga dilakukan pada tahun sebelumnya. Bupati Ketapang, Drs Henrikus M.Si dalam arahannya ketika pembukaan Imlek Bersama menilai ramainya warga yang hadir ini cukup luar biasa. Pengunjung yang datang pernuh dari dalam sampai keluar areal. Ia memprediksikan sedikitnya 6.000 pengunjung hadir ke hiburan pentas seni dan budaya. Dikatakannya, perayaan ulang tahun sebenarnya ada dua makna. Makna pertama mensyukuri pada tahun sebelumnya diberkahi dan diberkati Tuhan Yang Maha Esa. Makna kedua adalah berdoa, memohon kepada kepercayaan masing-masing agar tahun kedepan akan lebih baik lagi. Perayaan Imlek bersama di Ketapang memang dilakukan setelah melewati hari ke 15. Kegiatan Imlek Bersama bukan bagian dari ritual keagamaan. Tetapi kegiatan pentas seni untuk menyatukan kebersamaan, karena Imlek bukan milik satu

Bersatu Dalam Kasih, Kesemarakan di Imlek Bersama

FOTO BERSAMA : Bupati dan Wakil Bupati Ketapang foto bersama panitia Imlek Bersama Tahun 2013

kelompok saja. Tetapi milik semua kelompok yang menyakininya. Diuraikan Bupati Ketapang bahwa tahun ini adalah tahun ular air. Sedangkan t a hu n ya n g baru lewat adalah tahun Na g a. Ja n g a n ditafsirkan dari tahun naga ke tahun ular air, rezeki lebih surut dibanding tahun naga. Jangan pula ditafsirkan ular kadut dan lain sebagainya. Tetapi ta-

hun ular air ini, menurut fengshui mempunyai makna tahun yang penuh kebijaksanaan, dan obat. Maknanya penuh dengan kebijaksanaan dan membuat kita lebih kuat. “Jangan ditafsirkan masing-masing dan sendiri-sendiri, justru tahun ini lebih baik kita berusaha, saya sudah lihat dan bacabaca makna Tahun ular Air ini diinternet,,” tegas Bupati. Kesemarakan Pentas Seni dan Budaya pada tahun ini, diharapkan akan lebih baik lagi di tahun akan datang. Bupati Ketapang menyebutkan pentas seni dan budaya pendopo dapat dimanfaatkan semua etnis yang ada

LAPORAN DAN ARAHAN : Doa bersama, sambutan ketua Panitia dan Arahan Bupati Ketapang pada pembukaan Imlek Bersama tahun 2013

di Ketapang. Dari sejumlah etnis yang ada di daerah ini,

Dihibur Artis Ibukota, Kompleks Pendopo Jadi “Lautan Manusia”

LAUTAN MANUSIA : Sedikitnya 6.000-an pengunjung memadati kompleks Pentas seni dan Budaya Pendopo Bupati Ketapang

kembali berlanjut dengan ditandai pembukaan oleh Bupati Ketapang sekaligus pesta kembang api. Kemudian berlanjut dengan penampilan Group Nusantara, yang membawakan lagu dari masa ke masa, muda-mudi membawakan tarian alam semesta, senam sukacita dari tiga generasi, serta hiburan artis ibukota seperti Verdi Vera, Tina Toon dan Dorce Gamalama membuat warga tidak beranjak dari lokasi

TAMU: Ketua Kadin Kalbar dan sejumlah investor juga hadir

faatkan pentas seni pendopo. “Budaya yang belum

Wahana Perekat Persatuan dan Kesatuan

BARONGSAI: Atraksi barongsai Sabtu (9/3) petang di kompleks Pendopo Bupati Ketapang.

SEMARAKNYA Imlek Bersama terasa sejak atraksi Barongsai Budi Agung Pontianak dan Barongsai Ketapang pada sore hari. Ribuan warga kompleks pendopo pada Sabtu petang sampai malam hari. Demikian juga dengan permainan naga sekaligus memberikan penghormatan kepada Bupati Ketapang. Sempat jeda sesaat, melewatkan waktu sholat isya, kemeriahan Imlek bersama

semua mendapat tempat yang sama untuk meman-

tampil, kita tawarkan untuk menampilkan seni dan budayanya, kita punya leading sektor untuk memfasilitasinya, kita bersatu bersama bangun daerah ini,” ujarnya. Dalam kesempatan itu, Bupati menuturkan dalam hal budaya, tidak ada etnis yang lebih hebat. Budaya harus kita terima sebagai anugerah. Karena itu, visi dan misi Bupati dan Wakil Bupati Ketapang adalah melayani dengan adil. Melayani dengan adil ini diterapkan pada semua aspek. Karena itulah, Bupati Ketapang mengimbau kita semua menjaga keamanan dan ketertiban.”Kami ucapkan terima kasih kepada investor yang cukup berperan dalam mensukseskan kegiatan ini, kami harap kegiatan dari awal sampai selesai berjalan tertib, dan aman,” paparnya. Sementara itu, Hartono, Ketua Panitia Imlek Bersama menuturkan pembiayaan diperoleh dari bantuan pemda Ketapang, donatur dari investor kebun dan tambang, dan bantuan dari masyarakat Tionghoa. Ia mengucapkan terima kasih kepada Pemkab Ketapang, khususnya Bupati dan Wabup Ketapang yang memberikan moril dan finansial sehingga kegiatan Imlek Bersama bisa dilaksanakan sesuai jadwal yang ditentukan.Ia mengajak melalui Imlek Bersama mari kita bersama dorong nilai moral dan spiritual, sehingga memasuki tahun yang baru dibarengi dengan semangat dan tekad yang baru juga.Semoga Memasuki Tahun Ular Air, hidup kita akan lebih bernilai pada masa yang akan datang. **

hiburan. Para artis ibukota tampil maksimal. Mereka tak hanya menghibur dengan lagu-lagu, tetapi sekaligus permainan yang ditampilkan mampu membuat pengunjung terpingkalpingkal karena merasa lucu. Selain hiburan, pengunjung juga dapat kejutan. Pasalnya sejumlah door prize dibagikan. Bahkan, hiburan semakin lengkap dengan tampil Bupati Ketapang, Drs Henrikus M.Si dan

Ny.Riniwati, Wakil Bupati Ketapang, Boyman Harun SH dan Ny.Rachmiwati SH menyumbangkan lagu kesayangan. Perayaan imlek Bersama dihadiri sejumlah stakeholder baik tokoh masyarakat, jajaran Mu s p i d a, S K P D, k e t u a Kadin Kalbar, sejumlah pengusaha, bahkan mantan Kapolres Ketapang AKBP Badya Wijaya S.Ik juga hadir memenuhi undangan dari panitia. ***

NOSTALGIA : Group Nusantara membawakan lagu dari masa ke masa

RIBUAN warga yang hadir di kompleks pentas seni dan budaya pendopo Bupati Ketapang, benar-benar terhibur. Bukan hanya para undangan yang hadir memadati kompleks “istana rakyat” yang terbuka untuk umum. Tetapi, sejumlah pedagang juga mendapat untung dari aktivitas jual beli. Bupati Ketapang, Drs Henrikus menilai budaya dan seni menjadi salah satu perekat persatuan dan kesatuan. Melalui pentas seni dan budaya, semua etnis dan budaya dapat mengembangkan kreatifitasnya. Dengan seni, semua elemen bersatu. Hal ini terwujud, dimana susunan panitia Imlek Bersama terdiri dari dari berbagai suku bangsa yang ada di Ketapang. Ini menunjukkan keharmonisan yang ada di daerah ini. Dengan persatuan dan keakraban ini, diharapkannya, kondisi Ketapang tetap kondusif sehingga pembangunan di segala bidang dapat berjalan dengan baik. Semoga Ketapang lebih baik lagi dimasa yang akan datang.***

TARIAN : Muda-mudi membawakan Tarian Alam Semesta

MENGHIBUR : Bupati Ketapang Drs Henrikus M.Si dan Ny.Riniwati Henrikus ikut melantunkan lagu kesayangan

MANTAN KAPOLRES : Mantan Kapolres Ketapang, AKBP Badya Wijaya dan investor juga hadir dalam Imlek Bersama di Ketapang

ARTIS IBUKOTA : Verdi Vera tampil untuk kedua kalinya dalam perayaan Imlek di Ketapang

SALAMAN : Artis ibukota, Tina Toon bersalaman dengan Ny.Riniwati Henrikus

ARTIS IBUKOTA: Dorce Gamalama menghibur pengunjung

pontianak bisnis


Pontianak Post

Lokomotif kemajuan ekonomi kalbar

Selasa 12 Maret 2013


Bakrie Tunggak Bayar Obligasi JAKARTA—Perusahaan Grup Bakrie kembali menjadi sorotan. Kali ini, otoritas bursa melakukan penghentian perdagangan sementara (suspensi) terhadap saham PT Bakrieland Development. Bursa Efek Indonesia (BEI) mensuspen saham emiten berkode ELTY tersebut lantaran korporasi menunggak pembayaran pelunasan dan

bunga ke 20 Obligasi I Bakrieland Development tahun 2008 seri B. Hingga perdagangan kemarin (11/3), saham ELTY ditutup di level Rp53. Selama setahun, return perdagangan saham ELTY minus 58,14 persen. Saat ini, kapitalisasi pasar ELTY mencapai Rp2,35 triliun. Sebelumnya, pemeringkat efek PT Pemeringkat

Efek Indonesia (Pefindo) sempat menurunkan peringkat obligasi Bakrieland dari idB menjadi idCCC. Penurunan ini disebabkan oleh meningkatnya kekhawatiran terkait tekanan likuiditas perusahaan untuk melunasi obligasi tersebut. Disebutkan, perseroan baru mengalokasikan dana sebesar Rp160 miliar untuk pelunasan

obligasi. Sementara sisanya Rp120 miliar masih menunggu hasil divestasi asset. Kepala Divisi Perdagangan Saham BEI Andre P. J. Toelle mengatakan seharusnya ELTY membayar pelunasan pokok dan bunga obligasi tersebut pada 11 Maret 2013. Namun, berdasarkan laporan PT Kustodian Sentral Efek Indonesia (KSEI) nomor KSEI-0938/

DIR/0313 tanggal 8 Maret 2013, ELTY sebagai emiten belum memenuhi kewajibannya untuk melunasi utang obligasinya kepada KSEI yang menjadi agen pembayaran sampai dengan 8 Maret 2013. Corporate Secretary ELTY Kurniawati Budiman mengakui pihaknya belum dapat memenuhi pembayaran obligasi I Bakrieland Development

tahun 2008 seri B hingga jatuh tempo. Hal ini lantaran program divestasi yang sedang diupayakan perseroan belum dapat diselesaikan. “Ini (program divestasi) tidak selesai sesuai perkiraan,” jelasnya . Kurniawati menambahkan, ELTY sebenarnya juga menempuh rencana refinancing. Namun, upaya tersebut belum terealisasi karena posisi lever-

age perseroan masih tinggi, sebagai akibat belum selesainya divestasi unit jalan tol yang dimiliki oleh ELTY. “Kami sangat mengupayakan agar dana pelunasan pokok obligasi dan pembayaran bunganya dapat dibayarkan 11 Maret 2013. Namun, kami juga minta waktu selambat-lambatnya bisa dibayarkan pada 14 Maret 2013,” paparnya. (gal/kim)


Asuransi Jualan di Ritel Obat JAKARTA—Sebagai perusahaan yang masih tergolong baru, MNC Life memiliki ambisi untuk mengasuransikan seluruh masyarakat Indonesia terutama dari kalangan ekonomi menengah dan menengah bawah. Caranya dengan menambah jaringan pemasaran dengan mengandeng distributor farmasi, jaringan membayaran mikropay, maupun televisi home shopping. Sehingga pada akhir 2013, perseroan akan memiliki sekitar 1,5 juta nasabah dengan premi baru mencapai Rp300 miliar, naik 200 persen dari posisi akhir 2012. Target ambisius MNC Life tersebut diungkapkan oleh Direktur Utama PT MNC Life Indonesia Patricia Rolla di sela-sela pelucuran Hario Proteksi Dini di Jakarta, Minggu (10/03). “Strategi kami mengembangkan pasar sampai ke pelosok. Melalui penambahan jaringan pemasaran, kami mendekatkan diri dengan seluruh lapisan masyarakat sehingga produk kami makin mudah diiperoleh,” jelas Rolla. Perjalanan industri asuransi tanah air yang lebih dari tiga dekade terakhir ini hanya mampu menjangkau sekitar enam persen dari total populasi 240 juta menjadikan MNC Life mendedikasikan diri menjadi perusahaan asuransi jiwa untuk segmen ekonomi menengah dan menengah bawah Indonesia. Kelas ekonomi yang jumlahnya sangat besar di Indonesia. Apalagi selama ini asuransi indentik hanya untuk segmen nasabah kelas menengah dan menegah atas karena tingginya nilai premi yang harus dibayar. “Kami ingin membuktikan bahwa asuransi itu tidak perlu mahal,” lanjut dia. Komitmen tersebut diawali denga meluncurkan produk Hario Siaga pada tahun lalu. Kini, perseroan bekerja sama dengan jalur distribusi farmasi untuk memasarkan produk asuransi mikro Hario Siaga di 300 ribu outlet ritel obat di seluruh Indonesia. Dengan harga produk Hario Siaga mulai Rp55 ribu, produk asuransi ini diharapkan mampu mengasilkan penjualan lebih dari satu juta voucher dengan total nilai premi Rp55 miliar. “Kami juga mengadeng jaringan jasa pembayaran mikropay Akses yang selama ini melayani top up PLN dan handphone,” kata Rolla. Jumlah jaringan Akses saat ini sekitar 30 ribu titik dengan mayoritas berada di Jateng dan Jabar. MNC Life juga memasarkan produk baru asuransi kesehatan Hario Proteksi Dini melalui MNC Shop Indovision Channel 88. Yang menjadikannya sebagai satu-sarunya produk asuransi yang dipasarkan melalui jaringan TV home shopping di tanah air. Produk asuransi kesehatan yang melindungi diri dari penyakit kritis tersebut diklaim memiliki premi termurah di kelasnya karena nasabah bisa hanya membayar premi Rp5 ribu per hari. Dan nasabah bisa mendapatkan uang pertanggungan saat terdeteksi stadium awal suatu jenis penyakit kritis. “Living benefit asuransi ini bisa digunakan untuk pre and post waranty. Sehingga nasabah yang sudah terdeksi sejak dini penyakit jantung, stroke, gagal ginjal dan kanker bisa menggunakan uang pertamggungan untuk biaya pengobatan,” jelas VP Agency PT MNC Life Indonesia Sanderson The pada kesempatan sama. (aan)

ETIOS VALCO: Mobil terbaru Toyota, Etios Valco, dijual dengan harga di atas Agya dan di bawah Yaris.

Kandungan Lokal Etios 55 Persen


BONSAI: Penjual bonsai, Tono (40), saat merapikan tanamannya yang dipamerkan di Mal Matahari Pontianak, Minggu (10/3). Tanaman yang memiliki filosofi dasar keseimbangan dan harmoni ini memiliki banyak peminat. Harga yang ia tawarkan perpohon berkisar Rp250.000 hingga Rp5.000.000.

Beli Xenia Bawa Pulang Emas PONTIANAK – Demi menyenangkan para konsumennya di tahun 2013 ini, PT Astra Internatiaonal TbkDaihatsu dengan menggelar promo dahsyat yaitu “Daihatsu Puas”. Kepala Cabang Daihatsu Pontianak, Teguh Andriyanto mengatakan, program yang digelar Daihatsu ini merupakan program awal tahun yang diberikan untuk memanjakan konsumen. Setiap pembelian Daihatsu Xenia berkesempatan mendapatkan hadiah utama, yaitu uang tunai Rp1 miliar atau 1,5 kilogram emas. “Daihatsu memberikan kejutan untuk sahabat Daihatsu dengan menggelar promo Daihatsu Puas, bagi customer yang membeli mobil Daihatsu Xenia berkesempatan mendapatkan berbagai hadiah menarik, tak tanggungtanggung Daihatsu memberikan hadiah utama uang tunai Rp1 miliar atau bisa juga pilih 1,5 kilogram emas,” ungkapnya. Daihatsu juga memberikan hadiah lain yang tak kalah puas setiap bulannya yaitu, 22 Samsung LED TV 55, 77 iPhone 5 16Gb, 100 Sasung Galaxy S III 16Gb dan 168 Samsung Galaxy, dan kamera. Khusus bagi pembelian secara kredit melalui leasing ACC untuk 10 pembeli berkesempatan mendapatkan 25 gram emas.


PUAS: Daihatsu menggelar promo Pilih Uang Atau Emas (PUAS) dengan hadiah utama Rp1 miliar atau emas 1,5 kg.

“Ini akan dundi setiap bulan. Jangan sampai ketinggalan dengan program yang kita gelar karena ini merupakan komitmen kita dari Daihatsu sebagai ucapan terimakasih kita terhadap masyarakat,” ujarnya. Program Daihatsu puas juga berlaku untuk produk Daihatsu lainnya, seperti Luxio, Sirion, Minibus, Pick-Up dan lainnya. “Hadiahnya sama dan juga diundi setiap bulan,”

sambung Teguh. Pada bulan Maret ini, Daihatsu menggelar pameran di tiga lokasi berbeda, yaitu di SPBU Jalan Paris 2 dari tanggal 10 Maret-9 April, di Ayani Mega Mall 7-20 Maret, dan di Pontianak Convention Center pada 20-26 Maret. “Even-even ini kami gelar untuk memudahkan informasi tentang produk dan program-program Daihatsu,” katanya. (ars)

JAKARTA—PT Toyota Astra Motor (TAM) segera memfungsikan pabrik baru (plant II) di Karawang, Jawa Barat untuk memproduksi mobil terbarunya, Etios Valco yang menyasar segmen city car. Pabrik itu merupakan bagian dari komitmen investasi Toyota Jepang sebesar Rp13,3 triliun.“Etios ini sudah ada di India, tapi kita tidak ambil dari sana. Kita akan produksi sendiri di pabrik baru kita di Karawang yang dioperasikan PT. Toyota Motor Manufacturing Indonesia (TMMI). Untuk tahap awal local content (kandungan lokal) 55 persen, nantinya kita ingin sampai 80 persen. Itu sudah menjadi komitmen Toyota Jepang,” ujar Presiden Direktur PT Toyota Astra Motor, Johny Dharmawan disela peluncuran Etios Valco kemarin. Toyota Etios Valco merupakan city car yang secara khusus di desain untuk memiliki strong functional value terlengkap di kelasnya dan akan melengkapi product line-up di segmen ini, diantara Toyota Agya dan Toyota Yaris. Hadir dengan tiga pilihan varian yaitu tipe J, E, dan G yang semuanya akan di produksi di Indonesia. “Etios akan diproduksi di pabrik baru dengan mesin-mesin baru yang masih presisi. Tentu hasilnya pun pasti luar biasa,” tandasnya. Mobil terbaru Toyota ini dijual dengan harga di atas Agya dan di bawah Yaris. Semuanya memakai transmisi manual. Johny berdalih mobil bertransimisi manual masih menjadi pilihan masyarakat. “Umumnya pasar manual itu 80 persen matic 20 persen, hanya di Jakarta saja yang matic bergerak cukup pesat. Di Jakarta 5-10 tahun lalu matic masih 30-an persen sekarang mendekati 50 persen,” ungkapnya. Menurut Johny, dirilisnya Etios Valco karena tingginya permintaan pasar di segmen hatchback (sedan tanpa buntut) beberapa tahun belakangan. Hal ini mendorong Toyota untuk meluncurkan produk yang mampu memenuhi kebutuhan masyarakat di segmen tersebut. “Penyuka kendaraan hatchback membutuhkan produk dengan fitur dan spesifikasi yang tinggi. Butuh kendaraan yang nyaman, smooth ketika dikendarai, dan memiliki strong functional values,” katanya.Dalam beberapa tahun terakhir, segmen hatchback city car memperlihatkan peningkatan yang signifikan. Di tahun 2009, total market city car secara nasional mencapai 42.866 unit dan di tahun 2012 lalu total marketnya mencapai 118.244 unit atau meningkat 175,84 persen hanya dalam kurun waktu tiga tahun. “Di bulan pertama pada tahun 2013 ini, segmen hatchback pertumbuhannya tertinggi di antara segmen lain,” tambahnya. Secara nasional mobil hatchback berhasil mencetak penjualan sebanyak 7.470 unit, meningkat 84,9 persen dibanding Januari 2012. Sejalan dengan pertumbuhan yang signifikan di pasar, hatchback Toyota yang diwakili oleh Toyota Yaris pada bulan Februari mengalami pertumbuhan sebesar 28,7 persen dibanding Januari 2012 menjadi 1.529 unit. “Untuk Etios Valco kita target penjualan mencapai 2.000 unit perbulan,” jelasnya (wir)

Partnership RI-Jepang Dikaji Dampak ke Ekspor Kecil JAKARTA—Pelaksanaan kerjasama perekonomian Indonesia dan Jepang atau Indonesia






Japang Economic Partnership Agreement (IJEPA) bakal dikaji. Pasalnya setelah empat tahun berjalan, kerja sama itu tidak menunjukkan dampak ekspor Indonesia ke Jepang. Dirjen Kerjasama Industri Internasional Agus Tjahjana

menjelaskan, saat ini pertumbuhan impor Indonesia dari Jepang terus melesat sejak 2008 lalu. Rata-rata pertumbuhannya per tahun mencapai 25 persen. Sementara itu kinerja neraca perdagangan Indonesia terhadap Jepang justru melemah 6,6 persen per tahun. “Indonesia impor produk bernilai tambah seperti alat berat dan mesin, sedangkan ekspor ke Jepang mayoritas merupakan bahan mentah,” terangnya seusai acara Seminar Evaluasi Mou IJEPA di kantor Kementerian Perindustrian, Jakarta, kemarin. Melihat fakta-fakta itu ia merasa harus ada pembicaraan lebih lanjut demi perbaikan. Tahap awal ia bakal mendiksuikannya dengan Kementerian Perdagangan setelah itu baru bertemu dengan pihak Jepang. Namun ia memastikan, setelah berakhirnya kontrak IJEPA pada Juli nanti, pihaknya bakal memperpanjangnya. “Jepang masih menjadi negara yang harus diperhitungkan dalam perdagangan dunia,” terangnya.Agus menambahkan, ada beberapa faktor yang menyebabkan IJEPA ini masih belum menunjukkan manfaat lebih bagi Indonesia. Misalkan saja ketidaktahuan pengusaha mengenai IJEPA sendiri. (uma/kim)


K ran sekolah


Besok: AK ONTIAN P 9 N A M S

SMA Negeri 4 pontianak

Neli Apriandini; Remaja Berbakat Bidang Tilawah Alquran

Selalu Ditemani Orang Tua Saat Bertanding

Kab. Kubu Raya dalam lomba seni baca Al-Quran, ketika ia masih berdomisili di daerah tersebut. Siswi kelas XII IPA 3 ini juga pernah mewakili SMAN 4 Pontianak menjuarai MTQ antarpelajar SMA se-Kota Pontianak, se-provinsi Kalimantan Barat, dan kemudian mewakili Kalimantan Barat pada tingkat nasional di kota Makasar. Deg-degan, haru, dan beban adalah perasaan yang selalu menyelimuti Neli saat bertanding. “Lawan lawan saya enggak pernah ada yang enteng, hampir semuanya susah

NELI Apriandini, cewek bergigi gingsul dan bertubuh mungil ini memilki bakat yang jarang dimiliki oleh remaja kebanyakan. Neli biasa ia dipanggil memiliki bakat dalam tilawah Al-Quran atau seni baca AlQuran, dan ia sering kali menjuarai ajang MTQ (Musabaqah Tilawatil Quran). Siswi SMAN 4 Pontianak ini pernah mengikuti MTQ mulai dari antarsekolah, kecamatan, kabupaten, dan provinsi. Neli juga pernah mewakili Kota Bekasi dan

Pontianak Post

Selasa 12 Maret 2013

untuk dikalahkan,” ucap Neli sembari tertawa. Putri dari Ibrahim ini tetap berusaha keras walaupun lawan yang dihadapinya berat dan sukar untuk dikalahkan. Cewek kelahiran 13 April 1996 ini selalu giat berlatih setiap hari. “Latihan itu harus rutin dilakukan untuk menjaga stabilitas suara dan agar harkat, tajwid dan nadanya enggak lupa, selain itu makanan juga di jaga jangan sering makan makanan berminyak dan jangan minum es,” tuturnya. Ketika bertanding, dukungan dari keluarga adalah yang paling utama. Maka

tak jarang setiap bertanding Neli selalu ditemani orang tuanya, terutama sang ayah. Menurut Neli, ia sangat senang dan bahagia sekali rasanya bisa membahagiakan orang tua dan mewakili SMAN 4 dalam setiap kompetisi tilawah Alquran apalagi sampai ke tingkat nasional. “Harapan saya kelak akan muncul lagi bibit-bibit pembaca Alquran yang punya bakat lebih hebat dari saya yang akan kembali mengharumkan nama SMAN 4 Pontianak baik itu di lingkungan Kota Pontianak sampai tingkat nasional. Amin.” Semoga! (*)

30 Menit untuk Kegiatan Keagamaan



Merebaknya isu-is u pelanggaran nilai-n ilai moral di kalangan remaja se perti penggunaan narkoba, tawuran pelajar, pornografi, mencari bocoran so al ujian, perjudian dan lain-lain suda h menjadi masalah sosial yang sampa i saat ini belum dapat diatasi secara tuntas.

DAMPAK yang ditimbulkan cukup serius dan tidak dapat dikatakan sebagai persoalan sederhana. Kondisi ini membuat resah guru dan orang tua siswa. Banyak orang yang berpendapat kondisi tersebut bermula dari lingkungan sekolah. Masalah moral yang terjadi pada siswa tidak hanya menjadi tanggung jawab guru agama namun juga menjadi tanggung jawab seluruh warga sekolah. Selain itu, beberapa orang siswa yang kritis dengan melihat tantangan era globalisasi yang serba modern dan kebudayaan yang semakin sulit untuk dipilah tidak hanya akhlak tetapi juga pengetahuan tentang agama yang semakin kurang terpelihara dengan baik. Para remaja menjadi seperti alergi untuk bergabung ke tempat-tempat yang berbasis agama karena pemikiran mereka pengajian-pengajian atau kegiatan rohani lainnya hanya menghabiskan waktu, menjenuhkan dan tidak dikatakan anak gaul. Hal tersebutlah yang menjadi dasar pemikiran pimpinan SMAN 4 Pontianak beserta perangkatnya untuk menjalankan program menyisihan 30 menit waktu sebelum belajar di hari jumat dengan kegiatan

KEGIATAN ROHANI: Siswa SMAN 4 Pontianak menjalankan program menyisihan 30 menit waktu sebelum belajar di hari Jumat dengan kegiatan rohani. Bagi siswa beragama Islam membaca Alquran dan bagi yang Kristiani membaca Alkitab.

rohani. Bagi siswa yang beragama Islam, diarahkan untuk membaca Alquran dan bagi yang kristiani membaca Alkitab. Membaca Alquran bersama merupakan kegiatan yang sangat bermanfaat. “Selain memperlancar cara membaca Alquran, tentunya akan menambah pahala,” ucap Zaky Fajar siswa kelas XI, saat ditemui setelah usai membaca Alquran bersama. Selain itu siswa beragama Katolik dan Kristen bersama-sama membaca Alkitab yang diselingi pere-

Pentingnya Ketakwaan Pada Remaja KETAKWAAN adalah sifat seorang manusia yang selalu patuh pada perintah Allah dan menjauhkan segala larangannya. Dalam kamus besar bahasa Indonesia dijelaskanbahwatakwaadalahterpeliharanyasifat diri untuk tetap taat melaksanakan perintah Allah dan meninggalkan larangannya. Ketakwaan memang mempunyai peranan kuat dalam perilaku remaja karena merupakan pondasi utama yang tebentuk dalam diri mengenai tingkat

Tingkah laku yang terbentuk dari perilaku religius tentunya tingkah laku yang benar, yang sesuai dengan etika. Tingkah laku tersebut di antaranya menciptakan sikap empati, hormat dan kebersamaan. Selain itu siswa akan mulai berpikir positif dan selalu menjaga tingkah laku serta bertutur kata yang sopan. Maka dari itu, alangkah baiknya jika hal ini diterapkan juga di semua sekolah sehingga akan terbentuk generasi-generasi muda yang bermoral, dan beretika baik. (*)

Isi Waktu Istirahat dengan Beribadah

keimanan yang mempengaruhi prilaku, dan pergaulan remaja. Namun realita sesungguhnya pergaulan remaja dewasa ini sudah pada tingkat yang mengkhawatirkan. Karena sudah mengarah padahalhal yang negatif seperti free sex , narkoba dan tawuran yang mencerminkan sangat minimnya ketakwaan pada remaja. Berikut pendapat sejumlah siswa SMAN 4 Pontianak mengenai pentingnya ketakwaan pada remaja.

Ketakwaan merupakan bentuk wujud yang dibuktikan dengan menjalankan perintah Allah, ketakwaan sangatlah penting untuk kehidupan kita yang sedang mencicipi asam asin dan manisnya hidup. Jika kita tidak memiliki ketakwaan dan iman yang kuat saat bergaul kita akan goyah dengan prinsip yang telah dituturkan pada peraturan agama Islam, yang mana kita ketahui sekarang pergaulan SMA sekarang sangatlah luas dan bukan hal yang tidak tabu lagi jika ada sisi negatif di dalamnya.”

Riski Aprilian + Belakangan ini kita sering mendengar berita-berita tentang banyaknya akhlak-akhlak para remaja yang rusak. Seperti tawuran antarpelajar dan penggunaan narkoba. Semua itu karena sebagian besar remaja khususnya kaum pelajar memandang keberadaan ahlak dengan sebelah mata. Padahal dengan ahlak baik yang telah terpatri dalam diri remaja merupakan kunci utama yang akan selalu membawa nilai positif dalam hari-hari remaja itu sendiri. “

Meiry Dintia Arini

“Kita sebagai remaja tidak boleh hanya mementingkan kebebasan berekspresi sehingga mengabaikan nilai-nilai ketakwaan. Akan lebih baik lagi jika remaja yang selalu menanamkan nilai ketakwaan dalam hari harinya.”

Iip Alqadrie Redaksi Koran Sekolah

Reporter: Nora Indah Meilina, Meiry Dintia Arini Ain Risqi Faiqa, Adelia Tania Sari, Sy. M. Nur Taufik Alkadrie, Riski Apriliani, Lana Hendilina, Laily Luthfiana Diah, Della Hartini Putri Kartunis: Fahli Arfimas Fotografer: Aditya Weldianto Redaktur: Ai Marhayanti, S.Pd. Rita Arnmingsih, S.Pd. cmyk

nungan yang dipimpin guru agamanya. Maria Claudia siswa kelas XI berpendapat bahwa kegiatan ini sangat bermanfaat karena dapat lebih memahami makna dari Injil Alkitab dan lebih memahami agama. Pembiasaan kegiatan berbau religi di sekolah akan menciptakan siswa yang religius pula. Jika siswa sudah terbiasa hidup dalam lingkungan yang penuh dengan kebiasaan religius, maka kebiasaan-kebiasaan itu pun akan melekat dalam diri orang tersebut dan dapat diterapkan di mana pun mereka berada.

Jadi, para remaja khususnyakaumpelajarharusselalu mencerminkan nilai-nilai ketakwaan dalam kehidupan sehari-hari kita. Kebebasan berekspresi di era modern ini jangan sekali-sekali kita salah gunakan dengan meninggalkan nilai-nilai ketakwaan pada setiap perilaku dan kegiatan yang kita lakukan. Dengan kegiatan yang menjunjung tinggi nilai ketakwaan seperti selalu mendekatkan diri pada Allah SWT, bertanggungjawab,dan berhati-hati dalam bertindak mari kita tanamkan kembali inilai nilai ketakwaan dalam diri kita. ( *)

SALAT BERJAMAAH: Murid SMAN 4 Pontianak melaksanakan salat di musala secara berjamaah.

ISTIRAHAT adalah waktu dimana setiap orang merelaksasikan tubuh dan pikiran mereka dari hal-hal yang telah menyebabkan rasa penat. Waktu istirahat disekolah tentu adalah saat yang paling ditunggu-tunggu oleh para siswa. Mereka bisa memulihkan pikiran mereka yang telah dikuras pada saat jam belajar dengan mengisi perut, makan di kantin sekolah atau sekadar bermain dan berbincang-bincang dengan teman mereka. RASA lelah tentunya juga dapat di pulihkan dengan salah satu cara lainnya, yaitu beribadah. Itu lah yang terlihat dari keseharian sebagian besar siswa-siswi di SMAN 4 pontianak. Mereka tentu mendapatkan kepuasan rohani ketika mereka lebih mendekatkan diri kepada Tuhan. Setiap hari di jam istirahat sekolah murid-murid yang beragama muslim biasanya berbondong-bondong pergi ke musala yang Cartoon terletak di lingkungan sekolah untuk melaksanakan salat zuhur berjamaah. Disetiap jam istirahat baik istirahat pertama pukul 10.00 atau istirahat kedua pukul 12.00 WIB, selalu terlihat para murid yang melaksanakan ibadah salat. Di jam istirahat pertama biasanya mereka melaksanakan salat duha, dan di istirahat kedua tentu musala lebih dipadati lagi dengan murid dan guru yang biasanya melaksanakan Salat berjamaah di sana. Rutinitas tersebut tentunya bukanlah merupakan instruksi atau paksaan dari guru, namun memang keikhlasan dan kesadaran dari diri mereka sendiri. Memang di tahun ajaran baru, saat melakukan masa perkenalan sekolah, siswa awalnya dibimbing untuk melakukan kegiatan seperti mengajidisetiapminggu,atausalatberjamaah disekolah. Namun, setelah dilaksanakan bersama sekitar satu minggu, kebiasaan tersebut telah meningkatkan kesadaran mereka sendiri. Di minggu-minggu berikutnya, tanpa diberi instruksimerekamelakukanberbagaikegiatan tersebut dengan kesadaran sendiri. Selain itu, untuk menambah pengetahuan dan wawasan seputar keagamaan juga dibentuk ekskul ROHIS dan ROKRIS untuk para siswa, dan diadakan juga kegiatan mendengarkan ceramah di setiap Jumat untuk guru-guru di SMAN 4. Setiap hari-hari besar keagamaan biasanya juga tetap diperingati tentunya untuk menambahkan pengetahuan dan pendalaman keagamaan contohnya kegiatan Maulid Nabi Muhammad S.A.W. Kegiatan-kegiatan keagamaan tersebut tentunya sangat berdampak positif bagi siswasiswi. Salah satunya adalah meningkatkan C




keimanan siswa-siswi tersebut yang pastinya akan menumbuhkan sikap-sikap yang baik seperti berbuat jujur, solidaritas antar teman, sopan santun terhadap guru dan masih banyak lagi. Sikap yang telah dimiliki siswa-siswi tersebut juga akan memunculkan peningkatan baik dibidang akademis maupun dibidang nonakademis. (*)


Pontianak Post


Selasa 12 Maret 2013




07.00 07.30 09.30 11.00 12.00 12.30 19.00 20.00 21.00

Berqah (bersame Qur’an Hadist) Pontianak Pagi Mata Hati BBM (Berita Berita Musik) Berite Kite Siang Dialog Siang Berite Kite Malam Dangdut Orchestra King Of Dynasty Han

Berita-berita terkini yang terjadi di Pontianak dan sekitarnya disajikan secara mendalam, cerdas dan akurat.


07.30 Perempuan Hebat 09.00 KLIK! 11.00 New Friends 11.30 Topik Siang 13.00 Seleb Tolong Dong 14.30 Panda Fanfare aka Kungfu Panda 15.30 Curious George 19.30 Catatan Si Olga 21.30 Mel”s Update

06.00 08.00 11.30 13.30 18.00 19.00

The Tuxedo Pasokan air di AS terancam. Sekelompok teroris berusaha meracuni dengan bakteri. Aksi itu berusaha digagalkan seorang agen bertuksedo yang membuatnya jadi berkemampuan lebih. (*)

06.00 Was Was 07.00 SL SCTV Musik Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi


Terbebani Disamakan dengan Rihanna Citra Skolastika selalu dikait-kaitkan dengan Rihanna. Bukan sekadar meniru penampilan, jebolan Indonesian Idol 2010 itu pun dianggap meniru gaya bermusik, bahkan lagu Rihanna untuk single terbarunya. ACHMAD SUKARNO HAMID , Jakarta NAMA Citra Skolastika mulai dikenal saat menjadi Runner up Indonesian Idol 2010. Bukan hanya popularitas, pemilik nama lengkap Skolastika Citra Kirana itu mendapat banyak ilmu selama mengikuti karantina ajang pencarian bakat menyanyi itu. Ilmu yang kini menjadi bekalnya berkecimpung di industri musik tanah air. ”Banyak banget yang saya dapat di sana. Mungkin, tanpa Indonesian Idol saya tidak akan bisa seperti ini,” ujarnya saat ditemui di Epicentrum XXI, Kuningan, Jakarta Selatan. Saat ini, sudah lima single yang dirilis perempuan kelahiran Jogjakarta, 5 Juni 1993 itu. Everybody Knew (2011), Pasti Bisa (2011), Galau Galau Galau (2012), Sampaikan (2012), dan yang terbaru, Berlian. Lagu itu menjadi soundtrack film Berlian Si Etty yang dibintangi Fitri Tropica dan Yogi Finanda. Di beberapa radio, lagu itu masuk dalam deretan teratas tangga lagu. ”Saya sendiri nggak percaya. Tetapi setelah disurvei, memang benar lagunya laris di-request pendengar di radio,” tuturnya. Lagu itu, kata dia, sempat bersaing ketat dengan lagu milik Rihanna bertajuk Diamond. Itu semakin menguatkan kesan kalau dia sulit dipisahkan dari sosok penyanyi asal Saint Michael, Barbados itu. Selama ini, dia sering disebut-sebut meniru pelantun lagu Umbrella itu, mulai gaya bernyanyi hingga gaya rambut. ”Saya nggak tahu kenapa saya dihubungkan dengan penyanyi itu. Style dan image saya sekarang memang seperti ini,” ucapnya. Meski menampik meniru gaya Rihanna, Citra mengaku senang bisa disebut mirip dengannya. Namun, belakangan dia justru merasa terbebani karena selalu dibanding-bandingkan. Padahal, ada hal-hal yang terjadi di luar perkiraannya. ”Waktu saya mengecat merah rambut, ternyata sama dengan Rihanna. Awalnya sih saya nggak pengen pusing mikirin, tetapi semakin lama makin terbebani juga,” ungkapnya. Penyanyi jazz itu menegaskan kalau bukan Rihanna yang menjadi inspirasinya dalam bermusik atau berbusana. Apa yang ditampilkannya, merupakan murni gayanya sebagai Citra Skolastika. ”Saya nggak pengen dibilang Rihanna Wannabe. Sepopuler apa pun dia, yang pasti saya nggak pengen disama-samain dengan orang lain,” katanya. Namun, sepertinya dia masih sulit lepas dari bayang-bayang Rihanna. Selain kini memotong pendek rambutnya seperti Rihanna, dia pun menyanyikan lagu dengan judul sama. Rihanna punya lagu Diamonds, sementara dirinya mengusung Berlian yang merupakan bahasa Indonesia-nya, diamond. Lagu jazz itu dikemas dalam balutan musik klasik untuk menggandeng pendengar yang lebih luas. ”Alasan kenapa judul lagunya Berlian sangat simpel, karena filmnya berjudul Berlian. Seandainya judul filmnya mutiara, ya saya pasti nyanyi lagu berjudul mutiara. Jadi, nggak ada niat nyamain lagu Rihanna,” tegasnya. (*)


MIRIP RIHANNA: Mulai gaya bernyanyi hingga gaya rambut, Citra selalu dibanding-bandingkan dengan Rihanna.

TVONE 06.30 09.00 10.00 11.30 13.30

Kabar Arena Pagi Aku Bangga Coffee Break Kabar Siang Quick Count Pilgub Sulsel (Live) 17.30 Kabar Petang 19.30 Indonesia Lawyer’s Club

Disney Club Serial Pilihan Lintas Siang I Drama Somad Tendangan Si Madun Season 3 21.00 Panggil Gue Haji 23.00 Intermezzo



PON TV, Pukul 19.00 WIB

Berite Kite Malam


12.00 SL Liputan 6 Siang 12.30 SCTV FTV Siang 18.00 Si Biang Kerok Cilik 21.00 FTV Spesial Valentine

08.05 8 Eleven Show 11.30 Metro Siang 13.05 Wideshot 19.05 Suara Anda

20.30 Bicara Konstitusi 21.05 Top Nine News 22.30 Lirik Komedi

Trans TV Pukul 20.00 WIB

Indosiar pukul 22.00 WIB

Shanghai Bund Gara-gara ikut berdemonstrasi, nasib pemuda bernama Xu Wenqiang berubah. Selain dikeluarkan dari universitasnya, dia harus berpisah dari kekasihnya, Fang Yanyun. (*)

Adam Lambert Bikin Minder JAKARTA—Penyanyi jebolan American Idol (AI) season 8, Adam Lambert, 31, menggelar konser di Skenoo Hall, Gandaria City, Minggu malam (10/3). Venue konser malam itu tidak terlalu disesaki penonton. Namun, hal tersebut tidak memengaruhi Lambert. Dia tetap berusaha maksimal membuat venue menjadi panas. Aksi panggung dan suaranya selama menyanyikan 19 lagu bikin penonton bergoyang. Itu bukanlah penampilan pertama Lambert di Indonesia. Akhir tahun lalu, pemilik album For Your Entertaining dan Trespassing tersebut menyanyi pada malam pergantian tahun di Bali. Konser di Skenoo Hall itu dibuka dengan lagu If I Had You. Lalu, Naked Love, Cuckoo, dan Ncoe bergulir. Lambert pun mengajak seluruh penonton malam itu untuk bersenang-senang. “Kalian semua masih muda. Ayolah, kita bersenang-senang malam ini,” ujarnya. Sepanjang konser yang dipromotori Big Daddy itu, Lambert menunjukkan kemampuannya. Nada-nada tinggi dilahapnya. Hal itu membuat penonton semakin jejeritan. Dia memberikan penampilan komplet. Tidak hanya kualitas suara, tapi juga visual panggung. Panggung didukung sinar yang ditembakkan ke berbagai arah.

