Issuu on Google+

cmyk

Hotline Service Po

Phone: 082150002031 SMS: 085347259955

Pontianak Post

anak P nti

t os

Berlangganan & Pengaduan

&

No

RIS N ET ROY MORGA

Kamis 7 Maret 2013 M / 24 Rabiul Akhir 1434 H

Eceran Pontianak Rp. 3.000

pertama dan terutama di kalimantan barat

AFP PHOTO

Solusi Diplomasi Kebudayaan

Menteri Pertahanan Malaysia Zahid Hamidi menunjukkan gambar loyalis Sulu yang ditemukan tewas di Desa Tanduo, kemarin (6/3)

PONTIANAK—Raja Ketapang, Gusti Kamboja menilai konflik yang berkecamuk di Sabah, Sarawak harusnya bisa diselesaikan secara damai dan menggunakan diplomasi kebudayaan. Sangat naif rasanya, kata dia, jika persoalan seperti itu harus diselesaikan dengan cara mengangkat senjata serta mengorbankan banyak jiwa. Apalagi, yang berkecamuk adalah masyarakat serumpun.

Me nu r u t nya, s eb e na r nya konflik ini adalah masalah antar dua negara. Dan masyarakat Indonesia tidak berhak ikut campur. Namun, kata Gusti Kamboja, yang berKONFLIK perang didalamnya SABAH adalah saudara SULU

Ketua Moro National Liberation (MNLF) Nur Misuari saat berkunjung di kediaman Jamalul Kiram III (kanan).

uKe Halaman 7 kolom 5

Sulu Tantang Perang Gerilya

AFP PHOTO / Jay Directo

Tawau Ikut Mencekam

Shando Shafela

LAPORAN EKSKLUSIF DARI SABAH AFP PHOTO / Jay Directo.

SABAH– Serangan besar-besaran dari darat dan udara yang dilancarkan militer Malaysia di Lahad Datu, Negara Bagian Sabah, tak membuat pasukan Kesultanan Sulu gentar. Mereka justru terus menantang tentara Malaysia dan siap melancarkan perang gerilya. Daerah Lahad Datu yang berhutan dan penuh kebun kelapa sawit

Kesultanan Sulu adalah sebuah pemerintahan Muslim yang dahulu menguasai Laut Sulu di Filipina Selatan. Pada zaman kegemilangannya, negeri ini telah meluaskan perbatasannya hingga negeri Sabah. Dalam Kakawin Nagarakretagama, negeri Sulu disebut Solot, salah satu negeri di kepulauan Tanjungnagara (Kalimantan-Filipina) yaitu salah satu kawasan yang menjadi daerah pengaruh mandala kerajaan Majapahit di Nusantara. -

uKe Halaman 7 kolom 1

DAMPAK KONFLIK : Pengunjuk rasa di Manila membakar potret Presiden Filipina Benigno Aquino dan Perdana Menteri Malaysia Najib Razak dalam sebuah protes di depan Kedutaan Besar Malaysia. (bawah) Suasana Kota Tawau saat malam menjelang terlihat lengang. Jalan masuk dijaga ketat Tentara Malaysia, Rabu (5/3) malam.

-

1380, seorang ulama keturunan Arab, Karim ul-Makdum memperkenalkan Islam di Kepulauan Sulu. 1390, Raja Bagindo yang berasal dari Minangkabau melanjutkan penyebaran Islam di wilayah ini. Hingga akhir hayatnya Raja Bagindo telah mengislamkan masyarakat Sulu sampai ke Pulau Sibutu. 1450, seorang Arab dari Johor yaitu Shari'ful Hashem Syed Abu Bakr tiba di Sulu. Ia kemudian menikah dengan Paramisuli, putri Raja Bagindo. Ke Halaman 7 kolom 1

SUMBER: WIKIPEDIA

Hendy Erwindi

GRAFIS: BUDIKECIK/PONTIANAKPOST

Tentang Kesultanan Sulu

SHANDO SAFELA/PONTIANAK POST

Operasi “Penyelamatan” Tandan Kecewa Sisi Lain Konflik

Jabatan bukanlah untuk gagah-gagahan. Banyak tempat pengabdian lain di luar jabatan yang lebih diridhoi Tuhan Dollar US

Dolar SGD

Ringgit MYR

7.783

9.686

3.121

Selebritas

Fokus Nyanyi lagi SYUTING sinetron striping Berbagi Cinta sudah diselesaikan. Kini, Bunga Citra Lestari (BCL) bisa fokus kembali ke dunia musik. ’’Sinetronku baru selesai syuting. uKe Halaman 7 kolom 5

Bunga Citra Lestari

Sungguh luar biasa dedikasi Azis Sappe, 45, seorang tenaga kerja Indonesia (TKI) yang bekerja di Felda Sahabat, perkebunan sawit milik BUMN Malaysia ini. Walaupun kondisi sekitarnya mencekam, Azis tetap turun ke hutan sawit. Dia mengaku harus memungut tandan-tandan buah sawit segar sebelum membusuk. “Kalau busuk, harga jatuh. Pendapatan untuk anak “anak juga berkurang,” katanya saat ditemui di Felda Sahabat blok 10, kira-kira 20 km dari lokasi konflik Kampung Tanduo yang terletak di blok 17. Nama lengkapnya Azis Sappe. Dia berasal dari daerah Lambogo, Enrekang, Sulawesi Selatan. Kemarin (06/03) dia sendirian. “Biasanya ada istri dan anak yang membantu. uKe Halaman 7 kolom 5

Putusan Hakim Kubu Raya akan Banding

Ridlwan/ Jawa Pos

TETAP KERJA : Azis Sappe, TKI asal Enrekang yang bekerja sebagai buruh loading sawit saat ditemui di kebun Felda Sahabat Blok 10 kemarin.

Bos Djarum Tetap Terkaya Indonesia Kelas Menengah Melonjak JAKARTA - Keluarga Hartono masih belum tergoyahkan posisinya sebagai orang paling kaya di

Indonesia pada 2013. Merujuk daftar orang paling tajir teranyar yang dirilis majalah bisnis terkemuka Forbes, dua orang keluarga Hartono masih bertengger di posisi puncak. R. Budi Hartono uKe Halaman 7 kolom 1

SUNGAI RAYA -Sengketa peserta Calon Pegawai Negeri Sipil (CPNS) 2010 dengan Pemerintah Kabupaten Kubu Raya tampaknya terus berlanjut. Meski majelis Hakim PTUN Pontianak telah memenangkan peserta CPNS, Pemkab tamSaya sebagai paknya akan melakukuasa hukum kan banding. Kepala Bagian HuPemkab tentunya kum Bidang Hukum lebih memilih unPemerintah Kabupattuk banding, akan en Kubu Raya, Mustafa MS, mengatakan tetapi semuanya selain akan melakukeputusan ada kan upaya banding, dipimpinan... dirinya pun merasa kecewa dengan kepuMustafa MS tusan majelis hakim Kabag Hukum tersebut. Pasalnya Pemerintah KKR keputusan tersebut hanya menyudutkan Pemkab Kubu Raya. “Saya sebagai kuasa hukum Pemkab tentunya lebih memilih untuk banding, akan tetapi semuanya keputusan ada dipimpinan. Dan saat ini pun kita belum mendapatkan salinan keputusan itu,” katanya, Rabu (6/3).

GRAFIS: HERI OWEL/JAWA POS

uKe Halaman 7 kolom 5

Latifah Kodijat-Marzoeki, Guru Piano yang Tetap Eksis di Usia Senja 11: 57

15:11

18: 03

19:9

04:36

Resep Sehat, Keluarga, Musik, dan Murid yang Manis Ajang Jakarta New Year Concert awal Januari lalu menjadi bukti bahwa Latifah KodijatMarzoeki belum ’’habis’’. Perempuan 84 tahun itu tampil menawan bersama para pianis yang berusia jauh di bawahnya.   NORA SAMPURNA, Jakarta Latifah lahir di Indragiri, Riau, 12 November 1928. Berarti, usianya kini sudah lebih dari 84 tahun. Namun, kondisi tersebut tidak menghalangi dirinya untuk terus berkarya dan bersemangat menjalani hidup. ’’Ini Wolfgang, pemberian teman

Online: http://www.pontianakpost.com/ cmyk

saya. Usianya 3 tahun. Wolfgang tidak galak kok, ia suka mendengarkan musik,’’ kata Latifah ’’memperkenalkan’’ anjing kesayangannya yang berbulu cokelat kehitaman itu, kemarin (4/3). Dia lantas bercerita tentang awal kecintaannya pada musik klasik. Semua berawal saat Latifah berusia 7–8 tahun. Saat itulah dia mendapat pendidikan piano untuk kali pertama dari sang ibu yang asli Belanda, XXX. Selain itu, Latifah mendapat ilmu dari Hennie Geist, guru piano berkebangsaan Belanda yang tinggal di Sukabumi, serta Tine Drop, salah seorang pendiri sekolah musik Yayasan Pendidikan Musik (YPM) di Jakarta.

RAKA DENNY/JAWAPOS

uKe Halaman 7 kolom 1

AKTIF: Latifah Kodijat Marzoeki masih aktif mengajar piano di Yayasan Musik Jakarta, dan menjadi juri dari berbagai kompetisi piano di Indonesia.

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 4.000 *Ketapang Rp 4.000 *Kapuas Hulu Rp 4.000

Jawa Pos Group Media


EKONOMI BISNIS

2

1POUJBOBL1PTUrKamis 7 Maret 2013

Harga Elpiji Batal Naik

Foto : ADE SINUHAJI/JPNN

CATERING TERBAIK: Menteri Negara BUMN Dahlan Iskan (Dua Kanan) bersama Direktur Utama Aerofood ACS Bendady Pramono (kanan) dan Direktur Layanan Garuda Indonesia Faik Fahmi (dua kiri) saat melihat dari dekat dapur makanan milik Aerofood ACS (salah satu anak perusahaan Garuda Indonesia) di Kawasan Bandara Soekarno Hatta, Tangerang,Banten, Rabu (6/3). Garuda Indonesia terpilih sebagai maskapai dengan makanan terbaik dan menyisihkan 23 perusahaan penerbangan terkemuka lainnya, selain menyediakan makanan untuk maskapai Garuda Indonesia Aerofood ACS juga menyediakan makanan untuk 40 maskapai penerbangan dari berbagai negara.

Harga Pakan Belum Turun PONTIANAK – Melonjaknya harga jagung dan kedelai dunia tahun lalu masih memengaruhi tingginya harga pakan ternak di Kalimantan Barat. Salah seorang pedagang pakan ternak ayam yang cukup besar di Pontianak mengatakan kenaikan tersebut telah berlangsung sejak Agustus tahun lalu, dan belum menunjukan tanda-tanda penurunan. “Kenaikan tersebut cukup mempengaruhi para peternak kita,” ungkapnya, kemarin (6/3). Disebutkan dia, harga pakan ternak ayam sangat tergantung dengan harga kedelai dan jangung. “Bungkil kedelai dan jagung itu bahan baku utama pakan ayam, selain tepung ikan, tepung darah dan bahan mentah lainnya. Jadi kalau harga itu naik, harga kita juga dipastikan akan ikut naik,” kata dia. Disebutkan dia saat ini, harga pakan ayam jenis premium untuk satu kilogramnya mencapai Rp7.100. S e d a n g k a n p a k a n aya m jenis standar Rp6.900 per

kilogram. Sedangkan di kelas yang paling rendah atau kelas C harganya Rp6.700 per kilogram. Masing-masing jenis mengalami kenaikan Rp1.200 tiap kilogramnya dibanding tahun lalu. Meskipun harga kedelai dan jagung dunia sudah mulai menurun, namun di Indonesia agaknya harga pakan ternak ayam sulit untuk ikut turun. pasalnya, lanjut dia, beban produksi saat ini semakin meningkat seiring naiknya tariff dasar listrik sebesar 15 persen untuk pelanggan industri. Ditambah lagi naiknya standar upah minimal regional di berbagai provinsi, terutama Jakarta dan sekitarnya. “Di Pontianak saja UMK naik hampir 30 persen. Jadi harga sulit turun,” ucapnya. Tambahan lagi, penjualan pakan ternak ayam sangat dipengaruhi oleh konsumsi daging ayam di masyarakat. “Ini hubungannya dengan daya beli masyarakat kita. Sekarang harga karet, minyak sawit mentah dan kopra turun drastis. Kalbar sangat tergantung dengan tiga ko-

moditi ini. Kalau ini turun, penjualan daging hampir pasti juga akan menurun, kecuali pada hari raya besar,” jelas dia. Salah seorang peternak,

Putra berharap harga ayam bisa turun. ”Kalau begini terus, kita sangat kewalahan sekali. Peternak lokal atau dengan skala kecil akan kesulitan,” katanya. Soal harga

daging, dikatakan peternak kecil ini, mereka juga harus menyeimbangi harga menyesuaikan kebutuhan pasar dan itu pun cenderung turun. (ars)

Penting Gunakan Label Lokal PONTIANAK—Melihat cukup besarnya potensi sejumlah produk pelaku Usaha Kecil Menengah (UKM) lokal yang bisa bersaing kompetitif dengan produk-produk UKM luar, membuat Wakil Ketua DPRD Kota Pontianak, Arif Joni mengimbau kedepan agar semua pelaku UKM lokal secara keseluruhan bisa menggunakan label lokal saat mengekspor sejumlah produk yang dihasilkan. “Jika disetiap produk lokal yang dihasilkan dicantumkann label lokal, misalnya label bermerek Pontianak, secara tidak langsung bisa bisa memberikan kontribusi untuk mengenalkan sejumlah potensi yang dimiliki disetiap daerah yang ada di Kalbar, termasuk Pontianak ke dunia luar,” paparnya. Pria yang juga menjabat sebagai koordinator Komisi C

Arif Joni

DPRD Kota Pontianak ini menilai cukup banyak potensi kekayaan lokal termasuk seni dan budaya khas yang dimiliki Kota Pontianak, seperti aneka masakan, kue-kue tradisional, minuman khas teru-

tama yang terbuat dari bahan baku aloevera dan sejumlah kekayaan lain. “Semua produk lokal yang dihasilkan itu, jika berpeluang di ekspor keluar, memang sebaiknya setiap produk lokal itu harus memakai label lokal. Dengan begitu masyarakat luar akan semakin mengenal Pontianak,” jelasnya. Karenanya, Arif berencana kedepan akan melakukan koordinasi dengan sejumlah pihak, terutama Pemerintah Kota Pontianak, melalui dinas atau instansi terkait untuk membuat semacam program pembinaan bagi pelaku UKM dalam hal memacu semangat pelaku usaha lokal agar semakin optimal menghasilkan beragam produk lokal dengan kualitas baik dan bangga mencantumkan label lokal disetiap produk yang dihasilkan. (ash)

JAKARTA - Hiruk pikuk rencana kenaikan harga elpiji kemasan tabung 12 kilogram (kg) berakhir antiklimaks setelah Pertamina gagal mengantongi persetujuan pemerintah. Rencana kenaikan mulai Maret ini pun dipastikan batal. Menteri Koordinator Perekonomian Hatta Rajasa mengatakan, pemerintah menilai saat ini bukan waktu yang tepat untuk menaikkan harga elpiji. “Jadi, (kenaikan harga) elpiji belum kita rekomendasikan,” ujarnya di Kantor Kementerian Koordinator Perekonomian di Jakarta, kemarin (6/3). Menurut Hatta, keputusan tersebut diambil setelah berkoordinasi dengan Kementerian Energi dan Sumber Daya Mineral (ESDM), Kementerian Keuangan, dan Kementerian Badan Usaha Milik Negara (BUMN). Hatta mengakui, pemerintah memahami rencana Pertamina menaikkan harga elpiji 12 kg untuk memperkecil kerugian yang harus ditanggung. “Tapi dari sisi pemerintah, timing (waktu) nya belum tepat,” katanya. Menurut Hatta, di tengah tekanan inflasi yang cukup tinggi di awal tahun ini, kenaikan harga elpiji dikhawatirkan

akan makin menekan daya beli. “Kebutuhan (menaikkan harga elpiji) belum mendesak, tapi dampaknya bisa serius ke masyarakat,” ucapnya. Sebagaimana diketahui, sejak awal tahun ini, Pertamina berencana menaikkan harga jual elpiji 12 kg. Sebab, selama ini Pertamina menjualnya di bawah harga keekonomian, padahal tidak mendapatkan subsidi dari pemerintah. Akibatnya, tahun 2012 saja Pertamina merugi Rp5 triliun dari bisnis elpiji 12 kg. Berdasar usulan Pertamina, harga elpiji 12 kg akan dinaikkan dari Rp5.850 per kg menjadi Rp7.966 per kg. Sehingga, harga satu tabung gas elpiji 12 kg akan naik dari Rp70.200 menjadi Rp95.600. S e b e l u m n y a, Me n t e r i BUMN Dahlan Iskan mengatakan, dirinya bisa memahami posisi Pertamina yang kini terjepit. Sebab, kerugian dari bisnis elpiji tersebut sudah menjadi temuan audit Badan Pemeriksa Keuangan (BPK) yang mempertanyakan kenapa Pertamina menjual rugi komoditas yang memang tidak disubsidi oleh negara. “Kalau Pertamina sudah usul menaikkan harga, disetujui atau tidak, Pertamina sudah terbebas dari kesalahan,” ujarnya. (owi)

Wisman ke Kalbar Turun PONTIANAK – Badan Pusat Satatistik Provinsi Kalimantan Barat merilis sepanjang Januari 2013 lalu jumlah wisatawan mancanegara yang bertandang ke Kalimantan Barat mencapai 1.747 orang, atau turun 52,57 persen dibanding jumlah wiaman pada Desember 2012 lalu sebanyak 3.683 orang. “Jumlah wisman yang masuk ke Kalbar melalui Entikong sebanyak 56,38 persen sedangkan wisman yang masuk melalui Pontianak (Supadio) turun 33,97 persen dibanding Desember 2012 lalu,” jelas Kepala Bidang Statistik Distribusi BPS Propinsi Kalimantan Barat, Edi Rahman. Untuk tingkat hunian kamar hotel berbintang, lanjut Edi sepanjang Januari 2013 lalu mencapai rata-rata 48,06 persen, atau turun 8,55 poin dibanding tingkat hunian kamar Desember 2012 sebesar 56,61 persen. Sedangkan tingkat penghunian kamar akomodasi lainnya di Kalbar pada Januari 2013 mencapai rata-rata 40,14 persen atau naik sebesar 7,70

poin jika dibandingkan TPK Desember 2012 sebesar 32,44 persen. “Rata-rata lama menginap tamu pada hotel berbintang di Kalimantan Barat bulan Januari 2013 selama 2,06 hari, naik 0,38 hari bila dibandingkan dengan rata-rata lama menginap tahun pada desember 2012 yakni selama 1,68 hari. Rata-rata lama menginap tamu pada akomodasi lainnya di Kalimantan Barat Januari 2013 selama 1,49 hari naik 0,18 hari bila dibandingkan dengan rata-rata lama menginap tam pada Desember 2012 alau yakni selama 1,31 hari,” paparnya. Soal jumlah penumpang angkutan udara dalam negeri yang datang pada Januari 2013 lalu kata Edi, mencapai 110.519 orang atau turun 2,16 persen bila dibandingkan Dseember 2012 lau. Sedangkan jumlah penumpang angkutan udara dalam negeri yang berangkat pada Januari 2013 mencapai 101.972 orang dan turun 11,96 persen dibanding Desember 2012 lalu. (ash)

Hotel Mercure Gelar Open House Wedding Essentials Narnia Bridal dan Jony Wong Organizer Beri Penawaran Spesial PONTIANAK – Selalu hadir dengan konsep baru, Hotel Mercure Pontianak yang merupakan hotel bintang empat di Pontianak ini kini menghadirkan Konsep open house atau pameran terbuka dengan tema “Wedding Essentials”. Pameran ini dibuka pada Minggu, 10 Maret 2013 mulai pukul 10.00-22.00. setiap calon pengantin atau mereka yang hendak merencanakan pernikahan dapat dengan leluasa datang di Ballroom Hotel Mercure Pontianak untuk berkonsultasi mengenai paket

pernikahan dan penawaran menarik yang di sediakan dan dua diantaranya adalah Narnia Bridal. Di zaman yang serba modern ini, Narnia Bridal hadir di tengah-tengah Anda dengan konsep baru dan up to date. engusung tema “one stop wedding solution” Narnia Bridal menawarkan berbagai produk dan jasa dalam satu solusi. Berbagai macam produk dan jasa ditawarkan dengan harga bersaing diantaranya paket pernikahan hemat, make up, mobil pengantin, sewa gaun/ jas, dekorasi tempat acara, MC, Singer, Dancer, dan masih banyak lagi. Dengan konsep ini, Narnia Bridal memberikan kemudahan bagi Anda untuk

memilih sesuai kebutuhan dan pada hari minggu nanti Anda bisa menyaksikan demo make-up dan dance performance. Salah satu yang terlibat juga, Jony Wong menambahkan bahwa di acara ini tim JW Organizer siap membantuk untuk mengonsultasikan konsep perayaan pernikahan sesuai yang Anda idamkan. Mulai dari persiapan, pengisi acara, tema acara, perenca-

naan biaya, hingga eksekusi yang dijalankan oleh tim profesional dan berpengalaman. Di open house Wedding Essentials ini terbuka kesempatan untuk siapa saja, bahkan Anda dapat menyaksikan penampilan salah satu talent kami di bidang music jazz yang mungkin Anda butuhkan untuk membuat suasana pernikahan menjadi lebih meriah. Konsep open house atau pameran pernikahan mini ini juga menghadirkan booth Gunata Production, Hendra Decoration, HD Photography, dan Hampers Castle. Acara ini dibuka untuk umum, bebas biaya masuk dan gratis makanan serta

minuman ringan bahkan Hotel Mercure juga menyediakan doorprize salah satunya adalah voucher menginap di Mercure Banjarmasin serta beragam hadiah lainnya. Dapatkan harga khusus dan bermacam hadiah tambahan bagi Anda yang langsung melakukan pemesanan, khusus pemesanan paket pernikahan Mercure, Anda berhak mendaptkan kesempatan untuk membawa pulang satu unit sepeda motor Yamaha Mio. Untuk informasi selanjutnya, hubungi 0561577888 atau PR Manager Hotel Mercure, Teddy Manangka di 08115703162. Jangan lupa hadir di Mercure 10 Maret 2013. (biz/*)


cmyk

PONTIANAK BISNIS Pontianak Post

Kamis 7 Maret 2013

3

MUHAMAD ALI/JAWAPOS

PRODUK BARU: PT LG Electronics Indonesia memperkenalkan produk LG Home Appliance Biggest Capacity yakni mesin cuci berkapasitas 20 kg dan kulkas berkapasitas 910 liter. Lemari es ini merupakan kapasitas terbesar yang ada di pasar Indonesia.