Lambert sangat fashionable. Tampil dua jam, dia ganti kostum sekitar empat kali. Dia juga ditemani penari latar yang tak kalah menarik perhatian. Dua pria berperut six pack menari dengan gerakan gemulai. Sesekali mereka menempel ke Lambert sambil melakukan aksi menggoda. Konser itu ditutup dengan single Trespassing. Anji, penyanyi dan musisi Indonesia yang ikut nonton konser itu, pun memberikan pujian. “Saya berasa dipecut-pecut nontonnya. Suaranya parah, keren abis. Saya cuma geleng-geleng kepala sambil megangin tembok,” ungkap Anji lalu tertawa mengomentari konser Lambert. Dia kagum pada performance sang artis. Lengkingan Lambert memang prima, tidak ada nada yang meleset. Melihat itu, Anji pun merasa belum menjadi apaapa. “Lihat dia jadi mikir. Yuk, yuk, latihan lagi yuk,” kata Anji yang malam itu nonton bersama teman-teman bandnya. (jan/c5/ ayi)

Dua Jam Tampil Maksimal

TAMPIL MAKSIMAL: Adam Lambert, runner up American Idol 2009, saat menghibur penonton dalam konser bertajuk ‘For Your Entertainment’ di Skenoo Exhibition Hall Gandaria City, Jakarta, Minggu malam (10/3). ANGGER BONDAN/JAWA POS

Kiprah Abdee Negara ‘Slank’ sebagai Produser Musik

Garap Album Band Baru hingga Agnes Monica Bukan hanya Ridho, Abdee Negara pun memanfaatkan waktunya di luar aktivitas bersama Slank untuk mengembangkan karir bermusiknya. Mulai menciptakan lagu hingga menjadi produser musik. ACHMAD SUKARNO HAMID, Jakarta BUKANhanyadikenalsebagaigitaris dan penulis lagu, Abdee Negara ternyata produser musik yang cukup andal. Pria kelahiran Donggala, Sulawesi Tengah, 28 Juni 1968 itu memproduseri band rock Seurieus dalam menggarap album Rocker Juga Manusia. Selain itu, dia menjadi produser untuk album kompilasi A Mild Live Jakarta Music Festival. Dua-duanya, cukup sukses di pasaran. Seakan ingin mengulangi kesuksesannya, dia menggandeng The Painkillers sebagai ‘anak’ barunya. Bukan hanya musik, dari segi personel pun band itu sangat berwarna. Feyda merupakan keturunan Amerika Serikat, Maeda berdarah Arab, Sean Reno keturunan Tionghoa dan Aria asli Indonesia. ”Sebenarnya project menjadi produser sudah lama. Kalau nggak salah tahun 2000 itu aku produseri Seurieus Band,” ungkapnya. Sebagaiproduser,diaberhakmenentukan lagu-lagu yang dibawakan band itu. Tak terkecuali menyodorkan lagu ciptaannya. Namun, dia pun tidak mau egois. Menyumbang satu lagu, dirasanya sudah cukup. Dia memberikan mereka lagu bertajuk Teriak. ”Bagi saya mereka sangat istimewa, karena warna musik mereka bisa membangkitkan musik rock tanah air,” tuturnya. Seakan ingin benar-benar memastikan kalau band asuhannya diterima di industri musik tanah air, Abdee

melibatkan diri dalam lagu tersebut. Selain mencipta, dia ikut bernyanyi dan bermain gitar. Dan tentu saja, dia ikut muncul di video klipnya. ”Saya juga main di video klip dan turut dalam menggarap album ini,” terangnya. Menurutnya, memproduseri band baru merupakan bentuk kepeduliannya terhadap industri musik Indonesia. Sebab, regenerasi tidak akan bisa dihindari. ”Mereka ini adalah generasi penerus, dan selayaknyakamisebagaipenyanyi yang lebih dulu lahir harus memberikan kesempatan kepada mereka untuk berkarya,” imbuhnya. ”Saya ingin The Painkillers menjadi band rock dengan cita rasa masa kini yang easy listening, agar mudah diterima oleh masyarakat luas,” sambungnya. Abdee menambahkan, ber-

sama beberapa produser lain, dia pun pernah keroyokan memproduksi album dewasa pertama Agnes Monica dan Marshanda. Dia kebagian menggarap satu lagu. Sementara untuk kolaborasi dengan penyanyi atau band lain pun, sudah bukan hal asing baginya. Dia pernah tampil bersama The Brandals di lagu Mesin Kota dan satu lagu lagi bersama Sherina Munaf. Meski sangat menikmati perannya sebagai produser dan pencipta lagu, dia mengaku tetap menomorsatukan Slank, band yang membesarkan namanya. Sesuai kesepakatan, setiap personel Slank boleh punya kegiatan lain asal tidak mengganggu jadwal Slank. ”Slank tetap nomor satu. Dan semua ini tidak mengganggu aktivitas di Slank,” tegasnya (*)


ANAK BARU: Personil The Painkillers yang diproduseri Abdee.

SUKSES: Abdee Negara (kiri) bersama personil Slank lainnya.








Pontianak Post Selasa 12 Maret 2013

Perayaan Nyepi Umat Hindu

Ogoh-ogoh ; Usir Roh Jahat Bebas Mara Bahaya Sesuai dengan hakikat Nyepi, umat diharapkan bisa memaknainya, sehingga secara perlahan ada perubahan dalam diri masing-masing, terutama dalam pengendalian diri sendiri dan ikut mengendalikan keluarga. Hakikat itu pula yang diharap dapat dimaknai oleh umat Hindu di Kalimantan Barat WAHYU ISMIR, Pontianak


SEBANYAK kurang lebih 23 ribu umat Hindu Kalbar akan merayakannya serentak hari ini (12/3). Ketua Parisada Hindu Dharma Indonesia, Putu Dupa Bandem, mengatakan umat Hindu yang ada di Pontianak, dan sekitarnya biasanya merayakan Nyepi dan dipusatkan di Pura Giripati Mulawarman Jalan Adisucipto. Sedangkan untuk umat Hindu lainnya yang tersebar di seluruh Kalbar, akan melaksanakannya di tempat ibadah di daerahnya masing-masing. Dia mengatakan, perayaan Nyepi kali ini tidak berbeda dengan perayaan sebelumnya. Dimana satu hari sebelumnya, Senin (11/3) kemarin dilaksanakan persiapan di Pura serta pengarakan Ogoh-ogoh di sepanjang jalan sekitar Pura. “Ogoh-ogoh merupakan replika mahluk raksasa, sebagai salah satu rangkaian perayaan Nyepi, kita laksanakan juga di Pontianak. Meskipun jaraknya tidak jauh, hanya sampai perempatan jembatan Kapuas II saja,” ungkap dia. Pengertian dari pawai Ogoh-ogoh sendiri, kata dia, untuk mengusir roh jahat sehingga besoknya ketika Nyepi tidak ada roh jahat di bumi,sehingga umat Hindu dapat melaksanakan hari Nyepi dengan baik dan tanpa gangguan dari pengaruh yang tidak baik yang

diakibatkan oleh roh jahat. “Ogoh-ogoh begitu masyarakat biasa menyebut boneka raksasa ini. Dia merupakan simbolis dari raksasa jahat berbadan besar dengan rupa menyeramkan. Sebenarnya, ogohogoh punya satu fungsi pokok yaitu mengusir roh jahat di lingkungannya. Dengan demikian alam semesta akan terbebas dari segala mara bahaya,” ucap Dupa. Usai mengarak Ogoh-ogoh, dilanjutkan dengan tawur kasanga yang merupakan upacara menyambut tahun baru saka yang baru. Disamping itu, dilaksanakan pula puasa selama 24 jam mulai matahari terbit pada pada hari ini, hingga matahari terbit pada Rabu (13/3). Selain itu, pada hari ini pula masyarakat Hindu melaksanakan Catur Brata Panyepian, dimana Merupakan empat pantangan yang harus dijalankan saat melaksanakan hari Nyepi, yaitu Brata Amati Geni sendiri berarti tidak menyalakan api, dimana secara fisik memang tidak menyalakan api atau lampu, namun secara rohani api yang dimaksudkan disiniadalahsifat-sifatkodratmanusia, seperti amarah dan hawa nafsu. Brata Amati Lelanguan yaitu tidak boleh melaksanakan kegiatan yang berfoya-foya atau bersenang-senang. Hiburan selain membantu untuk menghilangkan kejenuhan secara tidak sadar akan membuat menjadi


PERSIAPAN NYEPI : Ketua Parisada Hindu Dharma Indonesia, Putu Dupa Bandem, saat melakukan persiapan upacara dalam perayaan Nyepi tahun saka 1935 di Pura Giripati Mulawarman Jalan Adisucipto.

lupa diri dan terjerumus. Brata Amati Lelungan Brata ini dimaksudkan bahwa pada hari Nyepi umat tidak boleh berpergian melainkan harus tetap diam di rumah. Ini untuk melatih pikiran kita agar tidak senantiasa liar tetapi selalu ingat ke

dalam sebagai instropeksi diri, baik perbuatan setahun sebelumnya maupun perencanaan satu tahun ke depan. Brata Amati Karya dimaksudkan umat tidak boleh melakukan pekerjaan, namun bukan berarti sama sekali

tidak berkegiatan namun pengendalian pikiran. “Sesuai dengan hakikat Nyepi, umat diharapkan bisa memaknainya, sehingga secara perlahan ada perubahan dalam diri masing-masing, terutama dalam pengendalian diri sendiri

danikutmengendalikankeluarga,agar tidak ribut di hari H-nya. Tidak saja saat Nyepi tetapi berkelanjutan. Oleh karena itu, ritual Nyepi mesti dijadikan tonggak untuk merefleksi, introspeksi dan mawas diri agar ke depan bisa lebih berkualitas,” pungkas.(*)

Dengan Kebersamaan Tingkatkan Persaudaraan

Putu Dupa Bandem

KEBERSAMAAN dan persaudaraan menjadi tema Nyepi tahun ini. Menurut Ketua Parisada Hindu Dharma Indonesia, Putu Dupa Bandem, kondisi Indonesia saat ini sangat rentan terjadi perpecahan, dikarenakan hal sepele. “Kita dapat lihat tayangan di televisi, yang mencerminkan bahwa kita tidak bersaudara. Sedikit saja permasalahan diselesaikan dengan keributan. Jadi makna dengan kebersamaan kita tingkatkan persaudaraan diharapkan mengetuk hati masyarakat bahwa kita bersaudara,” tukasnya. Dupa mengatakan, saat ini masyarakat

lebih mengedepankan perbedaan, termasuk diantaranya perbedaan keyakinan maupun agama. Padahal perbedaan keyakinan merupakan urusan individu umat manusia dengan tuhannya. Sedangkan perbedaan merupakan keragaman yang dapat membawa umat manusia kepada perdamaian. “Untuk perbedaan keyakinan, itu urusan lain karena itu urusan masing-masing manusia dengan tuhannya. Jadi mulai sekarang pertikaian dan perselisihan kita tutup, karena Indonsesia adalah satu bangsa yang mengedepankan persatuan, sesuai empat pilar kebangsaan,” katanya.


Di sisi lain, lanjut dia, perbedaan tersebut seharusnya menjadi suatu kekuatan. Karena dengan keragaman tersebut, maka rakyat Indonesia dapat saling mengenal lebih dalam antar satu dengan lainnya. “Bukannya malah menjadi alasan untuk pertikaian. Jadi kami berharap keberagaman menjadi landasan persatuan dan kesatuan bangsa Indonesia. Jadi makna Nyepi yahun ini sangat mendalam, dan saya harapkan umat Hindu pada khususnya dan masyarakat Indonesia pada umumnya dapat melaksanakannya dalam kehidupan sehari-hari,” tutur Dupa. Dupa mengimbau agar masyarakat

selalu semangat membangun intern kerukunan yang menjadi kebersamaan dalam kehidupan bermasyarakat dan berbangsa. Pandangan sempit, eksklusif dan menganggap pihak lain sebagai ancaman kiranya bisa dihilangkan. “Kita dituntun untuk terus meningkatkan berbuat kebajikan, agar senantiasa terbangun sikap dan tindakan yang mulia. Insya Allah bila hal ini telah mewarnai kehidupan setiap umat beragama, keselamatan, keamanan, kedamaian dan ketentraman akan terwujud dan dirasakan oleh semua umat manusia khususnya di Kalimantan Barat,” pungkas Dupa. (wah)


C cmyk




Pontianak Post


Selasa 12 Maret 2013

Tak Semua Mau Aklamasi Sambungan dari halaman 1

Saan buru-buru menambahkan, PD tidak kekurangan kader untuk didongkrak menjadi ketua umum. Dari internal, ada Mirwan Amir yang juga pendiri sekaligus ketua DPD PD Aceh. Ada juga tokoh yang punya pengalaman seperti Wakil Ketua Dewan Pembina Marzuki Alie, Sekjen DPP PD Edhie Baskoro Yudhoyono, dan Direktur Eksekutif PD Totok Riyanto. Dari kalangan eksternal, lanjut Saan, ada sejumlah alternatif nama. Misalnya, KSAD Jenderal Pramono Edhie Wibowo dan Menko Polhukam Djoko Suyanto. ”Nama-nama mereka cukup memadai,” ujarnya. Menurut dia, tokoh eksternal dimungkinkan karena PD tidak mengenal dikotomi. Saan berharap agar KLB berjalan secara terbuka. Tidak perlu ada pemaksaan agar berakhir dengan aklamasi. ”Bagian dari pemungutan suara. Peserta punya aspirasi yang beda-beda. Jadi, ya bergantung DPD dan DPC,” tegasnya. Sampai sekarang, imbuh Saan, belum ada satu pun figur yang mendominasi dukungan dari DPC-DPC. Sebelumnya Sekretaris Majelis Tinggi Jero Wacik menyampaikan telah diberi tugas oleh Ketua Majelis Tinggi Susilo Bambang Yudhoyono (SBY) untuk mempersiapkan KLB. SBY meminta KLB digelar sebelum 9 April. Dalam jadwal tahap pemilu yang disusun Komisi Pemilihan Umum (KPU), 9–15 April merupakan rentang waktu bagi parpol untuk menyerahkan daftar caleg sementara (DCS). Menurut Saan, digelarnya KLB merupakan pilihan rasional untuk mengakhiri polemik. ”Kalau Plt (pelaksana tugas ketua umum, Red) masih menimbulkan persoalan,” kata Saan. Dia menambahkan, KLB

Menristek Realisasikan KIM

sangat mungkin akan diadakan pada 20 Maret. ”Untuk lokasi masih tentatif (belum pasti, Red) di Bali,” ujar Saan. Wasekjen DPP PD Ramadhan Pohan menilai, dalam pemilihan sosok ketua umum baru nanti, memang tidak perlu muncul dikotomi antara kader internal dan eksternal. ”Saya ingin yang mimpin Partai Demokrat fokus sebagai Ketum, nggak ngurus yang lain-lain,” ujarnya. Ramadhan menilai Marzuki adalah calon yang bagus dengan kepemimpinan yang tegas. Namun, Marzuki harus fokus dengan tugasnya sebagai ketua DPR. ”Ketua DPR tugasnya berat. Kalau beliau Ketum, pasti akan keteteran,” ujarnya. Meski begitu, secara pribadi, Ramadhan lebih menjagokan kandidat eksternal. Dia memilih Pramono Edhie Wibowo sebagai Ketum baru PD. Pramono, menurut Ramadhan, komunikatif, konstitusionalis, dan sudah terbukti loyal kepada bangsa dan negara. ”Kriteria Pramono pasti pas dengan realitas Partai Demokrat. Kader, fungsionaris PD di pusat dan daerah pasti lega dan respek,” ujarnya. Ramadhan yakin, dengan sosok Pramono, gejolak internal di PD sangat mungkin akan nyaris hilang. ”Bagi Partai Demokrat, ini jalan cepat memulihkan harapan publik,” ujarnya. Selain Pramono, Ramadhan mendukung Menteri Perdagangan Gita Wirjawan sebagai calon Ketum PD. Gita dalam pandangannya adalah tokoh yang bersih, merakyat, egaliter, dan tidak aneh-aneh. Calon eksternal lain yang didorong Ramadhan adalah Menteri Dalam Negeri Gamawan Fauzi dan Mahfud MD. ”Saya kira, nama-nama di atas pasti sangat direspons pasar karena sesuai dengan selera publik,” ujarnya. Anggota Komisi III dari Fraksi PD Ruhut Sitompul juga menu-

tup semua opsi calon Ketum dari internal. ”PD kini tengah berada dalam situasi yang luar biasa. Karena itu, Ketum yang baru juga harus orang yang luar biasa. Dari dalam tidak ada yang luar biasa. Di dalam yang luar biasa hanya satu, yaitu SBY,” ucap Ruhut. Menurut dia, ada dua tokoh eksternal yang bisa didapuk sebagai ketua umum PD. Yakni, Pramono Edhie dan Djoko Suyanto. Apa pun yang nanti diusulkan majelis tinggi, Ruhut menegaskan, seluruh kader harus mematuhinya. Anggota Dewan Pembina Hayono Isman yang sebelumnya menjagokan Marzuki Alie mengisyaratkan ketidakcocokannya dengan opsi Ketum dari tokoh eksternal. Dia menegaskan, untuk menjadi Ketum PD, seseorang tak cukup hanya bermodal kartu tanda anggota (KTA). Calon Ketum itu, lanjut dia, harus sudah mengikuti program pelatihan kader dan pelatihan kepemimpinan PD. ”Kami tidak ingin PD hanya dipakai yang bersangkutan untuk menjadi capres. Memimpin partai harus dengan cinta dan hati. Jangan sampai memimpin partai dengan ambisi pribadi menjadi capres atau cawapres. Kalau itu terjadi, partai ini akan bodoh,” tegasnya. Hayono juga kurang sependapat dengan opsi aklamasi yang dipaksakan. ”Serahkan pada kongres. Kongres cukup dewasa. Kalau satu orang, tidak ada pemilihan (pemungutan suara). Kalau dua orang, tentu harus ada pemilihan,” ucap Hayono. Anggota Komisi XI Fraksi Partai Demokrat Achsanul Qosasi secara terbuka mendukung pencalonan Wakil Ketua Dewan Pembina Partai Demokrat Marzuki Alie. Menurut dia, Marzuki adalah figur yang cocok di tengah kondisi PD yang membutuhkan konsolidasi. ”Jika PD mau recovery, Pak Mar-

zuki adalah yang paling pantas. Pak Marzuki itu sosok yang paling mudah diterima DPC dan DPD,” ujar Achsanul. Menurut mantan wakil ketua komisi XI itu, kongres PD di Bandung menjadi fakta. Dengan bermodal semangat dan kerja keras saat menjadi Sekjen, Marzuki didukung banyak kader. ”Suaranya hanya terpaut puluhan suara dengan Mas AU (Anas Urbaningrum, Red),” ujarnya. Achsanul meminta kader PD lainnya mengurungkan niat untuk maju. Sebaiknya, di dalam KLB, PD memutuskan aklamasi untuk Marzuki. ”Agar kita bisa langsung fokus pada program kerja dan pemulihan partai dengan kekompakan dan kerja nyata untuk Pemilu 2014,” ujarnya. Di bagian lain, anggota tim lima Partai Demokrat Roy Suryo menegaskan, sangat mungkin KLB bakal dilangsungkan pada paro ketiga Maret ini. Namun, belum ada tanggal yang pasti. ”Insya Allah tidak sampai tanggal 23 (Maret). Tanggal pastinya akan ada. Mohon doa restunya agar internal partai kami bisa diselesaikan,” urainya. Soal bursa calon ketua umum, Roy menekankan, setiap kader memiliki peluang. Dia juga mengakui, banyak nama yang mulai muncul menjelang KLB. Namun, yang jelas, lanjut dia, calon Ketum PD harus kader partai, dibuktikan dengan kepemilikan KTA dan tidak merangkap jabatan. ”Semua kader punya kesempatan yang sama untuk maju, untuk bisa dipilih. Semua kader harus punya kelegaan jiwa untuk tidak dipilih. Kalau orang luar, siapa pun itu harus jadi anggota, dan memiliki KTA. Kalau dia sudah punya KTA, meski mungkin baru kemarin, baru seminggu, tapi yang jelas dia ada KTA. Karena arahan sudah jelas, harus dari dalam, dan tidak rangkap jabatan,” jelasnya. (pri/ bay/ken/c10/nw)

kecantikan. ”Mungkin masih bisa bertambah karena KPK belum menghentikan pengusutan terhadap aset Djoko Susilo,” tutur dia. Tiga SPBU itu berlokasi di kawasan Kapuk, Penjaringan, Jakarta Utara; Jalan Raya Ciawi, Bogor; dan jalan arteri Kaliwungu, Kendal, Jawa Tengah. Namun, dia tidak menyebutkan apakah tiga SPBU itu diatasnamakan Djoko Susilo sendiri atau orang lain. Yang pasti, aset-aset tersebut terkait dengan Djoko. Berapa nilai total seluruh aset

Djoko yang disita KPK? Johan menyatakan belum tahu secara pasti. Diajugamembantahkabarbahwa aset Djoko mencapai Rp 800 miliar atau malah di atas itu. Bantahan serupa keluar saat dia ditanya apakah ada aset yang tersebar di luar negeri. Menurut Johan, sejauh ini KPK hanya menemukan aset Djoko di Indonesia. Sayang, dia tidak memerinci apa saja bentuk 20 aset tersebut. Terutama lima aset lain. Sebab, selama ini KPK sudah menyita 12 rumah plus 3 SPBU. (Lengkap lihat grafis).

Sementara itu, kemarin KPK juga kembali memeriksa Kompol Legimo sebagai saksi untuk Djoko. Mantan anak buah Djoko di Korlantas itu baru keluar dari ruang pemeriksaan pada pukul 20.00. Dia diperiksa sejak siang. Tidak banyak informasi yang dia sampaikan kepada wartawan. Dia hanya menyatakan bahwa dirinya dicecar delapan pertanyaan oleh penyidik. ”Tidak ada,” ucap dia saat ditanya tentang ada tidaknya aliran dana ke DPR. (dim/c11/ nw)

KPK Sita SPBU Sambungan dari halaman 1

giliran tiga stasiun pengisian bahan bakar umum (SPBU) milik tersangka korupsi proyek simulator SIM di Korlantas tersebut yang diungkap. Tidak hanya itu, KPK juga menyita sebuah salon kecantikan yang dikelola istri Djoko serta beberapa bidang tanah lagi. Total, 20 aset Djoko telah disita KPK. Jubir KPK Johan Budi mengatakan bahwa 20 aset yang disita itu beragam. Mulai tanah, tanah dan bangunan, SPBU, hingga salon

Catur Brata Penyepian Tak Terpengaruh Lingkungan Sambungan dari halaman 1

“Ini lah saatnya umat Hindu menahan diri dari berbagai hal bersifat negatif, sehingga Catur Brata Penyepian yang dilaksanakan di rumah, tentunya di lingkungan yang dihuni umat beragama lain, tidak menjadi halangan.

Justru menjadi motivasi untuk beribadah lebih baik,” jelas dia. Selain itu, Putu menghimbau kepada umat Hindu untuk tidak mempermasalahkan lingkungan sekitar terkait pelaksanaan Catur Brata Penyepian di rumahnya. Sebab dalam agama Hindu sendiri selalu dianjurkan untuk men-

jalin hubungan yang baik kepada sesama manusia. Sehingga umat Hindu harus bisa menyesuaikan dengan kondisi lingkungan masing-masing. “Kita tidak bisa samakan dengan di Bali. Karena disana memang didominasi umat yang merayakan Nyepi. Jadi seluruh

transportasi diberhentikan. Beda dengan kita yang berada di luar Bali, termasuk di Kalbar. Jadi kita harus menyesuaikan diri. Tetapi saya yakin masyarakat akan menjaga kondisi yang kondusif sehingga menciptakan harmonisasi antar sesama umat beraga,” tuntasnya.(wah)

Soft Loans untuk Infrastruktur Kalbar Sambungan dari halaman 1

kualitas infrastruktur pada 2012-2013,menyatakan bahwa kualitas infrastruktur Indonesia hanya pada peringkat 92. Nilai itu dipengaruhi kualitas infrastruktur berupa kondisi jalan, rel kereta api, pelabuhan, bandara, dan listrik. Target pertumbuhan ekonomi Kalbar pada 2013 sekitar 6 persen. Kebutuhan dan investasi sebesar 22,51 triliun dengan komposisi investasi swasta sebesar Rp12,38 triliun dalam bentuk penanaman modal dalam negeri Rp6,18 triliun dan penanaman modal asing 687,92 juta dolar AS, sedangkan pemerintah nilainya Rp10,13 triliun. Lambannya investasi yang masuk ke daerah, masih disebabkan oleh masalah “klasik” untuk berinvestasi bukan hanya rendahnya kualitas hard infrastructures seperti jalan, jembatan, pelabuhan, listrik, air, tetapi juga soft infrastructures seperti masih buruknya governance dan ketidakefisien birokrasi, dll. Di Kalimantan Barat, khusus, peningkatan kualitas hard infrastructures disebabkan oleh rendahnya alokasi dana pembangunaninfrasruktur(pembentukan modal tetap) karena dana yang ”terbatas”. Selama ini pembangunan ditopang oleh dana APBD (DAU dan DAK) selain PAD, dimana kenaikan APBD rata-rata selama lima tahun terakhir naik sebesar 17,41 persen. PAD juga mengalami pertumbuhan rata-rata dalam lima tahun terakhir, sebesar 18,91 persen, namun dibandingkan dengan dana perimbangan (penerimaan total daerah), kontribusinya masih sangat kecil. Rata-rata kontribusi PAD terhadap APBD baru mencapai 41,09 persen. Sedangkan rata-rata kontribusi dana perimbangan terhadap APBD dalam 5 tahun sebesar Rp 53,40 persen. Dependency ratio yang tinggi ini

menunjukkan bahwa bahwa Kalbar masih sangat tergantung pada dana pemerintah pusat untuk membiayai pembangunannya. Akan tetapi di era otonomi, sesuai dengan UU No.32/2004 dan UU No.33/2004, untuk menanggulangi kekurangan anggaran dalam rangka pembangunan infrastruktur, pemerintah daerah masih mempunyai strategi lain yaitu dengan melakukan pinjaman daerah. Salah satu jenis pinjaman untuk pembangunan infrasruktur tersebut adalah pinjaman lunak (soft loans). Pinjaman lunak adalah fasilitas pinjaman dengan syarat-syarat pelunasan ringan, tingkat suku bunga rendah dan berjangka waktu panjang. Fasilitas ini diberikan oleh bank pembangunan multilateral dan bilateral untuk pembiayaan proyek pembangunan di negara-negara berkembang. Biasanya pinjaman lunak tersebut berjangka waktu panjang bahkan sampai dengan 50 tahun, selama masa tenggang (grace period) hanya membayar bunga dan biayapelayanan. Suku bunga pinjaman lunak yang ditawarkan Kementrian Keuangan RI pada umumnya di bawah 3 persen, Pinjaman lunak seharusnya digunakan Pemda pada proyek pembangunan yang menjadi prioritas utama dan untuk mengatasi masalah kritis atau mendesak yang dihadapi daerah. Di tingkat provinsi Kalbar, misalnya pembangunan pelabuhan internasional untuk mengangkut komoditas sawit dan pertambangan, pembangunan PLTN untuk penyediaan listrik, pembangunan dan perbaikan irigasi untuk peningkatan produksi pertanian. Demikian pula dengan pembangunan soft infrastructures seperti peningkatan kualitas governance dan birokrasi Pemda, peningkatan infrastruktur sosial, ekonomi, budaya, olah raga dan rekreasi.


Contoh lain pada tingkat kabupaten/kota, misalnya Pemkot Pontianak bisa memanfaatkan pinjaman lunak untuk membiayai sebagian pembangunan Jembatan Kapuas 3 (sebagian yang lain investment sharing dengan Pemprov dan Pempus), pembangunan fly-over, perbaikan drainase untuk mencegah genangan air di kota, penaggulangan sampah kota, dll. Di Kabupaten Sambas, pinjaman lunak bisa dimanfaatkan misalnya untuk pembangunan jembatan dari Senturang-Segarau yang sudah lama didambakan oleh masyarakat Kabupaten Sambas. Akan tetapi, ada berbagai masalah yang dikeluhkan Pemda dan perlu dikaji sebelum melakukan pinjaman seperti besar suku bunga efektif pinjaman karena banyak Pemda yang mengeluhkan suku buga yang diberikan masih relatif tinggi, pembebasan lahan yang memerlukan dana besar, kemampuan mengembalikan hutang dari sumber-sumber PAD. Pusat Investasi Pemerintah (PIP) Kementerian Keuangan dalam hal ini menawarkan kepada Pemerintah Daerah pinjaman lunak dengan bunga 0,00%-7,75% untuk mendukung percepatan pembangunan infrastruktur. Pinjaman tersebut ditujukan untuk proyek-proyek daerah yang dinilai kurang layak dan sangat dibutuhkan masyarakat. Persyaratan Umum Pinjaman Daerah yang ditentukan oleh PIP (, 09/13/2013). Manfaat dari pinjaman bagi Pemda adalah ia dapat meningkatkan governance skills dalam bentuk peningkatan pelayanan birokrasi yang efisien dan mendorong efisiensi dan efektivitas sector ekonomi masyarakat sehingga pada gilirannya akan meningkatkan PAD.

Pemerintah pusat (Kementrian Keuangan) perlu mensosialisasikan secara intensif pinjaman lunak tersebut ke Pemda-Pemda. Misalnya jangka waktu pinjaman, suku bunga efektif, masa tenggang (grace period) dan menciptakan insentif untuk mendorong agar Pemda termotivasi untuk meminjam. Umpamanya, kemungkinan adanya bantuan teknis yang diterima Pemda (technical assistance unit), dan insentif moneter lainnya. Perlu dicatat bahwa lambatnya perkembangan infrastruktur disebabkan juga oleh masalah pembebasan lahan dan kebijakan pembebasan lahan. Pemberlakuan UU No. 2/2012 tentang Pengadaan Tanah Bagi Pembangunan Untuk Kepentingan Umum yang diundangkan pada 14 Januari 2012 dan akan diberlakukan pada tahun 2013 setelah tiga aturan dari amanat Peraturan Presiden (Perpres) No 71 /2012 dapat dirampungkan. Diharapkan UU, Peraturan dan kebijakan tersebut dapat memberikan insentif bagi Pemda dan pihak swasta di Kalbar untuk mempercepat pembangunan infrasruktur di daerah sebagai perwujudan dari public-private partnership. Dengan pembanguan infrastrukturyangterencanadengan baik dan terintegrasi diharapkan Pemda Kalbar mampu mencapai pertumbuhan ekonomi sekitar 6 persen atau lebih tahun 2013, menarik lebih banyak investor asing dan domestic, sembari menjaga stabilitas harga dengan tingkat inflasi yang diharapkan 5,5 persen dan peningkatan IPM yang signifikan sehingga mampu menggeser level IPM ke tingkat yang lebih tinggi dari posisi yang selama beberapa tahun terakhir Kalbar menempati peringkat 27 atau 28 dari 33 provinsi di Indonesia. (Penulis adalah Dosen Fakultas Ekonomi Untan)

Sambungan dari halaman 1

pertama dilakukan langsung Menteri Riset dan Teknologi (Menristek) Gusti Muhammad Hatta. Saat peresmian menristek didampingi Sekda Kalbar M Zeet HamdyAssovie,sertaForkompimda Kabupaten Landak. “Saya memberi aspirasi. Dengan dibangunan dan pengembangan kawasan industri berbasis sumber daya alam lokal di Kabupaten Landak ini. Setahu saya di luar Jawa, baru di Kabupaten Landak ini yang pertama kali mengunakan Mesin Berkas Elektron (MBE). Mudah-mudahan daerah

lain dapat mencontoh dan belajar dari Kabupaten Landak,” ujarnya. Menristek, juga mengharapkan kerjasama antar Pemkab Landak dengan Kemenristek terus dilakukan. Terutama pengembangan industri seperti yang ada di KIM di Kecamatan Mandor ini. “Di bawah naungan Kementrian Ristek dan Teknologi kami ini ada 7 LPMK salah satunya adalah Batan. Banyak hal lagi yang dapat dilakukakan kerjasama yang menyangkut riset dan teknologi,” katanya. Pemprov Kalbar memiliki kebijakan jelas membangun sektor industri. Hal ini untuk mem-

perkuat industri hulu yang sudah dibangun. Selain itu dengan luas wilayah yang besar dan berpenduduk kurang, masyarakat Kalbar sebagian besar adalah sebagai petani karet, sawit, cacao, lada, kopi dan sebagainya. “Pemprov Kalbar sangat konsen untuk mendukung industri hulu yang besar ini kemudian bisa dijadikan nilai tambah. Nilai tambah ini bisa terwujud apa bila industri hulu ini bisa kita ciptakan. Tetapi perlu kita ingat bersama, bahwa persoalan kita ini adalah persoalan SDM,” ujar M. Zeet Hamdy Assovie Sekda Kalbar. (sgg)

Malaysia Klaim Tanduo Dikuasai Sambungan dari halaman 1

97 orang di berbagai wilayah di sekitar Lahad Datu. Mereka dianggap sebagai kaki tangan gerilyawan Sulu. “Saat ini kami terus melakukan siasatan untuk mencari tali barut (antek) peneroboh ini,” ujarnya. Pontianak Post kemarin mendapatkan keterangan dari salah satu saksi mata yang pernah melihat penangkapan itu di restoran Aulia, sebuah restoran utama di jalan Teratai, Lahad Datu. “Saya melihat tiga polis tidak pakai

seragam ada bekuk orang sedang makan,” kata Ikrom, warga Lahad Datu yang sering berada di sekitar restoran. Dia menceritakan, polisi itu hanya memakai celana pendek dan berkaos santai. “Saya duga dia dari CID. Pasal ada pistol dari pinggangnya,” katanya. Penangkapan di Malaysia memang selama ini dikenal sunyi dan senyap. Berbeda dengan di Indonesia, Malaysia punya Special Measures Act 2012 yang memperbolehkan aparat menangkap siapapun, dan warga

negara manapun yang dianggap membahayakan keamanan negara. Di bagian lain, tepat sepekan setelah diliburkan tanggal 4 Maret lalu, kemarin 52 sekolah di Lahad Datu mulai beroperasi. Pantauan koran ini, siswa-siswa tampak antusias diantar orang tuanya. Guruguru mereka mengantar pulang hingga ke depan gerbang sekolah. Iskandar Sholeh, orangtua siswa sekolah kebangsaan Lahad Datu bernama Aisyah mengaku senang sekolah berjalan normal. (rdl)

115 Kardinal Mulai Pilih Paus Baru Sambungan dari halaman 1

Viterbo, Lazio, Italia. Kala itu, gara-gara persaingan politik di antara para kardinal, pemilihan paus memakan waktu 2 tahun 8 bulan. Padahal, saat itu kardinal hanya 15 orang. Umat yang tidak sabar kemudian mengurung para kardinal di ruang terkunci agar tidak terpengaruh dunia luar. Sejak itulah muncul istilah konklaf yang berasal dari kata Latin conclave (dengan kunci) dalam pemilihan paus. Cerobong asap pun telah disiapkan di atas Kapel Sistine. Cerobong tersebut penting karena kesepakatan para kardinal untuk memilih paus baru akan dikabarkan melalui asap. Asap warna hitam bila belum bersepakat dan asap putih jika sudah ada yang terpilih. Di dalam kapel itu juga sudah ada dua perapian. Satu perapian untuk mem-

bakar surat suara para kardinal dan satu lagi untuk mengirimkan kabar kepada publik apakah paus baru telah terpilih atau belum. ’’Jika hari gelap, ada lampu sorot yang akan ditujukan ke arah cerobong asap itu agar tetap bisa dilihat,’’ ujar Frederico Lombardi, juru bicara Vatikan. Setidaknya ada beberapa kandidat kuat yang digadang-gadang menjadi paus. Mereka itu, antara lain, Kardinal Italia Angelo Scola, Kardinal Ghana Peter Turkson, Kardinal Nigeria Francis Arinze, Kardinal Kanada Marc Ouellet, Kardinal Brasil Odilo Scherer, dan Kardinal Meksiko Jose Francisco Robles Ortega. Tradisi berabad-abad itu akan disaksikan langsung oleh umat Katolik dari seluruh dunia dan jemaat yang berkumpul di Lapangan Basilika Santo Petrus, Vatikan. Untuk mengantisipasi kehadiran ratusan ribu jemaat,

Vatikan mulai berkoordinasi dengan pemerintah Italia. Mereka membangun rumah sakit darurat dan mempersiapkan sukarelawan untuk membantu jemaat yang datang. ’’Tidak ada yang bisa memastikan seberapa banyak jemaat yang datang ke Vatikan,’’ ujar Mario Vallorosi, pejabat keamanan di Roma. Saat Paus Benediktus XVI diangkat menjadi pemimpin umat Katolik pada 2005, jemaat yang datang dalam acara pengangkatan mencapai 350 ribu orang. Sekitar 100 ribu di antara mereka berasal dari Jerman, negara asal dari Benediktus. Pihak keamanan di Roma menargetkan 17 Maret sebagai acuan diangkatnya paus baru atau seminggu sebelum perayaan Paskah. Saat ini muncul keinginan paus baru berasal dari Amerika Latin atau Afrika setelah ratusan tahun selalu dari Benua Eropa. (AP/AFP/c4/oki)

Sekilas Tentang Konklav Sambungan dari halaman 1

pemilih akan memulai dengan konklav. Jam 10.00 pagi hari itu dirayakan Misa mulia Pembukaan Konklav di Basilika Santo Petrus, Vatikan, yang disebut dengan istilah “Pro Eligendo Romano Pontifice” (Misa pemilihan Paus Roma) dipimpin oleh Pemimpin Kollegium para Kardinal, yakni Kardinal Angelo Sodano. Perayaan Misa tersebut dihadiri oleh seluruh Kardinal Pemilih dan bukan pemilih, artinya yang sudah berumur di atas 80 tahun sejak sede vacante, dan terbuka

untuk seluruh umat Katolik. Di dalam Misa ini ujud utama yang dikedepankan adalah memohon bantuan Allah Tritunggal agar memberkati upacara konklav dan memohon bantuanNya melalui penerangan Roh Kudus agar para Kardinal Pemilih dapat memilih seorang Paus yang sungguh-sungguh tepat sesuai kehendak Tuhan sendiri. Sore hari, tepat pukul 16.30 para Kardinal pemilih berkumpul di Kapela Paulina di dalam Vatikan, lalu berarak dalam prosesi dan suasana doa menuju Kapela Sixtina, di tengah-tengah ban-

gunan Vatikan, tempat konklav akan berlangsung. Perarakan ini didahului oleh ajuda pemegang Salib dan diikuti oleh rombongan Koor Sixtina yang terdiri dari anak laki-laki dan pria dewasa. Para Kardinal pemilih mengenakan pakaian merah dengan segala perlengkapannya sebagai layaknya menghadiri sebuah peristiwa penting. Selama perarakan, para Serdadu Swiss dan Polisi Italia akan mengawal dan memastikan bahwa tidak ada pihak luar yang berkontak dengan para Kardinal Pemilih atau sebaliknya. (Penulis adalah Biarawan Katolik tinggal di Vatikan)

Kapok Ketemu Napi Brutal Sambungan dari halaman 1

yang tidak pernah ada di dalam bayangannya selama ini. Alona mengaku ngeri bertemu dengan

napi yang brutal. “Cukup sekali dalam hidupku ada di penjara,” tandasnya. Alona divonis bersalah tiga bulan penjara, lebih ringan sebulan dari tuntutan jaksa pe-

nuntut umum yang menuntutnya empat bulan penjara. Alona ditangkap Imigrasi Bandara Soekarno-Hatta karena menggunakan paspor palsu. (mer)

Konsumsilah Kulit Manggis Sambungan dari halaman 1

salah satu organ besar dalam tubuh, yang terletak di bawah paru kanan dan tulang rusuk. Hati memiliki fungsi penting dalam metabolisme makanan untuk menghasilkan energi serta sebagai organ penyimpan darah. Namun, beberapa jenis tumor dapat berkembang di hati. Walaupun demikian, tumor itu ada yang jinak dan ada yang ganas. Bila tak mengandung sel kanker, ia disebut tumor jinak, tapi bila mengandung sel kanker ia disebut tumor ganas. Hingga saat ini belum ada ahli yang dapat memastikan apa penyebab kanker ini. Yang bisa mereka lakukan adalah mengirangira faktor risikonya. Sesuatu yangmeningkatkankemungkinan seseorang menderita kanker disebut faktor risiko, sedangkan yang menurunkannya disebut faktor protektif. Faktor risiko itu ada yang bisa dihindari, ada yang tidak. Salah satu yang bisa dihindari adalah merokok dan yang tak bisa dihindari adalah genetik. Mesk beberapa faktor risiko dapat dihindari, bukan berarti Anda seratus persen dapat terbebas dari kanker. Sebaliknya, orang yang hidupnya penuh dengan faktor risiko belum tentu akan menderita kanker. Hepatitis B dan C kronis merupakan faktor risiko utama terjadinya kanker hati. Dan risikonya akan meningkat bila seseorang menderita kedua hepatitis itu secara bersamaan. Ganguan metabolisme pun dapat meningkatkan risiko kanker hati, misalnya

kelainan yang menyebabkan penumpukan zat besi dalam hati, yang disebut hemochromatosis. Data menunjukkan, lelaki lebih rentan terkena kanker hati ketimbang perempuan. Pengobatan untuk yang sudah kena adalah dengan transplantasi hati. Selain hanya bisa dilakukan di luar negeri, biayatreatment ini sangat mahal. Tapi, untuk mencegahnya, yang perlu dilakukan adalah skrining rutin dengan pemeriksan darah, USG, dan CT Scan. Bisa juga dengan rutin mengonsumsi antioksidan tingkat tinggi. Apa misalnya? Xanthone, yang terdapat dalam kulit buah manggis. Peneliti luar negeri, seperti Martin (1980), Kanchanapoom (1998), Nakasone (1998), Paul (1998), Nakatani (2002), dan Matsumo ( 2003) melaporkan bahwa 10 mikron/ml alfa-mangostin (turunan xanthone) yang diisolasi dari kulit buah manggis mampu menghambat sel leukimia HL-60 pada manusia, dan garcinone E (juga derivat xanthone) efektif untuk menghambat kanker hati, kanker lambung, dan kanker paru. Khasiatnya bahkan jauh lebih efektif bila dibandingkan dengan obat kanker seperti flauraucil, cisplatin,vincristin,metohotrexete, dan mitoxiantrone. Bila ingin mendapatkan informasi lengkap tentang khasiat kulit manggis tersebut, Anda bisa membacanya di buku berjudul Kulit Manggis Berkhasiat Tinggi itu, yang tersedia di Toko Buku Gramedia di seluruh Indonesia. Tapi, apakah untuk mendap-

atkan xanthone itu kita perlu mengimpornya dari luar negeri atau menggiling kulit manggis dulu untuk kemudian meminum airnya? Tidak. Sekarang, teknologinya sudah ada di Indonesia. Dan produk itu sudah beredar di apotek-apotek dan toko-toko obat terkemuka di kota Anda, dalam bentuk kapsul ekstrak kulit manggis. Namanya Garcia. Sekali lagi, nama produk itu adalah Garcia, bukan xanthone, karena xanthone adalah nama zat yang terkandung di dalamnya. Untuk konsultasi kesehatan, hubungi dokter kami pada jam kerja di telepon bebas pulsa 08001401430 atau di e-mail Dan kunjungi juga website kami: www. atau di e-mail: Bila ingin mendapatkan ekstrak kulit manggis pertama di Indonesia itu, Anda bisa menghubungi distributor Kalimantan Barat 081280016319, (0561) 7161419. Atau bisa juga mendapatkannya langsung di apotek-apotek dan toko obat di Kota Pontianak. Untuk di daerah hubungi Sub Distributor: Kubu Raya (085880501034), Singkawang (085386711108), Sambas (085387155781), Kabupaten Pontianak (085347695045), Bengkayang (085252223557), Landak (082156214191), Sanggau (082153805379), Sekadau (085386211220), Sintang (085880501034), Kapuas Hulu (081257268829) dan Ketapang (085252056206, Kayong Utara (085652054794). (adv)

Pontianak Post




Harus Banyak Bertanya NAYSILA Mirdad pun merasakan sulitnya menentukan nominasi Panasonic Gobel Awards. Sama seperti Dude Harlino, pemeran Dewi di sinetron D e w i Penjaga Rindu itu baru kali pertama masuk tim verifikasi ajang pengh a r -

gaan tahunan itu. Tak heran kalau dia sempat mengalami kebingungan dalam proses penentuan daftar nominasi. ”Ini pengalaman pertama aku. Kesulitan banyak, banyak yang aku nggak ngerti. Aku banyak bertanya dan banyak belajar,” ungkap perempuan kelahiran Jakarta, 23 Mei 1988 itu. Menurutnya, ada sederet kriteria yang harus dipenuhinya untuk bisa masuk dalam tim verifikasi. Salah satunya, terlibat dalam sinetron kejar tayang minimal 20 episode. ”Prosesnya panjang, kriterianya banyak. Misalnya, artis stripping minimal 20 episode dan non stripping minimal enam episode,” terang putri pasangan Jamal Mirdad dan Lidya Kandou itu. (ash)

sisi lain

Pontianak Post

Selasa 12 Maret 2013


Ogah Tanggapi Saksi Palsu BEBERAPA waktu lalu, mantan pembantu Ardina Rasty, Fendy, mengakui kalau dirinya memberikan kesaksian palsu dalam kasus penganiayaan yang dilakukan Eza Gionino terhadap mantan majikannya tersebut. Tak hanya itu, karena merasa terancam, Fendy juga meminta perlindungan paa lembaga Perlindungan Saksi dan Korban (LPSK). Menanggapi hal itu, Rasty mengaku tidak mengetahui hal tersebut. ”Aku nggak tahu, aku belum dengar, aku nggak tahu dan nggak nanggapin apa-apa,” katanya. Hal itu dikuatkan kuasa hukumnya, Aldi Firmansyah. Menurutnya, dia hanya memberikan dorongan supaya berkata yang sejujurnya

mengenai kasus Eza dan kliennya. ”Pada saat bertemu dengan penyidik kita bilang, kamu harus jujur apa yang kamu lihat, bilang saja. Begitu juga dengan penyidik,” jelasnya. Kepada penyidik, lanjutnya, Fendy pun mengakui kalau dirinya sering mendengar pasangan yang sempat berpacaran itu bertengkar. ”Dia bilang nggak pernah melihat kejadian itu, tapi sering mendengar, nggak pernah bilang pernah melihat. Kita bilang ceritakan apa adanya jangan takut, harus jujur,” tuturnya. Menurut Aldi, itu merupakan komunikasi terakhir antara Rasty dan Fendy. Setelah diperiksa penyidik, Fendy pun menghilang.(dew)


BP KAPET Borong 25 Tiket Jalan Sehat PONTIANAK--Badan Pengelola Kawasan Pengembangan Ekonomi Terpadu (BP KAPET) Khatulistiwa Kalimantan Barat, turut berpartisipasi dalam Jalan Sehat Spektakuler Pontianak Post – PTPN XIII 24 Maret mendatang. Tak tanggung-tanggung, 25 tiket diborong BP KAPET untuk seluruh karyawannya. Direktur Umum BP KAPET, Ibnu setiawan, mengatakan partisipasi ini merupakan keinginan seluruh karyawan. Sebab selain merupakan ajang silaturahmi sesama, dari segi kesehatan juga akan didapatkan karyawannya. “Kami menyambut baik dan mendukung penuh kegiatan jalan sehat spektakuler yang diadakan oleh Pontianak Post dan PTPN XIII ini. Jadi selain mendapatkan sehat, ini juga dapat dijadikan ajang berkumpul dengan sesama karyawan, karena dalam pekerjaan sehari-harinya disibukan dnegan rutinitas,” ungkap dia. Pontianak Post sendiri, lanjut dia, merupakan media yang selalu dekat dengan warga Kalbar. Sehingga setiap kegiatan yang dilaksanakan pastinya akan berlangsung meriah dan memanjakan pelanggannya. “Saya yakin pesertanya pasti ramai, karena pelanggan Pontianak Post menyebar hingga seluruh wilayah Kalimantan Barat. Koran pertama dan terutama di Kalbar ini tetap menjadi kepercayaan masyarakat, termasuk kami di BP KAPET. Jadi pastinya kami juga akan turut meramaikan acara tersebut,” tukas dia. (wah)

Wahyu Ismir/Pontianak Post

SEMANGAT: Seluruh jajaran BP KAPET dengan semangat menunjukkan tiket Jalan Sehat Spektakuler Pontianak Post – PTPN XIII.


BERSANDAR : Beberapa kapal terpaksa menunggu untuk bersandar ke tepi, karena banyaknya aktifitas di Pelabuhan Pontianak, Senin (11/03).

Kursi Mahasiswa Baru Terbatas

779 Ribu Berebut 140 Ribu Kursi

J AKA R TA - - R a n g k a i a n pendaftaran seleksi nasional masuk perguruan tinggi negeri (SNM PTN) 2013 secara resmi ditutup tadi malam pukul 22.00 WIB. Hasilnya ada sekitar 779 ribu pendaftar yang memperebutkan 140 ribuan kursi mahasiswa baru. Pengumuman peserta yang lolos SNM PTN akan diumumkan panitia pada 28 Mei mendatang. Ketua Umum Panitia Pusat SNM PTN 2013 Akhmaloka mengatakan, sejatinya pendaftaran SNM PTN 2013 sudah ditutup Jumat lalu (8/3). Tetapi

Sidang Lanjutan Gugatan Warga Inggris Terhadap cap Kaki Tiga

Saksi: Merek Cap Kaki Tiga Bisa Dibatalkan

JAKARTA--Miranda Ayu -akademisi dari Universitas Padjajaran, menyatakan bahwa pembatalan merek Cap Kaki Tiga bisa dilakukan apabila merek tersebut menyerupai lambang dari suatu negara. Setiap pihak yang berkepentingan terhadap merek tersebut, mulai dari pemerintah secara resmi maupun warga negara secara perorangan memiliki hak untuk menggugat pembatalan. “Dalam kasus cap kaki tiga saya melihat sendiri ada lambang kaki tiga di bendera, kartu pos, dan uang koin dari Negara Isle of Man. Jadi pihak yang berkepentingan dengan Isle of Man berhak melakukan gugatan, apabila simbol mereka dipakai untuk suatu produk komersial,” ujar Miranda selaku saksi ahli, saat persidangan di Pengadilan Niaga Jakarta

Pusat, Selasa (5/3). Miranda sebagai  ahli dalam Hak Karya Intelektual (HKI) sekaligus ahli hukum tata negara ini menjelaskan, negara yang memilik lambang negara atau simbol ini, memiliki perlindungan khusus. Hal itu diatur dalam UU nomor 24 tahun 2009 tentang lambang negara. Indonesia sebagai negara yang menghargai hak karya cipta, wajib juga memberikan perlindungan meskipun itu terhadap negara asing. Saksi ahli kedua Tantio Adji Ariyanto, menerangkan, gambar antara cap kaki tiga dengan lambang negara Isle of Man merupakan gambar yang sama. Ide dasar pembuatan gambar adalah sama, yakni kaki sebanyak tiga kaki yang ditekuk. Kemudian, pada tumit dari ke tiga kaki sama-sama ada gambar bintangnya.

“Dari dua keterangan saya itu sudah dapat membuktikan, bahwa gambar cap kaki tiga merupakan hasil jiplakan dari lambang negara Isle of Man,” terangnya. Sementara itu, kuasa hukum Russel Vince, Previany Annisa Rellina, mengatakan pihaknya dalam persidangan kali ini sengaja menghadirkan saksi ahli sebanyak dua orang. Ini sebagai tindak lanjut dihadirkannya saksi fakta pada persidangan pekan lalu. Saksi ahli yang dihadirkan ini berasal dari akademisi, dan mereka merupakan ahli dalam bidang desain grafis dan hak karya intelektual. “Saya berharap kehadiran dua saksi ini bisa dijadikan bahan pertimbangan hakim untuk memutuskan perkara nanti,” tandasnya. (wok)

karena banyak pendaftar yang belum menuntaskan alur pendaftaran SNM PTN, maka panitia memberikan masa perpanjangan waktu hingga tadi malam. “Besok (hari ini, red) panitia sudah fokus menyeleksi, tidak lagi menerima pendaftaran,” kata pria yang juga rektor Institut Teknologi Bandung itu. Dari rekapitulasi panitia, Universias Padjadjaran (Unpad) menjadi kampus paling banyak diminati pelamar SNM PTN 2013. Akhmaloka mengatakan, jumlah peminat kampus yang berdomisili di Bandung itu mencapai 75 ribuan pendaftar. Posisi berikutnya ada Universitas Gadjah Mada (UGM) Yogyakarta dengan 72 ribuan pendaftar dan Universitas Brawijaya (Unibraw) Malang ada 71 ribuan pendaftar. “Di kampus ITB sendiri peminatnya ada 30 ribu orang,” tandasnya. Akhmaloka menjelaskan saat ini tim TI (teknologi informasi) SNM PTN 2013 sudah siap dengan layanan teknologi untuk penyeleksian dokumen pendaftaran siswa. Dia mengatakan untuk urusan TI ini, panitia SNM PTN dibantu oleh salah satu BUMN yang bergerak di bidang telekomunikasi. Dalam masa penyeleksian yang dimulai hari ini, Akhmaloka mengatakan seluruh pendaftar SNM PTN 2013 akan dikelompokkan sesuai dengan universitas pilihan pertama. Selanjutnya masing-masing universitas pilihan pertama itu diberi waktu sebulan untuk me-ranking berdasarkan program studi dan nilai rapor. Selanjutnya hasil pemeringkatan itu langsung dipotong sesuai dengan kuota SNM PTN di masing-masing prodi di sebuah universitas. Bagi pelamar SNM PTN yang namanya terpotong di universitas pilihan pertama, langsung

dilempar ke universitas pilihan kedua. “Pemeringkatan di universitas pemilihan kedua ini juga diberi waktu sebulan,” ucap Akhmaloka. Selain berdasarkan nilai rapor, hasil ujian nasional (unas) 2013 juga menjadi penentu kelulusan. Akhmaloka mengatakan hingga saat ini panitia belum menemukan kasus pengatrolan nilai rapor. Biasanya kasus ini baru ditemukan ketika masa daftar ulang SNM PTN pada 11-12 Juni mendatang. Sebab pada waktu itu, setiap pelamar SNM PTN wajib membawa fisik rapor untuk pencocokan nilai di server. Dia mengatakan jika ada pelamar SNM PTN 2013 yang tidak diterima di unviersitas pilihan pertama dan kedua, tidak perlu kecil hati. Sebab mereka masih memiliki kesempatan untuk ikut di ujian tulis seleksi bersama masuk perguruan tinggi negeri (SBM

PTN) 2013 yang akan diluncurkan Jumat depan (15/3). Di pihak lain, Kementerian Pendidikan dan Kebudayaan (Kemendikbud) menyebutkan kuota nasional mahasiswa baru PTN tahun ini harus bertambah sepuluh persen dibanding tahun lalu. Mendik������� bud Mohammad Nuh mengatakan, PTN tidak perlu risau dengan instruksi penambahan kursi mahasiswa baru ini. “Urusan kekurangan gedung, kekurangan guru, dan kendala-kendala lain bisa dipecahkan,” tandas menteri asal Surabaya itu. Nuh mengatakan penambahan mahasiswa baru ini tidak menjadi beban PTN asalkan tingkat mahasiswa yang masa kuliahnya melebihi delapan semester bisa ditekan. Mantan rektor ITS itu mengatakan, saat ini kasus mahasiswa yang masa kuliahnya melebihi ketentuan normal

(delapan semester) masih cukup banyak. Nuh ���������� mengatakan mahasiswa tidak bisa serta merta disalahkan dalam fenomena ini. Sebaliknya dia juga meminta PTN dan dosen harus berbenah. Untuk urusan dosen misalnya, Nuh mengatakan tingkat kehadiran di kelas harus ditingkatkan lagi. “Sekarang tingkat kehadiran dosen mengajar kuliah hanya 75 persen,” tandasnya. Jika tingkat kehadiran itu bisa dinaikkan, Nuh yakin kasus mahasiswa molor menuntaskan kuliah bisa ditekan. Jika alur mahasiswa masuk dan tamat berjalan dengan normal, yakni selama delapan semester, Nuh yakin jumlah unit ruang kelas tidak jadi masalah. Begitu pula dengan jumlah ketersediaan dosen. “Tidak ada bedanya dosen mengajar 20 mahasiswa atau 30 mahasiswa,” kata dia. (wan)


MERIAH: Fun Bike 10 tahun Hotel Santika Pontianak yang digelar di Car Free Day, Minggu (10/3), cukup meriah. Acara dilepas Walikota Pontianak Sutarmidji. Walaupun cuaca terik, peserta tetap bertahan hingga akhir acara.

Metropolis Pontianak Post


SELASA 12 Maret 2013



Jadi Perhatian Serius KASUS pelecehan seksual yang melibatkan anak baik sebagai korban maupun pelaku perlu mendapat perhatian serius. Terlebih lagi usia pelaku sangat belia, yakni ada yang berumur sembilan tahun. ”Korban berusia lima tahun dengan pelaku berusia sembilan dan 12 tahun,” ujar Koordinator Rehab Mental, Pusat Perlindungan dan Pelayanan Anak Indonesia (Puspa) Kalimantan Barat, Armijn Santosa Chandra Besman di Pontianak, Senin (11/3). Armijn menjelaskan kasus pelecehan seksual dengan pelaku dan korban sangat belia tersebut masih dalam penelitian. Pelaku membantah berniat melakukan pelecehan seksual. PerisArmijn Chandra tiwa tersebut terjadi karena pelaku dan korban kelahi. ”Ini memang dalam penelitian, apakah memang pelecehan seksual atau anak-anak main-main. Hasil visum memang ada luka,” ujarnya. Hanya saja, Armijn menyayangkan kasus tersebut terekspos. ”Padahal anaknya bisa trauma. Orangtua seharusnya hati-hati dalam menyebutkan yang terjadi pada anaknya. • ke halaman 15 kolom 5


Dorong Industrialisasi PEMERINTAH Provinsi Kalimantan Barat mendukung pendirian pabrik lateks di Kabupaten Landak. Wakil Gubernur Kalbar, Christiandy Sanjaya mengatakan pendiriannya untuk mendorong industrialisasi hilir di wilayahnya, ”Peletakkan batu pertama pembangunan pabrik tersebut dilakukan oleh Menristek. Upaya pendirian ini bagus karena sudah saatnya industrialisasi,” ujar Christiandy di Kantor Gubernur Kalbar, kemarin. Ia menjelaskan semua potensi yang ada di Kalbar harus didorong untuk industrialisasi. Termasuk di bidang perkebunan, dengan industrialisasi dapat meningkatkan nilai jual produk yang dihasilkan. ”Selama ini kita hanya bisa mengirim rubber sheet. Dengan adanya pabrik bisa mengeluarkan produk seperti sarung tangan. Ini ada nilai tambahnya,” jelas Christiandy. Ia menambahkan kunjungan Menristek juga menggandeng Batan (Badan Tenaga Nuklir Nasional). Dalam kunjungan tersebut, lanjut Christiandy, Menristek juga melihat potensi pembangunan pembangkit listrik tenaga nuklir di Kalbar. Ia berharap pembangunan pembangkit tersebut bisa menjadi solusi sumber daya energi di Kalbar. ”Bahkan, di Kalimantan,” timChristiandy Sanjaya palnya. (uni)


Jalan Husien Hamzah rusak parah sejak satu tahun terakhir. Truk bermuatan berat sering amblas di sejumlah titik ruas jalan. Kecelakaan pun kerap terjadi karena pengendara menghindari lubang.

Agus Ngaku Dipukul Guru PONTIANAK - Kekerasan terhadap siswa oleh gurunya sendiri kembali terjadi. Kali ini menimpa Agus Veriyanto (15), siswa Sekolah Dasar Pelita Harapan di Jalan Komyos Sudarso, Pontianak. Kejadian tragis itu terjadi gara-gara password face-

book yang bernada jorok, Agus Veriyanto (15) siswa kelas lima SD ini pun nyaris dipukul gurunya sendiri Sabtu (9/3). Penganiayaan yang dilakukan oleh wali kelasnya tersebut, membuat bibir dan wajah anak pertama pasangan Tjem Fong dan Santi mengalami luka.

PONTIANAK - Paryadi masih optimis bisa merebut kursi Partai Demokrat, kendati saat ini ada dua kompetitor yang berasal dari internal partai. Setelah Hartono Azas (Ketua DPC Partai Demokrat) menyatakan siap maju, satu calon lagi yakni Bobby Chrisnaw a n ( Ke t u a I

Warga Keluhkan Air PDAM Keruh

Agus menceritakan, saat pulang sekolah salah satu temannya menanyakan apa password facebook dirinya. Ia pun menjawab dengan kalimat jorok. Usai menjelaskan, Marta salah satu guru taman kanak-kanak di lingkungan SD Pelita Harapan langsung memarahi Agus seraya menuduh telah memaki dirinya. • ke halaman 15 kolom 2

Paryadi Optimis Diusung Demokrat Arif Joni Mendaftar ke Golkar




Warga Komplek Star Adis Residence mengeluhkan Air PDAM Tirta Raya Kubu Raya yang keruh.

PONTIANAK - Warga Kabupaten Kubu Raya, Kecamatan Sungai Raya Senin (11/3) mengeluhkan air yang disalurkan Perusahaan Daerah Air Minum TirtaRayamenjadikeruhsepertilumpur.Setidaknya kejadian ini sudah terjadi sejak dua hari berturutturut. “Kami tidak tahu kenapa keruh seperti begini. Ini sudah dua hari berturut-turut. Kami minta dicek apakah ada kerusakan teknis atau persoalan lainnya,” kata Dani (32) salah satu pelanggan air PDAM di Komplek Star Adis Residence, Sungai Raya, Kubu Raya. Menurut dia, karena keruh tersebut sudah dua hari ia bersama suaminya tidak melakukan penyedotan. Sebab, kalau dipaksakan disedot, airnya keruh dan tidak layak untuk mandi, mencuci ataupun bersih-bersih kebutuhan dapur.

DPD Demokrat) juga menyatakan siap bersaing. “Saya tidak menganggap mereka sebagai kompetitor, justru saya melihat partai ini (Demokrat) memiliki kader-kader yang berpotensi. Ini adalah warna untuk sebuah demokrasi,” ungkapParyadikepada Pontianak Post ditemui di kediamannya kemarin.

• ke halaman 15 kolom 2

• ke halaman 15 kolom 5

Menilik Kondisi Terminal Batu Layang

Dulu Terminal Angkutan Umum, Kini jadi Terminal Walet Kondisi Terminal Batu Layang Pontianak semakin memprihatinkan. Tidak banyak lagi mobilitas angkutan umum dan penumpang yang terlihat. Hal ini memaksa Komisi B DPRD Kota Pontianak turun langsung melakukan pemantauan, untuk mengetahui apa penyebab dari sepinya terminal yang dulunya sangat dimanfaatkan masyarakat Pontianak Tersebut. WAHYU ISMIR/PONTIANAK POST

WAHYU ISMIR, Pontianak







Komisi B DPRD Kota Pontianak saat memantau Terminal Batu Layang.

TERMINAL Batu Layang terlihat sepi. Di area pemberhentian hanya terlihat beberapa bus luar Kota. Bahkan satu Bus Kota pun terlihat kosong penumpang. Seolah-olah menjadi penghias terminal. Hal tersebut berbanding lurus dengan jumlah penumpang, dapat dihitung dengan jari. Mereka yang menggunakan jasa bus diterminal hanya berasal dari oplet jurusan Batu Layang. Tak ayal, ketika penumpang turun, calo yang selalu setia menunggu berebut untuk mengajak mereka menaiki bus yang menggunakan jasa mereka. Saat mengunjungi terminak, Komisi B DPRD Kota Pontianak langsung berkoordinasi dengan kepala Unit Pelaksana Teknis Dinas (UPTD) Perhubungan Kota Pontianak. • ke halaman 15 kolom 2



Pontianak Post lSelasa 12 Maret 2013


Kontraktor Profesional BADAN Pimpinan Cabang (BPC) Gabungan Pelaksana Konstruksi Indonesia(Gapensi) Kota Pontianak menyatakan siap bersaing menghadapi sistem pelelangan secara online. Makanya, tuntutan bekerja secara profesional akan terus dikedepankan. Ketua BPD Gabungan Pelaksana Konstruksi Indonesia (Gapensi) Kota Pontianak, Adang Gunawan menyatakan dalam Musyarawah Kerja Cabang (Mukercab) masa bakti 2009-2014, di Hotel Grand Mahkota Adang Gunawan Pontianak, Sabtu (9/3) kemarin. ”Seluruh anggota Gapensi Pontianak siap bekerja profesional dan menyesuaikan berbagai perubahan dalam pelaksanaan jasa kontruksi di Kalbar. Saat ini, kita sebagai pelaku usaha kontruksi bernaung di Gapensi akan bekerja dengan profesional. Itu merupakan bagian dari komitmen kita bersama,” ujarnya. Menurut Adang, sesuai Perpres nomor 70 tahun 2012 tentang pelaksanaan jasa kontruksi hendaknya dipahami secara utuh, terutama berkaitan pengadaan barang dan jasa atau lelang proyek secara online. “Dari itu kita mengundang Lembaga Pengembangan Jasa Kontruksi (LPJK) untuk menjelaskan tentang pelelangan secara online melalui Layanan Pengadaan Barang/Jasa Secara Elektronik (LPSE). Kita juga masih sedikit bingung, dengan ada penjelasan ini Gapensi dan anggota yang bernaung di dalamnya bisa dan mampu memenuhi tuntutannya,” ujarnya. Dia menambahkan, Gapensi sebagai organisasi konstruksi tertua di Indonesia berkomitmen membangun Kota Pontianak lebih baik. “Kita berkomitmen membangun Kota Pontianak menjadi kota yang lebih baik,” ungkapnya. Sementara Walikota Pontianak, Sutarmidji melalui Kepala Dinas PU Kota Pontianak, Edy Kamtono, mengatakan tahun 2013 ini semua proyek barang dan jasa dilaksanakan lelang secara online. Ia berhatap seluruh anggora Gapensi dapat meningkatkan pemahamannya. “Itu tuntutan kerja dewasa ini semakin profesional,” ucapnya. Katanya dengan sistem tersebut persaingan rekanan lebih kompetitif. Sebab, rekanan dari luar juga dapat mengikuti lelang secara online, baik melihat pengumuman, mendaftar, maupun proses administrasi. “Harapannya profesionalitas rekanan harus teruji dan hasil pekerjaan dapat dipertanggungjawabkan,” katanya.(den)

PATUH: Himbauan pihak Untan terkait penertiban baliho dipatuhi oleh semua pihak. Buktinya, di tempat ini sangat langka terdapat baliho atau sejenisnya. MUJADI PONTIANAK POST

Tinjau Pos Perbatasan Kapuas Hulu PONTIANAK—Untuk pengendalian Satgas Pamtas, Danrem 121/ Abw, Kolonel Inf. Binarko Sugihantyo sebagai Komandan Komando pelaksana Operasi Pengamanan Perbatasan RI-Malaysia di Kalimantan Barat, gencar meninjau pos perbatasan. Salah satunya yang berada di daerah Kabupaten Kapuas Hulu. “InisebagaitugasdanfungsiDanrem sebagai Dankolakops pengamanan perbatasan, jadi kita akan melakukan pengecekan di pos perbatasan yang ada. Termasuk di Kapuas Hulu,” kata Danrem. Sebelum mengecek pos-pos perbatasan yang ada, Danrem 121/ Abw mengadakan tatap muka dengan masyarakat yang berada di Kampung Banua Martinus Kecamatan Embaloh Hulu. Dalam acara tersebut Danrem menghimbau kepada masyarakat agar

bersama-sama dengan TNI dan Polri untuk selalu bergandengan tangan dan bekerja bersama-sama untuk membangun dan menjaga keamanan khususnya di daerah perbatasan RIMalaysia. “TNI merupakan bagian dari masyarakat karena TNI berasal dari masyarakat, apabila ada hal-hal yang sekiranya memerlukan bantuan ataupun tenaga dari TNI, maka tidak perlu ragu-ragu untuk menyampaikan hal tersebutkepadaaparatTNIyangberada di wilayah setempat,” katanya. Danrem 121/Abw mengunjungi pos-pos pamtas yang berada di wilayah Kapuas Hulu antara lain Pos Kapar, Seriang, Ensanak dan Merakai Panjang dengan menggunakan jalur darat. Selain mengecek bangunan pos, sarana dan perlengkapan yang ada, Danrem juga memberikan pengarahan kepada prajurit yang melaksanakan

tugas Pamtas agar selalu menjaga disiplin sebagai seorang prajurit dan menghindari pelanggaran yang dapat merusak citra TNI di mata masyarakat serta melaksanakan pembinaan teritorial terbatas di sekitar pos-pos satgas pamtas. “Kita juga menekankan untuk selalu mewaspadai setiap kegiatan illegal yang mungkin terjadi di sekitar wilayah perbatasan RI-Malaysia. Sehingga TNI harus selalu menjaga kekompakan antar sesama prajurit dan tetap semangat dalam melaksanakan tugas,” tukasnya. Danrem 121/Abw berkesempatan memberikan cenderamata yang diserahkan oleh Dandim 1206/Psb Letkol Inf Jayusman kepada salah satu masyarakat yang berada di Kecamatan Puring Kencana sebelum bertolak kembali ke Makorem 121/ Abw di Sintang.(wah)

Jelang Pilkada, Polisi Gencar Patroli PONTIANAK—JajaranPolrestaPontianak siap meningkatkan patroli rutin menjelang Pilkada pada September mendatang.Peningkatanpengamanan sudah dikoordinasikan langsung ke Polda Kalbar. “Justru mulai sekarang pengamanan semakin kita tingkatkan agar situasi kamtibmas tetap kondusif,” ujar Kapolresta Pontianak AKBP Hariyanta belum lama ini. Ia mengatakan, beberapa pihak terkait juga akan dilibatkan dalam pengamanan ini. Satpol PP serta

dibantu Kepolisian melakukan patroli untuk membersihkan atribut selama kampanye yang telah dilakukan. Agar berjalan lancar, polisi menjalin koordinasi dengan Panwaslu dan para kandidat. Disamping memperketat pengamanan, kata dia, aparat juga melakukan pengawalan terhadap pergerakan logistik Pilkada, seperti kotak dan kertas suara. Terutama di daerahdaerah yang sulit dijangkau dan sulit dilakukan pengawasan.  “Koordinasi

turut kita lakukan dengan KPU guna memonitor pendistribusian logistik pemilu, terutama dalam hal pengawalan,” timpalnya lagi.  Ia menuturkan, penambahan personil aparat keamanan dilakukan di beberapa daerah yang membutuhkan. Situasi keamanan selama masa kampanye harus kondusif dan tidak ada hal-hal yang menonjol. Situasi ini diharapkan tetap terjaga pada masa tenangdansampaipuncaknyasaatberlangsung pemungutan suara.(rmn)

Persiapan FBBK Dimulai PONTIANAK—Kepala Taman Budaya Kalbar, Sabar Hati Duha, mengatakan pihaknya sudah melaksanakan persiapan ajang kebudayaan terbesar di Kalbar, Festival Budaya Bumu Khatulistiwa (FBBK), meskipun kegiatannya dilaksanakan pada September mendatang. “Ajang dua tahunan ini selalu menjadi perhatian kita. Sebab ini merupakan moment penampilan budaya di Kalbar. Semoga dengan bergabungnya Taman Budaya ke Dinas Pendidikan, maka akan membawa warna baru dalam penampilan FBBK kali ini,” ungkap Sabar. Menurut dia, konsep yang akan ditampilkan kali ini akan mengalami perubahan dibandingkan dua tahun lalu. Dimana pada saat itu, FBBK dilaksanakan di gedung Pontianak Convention Center (PCC), sehingga dia menilai momentum kebudayaannya tidak terlalu dirasakan. “Karena kegiatan semua tertumpuk jadi satu di PCC, jadi saya juga sempat bertanya kepada dinas Pariwisata, kenapa tidak memanfaatkan fasilitas yang sangat berkaitan dengan budaya. Jadi biar lebih terkesan kegiatan budayanya,” jelas dia. Oleh sebab itu, Sabar mengatakan, saat ini pihaknya tengah berkoordinasi dengan Dinas Pendidikan dan Kebudayaan, untuk membuat konsep dimana pada pelaksanaan nantinya akan berlangsung di seperti Taman Budaya, Museum, dan Rumah Betang. Bahkan pembukaan rencananya akan dilaksanakan di Pendopo Gubernur. “Kita sedang membicarakan dengan Dinas Pendidikan dan Kebudayaan untuk tindaklanjutnya. Namun saya pikir, Kadis pasti setuju dan kami akan membicarakan lebih lanjut kepada gubernur, karena rencananya pada saat pembukaan kita akan menggunakan pendopo Gubernur sebagai rumah rakyat,” kata Sabar. Moment FBBK kali ini, lanjut Sabar, diharapkan dapat menjadi edukasi bagi penonton, sehingga pengetahuan akan kebudayaan akan didapatkan. Terutama bagi generasi muda. Jadi pihaknya akan melakukan kolaborasi untuk meningkatkan nilai kebudayaan yang ditampilkan, terutama ahli seni dan budaya yang dapat menjadi patokan dalam keilmuanya. “Jadi konsepnya penonton bukan hanya mendapatkan tontonan, namun nilai pendidikan budaya akan ditonjolkan, jadi mereka akan mengetahui keunikan dan kelebihan budaya di Kalbar,” ungkapnya.(wah)

Pontianak Post •

Selasa 12 Maret 2013

Halo publik


Negeri yang Kaya tapi Miskin Pemerintah telah membatasi Bahan Bakar Minyak, sebagai upaya untuk menghemat energi yang semakin hari stoknya kian menipis. Beberapa industri maupun pabrik dirugikan karena kelangkaan BBM. Sejumlah supir truk melakukan unjuk rasa terhadap pertamina dan mendatangi gedung DPRD untuk mendapatkan haknya. Kelangkaan BBM tidak hanya di satu wilayah, juga tersebar dimana-mana. Kebijakan pemerintah dilihat tidak populis dalam membatasi BBM. Pasalnya beban Negara yang memiliki produksi minyak terbesar harus mengalami krisis meski perlu dipertanyakan keberadaanya. Lebih parahnya kelangkaan BBM ada oknum yang memanfaatkan kesempatan, dengan sengaja menimbun. Ironisnya, pemilik saham besar yang ada di Indonesia dikuasai oleh pihak asing termasuk migas. Sumber kekayaan alam yang berlimpah, terkenal dengan kesuburannya tidak menjadikan masyarakatnya


mampu bangkit dari paradoks kemiskinan, kebodohan, serta krisis moral dan jauh dari nilai keTuhanan. Faktanya sumber penghasil minyak yang berada di laut lepas dikuasai oleh pihak asing terus-menerus melakukan pengerukan setiap tahunnya tidak sedikit mendapatkan keuntungan. Kekayaan alam kita terus dibabat dan dikeruk oleh pihak asing investasi hanya mendapatkan persen. Tetapi kitalah yang memiliki keterbatasan sumber daya manusia, dituntut untuk mawas diri melakukan penguatan mentalitas, memperdalam keyakinan. Lebih menyedihkan,Negarakayadengan potensi sumber daya alamnya melimpah, masyarakatnya kurang menyadari peluang itu membuat mereka menjadi malas.



Jawaban Universitas Terbuka Menanggapi keluhan pembaca Pontianak Post tanggal 6 Maret 2013 tentang Biaya Kuliah di UT sesuai ketentuan yang berlaku, rincian biaya dapat dilihat di Barang siapa yang melakukan pungutan diluar ketentuan, akan dimintai pertanggungjawaban sesuai perundang-undangan yang berlaku. Keluhan mahasiswa akan ditindaklanjuti jika disampaikan secara rinci ke kantor UT Pontianak atau melalui email ke : atau Terima kasih. (08170289047)

Nilai Lakip Kesbangpol Menanggapi berita Pontianak Post edisi Selasa 5 Maret 2013, dengan ini kami klarifikasi sebagai berikut : berdasarkan hasil evaluasi Inspektorat Kota Pontianak bahwa Lakip tahun 2010 nilai CUKUP dan tahun 2011 dengan nilai BAIK. Sedangkan tahun 2012 baru akan dievaluasi bulan April 2013. Lantas dari mana diperoleh nilai ‘KURANG’? Demikian klarifikasi dari Kesbangpol Kota Pontianak. Atas perhatian diucapkan terima kasih. (Kakankesbanpol Kota Pontianak, Indra Yuana, 08164995543)










Pontianak Post lSelasa 12 Maret 2013

Tepat Memilih Mahkota Rumah

ATAP salah satu elemen terpenting sebuah rumah. Bagian ini berfungsi sebagai pelindung penghuni rumah dari segala cuaca, sekaligus sebagai estetika bangunan. Selain fasad bangunan, pandangan orang dari luar juga akan tertuju pada atap. Bila rambut mahkota bagi perempuan, maka atap juga ibarat mahkota pada sebuah rumah. Bentuknya

harus memesona, sehingga indah dipandang mata. Syarat kekuatan juga tidak boleh terabaikan. Memilih bentuk dan bahan yang tepat untuk mahkota rumah menjadi sangat penting, terutama di saat musim hujan dengan cuaca ekstrem seperti sekarang ini. Kendati bentuk bangunan indah dan megah, tetapi bila salah dalam konstruksi dan memilih bahan atap, bisa menjadi

petaka. Atap yang tidak terencana dengan baik tidak hanya merepotkan pemilik rumah. Air hujan yang masuk melalui lubang pada atap, juga dapat merusak perabotan yang terkena air hujan. Di pasaran, berbagai jenis bahan atap ditawarkan. Semua mengklaim keunggulan dan keindahan dalam bentuk. Tinggal konsumen menyesuaikan dengan konsep bangunan dan ketersediaan dana untuk bujet atap. Konsultan arsitek Dann Bintang, Asriadi menuturkan, material pentup atap saat ini banyak macamnya. Atap bentuk genteng dengan lapisan pasir dapat menjadi salah satu pilihan. Saat musim hujan berlalu, panas terik matahari akan menyengat. Dengan menggunakan genteng lapisan pasir ini maka dapat menetralisir suhu. Asriadi menambahkan, genteng seperti ini sangat cocok digunakan untuk rumah zaman sekarang. Selain kualitasnya bagus, juga tahan lama. Serta pemasangannya cepat

dan tidak tembus ke plafon saat hujan turun. Secara umum, memilih jenis genting atau bahan penutup rumah sebaiknya mempunyai keterkaitan dengan bentuk desain rumah. Setiap gaya rumah harus dipadukan dengan genteng yang menutupi bagian atas bangunan. Bila arsitektur bangunan memilih gaya tradisional maupun kolonial, maka lebih cocok menggunakan genting jenis beton, keramik, atau beton. Bila menggunakan konsep hunian modern, banyak jenis yang dapat diaplikasikan. Di pasaran, kita dapat menemukan banyak jenis atap. Bahan penutup rumah yang umum ditemukan antara lain, genting beton, genting tradisional, genting keramik, sirap, genting aspal, fiber semen, dan lainnya. Ada kalanya, atap  dipadupadankan dengan beberapa jenis bahan dalam satu rumah. Misalnya, atap untuk rumah menggunakan genting keramik, sedangkan untuk teras menggunakan fiberglass atau bahan lainnya. (ulf)

VivoBook Tawarkan Layar Sentuh Menawan TEKNOLOGI layar sentuh menjadi salah satu andalan produk ultrabook saat ini. Hal ini yang menginspirasi Asus dengan mengeluarkan ultrabook tipis yang menawan, Vivobook S400CA. Khusus Vivobook sendiri sebenarnya ada beberapa varian berbeda, namun khusus Vivobook S400CA menjadi salah satu perhatian pencinta teknologi informasi (TI). Ini lantaran menawarkan kepuasan tampilan dengan layar LCD touch screen sebesar 14 inci, resolusi maksimum 1366 x 768 pixel. Asus tipe ini juga memiliki desain keyboard chiclet sehingga terasa nyaman saat digunakan untuk mengetik. Tidak hanya keyboard, touchpad-nya yang lebar memudahkan saat menggeser pointer. Selain lebar, touchpad yang digunakan juga memiliki feature Asus Smart Gesture. “Bahan alumunium cover dan bodinya,

membuatnya terasa kokoh sekaligus memberikan kesan minimalis,” kata Manajer Sales Asus Mega Rich Makassar, Jeny di sela Mega Bazaar Computer (MBC) di Celebes Convention Centre (CCC), Jumat 8 Maret. Tidak heran menurutnya, banyak customer yang mencari perangkat tipe VivoBook selama pameran. Perangkat ini juga dilengkapi sebuah speaker yang dibalut dengan feature Asus SonicMaster. Menjadikan suara yang dihasilkan lebih powerfull. Ultrabook ini juga dipersenjatai dengan SSD Sandisk sebesar 24 GB, hard disk berkapasitas 500 GB dan berbagai keunggulan lainnya. Untuk prosesornya, Asus membenamkan kelas high-end, yaitu Intel Core i7 3517U, Core i5 3317U, Core i3 3217U, Core i3 2365U, Pentium 987 ULV, hingga kelas entry Celeron 847 ULV. (nur/die)


MENAWAN: Asus VivoBook menawarkan teknologi canggih layar sentuh.


PLASMACLUSTER: Pembersih udara dari Sharp yang menggunakan teknologi plasmacluster.

Sharp Plasmacluster

Udara Sehat untuk Keluarga KESADARAN akan pentingnya udara sehat demi terciptanya keluarga yang sehat, mendorong Sharp menggelar program Sharp Pure Air Pure Love with Plasmacluster hingga 16 Maret mendatang. Program ini untuk memperkenalkan keunggulan teknologi plasmacluster Sharp. New Business Development General Manager PT Sharp Electronics Indonesia, Koji Tokuda mengatakan teknologi plasmacluster yang diterapkan pada AC sangat hebat. Teknologi ini mampu menyerap debu dan menghilangkan bau. “Tujuan kami agar masyarakat semakin sadar pentingnya menjaga kualitas udara dalam rumah, sehingga kesehatan keluarga tetap terjaga,” ungkap Koji dalam rilisnya, kemarin. Product Marketing Manager PT Sharp Electronics Indonesia, Frans Wibowo menjelaskan plasmacluster merupakan teknologi pemurni udara dari Sharp. Teknologi ini dapat menonaktifkan mikroba di udara seperti virus, jamur, bakteri, penyebab alergi seperti debu rumah, serta sangat efektif dalam menghilangkan bau-bauan seperti asap rokok, binatang peliharaan, sampah, toilet, dan bau-bau tidak sedap lainnya, bahkan juga yang menempel pada serat bahan seperti bau keringat. Plasmacluster menghasilkan ion positif dan negatif seperti yang terdapat di alam. Kedua Ion ini akan mengikat virus, jamur, dan bakteri di udara kemudian mengubahnya menjadi air sehingga menghasilkan kemurnian udara pada ruangan. Saat ini, teknologi plasmacluster telah dikombinasikan dalam beragam produk Sharp seperti air-conditioner, air purifier, ion generator, lemari es, mesin cuci, vacuum cleaner, hair dryer, dan beragam produk lainnya. Teknologi plasmacluster juga telah diaplikasikan oleh 28 perusahaan di berbagai industri seperti mobil, kereta api dan lain lain. (fmc/die)

Pontianak Post

Selasa 12 Maret 2013

komunikasi bisnis Advertorial


Dijuluki Sebagai Mesin Pembunuh Kanker FOTO IST

DIABADIKAN: Acara Malam Ramah Tamah Alumni (Tamatan 1983) diabadikan bersama Bapak/Ibu dan Staf SMEAN 2 Pontianak tahun lalu.

Reuni 30 Tahun Alumni SMEA Negeri 2 Pontianak Tamatan 1983 SETELAH sukses menyelenggarakan acara Malam Ramah Tamah Alumni dengan Guru dan Staf SMEAN 2 Pontianak pada tahun lalu (26 Maret 2012), maka pada tahun ini Alumni SMEAN 2 Pontianak tamatan tahun 1983 kembali akan menggelar acara Reuni. Reuni yang akan digelar pada Senin, 25 Maret 2013 di Grand Kartika Hotel pukul18.30 WIB, adalah dalam rangka memperingati 30 tahun Alumni Tamatan Tahun 1983 telah menyelesaikan studi dari SMEAN 2 Pontianak, sekaligus untuk mempererat tali silaturahmi sesama alumni dan dengan para guru dan staf. Wangdin, selaku Ketua Panitia mengungkapkan, bahwa para Alumni Tamatan 1983 yang berdomisili di luar Kota Pontianak, antara lain; Jakarta, Palangkaraya,

Singkawang, Sanggau, Sintang, Putussibau, Ketapang dan lain-lain juga sudah menyatakan akan menghadiri acara reuni ini. Yo Hui Meng, yang selaku Wakil Ketua Panitia menambahkan, bahwa tentunya ada juga mengundang para Guru dan Staf menghadiri acara reuni ini. Nuraini yang didampingi Vianasari yang sama-sama diposisi Seksi Acara mengatakan, bahwa acara reuni ini adalah dari alumni, oleh alumni dan untuk alumni. Oleh karena itu, pengisi acara reuni ini adalah para alumni sendiri dan putra-putri alumni. Untuk mengikuti acara reuni ini, Alumni SMEAN 2 Pontianak Tamatan 1983 dapat melakukan pendaftaran langsung kepada Bendahara Panitia; Nurhayati HP: 081345470601 dan Budianto HP: 08125734985.(biz)

Hipertensi-Kolesterol Sembuh Dengan Sarang Semut & Gami

NAMA saya ibu Marnis, usia 55 tahun, asal Jakarta. Dari usia 35 tahun saya sudah punya penyakit darah tinggi, berhubung usia saya masih muda, pada saat itu tensi darah saya masih dapat terkontrol. Tetapi memasuki usia 50 tahun, saya merasa susah untuk mengontrol tensi darah saya, karena ternyata saya ada komplikasi penyakit kadar kolesterol yang tinggi dan ada benjolan di leher, lalu saya

diberitahu oleh teman saya produk Sarang Semut dan Gami PT. Prima Solusi Medika. Setelah mengonsumsi selama 1 bulan, kadar kolesterol darah saya normal, begitu juga tensi darah saya ikut normal, benjolan di leher saya juga berangsur-angsur mengecil dan sekarang benjolan di leher saya sudah tidak ada. Terima kasih Sarang Semut PT. Prima Solusi Medika. Info Penjualan Sarang Semut &

Gami di Kalimantan Barat hubungi telepon: 0852 4596 1665. Info produk: 0821 1154 8616. Atau diperoleh di Apt Amelia (Sei Raya), Apt Antara (Jl. Adi Sucipto), Apt Bersama (Jeruju), Apt Gajah Mada (Jl. Gajah Mada), Apt Kharias Bakti (Jl. Siam), Apt Makmur II (Jl. Gajah Mada), Apt Mandiri I (depan RS. Antonius.0), Apt Mandiri II (Jl. Penjara). Apt Mega Sari Farma (Jl. Veteran), Apt Merdeka Timur (Jl. Hos Cokroaminoto), Apt Sejahtera (Tanjung Hulu), Apt Siantan Jaya (Siantan), Apt Nusa Indah (Jl. Nusa Indah III Pontianak). Apt Sui Raya Dalam (Sei Raya Dalam), Apt Therapy (Jl. Danau Sentarum), Toko Obat 168 (Jeruju), Toko Obat Asia (Jl. Gajah Mada), Toko Obat Batara (Sei Raya Dalam), Toko Obat Ericia (Kobar), Toko Obat Hidup Sehat (Flambooyan), Toko Obat Jenaka (Jl. Penjara), Toko Obat Kapuas (Seroja), Toko Obat Labora (Jl. Husin Hamzah), Toko Obat Semi Abadi (Jl. Batanghari), Toko Obat Sinar Abadi I (Jl. Gajah Mada), Toko Obat Sinar Abadi II (Jl. Gajah Mada). Konsultasikan kondisi Anda ke nomor: 0821 1154 8616 untuk mendapatkan hasil optimal. Untuk mendapatkan testimoni lengkap pengguna produk ini silakan klik di (a2/bn)

Jangan Remehkan Sakit Kepala SAKIT kepala rasanya memang tidak menyenangkan. Meski sakit kepala bisa disembuhkan dengan obat, tapi tidak boleh dianggap remeh. Dokter spesialis saraf, Dr dr Akbar SpS menjelaskan, sakit kepala adalah nyeri yang tidak mengenakkan di seluruh daerah bagian kepala. Yaitu mulai dari bawah dagu sampai di belakang kepala. Penyakit ini tidak boleh dianggap enteng sebab bisa jadi gejala sebuah penyakit kronis. Akbar mengungkapkan, penyakit kepala dibedakan menjadi dua. Yakni sakit kepala primer dan sekunder. “Dalam dunia kedokteran, sakit kepala primer adalah sakit yang tak memiliki gejala, alias tanpa ada kelainan anatomi. Sedangkan sakit kepala sekunder adalah sakit kepala yang disertai kelainan anatomi atau karena adanya penyakit,” kata Akbar, saat ditemui di ruang kerjanya, belum lama ini. Lebih lanjut ia menjelaskan, jenis sakit kepala seperti migrain, cluster, sakit kepala tipe tegang merupakan jenis sakit kepala primer. Dikatakan primer, karena nyerinya muncul tanpa penyebab dan bisa berlangsung lama. Sedangkan sekunder, bisa muncul tiba-tiba dengan serangan yang sangat hebat. Hal ini bisa jadi karena adanya pendarahan di otak. Atau, bisa juga karena tumor otak. Jika tumor otak atau pendarahan otak, maka gejalanya adalah sakit kepala yang berlangsung lama dan berat. “Sakit kepala ini tidak boleh dianggap enteng. Karena sakit kepala bisa jadi gejala dari suatu kelaianan dan bisa jadi penyakit,” tambahnya. Hal senada juga diungkap dokter spesialis saraf lainnya, Dr dr Jumraini SpS. Menurutnya, sakit kepala sangat mengganggu aktivitas. Ia membeberkan, jenis sakit yang banyak dikeluhkan adalah sakit kepala sebelah atau migrain. Serangan sakit kepala migrain terasa lebih menyiksa dan terkadang datang tiba-tiba. “Penderita migrain akan merasakan nyeri dan berdenyut seperti dipukuli dan ditarik-tarik. Biasanya, disertai dengan gangguan saluran cerna seperti mual dan muntah. Penderitanya pun cenderung menjadi lebih sensitif terhadap cahaya, suara, dan bau-bauan. Hal itu tentu amat mengganggu dan bisa menghambat segala aktivitas si penderita,” terangnya.