LG Bangun Pabrik Mesin Cuci JAKARTA—PT LG Electronic Indonesia (LGEIN) terus mengukuhkan posisinya di Indonesia. Untuk itu, perusahaan elektronik asal negeri gingseng, Korea itu terus mengembangkan fasilitasnya di Indonesia. Setelah memiliki dua pabrik yang memproduksi televisi dan kulkas, tahun ini LGEIN dipastikan membangun pabrik lagi. President Director LGEIN Kim Weon Dae menjelaskan pabrik itu nantinya bakal memproduksi mesin cuci khususnya jenis dua tabung. Saat ini proses pembangunannya telah dimulai dan ditargetkan pada kuartal tiga siap beroperasi. “Lokasinya tak jauh-jauh dari dua pabrik kami sebelumnya, disekitar Jabodetabek,” terangnya saat ditemui pada acara launching

c

cmyk

m

y

k

produk LG Home Appliance Biggest Capacity, mesin cuci berkapasitas 20 kg dan kulkas berkapasitas 910 liter . Mengenai besaran investasi dan kapasitas pabrik Kim masih enggan menyebutkan. Ia hanya menjelaskan, pada tahap awal pabrik tersebut difokuskan untuk memenuhi kebutuhan pasar domestik. Setelah itu bakal dikembangkan untuk memenuhi pasar ekspor. Ia menambahkan potensi penjualan mesin cuci di Indonesia masih sangat prospektif. Saat ini penetrasi penggunaan mesin cuci di Indonesia masih rendah yaitu sekitar 22 persen. Tapi setiap tahunnya tren permintaannya terus tumbuh double digit setiap tahun. “Apalagi saat ini kelas menengah Indonesia tumbuh

besar. Tentu itu pasar yang sangat potensial,” terangnya. Pada kesempatan yang sama Marketing Director LGEIN Eric Setiadi menambahkan pembangunan pabrik baru tersebut merupakan salah satu strateginya mempertahankan pasar. Sebab menurutnya dalam berjualan hal utama yang harus diperhatikan adalah ketersediaan barang . “Dengan supply yang baik itu akan berpengaruh pada distribusi dan kepuasan konsumen,” katanya. Dengan adanya pabrik tersebut, Eric berharap dapat mengatrol market share mesin cuci LG di Indonesia hingga 30 persen. Saat ini, menurut data Growth from Knowledge (GfK) market share mesin cuci LG mencapai 27 persen. (uma)


4

INTERNASIONAL

+

Pontianak Post Kamis 7 Maret 2013

+

Hugo Chavez Tutup Usia

AFP PHOTO / LEO RAMIREZ

BERDUKA: Pendukung Chavez menangis di depan Rumah Sakit Militer di mana ia dirawat.

KARAKAS—Rakyat Venezuela berduka. Presiden mereka, Hugo Chavez dinyatakan telah meninggal dunia. Hal ini seperti diumumkan oleh wakil presiden Nicolas Maduro

pada Selasa (5/3) sore waktu setempat. Pengumuman ini sekaligus menjawab teka-teki yang berkembang seputar kondisi terakhir presiden kelahiran Sabaneta, 28 Juli 1954 itu.

Seperti diketahui Chavez didiagnosa menderita kanker sejak 2011 lalu. Presiden yang tegas menjadi penentang Amerika Serikatinikemudianmenjalaniproses pengobatan termasuk melakukan operasi di Kuba bulan lalu. Selepas operasi ini Chavez jarang tampil di publik. Selasa pagi kondisi pria 58 tahun ini dikabarkan semakin memburuk dan memasuki masa-masa kritis yang diperparah oleh infeksi saluran pernapasan. Hal ini ditegaskan oleh pengumuman Maduro didampingi para petingi politik danmiliter setempat. “Chavez meninggal setelah berjuang melawan penyakit yang sulit selama hampir dua tahun,� ujarnyaseperti dikutip dari BBC.

Chavez sendiri terlahir dengan nama lengkap Hugo Rafael Chavez Fraas. Sempat berkarier di militer dengan pangkat terakhir letnan Kolonel sebelum masuk penjara setelah kudeta gagal yang dilancarkannya pada 1992. Selepas dari penjara ayah empat anak ini membentuk partai Fifth Republic Movement dan memenangkan pemilu pada 1998. sejak awal 1999 mantan prajurit penerjun payung ini memimpin Venzuela hingga akhir hayatnya. Kini sepeninggal Chavez ketua kongres setempat Diosdado Cabello akan menjadi pelaksana tugas keperesidenan sementara seperti diamanatkan undang-undang. ( zul/jpnn)

+

+

C cmyk

M

Y

K


Pontianak Post

SHOW

Kamis 7 Maret 2013

SELEBRITAS

5

ACARA TV

SCTV 07.00 07.30 11.00 12.00 15.00 19.00 20.00 Pontv, pukul 15.00 WIB

Berqah (Bersame Qur’an Hadist) Pontianak Pagi BBM (Berita Berita Musik) Berite Kite Siang Ngamen di TV Berite Kite Malam Sejam Bersame Bang Midji 21.00 Ngagak Antu

07.00 09.00 10.00 12.00 12.30 17.00 18.00 22.30 24.00

Final Contract David Glover bekerja sebagai kurir di perusahaan milik sang paman. David tertarik kepada Jenny, yang juga memiliki perasaan yang sama dengannya. Cinta itu membuat David berurusan dengan pembunuh bayaran. (*)

METRO TV

Ngamen di TV Anda bisa memilih sejumlah lagu yang telah disiapkan oleh Pon TV dan akan didendangkan secara akustikan. Sampaikan juga salam kepada sahabat, keluarga dan orang terkasih Anda. Ngamen di TV..??Ancorreeee...

08.05 11.30 13.05 19.05

8 Eleven Show Metro Siang Wideshot Suara Anda

20.30 21.30 23.05 23.30

SEJAK sang vokalis menghirup udara bebas, Noah seakan kejar setoran. Berbagai konser digelar, kontrak iklan dengan beberapa perusahaan disepakati. Namun, bukan berarti Ariel (vokal), Lukman (gitar), Reza (drum), Uki (gitar) dan David (keyboard) hanya mengejar materi. Di sisi lain, mereka tetap mau berbagi dengan sesama lewat musik. Band yang mempopulerkan lagu Separuh Aku itu akan tampil dalam konser amal bertajuk Born to Speak for Solidarity di Tennis Indoor Senayan, 27 Maret mendatang. Bersama sejumlah musisi lain seperti Reza Artamevia, Bondan Prakoso & Fade 2 Black dan Alika. Tak tanggung-tanggung, Ariel cs akan membawakan 12 lagu. ”Jika buat malam dana, Noah siap tampil maksimal,” kata Ariel yang terlahir dengan nama Nazril Irham. Mantan pacar Luna Maya itu menjanjikan penampilan yang istimewa. Misalnya, berkolaborasi dengan Reza Artamevia yang dikenal masyarakat berkat lagu Pertama yang dirilis pada 1997. Lagu apa yang akan mereka bawakan, akan menjadi kejutan malam itu. ”Noah minimal akan membawakan 12 lagu. Satu diantaranya, saya siap duet dengan Reza,” tuturnya. Itu merupakan kali pertama Noah sepanggung dengan Reza. Tak heran kalau Ariel begitu bersemangat menantikannya. Terlebih, konser amal itu menjadi penyegaran di tengah jadwal manggung Noah di 40 kota. ”Ini satu hal yang belum pernah terjadi sepanjang karir kami, akan ada satu lagu spesial yang akan kami nyanyikan,” terangnya. Konser amal itu adalah kelanjutan dari tiga konser serupa yang digelar pada Februari 2010, Desember 2012 dan Februari 2013. Konser itu digagas Yayasan Charity Club Indonesia pimpinan Bens Leo, yang selama ini dikenal sebagai pengamat musik. Dua puluh persen dari penjualan tiket konser itu akan didonasikan kepada beberapa pekerja seni dan awak media yang tengah terbaring sakit. ”Pekerja seni dan pers selalu sejalan dalam menapaki dunia entertainment. Tetapi kadang ada beberapa diantaranya yang kurang beruntung. Maka pada kesempatan pertama ini, kami mencoba berbuat untuk mereka dan kami berencana untuk menjadikan konser ini menjadi acara reguler setahun tiga kali,” terang Rifaralalla Dewi selaku promotor. Tiket dibanderol seharga Rp300 ribuRp900 ribu. Selain kolaborasi Noah dan Reza Artamevia, kata dia, masih banyak kejutan yang akan dihadirkan. Termasuk penampilan Rebecca Reijman yang belum lama ini melahirkan anak pertamanya. Penyanyi berdarah Belanda itu akan menyanyi diiringi permainan gitar dari Kohar Kahler. ”Akan banyak kejutan yang kami berikan dalam konser amal itu,” tegasnya. (ash)

ANGGER BONDAN/JAWA POS

KONSER AMAL: Vokalis Noah, Ariel, saat manggung belum lama ini. Noah akan tampil di konser amal 27 Maret mendatang.

08.00 10.30 12.00 15.30 17.00 20.30 22.00

07.30 09.00 10.00 11.00 11.30 16.30 19.30 20.30 21.30

Serial Pilihan Kisah Unggulan Layar Kemilau Lintas Petang Zona Juara Raden Kian Santang Berbagi Cinta

Fenomania Pesbukers Best Of The Best Endless Love New Friends Topik Siang Aprilio King Dom Chibi-chibi Burger Princess Hours Chatting Dengan YM

TRANS TV 06.30 07.30 08.30 12.00

One Fine Day Kick Andy Newsmaker Metro Sports

Insert Pagi New Rangking 1 Sinema Indonesia Pagi Bioskop Indonesia

Global TV Pukul 22.30 WIB

NOAH

Tampil Maksimal untuk Malam Amal

ANTV

MNCTV Inbox Halo Selebriti FTV Pagi SL Liputan 6 Siang FTV Siang My Love Sinetron FTV Utama Liputan 6 Malam

14.00 15.45 19.00 20.00

Indosiar Pukul 24.00 WIB Reportase Siang Show Imah Oh Ternyata Bioskop Indonesia Premiere

Fire of Conscience Detektif kepolisian Hongkong Kapten Manfred Fong harus menangani kematian seorang PSK dan bermitra dengan Inspektur Kee. Drama pengkhianatan korps polisi dimulai. (*)

CALVIN JEREMY

Bidik John Mayer IMPIAN Calvin Jeremy berkolaborasi dengan salah satu idolanya, Wouter Hamel, terwujud. Dia tampil sepanggung dengan musisi jazz asal Belanda itu di Java Jazz Festival 2013, Minggu (3/3) dan konser mini yang digelar di Erasmus Huis, Jakarta Selatan, Senin (4/3). ”Wouter dan bandnya sangat luar biasa. Kayak mimpi rasanya, senang

banget. Wouter idola saya banget. Saking ngefansnya, saya sering ngetweet ke dia, dan senang banget waktu dibalas,” ungkapnya. Dia berharap kerjasama itu berlanjut dengan penggarapan sebuah album. Sepertinya bukan sekadar harapan, karena Wouter memberikan sinyal positif. ”Kita ingin berkolaborasi lagi di masa depan,” kata Wouter.

Setelah sukses tampil bareng Wouter, Calvin membidikan sasarannya pada musisi Amerika Serikat, John Mayer. Menurutnya, itu bukan sesuatu yang mustahil. ”Saya percaya nggak ada yang nggak mungkin. Kalau nggak sama John Mayer, ya sama musisi idola saya lainnya. Buat saya, selama ada kesempatan dan terbuka jalannya, kenapa nggak,” tuturnya. (ash)

ANGGER BONDAN/JAWA POS

IDOLA: Calvin Jeremy (kiri) bersama salah satu idolanya Wouter Hamel. Calvin juga berkeinginan mengadakan konser bersama idolanya yang lain, John Mayer.

Minta 15 Kamar Ganti JAKARTA – Aerosmith The Global Warming World Tour akan mampir ke Indonesia. Pada 11 Mei di JIExpo Kemayoran, Jakarta, band rock AS itu akan tampil. Ko n f i r m a s i kedatangan itu diucapkan promotor Dyandra Entertainment, Ismaya Live, dan Sound Rhythm, kemarin (6/3), di Plaza Indonesia. Pihak Aerosmith sudah memasukkan Indonesia ke jadwal tur di website. Band yang digawangi Steven Tyler, Joe Perry, Brad Whitford, Tom Hamilton, dan Joey Kramer itu memang sudah berumur. Mereka terbentuk pada 1970 di Massachusetts. Para personelnya juga sudah berusia lebih dari setengah abad. Tapi, sampai saat ini pesonanya tidak pudar. ”Beberapa hari yang lalu, ketika kami mengumumkan ini melalui Twitter, kurang dari 24 jam informasi sudah menyebar ke lebih dari 10 juta orang dengan hashtag #AerosmithJKT,” kata Yudha Perdana dari Ismaya Live. Pihaknya beserta dua promotor lain yang bergabung merasa sangat bersemangat karena bisa mendatangkan mereka. Di Asia, selain Indonesia, The Global Warming Tour akan singgah di Filipina dan Taiwan. Cheri Ibrahim dari Dyandra Entertainment mengungkapkan bahwa perjalanan tur band yang telah menelurkan 18 album itu dimulai dari Australia pada 28 April. Mereka manggung di Sydney, Brisbane, dan Melbourne. ”Semestinya dari Australia mereka langsung ke Taiwan. Jakarta dapat jadwalnya bulan Juni. Tapi, karena ada Filipina, akhirnya rutenya diubah. Dari Australia, mereka ke Indonesia. Kebetulan banget sih, kami dapat sedikit keberuntungan,” terangnya. Band yang populer dengan lagu I

Aerosmith Pastikan ke Jakarta

NET

TUR DUNIA: Band rock asal Amerika Aerosmith akan mengadakan konser di JIExpo Kemayoran, Jakarta, 11 Mei mendatang.

Don’t Want to Miss A Thing yang menjadi soundtrack film Armageddon itu akan membawa 80 ton kargo peralatan musik dan 70 orang kru. Arena konser nanti outdoor. Tepatnya di parkir barat JIExpo yang menampung sekitar 20 ribu orang. Steven Tyler dkk menginginkan panggung konsernya sama persis dengan panggung-panggung di negara-negara yang sudah mereka singgahi. ”Stage-nya mereka minta sama persis.

C

M

Y

K

Panggung ukuran 18 x 10 meter. Mereka minta dilengkapi lidah perpanjangan membentuk catwalk,” ujar Cheri. Pihak promotor sudah mulai menerima rider dari sang superstar. Mereka meminta dress room khusus yang menurut promotor cukup merepotkan. ”Lumayan merepotkan, tapi seru sih. Kami bisa merasakan kejayaan era rock n roll. Mereka minta disediakan 15 dressing room. Nggak tahu tuh buat apa aja.

Mungkin satu orang satu kali, ya,” jawab Yudha Perdana, lalu tersenyum. Apa pun itu, pihak promotor telah berkomitmen untuk memberikan apa yang diminta artis. Tiket konser dijual menjadi empat kelas, yaitu tribun (Rp700 ribu), reguler festival (Rp850 ribu), premium festival (Rp1,25 juta), dan VIP (Rp3 juta termasuk F&B). Mengenai pembagian kelas tersebut, banyak yang mempertanyakan kenapa harus

dibagi. Pasalnya, itu adalah konser rock, sepertinya kurang seru kalau harus duduk. Pihak promotor menjawab, itu awalnya menjadi perdebatan di kalangan mereka sendiri. Namun, kemudian itu yang menjadi keputusan bersama. ”Karena penggemar Aerosmith ini lintas generasi. Apalagi, setelah Steven Tyler jadi juri American Idol, penggemarnya jadi lebih luas range-nya. Makanya, kami bagi kelasnya,” jawab Yudha. (jan/c10/ayi)


CAKRAWALA

6

Pontianak Post Kamis 7 Maret 2013

AHLI SYAIR TUTUR YANG NYARIS TERLUPAKAN

Di Malaysia Dianggap Sastrawan Negara di Kalbar Jadi Kucing Kurap Usia menggeroti sosok tua yang badannya kini tampak sedikit kurus. Ciri khas rambut panjang sebahu yang semuanya berwarna putih tetap terpelihara. Begitu pula dengan kumis dan alis matanya. Gurat wajahnya seakan menunjukkan perjalanan hidup dan sarat pengalaman. Tak heran, Malaysia pernah mengganjarnya sebagai Sastrawan Negara. Sebuah jabatan yang terbilang tinggi di negeri jiran tersebut. Namun, jabatan itu ditolaknya. Mengapa ?

Pendidikan Efektif untuk Pengenalan Budaya Generasi Muda +

PONTIANAK-Tak dipungkiri, salah satu masalah yang dihadapi saat ini adalah menurunnya jiwa apresiasi dan rasa kecintaan generasi muda terhadap budaya asli. Hal itu seiring dengan arus globalisasi dan modernisasi generasi muda sekarang cenderung terpengaruh doktrin bahwa budaya asing yang diasosiasikan dengan gaya hidup yang modern. Hal itu memerlukan upaya antisipasi agar warisan budaya tidak hilang tergerus oleh perubahan jaman. Demikian disampaikan Ketua KNPI Kalbar, M Adi Cahyono. “Melestarikan budaya daerah sendiri adalah salah satu yang menurut saya adalah kewajiban kita sebagai generasi penerus agar budaya daerah sendiri tidak punah atau terlupakan akibat masuknya budaya-budaya luar yang terkadang tidak sesuai dengan budaya kita masyarakat Indonesia,” jelas dia. Karena itu, dalam pelestarian salah satu nilai budaya di Kalbar, diperlukan peranan lingkungan sekitar, dimulai keluarga hingga lingkungan pendidikan. Sehingga upaya Dinas Pendidikan dan Kebudayaan dalam upaya peningkatan pemahaman budaya melalui sistem pendidikan merupakan salah satu cara yang efektif.

Adi Cahyono

+

“Semoga hal ini merupakan titik awal dalam pengenalan budaya kepada generasi muda, sehingga sasaran peran selain masyarakat umum juga di tujukan untuk generasi muda untuk mengenal dan memahami sejarah dan budaya asli bangsanya dapat tercapai, karena generasi muda memiliki kewajiban besar untuk menjaga dan melestarikan apa yang di miliki oleh bangsanya,” ungkap Adi. Di sisi lain, generasi muda Indonesia yang akan menjadi penerus bangsa diharapkan mampu mengantisipasi dan juga teliti dalam memilih kebudayaan asing yang masuk, karena budaya asing tersebut tidak semuanya sesuai dengan sesuai dengan kebudayaan kita dan bisa berdampak sangat buruk terhadap eksistensi budaya, jika tidak benar-benar menyaringnya. Pada era globalisasi sekarang ini merupakan era dimana banyaknya budaya asing dengan bebas masuk ke Indonesia. Apalagi dengan adanya pasar perdagangan bebas yang telah lama diberlakukan membuat lebih bebas orang asing masuk ke negara ini. Dan bahkan tidak tanggungtanggung mereka menularkan budaya yang mereka bawa dari negaranya sehingga tidak sedikit para generasi muda khususnya remaja jaman sekarang yang terkontaminasi budaya asing tersebut tanpa memfilter apakah budaya atau kebiasaan tersebut baik atau buruk bagi mereka. ”Melestar ikan budaya sendiri diharapkan mampu untuk menjadi pioneer dalam menanggulangi pengaruh budaya luar, yang sekarang ini telah banyak merajalela di negeri ini. Apalagi di era globalisasi sekarang ini dengan banyaknya budaya barat yang ibaratnya telah menghipnotis para kawula muda bangsa Indonesia, maka sudah seharusnya kita sebagai generasi muda harapan bangsa untuk dapat melihat hal baik dan buruk,” tutur dia.(wah)

WAHYU ISMIR, Pontianak

WAHYU ISMIR/PONTIANAK POST

CATATAN : Harun Das Putra saat memegang buku catatan perjalanannya pada pengucapan puisi dunia ke – 9 yang dipersembahkan oleh Dewan Kesenian Kalbar. Ahli Syair Tutur ini kurang diberdayakan, padahal di Malaysia, dia setara dengan pejabat penting.

Semua Suku Memiliki Syair Tutur BANYAK yang tidak mengetahui, Lebih lanjut staf Taman Budaya bahwa seni syair tutur tak hanya dimi- Kalbar tersebut mengatakan, dalam liki oleh suku Melayu. Namun pada mengembangkan syair Bejande, pidasarnya semua suku memilikinya, haknya lebih mengarahkan kepada tapi dengan metode penyampaian anak sekolah setingkat TK dan SD. yang berbeda. Yoseph Oedilo Oendoen, salah seorang pelaku seni dan budayawan Kalbar, syair tutur merupakan kesenian yang dilakukan sejak dulu kala. Dimana saat itu syair tutur dipergunakan untuk bercerita atau meninanabobokan seseorang. “Semua suku di Indonesia ada syair tuturnya. Kalau di Malaysia ada yang namanya Siti Jubaidah dan Selendang Delima. Inilah yang sering dibawakan pada saat perlombaan. Padahal antara syair tersebut dengan syair tutur sangatlah berbeda, kalau syair tutur lebih cepat penyampaiannya, termasuk diantaranya suku Dayak,” jelas dia. Suku asli Kalimantan tersebut, lanjut Yoseph, mempunyai syair tutur yang bisa disebut “Bejande”. Meskipun termasuk ke dalam kategori syair, dia mengakui apabila Bejande jarang diikutkan dalam perlombaan. Namun masih dapat ditemukan pada kegiatan masyarakat Dayak di daerah lain di Kalbar. “Seperti di rumah betang, masih ada orang tua yang menerapkan Bejande untuk menidurkan atau sekadar cerita Yoseph Oedilo Oendoen kepada anak-anaknya. Seperti syair tutur, Bejande juga disampai- Akan tetapi dengan penyampaian kan dengan ciri khas nada tertentu,” secara umum. Untuk pengenalan ungkap dia. budaya tersebut memang belum

dilaksanakan. Pihaknya bukan tidak mau tradisi tersebut dikenal oleh masyarakat, masalahnya dari peserta sendiri belum ada keleluasaan, belum ada keterlibatan dari masyarakat Dayak sendiri. “Jadi saat ini bentuk pembawaannya bagaimana terserah si penyampai, tidak seperti Bejande yang benar-benar menanamkan ciri khas Dayak. Umumnya bercerita saja baik dengan atau tanpa alat peraga,” kata salah satu tokoh teater di Kalbar itu. Hal senada disampaikan Harun Das Putra. Tak hanya Bejande ataupun Syair Tutur di miliki masyarakat Dayak dan Melayu di Kalbar, di Malasyia dan Brunai Darussalam dengan Siti Jubaidah dan Selendang Delima, namun di Kalbar juga ada Syair Gulung yang berasal dari Kabupaten Ketapang. “Pada lirik baitnya banyaklah mengandung nilai-nilai pendidikan dan pesan moral atau estetika dalam kehidupan sosial, berbangsa dan juga beragama yang sangat menyentuh. Karena demikianlah pembelajaran orangorang Melayu dahulu kepada generasi pemuda. Bahasanya sangat halus dan bermakna sehingga mampu menggugah jiwa pendengarnya,” kata dia.(wah)

lebih mendapatkan tempat dan dihargai. Hal tersebut bermula pada saat kunjungan pertamanya ke Kuching, Malaysia pada 1988. Saat itu dia diundang ke Pertemuan Sastrawan Nusantara (PSN) IV, selanjutnya dirinya diundang kembali ke Kuching pada 2000 dalam rangka Dialog Borneo Serawak. “Hal itu berlanjut pada 2001, dimana saat itu hadir pada Pentas Sandiwara Datuk Bandar Kuching – Malaysia. Secara inisiatif saya menyampaikan syair tutur. Setelah itu, saya dijamu habis-habisan oleh pihak kerajaan Malaysia. Hal itu dilakukannya karena mereka benar-benar menghargai seni sastra,” ujar dia. Perlakuan istimewa tersebut tidak hanya berlangsung sampai disitu, Harun bahkan akan diangkat oleh pihak kerajaan Malaysia sebagai Sastrawan Negara. Dimana jabatan tersebut termasuk jabatan tinggi di Malaysia. “Saya diberi perhatian khusus karena ilmu yang saya miliki. Bahkan saya ditawarkan jabatan negara yang dinilai tinggi dan sebanding dengan penghasilan yang diberikan. Akan tetapi saya tolak,” katanya. Harun memiliki alasan sendiri

menolak tawaran yang hendak diberikan pihak kerajaan Malaysia. Dia lebih menghargai Indonesia. ”Meski kenyataannya sampai sekarang saya hanya jadi “Kucing Kurap”,” seloroh dia. Dia tidak pernah menyesali keputusan yang diambilnya tersebut. Sebab mengembangkan kesenian di daerah adalah di atas segalanya. Oleh sebab itu, dia berharap agar instansi terkait dapat lebih memperhatikan syair tutur, agar dikembangkan kepada generasi muda. Karena menurut dia, saat ini ahli syair tutur di Kalbar sangat sedikit. Bahkan umurnya sudah tua sehingga sangat dikhawatirkan akan punah. Tradisi budaya itu saat ini jarang diminati generasi muda Kalbar yang menyebabkannya menjadi kurang berkembang. Parahnya, generasi muda banyak tidak mengetahui akan syair melayu tersebut. “Saya tidak mengharapkan apa-apa, hanya berupaya maksimal memberikan kemampuan. Maklumlah saat ini umur saya sudah 73 tahun. Tidak tahun kapan akan dipanggil sang pencipta. Kalau memang ingin diberdayakan, sampai mati pun saya akan berupaya untuk mengajarkan syair tutur kepada generasi muda,” harap dia.(*)

PONTIANAK-Setelah bergabung dengan Dinas Pendidikan dan Kebudayaan, pihak Taman Budaya Kalbar berharap dapat melakukan pembinaan dan pemberdayaan terhadap pelaku seni dan budaya. Dari situ, diharapkan penyaluran ilmu seni dapat dilakukan, terutama melalui jalur pendidikan. “Kita berharap dengan bergabung ke Dinas Pendidikan dan Kebudayaan, maka pembinaan kepada pecinta seni dapat dilakukan, jadi mereka akan diberdayakan seperti yang kita harapkan selama ini,” jelas Sabar Hati Duha, Kepala Taman Budaya Kalbar. Menurut dia, dengan adanya jalur penyampaian seni dan budaya melalui pendidikan di sekolah tersebut, maka sasaran pengenalan budaya kepada generasi muda dapat terealisasi. Sebab selama ini pihaknya mengakui, generasi muda banyak yang tidak mengetahui adat budaya daerahnya, karena tergerus jaman. “Sekarang era globalisasi. Secara perlahan tradisi budaya dilupakan, terutama generasi muda. Jadi dengan adanya penerapan

dari dinas pendidikan untuk memperkenalkan budaya ke anak sekolah, kami sangat antusias sekali, bahkan secara tidak langsung akan memberdayakan pelaku seni dan budaya yang selama ini sepertinya terlupakan,” tuturnya. Namun demikian, Sabar mengatakan, meskipun sudah tidak lagi dibawah dinas pariwisata, namun pihaknya mengharapkan dinas tersebut mau membantu melestarikan budaya di Kalbar. Sebab budaya tak terlepas dari pariwisata, dimana setiap wilayah pasti akan menampilkan kebudayaannya untuk diperlihatkan kepada wisatawan. “Ibaratnya kita bergerak di sektor hulu untuk mengembangkan kebudayaan daerah. Sedangkan dinas pariwisata bergerak di sektor hilir untuk menyampaikan kebudayaan kita ke pihak luar, jadi walau bagaimanapun hubungan yang sinergi harus tetap dilakukan,” ungkapnya. Dalam waktu dekat, kata Sabar, pihaknya dan dinas pendidikan akan melakukan workshop kepada guru kesenian. Dari workshop diharapkan dapat menyalurkan pengenalan M

Y

K

+

Miris Kondisi Pelaku Budaya PONTIANAK--Perlakuan istimewa yang diberikan negeri tetangga terhadap pelaku seni dan budaya asal Kalbar membuat miris semua pihak. Kali ini, anggota DPRD Kota Pontianak, Nanang Setia Budi angkat bicara. Menurut dia, hal tersebut merupakan “Pekerjaan Rumah” pemerintah untuk lebih memperhatikan mereka. “Kalau dilihat memang sangat memperihatinkan. Sebab mereka di negeri tetangga sangat dipandang, bahkan akan diangkat sebagai pejabat. Namun di tempat asalnya, mereka di sia-siakan. Padahal seperti Harun Das Putra itu adalah maestronya syair tutur yang jarang dimiliki di Kalbar,” ungkap Nanang. Menurut dia, pelestarian budaya di Kalbar harus menjadi perhatian semua pihak, terutama dinas terkait dengan suatu program yang membuat kebudayaan tersebut tetap terjaga. Tentunya harus didukung oleh pemerintah dalam hal pendanaan semua kegiatan yang berkaitan dengan kesenian dan budaya. “Seperti yang kita ketahui bersama, Taman Budaya Kalbar sebagai pusat pelaku seni dan budaya berkreasi saat ini di bawah Dinas Pendidikan. Jadi saya berharap dapat melakukan kerjasama dengan pihak terkait, seperti Dewan Kesenian untuk melestarikan budaya di Kalbar,” jelas dia. Nanang Setia Budi Selain itu, kata Nanang, regenerasi harus selalu dilakukan. Sebab dikhawatirkan dengan usia pelaku seni dan budaya yang ahli di bidangnya sudah semakin tua, maka tidak ada lagi yang dapat mengajarkannya kepada generasi muda. “Kalau budaya tradisional sudah hilang, maka yang akan mendominasi generasi muda adalah budaya modern, jadi mereka tidak tahu dengan budayanya sendiri. Apalagi saat ini era globalisasi, dimana budaya luar dengan mudahnya masuk,” katanya. Upaya pelestarian tersebut, lanjut Nanang, selain dapat bekerjasama dengan dewan kesenian serta memberdayakan pelaku seni dan budaya, dapat pula dilakukan kerjasama dengan keraton sebagai pusatnya kebudayaan melayu. Sehingga apa yang dihasilkan akan lebih maksimal. “Keraton sebagai pusatnya kebudayaan Melayu tentunya memiliki narasumber yang autentik, apalagi syair tutur adalah budaya asli melayu. Tentunya dari pihak keraton dapat dilibatkan dalam pelestarian syair tutur ke depan,” harapnya.(wah)

Berdayakan Pelaku Seni dan Budaya Melalui Pendidikan

C cmyk

MESKI tak lagi muda, Harus Das Putra, masih terlihat segar. Raut mukanya penuh dengan semangat. Bahkan sambutan hangat mewarnai ketika Pontianak Post mendatangi kediaman sederhananya di gang Urai Hamid. Penampilannya apa adanya. Sederhana. Namun karyanya tidaklah dapat dikatakan sederhana jika menilik apa yang pernah hendak diberikan oleh Malaysia kepada dirinya. Harun Das Putra, adalah salah satu maestro budaya di Kalbar. Dia adalah seorang ahli syair tutur. Berbanding terbalik dengan Malaysia, di negerinya sendiri keahlian dan kepiawaian Harun Das Putra kurang mendapat tempat. Apalagi oleh dinas terkait untuk melestarikan kebudayaan khas daerah. “Jadi pekerjaan di bidang yang saya kuasai itu sangat jarang. Paling-paling kalau ada perlombaan saja dijadikan juri. Terakhir pada 2008 Balai Bahasa melibatkan saya untuk memberikan materi mengenai syair. Hanya Dewan Kesenian yang pernah memberikan saya penghargaan, sehingga dibuatlah catatan perjalanan saya dalam dunia sastra,” ungkap Harun. Di negeri seberang, Harun

kebudayaan kepada siswa sekolah. Tim yang mengajar nantinya adalah pelaku seni dan budaya. “Keterlibatan mereka secara otomatis akan menambah penghasilan. Tapi di sisi lain, harapan para ahli tersebut untuk meneruskan kepada generasi muda akan tercapai, karena saya yakin itulah tujuan utama mereka, bukan materi. Jangan sampai kita kehilangan narasumbernya, yang betul-betul ahli di bidangnya masing-masing,” jelas Sabar. Sabar juga mengakui, apabila pendanaan menjadi alasan utama pihaknya kurang melibatkan pelaku seni dan budaya. Sebab menurut dia, untuk melaksanakan sebuah kegiatan pasti dibutuhkan pendanaan yang besar. Termasuk diantaranya pembayaran kepada mereka yang terlibat di dalam kegiatan tersebut. “Kami tida berani untuk terlalu banyak membuat suatu kegiatan. Karena dulunya dana sangat minim. Jadi hanya bisa melakukan beberapa kegiatan yang tidak semuanya bisa

memanfaatkan ahli seni dan budaya tersebut. Paling-paling jadi juri. Tapi sekarang kita berharap, dengan bergabung ke dinas pendidikan, maka akan ada perubahan,” harap dia. Hal senada diungkapkan Harun Das Putra. Dia berharap dengan adanya perubahan penanganan taman budaya oleh dinas pendidikan dan kebudayaan, maka dia serta rekan sesama pelaku seni dan budaya dapat diberdayakan. Sebab selama ini, dirinya hanya menghadiri undangan kegiatan perlombaan untuk menjadi juri hingga mengantar pengantin untuk menyampaikan pantun. “Jadi selama ini untuk melakukan pekerjaan yang tetap itu tidak ada. Jadi tergantung berbagai pihak yang mengundang saya baik jadi juri maupun menyampaikan pantun pada saat orang nikah. Kalau tidak ada kerjaan, paling-paling saya nongkrong di warung kopi pasar tengah, hanya untuk mencari hiburan sekadar ngobrol dengan kawan-kawan. Jadi kalau diberdayakan seperti ini, tentunya kami senang sekali,” tuntasnya.(wah)

+


Pontianak Post

aneka

Kamis 7 Maret 2013

7

Sulu Tantang Perang Gerilya Sambungan dari halaman 1

telah menghambat daya serang militer Malaysia. Kondisi itu menguntungkan pasukan Sulu yang sudah berpengalaman perang gerilya. Muhajab Hashim, komandan pasukan Front Pembebasan Nasional Moro (MNLF), mengatakan bahwa saat ini ribuan veteran perang Moro telah menyeberang ke Sabah dengan perahu-perahu kecil. ”Banyak yang lolos dari aparat keamanan Malaysia. Mereka tahu daerah itu karena dilatih di sana pada masa lalu. Kami mengharapkan lebih banyak dari mereka (gerilyawan Moro) untuk bergabung,” tutur Hashim seperti dikutip The Manila Times tadi malam. Menurut sumber yang dekat dengan petinggi MNLF, gerilyawan Moro loyalis Sultan Sulu diperkirakan mencapai 40 ribu orang. Kata Hashim, ribuan milisi Moro itu sudah menyatakan minatnya bergabung dalam pertempuran di Sabah. Meski pemimpin MNLF belum secara resmi memerintah pasukan untuk berlayar ke Malaysia, mereka mendukung penuh upaya Sultan Sulu untuk mengklaim Negara Bagian Sabah sebagai wilayahnya. ”Tapi, sudah banyak yang berlayar sendiri-sendiri,” ungkapnya. S eb elumnya Malaysia mengerahkan tujuh batalyon

tentara (sekitar 7.000 personel) dan jet tempur F-18 serta Hawk untuk menggempur gerilyawan Kesultanan Sulu asal Filipina yang beranggota tak sampai 300 orang. Pesawat tempur Malaysia melakukan serangan besar ke Kampung Tanduo, Lahad Datu. Tak hanya dari udara, bombardir juga diikuti tembakan artileri dari darat. Serangan itu dilakukan untuk melokalisasi para gerilyawan supaya mundur ke tepi pantai timur Sabah tempat mereka mendarat pada 11 Februari lalu. Sejak pertempuran pecah pada Jumat pekan lalu (1/3), sudah 27 nyawa melayang di Sabah. Perinciannya, 14 orang Sulu, 7 aparat Malaysia, 1 pemilik rumah tempat Agbimuddin Kiram (pemimpin pasukan Sulu di Sabah) menginap di Desa Tanduo, dan 1 imam asal Filipina beserta 4 putranya. Menteri Pertahanan Malaysia Datuk Ahmad Zahid Hamidi menjelaskan, polisi forensik dari CSI Royal Police Malaysia ditembaki gerilyawan Sulu saat hendak mendata jumlah korban tewas pasca serangan Selasa lalu (5/3). ”Kejadian berlangsung sekitar pukul 13.45. Polisi kita yang sedang melakukan pendataan diserang,” ujar Ahmad Zahid dalam sidang media (jumpa pers) di Pos Komando Operasi Daulat, Felda Residence Sahabat, yang juga diikuti koran ini kemarin.

Menurut Ahmad Zahid, polisi forensik itu sedang berupaya membongkar makam-makam yang dibuat gerilyawan Sulu setelah diserang habis-habisan dari darat dan udara Selasa lalu. ”Mereka sudah menimbun jenazah. Saat kita hendak memeriksa, mereka menyerang dengan tembakan,” katanya. Tidak ada polisi Malaysia yang terluka dalam insiden itu. Ahmad menunjukkan potret yang memperlihatkan jasad gerilyawan Sulu dengan kondisi mengenaskan. Mereka terlihat masih belepotan tanah. Mungkin mereka ditimbun tergesagesa sebelum pasukan Malaysia datang. ”Saat ini sudah ada 13 jasad yang kita data, tapi masih sangat mungkin untuk bertambah,” ucapnya. Dia mengungkapkan, telah terjadi insiden kontak tembak dengan gerilyawan Sulu kemarin pukul 06.45. ”Tidak ada pihak kita yang terluka. Dari pihak penceroboh (penyusup) berhasil ditembak,” katanya. Ahmad yang didampingi Menteri Dalam Negeri Malaysia Hishammuddin Hussein menunjukkan foto-foto senjata gerilyawan yang berhasil disita di lokasi. Di antaranya, AK-47, M-16, dan senjata rakitan. ”Kami yakini penceroboh masih mempunyai amunisi, kita masih operasi mopping (penyisiran),” ucapnya.

Gerilyawan Sulu yang terdesak, menurut Ahmad, sangat mungkin melarikan diri dengan menyamar sebagai penduduk biasa. ”Karena itu, jalan masuk dan keluar kita perketat,” katanya. Ahmad juga selalu dikawal ke mana-mana. Tampak lima anggota Pasukan Gerakan Khas VAT 69 dengan senjata lengkap selalu mengiringi. Dia menyempatkan diri memberikan taklimat kepada polisi Malaysia yang hendak masuk menyisir jenazah lagi ke Kampung Tanduo. Pemeriksaan keamanan di tempat kejadian perkara (TKP) memang tak pandang bulu. Dari mana pun asal institusinya distop dan diperiksa. Pontianak Post yang masuk ke Felda Sahabat dari Kota Lahad Datu harus melewati enam checkpoint. Di tiap checkpoint, identitas selalu diperiksa. Barang bawaan juga dicek ulang dengan alat deteksi bom. Dari Pos Komando Operasi Daulat di kawasan Felda Residence Blok 16, Felda Sahabat, ke titik terpanas di Kampung Tanduo masih sekitar 20 kilometer lagi. Berkat bantuan seorang polisi Malaysia yang pernah mengikuti pelatihan di Jakarta Centre for Law Enforcement Cooperation (JCLEC) Antiteror di Semarang, Jawa Tengah, koran ini diantar hingga titik terdepan checkpoint sebelum Kampung

Resep Sehat, Keluarga, Musik, dan Murid yang Manis Sambungan dari halaman 1

Hennie kebetulan merupakan pasien sang ayah, dr Marzoeki, yang berasal dari Minang, Sumatera. Pada 1949, Latifah berangkat ke Belanda untuk meneruskan pendidikan musik piano. Dia dibimbing pamannya, Jaap Spaanderman, yang merupakan guru besar piano dan mantan dirigen A.O.V (Orkes Symphonie Arnhem). Lulus ujian degree superieur dari College Musical Belge dengan grande distinction pada 1952, Latifah akhirnya kembali ke tanah air dua tahun berselang. Dia pulang dengan bekal ijazah Konservatorium dari Muziek Lyceum Amsterdam. Istri (almarhum) Benito Kodijat itu benar-benar tidak bisa lepas dari piano. Dia memulai karir sebagai guru privat piano, mengajar di beberapa sekolah musik, mengajar piano-pedagogi, aktif menjadi panitia ujian piano, serta menjadi juri dalam berbagai kompetisi piano di Indonesia. Piano pedagogi khusus diberikan untuk para pengajar piano. ’’Sebab, belajar piano untuk diri sendiri dan untuk mengajar itu berbeda. Selama ini, orang sering menganggapnya sama, padahal tidak,’’ tegasnya. Sebagai guru piano senior yang dimiliki negeri ini, Latifah turut merumuskan kurikulum pendidikan piano. Dia juga aktif menulis buku sebagai sumbangsih terhadap pendidikan musik klasik di tanah air. Antara lain, Piano Kawanku, Program Kesiapan Musik, Tangganada

& Trinada, Penuntun Mengajar Piano, serta Istilah-Istilah Musik. Dalam buku-bukunya dan ketika mengajar murid-murid, Latifah menekankan pada lima dasar belajar musik. Yaitu, not harus tepat dan berkualitas, irama yang merupakan life of music, pembagian kalimat dan artikulasi, dinamika, serta tempo. Berbincang dengan Latifah bagaikan menyimak cerita sejarah Indonesia dan perkembangan pendidikan musik klasik di negeri ini. Selain kepeduliannya terhadap pendidikan musik, dia lancar bercerita tentang sejarah perjuangan kemerdekaan Indonesia. ’’Ayah saya seorang dokter pada masa perjuangan. Ibu saya, walaupun orang Belanda, mendukung kemerdekaan Indonesia,’’ tutur anak ketiga di antara empat bersaudara itu. Selain musik, Latifah hobi membaca. Terutama yang terkait dengan sejarah. Dia masih ingat peristiwa masa kecil sampai sekarang. Menekuni musik, diakui Latifah, membantu menajamkan ingatannya. ’’Saya rasa itu sangat membantu. Musik membuat otak terus aktif,’’ ungkapnya. Karena itu, ketika usianya tidak lagi muda, Latifah masih terus berkarya. Pada 6 Januari lalu, dia tampil dalam ajang Jakarta New Year Concert yang bertema Pianississimo 3 Generations bersama Ananda Sukarlan serta para pemenang Ananda Sukarlan Award (ASA) International Piano Competition 2012. Mereka mewakili tiga generasi

usia, yakni 84 tahun, 44 tahun, dan sembilan hingga belasan tahun. Pada kesempatan tersebut, Yayasan Musik Sastra Indonesia menganugerahkan Lifetime Achievement Award atas dedikasi Latifah dalam pendidikan musik klasik. Latifah dibuat terharu oleh kejutan yang diberikan Ananda Sukarlan yang bekerja sama dengan cucunya. ’’Ananda meminta mereka mengumpulkan foto-foto saya, ditampilkan di slide, lalu cucu saya membacakan perjalanan hidup saya di panggung. Saya sampai mau menangis rasanya,’’ ujarnya dengan mata berkacakaca. Latifah kembali terharu saat mengenang sang suami, Beni, yang wafat lima tahun lalu. ’’Saat mengenalnya, saya tahu dia sangat suka otomotif, meng-oprek-oprek mobil. Dia tahu saya cinta musik. Dua hal yang berbeda, tetapi kami bisa saling mencintai,’’ ucapnya. Sepeninggal sang suami, yang membuat Latifah tetap bersemangat menjalani hidup adalah keluarga dan kecintaannya pada musik. ’’Anak-anak dan cucu-cucu serta murid-murid yang manis. Merekalah sumber energi yang membuat saya tetap sehat,’’ tegas perempuan yang suka mengawali hari dengan menikmati secangkir kopi tubruk itu. Latifah juga rutin berenang setiap minggu. Selain itu, dia menerapkan pola makan sehat, yakni memperbanyak konsumsi sayur dan buah serta menghindari makanan yang digoreng.