IBU Hayati Lukman menjalani kan penelitian secara ilmiah yang operasi pengangkatan kanker lengkap, dalam hal ini belum ada rahim pada tahun 2011, namun untuk tanaman lain. Sudah banyak pada tahun 2012 kambuh lagi para pakar riset obat dari manca dan divonis kanker ganas oleh Negara yang melakukan penelitian dokter. ilmiah terhadap daun sirsak dan Operasi sebelumnya ternyata kulit manggis, untuk menggantikan tidak menuntaskan masalah. obat berbahan kimia, yang mana bila Apapun yang terjadi pada diri diminum dalam jangka waktu lama saya, saya harus menjalani dapat menimbulkan masalah baru terapi nonmedis. Pengobatan bagi si pemakai. Dari hasil penelitian alternatif yang dipilih adalah para pakar riset obat, kalau di dalam terapi daun sirsak yang dipadukulit manggis mengandung Xantone kan dengan kulit manggis, yang atau senyawa yang kurang lebih 50 kebetulan sudah ada dalam jenis yang merupakan anti oksidan bentuk kapsul yang namanya tingkat tinggi, yang mempunyai Erjun sehingga tidak perlu rekemampuan menetralkan radikal pot merebus daun sirsak dan bebas. Senyawa yang ada di dalam kulit manggis yang belum pasti kulit manggis berperan mengendadosisnya. likan sel kanker dengan mekanisme Ibu Hayati sangat bersyukur apotosis atau proses bunuh diri, dengan terapi Erjun, karena dan juga mengaktifkan sistim kekeErjun membuat ia terbebas dari balan tubuh dengan merangsang Hayati Lukman kanker ganas dan biaya yang sel pembunuh alami yang berfungsi dikeluarkan tidak sampai Rp2 juta. Daun Sirsak membunuh sel kanker dan virus. mengandung Acetogeniens Annonaceons (bahan Bayak para meneliti kulit manggis membuktikan Kimia) alami yang sangat luar biasa sebagai zat yang kalau kulit manggis mengandung anti oksidan 17.000ampuh untuk membunuh tumor dan sel-sel kanker 20.000 Orac/100 ons, bila dibandingkan dengan bahan yang mematikan, dan sifatnya tidak mengganggu lain berkadar anti oksidan tinggi. Seperti wartel dan sel-sel penting lainnya didalam tubuh. jeruk, hanya 300 dan 2400, Orac mempunyai keAcetogeniens Annonaceons yang ada di dalam mampuan anti okksidan menetralkan radikal bebas daun sirsak mempunyai kekuatan sepuluh ribu penyebab penyakit. Orac adalah singkatan dari oksigen kali lipat menghambat dan membunuh sel kanker, radikal absorbance kapasiti bebas. Erjun adalah kapsul dibandingkan denganAdriamicin dan terapi kemo. yang pertama yang komposisinya dari daun sirsak Daun sirsak mengandung kandungan gizi dan plus kulit manggis. Minum Erjun sangat bermamfaat senyawa alamiah yang membuktikan tanaman ini untuk mempercepat penyembuhan dan mencegah memiliki khasiat sangat luar biasa, karena dipengar- berbagai penyakit. uhi oleh senyawa aktif. Daun sirsak juga berfungsi Erjun sudah beredar di Apotek (Apt) dan Toko Obat sebagai anti bakteri, antijamur, efektif melawan (TO) di Pontianak. Daerah Singkawang: Apt Merdeka, berbagai jenis cacing dan parasit, menurunkan Apt Singkawang, Apt Asean dan TO Apollo. Ketapang: tekanan darah tinggi, defresi, stress menormalkan Apt Mulia, Lestari Farma dan TO Sumber Sehat. Sambas: kembali system syaraf yang kurang baik dan penyakit TO Santos. Sub distributor Sanggau Hp. 082151255333. degeneratif lainnya. Untuk informasi dan yang ingin menjadi sub distributor Kulit manggis dan daun sirsak sudah dilaku- di daerah hubungi Hp. 081 352 022 980.(d2/biz)

Pengobatan Sinshe Hongkong yang Manjur Sinshe Hongkong, Satu-satunya di Pontianak Atasi Rinitis & Asma secara Efektif dan Sampai Keakar-akarnya SINSHE Hongkong Pontianak yang beralamat di Jl. Agus Salim No. 126 Pontianak, merupakan pusat pengobatan penyakit kronis dengan metode herbal sinshe, ada konsultan sinshe ahli ternama dari Tiongkok, dengan herbal alami sinshe telah berhasil mengatasi penyakit banyak pasien penderita. Menggunakan paduan pengobatan tradisional herbal sinshe & resep ilmu pengetahuan modern, resep kuno kekaisaran, resep pengalaman, resep rahasia turun temurun, khusus mengobati berbagai penyakit bandel, penyakit kronis dan penyakit yang sudah lama diobati namun belum sembuh juga. Sinshe Hongkong Pontianak dalam mengobati berbagai penyakit jenis

akut maupun kronis antara lain: asma, radang hidung, radang tenggorokan, bronchitis, emfisema paru dan penyakit lainnya menerapkan metode herbal sinshe yang sudah memiliki sejarah sekitar 2.000 tahun, mengkombinasikan pengalaman para ahli pengobatan kuno, penelitian dan terobosan baru, digabungkan dengan teknologi tinggi modern, melalui penelitian bertahun-tahun berhasil menciptakan terobosan terbaru herbal alami yang sangat berkhasiat untuk mengobati berbagai macam penyakit radang hidung dan tenggorokan serta asma sampai ke akar-akarnya, yakni “San Lian He Xiao Yan Fang Fa” dan “Yi Tian Ding Chuan San”. Metode pengobatan herbal sinshe ini memiliki hasil efektifitas yang sangat tinggi, persentase keberhasilannya sangat tinggi, tidak beracun, tidak memiliki efek samping, tidak peduli kondisi penyakit ringan/ parah, usia tua/ muda, riwayat penyakit panjang/ pendek, ratarata begitu konsumsi obat herbal akan terasa khasiatnya, rata-rata diobati sekitar 3-7 hari semua gejala penyakit berangsur menghilang, dengan obat 2-3 tahap pengobatan bisa diatasi, sesudah diatasi tidak mudah kambuh. “Dapatkan program promosi khusus bagi yang datang berobat ke Sinshe Hongkong.” Untuk konsultasi dan pengobatan, hubungi: Sinshe Hongkong, Jl. Agus Salim No. 126 Pontianak, telepon: 0561-733268, 0821 52797 888 (Hari Minggu & libur tetap buka).(a2/biz)

Penelitian Jamu untuk Atasi Kanker

Jumraini menjelaskan, sakit kepala primer bisa sembuh sendiri tapi dengan catatan, menghilangkan penyebabnya. “Penyebab sakit kepala primer ini bisa karena stres, tegang, dan sebagainya. Tidak hanya tindakan mengambil obat untuk menghilangkan sakit kepala. Namun juga penting mengetahui jenis dan penyebab sakit kepala yang dialami sebelum menentukan obat yang sesuai,” jelas Jumraini. Lebih lanjut ia menjelaskan, sakit kepala karena ketegangan otot, memiliki ciri khas. Seperti sakit kepala sering terjadi, nyeri hilang timbul, tidak terlalu berat, dan diarasakan bagian depan hingga kebelakang secara menyeluruh. Sedangkan migrain, nyeri terjadi di dalam pelipis, terjadi disekitar mata atau pelipis, berdenyut pada satu sisi kepala dan kadang disertai mual dan muntah. Sementara Akbar menjelaskan, ciri dari sakit kepala sekunder yang disebabkan karena adanya kelainan antomi seperti tumor otak adalah nyeri bersifat ringan sampai berat. Sakitnya bisa dirasakan di satu titik atau di seluruh kepala, mengganggu penglihatan, dan perubahan mental. “Jika terjadi sakit kepala seperti ciri-ciri yang disebutkan di atas, maka penyebabnya harus dihilangkan. Seperti yang dijelaskan sebelumnya, jika sakitnya karena stres maka stres ini harus dihilangkan. Begitu juga dengan sakit kepala yang disebabkan tumor otak atau infeksi dan pendarahan otak. Mau tidak mau harus dilakukan pengangkatan,” ucap Akbar. (ulf/die)

SAMPAI saat ini pemerintah belum menjamin keampuhan khasiat jamu untuk mengatasi kanker. Tetapi Kementerian Kesehatan (Kemenkes) berencana menjalankan penelitian terkait manfaat penggunaan jamu dan terapi non-konvensional untuk penderita kanker. Dalam symposium The Role Of Internist in Cancer di Jakarta kemarin, Menkes Nafsiah Mboi menargetkan penelitian jamu dan terapi non-konvensional untuk penderita kanker ditarget beres 2015 nanti. “Penelitian pelayanan berbasis pengobatan non konvensional (jamu dan sejenisnya, red) yang telah dilakukan untuk hipertensi, hiperglikemia, hiperkolesterolemia, dan penyakit degeneratif lainnya,” kata Nafsiah. Sedangkan penelitian penggunaan obat-obatan untuk pengidap kanker, tegas Nafsiah, baru akan diumumkah hasilnya pada 2015 nanti. Dia tidak memungkiri jika saintifikasi jamu merupakan program pemerintah yang mulai dicanangkan pada 2010 lalu. Nafsiah mengklaim jika pemerintah telah melahirkan 200 dokter dengan kompetensi penelitian berbasis pelayanan kesehatan tra-

disional. Upaya ini penting karena keanekaragaman hayati di Indonesia sangat melimpah. Nafsiah menegaskan jika upaya saintifikasi ini diambil supaya penggunaan obat bisa diterima sebagai terapi standar dunia kedokteran konvensional. “Pengujian secara bukti ilmiah perlu dilakukan untuk obat tradisional,” kata dia. Dalam mempersiapkan saintifikasi ini, Nafsiah mengakui pihaknya menemui sejumlah hambatan. Diantara yang paling besar adalah urusan pendanaan. Namun Nafsiah bertekan akan mencari solusi untuk urusan pen-

danaan itu. Sebab dia mendapatkan laporan penelitian jika sejumlah formula jamu ternyata terucu secara ilmiah terbukti manjur untuk penyakit tertentu. Dia mengaku sudah tidak sabar untuk menerima laporan penelitian penggunaan jamu untuk pengobatan kanker. Nafsiah juga mengatakan, pemerintah saat ini telah menggodok rancangan peraturan pemerintah (RPP) tentang Pelayanan Kesehatan Tradisional. Dengan adanya RPP ini, Nafsiah menuturkan sudah ada dasar hukum untuk penggunaan jamu sebagai bagian dari layanan kesehatan. (wan/jpnn)


14 Editorial Kenaikan Harga Elpiji 12 Kg PERTAMINA mengusulkan kenaikan harga elpiji 12 kilogram (kg) sebesar 36,2 persen mulai Maret 2013 kepada pemerintah. Harga jual elpiji 12 kg direncanakan naik dari sebelumnya Rp 5.850 menjadi Rp 7.966,7 per kg atau naik Rp 2.116,7 per kg. Kenaikan harga itu diklaim Pertamina akan mengurangi kerugian dari bisnis elpiji 12 kg sebesar Rp 1,1 triliun atau menjadi tinggal Rp 3,9 triliun. Kenaikan harga elpiji 12 kg diyakini tidak akan memengaruhi masyarakat berpenghasilan rendah dan usaha kecil karena penggunanya berpenghasilan menengah ke atas. Untuk konsumen berpenghasilan rendah dan usaha kecil, sudah disediakan elpiji bersubsidi 3 kg. Pertamina kali terakhir menaikkan harga elpiji 12 kg pada Oktober 2009 sebesar Rp 100 per kg dari sebelumnya Rp 5.750 menjadi Rp 5.850 per kg. Padahal, biaya produksi elpiji terus mengalami kenaikan dari sebelumnya pada 2009 hanya sekitar Rp 7.000 menjadi Rp 10.064 per kg. Dengan biaya produksi saat ini Rp 10.064 per kg dan harga jual ke agen hanya Rp 4.912 per kg, ada selisih Rp 5.152 per kg yang mesti ditanggung Pertamina. Namun, hitung-hitungan bisnis itu tidak klop dengan hitung-hitungan pemerintah yang acuannya sama sekali berbeda dengan yang digunakan Pertamina. Melalui Menko Perekonomian Hatta Rajasa, pemerintah menilai rencana kenaikan tersebut tidak tepat jika dilakukan saat ini. Kondisi masyarakat tidak memungkinkan untuk menanggung beban naiknya harga elpiji 12 Kg. ”Waktunya tidak tepat,” tegas Hatta. Lantas, kapan waktu yang tepat? Sejauh ini belum ada penegasan dari pemerintah. Dengan tidak segera memberikan solusi kepada Pertamina atas dampak yang ditanggung dengan menahan harga elpiji 12 kg, pemerintah terlihat gamang. Apabila hal itu dibiarkan berlarut-larut, bukan hanya Pertamina, konsumen juga dirugikan. Seperti yang terjadi beberapa waktu terakhir, harga elpiji 12 kg di beberapa daerah naik. Selain itu, di beberapa daerah terjadi kelangkaan. Apa pun pertimbangannya, baik inflasi maupun politik, sebaiknya ditegaskan saja, tidak setuju harga dinaikkan dengan sebuah alasan dan tindakan yang bisa dipertanggungjawabkan. Jika memang tidak setuju, pemerintah bisa secara tegas dan resmi menolak rencana Pertamina untuk menaikkan harga elpiji. Setelah itu dilakukan penyelesaian politis, administratif, dan keuangan dengan Pertamina. Secara politis, pemerintah bisa memilih opsi menjadikan elpiji 12 kg barang subsidi. Namun, pilihan tersebut pasti mengundang gelombang gugatan. Opsi administratif dan keuangan bisa jadi paling tepat. Yakni, pemerintah bersedia mengurangi setoran dividen Pertamina ke pemerintah. Ini pilihan masuk akal. Sebab, keputusan menaikkan harga elpiji 12 kg pada dasarnya murni aksi korporasi karena merupakan barang nonsubsidi lantaran memang tidak terkait APBN. Persetujuan pemerintah semestinya hanya terkait dengan momentum dan pemerintah harus siap menanggung dampaknya. Tahun depan terjadi pemilihan umum. Hal ini membuat tidak ada waktu yang tepat untuk kebijakan tak populis. Pertimbangan politis pasti lebih dikedepankan daripada inti masalah, yakni ada produk nonsubsidi yang diintervensi. Jika demikian adanya, bisa dipastikan, kalau tidak terjadi tahun ini, kenaikan harga elpiji 12 kg tidak akan terjadi juga tahun depan. (*)

Pontianak Post

Pontianak Post

Selasa 12 Maret 2013

Ketika TNI Main Serbu oleh Mahmudi Asyari

DI sela-sela argumentasi mencari pembenaran, saya sangat menghargai pernyataan Menteri Koordinator Politik, Hukum, dan Keamanan (Menkopolhukam) Marsekal (Purn) Djoko Suyanto, yang menegaskan, “Apa pun alasannya, menyerang Mapolres adalah salah!” Pernyataan itulah yang semestinya keluar dari petinggi TNI sesaat setelah kejadian main serbu itu terjadi. Janganlah mencari-cari pembenaran dengan kejadian sebelumnya. Seharusnya pula ketika ada anggota Polri main tembak, Kapolri mengatakan serupa yang dikatakan Menkopolhukam tersebut. Sekiranya seperti, paling tidak anggapan mengendapkan kasus tidak akan mengemuka. Berkaitan dengan hal itu, melihat latar belakang memang perlu. Akan tetapi, bukan boleh menjadi pembenaran. Sekiranya semua proses hukum bisa menoleh ke belakang, tentu bukan hanya anggota TNI atau Polri yang boleh melakukan anarkis. Masyarakat yang merasa tidak mendapat keadilan pun tentu boleh melakukan hal serupa. Mereka juga berhak merasa tidak puas, terlebih lagi, sebagaimana sudah menjadi rahasia umum, melaporkan kehilangan kambing ke polisi tidak jarang malah kehilangan sapi. Meskipun kasus lain seperti rebutan lahan sangat bisa menjadi pemicu yang mendompleng kasus penembakan itu. Dalam konteks penegakan hukum, bukan hanya TNI yang boleh merasa tidak puas. Rakyat sudah ke ubun-ubun rasa tidak puasnya. Hanya, jika rakyat berani menyerbu, nanti dibilang teroris. Ketika sudah ada stigma teroris seperti pengikut PKI yang wajib mati. Berkaitan kasus tersebut, mengetahui motif memang perlu, namun bukan untuk menjadi pembenaran sehingga dengannya merasa tidak perlu menghukum para penyerang. Menurut saya, sebagaimana ditegaskan Menkopolhukam,

Ilustrasi : Kekes

apa pun alasannya sudah salah, tinggal dipetakan peran masingmasing. Ikut-ikutan pun harus disanksi berat, karena secara hukum dianggap membiarkan atau membantu terjadinya pelanggaran hukum. Bahkan, sesuai doktrin militer universal di mana seorang komandan bertanggung jawab atas aksi anak buahnya, komandan batalyon atau dandim sekali pun tidak bisa lepas tangan begitu saja, karena aksi melanggar hukum itu tidak lepas dari ketidaksanggupannya mengendalikan anak buahnya. Maka, tepatlah ungkapan Presiden Sukarno di Bandung pada sekitar tahun 1950-an bahwa seorang prajurit tidak pernah salah. Komandanlah yang harus disalahkan, karena ketidakmampuan mengendalikan anak buahnya. Seharusnya, petinggi TNI saat ini, selain mendengar pernyataan Menkopplhukam, harus meniru ketegasan Jenderal (Purn) Riyamizard Riacudu. Jenderal yang terkenal keras terhadap infiltrasi intelijen asing tersebut, sudah beberapa kali memecat anak buahnya yang terlibat bentrok dengan Polisi. Terakhir ketika di Sumatera Utara

sebuah batalyon mengepung kota lantaran berseteru dengan Polisi. Sang jenderal tanpa ragu membekukan batalyon itu. Sehingga, sekiranya dia masih KSAD, barangkali tidak akan ribut dengan Tim Investigasi, karena dia pasti akan dengan cepat bertindak. Sebagaimana dijelaskan pihak Polri di OKU bahwa komandan mereka tidak mengetahui tindakan anak buahnya, menurut saya, bukan serta merta seorang komandan bisa lepas tanggung jawab. Ketika kasus itu terjadi, berarti komandan lalai dalam pengawasan sehingga orangorang itu bisa keluar dari barak secara bersamaan. Pastilah seorang komandan barak tahu, karena rumah komandan biasanya di depan. Itu, jika memang benar-benar tidak membiarkan. Akan tetapi, taruhlah memang tidak tahu ketika bergerak, namun beberapa saat kemudian tahu ada penyerangan sehingga semestinya bisa segera memerintahkan. Dan, menurut penjelasan Dandim di OKU, ada satuan TNI AD dari Kodim dan PM yang berusaha mencegah.

Namun, kenapa terus terjadi pembakaran? Saya yakin bukan pembiaran. Bagaimana mungkin seorang perwira bisa membiarkan hal itu. Akan tetapi, yang sangat dikhawatirkan adalah mereka tidak menghargai komandan. Apabila ini terjadi, tentu sangat berbahaya bagi masyarakat, karena bukan sesuatu yang mustahil jadi sekelompok orang liar. Terkait kemungkinan komandan tidak dihargai, Saurip KD mempunyai penjelasan. Sebagaimana dilontarkan dalam sebuah wawancara di Metro TV lantaran saat ini air tidak mengalir dari atas. Menurutnya, air justru muncrat ke atas. Dengan kata lain, perwira hidup dari usaha anak buahnya yang menurut UUTNI semestinya dicegah. Akan tetapi, mau dicegah bagaimana karena kesejahteraan kurang dan karena mereka harus mencari lahan meskipun UU TNI menegaskan tidak boleh membawa-bawa atribut TNI. Akibatnya, ketika ada masalah komandan sulit bertindak karena ikut hidup dari mereka. Dan, sekiranya bertindak pun pasti tidak didengar. Akibatnya, terjadilah seperti

di OKU yang meskipun—sebagaimana ditegaskan pihak TNI— komadan dan PM berusaha mencegah, namun pengerusakan tetap berlangsung. Terlepas dari sikap salah yang semestinya tidak perlu diperdebatkan lagi bagi para anggota yang merusak kantor pemerintah, pihak Polri juga harus berintrospeksi atas ulah sejumlah anggotanya yang lebih mementingkan uang ketika akan melayani masyarakat. Dan, menurut saya, apa pun pelanggaran anggota TNI jika masih dalam ranah lalu lintas sangat tidak pantas untuk ditembak. Dalam menangkap pelaku pidana saja—jika acuannya hukum—ada tatacaranya termasuk kapan menembak. Itu pun bukan untuk membunuh. Sehingga, dari segi apa pun alasannya, menembak pelanggar lalu lintas sangat tidak patut dan berlebihan. Terkait hal itu, selain prosesnya terbuka, anggota Polri yang melakukan penembakan harus dihukum berat. Kepada TNI dan Polri, jadikanlah kasus tersebut kasus terakhir. Masingmasing harus merasa berkewajiban menaati hukum agar rakyat merasa mendapatkan teladan.*

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Per­setujuan Peru­bahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11­September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redak­si: (0561) 735070.Telepon Iklan/Pema­saran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: redaksi@pon­ Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Re­daksi/Penang­gung Jawab: B Salman. Redaktur Pelaksana: Khairul­rahman, Muslim Minhard, Donatus Budiono, Basilius. Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar, Efprizan. Sekre­taris Redaksi: Silvina. Staf Redaksi: U Ronald, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari Jawa Pos Group Kurniatama, Hendy Irwandi, Pracetak/Artistik: Mochsinin (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: Hari Kurniatama (Jl P Anom Telp (0562) 392683) Biro Sanggau: Sugeng (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Asri Isnaini, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Sutami. Pema­saran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Lang­ganan per 1 Bulan dalam kota Rp 80.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 40.000,- full colour Rp 50.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, mak­­si­mal 10 baris) pem­bayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Ming­gu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.

Pontianak Post •

aneka Pontianak

Warga Keluhkan Air PDAM Keruh Sambungan dari halaman 9

”Saya terpaksa membeli air. Sebab, memang sudah dua hari air PDAM keruh,” ujarnya. Kata dia air yang mengalir di rumahnya di kawasan perumahan sebelumnya jernih dan langsung bisa untuk kebutuhan dapur. Namun karena saluran airnya keruh, ia tidak bisa berbuat apa-apa bersama warga komplek sekitar. Warga setempat juga ikut protes. ”Secepatnya minta diatasi. Mudah-mudahan hanya pagi saja keruhnya,” ungkap dia. Ia bersama warhga berharap agar air keruh tidak terjadi lagi, karena berlangganan air juga tidak murah. Biaya langganan air bersih mencapai dari Rp50.000 sampai Rp100.000 per bulan. Makanya warga ikut protes kalau air yang diterima keruh dua hari berturut-turut ini. Sebelumnya Warga Kom-

plek Hanura Permai II, Kecamatan Sungai Raya, Kabupaten Kubu Raya resah dan panik. Sebab, sudah empat bulan lamanya, pelayanan air bersih PDAM Kubu Raya tak mengalir seperti biasa. Akibatnya kebutuhan mandi, cuci dan kakus terpaksa kembali ke cara lama. “Ya, kebanyakan warga kami terpaksa mencuci ke Sungai Kapuas. Meskipun begitu, kami tetap harus bayar. Saya pribadi harus bayar minimal biaya abodemen Rp58 ribu rupiah meskipun airnya tidak mengalir. Namun ada juga bayar Rp100 lebih walaupun airnya juga tidak mengalir,” ungkap Edy Ax, Ketua RT015/RW02, Komplek Hanura Permai II, Senin (04/3) di Pontianak. Ia menambahkan sudah beberapa kali protes diajukan warga Komplek Hanura Permai II ke PDAM Kubu Raya. Namun tetap saja belum

Jadi Perhatian Serius digubris. Pihaknya sendiri tidak mengetahui apa penyebab pasti, air PDAM tidak mengalir seperti biasa. “Yang pasti ledeng mampet sudah lama. Tidak jelas penyebab pastinya,” kata dia. Dia menambahkan meskipun tidak mengalir, warga tetap saja membayar dengan harga tidak murah. Warga meminta PDAM harus memperhatikan keluhan mayarakat di kompek tersebut. “Bayar tetap mahal, namun air tetap saja tidak jalan. Kami disini ada 120 rumah atau 120 kepala keluarga yang memakai jasa PDAM. Mohon diperhatikan keluhan kami,” ucapnya. Dikonfirmasi terpisah Harmawan, kepala Bagian Umum dan Keuangan PDAM Tirta Raya justru belum mengetahui adanya air keruh di sekitar kawasan perumahan. ”Saya belum tahu. Akan tetapi akan kami cek dulu,” katanya. (den)

Dulu Terminal Angkutan Umum, Kini jadi ... Sambungan dari halaman 9

Mereka mempertanyakan mengenai kondisi dan kendala terminal saat ini. “Kita sengaja turun ke lapangan untuk melihat secara langsung kondisi terminal Batu Layang. Hal ini berkaitan dengan penggunaan anggaran dan restribusi yang dipungut dari tiket, apakah sudah dipergunakan sebagaimana mestinya,” ungkap Nanang Setia Budi, Ketua Komisi B DPRD Kota Pontianak, disela pemantauan, Senin (11/3). Menurut Nanang, dengan dana yang tersedia melalui anggaran dan restribusi, seharusnya kondisi terminal lebih baik. Sehingga kenyamanan baik penumpang maupun bus yang masuk bisa didapatkan. “Bagaimana bus dan penumpang mau masuk ke terminal kalau sarana dan prasarananya saja sudah tidak layak dipergunakan. Makanya sepi seperti ini. Rukonya saja sudah banyak yang tidak berfungsi, bahkan kini sudah jadi terminal Walet,” kata Nanang. Di samping itu, Nanang mengungkapkan, sepinya terminal juga dikarenakan maraknya penggunaan jasa angutan yang langsung masuk ke kota. Sebab masyarakat menilai lebih efektif meskipun harus mengeluarkan biaya lebih. “Dinas perhubungan mengeluhkan hal ini sejak lama, padahal jasa angkutan baik taksi maupun bus harus masuk

ke terminal, sehingga jasa bus kota pun akan termanfaatkan. Meskipun tidak ada aturannya namun sebenarnya tidak diperbolehkan dan harus ditertibkan. Kita juga mengharapkan peran serta dari pihak kepolisian,” tuturnya. Untuk memperbaiki sarana dan prasarana yang tidak memadai, lanjut Nanang, akan dilakukan rapat kerja antara dewan dan dinas terkait. Karena tentunya hal tersebut bersangkut paut dengan anggaran. Bahkan pihaknya akan melakukan evaluasi, apabila dirasakan terlalu besar, maka akan mempergunakan APBD Provinsi atau APBN. Akan tetapi pihaknya akan mengikuti perkembangan yang ada, dimana fungsi dan pemanfaatan sarana dan prasarana di terminal terlaksana sebagaimana mestinya. “Anggaran tahun ini untuk terminal Batu Layang memang ada namun tidak besar. Kita ingin menganggarkan lebih besar sepertinya terbentur dengan sarana dan prasarana terminal saat ini belum termanfaatkan dengan baik. Walaupun terminal besar, tapi bis yang masuk tidak banyak percuma juga. Kalau ada input, maka harus ada realisasi penggunaannya di lapangan,” jelas dia. Kepala Unit Pelaksana Teknis Dinas (UPTD) Perhubungan Kota Pontianak, Burhan, mengakui saat ini sarana dan prasarana di terminal Batu Layang masih

sangat kurang. Fasilitas tersebut diantaranya loket untuk tiket, sarana air bersih, serta penerangan. “Kita sebenarnya sudah melaksanakan koordinasi, dan katanya secara bertahap akan diperbaiki,” kata Burhan. Selain itu, penyebab sepinya terminal kata Burhan adalah sulitnya pihak Dishub untuk menertibkan kendaraan angkutan umum yang tidak mau masuk ke terminal. Tak hanya yang resmi, seperti bus luar kota dan taksi berplat kuning, namun taksi gelap juga turut menjadi penyebab sepinya penumpang di terminal. “Padahal sejak dikeluarkan Perwa Nomor 22 tahun 2007, penertiban tersebut sudah dilakukan. Namun jumlahnya malah bertambah. Jadi kita kerepotan menertibkan mereka. Bahkan sekarang bus luar kota lebih pintar, mereka menunggu di wilayah perbatasan Kabupaten dan Kota. Setelah jam operasional selesai, mereka baru masuk,” ujar Burhan. Untuk itu, Burhan mengharapkan dengan perbaikan fasilitas terminal, maka akan dapat menarik penumpang dan bus kembali menggunakan terminal Batu Layang, sehingga kondisinya tidak terkesan terbengkalai seperti saat ini. “Kita tidak minta yang muluk-muluk, hanya ingin perbaikan fasilitas sehingga tercipta kondisi terminal yang tertib dan bagus dari saat ini,” pungkas dia. (*)

Agus Ngaku Dipukul Guru Sambungan dari halaman 9

Siswa kelas lima itupun langsung ditarik untuk diserahkan kepada Diah, wali kelasnya. Bukannya menasehati, malah tangan guru tersebut yang menempel di bibir serta leher Agus yang menimbulkan luka. “Saya sempat disuruh makan lima biji cabai rawit sebagai hukuman, namun saya tidak mau dan langsung kabur,” akunya Minggu (10/3). Tidak puas, wali kelas tersebut lantas menyuruh Charles salah satu guru pria untuk mengejar. Baju pramuka yang dikenakan Agus, langsung sobek karena ditarik dengan paksa. Sesampainya di ruang kepala sekolah, wali kelas tersebut langsung mendaratkan tangannya. Namun tidak kena, sebab Agus langsung mengelak. Pada saat kejadian tersebut, Yetje Katrine, kepala sekolah sedang berada di ruang kerjanya. Ia pun menyarankan Agus untuk minta maaf, namun belum sempat Agus bicara, sang wali kelas malah nantang Agus untuk berkelahi di luar ruang kepala sekolah. “Saya sempat disuruh untuk melaporkan kejadian tersebut ke kantor polisi, dan guru tersebut tidak takut dengan polisi karena dirinya banyak kenal anggota di Polsek Pontianak Barat,” ujarnya. Sebagai seorang ibu, Santi pun berusaha mencari kebenaran. Setibanya di sekolah, ia melihat Agus sudah tidak menggunakan seragam sekolah lagi karena bajunya sudah sobek akibat ditarik oleh guru. “Menurut guru tersebut, anak saya lari dan ditangkap, karena kata bu Diah, anak saya melawan dan ngomong jorok melecehkan guru,” jelas Santi. Katanya lagi, saat Agus dipukul oleh wali kelasnya dirinya tidak bereaksi. Kata Santi, dirinya dituduh tidak bisa mengajar anaknya lagi. Ibu empat anak ini juga semcmyk


Selasa 12 Maret 2013

pat membawa saksi yakni Raja, yang menanyakan password facebook kepada Agus. Namun, menurut Santi, kepala sekolah enggan menerima dan meminta agar urusan ini diselesaikan secara internal tanpa melibatkan orang lain. Usai kejadian tersebut, Yetje Katrine memintanya pulang sembari akan menyelesaikan persoalan tersebut bersama guru kelasnya. Namun, saat Agus pulang ke rumah, wali kelasnya tersebut enggan memberi maaf. Kata Santi, anaknya tersebut menceritakan bahwa wali kelasnya tersebut tidak maafkan. Kalau tidak dimaafkan, maka sekolah akan memberi Agus sanksi lagi. “Saya minta kasus ini diusut, kasihan dengan anak-anak lain. cukup anak saya saja yang menjadi korban,” pungkasnya. Kepala Sekolah Dasar Pelita Harapan Yetje Katrine membantah adanya pemukulan terhadap Agus. Menurut Yetje, pada saat kejadian, dirinya mengaku sedang tidak berada di tempat. Namun ia mendengar dari guru-guru yang lain bahwa pada saat itu, Agus marah-marah di luar kelas dan disuruh masuk ke ruang guru. “Tapi dia berontak, dan kemungkinan bajunya tersebut terkena tangan salah satu guru yang kebetulan berusaha membawa Agus ke dalam ruang guru,” aku dia, Senin (11/3). Lanjut dia, Agus pun lantas membuka baju serta membuangnya di tanah, dan langsung lari. Tidak lama kemudian, Santi ibu siswa tersebut datang ke sekolah dan menanyakan masalah anaknya. Kepala sekolah itupun menjelaskan bahwa anak tersebut yang salah, dan menpersilakan Santi untuk pulang karena akan diselesaikan dengan pihak sekolah. Tambahnya lagi, siswa kelas lima tersebut disuruh untuk meminta maaf kepada wali kelasnya. Namun,

wali kelas mau memaafkan dengan syarat bahwa Agus harus mengubah kelakuannya. “Agus kembali lagi, dan katanya sang wali kelas enggan memaafkan. Tapi kata saya, kalau guru tidak memaafkan, bukan kamu yang menanggung dosanya tapi guru tersebut,” ujarnya. Kepala sekolah ini pun tidak menyangka, kalau kasus tersebut dilaporkan orangtua siswanya ke Mapolsekta Pontianak Barat. Iapun baru tahu, setelah salah satu komite yang juga sebagai anggota di Polsekta Pontianak Barat mengabarkan hal tersebut usai kedua orangtua Agus melapor. “Pagi hari saya langsung kerumah Agus, mencari orangtuanya untuk menanyakan mengapa harus dilapor, kan bisa diselesaikan,” sesalnya. Katanya lagi, pada saat itu, orangtua Agus juga tidak ada menghubungi dirinya. Namun kedua orangtua Agus bersikeras, tetap tidak terima karena anaknya ditampar hingga luka. Padahal kata Yetje, dirinya tahu bahwa Agus pada saat itu sedang sariawan. “Tapi ya sudah lah, guru tersebut juga siap jika dipanggil pihak kepolisian. Pastinya sebelum diproses akan dilakukan mediasi antara kedua belah pihak. Namun sampai sekarang, belum ada panggilan,” paparnya. Kasus pemukulan siswa yang berujung pada laporan ke pihak kepolisian kata Kanit Reskrim Polsekta Pontianak Barat, IPDA Suprayogi, secepatnya akan dilakukan pemangilan guru yang dilaporkan tersebut. “Kita panggil segera yang bersangkutan, baik Diah maupun Charles, langkah akhir akan dilakukan mediasi. Kalau tidak berhasil mediasi akan kita lanjutkan sesuai dengan proses hukum. Keduanya bisa dikenakan pasal perlindungan anak karena korbannya masih d ibawah umur,” tegas dia. (arf)

Sambungan dari halaman 9

Jangan main tuduh atau main hakim sendiri,” ungkapnya. Armijn mengakui kasus pelecehan seksual yang melibatkan anak sebagai pelaku maupun korban sangat tinggi. Sejak tiga bulan terakhir pada tahun ini terjadi sekitar tujuh kasus. Kasus ini terjadi di kabupaten dan kota di Kalbar, seperti Melawi, Landak, dan Sintang. ”Ini termasuk sangat tinggi sebenarnya. Ini yang saya tangani. Belum lagi dari lembaga lainnya. Lembaga lain juga ada. Pelaku ada yang dewasa, ada juga anak-anak,” jelas Armijn.

Menurut Armijn, perlu dilakukan penelitian terhadap peningkatan kasus pelecehan seksual yang melibatkan anak. Peningkatan ini bisa disebabkan karena masyarakat mulai terbuka dan berani melapor. Apalagi saat ini lembaga swadaya masyarakat dan pemerintah gencar melakukan sosialisasi sehingga masyarakat merasa aman dalam melapor. ”Atau meningkat karena memang kasusnya banyak,” kata Ketua Himpunan Psikolog Provinsi Kalbar ini. Terkait regulasi, lanjut Armijn, cukup bagus. Hanya saja dalam pelaksanaan aturan tersebut pemerintah

harus lebih sensitif terhadap anak, khususnya terhadap anak sebagai pelaku. Begitu pula terhadap korban, pemerintah harus lebih responsif. ”Saat ini masih ada pejabat pemerintah yang kurang responsif,” katanya. Ia menambahkan sebagian besar pelaku dan korban memiliki hubungan dekat. Pelaku mengetahui secara jelas situasi korban, sehingga bisa melakukannya tanpa diketahui orang lain. ”Biasanya terencana. Korban bisa diancam. Pelaku biasanya orang dekat karena bisa melakukannya dengan aman dan sulit dilihat orang,” ungkapnya. (uni)

Paryadi Optimis Diusung Demokrat Sambungan dari halaman 9

Setelah melamar ke PDIP, Paryadi pada Minggu (10/3) ke ma r i n ju ga m e l a ma r Demokrat dan Partai Amanah Nasional (PAN). Ditemani puluhan simpatisannya, Wakil Wali Kota Pontianak yang mengusung moto Pontianak Sejahtera mendatangi Sekretariat Partai Demokrat pukul 14.00 dan Sekretariat Partai Amanah Nasional, pukul 15.00. Pa r ya d i o p t i m i s b i s a mendapatkan perahu Demokrat, karena penilaian bukan melalui keputusan tim sembilan, melainkan melalui lembaga survei. “Ini adalah partai yang mengutamakan sesuatu yang rasional dalam mengambil keputusan. Bukan berdasarkan kepentingan individu maupun golongan. Keputusan tepat adalah melalui survei oleh sebuah lembaga yang independen,” ungkap Paryadi. Jika melalui sebuah lembaga survei yang akan menilai popularitas dan elektabilitas seorang calon, Paryadi yakin sebagai kader yang layak dan dikenal masyarakat. Tanpa meremehkan kedua saingannya yakni Hartono Azas dan

Bobby Chrisnawan, Paryadi masih sangat optimis. “Insya Allah. Saya masih optimis,” ujar dia. Tim sembilan dijelaskan Paryadi, akan berisi tiga orang dari DPP, tiga orang dari DPD dan tiga orang dari DPC. Tim sembilan, jelas dia, hanya menentukan layak tidaknya seorang calon untuk mewakili partai. “Tim sembilan bukan pengambil keputusan mutlak,” tegas dia. Sementara itu, Anggota DPRD Kota Pontianak asal Partai Keadilan Sejahtera, Arif Joni Prasetyo, mendaftar ke Partai Golkar sebagai calon Wakil Wali Kota Pontianak, di Gedung DPD Golkar Pontianak, Senin (11/3). Saat mendaftar, Arif ditemani Ketua Fraksi PKS DPRD Kota Pontianak Ikhsan Syamsi dan Sekretaris Fraksi Pramono Tripambudi. Pendaftaran ini diterima Ketua DPD Partai Golkar Kota Pontianak, Heri Mustamin dan panitia pendaftaran Erick S. Martio. Arif Joni mengatakan, Partai Golkar merupakan calon mitra koalisi PKS yang potensial. “Saya berharap bisa bersama Golkar dalam pemilu wali kota Pontianak. Kami akan ikuti prosedur yang berlaku di

partai Golkar, agar saya lolos sebagai calon Wali Kota Pontianak. Kalau terjadi koalisi PKS dan Golkar, saya rasa ini koalisi yang kuat. Koalisi ini juga menggambarkan kekuatan yang plural, nasionalis dan religious,” jelas Arif memberi alasan mengapa memilih Golkar. Selain dengan Golkar, PKS tidak menutup kemungkinan akan menggandeng partai lain dalam satu koalisi besar. “Kami memiliki visi-misi yang akan saya usung adalah mewujudkan Kota Pontianak yang sejahtera. Dengan pendidikan, kesehatan serta pelayanan publilk yang lebih diprioritaskan,” lanjutnya. Ketua DPD Golkar Heri Mustamin mengatakan, hingga saat ini sudah ada 5 orang yang telah mendaftar sebagai calon wali kota dan 10 orang yang mendaftar untuk calon wali kota. Partai Golkar masih melakukan penjaringan pada calon-calon tersebut. “Nanti kita akan survey lagi dan kita rekap. Hasilnya akan kita serahkan ke DPD Provinsi dan kemudian akan dikirim ke DPP Golkar. Siapa yang terpilih nantinya akan didasarkan pada tingkat elektabilitas calon,” katanya. (her/bdi)


Terganggu Perekaman Sambungan dari halaman 16

Menurut Sopiandi, laporan tentang kerusakan diterimanya secara tertulis dari pemerintah kabupaten dan kota. Laporan ini pun diteruskan secara tertulis kepada Dirjen di Kementerian Dalam Negeri. ”Tetapi pihak di sana tidak memberikan jawaban tertulis. Saya sudah mengirim surat

resmi untuk meminta Dirjen memberikan jawabannya,” ungkap Sopiandi. Tindakan lain yang dilakukan yakni dengan menggelar pertemuan bersama pemerintah kabupaten dan kota di Kalbar besok, Rabu (13/3) di salah satu hotel di Pontianak. Dalam pertemuan tersebut pemerintah provinsi mendatangkan Direktur dari Kemendagri yakni Korwil

lima yang membawahi Kalbar, untuk menjelaskan dan mendengar penjelasan maupun masalah perekaman e-KTP dari kabupaten dan kota. ”Nanti dalam pertemuan itu kami meminta kabupaten dan kota menyampaikan keluhan dan memberikan pelaksanaan penjelasan mengenai perekaman e-KTP di wilayahnya masing-masing,” ungkap Sopiandi. (uni)

Sutarmidji: Jadilah Atlet Berprestasi Sambungan dari halaman 16

Mulyadi mengatakan, peserta kegiatan terdiri dari 504 pelajar tingkat sekolah dasar dan 1.804 peserta tingkat sekolah menengah pertama. “Yang menang dalam kejuaraan ini akan mewakili kota Pontianak

di tingkat provinsi,” ungkap Mulyadi. Menurutnya, kegiatan ini digelar dengan jadwal berbeda untuk tingkat SD mulai 11 hingga 15 Maret. Tingkat SMP akan berlangsung mulai tanggal 1 hingga 5 April. Cabang olahraga yang diperlombakan

antara lain atletik, bulutangkis, catur, renang, tenismeja, sepaktakraw, karate, pencak silat. Sementara untuk cabang seni antara lain pidato, cerita bergambar, menyanyi solo, menari tarian daerah, pantomin, cipta puisi dan desain batik. (bdi)

meningkatkan razia-razia untuk menekan pelanggaran berlalu lintas, terutama pada kawasan yang dinilai sering terjadi pelanggaran,”ujar Hariyanta. Mantan Wakapolresta Metro Bekasi ini menambahkan, pihaknya tetap akan menjaga, mengatur lalu lintas agar tidak semakin semerawut dengan keterbatasan yang ada dan semaksimal mungkin. Hariyanta menyatakan,

jika polisi lalu lintas sering dinilai tidak baik oleh masyarakat, maka sebenarnya mereka sangat merindukannya, “Sebenarnya image yang terjadi di kalangan masyarakat itu umumnya mereka benci dengan polisi lalu lintas. Pada saat mereka ditilang karena melanggar aturan, maka mereka begitu membenci. Tapi giliran terjadi kemacetan, mereka baru mencari polisi,” lanjutnya. (arf)

Kurang Sadar Sambungan dari halaman 16

kecelakaan,” lanjutnya. Selain itu, masih banyak orang tua yang memberikan izin pada anak-anaknya yang masih dibawah umur untuk membawa kendaraannya sendiri. Padahal, hal itu jelas-jelas dilarang karena anak sekolah belum cukup umur untuk mendapatkan Surat Izin Mengemudi (SIM), “Untuk itu, kami saat ini

Seleksi Anggota KPU Kalbar Didominasi ... Sambungan dari halaman 16

”Total pendaftar adalah 59 mereka. Setelah kami teliti, hanya 32 saja yang lolos. Mereka yang tidak lolos karena tidak memenuhi sejumlah kelengkapan administrasi,” jelas Hamka saat ditemui di kantornya, Senin (11/3). Sejumlah persyaratan yang dimaksud antaralain, surat dari pengadilan yang menyatakan bahwa pendaftar tidak pernah tersangkut kasus hukum, usia minimal 30 tahun, dan tidak aktif di partai politik. ”Dari hasil seleksi ternyata ada calon yang usianya di bawah 30 tahun. Itu ada empat orang. Kita tidak loloskan. Selanjutnya ada juga yang kita teliti ternyata yang bersangkutan masih aktif di partai politik,” kata Hamka. Para pendaftar berasal dari berbagai bidang pekerjaan, mulai dari swasta, akademisi, wartawan, hingga anggota KPU daerah. ”Mereka

yang lolos kebanyakan sudah berpengalaman sebagai penyelenggara pemilu. Ada yang berasal dari KPU daerah, baik kota maupun kabupaten. Anggota KPU Kalbar periode lalu juga ada yang mendaftar,” paparnya. Seleksi tertulis akan dilaksanakan di hotel Orchardz pada Kamis depan. Selanjutnya akan dilaksanakan tes kesehatan pada 19 Maret dan tes psikologi pada 20 Maret. ”Untuk materi tes tertulis itu langsung dari KPU di Jakarta. Kami tidak tahu apa materinya. Para calon silakan mempersiapkan diri,” katanya. Secara terpisah, Direktur Lembaga Pengkajian dan Studi Arus Informasi Regional (LPS AIR) Deman Huri Gustira menyatakan, selama ini informasi mengenai pendaftaran calon Anggota KPU ini sangat minim. ”Tiba-tiba saja sudah diumumkan hasil seleksinya. Kok kesannya kurang transparan ya?” katanya.