Tak heran bila dia masih bisa melakukan berbagai aktivitas. Jalannya juga masih lincah, meski terkadang menggunakan alat bantu. Tidak tampak bahwa sebetulnya kedua kakinya merupakan kaki bionik. ’’Saya sudah empat kali operasi kaki. Mungkin karena terlalu aktif sampai-sampai saya sering jatuh,’’ candanya. Pernah suatu ketika dia terjatuh di rumah. Saat dibawa asistennya ke rumah sakit, Latifah berpesan agar tidak menghubungi anak-anaknya karena tidak ingin mereka panik. Tiga anaknya (satu putra, dua putri) dan enam cucunya tinggal di Jakarta. Meski mempunyai kesibukan sendiri-sendiri, mereka kerap meluangkan waktu untuk berkumpul dan berlibur bersama. Contohnya, ketika merayakan ulang tahun sang oma beberapa tahun lalu. ’’Mereka ajak saya berlibur ke Belitung. Wah, di sana tempatnya sangat bagus. Mereka buatkan kaus dengan tulisan Kodijat. Yes, we are Kodijat’s family,” ungkapnya bangga. Saat ini, Latifah tengah menyelesaikan buku tentang bermain piano secara duet. Buku itu dia susun bersama dua koleganya, Vivi Embut dan Marie Alamri. Hari-harinya kini diisi dengan mengajar piano di rumah serta berkumpul dengan anak-cucu ketika weekend. ’’Banyak yang bertanya kenapa setua ini saya masih mengajar. Saya jawab, ’Why not?’ Saya akan terus mengajar selama saya mampu,’’ tegasnya. (*/c5/ca)

Bos Djarum Tetap Terkaya Indonesia Sambungan dari halaman 1

tercatat punya kekayaan USD 8,5 miliar (sekitar Rp 82,5 triliun) dari sektor perbankan dan tembakau. Bos Djarum dan BCA ini nangkring di urutan pertama Indonesia dan 131 orang terkaya dunia. Posisinya naik dibanding tahun lalu yang berada di ranking 146 dengan harta USD 6,5 miliar (sekitar Rp 63 triliun). Michael Hartono berada di peringkat kedua nasional dan di urutan ke-138 dunia dengan kekayaan USD 8,2 miliar (sekitar Rp 79,54 triliun). Tahun lalu, dia juga di urutan 138 terkaya dunia dengan harta USD 6,3 miliar (sekitar Rp 61,1 triliun). ’’Dari 386 orang terkaya di Asia Pasifik, terdapat 25 orang

kaya yang berasal dari Indonesia,’’ terang Forbes yang dipublikasikan kemarin (5/3). Tahun ini Forbes mencatat ada delapan orang kaya Indonesia baru yang masuk dalam daftar orang terkaya di dunia dibandingkan tahun lalu yang hanya 17 orang. Delapan muka baru itu antara lain Ciputra (USD 1,5 miliar), Sjamsul Nursalim (USD 1,2 miliar), Soegiarto Adikoesoemo (USD 1 miliar), Santosa Handojo USD 1 miliar, Harjo Susanto (USD 1 miliar), dan Alexander Tedja (USD 1 miliar). Sedangkan wajah-wajah lama di antaranya Chairul Tanjung (USD 3,4 miliar), Sukanto Tanoto (USD 2,8 miliar), Hary Tanoesudibjo (USD 1,7 miliar), Murdaya Poo (USD 1,6 miliar),

Tentang Kesultanan Sulu Sambungan dari halaman 1

- 1457, ia memproklamirkan berdirinya Kesultanan Sulu dan memakai gelar “Paduka Maulana Mahasari Sharif Sultan Hashem Abu Bakr”. Gelar “Paduka” adalah gelar setempat yang berarti tuan sedangkan “Mahasari” bermaksud Yang Dipertuan. - 1703, Kesultanan Brunei menganugerahkan Sabah Timur kepada Kesultanan Sulu atas bantuan mereka menumpas pemberontakkan di Brunei. Pada tahun yang sama, Kesultanan Sulu menganugerahkan Pulau Palawan kepada Sultan Qudarat dari

Kesultanan Maguindanao sebagai hadiah perkawinan Sultan Qudarat dengan puteri Sulu dan juga sebagai hadiah persekutuan Maguindanao dengan Sulu. Sultan Qudarat kemudian menyerahkan Palawan kepada Spanyol. -Masa sekarang, Sulu merupakan sebuah provinsi di Filipina. Ibu kotanya ialah Jolo. Provinsi ini terletak di Region Otonomi Muslim Mindanao. Provinsi ini memiliki luas wilayah 1.600 km² dengan memiliki jumlah penduduk 849.670 jiwa (2010) dan 134.868 tempat tinggal. Provinsi ini memiliki angka kepadatan penduduk 531 jiwa/km². *

dan Djoko Susanto (USD 1,5 miliar). Jumlah orang baru Indonesia yang masuk dalam daftar terkaya dunia tersebut sedikit di bawah Tiongkok yang mencatatkan 10 nama baru. Tiongkok menjadi negara dengan daftar nama baru terbanyak. Secara keseluruhan, Forbes mencatat ada 1.426 orang terkaya di dunia pada 2013. Nilai total harta mereka mencapai USD 5,4 triliun. Amerika Serikat (AS) menjadi negara paling banyak yang menyumbang daftar orang terkaya, yakni 442 orang. Kemudian diikuti negara-negara Asia Pasifik 386 orang, Eropa 366 orang, benua Amerika di luar AS 129 orang, serta Timur Tengah dan Afrika 103 orang. Sementara itu Managing Director Boston Consulting Group (BCG) Singapura Vaishali Rastogi mengatakan, saat ini jumlah masyarakat yang termasuk golongan kelas menengah di Indonesia sekitar 74 juta orang. Namun, dalam beberapa tahun ke depan, jumlahnya akan melesat hingga lipat dua. Itu dia paparkan dalam laporan Asia’s Next Big Opportunity: Winning Over Indonesia’s Middle Class and Affluent Consumers di Jakarta kemarin (6/3). Salah satu perusahaan konsultan terbesar di dunia ini menyebut, setiap penduduk dengan penghasilan Rp 2 juta - Rp 7,5 juta per bulan masuk klasifikasi kelas menengah. Menurut Rastogi, selain stabilitas pertumbuhan ekonomi di level tinggi, faktor penting yang akan mendongkrak jumlah kelas

menengah di Indonesia adalah demografi penduduk. ‘’Ini terkait dengan besarnya jumlah penduduk di usia produktif,’’ katanya. Dia merujuk data bahwa 62 persen penduduk Indonesia berada di usia produktif, antara 20 - 65 tahun. Sedangkan 27 persen lainnya berusia di bawah 15 tahun dan dalam beberapa tahun mendatang akan mulai masuk ke level usia produktif. ‘’Ini potensi yang luar biasa,’’ ucapnya. Rastogi menyebut, pertumbuhan kelas menengah yang selama ini didominasi oleh kawasan Jakarta Bogor Tangerang Depok Bekasi (Jabodetabek), akan mulai menyebar ke kotakota lain. Selain kota besar seperti Surabaya, Medan, Bandung, dan Makassar, kelas menengah di kota-kota lain juga diproyeksi akan tumbuh pesat. ‘’Tapi, dibanding wilayah lain, jumlah kelas menengah di Sulawesi tumbuh paling signifikan. Ini karena potensi ekonominya,’’ jelasnya. Menurut Rastogi, saat ini baru ada 12 kota besar di Indonesia yang memiliki lebih dari 1 juta kelas menengah. ‘’Pada 2020, jumlahnya akan melonjak hingga 22 kota,’’ katanya. Rastogi mengatakan, fakta menarik juga muncul dari kelompok kelas menengah di Indonesia. Menurut dia, optimisme kelas menengah Indonesia berada di level yang sangat tinggi. ‘’Juga lebih tinggi dibanding masyarakat di negara emerging market lain anggota BRIC, Brazil, Rusia, India, dan Tiongkok,’’ sebutnya. (oki/owi/dos)

Tanduo, sekitar 5 kilometer sebelum hot zone. ”Sudah tak bisa masuk lagi lebih dalam. Polisi biasa pun tak boleh, hanya anggota operasi komando yang bisa,” kata anggota Criminal Investigation Division Royal Police Malaysia yang tak mau ditulis namanya itu. Tampak truk angkatan darat Malaysia hilir mudik di sekitar lokasi. Polisi udara Malaysia juga sudah menyiagakan lima helikopter untuk mengangkut jasad orang Sulu yang berhasil ditemukan. Hingga tadi malam, pihak otoritas resmi Malaysia masih belum merilis secara pasti jumlah jenazah orang Sulu yang ditemukan di lokasi Kampung Tanduo. Koran ini yang mendatangi Lahad Datu Hospital mendapat keterangan dari petugas bilik mayat (kamar jenazah) bahwa mereka diminta bersiapsiap dengan 50 kantong mayat. ”Kami diminta siaga,” kata pria ber-name tag Ramzan itu. Warga Lahad Datu yang ditemui koran ini mengaku lega ketika gerilyawan Sulu berhasil diserang. ”Kami tak ingin berterusan, ingin segera usai,” ujar Arbudin Zain bin Nasri, pemilik kedai makanan olahan cempedak yang cukup laris di Lahad Datu. Kota ini memang sepi sejak pertengahan Februari lalu. ”Perniagaan makin sepi. Hendak

jalan ke Felda pun takut ada penceroboh,” katanya. Kemarin dilaporkan empat orang ditangkap polisi Sabah di Jalan Lapangan Terbang, Kota Semporna, sekitar 2 jam dari Lahad Datu. Empat orang itu diduga terlibat dalam penyerangan di kampung Sri Jaya Simunul, Semporna, yang mengakibatkan enam polisi Malaysia tewas pada Sabtu lalu (2/3). Semporna sebenarnya kota yang relatif damai dan tenang, kota itu dikelilingi pantai yang airnya bening. Situasi mencekam bukan saja terjadi di Lahat Datu dan Semporna. Namun juga terasa di kota lain yang tidak jauh dari pusat konflik. Salah satunya Tawau. Kota yang jaraknya satu jam perjalanan darat dari Semporna itu, Rabu (6/3) mencekam. Pontianak Post tiba di Tawau dari Kinabalu, sekitar pukul 21.30 waktu Malaysia. Saat keluar bandara, terlihat empat truk mengangkut ATM (Angkatan Tentara Malaysia) masuk ke kota. Jalanan di pusat Kota Tawau pun lengang. Menurut sopir taksi, Dirman, padahari-harisebelumnyaTawau tidak lengan seperti tadi malam. Walau ada yang tutup tetapi masih banyak toko tetap menggelar dagangannya hingga tengah malam. “Biasanya tidak begini. Ini sepi karena ada konflik,” ujarnya. Polisi juga meningkatkan keamanan. Setiap kendaraan dari arah bandara, Semporna dan

Lahat Datu diperiksa. Seorang polisi  menghentikan mobil dan memeriksa penumpang dengan lampu penerang. Lainnya bersiap dengan moncong senjata mengarah pada mobil. Bahkan di seberang jalan, dibuat kubu pertahanan dari karung pasir dilengkapisenjatamesin.“Mungkin polisi khawatir karena pengikut Sultan Sulu itu sekarang berganti baju. Mereka tidak lagi kenakan pakaian militer, tetapi sipil seperti kita ini,” ungkap Dirman. Di tengah kota, kedai makanan yang biasanya buka sampai larut malam menghentikan aktivitas mereka lebih awal. Selain karena alasan ada konflik, pembeli yang datang pun berkurang dari hari-hari biasanya. WiwitpedagangmakanandiJalan Stephen Tan mengatakan, pembeli berkurang dua malam terakhir sehingga dia terpaksa menutupkedaisebelumtengahmalam. “Sebelumnya kami masih jualan sampai tengah malam,” tuturnya. WiwitasalJawaTimuritutidakmenampik sepinya pembeli karena ada keributan di Lahat Datu dan Semporna. “Iya karena itu juga. Ini kue-kue sisa terpaksa dibuang karena tidak laku,” katanya. Walau sebagian kedai makan dan minum tutup, ada juga yang tetap beroperasi seperti makanan cepat saji, namun sepi pengunjung. Tidak ada satu pun warga yang membeli atau makan di tempat itu. (rdl/hen/c10/oki)

Solusi Diplomasi Kebudayaan Sambungan dari halaman 1

serumpun, sehingga perlu campur tangan saudara serumpun untuk menyelesaikannya. Apalagi, kata dia, dalam pertemuan yang berlangsung beberapa waktu lalu di Ketapang disepakati untuk membentuk kerapatan Raja Sultan se-Borneo, termasuk di dalamnya adalah Kesultanan Sabah, Brunei Darusallam dan Sulu yang berkonflik. “Terus terang kami menjadi prihatin. Kondisi seperti ini seharusnya tidak memakan korban jiwa. Seharusnya kita masyarakat Melayu serumpun harus hidup damai berdamp-

ingan dan jangan ada perang,” himbau dia. Ketua DPRD Kabupaten Ketapang itu juga mengungkapkan, ASEAN sebagai jembatan dan wadah komunikasi negara ASIA Tenggara, seharusnya bisa menjadi penengah persoalan tersebut. “Di ASEAN itu, ada bidang kebudayaan yang saya rasa mampu menjadi penengah persoalan tersebut. Kumpulkan seluruh raja di ASEAN ini. Lakukan pertemuan. Cari jalan keluar yang terbaik. Bukan antara pemerintah Malaysia dengan Kesultanan Sulu yang malah akan semakin panas,” katanya. Dia juga menyarankan agar

Pemerintah Malaysia, menemui perwakilan pihak kesultanan di daerah Sabah, Brunei dan Borneo dalam mencarikan solusi persoalan tersebut. Menurutnya, dengan latar belakang dan sejarah latar belakang serumpun yang sama, dia rasa, persoalan ini bisa diselesaikan dengan cara baik-baik. “Untuk permasalahan siapa pemilik sah, tanah Sabah, bisa dibuktikan dengan cara perdata. Siapa yang punya bukti kuat, masing-masing bisa mengajukan ke PBB. Mungkin dunia yang akan memutuskan, bukan Malaysia ataupun Kesultanan Sulu,” kata dia. (bdi)

Kecewa Putusan Hakim Sambungan dari halaman 1

Menurut dia, fakta-fakta yang diungkapkan dipersidangan tampaknya tidak menjadi pertimbangan majelis hakim. Seperti pada pelaksanaan Pemkab dianggap tidak berkoordinasi dengan Gubernur dan melibatkan perguruan tinggi. Padahal pada saat persidangan, pihaknya sudah mengajukan pertanyakaan kepada saksi dari Badan Kepegawaian Nasional (BKN) terkait apakah pernah mengikuti rapat koordinasi. “Jawabnya sudah jelas, yakni pernah mengikuti. Tapi tidak menjadi pertimbangan keputusan majelis hakim,” ucapnya. Sementara itu, Ketua DPRD Kabupaten Kubu Raya, Sujiwo mengatakan kasus sengketa antara peserta tes CPNS 2010 dengan Pemkab Kubu Raya, BKN, dan Kemenpan RB merupakan konflik yang berkepanjangan. Akan tetapi seperti yang diketahui, bahwa keputusan itu belum inkrach. Karena masih ada proses hukum yang mung-

kin akan dilakukan Pemkab Kubu Raya, seperti banding dan kasasi. “Kita berharap kedua belah pihak dapat berfikir jernih dan tidak terprovokasi dengan oknum-oknum yang dapat mengambil keuntungan dari konflik ini,” tuturnya. Akan tetapi, lanjut dia jika Pemkab Kubu Raya, BKN dan Kemenpan RB tidak melakukan upaya hukum selanjutnya. Maka secara langsung keputusan hakim tersebut sudah inkrach. Maka dari itu, amar-amar yang telah diputuskan majelis hakim harus dilakukan Pemkab Kubu Raya. “Wajib hukumnya, peserta tes CPNS 2010 yang berjumlah 236 itu diakomodir,” ungkapnya. Untuk mengakomodir peserta itu, menurut dia Pemkab Kubu Raya dalam hal ini Bupati Kubu Raya harus segera mungkin melakukan koordinasi dengan BKN dan Men PAN RB, karena kecil kemungkinan Pemkab bisa menyelesaikan masalah ini sendiri. Karena memang polimik ini menimbulkan berbagai per-

soalan yang perlu mendapatkan solusi yang tepat dari pemerintah pusat, seperti jika jika hasil keputusan itu dijalankan, maka peserta tes ulang 2012 harus dibatalkan. “Polemik ini yang harus segara diselesaikan bersama, sehingga dapat mengakomodir apa yang menjadi dampak dari keputusan itu. kalaupun pada akhirnya hasil tes ulang CPNS 2012 harus dibatalkan, maka peserta dapat mengajukan gugatan seperti yang dilakukan peserta sebelumnya,” ucapnya. Karena seperti yang disampaikan pihak PTUN Pontianak, tambah dia bahwa kesalahan kebijakan yang dilakukan pejabat negara tidak dapat dibebankan kepada masyarakat. Tentunya pernyataan ini menjadi peluang bagi peserta tes ulang CPNS 2012 untuk menuntut haknya. “Ini kita berandai-andai jika memang pada akhirnya Pemkab tidak mengajukan banding. Kalaupun itu terjadi, maka saya minta semua pihak untuk bersabar menjalani proses hukum,” imbaunya. (adg)

Operasi “Penyelamatan” Tandan Sambungan dari halaman 1

Tapi, sekarang takut lah. Biar saya sendiri saja,” katanya. Azis nampak semangat menancapkan tombak besinya ke tandan sawit yang masih merah kinyis-kinyis itu. Satu persatu, tandan diangkut dengan semacam traktor kecil yang juga disopirinya sendiri. “Kalau tidak begini, pasti busuk. Lagipula pihak Felda juga sudah jamin aman dan terkawal,” katanya dengan logat yang sudah ke SabahSabah an. Kawasan Felda Sahabat Lahad Datu adalah perkebunan sawit yang sangat luas. Sepanjang jalan, tampak buah-buah kelapa sawit yang siap panen. Luas kawasan yang menyum-

bang pendapatan daerah besar bagi Negara bagian Sabah ini mencapai 110 ribu hectare dan dibagi menjadi 48 blok. TKI dari Indonesia yang bekerja di Felda Sahabat ratarata berasal dari suku Bugis, dan Dayak. “Ada juga dari Jawa, tapi tak seberapa banyak,” katanya. Menurut bapak tiga anak ini pendapatannya lumayan. “Lebih kurang 1200 ringgit per bulan,” katanya. Saat ini, kurs 1 ringgit sekitar Rp 3200. Dia menolak saat koran ini meminta izin untuk mendatangi istri dan anak-anaknya. “Jangan, saya tak boleh,” katanya tanpa merinci alasan. Dalam keterangan Konjen RI di Sabah Soepeno Sahid pada koran ini Senin lalu,

memang banyak dari keluarga TKI yang juga ikut bekerja di ladang. “Ada banyak jenis pekerjaan yang menghasilkan tambahan uang,” kata Soepeno. Misalnya, memungut biji sawit yang jatuh. Lalu, mencabuti rumput di sekitar pohon, menabur pupuk dan juga membantu proses loading seperti yang kemarin dilakukan Azis. “Itulah mengapa minat belajar anak-anak TKI masih kurang. Sebab, oleh keluarganya mereka juga membantu bekerja. Lebih menghasilkan,” kata Soepeno. Sekitar 45 menit, traktor Azis sudah penuh. Dengan berpeluh dia pun minta diri. “Salam buat orang Enrekang ya,” katanya lantas tersenyum. (rdl)

Fokus Nyanyi lagi Sambungan dari halaman 1

Jadi, sekarang nyanyi lagi,’’ katanya ketika ditemui di Pluit, Jakarta Timur, Selasa (5/3). Pemeran Ainun dalam Habibie & Ainun tersebut sedang sibuk promo Cinta Sejati, lagu yang menjadi soundtrack film terakhirnya. Mengerjakan dua bidang, menyanyi dan berakting, BCL harus membagi waktu. ’’Karena kerjanya nggak cuma di satu bidang, jadi harus dibagi-bagi seperti ini. Diatur

lah,’’ terangnya. Kalau pekerjaannya sedang lebih banyak sebagai penyanyi, berarti waktu bagi BCL dengan si buah hati, Noah, juga lebih banyak. Sebab, pekerjaan menyanyi tidak menyita banyak waktu seperti syuting. BCL mengungkapkan, sebenarnya sekarang anaknya yang lahir pada 22 September 2010 itu punya urusan sendiri. Noah mulai bersekolah. Terkadang kalau dia mengajak, Noah sudah bisa menolak. ’’Sudah punya urusan sendiri.

Kadang nanya, mama mau ke mana” Tapi, kalau lagi nggak mood ikut, diajak juga nggak mau,’’ urai dia. Di bidang lain, BCL dan Ashraf memiliki bisnis restoran yang baru saja buka. Di tengah kesibukan, keduanya menyediakan waktu untuk mengontrol perkembangan restoran. ’’Saya sih biasanya datang untuk nengok saja. Ashraf yang lebih menguasai. Tapi, dari segi penjualan, sudah oke kok,’’ ungkapnya. (jan/c5/ayi)


cmyk

Pontianak Post

8

KAPANLAGI.COM

SOSOK SOSO K

OLLA RAMLAN

Lagu dari Sahabat

Gagal ke Turki, Pilih

Bumi, pemilik nama lengkap Andinie Aisyah Haryadi itu membawakan beberapa lagu yang ada dalam album #Andien. Di antaranya, Teristimewa, I Am Really Happy With You, u dan Bernyanyi Untukmu. Khusus pada single Teristimewa, a Andien ingin menyampaikan pesan kasih sayang. Baik sayang kepada sahabat, kekasih, maupun orang tua. “Singlee ini juga bakal jadi soundtrack sebuah film layar lebar. Semoga semuanya suka,’’ tutur perempuan kelahiran Jakarta 27 tahun lalu itu. Sayangnya, malam itu Andien tidak tahu apakah sahabatnya menyaksikan penampilannya atau tidak. Yang pasti, orang tua Andien tampak menikmati lagu-lagu yang dilantunkan sang putri. (nuq/c4/ca)

Kamis 7 Maret 2013

SISI LLA AIN

ANDIEN

ADA D yang istimewa pada album baru Andien yang bertajuk #Andien. Di dalamnya terdapat sebuah lagu berjudul Langit dan Bumii karya Tulus. Andien menyanyikan tembang tersebut saat tampil di ajang Java Jazz Festival 2013 di JIExpo Kemayoran beberapa waktu lalu. ’’Lagu ini diciptakan oleh sahabat saya (bernama) Tulus yang orangnya memang Tulus banget,’’ ucapnya. Andien tampak bahaa menyanyikan single iptaan sahabatnya tersebut. Selain Langit dan

Pontianak Post

TAK hanya Ayu Ting Ting saja yang kemarin (6/3) berangkat umrah ke Tanah Suci. Pasangan Olla Ramlan dan Aufar Hutapea juga melakukan umrah bersama. Olla mengatakan, gagal pergi berbulan madu ke Turki, tidak membuatnya kecewa. Olla dan Aufar memilih berangkat umrah sebagai pengganti bulan madu yang tertunda. Wanita kelahiran Banjarmasin, 15 Februari 1980 ini mengakui bulan madunya tertunda karena jadwanya yang padat. Bahkan demi bisa berangkat umrah hari ini, wanita yang dinikahi Aufar 20 Desember 2012 lalu ini sudah mengatur jadwalnya sejak enam bulan lalu.”Kebetulan memang sudah dimanagee dengan baik, sudah diatur enam bulan sebelumnya. Setelah menikah memang kami belum bulan madu. Awalnya kan mau ke Turki,

tapi meman yang belum Jadi kalau g bulan madu tukasnya. Olla men tidak terlalu kan pergi bu Dia kini mem berkonsentr menjalani u Tanah Suci M ”Iyalah. B madu nggak terlalu saya pikirkan ban ya,” kata ibu Sean Michae Alexander it (dew)

Orang Dekat Mantan Presiden PKS Disangka Cuci Uang JAKARTA -- Komisi Pemberantasan Korupsi (KPK) telah mengembangkan kasus dugaan suap terkait kuota impor daging sapi ke arah delik pencucian uang. Salah satu tersangka kasus tersebut, yakni Ahmad Fathanah, ditetapkan sebagai tersangka kasus tindak pidana pencucian uang (TPPU).”Penyidik KPK menemukan bukti-bukti yang

mengarah ke TPPU yang dilakukan oleh tersangka AF,” kata Juru Bicara KPK Johan Budi S.P di kantornya kemarin. Tadi malam penyidik KPK telah menyita empat mobil milik Fathanah. Yakni, Toyota FJ Cruiser, Toyota Alphard, Toyota Prado, dan Mercedez-Benz. Mobil-mobil tersebut lantas dibawa ke Gedung KPK.Terhadap

Fathanah, KPK mengenakan pasal 3 atau pasal 4 atau pasal 5 UU No 8 tahun 2010 tentang Pencegahan dan Pemberantasan Tindak Pidana Pencucian Uang jo pasal 55 ayat 1 ke 1 KUHP. Dalam kasus suap impor daging sapi, KPK menetapkan mantan Presiden PKS Luthfi Hasan Ishaaq sebagai tersangka. Nama Luthfi terseret setelah pada Se-

lasa (29/1) KPK menangkap tangan Ahmad Fathanah, orang dekat Luthfi, yang menerima Rp 1 miliar dari dua direktur PT Indoguna Utama, Juard Effendi dan Arya Abdi Effendi. Fathanah, Juard, dan Arya juga ditetapkan sebagai tersangka. Tuduhan pencucian uang terr sebut akan terus dikembangkan. “Tentu ini masih kita kembang-

Tangkuban Perahu Meletus Lima Kali

kan terus, karena ada dugaan juga dana ini mengalir ke tempat-tempat yang lain. Ini masih dikembangkan,” katanya. Menurut Johan, penyidik telah mengoleksi sejumlah temuan baru yang didapatkan pada saat penggeledahan. Dalam kasus suap impor daging, KPK telah menggeledah kantor importer daging PT Indoguna Utama,

Semburkan mburkan ap Hitam m inggi Meter BAND A UNG G – Aktiivitas vulkanologi Gunungg Tangkuban Perahu di Lembang, Kabupaten Bandung, Jawa Barat, meningkat. Kemarin terjadi lima kali letusan kecil atau freatik yang menimbulkan semburan material setinggi 100 meter. Akibatnya, abu vulkanik memenuhi bibir kawah. Pusat Vulkanologi dan Mitigasi Bencana Geologi (PVMBG) menetapkan status waspada sejak Senin (4/3) sore. Kepala Seksi Kesiapsiagaan Badan Penanggulangan Bencana Daerah (BPBD) Bandung Moch Pakih merekam video berdurasi lima menit saat terjadi letusan kecil keempat. Saat itu asap putih membubung tinggi dari dasar kawah. Sejurus kemudian keluar semburan asap hitam pekat dibarengi suara berr gemuruh. Hal itu membuat

PASCA FREATIK: Seorang petugas BPBD Kabupaten Bandung Barat(KBB) memantau secara langsung kondisi Kawah Ratu Gunung T Tangkuban parahu pasca 5 kali letusan kecil (Freatik), Rabu(5/3). TRI JUNARI/BANDUNG EKSPRES

BIAYA

Haji Murah Didukung DEWA WAN Perwakilan Rakyat (DPR) RI mendukung langkah Kementerian Agama (Kemenag) dalam upaya memangkas biaya haji melalui kerjasama dengan perusahaan terkait. Terutama yang berhubungan dengan biaya transportasi. Wakil Ketua Komisi VIII DPR, Jazuli Juwaeni, mengatakan dari hasil pertemuan antara komisi VIII dengan Menteri Perhubungan EE Mangindaan, dan Dirjen Penyelenggaraann Ibadah Haji dan Umroh Kementerian Agama, Anggito Abimanyu, memungkinkan terjadinya penurunan Biaya Penyelenggaraan Ibadah Haji (BPIH) pada tahun ini. Itu terjadi setelah melihat bahwa peluang menekan cost dari sektor transportasi untuk mengangkut para jamaah bisa ditekan. ”Komponen biaya ibadah haji yang paling besar adalah transportasi udara. Jika bisa diefisienkan maka akan terjadi penurunan yang signifikan pada BPIH tahun 2013,” ujarnya dalam keterangan resmi usai pertemuan dengan Kemenag dan Kemenhub di gedung DPR RI, kemarin. Khusus untuk biaya penerbangan, kata Jazuli, pengurangan biaya bisa dilakukan dengan mendorong agar maskapai penerbangan haji ditender dan dibuka ruang untuk berkompetisi antara maskapai yang memenuhi persyaratan. Kedua, Garuda Indonesia sebagai langganan pemenang tender dapat melakukan sewa pesawat dalam jangka panjang setidaknya minimal 1 tahun agar penggunan lebih optimal sehingga berdampak positif pada pengaturan strategi harga. Ketiga, menurutnya, pemerintah dalam hal ini Kemenhub diminta melakukan pembicaraan dari hati ke hati dengan pihak maskapai terutama Garuda Indonesia sebagai BUMN milik negara. Diminta agar turut membantu mengupayakan penekanan harga dengan tidak mengambil keuntungan terlalu tinggi. ”Demi kepentingan jamaah,” kata dia. Selanjutnya pemerintah juga bisa berbicara dengan pihak-pihak terkait untuk menegosiasi komponen biaya lainnya seperti dengan PT Pertamina agar mendiskon harga jual Avtur khusus untuk penerbangan jamaah haji. (gen)

Pakih dan beberapa anggota BPBD berlari turun meninggalkan kawah ratu menuju pos pemantauan yang berr jarak empat kilometer. ”Kebetulan merekam peningkatan kondisi kawah menggunakan video telepon seluler. Tiba-tiba freatik muncul diawali asap putih dari lubang kawah ratu,” ungkapnya. Peristiwa itu membuat para pedagang di kawasan wisata Gunung Tanggupan Perahu semburat. Mereka mengangkut dagangan menggunakan mobil pribadi dibantu kendaraan operasional BPBD yang siap siaga 24 jam di pos pemantauan. Kini sekitar kakawah ratu menyisakan lapisan abu vulkanik halus berwarna putih. ”Kami mengimbau seluruh masyarakat untuk tetap waspada, namun juga jangan termakan isu. Nanti jika memang semakin meningkat, BPBD memberi tahu masyarakat melalui posko di setiap desa yang sudah dibentuk manakala kemungkinan terr buruk terjadi,” tutur Pakih. Kawah ratu kembali menyemburkan material abu

3 jam, perempuan yang biasa dipanggil Rany tersebut kemarin enggan memberikan keterangan kepada wartawan. Untuk kali kedua, KPK juga memeriksa Ridwan Hakim, putra keempat dari Ketua Majelis Syura PKS Hilmi Aminudin. Setelah diperiksa sepuluh jam, Ridwan juga enggan berbicara ke media. (sof)

vulkanik kemarin pukul 05.59 WIB. Dengan kejadian itu, sejak 21 Februari 2013, di kawah ratu telah terjadi lima letusan freatik dengan ketinggian semburan hingga 100 meter dari permukaan bibir kawah. ”Letusan freatik terjadi selama 490 detik,” tutur pengamat Gunung Tangkuban Perahu Johan Kusuma di Pos Pengamatan Gunung Api Desa Cikole Lembang kemarin. Berdasar pantauan ( Bandung Ekspres (Jawa Pos Group) di kawah ratu, letusan kecil yang terjadi lima hari berturut-turut dalam rentang waktu berdekatan menyisakan gundukan tanah di dasar kawah yang awalnya rata. Debu vulkanik setebal tiga sentimeter melapisi permukaan bibir kawah yang biasa dikunjungi wisatawan. Sejak Selasa (5/3) para pedagang menurunkan barang dagangan karena khawatir terjadi letusan besar dan menimbun bibir kawah. Kios yang biasanya ramai saat kondisi Gunung Tangkuban Perahu normal kini sepi. Tidak ada pengunjung maupun pedagang yang berani naik ke atas kawah.(jnr/jpnn/c2/ca)

Nama Ali Akbar Menguat, Alifudin Menyusul Ketua Badan Kehormatan DPRD Kalbar PONTIANAK—Siapa pucuk pimpinan ketua Badan Kehormatan (BK) DPRD di Provinsi Kalbar masih simpang siur. Namun, desas-desus di lapangan mencuat dua nama. Itu adalah Ali Akbar SH dari fraksi PPP dan Alifudin dari Fraksi PKS. Keduanya dianggap figur kuat untuk memimpin dan mengawasi tindak tanduk para wakil rakyat. Beberapa anggota dewan yang ditemui di DPRD Kalbar memang engan berkomentar banyak. Alasannya, lobi fraksi-fraksi di DPRD Kalbar sudah menyepakati setidaknya lima (5) nama yang akan mengisi ruanngan BK. Mereka adalah Herr man Fauzi (Fraksi Demokrat), Gusti Effendi (Fraksi Golkar), M. Kebing L (fraksi PDI Perjuangan) dan Ali Akbar termasuk Alifudin dari Fraksi PPP dan PKS. ”Sudah ada namanama anggota BK itu sendiri. Nantinya mereka yang berembuk siapa layak menjadi pimpinan,” ujar salah satu anggota dewan yang namanya minta tidak dikorankan. Berdasarkan pengamatannya, ia berharap sosok Ketua BK punya sikap tegas berani dan keras ketika bertindak. Artinya tidak memandang fraksi manapun di DPRD Kalbar ketika ada ditemukan kesalahan di oknum wakil rakyat. ”Figur itu yang kami harapkan menjadi pimpinan BK,” katanya. Disamping itu, soal pengalaman juga layak menjadi pertimbangan.

Kemudian Ketua BK juga mampu menjaga harkat dan martabat anggota parlemen wakil rakyat Kalbar. Yang lebih penting kedekatan ke media sepertinya layak menjadi pertimbangan. Soalnya, ketua BK memang harus dan wajib dituntut bisa berkomunikasi ke media dengan baik. ”Saya pikir figur itu sudah ada. Tinggal bagaimana mengiringnya saja. Kalau Ketua BK sulit berkomunikasikemedia,akansulitmembuka apa-apa tindak tanduk oknum wakil rakyat,” tuturnya lagi. “Dan keterbukaan informasi itu yang dibutuhkan dari sosok pimpinan BK,” timpal dia. Dikonfirmasi terpisah Alifudin salah satu figur Ketua BK dari fraksi PKS menuturkan akan mengamankan amanah Ketua Fraksi PKS supaya dirinya maju menjadi Ketua BK. ”Saya akan amankan amanah fraksi saya,” katanya, Rabu (6/3) di Pontianak. Lantas kalau ada figur lain muncul ? politikus PKS ini tetap bersikukuh dan menginginkan kesepakatan fraksi-fraksi di DPRD sebagai konsensus tetap menjadi acuan. Seperti diketahui sebelumnya, sempat heboh dan mencuat kalau Ketua BK didorong dari PKS. Akan tetapi belakangan muncul nama Ali Akbar dari fraksi PPP didaulat kembali buat memimpin BK DPRD Kalbar. Alasannya, disamping yang bersangkutan berani, tegas juga berr pengalaman termasuk kedekatan ke media sehingga sangat mudah berkomunikasi. Alifudin tidak berani mengklaim lebih jauh. Namun, ia meminta pada hari senin ini yaitu tanggal 11 Maret diadakan rapat kembali mela@pontianakpost.com

cmyk

rumah milik tersangka, serta ruang kantor tersangka di Gedung Kemarin KPK masih me me-DPR.Kemarin meriksa sejumlah saksi terkait kasus tersebut. KPK kemarin memeriksa Maharany Suciono, seorang mahasiswi yang berada satu kamar dengan Ahmad Fathanah di Hotel Le Meridien saat KPK menggelar aksi tangkap tangan. Usai diperiksa sekitar

pemilihan pimpinan BK. Dan yang harus mengundang adalah dari pihak pimpinan dewan. ”Nantinya kita akan berembuk,” ujarnya. Ali Akbar yang masih menjabat Ketua BK tidak berani berkomentar banyak mengenai pimpinan BK DPRD Kalbar ini. ”Nantilah,” ujarnya dikonfirmasi terpisah. Sebelumnya Paripurna DPRD Kalbar mengenai pemilihan 5 orang anggota Badan Kehormatan (BK) DPRD Kalbar berlangsot. Sejumlah interupsi diajukan para wakil rakyat dalam pemilihan “pengawas kinerja” para anggota dewan ini. Paripurna tersebut digelar pada akhir Februari lalu. Bahkan Ketua Dewan sempat menskor rapat tersebut. Dan kemudian akhirnya disepakati lima orang sebagai anggota calon Badan Kehormatan dewan dari berbagai fraksi. Perjalanan paripurna lalu terlihat pemandangan menarik. Hujan interupsi para wakil rakyat dan silang pendapat mewarnai arti kata konsensus alias kesepakatan fraksi-fraksi terdahulu. Soalnya yang akan dimunculkan sebagai Ketua BK adalah dari fraksi PKS dan PPP. Meski tak tertera dalam tatib DPRD Kalbar terutama pasal 53 ayat 2, menyebutkan anggota BK berjumlah lima orang dipilih dan dari anggota DPRD Kalbar dalam rapat paripurna DPRD Kalbar. Ketua DPRD Kalbar, Minsen menjelaskan dalam tata tertib DPRD Kalbar pasal 53 ayat 2 menyebutkan anggota BK berjumlah lima orang dipilih dan dari anggota DPRD Kalbar dalam rapat paripurna DPRD Kalbar. (den)

ISTIMEWA W

KUNJUNGAN : rombongan kerja Paban II Jemen Srenad dipimpin oleh Kolonel Inf A.M. Putranto melaksanakan kunjungan kerja ke Mako Zidam XII/Tpr Pontianak.

Bangun Fasilitas Militer KODAM D M XII/Tpr berencana melaksanakanpembangunanfasilitas dan pemeliharaan bangunan militer. Kepala Zeni Kodam XII/Tpr Kolonel Czi G. Henu. B, mengatakan pada 2013 rencana akan membangun fasilitas militer berupa rumah dinas prajurit, pangkalan maupun sarana latihan militer yang akan dibangun di Rindam XII/Tpr Pasir Panjang, Brigif 19/Kh Singkawang, Yonif 641/Bru Singkawang, Yonif 644/ Ws Putussibau, Yon Armed 16/ Tkp Ngabang, Yon Kav 2/bc Segedung dan Yon Zipur6/Sd Anjongan. “Untuk melaksanakan perencanaan tersebut, rombongan kerja Paban II Jemen Srenad dipimpin oleh Kolonel Inf A.M. Putranto melaksanakan kunjungan kerja ke Mako Zidam XII/ Tpr Pontianak,” ungkap Henu, saat menyambut rombongan beberapa waktu lalu, didampingi Asisten Perencanaan Kodam XII/Tpr beserta seluruh perwira

Zeni Kodam XII/Tpr bertempat di Aula Makozidam XII/Tpr. Henu memaparkan, pemeliharaan bangunan (Harbang) rencananya yang akan mendapatkan perehapan terhadap sembilan satuan di wilayah Kodam XII/Tpr, diantaranya Yonif 641/Bru Singkawang, Yonif 642/ Kps Sintang, Yoni 631/Atg Palangkaraya, Yon Armed 16/Trk Ngabang, Denzipur 6/Sd Anjongan, Paldam XII/Tpr, Bekangdam XII/Tpr, Kumdam XII/Tpr, Kesdam XII/Tpr di Pontianak. “Perehaban ini merupakan program kerja tahun 2013,” tegas Henu. Selesai menerima paparan rombongan melaksanakan pengecekan langsung kondisi fisik di lapangan dengan mengunjungi rumah susun di Asrama Sudirman, pembangunan Yon Kav di Km 29 di Sungai Burung, Segedong, dan peninjauan di Makorindam XII/Tpr, Brigif 19/ Kh serta ke Yonif 641/Bru di Singkawang.(wah)


Metropolis Pontianak Post

KORAN

KAMIS 7 Maret 2013

Lahir, Dibunuh, lalu Dibuang PONTIANAK - Desa Mega Timur Sungai Ambawang dihebohkan dengan penemuan sesosok bayi laki-laki di dasar Parit Malaya Desa Mega Timur Kecamatan Sungai Ambawang, kemarin. Polisi menduga sosok bayi laki-laki yang diperkirakan baru berumur satu minggu itu dibunuh dan dibuang ke parit. Kepala Kepolisian Sektor Sungai Ambawang Suhdi mengatakan, penemuan sosok bayi laki-laki tersebut berawal dari laporan penemuan adanya mayat bayi di dalam parit tak jauh dari pemukiman warga di Desa Mega Timur. “Minggu (3/3) kemarin, salah seorang warga bernama Jefri, yang tak lain adalah abang ipar ibu si bayi

malang itu. Bahwasanya Jefri menemukan sesosok bayi laki-laki di dasar Parit Malaya yang berjarak sekitar 5 sampai 8 meter dari rumah ibu si bayi malang itu,” kata Suhdi, kemarin. Pihaknya saat ini sudah melakukan pemeriksaan secara maraton terkait penemuan mayat bayi malang tersebut. “Kami menduga, bayi itu dibunuh dan dibuang ke parit. Namun hingga saat ini kami masih melakukan pemeriksaan secara maraton terhadap beberapa saksi.

Bayi dalam Parit Lokasi : Parit Malaya Desa Mega Timur, Sungai Ambawang Bayi laki-laki itu diperkirakan berusia satu minggu Sekitar pukul 03.00, Minggu (3/3), ibu bayi itu keluar dari rumah untuk buang air kecil menuju parit di belakang rumahnya Saat ibu bayi itu keluar dari rumah, melihat anak dan suaminya masih tertidur pulas di kamar Usai buang air, ibu tadi kembali ke kamar dan mendapati bayi lakilakinya raib.

• ke halaman 15 kolom 2

Ibu itu terperanjat kaget dan spontan membangunkan suaminya. Ia mengatakan anak lakilakinya telah hilang dari ranjang tidur Orang-orang kemudian melakukan pencarian. Jefri menyeburkan dirinya di dalam parit. Kedua kakinya menginjak benda yang mengumpal di dasar parit.

Kakinya menginjak benda yang tak lain adalah sosok bayi dengan kondisi tak bernyawa lagi. Penemuan mayat bayi itupun kemudian dilaporkan ke Polsek Sungai Ambawang untuk proses lebih lanjut.

GRAFIS : SIGIT PONTIANAKPOST

Datangi Kejati Tanya Progres Korupsi Bansos

OLAHRAGA

Benahi Dua Aset DINAS Pemuda dan Olahraga Kalimantan Barat dalam waktu dekat akan melakukan pembenahan terhadap dua aset olahraga di kawasan gelanggang olahraga yakni GOR Pangsuma Pontianak dan Stadion Sultan Syarif Abdurahman. Pembenahan tersebut dilakukan karena kondisi GOR Pangsuma yang sudah dinilai tak layak dan keberadaan rumput Stadion SSA yang juga sudah tidak rata. “Rencananya dalam triwulan kedua ini kita akan melakukan pembenahan terhadap kedua aset olahraga tersebut,” ungkap Utin Kusumawaty didampingi Kepala Bidang Sarana dan Prasarana Guruh Paryono kepada Pontianak Post beberapa waktu lalu di Kantor Dispora Kalbar. GOR Pangsuma, kata Utin, saat ini pengelolaannya memang masih di pegang oleh Bidang Umum KONI Kalbar. Karena itu, untuk melakukan perbaikan tersebut, pihaknya akan segera berkoordinasi dengan pihak pengelola GOR Pangsuma Pontianak melalui Bidang Umum KONI Kalbar. “Ada beberapa titik yang akan kita perbaiki. Atap GOR yang bany a k bocor dan kondisi WC yang cukup memprihatinka n ,” ungkap dia. Utin juga mengatakan, kedepannya untuk pengelolaan beberapa titik di GOR Pa n g suma, salah satunya adalah WC dan parkir akan diserahkan kepada pihak ketiga. • ke hal.15 kolom 2

Utin Kusumawaty

NASIB OPLET

MUJADI/PONTIANAKPOST

Sudah banyak opelet menjadi besi tua atau alih fungsi dijadikan angkutan barang. Bahkan di Jalan Ya’ M Sabran, Pontianak Timur, opelet sudah lama dibiarkan pemiliknya di ruang terbuka.

Polisi Tunggu Hasil Lab Forensik PONTIANAK - Kepolisian Resor Kota Pontianak masih menunggu laporan resmi hasil Laboratorium Forensik Mabes Polri terkait kebakaran yang menimpa Dinas PU Pembangunan Jalan dan Jembatan Kalimantan Barat yang terjadi pada, Sabtu (2/3). Kepala Satuan Reserse dan Kriminal Kompol Puji Prayitno mengatakan, hasil sementara dari pemeriksaan identifikasi Labfor

Kami masih menunggu hasil laporan resmi dari Laboratorium Forensik Mabes Polri. Hasilnya akan dilaporkan seminggu kemudian sejak dilakukan pemeriksaan Puji Prayitno

Mabes Polri, tidak menemukan terjadinya tanda-tanda hubungan arus pendek yang menyebabkan

BEKELIT

kantor yang dipenuhi dokumen negara itu terbakar. Kendati demikian, pihaknya belum dapat memastikan apakah ada kesengajaan atau kelalaian dari pihak terkait. “Kami masih menunggu hasil laporan resmi dari Laboratorium Forensik Mabes Polri. Karena hasilnya akan dilaporkan seminggu kemudian sejak dilakukan pemeriksaan,” kata Puji. Sementara itu Di Jalan Khatulistiwa Pontianak Utara sedikitnya dua unit rumah ludes terbakar. Kedua rumah itu milik M Sood dan M Said sekira pukul 05.30.