Deman meminta agar proses seleksi anggota KPU ini lebih transparan lagi sehingga masyarakat bisa melakukan pemantauan. Deman juga mendesak tim seleksi untuk melakukan penelusuran (tracking) terkait rekam jejak para calon. Penelusuran ini perlu melibatkan tim independen. Hal ini diperlukan supaya mereka yang terpilih adalah benar-benar orang yang tepat. ”Kita perlu tahu profil mereka seperti apa? Selama ini bagaimana kinerja mereka,” kata Deman. Deman mengingatkan agar tim seleksi juga bisa bekerja secara profesional dan bebas dari segala tekanan partai politik. ”Kita tahu bahwa KPU itu memiliki peran sangat strategis dan sarat diintervensi partai politik. Karena itu pilihlah anggota kpu yang benar-benar punya integritas dan mampu membangun proses demokratisasi politik.,” katanya. (her)




Pontianak Post


Kurang Sadar KEMACETAN yang terjadi di beberapa ruas jalan protokol di Kota Pontianak dalam waktu-waktu tertentu dikarenakan masih kurangnya kedisiplinan para pengendaran. Hal itu diungkapkan Kepala Kepolisian Resor Kota Pontianak, Ajun Komisaris Besar Polisi Hariyanta, belum lama ini. Menurut Hariyanta, kemacetan yang sering terjadi pada jam anak ke sekolah dan pulang kantor tersebut diakibatkan disiplin berlalu lintas dari masyarakat masih rendah. “Pengguna jalan, masing-masing berebut ingin mendahului, sehingga terjadi kemacetan pada ruas jalan-jalan protokol Pontianak,” katanya. Hariyanta menilai, para pengguna kendaraan bermotor khususnya roda Dua juga terkesan tidak memprioritaskan keselamatan, baik diri sendiri maupun pengendara lain. “Contohnya, masih banyak masyarakat yang menerobos lampu merah pada perempatan, sehingga seri­ ng menyebabkan kemacetan, bahkan


Amankan Gula Ilegal Usai Tabrakan PONTIANAK - Sebuah minibus de­ngan nomor polisi KB 1119 QB diamankan aparat kepolisian karena diduga mengangkut puluhan karung gula yang diduga ilegal, Senin (11/3) siang di Jalan Patimura, Pontianak. Upaya penyelundupan gula ini terungkap setelah terjadi kecelakaan antara minibus itu dengan sebuah kendaraan bermotor dengan KB 5360 WB di depan Matahari Mall Pontianak. Kejadian itu berawal ketika minibus yang dikemudikan Isop melaju

dari Jalan Jendral Urip menuju pelabuhan Dwikora. Dengan waktu yang bersamaan, kendaraan bermotor yang dikendarai Siti itu melintas dari arah Jalan Patimura. Kedua kendaraan nahas itu pun bertabrakan tepat diperti-

gaan antara Matahari Mall dan Maskar Den Intel Kodam XII/Tanjungpura. Kendaraan yang melaju dari arah Jalan Patimura itu pun langsung menabrak moncong mobil. Korban terpental dan kepalanya

Ke Halaman 15 kolom 5


Terganggu Perekaman PEREKAMAN kartu tanda penduduk elektronik (e-KTP) di beberapa kabupaten kota di Kalimantan Barat mengalami gangguan. Kepala Biro Kependudukan dan Catatan Sipil Pemprov Kalbar, Sopiandi menegaskan gangguan tersebut berasal dari pemerintah pusat. ”Gangguan itu bukan dari kita, melainkan dari pusat. Gangguan ini hampir satu bulan,” ujar Sopiandi di Kantor Gubernur Kalbar, Senin (11/3). Sopiandi menjelaskan gangguan terjadi pada jaringan. Akibatnya proses Sopiandi perekaman di 14 kabupaten dan kota di Kalbar banyak gangguan. Mekanisme perekaman selama ini yakni dari kecamatan langsung ke kabupaten, kemudian kabupaten langsung ke pemerintah pusat. ”Bayangkan kalau lima ribu orang direkam, gangguan dan hilang. Pusat meminta kita (provinsi) melakukan perekaman, tetapi alat sering bermasalah,” keluh Sopiandi. Jika terjadi gangguan, data yang telah terekam tidak hilang, namun untuk membuka data tersebut harus dilakukan tenaga ahli dari Jakarta. Ke Halaman 15 kolom 5

Selasa 12 Maret 2013


AMANKAN: Sebuah mobil dengan diamankan aparat kepolisian karena kedapatan membawa puluhan karung gula yang diduga ilegal di Jalan Patimura, Pontianak.

menghantam kaca mobil, sehingga mengakibatkan kaca mobil retak. Sementara korban mengalami luka pada bagian wajah dan kaki kirinya. Kedua kendaraan itupun kemudian diamankan di Markas Den Intel Kodam XII/Tanjungpura. Namun saat dilakukan pemeriksaan lebih lanjut, diketahui minibus tersebut kedapatan mengangkut puluhan karung gula. Dewi, pemilik mobil sekaligus puluhan karung gula itu mengaku, mendapatkan gula tersebut dari Sekayam, Sanggau. Menurutnya, dia sudah tiga kali pulang pergi, Pontianak-Sanggau untuk mengangkut gula-gula tersebut. “Ini gula saya. Kami bawa dari Kembayan,” katanya saat ditemui di Markas Den Intel Kodam XII/Tanjungpura, kemarin. Isop mengaku, dirinya hanya dimin­ ta untuk menyopiri mobil milik Dewi dari Kota Baru menuju Pelabuhan Dwikora Pontianak. “Saya tidak tahu apa isi mobil itu. Karena saya hanya diminta untuk menyopiri saja. Sebenarnya ada sopirnya sendiri, karena dia tak masuk, maka Bu Dewi meminta saya,” kata Isop. Sementara itu kedua kendaraan tersebut diamankan untuk proses lebih lanjut. “Sementara ini kita amankan dulu. Terkait gula yang diduga ilegal ini akan diserahkan ke Reskrim untuk proses­lebih lanjut. Karena setelah diperiksa, ternyata gula di dalam mobil tersebut tidak dilengkapi dokumen. Menurut pengakuan pemilik gula berasal dari Kembayan,” kata Aipda Sri Supikat, salah satu petugas Lalu Lintas. (arf)

Sutarmidji: Jadilah Atlet Berprestasi Seleksi Anggota PONTIANAK - Wali Kota Pontianak Sutardmiji berharap di ajang O2SN dan FLS2N yang berlangsung 11 Maret hingga 5 April di Pontianak ini memberikan manfaat positif bagi kemajuan prestasi olahraga dan seni. Dia berharap kota Pontianak tetap menjadi barometer kemajuan bidang olahraga dan seni daerah ini dengan raihan prestasi yang membanggakan. Oleh karena itu, di ajang Olimpiade Olahraga Siswa Nasional (02SN) dan Festival Lomba Seni Siswa Nasional (FLS2N) harus mampu menghasilkan atlet-atlet dan duta-duta berprestasi. “Jadilah atlet-atlet berpresta-

si. Menjadi pemenang dan duta membanggakan agar dapat mewakil Pontianak di tingkat provinsi. Saya ingin melalui kegiatan ini Pontianak lebih dikenal secara luas di Indonesia dengan prestasi-prestasi yang diraih oleh duta olahraga dan seni,” ungkap Sutarmidji dihadapan ribuan siswa-siswi SD dan SMP baik negeri maupun swasta di Padang Ball Keboen Sajoek Pontianak, Senin (11/3) kemarin. Wali Kota juga meminta agar dewan hakim dan wasit betul-betul objektif dalam memberikan penilaian dalam perlombaan nanti. Penjurian





dalam kompetisi musti dilakukan secara fair dan jujur. Selain itu, tambah Wali Kota, untuk menciptakan generasi muda yang benar-benar memiliki kemampuan yang andal, para pelajar juga harus bersikap fairplay serta tidak melakukan hal-hal yang tidak baik dalam meraih juara. “Kepada penilai dan atlet semuanya harus mengedepankan objektivitas. Junjung tinggi semangat olahraga dan bersikaplah fairplay,” pinta Sutarmidji. Sementara itu, Kepala Dinas Pendidikan Kota Pontianak Ke Halaman 15 kolom 5

KPU Kalbar Didominasi Komisioner Aktif PONTIANAK - Tim Seleksi Anggota KPU Kalimantan Barat telah mengumumkan hasil seleksi administrasi calon anggota KPU Kalbar. Sebanyak 32 orang dinyatakan lolos dan selanjutnya akan mengikuti seleksi tertulis yang akan digelar pada

Kamis (14/3) mendatang. Ketua Tim Seleksi Anggota KPU Kalbar Hamka Siregar mengatakan sebanyak 27 orang dinyatakan gugur karena tidak memenuhi sejumlah persyaratan administrasi. Ke Halaman 15 kolom 5

Selasa 12 Maret 2013

pro-kalbar Pontianak Post

Konflik Sulu

Jangan Terprovokasi SENADA dengan yang dikemukakan Raja Ketapang, Gusti Kamboja yang menilai konflik­ yang berkecamuk di Sabah, Sarawak hingga hari ini seperti dilansir harian ini sepekan lalu harusnya bisa diselesaikan secara damai dan menggunakan diplomasi kebudayaan. Bahkan, ditegaskannya, konflik ini adalah masalah antar dua negara. Dan masyarakat Indonesia tidak berhak ikut Petrus SA campur. “Saya setuju bawha penanganan masalah tersebut dengan diplomasi Internasional. Kita tak perlu ikut campur. Karenanya saya juga mengimbau warga perbatasan agar jangan terprovokasi dengan konflik Sabah - milisi Sulu tersebut,” ujar pemuda perbatasan, Petrus SA. Dia menambahkan, diakui atau tidak, kawasan perbatasan rentan dengan konflik semacam itu. Hubungan emosional, karena



Yakin Bukan Rekayasa Video Pekerja Anak SINTANG—Forum aliansi masyarakat Korban Investasi (Famki) Sintang angkat bicara soal mencuatnya kasus PT SSA mempekerjakan anak dibawah umur yang beredar divideo. Famki turut meyakini kalau video tersebut bukan rekayasa. Perusahaan perkebunan di Sintang disinyalir juga banyak mempekerjakan anak dibawah umur.

“Kami sudah melakukan investigasi di 14 kecamatan lokasi areal perkebunan di Sintang. Hasilnya mungkin 90 persen perusahaan perkebunan kelapa sawit mempekerjakan anak dibawah umur. Sebetulnya butuh keseriusan pemerintah jika ingin menindaklanjutinya,” kata ketua Famki, Ricky Kuswanto, kemarin. Famki ikut meminta pemerintah jika ingin menyelesaikan perkebunan mempekerjakan anak secara serius. Bukan

setengah hati apalagi jika turun ke lokasi dengan member tahu pihak perusahaan. Pasalnya upaya demikian rentan sulit bisa mendapatkan informasi akurat. “Kami siap mendampingi pemerintah turun ke lokasi. Tapi berangkatnya harus seperti inspeksi mendadak. Supaya kenyataan dilapangan dapat diperoleh,” kata Ricky. Ricky menduga perusahaan mempekerjakan anak merupakan salah satu modus untuk mengelabui masyarakat,

kalau investasi memang bermanfaat, Yakni bisa menghasilkan pendapatan. Sehingga ketika libur sekolah maupun anak yang putus sekolah, tidak jarang ditemukan anak bekerja di perkebunan kelapa sawit. “Kalau kerjanya macam-macam. Ada yang cabut lalang. Mengangkut benih dengan polibek,” kata dia. Ke Halaman 27 kolom 1

Ke Halaman 27 kolom 1



PERIKSA: Kapalres Singkawang, AKBP Prianto sedang melihat barang bukti narkoba yang berhasil diamankan­dari dua tersangka. OZY/PONTIANAKPOST

JAMBRET: Barang bukti penjambretan.

Jambret Tewas FA (24), penjambret dompet milik Kurniasih, Minggu (10/3) sekitar pukul 21.00, di depan Toko Hosana Jalan Kalimantan, Kecamatan Singkawang Tengah, Kota Singkawang, tewas. Belum diketahui penyebab tewasnya, namun Ke Halaman 27 kolom 5

Gedung Pengadilan

Dipertanyakan TIGA belas tahun sudah Landak memisahkan diri dari kabupaten Pontianak sebagai kabupaten pemekeran. Namum selama itu pula kantor penga­ dilan sebaik tempat penegakan hukum belum kunjung ada. Usulan demi usulan baru kini terealisasi. “Dua tahun lalu D PRD kabupaten Landak dan tim dari eksekutif mengajukan pembagunan kantor pengadilan ke keKlemen Apui mentrian Hukum dan HAM di Jakarta. Kunjungan kami kementrian Hukum Dan Ham menbuahkan hasil, gayung bersambut, kementrian dapat mengabulkan pembangunan kantor pengadilan dengan menglontorkan dana sekitar kurang lebih 1 milyar. Yang realisasinya dikerjakan tahun 2012 dan 2013,” kata Klemen Apui, belum lama ini. Namu anehnya, setelah pemerintah daerah menyiapkan tanah untuk pembangunan di pal 8 jalan Ngabang- Pontianak, pembangunan Ke Halaman 27 kolom 5


Pengguna Sabu Diringkus SINGKAWANG-Polres Singkawang meringkus dua pengguna narkoba jenis sabu-sabu, di rumah kost Jalan Ali Anyang, RT 41 RW 15 Kelurahan Pasiran, Kota Singkawang, Rabu (6/3) pukul 17.00 WIB. Keduanya yakni Ad, warga Jalan Raya Bagak Dusun Maruha dan Th alias Bu warga Jalan Yos Sudarso Gang Nelayan, Kota Singkawang. Dari tangan keduanya, polisi menyita barang bukti berupa empat paket kecil ukuran seperempat gram, dua paket besar ukuran dua gram, satu buah timbangan digital, kaleng

bulan warna pink tempat alat sabu, popeye, lima pipet, satu bungkus kosong rokok untuk menyimpan empat paket kecil sabu, dua ponsel, dua bong dan uang tunai sebesar Rp950 ribu. “Sabu-sabunya sudah kita uji lab, begitu juga dengan keduanya sudah di tes urine dan hasilnya positif. Barang yang diamankan benar-benar sabu dan keduanya memang menggunakan sabu,” kata Kapolres Singkawang AKBP Prianto melalui Kasat Narkoba Polres Singkawang, Iptu Prayitno kepada wartawan, di ruanganya,

Cemburu, Istri Dibacok

Senin (11/3) siang. Ia menyebutkan jika keduanya diringkus saat menikmati sabusabu di kost milik Ad. Kendati demikian keduanya saling tuding mengenai kepemilikan sabu. “Sabu empat paket kecil itu ditemukan di kotak rokok, dan sabu paket besar di sudut ruangan. Tetapi mereka malah saling tuding mengenai kepemilikan dua paket sabu besar,” tukas Kasat. Hal yang sama ketika diwawancarai wartawan, keduanya memang saling

SINGKAWANG- Lantaran dibakar api cemburu, Tjf alias Afn (37) warga Kelurahan Sedau Singkawang Selatan, membacok istrinya Nsm (41) di bagian kepala sehingga istrinya mengalami pendarahan dan harus mendapatkan delapan jahitan. Ketika sedang dalam pemeriksaan petugas Polsek Singkawang Selatan Senin (11/3), Afn mengaku apa yang dilakukan terhadap sang istri dikarenakan rasa cemburu. Pada saat kejadian, dimungkinkan adalah puncaknya dari kekesalan yang dirasakannya. “Salah paham, saya melakukannya (membacok kepala istri) karena cemburu,” kata Afn , Senin (11/3). Tapi sebelum kejadian itu, Afn menyebutkan masih tetap satu rumah dengan istrinya. lantaran bisa di selesaikan secara baik-baik, Afn mengaku sang istri akan menarik laporan yang ada. “Istri saya akan mencabut laporan,” katanya. Kapolsek Singkawang Selatan, AKP Bagus Nyoman Gede Junaedi melalui Kanitreskrim, Aiptu Supianik mengatakan dari hasil pengembangan sementara, pembacokan memang di latar belakangi rasa cemburu suami kepada sang istri. “Sementara dari penyelidikan yang kita lakukan, masih dikarenakan rasa cemburu saja, kalaupun ada faktor lain sedang dalam pengembangan,” kata Aiptu Supianik, Senin (11/3). Supianik menjelaskan pembacokan terjadi pada Kamis malam sekitar pukul 19.45 Wib. Dimana saat Afn datang ke rumah yang beralamat di Padang Pasir Rt 020 Rw 4 Kelurahan Sedau Singkawang Selatan, mendapati sang istri tidak berada di rumah.

Ke Halaman 27 kolom 1

Kapolres Dukung JSPP Siapkan Doorprize dan Personil SINTANG—Kapolres Sintang AKBP Oktavianus Marthin mendukung penuh pelaksanaan jalan sehat spektakuler dalam rangka hari ulang tahun (HUT) ke-40 Pontianak Post di Sintang. Dukungan diberikan dengan kepastian akan mengerahkan personil untuk turut serta memeriahkan sekaligus pengamanannya. “ Jalan sehat merupakan bentuk kegiatan positif, maka kepolisian akan mendukung penuh kegiatan

tersebut,” kata Kapolres, kemarin Senin (11/2). Kapolres ikut memastikan akan menyiapkan doorprize bagi peserta. Bahkan hal tersebut, lanjut dia, telah dibicarakan bersama jajarannya Ke Halaman 27 kolom 1

JALAN SEHAT: Kapolres Sintang AKBP Oktavianus Marthin bersama Sutami, Kabiro Pontianak Post Sintang menjelang jalan sehat spektakuler HUT ke-40 Pontianak Post


Patroli TNI Temukan 8 Jalan Tikus di Perbatasan

Beli Sembako ke Distrik Mongkos dan Mapu Disamping jalan resmi, ternyata hubungan ke negeri Jiran, Malaysia juga melewati jalan-jalan tikus. Setidaknya ada delapan jalan tikus di sepanjang kawasan perbatasan darat Kecamatan Sekayam dengan Sarawak (Malaysia) selama melaksanakan patroli perbatasan. AGUS ALFIAN, Sanggau


PELABUHAN GAGAL: Kawasan Kuala Sing­ kawang­belakangan hanya dijadikan tempat ber­ main dan mancing menjelang sore. Sebelumnya,­ Kuala akan dijadikan pelabuhan.

KORAMIL 1204-02/Sekayam mencatat ada delapan jalan tikus atau jalan sempit tempat lalu lintas warga. “Jalan tikus` itu merupakan akses warga perbatasan untuk keluar masuk dari dan ke negara tetangga Malaysia,” kata Danramil 120402/Sekayam, Lettu Inf Eko Prasetyo W, Senin (11/3) kemarin.

Agus Alfian

JALAN TIKUS: Warga perbatasan menggunakan motor membeli sembako ke Distrik Mongkos lewat jalan tikus yang bermedan berat dan berbukit.





Menurutnya, Koramil Sekayam, sudah satu pekan melaksanakan pengawasan di jalan tradisional atau jalan tikus bersama dengan masyarakat di wilayah Sekayam. Yakni di Desa Lubuk Sabuk, Dusun Segumon yang berbatasan dengan Mongkos dan Desa Bungkang Dusun Bantan yang berbatasan langsung dengan Mapu Sarawak (Malaysia). “Temuan kita di lapangan memang ada delapan jalan tikus, yang kerap dipergunakan oleh masyarakat untuk meng­ akses ke negara jiran tersebut,” ungkapnya. Menurut dia, keberadaan jalan tikus tersebut memang sudah ada sejak jaman konfrontasi. Kini masih dipergunakan warga untuk menjual hasil bumi ke negeri jiran. Kendati demikian kerawanan dan dampak dari jalan tikus juga harus diwaspadai. Oleh sebab itu, pihaknya bersama dengan tokoh masyarakat di desa yang berbatasan langsung dengan Malaysia bersama-sama memantau jalan tikus guna mengantisipasi kejadian yang tidak diinginkan. Seperti penyelundupan, penyusupan dan sebagainya. Ke Halaman 27 kolom 5



Ancam Pecat Anggotanya SALAH seorang oknum anggota honorer Satuan Polisi Pamongpraja (Sat Pol PP) Kabupaten Kubu Raya berinisial A, resmi menjadi tahanan Polresta Pontianak. Ini lantaran yang bersangkutan menggunakan kartu kredit milik korban pencurian beberapa waktu lalu. Kepala Sat Pol PP Kabupaten Kubu Raya, Andy Hasryadi, mengatakan, tindakan tidak terpuji yang dilakukan anggotanya tersebut, jelas telah memalukan dan mencoreng nama kesatuan dan Pemerintah Kabupaten (Pemkab) Kubu Raya. SeharuAndy Hasryadi nya, ditegaskan dia, anggota Sat Pol PP menegakkan peraturan daerah (perda), namun kenyataannya malah sebaliknya, menjadi pelaku pencurian. Dia menegaskan bahwa dirinya tidak akan pernah memberi kesempatan dan pertimbangan kepada anggota yang melakukan pelanggaran berbentuk kriminalitas. Sementara khusus untuk anggotanya yang berinisal A tersebut, akan dipecat dari kesatuannya. “Tidak ada pilihan lain kecuali dipecat,” tegasnya, Senin (11/3) di Sungai Raya. Terkait tindakan tidak terpuji yang dilakukan oknum bersangkutan, pihaknya telah melakukan rapat, untuk mengambil pertimbangan. Hasil dari rapat tersebut, menurut dia, kemungkinan besar pilihannya adalah pemecatan. Meski memang tidak dipungkirinya, jika tindakan pemecatan dilakukan, maka kesatuan yang dipimpinnya akan mengalami kekurangan anggota. Dia menjelaskan terkait tindakan oknum tersebut, telah menyampaikan kepada Bupati Kubu Raya Muda Mahendrawan selaku kepala daerah. Hal itu dilakukannya untuk meminta pertimbangan atas sanksi yang akan diberikan kepada oknum Sat Pol PP yang dimaksud. Untuk mengantisipasi hal serupa, dia berjanji akan akan lebih fokus memberikan pembinaan kepada anggota-anggotanya di regu dan kesatuannya masing-masing. “Kepala seksi dan kepala bidang sudah perintahkan untuk memberikan pembinaan kepada anggota. Kita berharap agar apa yang dilakukan A, tidak terulang kembali kepada anggota kita lainnya,” ucapnya. Diungkapkan dia bahwa selama salah satu anggotanya tersebut menjalankan tugas di kesatuannya, tercatat sudah dua kali melakukan pelanggaran. Bahkan untuk dua pelanggaran tersebut, mereka masih memberikan pertimbangan untuk dibina, dengan harapan agar yang bersangkutan bisa berubah. Akan tetapi, dia menyayangkan, ternyata salah satu anggotanya tersebut kembali melakukan pelanggaran, bahkan yang dilakukan sudah masuk dalam ranah kriminalitas. “Saya rasa, oknum ini sudah tidak bisa dibina lagi dan sudah seharusnya memang dipecat dari kesatuannya. Jika tidak diambil tindakan tegas, maka oknum tersebut akan kembali mengulang pelanggaranm,” tandasnya. (adg)

Pontianak Post

Selasa 12 Maret 2013

KPU Tetapkan Dapil Kubu Raya


RUNTUH: Baru berumur sekitar dua minggu, bak sampah di Jalan M Alianyang, Sungai Ambawang, sudah runtuh. Dilihat kondisi fisiknya, memang cukup rawan jebol.

Revitalisasi Poktan dan Penyuluhan SUNGAI RAYA – Bupati Kubu Raya, Muda Mahendrawan, meminta kepada semua jajaran di sektor pertanian, perkebunan, perikanan, dan peternakan, agar melakukan gerakan revitalisasi kelompok tani (poktan) dan penyuluhan. Dia yakin sektor-sektor tersebut akan maju dan berkembang, jika para petani tanaman pangan, pekebun, peternakan, nelayan, dan pembudidayaikan,mampumenguasai teknologi pertanian-perikanan dan manajemen pemasaran. “Dengan revitalisasi itu, tentu akan berdampak pada hasil dan kemampuan dalam mengakses permodalan,” katanya, Senin (11/3) di Sungai Raya. Menurutnya,semuajajarandisektor tersebutdapatmelakukangerakanrevitalisasikelompoktanidanpenyuluhan. Sepertidiketahui,diamengungkapkan bahwa saat ini pemerintah, melalui program nasional pemberdayaan masyarakat mandiri (PNPM-Md) dalam upaya mengentaskan kemiskinan, di mana untuk sektor pertanian, telah dilaksanakanprogrampengembangan usaha agribisnis perdesaan (PUAP)

yang berbasis pada gabungan kelompok tani (Gapoktan). “Kemampuankemampuan tersebut hanya akan benar-benar terwujud, jika kelompok tani benar-benar nyata dan bukan sekadarpapannamayangtidakpernah melakukan apa-apa,” ucapnya. Dia menyatakan tidak ingin terlalu pesimis terkait kelompok tani yang hanya papan nama dan tidak melakukan apa-apa. Akan tetapi, dia mengingatkan, jika kelompok tani trsebutmasihtetapdipertahankandan tidak memiliki kesadaran, maka upaya untuk memajukan sektor ekonomi masyarakat tentu sulit terwujud. Dia menegaskan, gerakan revitalisasi kelompok tani dan penyuluhan menjadi sangat mendesak untuk dilakukan. Karena, dia menambahkan, seperti diketahui, PUAP harus menyentuh petani, pekebun, peternak, dan nelayan miskin, yang juga belum tentu terakomodirdalamkelompoktaniyang sudah ada selama ini. “Saya berharap semoga angkaangka kemajuan yang muncul dari pelaksanaan proyek pembangunan

selamainibukanhanyasekadarangka,” tuturnya. Selama ini, diungkapkan Bupati, pemerintahselaluberupayamembuka peluang-peluang lebih besar di sektorsektor tersebut karena berpotensial. Pertanian, peternakan, dan nelayan, dikatakan Bupati, memang sangat dekat dengan kultur masyarakat KabupatenKubuRaya.Makaberdasarkan hal itu, untuk meningkatkan peran serta dalam memajukan pertanian dan perikanan, Bupati mengatakan, selainperanaktifgapoktan,KontakTani Nelayan Andalan (KTNA) Kubu Raya juga diharapkan bisa meningkatkan peran sertanya. “KTNA merupakan organisasi pertanian yang memiliki peranan yang sangat penting untuk membantu pemerintah, mencapai sasaran utama pelaksana pertanian dan nelayan. Karena dua sektor tersebut merupakan sektor andalan kita dan sangat efektif, untuk terus dikembangkan dalam upaya membangun ekonomi masyarakat,” terangnya. (adg)

Jabatan Eselon III-IV Dihapus RENCANA pemangkasan jabatan eselon III dan IV semakin mendekati kenyataan. Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (KemenPAN-RB) sudah menyiapkan 11 jabatan fungsional (Jabfung)utamauntukmemindahkanPNS yangmendudukijabataneselonIIIdan IV. Menurut Wakil MenPAN-RB, Eko Prasojo, hal ini dilakukan agar pegawai tidak dirugikan dan tetap memiliki orientasi kinerja. “Kitamulaimemindahkanorientasi struktural menjadi fungsional dengan memangkas eselon III dan IV,” kata Eko Prasojo di Jakarta, Senin (11/3). Dalam pemangkasan tersebut, ada beberapa hal yang harus siap

dan menjadi tolok ukur di antaranya angka kredit, pola karier, dan lainlain. Diakui Eko Prasojo, kalau saat ini tunjangan fungsional masih lebih rendah dibanding jabatan struktural. Akibatnya, jabatan struktural menjadi rebutan, karena tunjangannya banyak. Karena itu, tunjangan fungsional harus ditingkatkan. “Nanti akan kita buat tunjangan fungsional setara struktural, sehingga PNS tidak terpaku pada jabatan struktural saja,” ujarnya. Untukjabatanstruktural,lanjutguru besarUIini,sejalandenganmuatandalam RUU Aparatur Sipil Negara (ASN). Dimanauntukjabatanstrukturalhanya sampai pada jabatan eselon II, sebagai

policy maker (pembuat keputusan). Sedangkan jabatan lainnya berbasis fungsi. “Untuk jabatan seperti Kepala Kantor, Camat tidak dihapuskan. Sedangkan jabatan seperti perencana, auditor, dan analis kebijakan masuk ke dalam jabatan fungsional,” tambahnya. Agar PNS tidak kaget dengan pemangkasan jabatan ini, akan dilakukan secara selektif dan bertahap. Pemangkasan jabatan eselon III dan IV dilakukan sampai 2014. Ini terus berlanjut pada 2015 sampai 2017. “Diharapkan dalam lima tahun penghapusan jabatan eselon III dan IV sudah selesai,” ucapnya. (esy/jpnn)

SUNGAI RAYA – Komisi Pemilihan Umum (KPU) Kabupaten Kubu Raya telah menetapkan daerah pemilihan (dapil) dan jumlah kursi anggota DPRD Kabupaten Kubu Raya pada Pemilihan Umum (Pemilu) 2014 mendatang. Ketua KPU Kabupaten Kubu Raya, Idris Maheru, mengatakan berdasarkan Surat KPU RI Nomor 112/Kpts/KPU/Tahun 2013 tertanggal 9 Maret 2013, pada lampiran II.61.12, dapil di Kabupaten Kubu Raya terbagi menjadi enam. Enam dapil dimaksud yakni Dapil I yang meliputi Kecamatan Sungai Raya, di mana di dalamnya merupakan Sungai Raya A. Untuk Sungai Raya A, terdiri dari beberapa desa seperti Arang Limbung, Kuala Dua, Limbung, Teluk Kapuas, Sungai Raya Dalam, dan Parit Baru, dengan jumlah penduduk mencapai 150.122 jiwa, sehingga bisa memperoleh 12 kursi di DPRD. Sementara untuk Dapil II, di dalamnya meliputi Sungai Raya B, terdiri dari beberapa desa seperti Sungai Ambangah, Tebang Kacang, Sungai Asam, Pulau Limbung, Kapur, Gubung Tamang, Sungai Bulan, Madu Sari, Mekar Sari, hingga Mekar Baru, dengan jumlah penduduk mencapai 64.053 jiwa, serta memperoleh jumlah kursi lima. Sedangkan untuk Dapil III, meliputi Kecamatan Terentang dengan 11.186 jiwa, Batu Ampar (33.702 jiwa), dan Kubu (40.325 jiwa), dengan jumlah tujuh kursi. Untuk Dapil IV meliputi Kecamatan Rasau Jaya dengan jumlah penduduk 27.673 jiwa, dan Teluk Pakedai (20.144 jiwa), di mana memperoleh empat kursi. Kemudian Dapil V meliputi Kecamatan Sungai Kakap. Sementara dapil terakhir, Dapil VI, meliputi Kecamatan Kuala Mandor B dan Sungai Ambawang, dengan jumlah penduduk masing-masing 30.264 jiwa dan 72.993 jiwa, dengan perolehan delapan kursi. “Jadi, Idris Maheru jumlah kursi yang tersedia sebanyak 45 dan tidak berubah dari pemilu sebelumnya,” katanya, Senin (11/3) di Sungai Raya. Dia menjelaskan, penetepan dapil tersebut telah ditetapkan secara nasional, di mana di Kabupaten Kubu Raya terjadi pemecahan dapil, khususnya di Kecamatan Sungai Raya. Pemecahan dapil tersebut, dikatakan dia, pada dasarnya berdasarkan ketentuan Undang-Undang Nomor 8 Tahun 2012 tentang Pemilihan Umum Anggota DPR, DPD, dan DPRD, yang diperjelas pada pasal 27, di mana daerah pemilihan terdiri dari kecamatan atau gabungan kecamatan, dengan alokasi kursi tiga hingga 12 kursi untuk masing-masing dapil. Akan tetapi, dia menambahkan, setelah Kecamatan Sungai Raya dihitung setiap kecamatan, diperoleh total kursi mencapai 17. Dengan total jumlah tersebut, maka Sungai Raya dianggap sudah tidak mampu lagi mengakomodir ketentuan undang-undang mengenai jumlah kursi yang diperuntukkan di DPRD. “Pada pasal yang sama, tepatnya pada ayat ke tiga, dijelaskan bahwa kecamatan yang sudah melebihi 12 kursi, harus dilakukan pemekaran kecamatan dapil, sehingga tidak lagi menjadi kecamatan atau bagian kecamatan, melainkan bagian kecamatan,” terangnya. Dia mengatakan dari pemecahan dapil tersebut terjadi perubahan nama di mana pada Pemilu 2009 dapil Ambawang dan Kuala Mandor B, tergabung dalam Dapil II dan sekarang menjadi Dapil VI. Sementara untuk Sungai Kakap yang dulunya Kubu Raya III, kini menjadi Kubu Raya V. Sementara untuk Batu Ampar, Terentang, dan Kubu, di mana dulunya berada di Dapil V, kini menjadi Dapil III. “Yang tetap dan tidak berubah hanya Kecamatan Teluk Pakedai,” tuturnya. Dia menegaskan, pada dasarnya pemecahan dapil tersebut dilakukan sesuai dengan ketentuan undang-undang yang berlaku, seperti kecamatan yang alokasinya kurang dari tiga kursi, wajib digabung dengan kecamatan lainnya. “Karena dapil ini telah diputuskan, maka keputusan inilah yang akan menjadi acuan partai-partai politik, untuk mengajukan calon legislatif sementaranya. Dan jumlah yang dapat diajukan 100 persen dari jumlah kursi yang ada di masing-masing dapil,” pungkasnya. (adg)

Pontianak Post

Selasa 12 Maret 2013


SPT Tahunan PNS MENINGKATKAN kepatuhan penyampaian Surat Pemberitahuan Tahunan Pajak Penghasilan Wajib Pajak Orang Pribadi tahun pajak 2012, Kantor Pelayanan Penyuluhan dan Konsultasi Perpajakan (KP2KP) Ngabang kembali menggelar kegiatan sosialisasi perpajakan bagi pegawai di lingkungan Kementerian Agama Kabupaten Landak pada Kamis. Acara yang dilangsungkan di Aula Kantor Kementerian Agama Kabupaten Landak diawali dengan sambutan Kepala Kantor Kementerian Agama Kabupaten Landak, H. Mudjazie Bermawie. “ Kami menyambut baik dilaksanakan kegiatan sosialisasi perpajakan ini, diharapkan melalui sosialisasi ini dapat menambah pemahaman Wajib Pajak PNS terhadap kewajiban menyampaikan SPT Tahunan Pajak Penghasilan,” harapnya. Mudjazie menambahkan bahwa pajak bukan hanya sebagai kewajiban kepada negara tetapi juga merupakan salah satu bentuk dari ibadah, karena konsep pajak tidak jauh berbeda dengan konsep zakat. Keberhasilan pelaksanaan administrasi perpajakan, imbuhnya, tidak terlepas dari dua hal, pertama adalah adanya kesadaran dari masyarakat Wajib Pajak dalam membayar pajak dan kedua adalah kepercayaan masyarakat kepada petugas pajak. Tanpa adanya kesadaran, penerimaan negara dari sektor pajak tidak akan maksimal. Ia mencontohkan bahwa saat ini banyak dijumpai masyarakat yang dapat dikategorikan sebagai golongan mampu namun belum sepenuhnya melaksanakan kewajiban perpajakannya secara benar. Sedangkan kepercayaan masyarakat kepada petugas pajak perlu terus ditumbuhkan,” pungkasnya. Dalam kesempatan yang sama, Kepala KP2KP Ngabang, Nugroho Adi Saputro mengatakan bahwa kegiatan sosialisasi ini merupakan salah satu upaya menumbuhkan kesadaran Wajib Pajak. Pihaknya selalu berusaha meningkatkan kualitas pelayanan dalam rangka memberikan pelayananprimauntukmewujudkanmasyarakat yang sadar pajak.” Apabila diperlukan konsultasi terkait pemenuhan hak dan kewajiban perpajakan, kami siap mengakomodasi,” ujarnya. Nugroho mengingatkan para pegawai di lingkungan Kementerian Agama Kabupaten Landak sebagai PNS untuk mematuhi peraturan perundang-undangan yang berlaku termasuk peraturan perpajakan. Salah satu Kewajiban PNS sebagai Wajib pajak adalah menyampaikan SPT Tahunan PPh, meskipun Pajak Penghasilan Pasal 21 Wajib Pajak Orang Pribadi PNS telah dipotong dan disetorkan oleh bendahara masing-masing unit kerja. Hal ini tertuang dalam Pasal 3 UU Nomor 6 Tahun 1983 sebagaimana telah diubah terakhir dengan UU Nomor 16 Tahun 2009 tentang Ketentuan Umum Dan Tata Cara Perpajakan (KUP). Dalam ketentuan tersebut dinyatakan bahwa setiap wajib pajak wajib mengisi SPT dengan benar, lengkap dan jelas dalam bahasa Indonesia. SPT diisi menggunakan huruf latin, angka arab, satuan mata uang rupiah dan menandatangani serta menyampaikan ke kantor Direktorat Jenderal Pajak tempat Wajib Pajak terdaftar atau tempat lain yang ditetapkan oleh Direktorat Jenderal Pajak. Nugroho menjelaskan bahwa Surat Pemberitahuan Tahunan Pajak Penghasilan (SPT Tahunan PPh) merupakan surat yang digunakan Wajib Pajak untuk melaporkan penghitungan dan atau pembayaran PPh, objek pajak PPh dan / bukan objek pajak PPh, dan / harta dan kewajiban untuk satu tahun pajak atau bagian dari Tahun Pajak. Sesuai ketentuan Undang-Undang Perpajakan, SPT berfungsi sebagai sarana untuk melaporkan dan mempertanggungjawabkan penghitungan jumlah pajak yang sebenarnya terutang dan untuk melaporkan pembayaran atau pelunasan pajak yang telah dilaksanakan sendiri atau dipotong oleh pihak lain. (wan)



Pedagang Lama Bakal Digusur? MEMPAWAH- Suhu politik menjelang Pemilihan Kepala Daerah mulai memanas. Terlebih lagi, ada yang sengaja memanasmanasi, sehingga kondisi yang kondusif, sejuk, nyaman mulai terusik. Itulah sekilas gambaran yang terjadi di komplek pasar Tradisional Sebukit Bestari Mempawah. Hal itu terungkap, saat Disperindagkop UKM bersama Asisten II Setda rapat dengan sedikitnya 30 pedagang ikan, sayur, sembako, buah serta sembako beberapa waktu lalu. Dari hasil pertemuan, pedagang mengindikasikan, pemerintah kabupaten masih belum berpihak pada wong cilik. “Kami melihat, ada indikasi ingin menggusur padagang lama. Sehingga dibuatlah larangan agar pedagang untuks ementara jangan menempati ruko yang sudah jadi. Bahkan, mengancam akan meempatkan Sat Pol PP untuk menjaga, jika pedagang menempati,” cerita Ilyas, pedagang sembako kepada koran ini kemarin. Melihat gelagat pada pertemuan, pedagang mengindikasikan, ada upaya untuk menggusur dan menempatkan kalangan keluarga diruko maupun meja dipasar ikan yang baru. “Kami tidak menuduh, tapi indikasinya

jelas, jika mendengar pensembako. Kalau dipindahkan jelasan saat pertemuahn. Bukelokasi lain, pedagang tidak kannya memberikan solusi, mau,” tegasnya. melainkan larangan untuk Tak hanya itu, Ilyas menilai pedagang menuntut hak,” petugas sepertinya sudah akunya. mendahului perencanaan. Olah karena itu, Ilyas Karena mau dibangunkan mohon kepada Bupati untuk ukurannya dipersempit alamenyikapi persoalan itu agar san tidak ada dana. Pedagang tidak berbenturan antara mau sewa ruko lain dilarang. kepentingan yang dapat merHalnya membangun paugikan Ria Norsan sebagai tungan juga dilarang. “Kami incumbent yang maju pada minta bangunan ukuran Pilkada 2013 ini. 3,4 meter seperti ruko lama. “Bupati musti tanggap Bukannya 1,5x3 meter,” ujar dan meresfon persoalan Ilyas. Yang lebih mengherIlyas itu. Jangan sampai kebijakan ankan lagi, bangunan pasar dilapangan berbenturan dengan apa yang ikan terbilang sudah selesai dibangun. Justru diharapkan,” sarannya. dilapangan terlihat masih membangunkan Mewakili pedagang lainnya, Ilyas yang lagi tempat usaha sementara disamping sudah 16 tahun berdagang dilokais itu bangunan baru. “Lantas, untuk apa dibanmengaku, saat ini ada lanjutan pembanguna gun, jika masih dibuat tempat jualan ikan tahap kedua ruko. Kebetulan menggusur sementara,” sorot pedagang. ruko yang ditempati. Kalangan pedagang Pedagang minta Bupati jangan membiarminta, dibangunkan ruko sementara di lokasi ka kondisi itu berlarut-larut. Sebab, kebijakan yang ada. Bukan justru dipindahkan jauh pimpinan dengan kebijakan yang dibuat dari komplek pasar ikan. “Pedagang maunya pejabat dilapangan terkadang bertolak tetap dilokasi pasar ikan, disitulah pedagang belakang. Terkadang pula cenderung men-

gupayakan untuk kepentingan keluarga dan kroni, dengan mengorbanan kepentingan rakyat. “Jangan sampai karena nila setitik, rusak susu sebelanga,” warning Ilyas mewakili para pedagang yang merasa dipojokkan terpaksa bersuara lantang. Terlebih pula, asisten II yang hadir saat pertemuan dengan para pedagang beserta kabid Perdagangan dinilai secara keras memberikan larangan kepada pedagang untuk menempati. Pemerintah selalu saja merasa benar dan terkesan menantang pedagang kalau mau melaporkan kemana saja mereka tidak takut. Jawaban yang diberikan adalah dengan menempatkan Pol PP sebagai pengamanan ruko di pasar tradisional. Pada awalnya rencana pembangunan itu, semua pedaang sudah didata dan dipastikan mereka yang punya ruko akan kembali menempati ruko barunya. Juga begitu dnegan pedagang ikan. Anehnya, begitu sudah jadi, seperti dipojokkan dan dilarang untuk ditempati. “Larangan seperti itu, kebijakan siapa. Bupatikah, kadis Perindagkop UKM kah, atau pihak kontraktor,” tanya pedagang. MerekamengingatkanPemerintahjangan pernah menyakiti hati rakyat, jika masih ingin mendapatkan simpati rakyat. (ham)

TNI-Polri Jalin Kebersamaan


TUAI KRITIK: Bangunan pasar tradisional Sebukit Rama Mempawah hingga kini masih menuai kritikan masyarakat, khususnya para pedagang.