PONTIANAK- Sejumlah mahasiswa yang tergabung dalam Solidaritas Mahasiswa dan Pemuda Pengemban Amanat Rakyat (Solmadapar) kembali mendatangi Kejaksaan Tinggi Kalimantan Barat untuk mempertanyakan kelanjutan penanganan dugaan kasus korupsi bantuan sosial Koni Kalbar, pagi kemarin. Sembilan mahasiswa yang dilengkapi atribut berupa spanduk dan bendera itu melakukan orasi di depan kantor Kejati Kalbar. Mereka menuntut komitmen Kejati Kalbar dalam penanganan kasus tindak pidana korupsi, yang dinilai hingga saat ini belum jelas penyelesaiannya. Seperti halnya tindak pidana kasus korupsi dana bansos Koni Kalbar yang merugikan keuangan negara sebesar Rp22,14 miliar. Menurut Yunus, korlap Solmadapar, bocornya anggaran bansos ini menjadi hasil temuan audit BPK Perwakilan Kalimantan Barat pada tahun 2006-2008 dan telah diserahkan kepada Polda Kalbar untuk selidiki. Namun, lanjutnya, dalam proses penyidikan serta penyelidikan yang m e ma ka n wa ktu kurang lebih tiga tahun itu tidak membuahkan ha s i l ya n g signifikan. Tapi setelah sekian lama, kata Yunus, dalam proses kasus ini

• ke hal.15 kolom 2

• ke halaman 15 kolom 5

Kompetisi Koran Sekolah

Koran Sekolah jadi Ajang Salurkan Ekspresi Sebanyak 19 sekolah yang telah berpartisipasi pada halaman Koran Sekolah Pontianak Post kemarin (6/3) hadir di Redaksi Pontianak Post dalam sosialisasi Kompetisi Koran Sekolah ‘Pontianak Post Award’. PEMIMPIN redaksi Pontianak Post B Salman menjelaskan, juri dari Pontianak Post akan menilai hasil terbitan halaman koran sekolah di Pontianak Post. Penghargaan diberikan pada empat bidang: yakni Kreatifitas Koran Sekolah Terbaik, Tulisan (news dan feature) Terbaik, Foto Terbaik dan koran sekolah Terfavorit (poling guntingan koran). Koran sekolah adalah lembaran halaman Pon-

tianak Post yang dikerjakan para pelajar di Kota Pontianak dan Kubu Raya. Koran sekolah terbit setiap hari kecuali Minggu. Materi yang dikupas adalah seputar aktivitas sekolah masing-masing. Isinya berupa tulisan, foto, karikatur, puisi, cerpen dan lainnya dikerjakan para pelajar. Menurut Salman, tujuan dibuatnya halaman koran sekolah adalah untuk melatih keterampilan menulis para pelajar, baik membuat berita, feature, puisi, ataupun cerpen. Koran sekolah juga dimaksudkan untuk mengasah bakat fotografer, karikatur, kartun dan ilustrasi. ”Ini menjadi ruang publikasi beragam aktivitas pelajar. Sekaligus meningkatkan kesadaran membaca dan melatih mereka bekerja dalam tim,” jelas Salman. • ke halaman 15 kolom 2

ILUSTRASI : KEKES

C

m

y

k

KORAN

BUDI MIANK/PONTIANAKPOST

Halaman koran sekolah yang terbit di Harian Pontianak Post.


10 INFO

Kantor Gapensi Pontianak Tukar Guling

+

KETUA BPC Gabungan Pelaksana Kontruksi Nasional Indonesia (Gapensi) Kota Pontianak, H. Adang Gunawan menuturkan pembangunan Hotel Transera yang berada di Jalan Gajah Mada, Komplek Hijas, Pontianak Selatan telah mengakibatkan terjadinya pergeseran atau penurunan kontruksi bangunan kantor Gapensi Pontianak yang berada di Blok C Nomor 11. Kebetulan hotel dan kantor salah satu asosiasi yang menaungi para pekerja kontruksi letaknya berdampingan. “Hanya kami sudah bicarakan dengan Hotel Transera. Setelah beberapa kali bertemu terjadinya kedua kesepakatan. bangunan Kantor Gapensi di Gajah Mada akan ditukar guling dengan ruko di Jalan Mardeka Barat,” ungkapnya, Rabu (6/3) menggelar jumpa pers di kantor Gapensi Kota Pontianak. Dengan terjadinya kesepakatan tersebut, lanjutnya, pihak Hotel Transera akan memiliki bangunan H. Adang Gunawan dan tanah kantor Gapensi di Jalan Gajah Mada. Sebagai pengantinya akan dibangunkan kantor baru lokasi kantor Gapensi Kota Pontianak di Jalan Mardeka Barat. “Untuk ruko baru kantor Gapensi Kota Pontianak sekarang masih dalam tahap pembangunan, mungkin sekitar 70 persen,” ujarnya. Ia menambahkan bangunan baru kantor Gapensi Kota Pontianak memang jauh lebih strategis. Lokasinya mantap juga tempat parkir dan bangunannya cukup luas dibandingkan kantor lama. Bahkan lebih lebar sekitar 4,5 meter setelah dikontruksi beton dua lantai. “Dan yang lebih kena adalah dekat Masjid juga ada arena olahraganya seperti lapangan tennis,” ungkap Adang. Menurutnya dengan dengan kantor baru kedepannya akan mempermudah pelayanan ke anggota Gapensi yang jumlahnya 285 orang. “Itu intinya. Pada awalnya kami juga berharap di musyawarah kerja cabang (mukercab) direncanakan 9 Maret 2013 berada Hotel Mahkota. Kita sudah berada di kantor baru. Namun itu belum dapat terlaksana,” ucapnya seraya menambahkan terjadi keterlambatan pembangunan. ”Diprediksi April h bisa ditempati,” kata dia. Kegiatan Mukercab Gapensi Pontianak rencananya menghadirkan Putut Marhayudi selaku Ketua LPJKN dari pusat dan Baskoro Effendi (LPJKD Kalbar) sebagai nara sumber dari Kalbar. Mereka akan memberikan sesi pencerahan kepada para anggota. Rencananya akan dibahas dan dibekali perpres 70 tahun 2012 tentang Perubahan Kedua Atas Peraturan Presiden Nomor 54 Tahun 2010 tentang Pengadaan Barang/ Jasa Pemerintah. (den)

metropolitan

Kamis 7 Maret 2013

Warga Kalbar Jangan ke Sabah PONTIANAK — Wakil Ketua DPRD Provinsi Kalbar, Ahmadi meminta warga negara Indonesia khususnya asal Provinsi Kalimantan Barat untuk sementara waktu diminta tidak bepergian ke Malaysia terutama ke daerah konflik di Sabah, Malaysia. ”Tunda dululah kalau yang ingin bepergian. Situasi belum kondusif. Ini juga buat kebaikan bersama,” katanya, Rabu (6/3) di Pontianak. Menurut dia konflik di Sabah, Malaysia memang bukan antara Indonesia dan Malaysia. Namun perlu diingat, konflik di Sabah antara Kerajaan Sulu dan Pemerintah Malaysia dapat berakibat fatal hingga korban jiawa. Terlebih, tidak sedikit TKI yang bekerja di sana, khususnya di sektor perkebunan sawit

Para TKI kita saja, banyak diselamatkan ke tempat aman. Makanya WNI yang berniat bepergian diminta tunda dululah agendanya sampai situasi benar-benar kondusif

Ahmadi

diungsikan. “Para TKI kita saja, banyak diselamatkan ke tempat aman. Makanya WNI yang berniat bepergian diminta tunda dululah agendanya sampai situasi benar-benar kondusif,” pintanya. Dia menambahkan WNI pekerja di perkebunan sawit di Sabah saja, sampai harus

menghentikan aktivitasnya segala. Sebab, konflik tersebut berpotensi mengancam keselamatan jiwa dan mengakibatkan gelombang pengungsi secara besar-besaran. Makanya, WNI haruslah berpikir keras kalau ingin bepergian ke Malaysia. “Kalau urusannya tak terlalu penting, janganlah bepergian,” kata dia. Politikus PPP Kalbar ini menambahkan situasi di Sabah terutama di daerah konflik se-

makin memanas. Adu strategi antara Militer Malaysia dengan Kerajaan Sulu tidak terelakan. Kalau tidak salah serangan udara dan serangan darat sudah berlangsung 3 minggu dan mengakibatkan korban tewas mencapai 27 orang. “Ini juga patut menjadi bahan kita khususnya WNI di Kalbar,” ujarnya. Katanya lagi pemerintah pusat sepertinya harus membuat travel warning untuk

WNI, terutama TKI yang ingin bertolak ke Sabah, Malaysia. Kemudian peringatan tersebut disebarkan ke pemerintah ke provinsi yang berbatasan lansung dengan Malaysia seperti Kalbar dan Kaltim. ”Ya untuk menjaga-jagalah WNI kita,” ungkap dia. Disamping melarang bepergian, Ketua PPP Kalbar ini berharap konflik antara Malaysia dan Kerjaan Sulu tidak terlalu panjang. Sebab, meskipun berlabel berebut daerah Sabah, tetapi tak sedikit nyawa sudah melayang secara sia-sia. ”Saya pikir, konflik ini dapat diselesaikan dengan damai dan amanlah. Jangan lagi tambah nyawa manusia harus mati sia-sia. Kita berharap konflik Sabah secepatnya teratasi,” katanya. (den)

+

Larang Praktik Suap Penerimaan CPNS

cuaca

Gelombang Empat Meter Angin kencang mulai berhembus di beberapa perairan Indonesia, salah satunya Kalbar. Badan Meteorologi Klimatologi dan Geofisika (BMKG) Maritim Pontianak mencatat, angin yang berhembus kencang menimbulkan ombak besar setinggi empat meter. “Tingginya gelombang laut di wilayah kepulauan Natuna dan Sambas mengakibatkan banyaknya daerah tekanan rendah di perairan Indonesia. Sehingga memicu gelombang besar, ini tercatat selama sepekan kedepan,” kata Prakirawan BMKG Maritim Pontianak, Primastuti, kemarin (6/3). Dia mengatakan, di kepulauan perairan kecil seperti Sambas dan Singkawang turut berpotensi gelombang besar. “Secara keseluruhan, perairan Kalbar masih terbilang normal, namun harus terus diwaspadai,” pintanya. Kepala Kantor SAR Pontianak Ida Bagus Gede Budisma mengakui, sejak beberapa hari terakhir cuaca kurang bersahabat untuk pelayaran karena gelombang tinggi dan angin kencang. Berkaitan dengan keberangkatan kapal-kapal, menurutnya itu sepenuhnya menjadi kewenangan serta tanggung jawab Adpel.   “Kita harapkan semua yang ingin berlayar hendaknya bersabar menunggu sampai cuacanya membaik untuk keselamatan kita semua. Jangan sampai SAR kerja. Kalau SAR kerja, berarti sudah musibah,” tuntasnya. (rmn)

Pontianak Post

MUJADI/PONTIANAK POST

BERANGKAT KERJA: Pagi hari, jubelan kendaraan warga yang akan beraktivitas ke dalam Kota Pontianak terus meningkat. Simpang empat Tanjung Raya dan Jembatan Kapuas I, menjadi kawasan membuat was-was kemacetan dan tertinggal jam kerja.

+

PONTIANAK — Wakil Gubernur Kalimantan Barat, Christiandy Sanjaya mengingatkan penerimaan calon pegawai negeri sipil harus dilaksanakan secara transparan dan tidak boleh adanya praktik suap. “Harus dilaksanakan terbuka. Jalankan sesuai aturan,” ujar Christiandy di Hotel Orchardz Perdana, Rabu (6/3). Menurut Christiandy, penerimaan CPNS sesuai aturan ini untuk menghindari terjadinya masalah di kemudian hari. Apalagi saat ini masyarakat bisa mengakses langsung proses penerimaan. Jika ada hal-hal yang diluar ketentuan, bisa langsung mencuat dan diketahui masyarakat luas. Jika terjadi persoalan dan berlanjut hingga ke ranah hukum, banyak kerugian yang diper-

oleh, baik oleh pemerintah maupun masyarakat. Selama ini pemerintah membuka lowongan atau formasi tertentu menunjukkan bahwa mereka membutuhkan tenaga untuk pelayanan kepada masyarakat. “Jika ada kemacetan dalam penerimaan ini, yang rugi juga masyarakat. Kita membuka lowongan artinya membutuhkan formasi untuk melayani masyarakat,” ujar Christiandy. Terkait proses hukum penerimaan CPNS Kubu Raya Tahun 2010, Christiandy mengatakan hukum harus dihargai. Jika persoalan bergulir hingga ke ranah hukum, keputusan yang dijatuhkan harus dilaksanakan.   “Keputusan hukum yang baku. Siapapun harus melaksanakannya,” katanya. Ia berharap penerimaan CPNS kedepannya berjalan baik. “Jika berjalan baik, saat diterima PNS bisa langsung bekerja,” timpalnya. (uni)

+

cmyk

C

m

y

k


Pontianak Post

l

Kamis 7 Maret 2013

HALO PUBLIK Rapel Beras

Buruknya Jalan Adisucipto Kepada instansi terkait, mohon diperhatikan dan ditindaklanjuti keadaan jalan Adi Sucipto. Selepas terminal oplet sampai depan jalan Siaga jalannya sudah benar-benar buruk dan membahayakan pengguna jalan. Lampu penerangan juga saya rasa kurang. Pada waktu malam hari pengguna jalan hanya mengandalkan sorot lampu kendaraan dan lampu penerangan dari kios atau ruko di tepi jalan. Sudah sering terjadi kecelakaan karena kondisi yang demikian. (089654124050)

+

Sebagai PNS Kabupaten Sambas, kami ingin menanyakan kepada instansi terkait tentang rapel beras PNS Kabupaten Sambas. Mengapa kok sampai kini masih belum juga ada? Mohon agar Bupati Sambas turun tangan dalam mengatasi hal tersebut, karena rapel beras itu merupakan hak PNS. Walaupun kecil nilainya, tapi bagi kami sangat besar manfaatnya. (082155223059)

Penutupan Jalan Gang Kepada Yth. Pak Wako, saya mau tanya apa dasar warga menutup jalan gang yang sudah menjadi jalan umum? Karena sekarang ini timbul trend di setiap gang berlomba-lomba membuat pintu & menutupnya kalau malam tiba. Seperti yang terjadi di jalan Suwignyo gang Nur 2 & gang Nur 3. Kalau dibiarkan lama-lama dikhawatirkan bisa menimbulkan konflik warga. (081256717463)

Resah Pemalakan di SPBU Saya sebagai warga Pontianak sangat mendukung sekali apa yang dikatakan Ketua Komisi A DPRD provinsi Kalbar, Retno Pramudya tentang “Premanisme Merajalela di SPBU” yang dimuat di koran Pontianak Post hal. 9 kolom Metropolis tanggal 20 Februari 2013.

Kami sangat mengharapkan pada pihak kepolisian dapat mengatasinya. Kasihan pada sopir-sopir sudah lama antrinya dimintai duit lagi, apakah negara kita ini akan kita biarkan menjadi negara premanisme? Semoga Pemda dan Pemkot dapat bekerja sama dengan pihak Kepolisian untuk menertibkan oknum masyarakat yang suka malak di setiap SPBU di Kota Pontianak ini. Semoga berhasil. (085251842324)

11

Korupsi dan Narkoba, Penghambat Pembangunan Korupsi dan narkoba merupakan dua hal berbeda tapi sama-sama memiliki dampak negatif yang sangat mengkhawatirkan. Sehingga dapat merusak tatanan dalam suatu masyarakat bahkan negara dan bangsa sekalipun. Korupsi dan narkoba juga merupakan dua hal yang selalu menjadi buah bibir di masyarakat dan media massa bahkan menjadi pembicaraan di warung kopi sehingga banyak menyita waktu banyak orang, terutama bagi mereka yang peduli dan kritis. Sudah menjadi hukum alam (sunnatullah) bahwa segala sesuatu yang berbau negatif pasti akan berdampak negatif pula. Begitu pula halnya dengan korupsi dan narkoba, bahkan gara-gara ‘mereka berdua’ (korupsi dan narkoba) pemerintah harus memeras otak bagaimana kedua hal tersebut bisa diminimalisir atau bahkan dieliminir dengan memberantas setuntas-tuntasnya. Usaha pemerintah untuk membasminya yaitu dengan lembaga bernama Komisi Pemberantasan Korupsi (KPK) dan Badan Narkotika Nasional (BNN). BNN memiliki biro atau perwakilan di daerah untuk wilayah propinsi dan kabupaten yang dikenal dengan BNN Propinsi dan BNN Kabupaten yang biasanya dikomandani oleh orang nomor dua di propinsi atau kabupaten, yaitu wakil gubernur atau wakil bupati. Selanjutnya, gara-gara koru-

psi dan narkoba pula pemerintah harus merogoh kocek dalam-dalam untuk mengang-

garkan setiap kegiatan dan segala sesuatu yang diperlukan oleh KPK dan BNN. Besarnya biaya (cost) dan perhatian pemerintah untuk kasus korupsi dan narkoba seolah-olah menjadi penghambat pembangunan di negeri ini. Apalagi ada isu prioritas pembangunan di pulau jawa dengan pulau-pulau lain sehingga terjadi kecemburuan sosial bagi masyarakat. Tentu saja hal ini akan memiliki efek negatif terhadap tatanan masyarakat sehingga tidak heran sering terjadi pertikaian dan perselisihan apalagi semuanya bersumber dari korupsi dan narkoba. Menurut hemat penulis, menjadi sangat wajar jika pembangunan hampir di setiap lini dan aspek di tanah air menjadi tidak maju atau jalan di tempat bahkan mundur. Gara-gara korupsi banyak pejabat di negeri ini yang

masuk penjara dan gara-gara narkoba tidak sedikit pula artis atau selebritis yang masuk penjara. Artinya, korupsi dan narkoba telah “berjasa” mengantarkan public figure di negeri ini masuk ke dalam hotel prodeo. Oleh karenanya, tidaklah heran jika pemerintah (baca: negara) dan agama telah mengharamkan praktik korupsi (termasuk suap-menyuap) dan penyalahgunaan narkoba. Banyaknya biaya yang tersedot untuk menangani kasus korupsi dan narkoba menjadi penghambat pembangunan di negeri ini. Benar saja, jika anggaran dana yang dipakai untuk kepentingan kasus korupsi dan narkoba yang jumlahnya milyaran bahkan trilyunan itu dialihkan untuk membangun jalan atau memperbaiki infrastruktur di daerah-daerah terpencil dan terisolir, menurut hemat penulis, justru akan lebih mengena dan bermanfaat. Menutup tulisan ini, mari kita bersama-sama membantu KPK dan BNN untuk memberantas korupsi dan memerangi penyalahgunaan narkoba dengan tidak melakukan tindakan korupsi dan tidak mencicipi narkoba mulai dari diri sendiri, mulai dari yang kecil, dan mulai dari sekarang. Jika korupsi dan penyalahgunaan narkoba tidak hilang di tengah masyarakat, niscaya pembanguan di Indonesia tercinta ini dari tahun ke tahun akan jauh lebih maju, insya Allah. Wallahu a’lam. **

+

Santriadi Rizani Umar Guru MA GERPEMI Tebas & SMP Negeri 8 Tebas, Kab. Sambas.

Infrastruktur Tak Dukung Pendidikan Jika kita membicarakan tentang pendidikan, pastilah terlintas di dalam pikiran kita tentang masa depan yang lebih baik.Untukmeraihitu,kitaharus memiliki seorang guru yang memiliki jiwa seni dan public speaking yang baik. Sebab jika seoranggurutidakbisamenyampaikan apa yang ingin disampaikankepadaparamuridnya,maka siswa akan tidak memahami tentang apa yang disampaikan oleh gurunya. Bahkan ketika siswa/i yang ditanya mengerti atau tidak mengenai apa yang telah disampaikan oleh guru, mereka hanya menjawab “ya” tetapi kebanyakan dari mereka tidak mengerti

tentang apa yang dijelaskan oleh guru mereka. Bukan rahasia umum lagi, banyaknya jalan di daerah yang rusak khususnya di daerah Kubu Raya, yang mungkin saja dapat mempengaruhi proses pembelajaran. Khususnya di sekolahsekolahdidaerahKubuRayabaik itu SD,SMP, maupun SMA yang masih tertinggal dengan sekolah di daerah perkotaan. Banyak faktor yang bisa menyebabkan itu terjadi, antara lain dari infrastruktur dan fasilitas-fasilitas yang dimiliki oleh pihak sekolah untuk menunjang proses belajar–mengajar. Tak terkecuali rendahnya kesadaran tenaga pengajar di daerah untuk

memotivasi siswa-siswanya. Ditambah lagi dengan guruguru yang bertindak nakal atau mangkirdaritanggungjawabnya sebagai guru yaitu mengajar. Lebih parahnya lagi, ada guru yang datang dua kali dalam seminggu atau dua kali dalam sebulan. Mungkin ia datang hanya untuk mengisi laporan dan mengambil uang gajian. Sungguh sangat ironi ketika seorang guru yang seharusnya memberikancontohyangbaikkepada siswanya, malah ia bertingkah laku seperti itu. Nur Arifin Asrama Mahasiswa Kab. Kubu Raya .

TPA Juga Tempat Les TAMAN Pendidikan Alquran (TPA) biasanya sangat identik dengan ilmu agama Islam. Ada TPA yang sepi karena anak didiknya kurang. Sekarang mereka lebih disuruh oleh orang tuanya untuk ikut les mata pelajaran. Nah, seharusnya TPA tidak hanya menjadi tempat belajar agama. Bisa ditambahkan les gratis. Misalnya, jika belajar agama dilakukan selesai salat Asar, lesnya dilaksanakan setelah salat Magrib sampai Isya. Selain itu, kegiatan lebih variatif. Misalnya, ada kesenian religius, cerita teladan yang menarik, perlombaan, dan mabit (malam bina iman dan takwa). Tentu hal tersebut menjadi sesuatu yang menarik bagi santri dan yang terpenting orang tua santri.

+

Tyas Haryadi

cmyk

C

m

y

k

+


komunikasi bisnis

12

Pontianak Post

Kamis 7 Maret 2013

Fakultas Ekonomi Untan Membuat Gebrakan Baru pada 2013

Student Exchange & Student Mobility di Jepang dan Malaysia

UNIMAP PERLIS: Pembantu Dekan III FE Untan Dr M Irfani Hendri menyerahkan cinderamata pada Timbalan Dekan Pembangunan Pelajar dan Alumni disaksikan Timbalan Dekan Akademik dan Penyelidikan UNIMAP Dr Mohammad Sharif Bin Ismail saat orientasi mahasiswa Kelas Internasional FE UNTAN di Kampus UNIMAP Perlis.

DUKUNGAN: Wali Kota Pontianak H Sutarmidji SH MHum dan Konsul Malaysia Khairul Nazran ikut mendukung pelaksanaan Program Student Exchange dan Student Mobility FE UNTAN disaksikan Dekan FE UNTAN Dr Hj Jamaliah SE MSi.

INTERNASIONAL: Mahasiswa Kelas Internasional FE Untan, Annisa dan Aristia, saat mengikuti pertemuan student internasional di University of Malaya, Kuala Lumpur.

CINDERAMATA: Empat mahasiswa Kelas Internasional FE Untan bertemu dan menyerahkan cinderamata pada Dekan COB University Utara Malaya Dr Ahmadasari Alaudin.

PELEPASAN: Mahasiswa FE Untan yang mengikuti Program Student Exchange dan Student­ Mobility tahun 2013 berfoto bersama setelah acara pelepasan Dekan FE Untan Dr Hj Jamaliah SE MSi.

FAKULTAS Ekonomi (FE) Universitas Tanjungpura kembali membuat gebrakan guna meningkatkan kualitas mahasiswanya dalam menyongsong Era Komunitas Ekonomi ASEAN. Sebanyak 44 mahasiswa Kelas Internasional FE UNTAN diberangkatkan ke beberapa perguruan tinggi di Negeri Malaysia dan Jepang guna mengikuti perkuliahan selama satu semester. Menurut Dekan FE Untan Dr Hj Jamaliah SE MSi, 44 mahasiswa Kelas Internasional tersebut sebelumnya telah mengikuti perkuliahan selama tiga semester di FE Untan. “Dan di semester 4 ini mereka mengikuti perkuliahan di beberapa perguruan tinggi luar negeri yang telah bekerjasama dengan kita, diantaranya University of Malaya (UM) Kuala Lumpur, University Utara Malaysia (UUM) Kedah, University Malaysia Perlis (Unimap), Unimas dan Kochi University di Jepang,” paparnya. Selain memberangkatkan 44 mahasiswa Kelas Internasional, FE Untan di tahun 2013 juga memberangkatkan tiga mahasiswa dalam program student mobility, di mana dalam program tersebut para mahasiswa selain mengikuti aktivitas akademik juga terlibat dalam aktivitas kemahasiswaan di perguruan tinggi

luar negeri selama dua minggu. “Sebenarnya Program Student Mobility sudah mulai kita rintis sejak 2011 dengan memberangkatkan 15 aktivis mahasiswa FE Untan di Unimas Sarawak,” terang Jamaliah. Tujuan dari Program Student Exchange maupun Student Mobility jelasnya, adalah untuk meningkatan pengetahuan para mahasiswa dan memperluas wawasan mahasiswa. “Dalam menghadapi era Komunitas Ekonomi ASEAN tentu para mahasiswa harus semakin meningkatkan kompetensi yang didukung wawasan dan jaringan yang luas,” ucap ibu berjilbab ini. Melaksanakan Program Student Exchange dan Student Mobility kata Jamaliah, bukanlah pekerjaan mudah. “Namun Alhamdulillah, ini menjadi lebih ringan karena banyak pihak yang mendukung program ini, seperti Rektor Untan sendiri, juga Wali Kota Pontianak dan Konsul Malaysia,” tuturnya. Bahkan menurut Jamaliah secara bertahap jumlah perguruan tinggi luar negeri yang menjadi mitra dalam pelaksanaan Student Exchange dan Student Mobility akan terus ditambah, termasuk kerja sama dengan dunia usaha. (*) Narasi : Agus Sulaiman Foto-Foto : Odeng FE Untan

UNIMAS: Mahasiswa FE Untan yang melaksanakan student exchange dan student mobility di Unimas bersama dua dosen pembimbing, Dr Fariastuti dan Dr Nurul Bariyah.

Diciptakan Pakaian Selam Ikan Pari Terbang OCEANWINGS kini telah meluncurkan satu pakaian selam unik yang memungkinkan penggunanya terbang di dalam air bak ikan pari. Pakaian yang dirancang khusus ini terlihat menarik dan persis seperti sirip ikan. Setelan pakaian yang dinamakan Oceanwings ini membuat desain sayap antara tangan hingga kaki. Dengan desain tersebut, anda memungkinkan untuk berenang di kedalaman laut yang luas layaknya ikan. Pemakainya dijanjikan akan mendapatkan pengalaman terbang di bawah air. Pakaian unik ini dirancang oleh desainer asal Prancis, Guillaume Binard dan diproduksi melalui kerjasama dengan Aqua Lung.”Oceanwings adalah salah satu ikon paling populer dari masyarakat kita, mewujudkan impian tertua manusia yakni terbang, “kata Binard dikutip laman mail, Selasa (5/3).“Proyek ini menun-

seremoni

BUKA RAKOR: Wakil Gubernur Kalbar Drs Christiandy Sanjaya SE MM membuka rapat koordinasi Forum SKPD untuk pemberdayaan koperasi dan UMKM se-Kalbar, disaksikan Kadiskop UMKM Kalbar Drs Ignasius IK SH MSi dan peserta rakor, kemarin.

jukkan kesamaan antara lingkungan udara dan air, serta menemukan perbedaan utama yakni kepadatan,” tambahnya. Pada salah satu video yang disutradarai oleh Jerome Espla, digambarkan pemakai wingsuit terlihat benar-benar mirip ikan

Diskop UMKM Gelar Rakor Pemberdayaan

pari yang terbang di kedalaman laut. Sayangnya, untuk sementara pakaian selam menarik dan unik ini tidak untuk dijual. “Ini hanya sebuah prototipe karya seni dan tidak akan dijual,” ujar juru bicara Aqua Lung, Frédérique Gouin.(afz/jpnn)

DINAS Koperasi, Usaha Mikro, Kecil, dan Menengah (Diskop UMKM) Kalimantan Barat menggelar Rapat Koordinasi Forum SKPD untuk pemberdayaan koperasi dan UMKM se-Kalbar di Hotel Orchardz Ayani, Jl Perdana Pontianak, 5-8 Maret 2013. Rakor dibuka langsung Wakil Gubernur Kalbar Drs Christiandy Sanjaya SE MM, Rabu (6/3) pagi. Ia menyampaikan, sebagai bagian dari tujuan pembangunan ekonomi, pemberdayaan koperasi dan UMKM menjadi hal yang penting untuk mendapatkan perhatian pemerintah. Program pemberdayaan pemerintah pada dasarnya untuk mewujudkan koperasi dan UMKM sebagai pelaku ekonomi berdaya saing tinggi, profesional, dan mampu memberikan kontribusi bagi pertumbuhan ekonomi dan kesejahteraan masyarakat. “Pembinaan koperasi dan UMKM diharapkan menghasilkan wirausaha baru yang profesional dan mampu menyerap tenaga kerja potensial,” ujar Wagub saat memberikan sambutan dan arahan. Ia tidak menampik bahwa

AS Gunakan Kapal Kecil untuk Operasikan Pesawat Nirawak MILITER AS berencana menggunakan kapal-kapal kecil sebagai landasan untuk pesawat tak berawak saat mendarat dan lepas landas. US Defense Advanced Research Projects Agency (Darpa) mengatakan, kapal-kapal kecil itu diperlukan untuk meningkatkan pengawasan dan pengintaian di udara. Unmanned aerial vehicles (UAV/ pesawat tanpa awak) atau yang lebih dikenal dengan sebutan drone, biasanya diluncurkan di daratan. Karenanya penggelaran drone di laut lebih sulit karena harus mengisi bahan bakar terlebih dulu. “Mereka saat ini memerlukan operator pesawat besar dengan landasan yang panjang,” ujar sumber Darpa, seperti dilansir BBC, Senin (4/3).Proyek baru yang dinamai TERN (Tactically Exploited Reconnaissance Node), diambil dari nama burung laut yang dikenal karena daya tahannya. Manajer Program Darpa, Daniel Patt, menyatakan, memung-

kinkan kapal-kapal kecil mengambil alih fungsi landasan panjang yang selama ini digunakan UAV. “Ini seperti memiliki elang kembali ke lengan seseorang, tapi tidak untuk bertengger statis,” ucapnya.

Terlebih lagi, sekitar 98 persen dari luas daratan dunia terletak dalam jarak 900 mil laut dari pantai. Sementara Darpa melihat konflik di lautan terus mengalami peningkatan. (esy/jpnn)

c

M

y

K

kondisi koperasi dan UMKM di Kalbar saat ini masih memiliki keterbatasan. “Sisi lembaga, usaha, dan permodalan masih menjadi faktor yang membatasi ruang gerak koperasi dan UMKM. Tapi jika kita pelajari lagi, pada dasarnya permasalahan yang ada terletak pada keterbatasan SDM koperasi dan UMKM,” katanya. Wagub meminta dalam rakor tersebut bisa ditemukan solusi untuk berbagai permasalahan yang ada. “Koperasi dapat sinyal positif dari Bank Indonesia dilihat dari rendahnya tingkat NPL kita. Solusi apa yang bisa ditawarkan pada Koperasi dan UMKM yang belum mampu mengakses pada kita. Buka jalan, termasuk akses permodalan. Yang tidak bagus di manajemen, kita bantu,” paparnya. Ia berpesan, pemberdayaan koperasi harus beriringan dengan administrasi birokrasi yang baik. “Jangan kita bicara koperasi, tapi ternyata administrasi di jajaran birokrasi bermasalah,” tegasnya. Drs Ignasius IK SH MSi, Kadiskop UMKM Kalbar menyampaikan, rakor dimaksudkan sebagai media untuk membahas

permasalahan khusus yang dihadapi dalam pembangunan koperasi dan UMKM. Rakor turut membahas isu-isu aktual dan strategi yang memberikan pengaruh pada proses pembangunan koperasi dan UMKM. “Rakor ini ditujukan untuk terwujudnya koordinasi yang efektif dalam pembinaan koperasi dan UMKM melalui program kegiatan yang dilaksanakan. Terwujudnya monitoring dan evaluasi yang berkaitan dengan pemberdayaan koperasi dan UMKM di Kalbar. Serta, mensosialisasikan hal-hal yang berkaitan dengan program pemberdayaan koperasi dan UMKM,” jelas Ignasius. Rakor diikuti para kepala dinas dan pejabat yang membidangi koperasi dan UMKM kabupaten/kota se-Kalbar. Rakor juga diisi paparan dari Kementerian Koperasi dan UKM Republik Indonesia, paparan tentang pemberdayaan koperasi dan UMKM oleh kabupaten/ kota, serta paparan pejabat eselon III di lingkungan Dinas Koperasi dan UMKM Kalbar. (d1/ser)


Pontianak Post

Kamis 7 Maret 2013

KOMUNIKASI BISNIS

Jadi Kaya & Bahagia Semudah Tersenyum Dengan Optimasi Alam Bawah Sadar Segera Dapatkan Tiketnya Sebelum Kehabisan TAHUKAH anda, bahwa hanya 10 persen manusia yang sering menggunakan alam bawah sadar dan terbukti, mereka orang-orang terkaya di dunia dan bahagia. Ternyata alam bawah sadar juga berkekuatan 10 kali lipat dari pikiran sadar kita. Bahkan, menurut para ahli, pikiran bawah sadar mampu mempengaruhi kehidupan atau kesuksesan seseorang sebesar 88 persen dan 12 persennya dipengaruhi otak sadarnya, namun sayang potensi luar biasa ini baru kita ketahui sekarang. Untuk itu, kami mengajak anda berinvestasi ilmu cara privat mengaktifkan pikiran bawah sadar, sehingga apa yang kita inginkan akan segera terwujud. Manfaat bagi peserta dalam acara ini: (1) Bisa mengaktifkan kekuatan rakasa dalam tubuh (alam bawah sadar, sehingga kesuksesan mengejar anda). (2) Mempertajam intuisi, sehingga bisinis menjadi lancar. (3) Menarik orang lain mulai dari klien, investor, mitra bisnis, calon pasangan hidup. (4) Membuka aura rezeki. (5) Membersihkan energi negatif dalam tubuh. (6) Menjadikan anda

lebih sabar dan bijak, sehingga kemudahan datang untuk anda. (7) Kesembuhan dalam penyakit. (8) Menurunkan gelombang otak agar doa-doa anda cepat terkabul, bisa untuk semua agama. Bagi anda ingin mendapatkan semua manfaat di atas, CV. Mega Jaya Group akan melaksanakan seminar Optimasi Alam Bawah Sadar di Hotel Merpati, Jl. Imam Bonjol Pontianak, pada Sabtu, 9 Maret 2013, pukul 18.30 WIB. Dengan menghadirkan Trainer Nasional nomor wahid Mr.Yan yang juga pengusaha properti di Jawa Timur. Kesaksian yang datang dari para peserta diantaranya: Dahsyat! refleksi energi positif yang saya tebar seperti pelajaran tadi malam, habis subuh saya sempatkan afirmasi, Alhamdulillah separuh dagangan saya terjual habis, trims atas ilmunya Mr Ryan (Suhendra Jambi). Diakhir latihan hampir selesai, saya mendapatkan SMS dari orang yang melarikan uang saya Rp150 juta, dia berjanji akan mengembalikan uang saya besok pagi. Sangat ajaib hampir-hampir saya tidak percaya dengan kejadian ini (Edi Medan). Ilmunya sangat paten berguna bagi saya dan keluarga, manajemen hati yang diajarkan membuat usaha saya kebanjiran order dan menjadi magnet uang (Moh Achir Padang), dan masih banyak kesaksian lain yang tidak memungkinkan untuk dicantumkan semua di sini.

Road to Seminar Mario Teguh It’s Not Cheap, But It Will Make You Expensive’ “KEBAHAGIAANMU adalah kebebasan untuk melakukan yang ingin kau lakukan, dan dalam melakukannya engkau dikenali dengan kekayaan yang utuh.” Ini sedikit kutipan dari Facebook Mario Teguh. Kalimat motivasi dalam Facebook Mario Teguh telah banyak membantu orang lain. Jadi tidak mengherankan jika Mario Teguh meraih MURI sebagai motivator dengan Fans Facebook mendunia. Beliau juga dipilih sebagai 1 dari 8 pemimpin berpengaruh di 2009 berdasarkan versi Harian Republika. Kini, warga Kalimantan Barat, khususnya Pontianak berkesempatan langsung bertemu muka dengan Mario Teguh. The Best Motivator in Asia ini bakal menggelar Seminar Super ‘Breaking Through’ di Kalimantan Ballroom Hotel Aston Pontianak, Jumat, 22 Maret 2013, pukul 18.3021.00. “Bapak Mario Teguh membimbing kita sukses melampaui kekurangan dan kelemahan,” ujar Iwan Kurniawan, ketua pelaksana seminar dari Nu Eternity Production Pontianak. Ia mengaku, pihaknya telah melobi Manajemen Mario Teguh sejak Agustus 2012. “Selama enam bulan kami terus follow up, akhirnya berhasil mendapatkan jadwal seminar di Maret ini,” ujarnya,

Mr. Yan Contoh-contoh bisa kita praktikan di seminar ini, peserta dapat melayang ketika konsentrasi penuh, ini membuktikan bahwa semua orang memiliki kemampuan luar biasa yang selama ini kita anggap mistis.Untuk itu, segera dapatkan tiket seminar optimasi Alam Bawah Sadar di Resepsionis Hotel Merpati, Jl. Imam Bonjol Pontianak (selama 24 jam) seharga Rp75 ribu/orang atau Rp100 ribu untuk 2 orang. Informasi lebih lanjut, anda cukup SMS, ketik: info (spasi) No.Hp (spasi) asal kota kirim ke 085232888876 (a/n Hadi). Maka kami yang akan menghubungi anda! Buruan daftar sekarang, kesempatan terbatas, dijamin anda pasti bisa, garansi 100 persen uang kembali.(d3/biz)

KAKEK 3 cucu ini menghabiskan waktunya di kursi roda akibat stroke yang di akibatkan tekanan darah tinggi. Sebelumnya ia tergolong pecandu rokok dan kopi, dan makanan kesukaannya adalah sate kambing. Akibat dari pola hidup yang tidak terkontrol ia membisu seribu bahasa di kursi roda. Ia masih beruntung karena sudah dapat berbicara selama ia minum kulit manggis plus daun sirsak dalam bentuk kapsul yang namanya Erjun, tutur sang istri yang selalu setia menemaninya yang berdomisili di jln. Mereanti Surabaya. Kulit manggis dan daun sirsak sudah ada dalam bentuk kapsul yaitu Erjun, sehingga tidak perlu lagi merepotkan diri untuk merebus daun sirsak plus kulit manggis yang belum di ketahui dosisnya. Daun Sirsak mengandung Acetogeniens Annonaceons (bahan Kimia) alami yang sangat luar biasa sebagai zat yang ampuh untuk membunuh tumor dan sel-sel kanker yang mematikan, dan sifatnya tidak mengganggu sel-sel penting lainnya didalam tubuh. Berpuluh puluh tahun penelitian daun sirsak di tutup tutupi, karena dapat mengancam kelangsungan hidup kemoterapi yang biasa di gunakan penderita kanker dan juga industri kimia, karena daun sirsak harganya murah. Acetogeniens Annonaceons yang ada di dalam daun sirsak mempunyai kekuatan

Solusi Tepat Terobosan Terbaru Atasi Segala Macam Penyakit Pria Pengobatan Sinshe Hongkong yang Manjur, Satu-satunya di Pontianak

impa pria pada berbagai kalangan usia dan harus diobati sedini mungkin, agar tidak memburuk hingga menimbulkan penyakit komplikasi bandel lainnya yang sangat parah dan berbahaya. Sinshe Hongkong Pontianak ada konsultan sinshe ahli herbal sinshe ternama dari Tiongkok yang siap membantu Anda. Melalui pengalaman kerja keras puluhan tahun akhirnya berhasil menemukan terobosan terbaru, khusus mengatasi disfungsi seksual pria seperti; impotensi, ejakulasi dini, radang prostat, sperma mati, tidak ada sperma, alat vital tidak normal, kemandulan dll. Hasilnya relatif cepat, aman, dan tanpa efek samping. Terobosan metode sinshe dengan herbal berharga alami yakni “Qiang Yang Bu Shen Liao Fa” ini dipadukan akupuntur elektroterapi sangat

terkenal di beberapa negara, berfungsi memperkuat ginjal & sperma, menyeimbangan unsur yin & yang di dalam tubuh, setelah diatasi bisa menormalkan fungsi seksual, masa berhubungan bisa lebih lama. Ratarata setelah 2-3 tahap pengobatan, gejala penyakit seperti kencing terasa sakit, sering kencing, tidak tahan kencing, kencing tidak bertenaga, tidak tuntas, berbusa, bernanah dan lainnya berangsur menghilang secara nyata, sistem reproduksi kembali normal, bisa diatasi hingga ke akar penyakit dan tidak mudah kambuh kembali.“Dapatkan program promosi khusus bagi yang datang berobat ke Sinshe Hongkong.” Untuk konsultasi dan pengobatan hubungi: Sinshe Hongkong, Jl. Agus Salim No. 126, Pontianak telepon: 0561-733268, 0821 52797 888 (Hari Minggu & libur tetap buka).(a2/biz)

eka berjalan lebih lama dari 24 jam,” ucap Lack. Menurutnya, kebanyakan orang memiliki jam tubuh 24 jam. Ini adalah irama alami yang mempengaruhi kantuk serta suhu inti tubuh. Namun pada orang dengan gangguan fase terlambat tidur, dibutuhkan waktu lebih lama untuk menyelesaikan siklus. Akibatnya mereka cenderung menunda tidur dan bangun. Lack menjelaskan, dibutuhkan tes terhadap populasi yang lebih besar untuk bisa mengkonfirmasi temuannya tersebut. Langkah ini di-

t y Production Pontianak telah menandatangani kontrak dengan Manajemen Mario Teguh untuk seminar di Pontianak. “Kami telah melunasi semua kewajiban administrasi pada Manajemen Mario Teguh satu bulan sebelum tanggal seminar. Jadi tidak

perlu ragu lagi, seminar 22 Maret ini, pasti terlaksana,” tegasnya. Panitia menyediakan beberapa jenis undangan, yaitu VVIP, VIP, Kelas A, Kelas B, dan Kelas C. Undangan VVIP dan VIP hanya untuk pihak sponsor, pendukung acara, dan pejabat. “VVIP dan VIP sudah terisi penuh. Untuk Kelas A, B, dan C masih tersedia dan sudah bisa dibeli,” katanya. Untuk pemesanannya bisa menghubungi Toni 08785666-6635 / 0858-22222283, Iwan 08125751-8397, atau Hendra 0561-6598908 / 0812-57834683, Pin BB 2A2CBC85, hotline 0 5 6 1 6598908. “ I t ’s n o t cheap, but it w i l l m a k e you expensive,” ujar Iwan menirukan b a h a s a Ma rio Teguh. Kursi yang disiapkan terbatas dan bernomor (seperti penerapan di bioskop). Kursi yang terisi tiap hari di-update dan dapat dilihat langsung di www. ajspontianak.com untuk posisi denahnya. (d1/biz)

UKURAN otak kecil tak berarti bodoh. Kalau pria mentertawakan otak wanita karena ukurannya (kecil), mereka melakukan sebuah kesalahan. Menurut sebuah penelitian, otak kecil wanita ternyata lebih efektif digunakan, dibandingkan otak pria yang berukuran besar. Para peneliti dari Universitas Los Angeles Madrid, melakukan serangkaian tes kecerdasan pada pria dan wanita. Pengujian ini ditujukan untuk mengetahui perbedaan dan fakta ukuran otak. Dalam tes tersebut, otak kecil dikatakan lebih efektif dan produktif karena memiliki penalaran induktif. Inilah yang menjadi alasan mengapa banyak wanita yang ahli dalam keterampilan numerik, kemampuan melacak situasi, dan pandai menggunakan bahasa Inggris, seperti