Beasiswa Bagi Siswa Daerah Terpencil UNTUK menampung anakanak yang kurang mampu tetapi memiliki prestasi yang baik, Universitas Tanjungpura (Untan) akan memberikan beasiswa penuh bagi calon mahasiswa yang berprestasi khusus daerah terpencil di perbatasan atau miskin marginal. Penerimaan mahasiswa tersebut untuk Tahun Akademik 2013/2014, khusus beasiswa bagi siswa tamatan SMA/SMK/ MA/MAK negeri atau swasta yang lulus Unas tahun 2013 dan lulusan tahun 2012. “Beasiswa yang dimaksud Outreaching Untan adalah

Program Bidikmisi yang beasiswanya meliputi pembebasan SPP, biaya administrasi, dan biaya hidup selama 4 tahun dan bantuan biaya transportasi, “ kata Kabid Dikmen Dinas Pendidikan Kabupaten Landak Jongki SPd MPd. Diterangkan Jongki, penerimaan Beasiswa Penuh Outreaching tahun 2013 menerima sekitar 950 orang. Namun untuk bisa diterima tetap melalui tahapan seleksi, pertama melalui jalur Seleksi Nasional Mahasiswa Perguruan Tinggi Negeri (SNMPN), kedua Seleksi Baru Mahasiswa Perguruan Tinggi

Negeri (SBMPTN), dan ketiga Mandiri Outreaching Untan (MOU). “Mekanisme pendaftaran disosialisasikan melalui brosur panduan dari Untan sendiri. Untuk menyampaikannya kepada siswa tentu tugas kepala sekolah yang bersangkutan,” katanya Syarat bagi siswa adalah belum pernah ikut seleksi Bidikmisi usia maksimal 21 tahun dari keluarga miskin marginal, berasal dari daerah perbatasan terpencil. Pendapatan orang tua harus dilampirkan dengan rekomendasi dari desa. (wan)

MEMPAWAH—Tragedi pembakaran Mapolres Ogan Kemiring Ulu (OKU) Sumatera Selatan oleh Batalyon Arteleri Medan (Yon Armed) 15/76 tarik Martapura disikapi para pimpinan TNI-Polri di Bumi Khatulistiwa. Hal itu terlihat jelas dari ikatan kebersamaan Pangdam XII Tanjungpura dan Kapolda Kalbar yang saling berangkulan. Hal itupun terus diikuti jajaran yang ada dibawahnya seperti Dandim-Kapolres yang terlihat tetap kompak. Demikian pula yang terlihat di jajaran Polres Mempawah-Kodim 1201 MPH yang terlihat saling berbauran dalam aksi senam bersama. Perhelatan senam pagi yang dilaksanakan di terminal Mempawah jumat itu, Kegiatan itu diikuti Kapolres AKBP Sigit Dedi Purwadi S.Ik MH Kapolres Mempawah beserta jajaran. Halnya dengan TNI juga diikuti Letkol Kav Bambang Sulistyo Dandim 1201 MPH, beserta jajarannya, sebagai bentuk solidaritas atas konflik antara TNI-Polri di Ogan Komering Ulu (OKU), Sumatera Selatan. Kapolres menegaskan, pihaknya selalu menjaga keharmonisan sesama lembaga penegak hukum dan institusi yang ada di wilayah kerjanya. Baik antara Polri dan TNI maupun lembaga lain yang ada. “Apa yang kami perbuat dan lakukan menunjukan bahwa hubungan disini tetap solid. Kami senantiasa bekerjasama dalam menjaga keamanan dan ketertiban masyarakat. Kita tetap bersatu dan akan terus menjalin hubungan baik,” tegas Sigit Dedy

Purwadi. Ucapan senada juga disampaikan Dandim 1201 Mempawah yang mengaku prihatin dengan konflik yang berujung pada pembakaran Mapolres OKU. Dia pun mengatakan konflik tersebut hendaknya t menjadi pembelajaran agar tidak terulang kembali dimasa mendatang. Kurang lebih satu jam lamanya, ratusan personil dari dua satuan itu melakukan gerak olah tubuh mengikuti irama. Sebab, prinsif dan tujuan olahraga itu untuk membuat tubuh selalu segar dan fresh. Kedua institusi negara itu terihat kompak dan ahrmonis melakukan olahraga senam bersama. Usai melaksanakan senam, para aparat keamanan ini tampak berbincang-bincang seraya bersenda gurau. Kedua pihak tampak santai dan berbicara hangat sembari menikmati panas matahari pagi di Kota Mempawah. Melihat sisi positif dari kedua pimpinan. Susanto SE ME, salah satu anggota DPRD memberikan mengapresiasi kegiatan olahraga bersama antara instansi Polri-TNI itu. Menurut dia, kegiatan serupa penting dilaksanakan untuk meningkatkan koordinasi dan menjalin keharmonisan hubungan kedua lembaga yang ada. Kedepan Susanto berharap, konflik antar satuan seperti yang terjadi di OKU tidak terjadi di bumi Kalbar halnya pula Kabupaten Mempawah pada khususnya.Sebab, konflik hanya akan menimbulkan kerugian dan merusak kondusifitas keamanan dan ketertiban masyarakat (kamtibmas) yang sudah tercipta selama ini. (ham)


20 PLN

Datang Langsung MASYARAKAT yangakanmenyambungaliran listrik baru, diharapkan langsung datang ke kantor PLN Cabang Singkawang. Pasalnya, beberapa laporan telah masuk mengenai adanya besarnya biaya yang harus dikeluarkan termasuk lama sambungan yang ada belum bisa di aliri listrik. “Masyarakat yang akan menyambung jaringan baru, diharapkan langsung datang ke kantor PLN, sehingga akan mengetahui secara jelas berapa biaya yang harus dikeluarkan ataupun berapa hari sambungan listrik itu akan dinyalakan,” kata Manajer Cabang PLN Singkawang, Arief Kuncoro Senin (11/3). Menurut Arief, hal ini sebagai langkah antisipasi mengenai adanya keluhan dari masyarakat yang mengaku terlalu besar dikenakan biaya saat akan memasang jaringan baru. Kemudian juga lama dinyalakannya aliran listrik ke rumah yang bersangkutan. Kalaupun ada petugas dari PLN yang turun ke rumah warga untuk penyambungan, dikatakan Arief,akandilengkapidengan SuratPerintah Kerja (SPK) dari PLN dengan kode TUL109. “Warga jika didatangi petugas yang mengaku dari PLN, harus ditanya dulu ada tidak SPK-nya dan dilengkapi tanda pengenal,” katanya. “Masyarakat tidak sembarangan menerima tawaran jika ada orang atau pihak yang mengaku bisa menyambungkan jaringan listrik,” katanya. Aduan yang diterima PLN, diantaranya ada warga yang mengaku telah lunas membayar biaya penyambungan listrik baru. (fah)

Pontianak Post

RS Beli Tiket, Wakil Wako Siapkan Doorprize SINGKAWANG-Rumah Sakit Abdul Aziz Singkawang memastikan ikut dalam Jalan Sehat Spektakuler Pontianak Post yang dilaksanakan 24 Maret mendatang. Kepastian itu setelah Panitia JSS Pontianak Post mendatangi Direktur Rumah Sakit Abdul Aziz Singkawang, Carlos Djafara di ruang kerjanya, kemarin. “Sayapastimendukung.Sayaakanbagikan kepada mereka yang ingin ikut yang tidak bertugas pada hari pelaksanaan,” kata Carlos yang memborong tiket. Menurut Carlos, kegiatan tersebut sangatlah positif apalagi dibarengi dengan doorprize yang luar biasa. “Mungkin baru Pontianak Post yang menggelar jalan sehat ada hadiah utamanya untuk diundi berhadiah rumah berserta isinya,” kata Carlos. Sementara itu, Wakil Wali Kota Singkawang, H Abdul Mutalib SE ME disambangi di rumah dinasnya siang kemarin memastikan akan menyediakan doorprize sejumlah barang elektronik. “Saya pasti dukung. Inikan acara bagus. Saya akan sediakan sejumlah barang elektronik untuk para pemenang. Jadi, tunggu saja tanggal 24 Maret,” kata Abdul Mutalib. Dia juga siap ikut dalam

MENGALIR: Dukungan diberikan oleh sejumlah kalangan kepada panitia pelaksana JSS, di antaranya dari Wakil Wali Kota Abdul Mutalib dan Direktur RS Abdul Aziz, Carlos Djafara

kegiatan tersebut. “Semoga saja tidak ada agenda keluar kota pada hari pelaksanaan. Saya akan ikut,” kata Abdul Mutalib. Saat ini, sejak dibuka hingga sekarang sudah sangat banyak masyarakat membeli tiket di Kantor Pontianak Post Biro Singkawang. “Ada yang datang langsung ke kantor setelah menghubungi. Ada juga yang minta diantar. Sebab, membeli tiket sebanyak sepuluh tiket atau lebih, kita akan

mengantarkannya secara langsung kepada pembeli,” kata Ketua Panitia Jalan Sehat Spektakuler Pontianak Post, Zulkarnain S Sos, kemarin. Menurut dia, banyak anak sekolah yang juga ingin ikut ambil bagian dalam kegiatan tersebut. “Mereka ingin dikoordinatori oleh para guru untuk membeli. Nanti, kita akan sambangi sekolah-sekolah agar lebih mudah,” kata Zulkarnain. Menurut dia, rumah

berserta perabotannya yang disediakan oleh Pontianak Post sebagai hadiah utama sudah tersedia di Pontianak. “Semua peserta dari semua kabupaten kota di Kalbar berhak ikut serta,” kata Zulkarnain. Dia berharap, kepada mereka yang belum membeli tiket untuk segera menghubungi Kantor Pontianak Post Jalan Gunung Raya nomor 15 Singkawang Barat. Semoga Anda yang beruntung ! (*)

Eks RSBI Pungut Biaya


Irup di SMA 3 KOMANDAN Koramil Kota, Kapten Inf Sutaryono, Senin (11/3) pagi menjadi pembina upacara bendara hari Senin yang dilaksanakan oleh SMA 3 Singkawang. Kesempatan ini, Kapten Sutaryono menjelaskan sekolah dapat dikatakan baik dan bagus tentunya tidak terlepas dari komponenkomponen yang ada pada sekolah tersebut sebagai faktor pendukungnya. Salah satunya, kata dia, seperti kualitas pendidik yang mendukung, sarana dan prasarana yang memadai, kedisiplinan, ketertiban dilingkungan sekolah. “Keamanan lingkungan sekolah juga merupakan faktor pendukung yang sangat penting yang harus dimiliki sekolah,” kata dia. Kesempatan itu pula, komandan koramil kota ini juga menjelaskan soal bela negara. Menurut dia, bela negara bukanlah hanya tugasTNI saja, melainkan semua pihak termasuk pelajar. “Bukan hanya mengangkat senjata melainkan bela negara itu sesuai dengan profesinya masing-masing. Misalnya, TNI dengan profesinya pertahanan dan keamanan negara, guru dengan mendidik siswanya agar mampu berkarya, pelajar yakni belajar dan belatih dengan mengedepankann kedisiplinan yang tinggi sehingga meraih cita-cita,” kata dia. Tak hanya itu, dia juga mengingatkan kepada siswa untuk menjaga kebersihan dilingkungan rumah, sekolah dan dimana saja mereka berada. (zrf)

Selasa 12 Maret 2013


TERBAKAR: Warga yang sedang mengendarai motor melintas di tengah kepulan asap yang berasal dari lahan terbakar.

Raskin Bengkayang Juga Turun SINGKAWANG-Turunnya penerima raskin tidak hanya terjadi di Singkawang, tap juga di Kabupaten Sambas dan Bengkayang. Kedua wilayah masih termasuk Sub Devisi Regional Bulog Singkawang. Pada tahun ini untuk Kabupaten Sambas ada 27.653 rumah tangga sasaran (RTS) yang menerima raskin dengan jumlah beras sebanyak 413.445 kg. Jumlah itu mengalami penurunan karena pada tahun sebelumnya, ada 28,443 rumah tangga sasaran (RTS) dengan jumlah berasnya 42.6645 kg. Sedangkan untuk daerah Bengkayang pada tahun 2012 ada 10.308 rumah tangga sasaran (RTS) yang menerima raskin dengan jumlah beras sebanyak 154.620 kg. Angka itu menurun menjadi, 9985 rumah tangga sasaran (RTS) dengan jumlah raskin 149.000 ton. Singkawang sendiri sudah melakukansosialisasimengenai pembagian raskin ini kepada masyarakat. Sejauh ini Bulog

mengklaim belum menerima laporan dari masyarakat yang mempertanyakan penurunan jumlah tersebut. “Mingguminggu untuk wilayah Singkawang bisa disalurkan tinggal menunggu permintaan dari kelurahan dan kecamatan,” jelas Kepala Pelayanan Publik, Sub Devisi Regional Bulog Singkawang, Hendra. Hal yang berbedadenganwilayahKabupaten SambasdanBengkayang,karena kedua wilayah tersebut belum melakukansosialisasimengenai pembagian raskin. Saat ini stok beras yang tersedia di Bulog yakni beras LN dan Sulsel.Hendrapunmenyinggung jika saat ini Bulog belum bisa mengambil beras lokal untuk dibagikanmasyarakatmengingat harganya yang terbilang tinggi.

Namunjikahargaberaslokalyang direncanakan panen pada bulan Maret-Aprilbisaterjangkau,maka tidakmenutupkemungkinanpemerintah akan memberlakukan kepada masyarakat. “Kita belum menggunakan beras lokal belum mengingatharganyamasihtinggi. Beras yang saat ini digunakan berdasarkan inpres lama. Untuk harga jual kembali kepada masyarakat hanya Rp1600. Kita berharap jika panen raya Maret-April, mudah-mudahan bisa masuk,” jelasnya. Jika menggunakanberaslokal,kataHendra, maka akan berdampak positif kepada masyarakat. “Beras lokal dibeli dari masyarakat juga, dan dikembalikan lagi kepada masyarakat. Jadi perputaran ekonomi di lokal,” tukasnya. (mse)

SINGKAWANG-Eks Rintisan Sekolah Bertaraf Internasional di Kota Singkawang, sampai saat ini masih memunggut biaya terutama sumbangan pembangunan pendidikan kepada para siswa. Padahal, Mahkamah Konstitusi sudah menghapus RSBI dan tidak diperkenankan lagi memunggut biaya apa pun termasuk SPP bagi eks RSBI diseluruh Indonesia termasuk Kota Singkawang. “Kita sudah terima laporan dari orang tua siswa SMP eks RSBI yang mengatakan eks RSBI masih saja memunggut biayaterutamaSPP.SejakJanuari hinggaFebruari.Padahal,dalam keputusan MK itu tidak dibenarkan. Tidak boleh lagi dan itu bisa dinyatakan punggutan liar alias pungli,” kata Pemerhati Sosial Pembangunan Singkawang, Muhammad Firdaus, kepada Pontianak Post, kemarin. Menurut dia, tiap bulan orang tua harus membayar Rp175 ribu persiswa. Bila di sekolah tersebut memiliki siswa sebanyak tiga ratus, maka bisa enam puluhan juta perbulan. “Uang itu untuk apa. Ini perlu perjelas. Kita minta Dinas Pendidikan Kota Singkawang mengawasi masalah keuangan tersebut. Jika memang masih saja, aparat hukum bisa melakukan penye-

lidikan atas punggutan tersebut. Sekolah tersebut bisa diseret tindak pidana,” kata Firdaus. Diakui Firdaus, selama ini pun tidak ada perbedaan yang amat mencolok antara RSBI dengan sekolah biasa. “Soal mutu, tidak ada yang mencolok. Sama saja kualitasnya, malah mereka kalah. Yang mencolok hanya soal biaya saja. Biaya di sekolah biasa tidak ada. Di sekolah RSBI itu luar biasa,” kata Firdaus menyentil. Selain menyorotimasalahtersebut,Firdausjuga mengingatkankepada sekolah-sekolah tingkat sekolah pertama untuk menghentikan punggutan Rp1000 perpekan dari siswa. “Alasan sekolah klasik yaknibantuansosial.Kalausekali atau dua kali bisa dibenarkan. Punggutan yang bisa dianggap punggutanliaritusudahberjalan tiga tahun. Uang itu pun juga tidak pernah dijelaskan kepada orang tua siswa untuk apa, siapa yang menyalurkannya,” kata Firdaus. Dinas pendidikan pun dilihat Firdaus, sangat lemah. Bahkan, dinas pendidikan tidak mau mengurusimasalahtersebut.“Dinas pendidikan kayaknya lebih cenderungmengurusiproyeksaja yang bisa memberikan keuntungan bagi oknum-oknum dinas pendidikan itu sendiri. (zrf)

Desak Pemkot Sampaikan RPJMD SINGKAWANG- Pemerintah Kota Singkawang diharapkan segera mempersiapkan Reperda tentang Rencana PembangunanJangkaMenengahDaerah (RPJMD) 2013-2017. Pasalnya, sesuai Permendagri Nomor 54 Tahun 2010, selambat-lambatnya enam bulan paska pelantikan Walikota dan Wakil Walikota terpilih harus sudah di Perda-kan. Permendagri Nomor 54 Tahun 2010 tentangpelaksanaanPeraturanPemerintahNomor8Tahun2008tentangtahapan, tata cara penyusunan, pengendalian

dan evaluasi pelaksanaan rencana pembangunan daerah, diamanatkan dokumen RPJMD tersebut telah diperdakan selambat-lambatnya enam bulan setelah pelantikan Wako dan Wakil Walikota terpilih. Dalam Permendagri tersebut disebutkan Perencanaan pembangunan daerah adalah suatu proses penyusunan tahapan- tahapan kegiatan yang melibatkan berbagai unsur pemangku kepentingan di dalamnya, guna pemanfaatan dan pengalokasian sumber daya

yang ada, dalam rangka meningkatkan kesejahteraan sosial dalam suatu lingkungan wilayah/daerah dalam jangka waktu tertentu. Wakil Walikota Singkawang, Abdul Mutalib mengatakan proses penyiapan dokumenRPJMDKotaSingkawang20132017 sekarang ini sedang berlangsung, dengan leading sektor berada di Badan Perencanaan Pembangunan Daerah (Bappeda) Kota Singkawang “Padasaatinitelahdisusun Rancangan RPJMD yang harus dimatangkan terlebih

dalam bentuk diskusi kelompok terarah dengan topik kajian pada sejumlah isu strategis daerah yang terkait langsung dengan pencapaian visi dan misi Wako dan Wawako Singkawang,” kata Abdul Mutalib. Sementara itu, Anggota DPRD Kota Singkawang dari Fraksi Amanat Kebangkitan Sejahtera Daerah (Akseda), Uray AswandimengingatkandiawalpemerintahanWalikotaSingkawang,AwangIshak dan Wakil Walikota Abdul Mutalib, agar segera menyampaikan RPJMD . (fah)


Pontianak Post 6HODVD0DUHW


Siapkan Empat Posko


KABAG Humas, PDE, dan Sandi Setda Pemkab Sambas melalui Kasubbag Humas, Ilham, mengungkapkan, sesuai data dari Pemerintahan Kecamatan Tebas, Senin (11/3), kebakaran di Pasar Segarau, Tebas, Minggu (10/3) siang, membakar sedikitnya 28 pintu bangunan. Bangunan-bangunan dimaksud terdiri dari dua rumah tempat tinggal, dua gudang, dan 24 ruko. “Tidak ada korban jiwa yang meninggal. Hal itu sesuai laporan Camat Tebas,� ujar Ilham. Korban yang mengungsi di luar posko penampungan, Kerugian ditaksir dijelaskan dia, mencapai 20 akibat musibah kepala keluarga (KK) atau kebakaran itu kurang sekitar 105 jiwa. Sementara jumlah posko atau tempat lebih mencapai satu setengah miliar penampungan yang dipersiapkan pemerintahan setempat, rupiah. Tidak ada tersedia empat lokasi, yakni korban jiwa yang rumah dinas puskesmas, gumeninggal. dang jeruk, gedung koperasi, Hal itu sesuai dan pasar desa.“Kerugian ditaksir akibat musibah ke- laporan Camat Tebas. bakaran itu kurang lebih mencapai satu setengah miliar rupiah,� ungkap Ilham. Sesuai data dari pihak kecamatan, Kasubbag Humas menyebutkan bahwa musibah kebakaran terjadi sekitar pukul 12.30 WIB, Minggu (10/3) di Komplek Pasar Segarau Parit. Api, menurut dia, diperkirakan berasal dari arus pendek listrik Toko Roti Tainga atau Aen, yang terletak di blok sebelah timur atau tepian sungai. Tetapi, dia mengungkapkan, keterangan resmi mengenai penyebab kebakaran masih sedang diselidiki pihak kepolisian. Sementara sebelumnya, Bupati Sambas Juliarti Djuhardi Alwi didampingi Camat Tebas, Kasat Pol PP, dan beberapa unit kerja lainnya, telah melakukan peninjauan langsung ke lokasi kebakaran. Bupati memberikan beberapa arahan, terkait penanganan pascakebakaran. Sedangkan bantuan dari pemerintah daerah, sejauh ini sedang diproses unit kerja terkait. (Har)

Sekda Ingatkan tentang Kode Etik Pemilu KPU Lantik PPK se-Kabupaten Sambas SAMBAS – Sekretaris Daerah (Sekda) Sambas Jamiat Akadol mengingatkan panitia pemilihan kecamatan (PPK), agar melaksanakan semua tahapan program dan jadwal penyelenggaraan Pemilu Anggota DPR, DPD, dan DPRD di tingkat kecamatan, sesuai Peraturan KPU Nomor 18 Tahun 2012. Penegasan tersebut dikemukakan Sekda saat menghadiri pelantikan 95 anggota PPK di Sambas, kemarin (11/3). “Panitia pemilihan kecamatan adalah penyelenggara pemilu di tingkat kecamatan, yang mempunyai tugas, wewenang, dan kewajiban yang harus dilaksanakan berdasarkan asas penyelenggara pemilu, dan selalu memperhatikan kode etik penyelenggara pemilu, serta mematuhi segala peraturan perundang-undangan yang berlaku,� ujar dia. KPU Kabupaten Sambas,secara resmi melantik dan mengambil sumpah 95 anggota PPK se-Ka-

mengerti tata aturan pengelolaan administrasi,� gugahnya. Sekda juga menegaskan bahwa anggota PPK harus menjujung tinggi asas pelaksanaan Pemilu, sehingga mampu mengedepankan netralitas, khususnya bagi anggota PPK dari kalangan PNS. Pada kesempatan yang sama, ketua KPU Kabupaten Sambas, Suaib, mengingatkan agar PPK melakukan konsolidasi, dengan membangun komunikasi yang harmonis di tingkat internal, baik sesama anggota PPK maupun dengan unsur sekretariat. “Lakukan koordinasi yang intens dengan komponen-komponen eksternal yang ada di wilayah +$5,.851,$7+$0$3217,$1$.3267 kecamatan,� tegas Suaib. 8&$3$16(/$0$76HNGD6DPEDV+-DPLDW$NDGROEHUVDPD Pasalnya, dia mengingatkan .HWXD .38 .DEXSDWHQ 6DPEDV 6XDLE PHPEHULNDQ XFDSDQ kembali bahwa data pemilih VHODPDWNHSDGDVHOXUXKDQJJRWD33..DEXSDWHQ6DPEDV\DQJ selalu menjadi persoalan dalam NHPDULQ  GLODQWLN setiap pemilu. Ini, menurut dia, bupaten Sambas, berdasarkan tersebut, Jamiat juga mene- terjadi lantaran kekurangvaliSurat Keputusan Komisi Pemili- kankan agar PPK yang telah dan data pemilih dan masih ada han Umum Kabupaten Sambas terbentuk, segera mengusulkan pemilih yang belum terdaftar, Nomor 04/Kpts/KPU-Kab-019 calon sekretaris PPK kepada sehingga mereka tidak dapat .435667/2013 tertanggal 6 Maret Bupati Sambas, melalui KPU menggunakan hak pilihnya. Ketua KPU mengharapkan 2013. Seremonial tersebut Kabupaten Sambas. Pengusudihadiri beberapa anggota lan tersebut, ditegaskan dia, agar PPK dapat mengoorForkopinda dan KPU Provinsi merupakan sesuatuyang sangat dinasikannya dengan PPS, Kalbar. Dalam kesempatan penting. “Pilih sekretaris yang dan memaksimalkan tugas

pantarlih atau PPDP dalam pelaksanaan pemutakhiran data pemilih. PPK diminta dia agar berpedoman pada asas penyelenggaraan pemilu, sebagaimana dituangkan pada pasal 2 Undang-Undang Nomor 15 Tahun 2011 tentang Penyelenggara Pemilu. Asas-asas yang dimaksud yakni mandiri, jujur, adil, kepastian hukum, tertib, kepentingan umum, keterbukaan, proposionalitas, profesionalitas, akuntabilitas, efisiensi, dan efektivitas. “Jaga sumpah jabatan yang baru saja anggota PPK ucapkan, atas nama Tuhan Yang Maha Esa. Karena hal tersebut merupakan komitmen hati nurani selama menjalankan tugas dan wewenang yang diberikan Undang-Undang,� tuturnya. Dalam hal keuangan, Suaib mengharapkan agar anggaran dikelola dengan penatausahaan administrasi keuangan yang baik. PPK, dikatakan dia, wajib membuat laporan realisasi anggaran, yang telah digunakan, agar dilengkapi dengan bukti administrasi yang sah dan disampaikan kepada KPU Kabupaten Sambas. (Har)


Budidaya Buah Naga, Omzet Capai Rp5 Juta Terobosan Kelompok SPP Bunga Tanjung TANGARAN – Kecamatan Tangaran yang letaknya di daerah pesisir pantai utara Kabupaten Sambas, ternyata memiliki potensi untuk budidaya tanaman Buah Naga (Dragon Fruit). Ini telah dibuktikan oleh Kelompok Usaha Bersama (KUB) Bunga Tanjung Desa Simpang Empat, Tangaran. Mereka memanfaatkan modal usaha, dari kegiatan simpan pinjam kelompok perempuan atau lebih dikenal dengan sebutan SPP, yang dikelola UPK PNPMMPd Kecamatan Tangaran. Menurut Rusmala, ketua


Kelompok SPP Bunga Tanjung, mereka sangat terbantu sekali dengan adanya bantuan modal melalui SPP, yang diberikan UPK Kecamatan Tangaran. Dengan suku bunga yang kecil, di mana hanya 1 persen perbulan, dengan jangka waktu selama 18 bulan, maka sekarang ini, melalui modal simpan pinjaman SPP tersebut, mereka bisa membudidayakan 250 batang tanamanBuah Naga,mulai dari penanaman hingga panen. “Berkat kerjasama, kerja keras anggota, Alhamdulillah, sekarang ini penghasilan panen Buah Naga kelompok kami rata-rata 5 kilogram batang, pada musim buah dari Bulan Oktober 2012 – Februari 2013, dengan harga permintaan

jung bisa menikmati hasilnya. Selain untuk pengembalian pinjaman ke UPK Kecamatan Tangaran, hasil kegiatan tersebut sangat membantu dalam menambah penghasilan keluarga mereka masing-masing. Sungguh tidak terasa, kelompok tersebut sudah memasuki angsuran ke-17 di UPK Kecamatan Tangaran. Bahkan mereka berencana akan mengajukan pinjaman kembali kepada UPK Kecama+$5,.851,$7+$0$3217,$1$.3267 tan Tangaran, di mana tentunya %8$+1$*$5XVPDODNHWXD.HORPSRN633%XQJD7DQMXQJ 'HVD6LPSDQJ(PSDW7DQJDUDQPHPSHUOLKDWNDQ%XDK1DJD dengan pinjaman yang lebih besar lagi, untuk menambah GLKDPSDUDQNHEXQ%XDK1DJD\DQJDNDQVHJHUDGLSDQHQ modal budidaya buah naga ini. pasar lokal Rp20 ribu – Rp25 selama 5 bulan atau Rp5 juta Sebagai catatan, UPK Kecamaribu perkilogram, jadi omzet rupiah perbulannya,� katanya. tan Tangaran sampai saat ini kelompok kami sudah men- Sekadar diketahui, semua telah melayani 66 kelompok capai Rp25 juta – Rp30 juta, anggota kelompok Bunga Tan- SPP, dengan jumlah anggota sebanyak 523 orang, yang tergolong dalam dua kategori. Kategori-kategori dimaksud yakni kelompok usaha bersama (KUB) dan kelompok aneka usaha (KAU) yang tersebar di tujuh desa. Menurut ketua UPK Kecamatan Tangaran, Wasdi HZ, yang ditemui di Sekretariatnya di Jalan Lingkar Simpang

Empat, Pancur, baru-baru ini, kelompok SPP Bunga Tanjung Desa Simpang Empat adalah salah satu dari kelompok KUB yang memanfaatkan dana pinjaman dari UPK, di mana untuk sementara, merupakan satu-satunya kelompok KUB yang berhasil dalam mengelola dana simpan pinjam SPP, yang dialokasikan oleh UPK Kecamatan Tangaran. “Kami sebagai pengurus UPK sangat berterima kasih kepada kelompok SPP Bunga Tanjung, yang telah mengangkat nama baik kami selaku UPK, dan semua pelaku PNPM-MPd, Desa Simpang Empat, serta Kecamatan Tangaran pada umumnya,� ungkapnya. Saat ini, kata Wasdi, UPK Kecamatan Tangaran selalu berusaha memberikan yang terbaik, dalam melalukan pendampingan dan pembinaan, terhadap seluruh kelompok SPP, baik dari segi pembukuan, peluang usaha, kelembagaankelompok, dan menjagakeberlanjutanaset UPK. “Agar untuk ke depannya akan banyak lagi muncul

KUB sukses yang lain, dengan produk yang lain pula,� katanya. Keberhasilan ini, diakui dia, tidak lepas dari kerjasama antara pelaku-pelaku baik tingkat kecamatan, seperti camat, BKAD, PL, dan PjOK, maupun pelaku tingkat desa, antara lain kepala desa, BPD, LPM, KPMD, dan lain-lain, serta seluruh masyarakat K e c a m a t a n Ta n g a r a n . IaberharapkedepannyaPNPMMPd Kecamatan Tangaran bisa menjadi bagian penting dari pembangunan ekonomi kerayatan menengah ke bawah di Kecamatan Tangaran. Dia juga berharap agar pelaku PNPMMPd, bukan hanya sekadar pelaksana dana stimulan dari program pemerintah. “Akan tetapi sebagai program yang mampu menciptakan manusia–manusia potensial, yang memiliki rasa peduli dan peka terhadap kondisi dan situasi wilayahnya dengan pola fikir, apa yang bisa diberikan, bukan dengan apa yang bisa dapatkan?� ungkapnya. (Har)




Pontianak Post

Air PDAM Kembali Macet


Masih Agenda Pemeriksaan KASUS dugaan Tindak Pidana Korupsi (Tipikor) Pengadaan obat cacing sejauh ini masih dalam tahap pemeriksaan. Kasus pengadaan dengan empat berkas perkara tersebut sedikitnya sudah dilakukan pemeriksaan kepada 13 saksi baik dari pihak swasta dan perusahaan. Demikian disampaikan Kasi Pidana Khusus (Pidsus) Kejaksaan Negeri Sanggau, Rya Dilla Fitri, Senin (11/3) kemarin. “Tanggal 13-14 Maret 2013 pemeriksaan untuk panitia pengada obat cacing. Sejauh ini yang sudah diperiksa ada 13 saksi dari swasta dan perusahaan yang bersangkutan,” katanya ditemui di ruang kerjanya. Sementara itu, salah satu tim jaksa, Amiruddin menyampaikan bahwa kasus tersebut masih akan melakukan pemeriksaan kepada saksi ahli. Usai agenda pemeriksaan saksi ahli, akan diberikan kesempatan untuk menghadirkan saksi yang meringankan. “Setelah ada kesaksian ahli, kalau tidak ada saksi yang meringankan jika dipandang perlu, baru nanti selanjutnya pemeriksaan terdakwa. Setelah itu, baru penuntutan,” jelas Amir. Ditegaskannya, bahwa tim jaksa masih melakukan proses sesuai rencana tahapan yang sudah ada. Sehingga pemeriksaan bisa berjalan baik dan tuntas sesuai waktu yang dijadwalkan. (sgg)

Selasa 12 Maret 2013


KANDIDAT: Empat kandidat balon Bupati dan Wakil Bupati Sanggau yang melakukan pertemuan di Parindu.

Infrastruktur dan IPM Paling Disorot SANGGAU - Dari hasil pertemuan keempat bakal calon (balon) Bupati dan Wakil Bupati Sanggau, Munsin, Jumadi, Supardi dan Losianus bersama 600-an masyarakat Kabupaten Sanggau di Wisma Sinai, Parindu Sabtu (09/03) kemarin terbongkar, terdapat dua permasalahan krusial yang paling banyak dikeluhkan oleh masyarakat Sanggau selama ini. Persoalan itu diantaranya, yakni infratruktur jalan dan Indek Pembangunan Manusia (IPM) yang rendah. Demikian disampaikan oleh salah satu balon Wakil Bupati Sanggau, Drs Supardi, Senin (11/03). “Hampir dari semua masyarakatan yang hadir, ada sekitar 600-an, mengeluhkan soal infrastruktur. Karena kebanyakan dari

mereka yang datang dari desa, berharap adanya perbaikan infrastruktur di pedesaan. Yang kedua masalah IPM,” kata Supardi. Namun dari kedua permasalahan tersebut, masalah infrrastruktur kata Supari yang paling dominan. Karena masyarakat beranggapan, mjika persoalan infrastruktur dapat dijadikan konsentrasi khusus bagi masing-masing balon, maka IPM kemungkinan besar akan meningkat secara sendirinya. “Karena takaran IPM utamanya berhubungan erat dengan pendidikan, kesehatan dan ekonomi. Jika infrastruktur baik maka kemungkinan IPM juga akan baik. Soalnya bagaimana mereka mau bersekolah, kalau akses menuju sekolah susah, bagaimana pula seandainya mereka sakit, mau kerumah





sakit saja jauh? Mereka banyak kebun, tapi ketika mau menjual hasil perkebunan, mereka kesulitan karena kondisi jalan buruk,” terang Supardi. Namun demikian, Supardi menjelaskan, pertemuan yang dilakukan oleh para balon tersebut bukan sebagai untuk mencari solusi atau mengumbar janji-janji kampanye kepada publik. Kehadiran para balon hanya sebagai penyerapan aspirasi sebagai bekal para balon jika terpilih nantinya. “Jadi ini-ini lho yang dimau masyarakat. Kita tidak ngumbar janji, kita hanya menjaring menyaring, apa yang dimau masyarakat kedepan. Karena dari permasalahan tersebut, mereka melihat realita yang ada. Infrastruktur merupakan urat nadi masyarakat,” katanya. (fik)

SANGGAU--Layanan air PDAM Kota Sanggau kembali mengalami masalah. Sejumlah warga mengeluhkan karena sudah hampir lima hari, air PDAM tidak mengalir. Kebutuhan air untuk keperluan sehari-hari juga jadi terganggu. Untuk kebutuhan mandi, warga harus ke sungai. Warga Jalan Sudirman Sanggau, Acip (58), Senin (11/3) kemarin membenarkan bahwa air PDAM sudah lima hari tidak mengalir. Ia mengeluhkan susah untuk mandi, karena untuk mandi ia harus pergi ke sungai. Ia juga menyampaikan, air di sebelah rumahnya ternyata tetap mengalir. “Di rumah sebelah, air tetap mengalir. Pelayanan PDAM macet lagi, jadi susah mandi. Kalau mau mandi harus ke sungai lagi. Sudah lima hari inilah mandi di sungai, air di rumah gak ada,” katanya menceritakan. Hal senada juga dikatakan Wahab (30), ditempatnya bekerja air yang biasanya lancar, saat ini tidak mengalir hampir sepekan ini. Ia hanya memanfaatkan sisa tampungan air yang ada di bak mandi. Untuk mandi, air yang ada harus dihemat sampai air mengalir kembali. “Pakai sisa tampungan air yang sebelumnya. Jadi dihemat-hemat pakai airnya, mau ke sungai lumayan jauh juga. Kita berharap layanan PDAM bisa lancar kembali pada beberapa hari ke depan supaya bisa kembali normal lagi seperti biasanya,” katanya. (sgg)

Pontianak Post •

Selasa 12 Maret 2013


Waspadai Barang Ilegal


SINTANG-- Danrem 121/ Abw Kolonel Inf. Binarko Sugihantyo meninjau Pos-Pos perbatasan yang berada di daerah Kabupaten Kapuas Hulu, kemarin. Hal ini berkaitan sebagai tugas pengendalian Satgas Pamtas dimana Danrem 121/Abw sebagai Komandan Komando pelaksana Operasi Pengamanan Perbatasan RIMalaysia di Kalimantan Barat. Demikian kata Kapenrem 121/ ABW Mayor Kav Eddy Wijaya, kemarin. Dalam kunjungannya ke pos-pos perbatasan, Danrem 121/Abw didampingi oleh Kasiterrem 121/Abw Mayor Inf. Nico, Kasilogrem 121/Abw Mayor Inf. Mujiburrohman dan Pasiopsrem 121/Abw Kapten Inf Dedi. Rombongan berangkat dari Makorem 121/ Abw pada pukul 10.30 wib (3/3) dengan menggunakan Heli Bell 412 BKO Pangdam XII/Tpr dan mendarat di Kecamatan Embaloh Hulu. “Sebelum mengecek pospos perbatasan yang ada, Danrem 121/Abw mengadakan tatap muka dengan masyarakat yang berada di Kampung Banua Martinus Kecamatan Embaloh Hulu. Dalam acara tatap muka tersebut Danrem 121/


Jumlah Ranmor Naik 12 Ribu Unit Penrem

Temu Warga: Danrem 121/Abw Kolonel Inf. Binarko Sugihantyo saat berdialog bersama warga perbatasan di Kabupaten Kapuas Hulu. Danrem mengajak semua elemen bergandengan tangan untuk membangun kawasan perbatasan

Abw menghimbau kepada masyarakat agar bersamasama dengan TNI dan Polri untuk selalu bergandengan tangan dan bekerja bersamasama untuk membangun dan menjaga keamanan khususnya di daerah perbatasan RIMalaysia,” kata Kapenrem. Menurut Kapenrem, Danrem juga menyampaikan, TNI merupakan bagian dari masyarakat karena TNI berasal dari masyarakat, apabila ada hal-hal yang sekiranya memerlukan bantuan ataupun tenaga dari TNI, maka

tidak perlu ragu-ragu untuk menyampaikan hal tersebut kepada aparat TNI yang berada di wilayah setempat. Kemudian Danrem 121/ Abw mengunjungi pospos pamtas yang berada di wilayah kabupaten Kapuas Hulu antara lain pos Kapar, pos Seriang, pos Ensanak dan pos Merakai Panjang dengan menggunakan jalur darat. Selain mengecek bangunan pos, sarana dan perlengkapan yang ada, Danrem 121/Abw juga memberikan pengarahan kepada prajurit


yang melaksanakan tugas Pamtas. Kapenrem menambahkan, kepada prajurit, Danrem mengingatkan prajurit agar selalu menjaga dan menghindari pelanggaran yang dapat merusak citra TNI dimata masyarakat serta melaksanakan pembinaan teritorial terbatas di sekitar pos-pos satgas pamtas. Danrem 121/ Abw juga menekankan untuk selalu mewaspadai setiap kegiatan illegal yang mungkin terjadi di sekitar wilayah perbatasan. (stm)

SINTANG- - Pertumbuhan jumlah kendaraan bermotor (ranmor) di Sintang setiap tahun cukup besar. Berdasarkan data Unit Penerimaan Pajak dan Daerah (UPDD) Dinas Pendapatan Daerah Provinsi Kalimantan Barat, di Sintang sebanyak 12 ribu unit kendaraan baru bertambah pada 2012. Kendaraan roda dua mendominasi angka pertumbuhan tersebut. “Tahun ini (2012) tercatat ada sekitar 12 Ribu kendaraan habis terjual. Kalau 12 ribu pertahun, jika di hitung perbulan ada sekitar seribu kendaraan terjual. Inikan cukup tinggi. Sebanyak 30 persen dari kendaraan baru itu adalah kendaraan roda empat. Selebihnya, sepeda motor,” kata Kepala UPDD Dispenda Sintang, Mawardi, kemarin. Menurut Mawardi, tingkat

ekonomi masyarakat kabupaten Sintang jika pada 2013 tidak jauh berbeda dengan tahun 2012, maka diyakini daya beli masyarakat untuk memiliki kendaraan tetap tinggi. Hal demikian otomatis akan ikut mendorong peningkatan pendapatan asli daerah. Sementara untuk pajak bea balik nama kendaraan, lanjut dia, terhitung 1 Maret 2013 naik menjadi 12,5 persen. “Biaya balik nama kendaraan bermotor pada tahun lalu berkisar 10 persen dari total harga kenadaraan per unit. Sehingga jika dihitung ada kenaikan hanya 2,5 Persen. Dengan kenaikan BBN di prediksikan harga kendaraan bermotor akan naik.” kata dia. Disinggung untuk kendaraan yang belum beabalik nama di Kabupaten Sintang,

menurut Mawardi, jumlahnya diperkirakan cukup banyak. Maka dia berharap kepada pemiliknya buat segera melakukan pengurusan bea balik nama. “Dengan bea balik nama hak kepemilikan kendaraan akan semakin jelas,” kata dia. “Kalau membeli kendaraan baru itu jelas. Yang mengurus BBN langsung dari dealer dimana kendaraan di beli. Tetapi kalau membeli kendaraan secand masih menggunakan nama pemilik lama,” tambah dia. Ia mengatakan, untuk kendaraan berpelat luar, milik pribadi atau perusahaan, bea balik nama wajib dilakukan minimal paling lambat tiga bulan selama kendaraan ada di Sintang. “Kalau sudah tiga bulan harus di bea balik nama. Kalau tidak akan di tindak,”kata dia. (stm)





Pontianak Post 6HODVD0DUHW

Perusahaan Serobot Lahan Warga


Ubah Pola Konvensional


POLA petani tradisional yang masih lakukan petani di berbagai Daerah di Sekadau tampaknya belum menunjukan hasil yang membanggakan. Ini menjadi perhatian penting pemerintah daerah dan instansi terkait bagaimana mengubah pola pikir petani untuk mencapai tujuan peningkatan produksi petani yang meningkat. “Kita khawatir jika petani masih mempertahankan pola bertani tradisional berlanjut akan berdampak buruk kepada mereka sendiri. Pola pikir tradisional seperti ini harus diubah oleh petani sendiri,� kata Dirut JKPP Bogor, Kasmita Widodo, Kerja Pemetaan Partisifatif (JKPP) Project .DVPLWD:LGRGR Leader SLUP Sekadau di Kecamatan Nanga Mahap. Ia mengakui ada beberapa kendala yang ditemui di Nanga Mahap terkait upaya meningkatkan produksi pertanian, antara lain kurangnya dukungan sarana prasarana dan minimnya penguasaan ilmu bertani modern di kalangan petani. “Petani paling banyak pola ladang berpindah ‘selamat tinggal’, yang artinya lahan yang sudah dipakai tidak dipergunakan produktif lagi, namun ada beberapa yang menaminya tanaman karet dan buah-buahan,� jelasnya. Dilihat dari segi potensi lahan, Nanga Mahap cukup subur dan memiliki potensi pertanian yang cukup baik. Hanya saja, pemanfaatan lahan berkelanjutan belum disadari petani dan masyarakat sekitar. “Kita ingin bagaimana petani mengalihkan pola bertani lahan basah (sawah) sehingga lahan kering bisa dimanfaatkan dengan tanaman lain seperti karet, kayu hutan dan tanaman produktif lainnya,� ucap dia.(nie)



Warga Swadaya Perbaiki Jalan SEKADAUâ&#x20AC;&#x201D;Warga Gang Rawa Bhakti melakukan perbaikan jalan gang secara swadaya, Minggu (10/3) kemarin. Perbaikan dilakukan lantaran kondisi ruas jalan gang telah rusak parah. Salah seorang warga yang ikut dalam kegiatan itu, Bastianus mengungkapkan ide untuk memperbaiki secara swadaya muncul atas inisiatif masyarakat setempat. Bastianus menuturkan, warga gang Rawa Bhakti yang berjumlah lebih kurang 30 KK masing-masing menyumbangkan uang senilai 110.000 rupiah per-KK untuk keperluan memberi bahan material. Adapun material

yang sudah terkumpul yakni pasir, kerikil, kawat besi, dan semen. â&#x20AC;&#x153;Ini merupakan kesepakatan warga yang tinggal di komplek karena jalan gang merupakan akses satu-satunya di sini. Segala kebutuhan seperti material dan alat-alat pertukangan sudah tersedia,â&#x20AC;? tutur pria yang akrab disapa Uju itu. Kondisi jalan gang yang dibangun Pemkab Sekadau pada tahun 2007 silam itu tampak rusak parah. Di sejumlah titik, lubang menganga. Badan jalan yang terbuat dari semen telah terkelupas seiring waktu. Kondisi itu jelas menyulitkan warga untuk keluar masuk Gang Rawa

Bhakti. Diakui Uju Bencot, warga setempat pernah mengajukan proposal perbaikan jalan itu kepada Pemkab Sekadau beberapa waktu lalu. Namun, hingga kini belum ada kepastian terkait usulan tersebut. Warga masih berharap kucuran dana dari Pemkab Sekadau mengingat dana yang terkumpul secara swadaya terbatas. â&#x20AC;&#x153;Danayangterkumpultidak akan cukup untuk melakukan perbaikan secara permanen. Kami berharap pemerintah daerah mengucurkan anggaran untuk perbaikan jalan gang kami secara total,â&#x20AC;? tuntasnya. (nie)

Lahan Kritis Capai Hampir Seratus Ribu Hektar SEKADAUâ&#x20AC;&#x201D;Hutan merupakan salah satu sumber daya alam yang memiliki peran sangat vital bagi kelangsungan hidup umat manusia. Karenanya, semua pihak wajib menjaga kelestarian hutan. Selama ini berbagai upaya telah dilakukan Pemkab Sekadau guna melestarikan hutan yang ada maupun hutan yang perlu direboisasi. Misalnya dengan cara memberi bibit kayu kepada kelompok tani di desa-desa agar dapat menanam di kawasan hutan yang sudah ditebang pohonnya akibat tradisi ladang berpindah.


â&#x20AC;&#x153;Tentu perlu menjadi perhatian semua pihak. Mari kita jaga hutan yang masih ada, dan yang akan ditanami untuk anak cucu kita ke depan,â&#x20AC;? tutur Reymond, salah seorang pemuda pecinta lingkungan Sekadau, kemarin. Kabupaten Sekadau memiliki luas wilayah 5.444,20 kilometer persegi yang terbagi menjadi tujuh kecamatan. Wilayah Kabupaten Sekadau di sebelah utara dan timur berbatasan dengan kabupaten Sintang, sedangkan sebelah barat berbatasan dengan Kabupaten Sanggau dan sebelah selatan

berbatasan dengan Kabupaten Ketapang. Sebagai Kabupaten baru, posisi Sekadau cukup menguntungkan. Sungai Kapuas yang menjadi tulang punggung transportasi sungai melintas di tengah kota ini. Dinas Kehutanan dan Perkebunan Kabupaten Sekadau tahun 2011 mencatat, luas wilayah Kabupaten sekadau 544.420, di antaranya 137.200 hektar atau sekitar 25 persen dari luas kabupaten terdapat kawasan hutan. Dari luas kawasan hutan ini, 37.600 hektar di antaranya

kawasan yang berhutan, 99.600 hektar kawasan berhutan yang dikategorikan sebagai lahan kritis dan tidak produktif. Sementara, sekitar 58.000 hektar hutan tak boleh diambil kayunya karena berstatus hutan lindung. Di sektor perkebunan, penduduk Sekadau menanami kebun-kebun mereka dengan berbagai tanaman seperti lada hitam, kakao, dan karet, dan perekebunan sawit yang ditanam di areal kebun pribadi atau milik perusahan perkebunan. Sejak dahulu, hutan-hutan

yang tersebar di Sekadau juga menjadi lahan mata pencarian bagi 4,3 persen penduduk setempat. Penjual sekaligus pembuat bak truk juga mebel dari kayu mudah ditemui di sepanjang jalan. Industri kayu berskala kecil ini memanfaatkan kayu-kayu di hutan rakyat sebagai bahan baku rumah tinggal maupun furniture. â&#x20AC;&#x153;Jadi untuk menjaga hutan kita ini memang butuh kerjasama, stake holder Pemerintah Daerah dan masyarakat itu sendiri,â&#x20AC;? harap Alumni fakultas Kehutanan Untan ini. (nie)

SEKADAUâ&#x20AC;&#x201D;Potret buruk investasi perkebunan kembali mencuat. Kali ini perusahaan perkebunan kelapa sawit, PT. Agro Andalan dituding tidak mengindahkan kearifan lokal masyarakat di sekitar areal HGU. Seperti yang terjadi di Dusun Gedet, Desa Mondi, Kecamatan Sekadau Hulu. PT. Agro yang tengah melakukan ekspansi lahan perkebunan dituding menggarap lahan milik masyarakat tanpa pemberitahuan terlebih dahulu. Adapun tanah yang digarap tersebut milik pasangan suami istri (Alm) Deris dan Mera, warga Dusun Gedet. Ahli waris (anak-red) dari pemilik lahan Lusia Siti mengatakan, PT. Agro Andalan telah menggarap lahan milik keluarganya tanpa pemberitahuan. â&#x20AC;&#x153;Usut punya usut, ternyata PT. Agro Andalan menerima penyerahan lahan seluas lebih kurang 10 hektar itu dari seorang makelar, namanya Paus masih kerabat kami juga,â&#x20AC;?Aku Siti. Kronologi penyerahan lahan bermula saat pihak perusahaan melalui humasnya melakukan penawaran kepada masyarakat Dusun Gedet untuk menyerahkan lahannya menjadi perkebunan kelapa sawit. Tanpa ba bi bu, Paus (kerabat Siti) menyerahkan lahan itu atas nama dirinya sendiri. Padahal, Paus tidak ada sangkut-pautnya atas hak kepemilikan lahan tersebut. Lahan tersebut diserahkan Paus kepada PT. Agro Andalan pada pertengahan tahun lalu. â&#x20AC;&#x153;Saudara Paus bukanlah ahli waris yang sah. Memang

benar dia adalah kerabat kami, namun dia tidak berhak menyerahkan lahan milik orangtua kami atas namanya sendiri,â&#x20AC;? ucap Siti. Secara historis tanah tersebut sudah dikuasai keluarganya dan dijadikan lahan bercocok tanam secara turun temurun. Pengakuan Siti diperkuat oleh pernyataan pemilik lahan lainnya yang berbatasan dengan lahan tersebut. Selaku ahli waris, Siti menyayangkan sikap PT. Agro Andalan yang langsung menggarap lahan itu tanpa mencari tahu kebenaran siapa pemilik sahnya. Lagipula, saat penyerahan dilakukan (oleh Paus), tidak ada saksi-saksi yang menguatkan bahwa lahan itu dikuasai oleh Paus. Siti menyesalkan sikap perusahaan yang tidak mengindahkan kearifan lokal dan hanya memikirkan profit semata demi keuntungan sepihak. â&#x20AC;&#x153;Harusnya pihak perusahaan cari tahu dulu asal usul tanah itu, tanyakan kepada pemilik yang sah apakah mau diserahkan sebagai lahan perkebunan atau tidak,â&#x20AC;? kesal Siti. Namun, pihak keluarga Lusia Siti telah melakukan koordinasi dengan PT. Agro Andalan terkait keabsahan penyerahan lahan itu. Pihaknya meminta perusahaan tidak melakukan aktivitas apapun di lahan tersebut. â&#x20AC;&#x153;Saat ini memang tidak ada aktivitas apapun di lahan itu. Kami tidak akan tinggal diam jika suatu saat lahan itu kembali digarap,â&#x20AC;? pungkas Siti. (nie)



Pontianak Post

Selasa 12 Maret 2013


Tersisa 8 Ribu


ANGKA penduduk miskin di Kabupaten Kayong Utara turun signifikan sejak lima tahun terakhir. Dari 18 ribu jiwa pada tahun 2007, angka kemiskinan turun drastis menjadi 8 ribu jiwa pada tahun 2012. Sekilas melihat data tersebut begitu memperlihatkan keberhasilan yang dilakukan pemerintah daerah. Betapa tidak, dalam lima tahun atau seiring dengan terbentuknya Kabupaten Kayong Utara sebagai daerah otonomi baru yang diresmikan pada 26 Juni 2007, angka orang miskin di kabupaten ke-13 di Provinsi Kalbar ini, berhasil dikurangi sebesar 10 ribu jiwa. Lantas, seperti apa komentar Bupati Kayong Utara, Hildi Hamid, mengenai turunnya angka penduduk miskin di daerah yang dia pimpin sejak tahun 2008 tersebut? Hildi Hamid “Memang angka kemiskinan sudah turun, tetapi saya belum puas, dan belum bisa tidur dengan tenang. Sebab masih ada sekitar 8 ribu jiwa orang miskin di daerah ini,” ungkap Hildi ketika membuka acara Pemantapan Pekerja Sosial (Peksos) Lapangan, dirangkai dengan Penyerahan Bantuan Usaha Ekonomis Produktif (UEP) di Gedung Balai Praja Sukadana, Jumat (8/3) lalu. Lebih rinci, Bupati menerangkan, angka penduduk miskin pada tahun 2007 sebesar 8 ribu menjadi 14.390 pada tahun 2008. Angka ini terus turun menjadi 12.500 pada tahun 2009 dan 11.200 pada tahun 2010. Selanjutnya, ditambahkan dia, pada tahun 2011, angka penduduk miskin turun lagi menjadi 10.520 dan tersisa sekitar 8.300 pada tahun 2012. “Angka kemiskinan ini harus kita tekan, karena masih ada sekitar 8 ribu orang miskin, maka saya akui belum berhasil,” aku Hildi merendah. Salah satu upaya menekan angka kemiskinan, menurut Hildi, adalah dengan cara memberdayakan masyarakat miskin, agar berdaya guna. Dia memisalkan, dengan cara memberikan bantuan berupa sarana dan prasarana pendukung usaha bagi keluarga miskin. (mik)



Sindikat Penggunting Kunci Gembok Dibekuk KETAPANG – Jajaran Polres Ketapang berhasil membongkar sindikat bongkar toko, dengan modus menggunting kunci gembok. Lima tersangka berhasil dibekuk di tempat yang berbeda. “Satu tersangka dibekuk oleh Resmob Polda Kalbar di Pontianak. Sedangkan empat lainnya dibekuk di Ketapang,” ujar Kapolres Ketapang, AKBP Ari Wahyu Widijananto, melalui Kasatreskrim, AKP Andi Oddang Riuh, kemarin (11/3) sore di Mapolres. Dari penangkapan tersangka AY di Pontianak, kemudian dilakukan pengembangan, yang mengarah kepada tersangka lainnya yang berinisial M. M ternyata merupakan seorang residivis. Tidak cukup sampai di situ, Polres terus melakukan pengembangan yang kemudian mengarah kepada tiga tersangka lainnya. “Pada saat ditangkap, tersangka M sedang berpesta narkoba tadi subuh (11/3). Sedangkan tiga lainnya ditangkap sekitar seminggu yang lalu,” lanjung Oddang. Dia juga mengungkapkan bahwa kelima tersangka yang dimaksud adalah AY, M, DD,


BEKUK: Kasatreskrim Polres Ketapang, AKP Andi Oddang Riuh, saat menginterogasi komplotan pembobol toko elektronik dengan modus pengguntingan kunci gembok, kemarin (11/3).

SH, dan HM. Penangkapan dilakukan kepada tersangka yang menjual ban hasil curian. Setelah dilakukan pengembangan, ternyata mengarah kepada sindikat gunting gembok, yang akhirnya mengarah kepadapembobolantoko-toko elektronik. “Ternyata pelakunya sama. Bahkan dari hasil

pemeriksaan, seluruh toko di Ketapang sudah digambar yang akan menjadi sasaran mereka selanjutnya,” ujarnya. Tidak tanggung-tanggung komplotan ini bahkan menguras seluruh isi toko elektronik. Di antaranya toko elektronik Prima Jaya Elektronik, yang dikuras sebanyak dua kali, da-

lam kurun waktu dua malam. Untuk melancarkan aksinya, komplotan ini juga menggunakan empat unit mobil, di antaranya tiga unit minibus dan satu unit pick up. “Kejadiannya pada perayaan Imlek kemarin. Kerugiannya sekitar Rp150 juta,” lanjut Oddang. Hasil dari pembobolan toko

elektronik ini, terlebih dahulu dikumpulkan di Ketapang. Setelah semua terkumpul, komplotan ini menjualnya ke berbagai daerah, di antaranya di Kota Pontianak dan Ketapang sendiri. “Dari hasil penjualan barang-barang ini mereka pergunakan untuk membeli obat-obatan terlarang,” ujar Oddang. Lebih lanjut Oddang mengungkapkan, pihaknya sudah mengintai komplotan ini karena sudah sangat meresahkan masyarakat, khususnya pemilik toko elektronik. Untuk membongkar sindikat tersebut, pihaknya mengintai selama dua bulan. “Ini memang sasaran kami. Karena ini sangat meresahkan warga. Namun, kita akan terus kembangkan kasus ini,” tuturnya. Untuk mengantisipasi hal serupa, Oddang menghimbau kepada seluruh masyarakat untuk terus waspada. Di antaranya memasang camera sisi TV. “Mereka akan diproses sesuai dengan hukum yang berlaku. Mereka akan diancam kurungan di atas 5 tahun,” tambahnya. (afi)


Bupati Siap Kampanyekan Ketahanan Pangan Melirik Budaya ‘Mengembaru’ di Desa Sukamaju KETAPANG –  Mengembaru atau menumbuk amping biasanya dilakukan saat memulai musim panen. Acara mengembaru dilaksanakan di tempat Bosman di Desa Sukamaju, Muara Pawan, beberapa waktu lalu. Kegiatan tersebut dihadiri Bupati Ketapang Henrikus bersama sejumlah  SKPD. Sebelum menghadiri acara mengembaru, Bupati bersama SKPD terlebih dahulu meninjau lokasi food estate yang dibuka   oleh konsorsium BUMN. Peninjauan tersebut juga didampingi manajemen PT SHS. Setelah dilakukan peninjauan di lokasi pembukaan lahan food estate, kemudian Bupati bersama SKPD menghadiri acara mengembaru yang dilaksanakan di lokasi milik Bosman. Sejumlah warga ketika itu, terlihat sedang melakukan penumbukan emping. Bahkan Bupati juga menyempatkan diri membaur menumpuk em-

ping bersama   dengan masyarakat. Rombongan Bupati bahkan sempat menikmati emping yang disuguhkan warga. Menurut Saiful Bahri, kepala Desa  (Kades) Sukamaju, lokasi tersebut masih merupakan bagian dari wilayah Desa Sukamaju.Acaramengembaru ini sendiri dilakukan, sebagai bagian wujud syukur mereka terhadap kehadiran PT SHS, dalam membuka lahan food estate di Sukamaju. Budaya mengembaruinisendiri tetap akan terus dipertahankan. “Kita berharap nanti   setISTIMEWA elah PT SHS  melaku- TUMBUK AMPING: Bupati Ketapang kan penanaman padi, Henrikus menumbuk amping, ketika dan panen perdana mengikuti acara mengembaru di Desa dilakukan, rencana Sukamaju, Muara Pawan, beberapa kita   juga akan kita waktu lalu. l a ku k a n b u d aya mengembaru,” kata Saiful. terus dipertahankan. Ia secara Sementara itu,   Bupati Keta- pribadi bahkan mendukung pang, Henrikus, berharap agar acara budaya yang dilakukan budaya mengembaru harus tersebut. Lebih lanjut, Bupati

menerangkan mengenai pentingnya peningkatan program ketahanan pangan. Ia berharap lahan-lahan dimanfaatkan untuk difungsikan seperti program ketahanan pangan. Bupati sendiri menegaskan bahwa ia akan tetap mengampanyekan   program pangan, demi mensejahterakan masyarakat. Penegasan Bupati tersebut disampaikan di depan masyarakat yang hadir dalam acara mengembaru. Melalui pertemuan informal seperti ini, dia mengharapkan agar program pemerintah daerah, khususnya ketahanan pangan dapat disosialisasikan. Ia meng-


inginkan agar masyarakat sejahtera, dengan istilah mampu menjadi petani berdasi. Artinya, dikatakan dia, melalui program ketahanan pangan, masyarakat bisa sejahtera. “Baik terpenuhi sandang, pangan, dan papan. Karena itulah, dengan masuknya BUMN mengolah food estate di Ketapang, saya mengajak masyarakat mendukung. Lahan-lahan tidur dapat dimanfaatkan dengan maksimal. Hasilnya, masyarakat bisa mensekolahkan anak-anak mereka,” ungkap Bupati.   Henrikus mengingatkan bagaimana kondisi tanpa pangan akan menjadikan masyarakat

susah. Ia bercerita pada sekitar tahun 1965, begitu banyak uang di tangan, namun saat itu mencari beras sangat susah. “Saya masih ingat, duit ada ditangan,

tapi cari beras sampai bersepeda ke Pesaguan, itu pun hanya dapat dua kilogram, bagaimana susahnya kalau pangan tidak ada?” ungkap dia. (ads)







Dibagi Empat Zona JADWAL kampanye Pemilukada Kabupaten Kayong Utara ditetapkan mulai 11 – 24 Maret mendatang. Memasuki masa kampanye tersebut, KPU Kabupaten Kayong Utara membagi empat zona untuk empat pasangan Calon Bupati dan Wakil Bupati Kayong Utara periode 2013 – 2018. Pembagian empat zona tersebut sebagai langkah aman untuk memaksimalkan kampanye para pasangan calon di masa 14 hari yang telah ditentukan KPU. “Selain itu, juga agar tidak ada benturan kawasan kampanye antara pasangan satu dengan pasangan lainnya,” ujar ketua KPU Kabupaten Kayong Utara, Dedi Efendy, di kantornya, akhir pekan lalu. Zona yang ditetapkan oleh KPU meliputi zona I yakni di Kecamatan Sukadana, kemudian zona II (Kecamatan Simpang Hilir), zona III (Kecamatan Teluk Batang dan Kecamatan Seponti), dan zona IV (Kecamatan Pulau Maya dan Kecamatan Kepulauan Karimata). “Masing-masing zona setiap pasangan memiliki tiga hari untuk melakukan kampanye,” kata dia. Terkait waktu kampanye, Ketua KPU yang akan berakhir masa jabatannya pada Juni mendatang ini, menyebutkan terdapat tiga model kampanye, yakni  rapat terbuka, pertemuan terbatas, dan tatap muka atau dialogis. mik)

kayong utara

Pontianak Post

Selasa 12 Maret 2013

Bupati: Jangan Langgar Hukum Kades Diusut Karena Diduga Korupsi


UCAPAN SELAMAT: Bupati Kayong Utara Hildi Hamid memberikan ucapan selamat kepada tiga kepala desa, seusai melantik mereka di Gedung Balai Praja Sukadana, beberapa waktu lalu.





SUKADANA – Bupati Kayong Utara, Hildi Hamid, meminta kepada para kepala desa (kades) agar mengikuti aturan dan tidak melanggar hukum, dalam menyelenggarakan pemerintahan di tingkat desa. Hal ini disampaikannya ketika melantik tiga kades secara serempak di Gedung Balai Praja Sukadana, Jumat (8/3) lalu. Tiga kades yang dilantik tersebut adalah Kades Tanjung Satai, Kades Kemboja (Kecamatan Pulau Maya), dan Kades Matan Jaya, Simpang Hilir. Dalam pidatonya, Bupati menegaskan bawa alokasi dana desa (ADD) merupakan anggaran yang memiliki kewajiban, untuk dipertanggungjawabkan penggunaannya. Penyimpangan penggunaan dana tersebut, diingatkan Bupati, dapat berakibat kepada penyelesaian di pihak penegak hukum. “Dan untuk tahun 2013 ini, diindikasikan bahwa ada kepala desa di wilayah Kabupaten Kayong Utara, yang telah dilaporkan warganya kepada pihak yang berwajib,” katanya. Untuk itu, Bupati berharap, peran lebih dari badan permusyawaratan desa (BPD), untuk memberikan perhatian lebih intensif, terhadap pengelolaan keuangan desa yang dilaksanakan oleh seorang kades. “Ingatkan apabila kepala desa tidak melaksanakan programprogram yang telah ditetapkan dalam APBDesa. Sebuah pilihan harus menjadi ketetapan bersama, yaitu mengutamakan kepentingan masyarakat bersama, di atas kepentingan individu maupun sekelompok orang,” serunya. Terpisah, kepala Bidang Pemerintahan Desa Badan Pemberdayaan Masyarakat, Pemerintahan Desa, Perempuan, dan Keluarga Berencana (BPMPDPKB) Kabupaten Kayong Utara, Didik Kurniawan, membenarkan bahwa ada seorang kades yang sekarang sedang diusut. “Benar, saya sudah dipanggil untuk menjadi saksi dan dugaan kasusnya seputar tipikor (tindak pidana korupsi),” kata Didik. (mik)

Pontianak Post

Selasa 12 Maret 2013

aneka kalbar


Izin Sawit di Lahan Gambut


ANDALAN: Transportasi sungai tetap jadi andalan warga di daerah. Apalagi ketika musim penghujan, dimana jalan yang ada tak bisa dilewati karena berlumpur.

Kapolres Dukung JSPP Sambungan dari halaman 17

sebelum Pontianak Post bersilaturahmi ke Polres Sintang. Menyusul pelaksanaan jalan sehat di Sintang sudah terpublikasi dan banyak masyarakat sudah memborong kuponnya. Apresiasi besar Kapolres terhadap pelaksanaan jalan sehat ini juga ditandai dengan membahas singkat masalah teknis untuk rute yang akan dilalui peserta. Yang intinya semua bisa berjalan lancar dan sukses, sehingga pengamanan rute peserta nanti akan diberi-

kan perhatian. “Panitia mungkin bisa rapat bersama dengan jajaran SatLantas kalau untuk pengamanan rute. Membicarakan teknis di lapangan (rute) saat hari pelaksanaan,” kata Kapolres. Sementara untuk jalan sehat di Sintang, keikutsertaanya juga terbuka bagi masyarakat Kabupaten terdekat. Seperti masyarakat Melawi, Kapuas Hulu serta Sekadau. Jalan sehat spektakuler itu sendiri digelar serentak di tujuh kota/ kabupaten di Kalimantan Barat. Untuk di Sintang, Pontianak Post bekerjasama den-

gan Korem 121/ABW dalam penyelenggaraannya.

Jalan sehat ini, selain  berhadiah utama  satu unit rumah lengkap furniture,  juga meny-

iapkan hadiah menarik seperti sepeda motor, televisi dan berbagai macam lainnya juga akan diberikan kepada peserta yang beruntung. Dan semua peserta akan mempunyai kesempatan sama. Sementara untuk mendapatkan kupon jalan sehat bisa dengan mendatangi kantor Biro Pontianak Post Sintang jalan JC Oevang Oeray atau menghubungi nomor telepon 081345107773 (Sutami Biro Pontianak Post Sintang). Pelaksanaan jalan sehat HUT ke 40 Pontianak Post di Sintang ini juga turut didukung harian Kapuas Post. (stm)

perundingan. Mungkin, akan memakan waktu lebih lama. Akan tetapi, itu akan lebih baik, ketimbang dibiarkan berlarut-larut hingga korban terus berjatuhan. “Ada mahkamah Internasional. Kita yang di daerah perbatasan Kalbar, Aruk, Jagoi, Entikong dan Badau, tak perlu ikut campur. Juga tak perlu terprovokasi keduanya. Masing-masing tentu punya argumen sendiri sendiri untu mengklaim sebagai wilayah mereka,” kata Presiden Front Pembela Dayak (FPD) ini. Mantan Ketua DPRD Bengkayang ini sangat menyayangkan apabila konflik di utara

Kalimantan itu akan memberikan dampak negatif buat masyarakat Indonesia yang ada di perbatasan. “Besar kecil jelas berdampak. Terutama buat warga kita yang menjadi TKI (pekerja sawit) di sana. Tentu mereka was-was.” Belakangan konflik mulai mereda, dan masyarakat sudah beraktivitas sebagaimana biasa. “Tetapi itu pun tetap diwaspadai, khususnya oleh masyarakat Indonesia yang bekerja di sana, sebab situasi keamanan belum benar-benar pulih sebagaimana sebelum penyerangan tersebut,” katanya mengakhiri. (ing)

kondisi Nsm sudah berdarah di kepala dan posisi nya sudah tumbang kemudian langsung dibawa ke Rumah Sakit untuk mendapatkan perawatan, sementara Afn seketika itu juga dibawa ke Polsek untuk dimintai keterangan,” katanya. Atas kejadian tersebut, lanjutnya, adik kandung korban, Ndt (33) membuat laporan ke Polsek Singkawang. “Sementara ini pelaku kita amankan, dan akan dikenakan Pasal 44 UU 23 Tahun 2004 tentang tindak pidana penghapusan kekerasan rumah tangga

dengan ancaman hukuman lima tahun, namun jika dalam perkembangannya nanti mengakibatkan luka berat akan diancam hukuman sepuluh tahun,” katanya. Pelaku kemudian ditahan sementara di Mapolsek Singkawang Selatan, Barang Bukti yang diamankan petugas adalah satu buah pisau warga putih dengan pegangan warna hitam. Korban setelah mendapatkan perawatan sebanyak delapan jahitan di kepalanya, sudah pulang ke rumah dan hari ni dimintai keterangan di Mapolsek.(fah)

kalau rekayasa,” kata Rabab, kemarin Minggu (10/3). Rabab mempunyai fotofoto anak lagi bekerja di PT SSA. Semua didokumentasikan langsung olehnya, sebagai tindak lanjut laporan masyarakat setempat. Yakni orang tua yang anaknya bekerja di perusahaan, dan pernyataan itu dibuat secara tertulis. Berisi upah anaknya belum dibayar penuh untuk bibit 1000 polibek, hanya 400

polibek yang sudah mendapatkan kompensasi. Tapi bentuknya bukan berupa uang tunai melainkan beras. Karena itu Rabab meminta pemerintah dapat menyelesaikan permasalahan perusahaan yang diduga sudah mempekerjakan anak dibawah umur. Pasalnya bisa berdampak negatif bagi anak, yakni malas sekolah karena merasa sudah dapat menghasilkan uang. (stm)

Untuk menjadi peserta jalan sehat sendiri   sangat mudah.   Cukup dengan membayar Rp.10.000,  satu kupon jalan sehat bisa didapatkan. Yang   tiap kupon tersebut nanti akan diundi buat menentukan pemenang. Baik untuk hadiah utama berupa satu unit rumah maupun hadiah menarik lainnya.

Jangan Terprovokasi Sambungan dari halaman 17

masih satu rumpun dan satu pulau, Kalimantan, memungkinkan ikatan emosional se pulau akan dikedepankan. Namun, Petrus meyakini, kedewasaan dan pola pikir warga perbatasan, tidak akan semudah itu terprovokasi dari keduabelah pihak yang berkonflik. Apalagi, ditinjau dari sisi jarak daerah yg bergolak, tidak persis bersebelahan. Namun, karena, menyangkut daerah perbatasan bisa saja penyusup dari kedua belah pihak memanfaatkan kondisi geografis tersebut. “Karena jarak yang dekat

dengan kita,” tambahnya. Beruntung, imbuhnya, TNI sudah memperketat penjagaan di kawasan perbatasan untuk menyikapi konflik tersebut. Pun demikian, diharapkan personil TNI yang diturunkan, tak hanya sekadar patroli atau pun menjaga kawasan perbatasan, namun juga ambil bagian dalam sosialisasi terhadap masyarakat perbatasan. Tak hanya di radius terdekat pada kawasan konflik, tetapi di sepanjang perbatasan yang ada. Menilik permasalahan yang ada, diterangkannya kedua belah pihak harus mengedepankan

Cemburu, Istri Dibacok Sambungan dari halaman 17

“Istrinya saat datang ke rumah tidak ada, Afn kemudian mencarinya hingga melihat sang istri di sebuah warung mie di daerah Kaliasin Luar, namun sebelumnya berdasarkan keterangan yang dikumpulkan pelaku dan korban (suami dan istri) sering cekcok, dan selama ini komunikasi keduanya kurang baik,” katanya. Mengetahui sang suami datang, dikatakan Supianik, Nsm yang awalnya sedang mengobrol berdua dengan penjual

mie, kemudian pindah ke rumah yang tidak jauh dari tempat tersebut. “Afn pun mendatangi sang istri yang sedang berada di rumah, langsung melayangkan pisau yang memang dibawanya,” katanya. Melihat kejadian tersebut, lanjut Supianik, warga yang melihatnya selanjutnya memberitahukan kepada Petugas Polsek Singkawang Selatan. Hingga akhirnya beberapa anggota polisi datang ke Tempat Kejadian Perkara (TKP). “Saat datang, kita melihat

Yakin Bukan Rekayasa Sambungan dari halaman 17

Karena itu, Famki menilai kalau pihak indepen perlu turun untuk menginvestigasi soal anak bawah umur yang bekerja di perkebunan kelapa sawit. Harapannya, masalah tersebut bisa ditangani secara objektif. Seperti diberitakan (11/3) Sekrestaris Desa Nanga Kesange Ambalau Sintang, Rabab, memastikan kalau rekaman

gambar maupun video perusahaan perkebunan kelapa sawit PT Sinar Sawit Andalan (SSA) telah mempekerjakan anak dibawah umur tanpa rekayasa. Tudingan yang menyebut dirinya sengaja merekayasa dibantah. “Saya berani di sumpah secara adat maupun agama, kalau anak dibawah umur bekerja di PT SSA adalah benar. Foto dan tayangan yang beredar itu asli. Tidak benar

Pengguna Sabu Diringkus Sambungan dari halaman 17

tuding mengenai kepemilikan sabu sebesar. Th alias Bu menuding jika sabu-sabu tersebut milik Ad. Sebaliknya Ad menuding sabu tersebut milik Th aliasn Bu. Bahkan ia mengaku jika empat paket kecil sabu itu dibelinya dari tangan Th alias Ab. “ Me re k a m e m b e r i k a n kronologi yang berbeda, tetapi itu hak mereka. Karena keterangan yang tersangka berikat nilainya rendah dan untuk pembuktian itu hanya ada di Pengadilan,” kata Kasat. Sementara itu, Ad mengatakan jika sabu dua gram itu milik Th alias Bu, sedangkan untuk empat paket kecil ia mengakui jika itu miliknya. Namun Ad membantah jika dituduh sebagai pengedar, lantaran ia merasa hanya

sebagai pemakai. Sedangkan Ad mengaku jika timbangan yang digital yang ditemukan di kamar kostnya itu milik Th alias Bu. “Yang dua gram itu punya dia,” kata Ad sambil menunjuk Th alias Bu. Kendati demikian, Ad tidak membantah jika ia dituduh sebagai pengkonsumsi sabu. Bahkan itu sudah dilakukan selama kurun waktu dua tahun terakhir ini. Barang haram tersebut dibelinya di Pontianak dan pengakuannya diperoleh di Beting. “Saya datang sendiri ke Pontianak dan langsung ke Beting untuk membeli sabu. Kedua orang tua saya tidak mengetahui jika saya mengisap sabu. Tetapi kalau sabusabu empat paket kecil itu saya beli dari Bu,” ungkap Ad. Sedangkan dengan Th alias

PUTUSSIBAU – Upaya meningkatkan perekonomian daerah dan kesejahteraan rakyat terus dilakukan pemerintah Kabupaten Kapuas Hulu. salah satu diantaranya dengan mendorong masuknya investasi perkebunan sawit. Hanya saja, pemerintah daerah di ingatkan untuk hati-hati dalam pemberian izin kepada para investor perkebunan sawit tersebut. “Hati-hati. Jangan sampai menyalahi aturan. Terutama dalam hal lahan. Salah satunya yang terkait perizinan di lahan gambut,” ingat Ir Agustinus Kasmayani, MH, Anggota DPRD Kapuas Hulu. Dikatakan Politisi Partai Demokrat ini, dalam pemberian izin perkebunan sawit harus memperhatikan salah satunya Pedoman Pemanfaatan Lahan Gambut Untuk Budidaya Kelapa Sawit. Yaitu Permentan No. 14/Permen-

membeli sabu tersebut dari dirinya. “Saya hubungi Ad, tanya bahan (kode untuk, dia bilang ada, tapi harganya tinggi,” kata Bu. Th alias Bu mengaku sudah lama menjadi pencandu narkotika jenis sabu-sabu. Kendati demikian ia mengakui jika sempat berhenti selama lima tahun dan berangkat kerja ke Batam. Namun ketika kembali ke Kalbar, ia kembali mengkonsumsi Sabu. “Saya berangkat dari Sungai Duri untuk membeli bakso dan langsat punggur, titipan orang tua angkat. Sebelumnya sudah menghubungi Ad untuk membeli sabu-sabu,” kata Bu. Dalam kasus tersebut, keduanya bakal dijerat UU No 35 tahun 2009 Tentang Narkotika, pasal 114 dengan ancaman hukuman maksimal 15 tahun penjara. (mse)

but bukan pasir kuarsa dan bukan tanah sulfat masam, tingkat kematangan gambut saprik (matang) atau hemik (setengah matang), dan tingkat kesuburan tanah gambut eutropik. “Dan penting juga dalam pengusahaan budidaya kelapa sawit di lahan gambut adalah dengan tetap menjaga kelestarian fungsi lingkungan,” ujarnya. Di Kalbar, lahan gambut tersebar di Kab. Kapuas Hulu, Sambas, Pontianak, Kubu Raya dan Ketapang dengan total luasan 1,73 juta hektar . Di Kapuas Hulu memiliki luas 67.082 Hektar. Anggota DPRD yang terpilih dari zona dua ini beharap, luasan lahan gambut itu tidak tergerus dan terus berkurang akibat ekspansi perkebunan sawit. Mengingat, lahan gambut memiliki arti penting bagi lingkungan. (w@Nk)

tor itu terus membuntuti kedua pelaku yang kabur tersebut. Keduanya berhasil dikejar, dan berada tak jauh dari Asrama Kepolisian di Jalan K.S Tubun. Oleh pengendara itu, langsung menendang stang sepeda motor pelaku, hingga akhirnya keduanya tersungkur di parit. Karena panik, keduanya lantas kabur masuk ke dalam hutan. Warga yang mengetahui insiden itu, lantas berdatangan dan sambil berteriak. Ada yang berteriak untuk membakar motor yang ditinggal pelaku. Apalagi kawasan tersebut dekat dengan pemukiman penduduk. Menerima informasi dari warga, polisi pun langsung mendatangi lokasi kejadian (tempat dimana pelaku Polisi lantas melakukan penyisiran tempat pelarian pelaku. Setelah dilakukan pencarian selama kurang lebih dua jam, keduanya berhasil ditemukan, tapi di tempat yang terpisah dalam kondisi fisik lemah. Satu pelaku berinisial Fa ditemukan di hutan dekat bak air PDAM, sedangkan Ma ditemukan tak jauh dari lokasi tersebut. Keduanya pun langsung digelandang ke Polres Singkawan, sekitar pukul 00.00 WIB. Ternyata setelah kurang lebih tiga jam diamankan di Polres, kondisi fisik salah seorang pelaku, yang diketahui bernama Fa masih tampak lemah. Tepat pukul 03.00 Fa dilarikan ke Rumah Sakit Abdul Azis. Tak berselang lama, sampai di rumah sakit, Fa sudah tewas. Polisi menduga kuat jika Fa meninggal dalam perjalanan menuju ke rumah sakit. Kendati demikian polisi belum bisa memastikan penyebab tewasnya Fa. Saat dikonfirmasi, Kapolres Singkawang, AKBP Prianto, melalui Kasat Reskrim AKP Isbullah membenarkan jika pihaknya mengamankan kedua pelaku pejambretan tersebut. “Pelaku diamankan setelah kita melakukan pencarian. Keduanya diamankan dengan kondisi fisik yang lemah. Hanya saja, Fa ketika dilarikan ke rumah sakit, sudah meninggal dunia dan diperkirakan

meninggal di perjalanan,” jelas AKP Isbullah kepada wartawan, Senin (11/3) di ruangannya. Ia pun membenarkan jika korban terjatuh ke parit akibat stang motornya ditendang pengendara motor misterius. Hingga saat ini pun polisi belum mengetahui siapa pengendara itu. “Fa dan rekannya, Ma, kabur usai mengambil dompet milik Kurniasih. Pelaku tidak menyadari jika dia dikejar pengendara motor lain. Sampai di K.S Tubun, pelaku berhasil dikejar dan stang sepeda motor ditendang hingga terjatuh ke parit dan kemudian kabur ke hutan, dan disisiri anggota Polres yang berhasil menemukan mereka,” jelas Kasat. Meski polisi belum bisa menyimpulkan penyebab tewasnya Fa. Namun dari fisik Fa, memang ditemukan luka lecet di kedua siku dan rahang kiri lebam. Dan polisi menegaskan jika Fa tewas bukan karena ditembak seperti isu yang beredar. Lalu, apakah karena dikeroyok massa ? “Tidak bisa pastikan penyebab tewasnya karena saya tidak melihat, tetapi yang pasti Fa tewas bukan karena ditembak. Keterangan dari dokter, memang ada luka lebam di rahang kiri dan lecet di kedua siku,” ungkap Isbullah. Sejauh ini, kata Kasat, Polisi masih melakukan penyelidikan terkait dengan track record kedua pelaku. Pasalnya diketahui dari identitas jika keduanya warga yang berdomisili di Singkawang. “Fa memang asal Singkawang, tapi lama tinggal di Pinyuh Dalam, sedangkan Ma warga Dusun Nusapati, Desa Galang, Kabupaten Pontianak. Kita koordinasikan dengan Polresta Pontianak mengenai kasus mereka,” jelas Kasat Sementara itu, Wartawan koran belum bisa memancarai rekan korban, Ma, karena baru menjalani pemeriksaan kepolisian pada kemarin siang. “Besok saja, ya. Ma masih kita pintai keterangan,” kata Kasat singkat. Hingga berita ini diturunkan, kasus tersebut masih dalam penyelidikan pihak kepolisian. (mse)

Jambret Tewas Sambungan dari halaman 17

polisi menegaskan tidak adanya luka tembak pada tubuh pelaku. Dalam aksi itu, Fa tidak bekerja sendiri melainkan bersama rekannya berinisial Ma. Dari tangan keduanya, polisi menyita barang bukti, dompet warna coklat dengan corak putih, kartu identitas, uang Rp42 ribu, anting-anting seberat 50 miligram yang merupakan milik korban dan helm KYT berwarna merah. Informasi yang berhasil dihimpun, peristiwa itu berawal ketika korban yang datang dari arah Roban berangkat menuju ke Jalan Setia Budi untuk membeli nasi goreng. Usai membeli nasi goreng, sambil membonceng anaknya korban pun pulang menuju ke rumah. Tanpa disadari ada pengendara sepeda motor Yamaha Vixion KB2634 BO yang berboncengan membuntutinya. Belakangan diketahui pengendara sepeda motor itu ialah Fa, sedangkan yang dibonceng adalah Ma. Begitu tiba di Jalan Kalimantan, Fa lantas menyalip sepeda motor korban dari jalur dari kanan. Dengan sigap Fa langsung merampas dompet korban yang tersimpang di boks depan sepeda motor dan kemudian tancap gas alias kabur. Korban pun tak bisa berbuat apa-apa, hanya melihat pelaku kabur di kegelapan malam. Rupanya tidak hanya korban yang mengetahui kejadian itu, tapi ada pengendara sepeda motor lainnya yang juga melihat aksi pelaku. Tidak diketahui identitas pengendara motor tersebut, namun ia sempat menyarankan korban untuk melapor ke Polres Singkawang. Mendapat saran dari pengendara misterius itu, korban lantas berangkat ke Polres untuk melaporkan kejadian yang dialaminya. Sedangkan pengendara motor yang belakangan diketahui mengendarai motor matic itu langsung mengejar pelaku yang kabur ke arah Jalan Sudirman yang kemudian masuk ke Jalan K.S Tubun. Rupanya, pengendara mo-

Beli Sembako ke Distrik Mongkos dan Mapu Sambungan dari halaman 17

Bu, Ad mengaku sudah dikali sama-sama mengkonsumsi sabu-sabu dan mereka sudah saling kenal selama enam tahun terakhir. “Kami sudah saling kenal dalam waktu enam tahun terakhir ini. Sebelumnya pernah nyabu sama-sama di Gang Ceremai,” kata Ad. Sebaliknya Bu mengatakan jika semua sabu itu milik Ad. Barang bukti miliknya yang diamankan polisi hanya dua botol minuman penyegar, salah satu dari botol tersebut sudah dibuat bong dan uang sebesar Rp950 ribu. Namun ia mengakui jika kedatanganya ke Singkawang memang untuk membeli sabu dan karena itu, ia menghubungi Ad. Ia menyebutkan sabu itu sebagai batu atau bahan. Bahkan ke empat sabu itu diakuinya memang milik Ad, tidak seperti yang diakui Ad jika dia

tan/PL.110/2/2009 tanggal 16 Pebruari 2009. Permentan itu merupakan tindak lanjut dari Keputusan Presiden Nomor 32 Tahun 1990 tentang Pengelolaan Kawasan Lindung. “Dimana disebutkan bahwa pemanfaatan lahan gambut untuk budidaya kelapa sawit dapat dilakukan dengan memperhatikan karakteristik lahan gambut sehingga tidak menimbulkan kerusakan fungsi lingkungan,” tutur Kasmayani. Menurut aturan itu dikatakan Kasmayani, pengusahaan budidaya kelapa sawit dapat dilakukan di lahan gambut dengan memenuhi kriteria yang dapat menjamin kelestarian fungsi lahan gambut. Yaitu diusahakan hanya pada lahan masyarakat dan kawasan budidaya, ketebalan lapisan gambut kurang dari 3 (tiga) meter, substratum tanah mineral di bawah gam-

“Sasaran patroli yang kami lakukan selain mendukung pengamanan kawasan perbatasan juga untuk mengantisipasi peredaran senjata, bahan peledak hingga narkoba,” katanya. Pelintas kebanyakan warga setempat yang berada di Dusun Segumon Desa Lubuk Sabuk, barang yang dibawa mereka adalah kebutuhan pokok, imbuhnya. Ia mengaku prihatin den-

gan kondisi itu karena memang sebagian besar barangbarang kebutuhan pokok yang ada di kawasan perbatasan lebih banyak berasal dari Malaysia. “Mau bagaimana lagi, sebagian besar masyarakat menjual hasil bumi dan membeli kebutuhan pokoknya dari Malaysia karena minimnya pasokan dari negeri sendiri akibat akses jalan yang rusak parah,” ucapnya. Untuk aktivitas ekonomi di kawasan perbatasan melalui

jalur tikus memang sebenarnya tidak mudah karena harus melalui jalan berbukit. “ Te t a p i t e t a p d i p i l i h masyarakat karena untuk sampai ke kota Kecamatan Sekayam jauh lebih sulit daripada pergi ke Malaysia,” jelasnya. Ia menilai sejauh ini kondisi kawasan perbatasan Sekayam masih sangat kondusif. “Patroli tetap kami laksanakan rutin dan terkadang juga kami laksanakan patroli gabungan bersama polisi,” kata dia. (*)

rakyat diri tetap menginginkan ada penjelasan dari instansi terkait ikwal pembangunan gedung Pengadilan Ngabang. Karena keberadaan kantro pengadilan sudah menjad dambaan warga Ngabang. “Masak sidang pelanggaran lalintas saja harus ke Mempawah,” ujarnya

Belum lagi sambungnya, gedung di jalur dua yang direncanakan akan digunakan untuk kantor pengadilan sementara, bahkan untuk biaya rehabilitasnya pemerintah kembali menglontorkan Rp350 juta. “Namun sampai sekarang tidak difungsikan,” ungkap Apui. (wan)

Dipertanyakan Sambungan dari halaman 17

sepertinya terhenti. Bahkan sampai sekarang yang sudah dibangun hanya tiang-tiang. Pertanyaanya, apakah dana sekitar 1 miliar itu hanya untuk bangun tiang saja. Apakah tidak inklud satu gedung dananya 1 miliar. Sebagai wakil


Pontianak Post


Selasa 12 Maret 2013

SOCCER Barca Menang, Milan Lolos BURSA dunia mengunggulkan Barcelona menang pada leg kedua nanti. Asian Handicap memberikan voor 1 3/4 buat Milan. Artinya, bila hanya menang 2-0, maka petaruh Barca menang separo dari nilai taruhan. Bursa taruhan lainnya, seperti William Hill juga menjagokan Barca bisa mengalahkan Milan. Mereka memberikan kompensasi sembilan kali lipat. Namun, untuk tim yang lolos ke perempat final, nyaris semua bursa kompak memfavoritkan Milan. (ham/bas) Bursa




William Hill Ladbrokes Bwin Sportingbet

1,33 1 ,29 1,3 1,28

5 6 6,25 5,75

9 8,5 7 8 ,5

Bursa Lolos


AC Milan

William Hill Paddy Power Coral Stan James

2,1 2,25 2,1 2,1

1,67 1,57 1,65 1,75

Barca Menyerang, Milan Balance




18 Alba

3 Pique

14 Mascherano

ura (asi

10 Messi 19 Niang



8 Iniesta



10 Pedro 92

El Shaarawy


la Pe

4 Muntari



4 Fabregas

16 Busquets

6 Xavi

i Ro

18 Montolivo




10 Boateng





17 Zapata



23 Ambrosini



2 De Sciglio


ar Yepes lini tengah, dengan menumpuk gelan- lanjut Constant. 32 ung r u s 20 H ( i a dang bertahan. Di sisi lain, Barca Abbiati ass Abate meneor K Milan juga akan memilih retreat alias akan mencoba segala t k i V mukan solusi sit : menarik garis pertahanan lebih dalam. cara untuk membalika saat tim buntu di p-W Kondisi itu ideal dengan stok gelandang kan keadaan. Selama Cam u tengah laga. o N bertahan Milan seperti Massimo ini, Barca selalu ter: Selain itu, dia juga harus dion Ambrosini, Sulley Muntari, dan paku dengan satu cara Sta mampu menjaga mental para pemain Riccardo Montolivo. Juga, Kevin bermain dan satu fiPrince Boateng yang bisa menjaga losofi bermain. Mereka ketika sedang frustasi di tengah lapangan. keseimbangan menyerang dan juga selalu mati kutu k e t i k a ”Ini situasi sulit. Tanpa bos, seperti perubertahan. strikernya Lionel Messi terperang- sahaan tanpa chairman. Kami merindukannya,” bilang Gerard Pique, bek Barca, ”Kami bukannya bertahan kap zona pertahanan lawan. total. Kami tetap melakukan se- SIARAN LANGSUNG ”Kami harus mencoba segala- seperti dikutip Reuters. Meski berada di New York, Vilanova rangan dan mencoba mencetak nya untuk menang. Kalau kami tiSCTV gol cepat. Secara mental, kami dak mengambil risiko, maka kami tetap memberikan masukan kepada tim, sangat siap menghadapi pertan- Pukul 02.45WIB tidak akan menang. Kami harus sayangnya tidak bisa terjadi di tengah dingan ini,” kata Kevin Constant, tunjukkan sebagai tim besar dan lapangan. “Kami akan menyarang sejak bek kiri Milan, seperti dikutip Football mampu membuat sejarah comeback yang awal dan berharap bisa menmang 3-0,” Italia. hebat,” jelas Dani Alves, bek kanan Barca, ujar bek timnas Spanyol itu. Kekuatan Barca juga kian mantap Ya, di pentas domestik Milan memang kepada Barca TV. sedang on fire. Setelah sempat terpuruk Tanpa Tito Vilanova yang masih menja- dengan pulihnya Xavi Hernandez. Dia pada awal musim, kini mereka sudah lani pengobatan akibat kanker parotis di memang belum kembali ke kondisi 100 menembus tiga besar di klasemen se- Amerika Serikat, beban berada di tangan persen, tetapi tetap memaksa untuk turun. mentara Serie A Liga Italia. “Kami punya Jordi Roura. Inilah yang menjadi titik le- ”Saya pastikan akan berada di lapangan keuntungan dan harus dimaksimalkan,” mah Blaugrana, julukan Barca. Roura ha- dan membantu tim,” kata Xavi, seperti dikutip Goal. (ham)

ri lleg





Lima Laga Terakhir Menang-Menang-Seri-Menang-Menang


2 Alves



Evaluasi - Efektif dan Efisien. Sudah tahu bakal kalah dalam penguasaan bola, Rossoneri sebutan Milan - bermain cerdas dengan mengatur tempo dan memaksimalkan serangan balik. - Pivot Players. Riccardo Montolivo punya peran sentral sebagai penghubung pertahanan dan pembuka skema serangan sekalipun lini tengah dikuasai Barca. Prediksi - Balance. Sangat penting bagi Massimo Ambrosini cs tetap menjaga kedalaman dan tidak bernafsu menyerang karena yang mereka butuhkan bukan kemenangan, melainkan lolos. - Kembali Bikin Frustrasi. Dengan beban lebih berat ada di pundak pemain Barca, pemain Milan sepertinya akan menampilkan trik-trik untuk membuat frustrasi lawan. (dns)

BARCELONA -- Defisit dua gol membuat tugas Barcelona pada second leg babak 16 besar Liga Champions sulit. Agar lolos ke perempat final, mereka harus menang dengan selisih tiga gol atas AC Milan di Nou Camp dini hari nanti (siaran langsung SCTV pukul 02.45 WIB). Bukan mudah menjebol gawang Rossoneri, julukan Milan, tiga gol. Pelajaran dari first leg babak 16 besar (20/2), Barca hanya bisa sekali melepas tembakan ke gawang Milan yang dikawal kiper veteran Christian Abbiati. Pelatih Milan Massimiliano Allegri menerapkan strategi pertahanan berlapis dan menahan serangan Barca di lini tengah. Barca benar-benar kesulitan memasuki area penalti Milan. Pada second leg, sepertinya taktik seperti itu kembali dipakai. Apalagi, Milan kehabisan stok penyerang. Mario Balotelli tidak bisa bermain karena cup-tied, sedangkan Giampaolo Pazzini cedera, dan Robinho kurang fit. Sehingga penguatan akan dilakukan di

rc e


ih :




t Pela

Evaluasi - Minim Kreativitas. Dalam first leg di San Siro, Barca - sebutan Barcelona kehilangan kreativitas menembus perimeter kotak 16 AC Milan. Tanpa Xavi Hernandez, tak ada pula umpan-umpan cerdas yang mengejutkan. - Tidak Punya Plan B. Banyak pengamat menilai Barca seharusnya mengubah strategi di babak kedua atau ketika mengalami kebuntuan serangan. Tidak heran apabila para pemain merindukan sosok pelatih Tito Vilanova. Prediksi - Menyerang dan Menyerang. Butuh kemenangan tiga gol membuat Barca tak punya pilihan lain selain harus mengambil inisiatif menyerang sejak kickoff. Gol di 15 menit awal bisa menaikkan motivasi tuan rumah. - Key Bench. David Villa atau antara Cesc Fabregas dan Alexis Sanchez seharusnya bisa memberikan perbedaan ketika dimainkan sebagai pemain pengganti mengingat jam terbang Eropa mereka. Lima Laga Terakhir Menang-Kalah-Kalah-Menang-Kalah


Janjikan Gaji Rp 75,3 juta buat Allegri JABATAN pelatih AC Milan Massimiliano Allegri telah ditegaskan aman, apabila finis di tiga besar Serie A Liga Italia musim ini. Biar begitu, rumor mantan tactician Cagliari itu bakal angkat kaki dari San Siro, markas Milan, tetap santer. Padahal, wakil presiden Milan Adriano Galliani berulang kali meyakinkan Alle-

gri akan bertahan musim depan. Lagipula kontraknya masih tersisa hingga Juni 2014 mendatang. Hanya, banyaknya tawaran dari klub lain bisa membuat Allegri berpikir ulang. Setelah sebelumnya AS Roma berulangkali menegaskan ketertarikannya kepada Allegri, kini Corriere dello Sport melansir, klub Ukraina Shakhtar Donetsk tertarik. Me-





reka ingin menggantikan Mircea Lucescu dengan Allegri musim depan. Demi mendapatkan Allegri, Shakhtar mengajukan penawaran yang sulit ditolak. Mereka bersedia membayar 6 juta euro atau setara Rp 75,3 miliar pertahun. Jumlah itu jauh lebih banyak ketimbang gaji yang sekarang diterimanya di Milan. Pelatih yang langsung membawa Rossoneri, julukan Milan, scudetto pada musim pertamanya melatih itu digaji hanya 2,5 juta euro (Rp 31,4 miliar) pertahun di Milan saat ini. Milan juga belum mengajukan kenaikan gaji kepada Allegri. Meski musim lalu gagal membawa Milan scudetto dan musim ini juga berpotensi kehilangan scudetto, Allegri tetap dinilai sebagai pelatih potensial. Pasalnya, musim ini saat Milan kehilangan bintangnya, dia mampu mengandalkan pasukan muda. Musim ini, Milan dipenuhi dengan para bintang muda seperti Stephan El Shaarawy, Bojan Krkic, Mbaye Niang, Mario Balotelli, dan Mattia De Sciglio. Mereka menggantikan peran pemain berpengalaman seperti Zlatan Ibrahimovic, Antonio Cassano, Thiago Silva,

Massimiliano Allegri

Alessandro Nesta, serta beberapa veteran lainnya. Kendala Shakhtar adalah harus bermain di Ukraina dengan bahasa baru dan kompetisi baru. Makanya, ketertarikan Roma juga jadi perhatian. “ Aurelio Andreazzoli cukup baik, tetapi bila Roma ingin mengganti pelatih, saya pikir Allegri pilihan yang lebih baik ketimbang Walter Mazzarri,” kata Daniele Adani, Sky Sport Pundit serta mantan pemain Lazio dan Inter Milan. (ham)


30 Modal Menuju Tiga Target Even


JAKARTA--Secara raihan gelar, memang hanya satu titel yang dibawa para pemain Indonesia dari All England 2013. Itu berarti sama dengan pencapaian tahun lalu. Namun, secara keseluruhan banyak peningkatan signifikan yang dicatat pasukan Merah Putih. Indonesia menempatkan delapan wakil (tujuh dari pelatnas, satu nonpelatnas) di perempat final, terbaik dalam satu dekade. Empat di antaranya menembus semifinal, tiga di ganda campuran dan satu ganda putra. Tahun lalu, hanya ada empat wakil Indonesia di perempat final, tiga dari Cipayung dan satu nonpelatnas. Dari keempatnya, hanya Owi/Butet-sapaan akrab Tontowi/Liliyanayang masuk babak empat besar dan akhirnya menjadi juara. “Tahun ini, prestasi bulu tangkis tanah air menapak ke arah positif. Kalau melihat di All England, wakil kita di delapan besar cukup banyak. Lalu di semifinal hingga menjadi juara. Dibanding tahun lalu, ini jelas kemajuan pesat,” kata Kasubid Pelatnas PB PBSI Christian Hadinata ketika dihubungi kemarin di Jakarta. Christian juga menyoroti raihan Linda Wenifanetri dan Tommy Sugiarto yang lolos sampai perempat final. “Kerja keras keduanya harus diapresiasi,” tutur juara ganda campuran All England 1979 bersama Imelda Wiguna itu. Lantas bagaimana dengan pemain-pemain yang hanya mencapai babak pertama” Christian masih menunggu laporan keseluruhan dari tim pelatih yang berangkat ke Inggris. Senada dengan Christian, pelatih ganda campuran pelatnas Richard Mainaky juga belum bisa memberikan penilaian kepada pemainnya. Yang pasti, dari, empat pasangan yang dikirim dari Cipayung, hanya satu yang terhenti di babak pertama. Yaitu Riky Widianto/Richi Puspita. “Kalau M. Rijal/Debby Susanto jelas melebihi target. Mereka saya target perempatfinal. Lalu Fran Kurniawan/Shendy Puspa Irawati juga bisa masuk perempat final dengan mengalahkan unggulan ketiga adalah pencapaian tersendiri,” ucap Richard. Selain ganda campuran, bapak satu anak itu juga menangani ganda putri. Untuk ganda putri, Richard menyebutkan baru menerima tongkat kepelatihan ganda putri satu setengah bulan lalu. Sehingga juga belum bisa banyak melakukan penilaian. (dra/ttg)

Pontianak Post


Selasa 12 Maret 2013

Perbarui Rekor, Pikirkan Pensiun Bernard Hopkins

PHILADELPHIA --Sekali lagi Bernard Hopkins memecahkan rekor sebagai petinju tertua yang mampu meraih gelar juara dunia di badan tinju dunia yang bergengsi. Setelah tahun lalu kehilangan gelar juar dunia kelas berat ringan versi WBC, kali ini dia memiliki gelar di versi badan tinju dunia IBF. Itu didapatnya setelah menang angka mutlak

atas Tavoris Cloud, Minggu (11/3). Hopkins pernah mengatakan masih akan terus berkubang di dunia profesional hingga berusia 50 tahun. Tapi, di usianya kini yang sudah 48 tahun, dia kembali berpikir mengenai kelanjutan karirnya. Hopkins mengindikasikan segera gantung sarung tinju.


Petinju asal Amerika Serikat itu mengatakan, jika tak ada lagi pertarungan yang menarik untuknya, maka dia akan berhenti. Dalm hal ini tentu saja masalah bayaran. ”Jika saya tak lagi termotivasi, maka tak ada lagi pertarungan. Jika tak ada lagi pertarungan yang berarti, saatnya untuk berhenti,” kata Hopkins seperti dikutip Associated Sport.

Hopkins dinyatakan menang angka mutlak atas Cloud, di Barclays Center, Philadelphia. Dia pun memperpanjang catatan sebagai petinju tertua yang memiliki gelar juara dunia. Sebelumnya, dia sudah memiliki predikat yang sama ketika mengalahkan Jean Pascal, pada Mei 2011. Saat itu, dia berusia 46 tahun, melampaui rekor sebelumnya yang dimiliki

George Foreman. Catatan tersebut membuat Hopkins sudah berada di awangawang. Petinju yang mendapatkan julukan The Executioner itu kemudian mengatakan, dirinya enggan kembali berlatih di gym tempatnya menempa diri selama ini di Philadelphia. Sebab, dia melihat tak ada lagi manfaat baginya untuk berlatih keras. “Saya hanya ingin duduk dan melihat apa ada yang bermakna bagi saya di luar sana. Saya tak ingin menjadi badut sirkus. Saya orang yang sangat bangga saat ini,” tutur Hopkins. Fisik Hopkins memang menunjukkan perbedaan berarti bila dibandingkan masa jayanya lebih dari satu dekade silam. Namun, kemampuannya menyelesaikan pertarungan sudah jauh menurun. “Mereka mengatakan petinju menjadi tua di atas ring. Tidak, petinju menjadi tua di gym ketika tidak ada orang yang cukup jujur untuk mengatakan bahwa mereka sudah tua,” bebernya. Pernyataan ini tentu bertolak belakang dengan pengakuan Hopkins sebelumnya. Petinju berusia 48 tahun tersebut pernah menyebut bahwa dirinya akan bertarung hingga lima tahun lagi. Tapi, sejarah dan rekor sudah telanjur digenggamnya. “Saya mengatakan kepadanya (Cloud) bahwa saya tak akan berada lama di sini; hanya lima tahun lagi,” ungkap Hopkins seusai laga melawan Cloud. Hanyapertarungan-pertarung besar dan berpotensi memecahkan rekor popularitas yang bisa menghentikan niat Hopkins segera gantung sarung tinju. Di luar sana, lawan-lawan yang punya kemampuan setingkat dengannya juga masih banyak. (ady)



C cmyk




Pontianak Post


Selasa 12 Maret 2013

Naik Peringkat Berkat CR7 VIGO -- Real Madrid memang masih tertinggal 13 angka (58-71) dengan Barcelona setelah jornada ke-27 Primera Division. Tapi, Real kini tak lagi menempati peringkat ketiga. Kemenangan 2-1 atas Celta Vigo di Balaidos kemarin membuat Los Merengues - sebutan Real - naik ke urutan kedua mengusur rival sekota Atletico Madrid dengan selisih

Piala FA


masing-masing pada menit ke-61 dan penalti menit ke-71. Sedangkan gol tuan rumah dicetak Iago Aspas (63”). “Kami mengakhiri laga dengan kemenangan, tapi miskin peluang. Kami bisa meraih malu seandainya Celta mampu memaksimalkan peluang mereka,” kata asisten pelatih Real Aitor Karanka kepada Marca. Sukses Real naik ke peringkat


Primera Division CELTA VIGO










The Blues Harusnya Lolos MANCHESTER -- Manchester United belum move on dari kegagalan di Liga Champions saat menghadapi Chelsea di perempat final Piala FA kemarin dini hari WIB (11/3). Bertanding di Old Trafford, United yang sudah unggul 2-0 hanya dalam 11 menit dipaksa mengakhiri laga dengan 2-2. Itu setelah gol-gol Javier “Chicharito” Hernandez dan Wayne Rooney mampu disamakan Eden Hazard (59”) dan Ramires (68”). Setan Merah (julukan United) beruntung tidak kalah karena The Blues - sebutan Chelsea - mendominasi permainan dan menciptakan banyak peluang sepanjang babak kedua. Tapi, defender United Rio Ferdinand tak beruntung karena ulahnya mendorong keras Fernando Torres dalam insiden tanpa bola di akhir babak kedua terancam sanksi dari FA. Belum ada konfirmasi kapan replay di Stamford Bridge bakal dihelat. Hanya, siapapun pemenang United versus Chelsea tak beruntung karena sudah ditunggu Manchester City dalam semifinal di Stadion Wembley (14/4). Slot semifinal lainnya, juga di Wembley (13/4), mempertemukan Wigan Athletic kontra pemenang replay Milwall/Blackburn Rovers. (dns)







“I Believe everything happens for a reason. People change so you can learn to let go, things go wrong so that you can appreciate them when they’re right.”

Pontianak Post ● Selasa 12 Maret 2013

- Legenda Diva Dunia -



DANGDUT adalah aliran musik yang sudah nggak asing bagi masyarakat Indonesia, dangdut adalah musik yang sangat merakyat bagi bangsa Indonesia sejak zaman berdirinya negara Indonesia. Musik dangdut berakar dari musik Melayu yang mulai berkembang pada tahun 1940-an. Irama Melayu sangat kental dengan unsur aliran musik dari India dan gabungan dengan irama musik dari Arab.

ERA 1960-AN

Musik Melayu mulai dipengaruhi oleh banyak unsur mulai dari gambus, degung, keroncong, langgam. Sebutan dangdut ini merupakan onomatope atau sebutan yang sesuai dengan bunyi, yaitu bunyi alat musik tabla atau yang biasa disebut gendang. Dan karena bunyi gendang tersebut didominasi dengan bunyi “dang” dan “dut”, maka sejak itulah irama Melayu berubah sebutanya menjadi suatu aliran musik baru yang lebih terkenal dengan irama musik dangdut.

ERA 1970-AN

Aliran musik dangdut yang merupakan seni kontemporer terus berkembang, pada awalnya irama dangdut identik dengan seni musik kalangan kelas bawah. Memang aliran seni musik dangdut ini merupakan cerminan aspirasi dari masyarakat kelas bawah yang mempunyai ciri khas kelugasan dan kesederhaannya.

ERA 1980-AN

Karena sifat kontemporernya maka di awal tahun 1980-an musik dangdut berinteraksi dengan aliran seni musik lainnya, yaitu dengan masuknya aliran musik pop, rock dan disco atau house music. Selain masuknya unsur seni musik modern, musik dangdut juga mulai bersenyawa dengan irama musik tradisional seperti gamelan, jaranan, jaipongan dan musik tradisional lainnya.

ERA 1990-AN

Musik dangdut mulai berasimilasi dengan seni gamelan dan terbentuklah suatu aliran musik baru yaitu musik dangdut campursari atau dangdut Campursari. Meski musik dangdut yang lebih original juga masih eksis pada masa tersebut.

ERA 2000AN

Seiring dengan kejenuhan musik dangdut yang original maka diawal era ini para musisi di wilayah Jawa Timur di daerah pesisir Pantura mulai mengembangkan jenis musik dangdut baru yaitu seni musik dangdut Koplo. saat ini Musik dangdut sudah menjangkau segala kalangan masyarakat dari kalangan kelas bawah sampai kalangan menengah dan kelas atas pun sudah mulai ketagihan dengan seni musik dangdut ini. (*/bbsb)


RACIKAN UNIK FEBRUARI lalu, (10/2) Grammy Awards ke-55 dan Brit Awards (20/2) mencuatkan deretan newcomer sebagai peraih penghargaan dan memborong nominasi. Mumfords and Sons Berjaya di Grammy dan Brit Awards sekaligus. Sementara itu, Gotye memborong tiga kemenangan sekaligus.


Tak Pernah Takut Berbeda NAMA Mumford and Sons sedang jadi sorotan penikmat musik di seluruh dunia. Mereka menyabet Album of the Year untuk rilisan kedia mereka, Babel. Band asal Inggris yang mengusung musik folk rock itu juga meraih gelar Best British Band dalam Brit Awards kemarin. Kuartet yang terdiri atas Marcus Mumford, Winston Marshall, Ben Lovett, dan Ted Dwane itu baru terbentuk sejak 2007. Mereka menghadirkan racikan musik bluegrass yang unik dan segar lewat album pertama mereka, Sigh No More (2010). Bluegrass yang ditawarkan Mumford and Sons keluar dari multiinstrumen yang dipegang masing-masing personelnya. Instrumen etnik seperti akordion, banjo, dan mandolin juga di-mix dalam musik mereka. Itulah salah satu nilai plus kuartet tersebut

yang membuat mereka cukup berbeda, baik soal aransemen maupun performance. Lewat album Sigh No More, mereka pernah diganjar gelar British Album of the Year pada Brit Awards 2011, Top Alternative Album serta Top Alternative Artist dalam Billboard Music Awards 2011. Penjualan album itu meraih platimum, baik UK maupun di AS. Selang dua tahun, mereka kembali dengan materi baru, Babel, pada pertengahan 2012. Album itu menjadi the fastest selling album di UK dan menjadi the secondbiggest selling di AS serta menempati no 1 penjualan album berdasar Nielsen SoundScan. ”Kami membuat (album) ini dan telah memikirkan semua dengan matang. Sekarang menyenangkan melihat album ini berhasil. Itu sangat gila bagi kami,” ujar Marcus Mumford. Tak kenal takut mencoba nuansa baru dan mengutak-atik instrument lewat alat musik, di album ketiga nanti mereka sudah berkoar lebih gila lagi. ’’Kami pengin mencoba hip hop. We really want to rap. Kami sudah diskusi dengan Jay-Z soal ini,” ujar Mumford.


Dobrak Citra Solois Flamboyan SATU single yang catchy bisa meroketkan nama seorang musisi. Apalagi setelah ditengok secara keseluruhan, karyanya memang luar biasa. Gotye, penyanyi pendatang baru asal Australia, membuktikannya lewat single Somebody That I Used to Know. Tidak tanggung-tanggung, pria yang bernama asli Wouter Wolly De Backer tersebut memborong tiga gelar sekaligus. Album Making Mirror miliknya dinobatkan sebagai pemenang kategori Alternative Music Album. Sementara itu, single Somebody that I Used to Know berhasil menyabet dua gelar, Pop Duo/Group Performance dan Record of the Year. Sebelumnya, lagu tersebut juga mengantarkan Gotye meraih gelar di ARIA Music Awards 2011 dan APRA Music Awards 2012. Dengan berbagai penghargaan yang diraihnya, tak berlebihan bila Gotye berhasil membuat aransemen musik yang unik dan pas dengan warna vokalnya. Dia menerobos dominasi solois flamboyan dengan pop klasik dan sentuhan elektro yang unik. Suara khas Gotye kerap dibanding-bandingkan dengan Sting dan Peter Gabriel. ”Terima kasih untuk dukungan penuh dari kalian semua. Aku tidak akan bisa meraih ini semua sendirian,” ujar Gotye di situs pribadinya. Dia juga menyatakan tertantang untuk bertualang lebih jauh di dunia musik. ”Dunia musik di luar sana masih sangat menarik untuk dijelajahi,” bebernya. (*/det)

Bangkit Kembali PERGANTIAN personel kerap membuat band yang terbentuk mengalami fase penghambatan dalam berkarir. Meskipun sempat mengalami vakum beberapa tahun, tapi tak membuat band ini patah semangat. Betul kata pepatah, di balik kesedihan akan ada sebuah senyuman indah, dan band ini kembali menemukan keindahan bermusiknya dengan mengusung visi dan misi baru bersama personel-personel yang mampu mengembangkan potensi band ini di industri musik. BY: GHEA LIDYAZA SAFITRI

PERSONEL: Tyo (vocal), Fian (drum), Indra (bass), Fadly (lead guitar), Dimas (keyboard)





Developy sudah berdiri sejak 14 Februari 2007 lalu, memulai debut perdana sejak digawangi oleh kelima pendirinya. Meski telah terhitung lama dalam bermusik, Developy sempat mengalami beberapa pergantian personel karena ada beberapa kedala pribadi yang nggak memungkinkan mereka untuk tetap bersama dalam menyatukan visi dan misi. Dua tahun megalami vakum membuat band Developy akhirnya kembali bangkit dan terus melangkah

maju dengan mengajak beberapa personelnya yang masih bertahan hingga menemukan sosok pengganti yang tepat. Kelima personel inilah yang akhirnya tetap memperjuangkan Developy untuk tetap bangkit, mengembalikan visi dan misi awal. Di formasi ini komitmen yang sangat tinggi dalam membangun sebuah grup band untuk mencapai sebuah kesuksesan itu lahir kembali. Developy memiliki arti Develop yang berarti pengembang. Mereka selalu megembangkan karya-karya serta kreatifitas yang dituangkan dalam lagu-lagu yang akan diciptakan, dan saat ini total lagu yang terkumpul sudah sebanyak 10 buah lagu yang diantaranya “Aku Ada Untukmu”, “Bertahan” dan “Isyarat”. Genre yang diangkat Developy sendiri adalah pop alternative, lebih enak didengar karena aliran tersebut mendominasi pasaran musik Indonesia tetapi bukan hanya terpaku terhadap genre tersebut, karena nggak hanya sebatas itu, aliran musik ini membuat personel dapat menikmati musik bukan tuntutan pasaran. Sukses ya Developy! **

Asia memiliki proporsi entrepreneur yang tinggi jika dibandingkan dengan wilayah lain. Entrepreneur di Asia mencapai 47 persen, sedangkan AS hanya 29 persen dan Eropa 30 persen. Di antara sekian banyaknya pengusaha di Asia, hanya 39 persen yang berasal dari kaum perempuan.



Pontianak Post Selasa 12 Maret 2013



SETIAP berkunjung ke kabupaten Ketapang, tak sah rasanya jika tak membawa amplang sebagai oleh-oleh. Dibalik kepopuleran amplang, ada kiprah dua perempuan yakni Fauziah Nawawi (52 th) dan Herlina (51 th) yang menjadikan amplang sebagai mata pencaharian mereka. Sama-sama merintis usaha ini sejak awal, dari jatuh bangunnya hingga seberhasil sekarang. Berbagai terobosan unik mereka telorkan, baik dari bentuk, rasa maupun cara pemasaran amplang. Tak hanya untuk masyarakat lokal dan wisatawan saja, tapi amplang mereka juga diorder dalam jumlah besar, untuk pesanan hingga ke luar pulau. Oleh : Ashri Isnaini

Saya mulai bisnis amplang ini sejak tahun 2002. Saya sengaja melakukan pensiun dini dari pegawai, karena ingin dapatkan mendapatkan penghasilan yang jauh lebih baik. Saya berpikir untuk membuka usaha. Setelah saya pikir-pikir dan lihat peluang yang ada, makanya saya beranikan diri untuk memulai menjalankan usaha amplang ini

Apa Anda punya latar belakang bisnis? Apakah ini bisnis pertama kali?

Semula saya sempat jual pakaian dan merangkai bunga untuk dijual. Hanya karena satu kelemahan saya tak bisa tegas saat berdagang, misalnya kalau ada orang ngutang atau kredit, saya tak bisa tegas untuk menagih. Alhasil barang dagangan saya jarang dibayar full konsumen. Akhirnya, Desember 2004 saya berpikir untuk memutar modal dan terbersitlah ide bisnis amplang ini.

Karena waktu itu belum banyak yang buat, semula saya berniat menjadikan amplang ini menjadi salah satu oleh-oleh khas Ketapang yang bisa disajikan atau dikemas dengan unik. Saya tahu prospek usaha ini bakal maju, apalagi Ketapang merupakan salah satu daerah pesisir pantai yang kaya akan potensi alam seperti ikan. Dan kekayaan alam yang ada itu memang menunjang untuk mengembangkan usaha yang saya rintis sejak nol hingga dikenal cukup banyak oleh masyarakat luas.

Kenapa tertarik usaha amplang? Apa sejak awal Anda sudah optimis usaha ini akan sukses?

Apapun usahanya saya yakin tetap ada resiko. Namun setelah saya pelajari soal bisnis, usaha amplang itu minim resiko. Misal, jika diolah dan dikemas dengan baik dalam jangka waktu hingga 1 bulanan, amplang itu masih bagus dan tidak rusak. Saya optimis usaha ini maju. Selain belajar dari usaha sebelumnya, usaha amplang ini memang cocok di Ketapang yang merupakan daerah pantai dan kaya akan hasil ikan. Tinggal bagaimana cara saya mengolah dan memasarkan hingga produk yang saya buat diterima baik oleh konsumen saja.

Untuk modal awal, saya memakai modal pribadi. Kebetulan ada tabungan. Usaha ini memang saya mulai dari nol, karena usai dari pensiun dini, saya ingin buat kesibukan baru yang lebih bermanfaat. Makanya saya beranikan diri untuk belajar berbisnis walaupun awalnya kecil-kecilan. Namun dengan usaha dan kerja keras akhirnya usaha saya ini membuahkan hasil yang cukup memuaskan

Dari mana mendapatkan modal usaha? Apakah ini murni usaha yang dirintis sejak awal, ataukah usaha keluarga?

Untuk modal awal saya menggunakan modal pribadi. Waktu itu dengan modal sekitar Rp 2 - 5 jutaan, sudah bisa buka usaha amplang di rumah. Awalnya saya asli bandung dan hijrah ikut suami di Ketapang. Jadi bisa dibilang, saya ini orang pendatang. Ini usaha yang benar-benar saya rintis sendiri sejak awal, tentunya setelah sharing atau meminta pendapat dengan beberapa teman yang sudah duluan mulai usaha amplang

Karena saya memulai usaha ini untuk mendapatkan sesuatu yang lebih baik, makanya saya berhati-hati dan selalu menyiasati agar tidak salah dalam melangkah. Selain konsisten, saya dengan teliti dan disiplin menjalankan usaha ini agar strategi yang saya ambil berpeluang maju untuk pengembangan usaha saya kedepan.

Bagaimana cerita perjuangan Anda mendirikan usaha ini? Apa suka dan dukanya?

Yang membedakan amplang saya mungkin dari kemasan. Karena saya suka jalan-jalan ke luar daerah. Untuk membuat terobosan, saya belajar dan melihat perkembangan usaha serupa di daerah lain. Kira-kira ada yang cocok dan bisa diimplementasikan sesuai dengan usaha yang saya geluti, maka saya terapkan hal-hal unik yang saya temui diluar. Misalnya soal perbaikan kemasan hingga aneka rasa amplang yang saya buat. Intinya selain belajar dari daerah lain, saya juga selalu berupa bereksperimen untuk membuat sesuatu yang lebih baik lagi bagi usaha yang saya tekuni sejak tahun 2002 lalu ini. Proses pengerjaan atau pengolahan amplang dimulai dari jam 7 pagi hingga sore sekitar jam 4an. Saya juga memiliki bumbu atau adonan khusus untuk membuat amplang khas â&#x20AC;&#x2DC;obicâ&#x20AC;&#x2122;. Untuk pemasaran, selain titip di sejumlah swalayan terdekat dan jualan di rumah, saya juga punya relasi yang siap jualkan amplang saya di Pontianak. Jadi dalam seminggu, saya bisa kirim 2 â&#x20AC;&#x201C; 3 kali sesuai pesanan di Pontianak. Banyak juga wisatawan luar yang datang langsung ke rumah untuk membeli amplang dan dijadikan oleh-oleh. Para pembeli selain warga lokal juga ada dari Pontianak, pulau Jawa dan beberapa kota lainnya. Intinya, siapapun orang luar yang datang ke Ketapang dan ingin membeli amplang juga banyak yang datang ke rumah toko saya. Semula saya pasarkan produk hanya dari mulut ke mulut. Lama-kelamaan langganan tetap saya yang merasa pas atau ketagihan dengan amplang yang saya buat, merekalah yang bantu memasarkan dengan menceritakan ke rekan-rekan atau masyarakat luas lainnya tentang produk amplang yang saya buat. Alhamdulillah amplang saya bisa dikenal cukup luas di masyarakat Ketapang hingga di Pontianak dan beberapa kota lainnya. **

Terobosan unik apa yang membuat amplang Anda berbeda dengan toko lainnya?

Bisa ceritakan tentang pembuatan hingga pemasaran amplang Anda?

Bagaimana Anda mengenalkan amplang ini sebagai oleh-oleh khas Ketapang?





Semula saya juga tidak tahu bagaimana cara menjalankan usaha ini agar tidak gagal. Apalagi kala itu suami saya sudah meninggal dan saya harus menghidupi lima orang anak yang masih kecil-kecil. Mau tidak mau saya terdorong untuk banyak belajar dan bekerja keras. Hampir delapan tahunan saya membangun relasi. Walau sudah lumayan dikenal, saya masih juga sering menitipkan amplang buatan saya di toko-toko. Baru sekitar tiga tahun terakhir ini saya hanya jualan amplang di rumah saja. Jadi setiap yang mau beli mereka order, saya antarkan amplangnya atau si pembeli yang datang ke rumah. Semula saya lihat bentuk amplang yang dijual kebanyakan orang itu khan hampir sama, berbentuk bulat kecil. Nah, saya buat terobosan dengan membuat amplang yang agak panjang. Awalnya banyak konsumen yang heran dan bertanya kenapa bentuk amplang saya agak berbeda, tapi lama kelamaan mereka justru menyukai bentuk dan rasa amplang tersebut. Selain itu, saya juga mencetak amplang dengan aneka cetakan kue seperti cetakan bentuk bunga, stik dan daun. Rasanya pun beragam. Selain rasa original, ada juga amplang dengan campuran sayur seperti bayam, keju dan beberapa rasa lain sesuai resep pribadi saya, khas ala Fauziah Nawawi heheeâ&#x20AC;Ś

Setiap pagi ikan-ikan segar yang disiapkan langsung diadon dengan tepung dan racikan bumbu yang telah disiapkan oleh sejumlah karyawan, untuk diolah menjadi amplang. Waktu awal mula membuat usaha ini, dalam sehari saya paling banyak membuat 5 kilogram amplang saja. Tapi sekarang minimal sehari saya buat 30 - 60 kilogram amplang. Tentunya promosi akan produk amplang yang saya jual dimulai dari keluarga, rekanan, sahabat dan orang-orang sekitar. Walau tak jual ke luar, namun jika ada pembeli dari Jawa yang ingin beli dan minta paketkan, akan kita kirim. Konsumen transfer dulu uangnya, baru kita kirim amplangnya.

Biasanya saya sering diajak instansi pemerintah untuk ikut pameran Usaha Kecil Menengah. Dari situ juga, saya pelan-pelan kenalkan produk yang saya buat. Selain itu karena punya banyak teman, melalui teman-teman terdekat atau relasi bisnislah, usaha ini makin dikenal banyak orang. Saya kebetulan juga sewa toko untuk jualan empek-empek, dan sejumlah makanan lain. Disitu juga saya titip produk amplang saya untuk dijual. Tapi lebih utama lagi di rumah saya selalu siap stok untuk dijual. **


Pontianak Post





Selasa 12 Maret 2013

Pontianak Post

Selasa 12 Maret 2013

Metro sport

BAORI Kuatkan Kedudukan Voter JAKARTA-Polemik yang muncul dari sbelas Pengprov PSSI setelah penetapan voter untuk kongres PSSI 17 Maret usai sudah. Itu setelah Badan Arbitrase Olahraga Republik Indonesia (BAORI) memutuskan bahwa caretaker yang ditunjuk oleh PSSI tidak berlaku. Kepastian itu tertuang dalam surat bernomor 22/ BAORI/III/13 perihal Permohonan Fatwah yang dikeluarkan kemarin (11/3). Badan yang menjadi arbitrase dalam sengketa bidang olahraga itu mengeluarkan

beberapa poin keputusan yang menganulir putusan dari PSSI untuk melakukan pembekuan Pengprov. BAORI menyatakan bahwa berdasarkan statuta PSSI terkait dengan keanggotaan, tidak satupun ketentuan yang mengatur atau menyebutkan tentang pembekuan kepengurusan anggota PSSI. Pasalnya, yang diatur terkait keanggotaan PSSI berdasarkan Bab II Keangotaan adalah skorsing (Pasal 16), pemberhentian (Pasal 17) dan pengunduran diri (Pasal 8) anggota PSSI.

”Maka, surat keputusan tentang pembekuan 11 kepengurusan anggota PSSI sebagaimana telah diterbitkan oleh PSSI adalah tidak memiliki dasar hukum,” tulis surat yang ditandatangani oleh Sekretaris BAORI Sudirman, tersebut. Keputusan tentang sebelas Pengprov itu sebelumnya berkaitan dengan verifikasi voter Kongres. Karena itu, keputusan yang sudah diputuskan tim verifikasi dan disahkan oleh PSSI, diperkuat Baori dalam poin ke lima di surat yang sama. (aam)


Persipon Cari Enam Pemain Luar

PONTIANAK—PT. Persipon Khatulistiwa akan menambah personil pemain dari luar daerah Kalimantan Barat. Dimana jumlah yang ada sekarang dinilai masih kurang pemain. Untuk itu diperlukan penambahan personil pemain lagi. “Untuk saat ini Tim Persipon akan menambah 6 pemain lagi dari luar. Jadi untuk total pemain ada 24 personil,” ungkap





Paryadi, Ketua PT Persipon Khatulistiwa, Minggu (10/3). Wakil Walikota Pontianak tersebut menilai kebutuhan personil untuk lokal sudah memenuhi kuato. Dimana 70 persen pemain diambil dari daerah. Sedangkan untuk 30 persen sisianya di isi dengan pemain dari luar. “Nanti kita isi pemain dari luar,” paparnya. Dia mengatakan pertan-

dingan uji coba tim Persipon kemairn di Malaysia hasilnya meningkat pesat. Tentunya targe yang dicapai masuk lima besar dipenuhi. Alhasil dilakukan demi membawa nama baik sepakbola Kalimantan Barat di kacah nasional hingga tingkat internasional. Terkait tentang persolan PSSI diharapkannya di Kongres PSSI berjalan baik. Direncakan kongres

tersebut di bulan Maret 2013. Tentunya kekisruhan yang selama ini terjadi. Diharapkan ada titik temu jalan penyelesaiannya. “Kita berharap hasil Kongres PSSI dapat menghasilkan rekomendasi yang membawa prestasi untuk persatuan sepakbola seluruh Indonesia. Sehingga perstasi sepakbola kita akan semakin membaik,” papar Paryadi. (irn)


Jangan Pikirkan Perempatfinal MUNICH –Menghadapi Arsenal di leg II, Kamis (14/3) akan dilakoni Bayern Munich diprediksi sebagian kalangan bakal lolos, karena bermain di kandang sendiri. Apalagi berbekal kemenangan 3-1 dicatatkan Bayern dalam laga leg I babak 16 besar Liga Champions di kandang Arsenal. Namun Gelandang Bayern Munich Toni Kroos mewanti-wanti timnya agar tidak langsung memikirkan perempatfinal Liga Champions. ”Kami tidak boleh membicarakan undian untuk perempatfinal terlebih dulu. Kami masih harus menghadapi laga lawan Arsenal. Kami harus memastikan tiket lolos sebelum membicarakan potensi pengundian nanti,” serunya di Soccerway. Menurut pemain internasional Jerman berusia 23 tahun tersebut, Bayern memang dalam posisi bagus untuk lolos ke fase berikutnya menyusul laga leg I lalu. Tetapi Arsenal tak boleh langsung dicoret begitu saja. “Kami harus fokus dan tak boleh meremehkan Arsenal. Mereka adalah sebuah tim top, seperti yang sudah kita lihat di leg pertama. Kami harus kembali menampilkan permainan bagus.” Kiper Manuel Neuer pun memiliki pandangan serupa. Menurutnya, Bayern kini harus menghadapi laga lawan Arsenal dengan cara yang tepat dan tak boleh meremehkan lawan. “Kami terus berusaha sekuat tenaga, juga di partai Liga Champions lawan Arsenal. Kami akan kembali menjalani laga itu dengan sikap yang tepat dan menginginkan kemenangan.” “Saya harap kami kali ini tidak akan kebobolan lagi,” lugas Neuer. (int)

Toni Kroos


Pontianak Post

Selasa 12 Maret 2013





20 Pukki

GELSENKIRCHEN -- Borussia Dortmund telah memastikan tempat di perempat final Liga Champions. Bayern Munchen seharusnya juga lolos seiring kemenangan 3-1 atas Arsenal dalam leg pertama di London. Jerman pun memiliki kans meloloskan tiga wakilnya seandainya Schalke 04 mampu mengatasi perlawanan Galatasaray di Veltins-Arena dini hari nanti WIB. Schalke memang sukses menahan seri 1-1 Galatasaray di Istanbul (20/2). Tapi, untuk lolos, The Royal Blues “ sebutan Schalke “ tetap harus mengejar kemenangan ketimbang mengandalkan skor 0-0. Itu berarti tuan rumah harus mampu mencetak gol. Yang jadi masalah, bomber utama Klaas-Jan Huntelaar bakal absen. Hunter (sapaan akrab Huntelaar) mengalami cedera ligamen lutut kiri dalam kemenangan 2-1 atas Dortmund dalam derby Ruhr di Bundesliga (9/3). Hunter yang musim ini telah mengemas 13 gol di berbagai

17 Farfan

12 Drogba

31 Draxler

9 Bastos

33 Neustaedter

12 Hoeger

22 4 Uchida Hoewedes

32 Matip

35 Kolasinac

34 Hildebrand

Schalke 04 (4-2-3-1)

14 Sneijder

10 Melo 55 Sarioglu

17 Burak Yilmaz

8 Inan 26 Kaya

4 Altintop

13 Nounkeu 25

11 Riera


Galatasaray (4-3-1-2)

Pelatih: Jens Keller Pelatih: Fatih Terim Stadion: Veltins-Arena, Gelsenkirchen-Wasit: Jonas Eriksson (Swedia)

ajang itu bahkan diancam vonis absen sampai dua bulan meski tak sampai naik meja operasi. Tanpa Hunter, der trainer Schalke Jens Keller bakal mengandalkan striker muda (22 tahun) Finlandia, Teemu Pukki. Di sisi lain, striker internasional Rumania Ciprian Marica masih cedera, sedangkan striker internasional Nigeria Chinedu Obasi hanya dimainkan sekali dalam sepuluh laga Schalke di bawah kendali Keller.





“Kehilangan Huntelaar di momen penting adalah pukulan berat bagi tim. Tapi, saya harap itu tidak menganggu stabilitas tim yang sudah mulai berjalan dalam beberapa laga terakhir,” kata Keller seperti dilansir di situs resmi klub. Konsistensi bakal menjadi kunci Schalke. Sudah sebulan terakhir Benedikt Hoewedes dkk tak pernah kalah atau sejak dihajar empat gol tanpa balas oleh Bayern (9/2). “Kami memang berada dalam posisi bagus di leg

kedua. Tapi, hasil seri di Istanbul hanya akan berarti seandainya kami lolos ke perempat final,” tutur Keller yang juga kehilangan pencetak gol leg pertama, Jermaine Jones, karena menjalani skors itu. Dari kubu tamu, Galatasaray tetap memiliki keyakinan tinggi untuk lolos meski harus bermain away. Itu dipicu catatan klub asuhan Fatih Terim tersebut yang mampu meraih dua kemenangan away di fase grup. Sejarah di fase knockout ajang Eropa mencatat, Galatasaray pernah sembilan kali menghadapi situasi bermodal hasil seri dalam leg pertama home. Hasilnya ? Hanya sekali Cim Bom “ julukan Galatasaray “ mampu lolos. “Kami yakin bisa berbuat sesuatu di sana (kandang Schalke). Kami juga tak akan kekurangan dukungan karena banyak warga negara kami (Turki) di Gelsenkirchen,” kata Hamit Altintop, gelandang Galatasaray yang pernah empat musim berkostum Schalke itu, di situs resmi UEFA. (dns)

Pontianak Post