M

ERJUN dan kulit buah manggis yang ada didalam kapsul erjun adalah untuk mengobati berbagai penyakit, baik itu penyakit degeneratif dan kanker juga untuk penyakit ringan lainnya Untuk imformasi dan yang ingin menjadi subdis di daerah hub. Hp. 081 352 022 980 Erjun sudah beredar di Pontianak : Tersedia di Apotik dan Toko obat terdekat. KETAPANG : Apt, Mulia, Lestari Farma, T.O Sumber Sehat danT.o .SumberSehatSAMBAS:T.o.Sant osSingkawang:Apt.Merdeka,Apt. Singkawang,. Apt. Asean,dan Toko obat Apollo. Subdis Sanggau Hp.082151255333. (d2/biz)

yang dilansir Zeenews. Meski begitu, bukan berarti otak pria tidak memiliki keunggulan. Untuk kecerdasan spasial, pria masih memimpin.Satu penyebab perbedaan ini adalah jumlah sel neuron pria dan wanita. Pria memiliki banyak sel neuron yang ber-

fungsi untuk penalaran. Sedangkan perempuan memiliki lebih banyak koneksi antarneuron, sehingga membuat wanita berpikir lebih cepat. Hal inilah yang memungkinkan wanita lebih cepat dalam menyelesaikan tugasnya. (int)

Ganja, Jenis Narkoba Paling Populer di Indonesia

harapkan dapat mendukung terapi yang selama ini diyakini mampu membantu mereka yang mengalami gangguan fase terlambat tidur. Salah satunya adalah terapi cahaya terang untuk mendorong kesigapan di pagi hari dan melatonin untuk mendorong rasa kantuk di malam hari. Lebih lanjut Lack menilai, sangat penting untuk menemukan penyebab gangguan fase terlambat tidur ini. Pasalnya kondisi tersebut mempengaruhi begitu banyak orang. Mulai dari pelajar yang sering terlambat ke sekolah hingga pekerja yang telat datang ke kantor. (int) C

sepuluh ribu kali lipat menghambat dan membunuh sel kanker dibandingkan denganAdriamicin dan terapi kemo. Daun sirsak juga berfungsi sebagai anti bakteri, antijamur, efektif melawan berbagai jenis cacing dan parasit, menurunkan tekanan darah tinggi, defresi, stress menormalkan kembali system syaraf yang kurang baik dan penyakit degeneratif lainnya. Kulit mangis mengandung Xantone atau senyawa yang kurang lebih 50 jenis yang merupakan anti oksidan tingkat tinggi yanmg mempunyai kemampuan menetralkan radikal bebas. Senyawa yang ada didalam kulit manggis berperan mengendalikan sel kanker dengan mekanisme apotosis atau proses bunuh diri, dan juga mengaktifkan sistim kekebalan tubuh dengan merangsang sel pembunuh alami yang berfungsi membunuh sel kanker dan virus. Bayak para meneliti kulit manggis membuktikan kalau kulit manggis mengandung anti oksidan 17000 sampai 20000 Orac/ 100 ons. Bila di bandingkan dengan bahan lain yang berkadar anti oksidan tinggi. Seperti wartel dan jeruk, hanya 300 dan 2400, Orac mempunyai kemampuan anti okksidan menetralkan radikal bebas penyebab penyakit. Orac adalah singkatan dari oksigen radikal absorbance kapasiti bebas penyebab penyakit Khasiat utama dari daun sirsak

Otak Wanita Bekerja Lebih Efektif Dibanding Pria?

Penyebab Orang Sulit Bangun Pagi APAKAH Anda termasuk orang yang sulit tidur di malam hari dan bangun di pagi hari? Selalu menekan tombol snooze setiap kali jam beker berbunyi? Jika ya, berarti Anda mengalami gangguan fase terlambat tidur (Delayed Sleep-Phase Disorder/DSPD) Seperti dilansir laman Daily Mail, sekelompok peneliti di Flinders University, Adelaide, Australia, melakukan penelitian terhadap DSPD. Sebuah gangguan yang ditandai dengan ketidakmampuan tidur dan bangun pada waktu normal. Menurut ketua tim peneliti, Profesor Leon Lack, hasil awal memperlihatkan bahwa jam tubuh internal orang yang mengalami gangguan tersebut berjalan lebih lambat dari rata-rata. Orang yang mengalami gangguan ini biasanya tidak bisa tidur hingga pukul 2 atau 3 pagi, atau dalam beberapa kasus hingga pukul 4 pagi. Hal tersebut membuat mereka sulit bangun pada keesokan harinya. “Kami telah menyelidiki apa yang menyebabkan orang terlambat tidur dan salah satu penjelasan paling masuk akal adalah jam tubuh mer-

“Kami ingin Bapak Mario memberikan pencerahan karakter bagi warga Kalbar. Kami bersyukur niat ini disambut baik.” Iwan yakin animo masyarakat Kalbar terhadap Seminar Super Mario Teguh tinggi. “Super sekali animo warga dengan even ini. Buktinya, posting iklan kami untuk Seminar Super Bapak Mario Teguh langsung mendapat 1.800 lebih like hanya dalam tiga menit. Sangat super animonya,” katanya. Toni Sutiono, humas seminar menambahkan, Nu Eterni-

Bertahun-Tahun Duduk di Kursi Roda

SINSHE HONGKONG

CIRI khas, kemanjuran dan keunggulan Sinshe Hongkong Pontianak sangat jelas. Dengan resep kuno kekaisaran, resep rahasia turun temurun serta herbal Tiongkok alami, intinya mengobati berbagai penyakit bandel yang susah disembuhkan, khusus menangani berbagai penyakit kronis, begitu diobati langsung dapat dirasakan manfaatnya. Efektif mengobati berbagai penyakit kronis sampai akarnya, tanpa efek samping, setelah diatasi tidak mudah kambuh kembali. Menurut survei terbaru, disfungsi seksual pria termasuk penyakit yang sangat banyak diderita. Terutama persentase penderita impotensi, ejakulasi dini, radang prostat mengalami kenaikan pesat, berdampak jauh lebih parah bagi psikologi dan jiwa, dibanding penyakit pria lainnya, juga merupakan 30% alasan retaknya keharmonisan rumah tangga, menghancurkan kepercayaan diri pria. Penyakit gangguan fungsi seksual men-

13

Advertorial

PENYALAHGUNAAN narkoba semakin meningkat pesat di dunia, termasuk Indonesia. Berdasarkan data Badan Narkotika Nasional (BNN) tahun 2012, diperkirakan ada sekitar 26.458 kasus penyalahgunaan narkoba. Dari angka tersebut, sebanyak 17.620 adalah kasus narkotika, 1.599 zat psikotropika, dan 7.239 zat adiktif. “Penyalahgunaan obat-obatan ini banyak terjadi pada kisaran Y

K

usia mulai dari 20 hingga 40 tahun. Paling banyak mereka tercatat menggunakan ganja dan shabu,” kata Deputi Hukum dan Kerjasama BNN, Bali Moniaga, saat ditemui di Menara Thamrin, Jakarta Pusat. Saat ini, ganja tercatat sebagai narkotika terpopuler di seluruh dunia, termasuk Indonesia. Dirjen Kejahatan Terorganisir Transnasional Kemenlu, Spica Tutuhatunewa, mengatakan, ganja pop-

uler karena lebih mudah diolah. “Ganja dari daun mentah yang dikeringkan saja sudah dapat digunakan, tak perlu diolah lebih jauh seperti opium,” ujar Spica. Berdasarkan laporan tahunan Dewan Pengawas Narkotika Internasional (INCB) kawasan Asia dan Afrika, ganja juga masih menjadi narkoba yang ditanam, diedarkan, dan disalahgunakan secara luas. (int)


opini

14

Pontianak Post

Kamis 7 Maret 2013

Mencermati Rancangan RPJMD Kalbar 2013-2018 (Bagian 3)

Etos Kerja Aparatur SEHEBAT apapun suatu rencana, sebaik apapun strategi yang dipilih dan selengkap apapun sarana yang disediakan, pada akhirnya hasil dari kegiatan ditentukan oleh para manusia pelaksananya. Para pengamat pembangunan meyakini bahwa kunci penting penentu keberhasilan pembangunan di suatu negara adalah aparatur pemerintahnya. Kalau kita berkunjung ke beberapa negara yang relatif lebih maju dibandingkan kita, maka kita segera melihat bahwa etos kerja aparatur mereka tinggi. Pegawai negara bekerja dengan disiplin, teliti, tekun, ramah, gembira, cepat tanggap, kompeten, jujur, berani, kreatif dan percaya diri. Mereka bekerja dengan

sepenuh hati. Etos kerja dapat diartikan sebagai adat atau kebiasaankebiasaan yang baik dalam bekerja. Etos kerja seorang pribadi merupakan perwujudan dari penghayatannya terhadap makna pekerjaan. Kalau pekerjaan itu disyukuri sebagai berkat, dilakukan dengan gembira, dijadikan aktualisasi diri, dihayati sebagai bentuk ibadah, maka kerja itu menjadi pelayanan terbaik. Penghayatan itu membentuk sikap dan mengendalikan tindakan atau perilaku. Selanjutnya, tindakan yang terus-menerus diulang menjadi kebiasaan. Akhirnya terbentuklah budaya kerja organisasi. Bagaimana etos kerja aparatur pemerintahan kita?

Dalam ungkapan isu-isu strategis rancangan RPJMD Kalbar 2013-2018 tergambarkan dengan jelas bahwa kita sangat memerlukan pengembangan kualitas aparatur pelaksana pembangunan. Masih rendahnya kompetensi aparatur dalam pelayanan masyarakat diakui eksplisit dan implisit. Pegawai yang rendah etos kerja (kurang kompeten, kurang ramah, kurang disiplin, kurang rajin, dan seterusnya) mudah ditemukan di setiap instansi pemerintah kita. Tiga orang dari para Bupati kita di Kalbar pernah bercerita kepada saya tentang para pegawai bawahan mereka. Intinya, ketika Bupati tidak berada di kantor, para pegawai mulai lesu kerja, bahkan ada yang langsung pulang

oleh P. Florus

ke rumah atau pergi untuk urusan pribadi. “Suatu kali saya bilang bahwa saya mau Pontianak. Padahal saya hanya pergi makan siang ke rumah. Ketika saya balik ke kantor dan pergi ke beberapa SKPD, ternyata sebagian pegawai sudah hilang,” begitu cerita seorang Bupati. Ia melanjutkan, “Sebaliknya, kalau saya ada di kantor, semua pegawai seperti sedang bekerja dengan serius.” Bupati lain menceritakan tentang seorang pegawainya yang berkomentar kepada wartawan. Pegawai itu ditanyai, “Mengapa tidak masuk kerja?” Dia menjawab, “Buat apa setiap hari masuk kerja,

Bupati kami saja sering tidak masuk kantor.” Bukankah ini contoh pegawai yang belum memahami bahwa seorang pemimpin seperti Bupati atau Gubernur bekerja tidak lagi terikat tempat dan jam kantor? Etos kerja aparatur pemerintah yang rendah bukan hanya masalah Kalbar, tetapi masalah bagi semua provinsi, alias masalah nasional. Wakil Menteri Pendayagunaan Aparatur dan Reformasi Birokrasi, Eko Prasojo, sering mengakui bahwa aparatur pemerintahan kita pada umumnya punya keterampilan memadai, tetapi etos kerja mereka masih rendah. Dalam suatu seminar bertema ‘Membangun Karakter Bangsa’ di Pontianak pada pertengahan

tahun 2012, Eko Prasojo menceritakan pengalamannya ketika masih kuliah di Jerman. Sekembali dari berlibur di Indonesia, dia membelikan kain batik untuk Profesornya. Tetapi Sang Profesor menegurnya, karena menganggap pemberian itu sebagai sogokan. “Sementara kita di Indonesia masih terbiasa dengan uang rokok, uang terima kasih atau uang pelicin,” kata Eko Prasojo. Sampai tingkatan Kepala Dinas atau Kepala Biro di Provinsi dan Kabupaten/ Kota, pada umumnya etos kerja sudah cukup tinggi. Namun pada tingkatan di bawah itu masih rendah. Menyadarkan etos kerja, membiasakannya sampai menjadi budaya kerja memerlukan ketekunan, proses

dan waktu cukup panjang. Kegiatan penyadaran etos kerja dalam waktu 4 sampai 6 hari untuk satu kelompok merupakan momen untuk meyakini dan menumbuhkan etos kerja. Itu bukan ceramah tentang etos kerja, tetapi proses penyadaran refleksifpartisipatif-proaktif. Setelah itu perlu dibangun sistem kerja, yang pada hakikatnya ‘memaksakan’ sekumpulan etos untuk dibiasakan. Pemaksaan itu mungkin dalam bentuk hadiah (penghargaan) atau hukuman (sanksi). Mendisiplinkan seseorang, misalnya, tidaklah mudah. Pada awalnya mungkin perlu dipaksakan dengan ancaman sanksi atas ketidakdisiplinan. Begitu juga terhadap setiap perilaku lain.* (*/Habis)

Editorial

Sudahi Polemik Perintah Penahanan KEBIASAAN sebagian hakim kasasi di Mahkamah Agung yang tidak mencantumkan perintah penahanan dalam amar putusannya kini menjadi isu nasional. Sebab, celah itu dimanfaatkan sejumlah terpidana korupsi untuk menolak pelaksanaan eksekusi. Bak gayung bersambut, tidak sedikit kejaksaan yang ragu dan memutuskan untuk tidak menjalankan eksekusi. Mereka khawatir, putusan itu benar-benar batal demi hukum karena tidak memenuhi persyaratan seperti yang diatur dalam pasal 197 ayat 1 huruf k KUHAP. Sebenarnya, jawaban atas polemik itu sudah dijelaskan dalam putusan Mahkamah Konstitusi (MK) yang dijatuhkan pada 22 November tahun lalu. Prinsipnya, putusan yang tak memuat perintah penahanan tidak batal demi hukum. Artinya, dalih para pengacara kasus korupsi yang ingin me-

Pontianak Post

lepas beban hukum kliennya dengan tafsir pasal itu haruslah disudahi. Tidak perlu beralasan lagi, jaksa harus menyegerakan pelaksanaan eksekusi terhadap putusan yang seperti itu. Mereka harus ingat, eksekusi merupakan jaminan atas kepastian hukum. Semakin jaksa beralasan, peran mereka sebagai penjaga kepastian itu perlu diberi tanda tanya besar. Bila dirunut ke belakang, MK dalam putusan No 69/PUUX/2012 sudah memberikan penjelasan gamblang. Alasanalasan para hakim konstitusi sebelum mereka sampai pada amar putusan juga amat terang. Tidak perlu ada tafsir berteletele yang mengaburkan substansi vonis MK tadi. Hakim menyatakan, persidangan perkara pidana (sebagaimana yang dihadapi Sukamto Hadi cs yang tersandung kasus korupsi dana jasa pungut atau kasus Bupati Kepulauan

Aru Teddy Tengko) adalah mencari kebenaran materiil. Nah, putusan Mahkamah Agung (MA) adalah bentuk kebenaran materiil itu. Menjadi ganjil apabila persoalan ”perintah penahanan” digunakan sebagai celah untuk menghapus kebenaran materiil yang telah ditemukan. Apalagi, proses penemuan kebenaran itu selalu memakan waktu dan melintasi persidangan yang berbelit dan berlevel-level. Mengingkari putusan pidana dengan dalih tidak adanya perintah penahanan juga mencoreng substansi keadilan. Boleh jadi, tak terlalu merugikan apabila yang ditangani hanyalah perkara kelas teri, seperti pencemaran nama baik. Sudah pasti tidak banyak yang merasa dirugikan. Lain halnya ketika pengingkaran itu dilakukan dalam perkara korupsi. Bila dalil itu diamini, rasa keadilan makin tersayat-sayat. Bisa dibayang-

kan, para koruptor yang sudah dipenjara sebelum putusan MK itu, bakal rame-rame membuka lembaran putusan yang mereka terima. Selanjutnya, mereka mati-matian menyimak dan mencari kata-kata perintah ”ditahan”. Betapa negara akan direpotkan menghadapi gugatan perdata para koruptor. Mereka menuntut ganti rugi atas perlakuan negara yang bisa dianggap timpang dan dipaksakan. Boleh saja jika terlewatnya pencantuman perintah penahanan itu menjadi koreksi bagi MA. Para hakim agung harus lebih ekstrahati-hati saat menuliskan putusan. Mereka harus membaca ulang, setidaknya apakah kaidah penulisan putusan sudah terpenuhi. Putusan yang lengkap dan baik adalah separo dari bentuk keadilan itu. Jangan sampai putusan yang dijatuhkan memicu silang sengkarut dan ketidakpastian yang lebih substansial. (*)

Ilustrasi : Kekes

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Per­setujuan Peru­bahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11­September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redak­si: (0561) 735070.Telepon Iklan/Pema­saran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: redaksi@pon­tianakpost.com. Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Re­daksi/Penang­gung Jawab: B Salman. Redaktur Pelaksana: Khairul­rahman, Muslim Minhard, Donatus Budiono, Basilius. Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar, Efprizan. Sekre­taris Redaksi: Silvina. Staf Redaksi: U Ronald, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari Jawa Pos Group Kurniatama, Hendy Irwandi, Pracetak/Artistik: Mochsinin (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: Hari Kurniatama (Jl P Anom Telp (0562) 392683) Biro Sanggau: Sugeng (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Asri Isnaini, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Sutami. Pema­saran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Lang­ganan per 1 Bulan dalam kota Rp 80.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 40.000,- full colour Rp 50.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, mak­­si­mal 10 baris) pem­bayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Ming­gu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.


ANEKA PONTIANAK

Pontianak Post Kamis 7 Maret 2013

15

Lahir, Dibunuh, lalu Dibuang Sambungan dari halaman 9

Siapa pelakunya, masih kami selidiki,” kata Suhdi. Suhdi menceritakan, berdasarkan pemeriksaan dari beberapa saksi, sekitar pukul 03.00, Minggu (3/3), Ira (18), ibu bayi malang itu keluar dari rumah untuk buang air kecil menuju parit yang terletak di belakang rumahnya. Saat ibu bayi itu keluar dari rumah, melihat anak dan Sunardi, suaminya masih tertidur pulas di kamar. Setelah usai buang air, Ira pun kembali ke kamar dan mendapati bayi laki-laki buah cintanya dengan Sunardi raib entah ke mana. Ira pun terperanjat kaget dan spontan membangunkan suaminya, dan mengatakan bahwa anak laki-lakinya telah hilang dari ranjang tidur. Alangkah kagetnya Sunardi, melihat sang anak tak yang awalnya tidur bersamanya itu hilang. Kegaduhan dalam rumah tangga itupun terjadi. Misteri hilangnya bayi itu pun menggema dan menghebohkan Desa Mega Timur. Jefri yang tak lain adalah abang ipar dari ibu bayi itu pun mulai penasaran. Ia terus mencari keberadaan sang bayi den-

gan menyusuri parit itu. Saking penasarannya, Jefri pun menyeburkan dirinya di dalam parit. Alangkah kagetnya dia, setelah kedua kakinya menginjak benda yang mengumpal di dasar parit. Rasa penasaran yang begitu besar itu pun akhirnya terjawab sudah. Kakinya menginjak benda yang tak lain adalah sosok bayi milik Ira dengan kondisi tak bernyawa lagi. Penemuan mayat bayi itupun kemudian dilaporkan ke Polsek Sungai Ambawang untuk proses lebih lanjut. Suhdi menambahkan, selain melakukan pemeri k s aa n s e ca ra i nt e n s i f, pihaknya saat ini masih menunggu hasil otopsi yang dilakukan RS Bhayangkara Polda Kalbar. “Kita masih menunggu hasil otopsi. Apakah bayi itu dibunuh, kami masih selidiki. Arahnya sudah ada, tapi siapa pelaku pembunuhan itu kita masih lakukan pemeriksaan,” pungkasnya. Di bagian lain, tindak kejahatan yang masih meresahkan masyarakat, membuat jajaran Polresta Pontianak terus menggiatkan patroli rutin. Mulai hari ini, pihaknya menggelar operasi panah hingga 20

Maret mendatang. Polresta telah berhasil mengungkap beberapa kasus konvensional. Peristiwa ini kerap kali terjadi di lingkungan masyarakat. Seperti curat, curas, curanmor, hingga peredaran narkotika. Berdasarkan data, pihaknya berhasil mengungkap 27 kasus tersebut dalam sepekan. “Dalam seminggu ada 27 kasus yang masuk di wilayah hukum kita. Diantaranya, ada 7 tersangka diamankan pada kasus curat, dan 1 tersangka curanmor. Sementara curas masih nihil,” kata Kabid Humas Polresta Pontianak AKP Slamet Wagiyono kepada Pontianak Post, kemarin. Dari catatan tersebut, kata dia, akan terus dievaluasi terkait perkembangan tingkat kerawanan kriminalitasnya. Setelah hasil itu dirangkum, maka semua personil akan diterjunkan ke lapangan sesuai kesatuan masing-masing. Tidak hanya Reskrim, beberapa jajaran lain turut membantu demi menjaga kamtibnas di daerah yang dianggap rawan aksi kejahatan. “Sudah kita petakan daerah tersebut, dan sekarang masih terus dievaluasi,” kata Slamet. (arf/rmn)

Koran Sekolah jadi Ajang Salurkan Ekspresi Sambungan dari halaman 9

Firdania, siswi SMA Negeri 7 Pontianak, mengatakan adanya koran sekolah menjadi ajang baginya untuk belajar menulis. Selama ini dia mengaku suka sekali menulis. Namun jarang mendapatkan kesempatkan untuk mempublikasikan tulisannya di koran. “Dengan adanya koran sekolah

ini saya bisa menampilkan tulisan saya di koran dan dibaca banyak orang,” katanya. Menurut Firdinia, koran sekolah juga membuat pelajar jadi lebih kreatif. Mereka juga bisa mendapatkan pemahaman mengenai dunia jurnalistik. “Dengan adanyan koran sekolah saya bisa cara menulis yang baik di koran. Ini sangat berman-

faat,” katanya. Hal senada dikemukakan Muhammad Fathoni dari SMA Negeri 2 Sui Raya. Menurutnya, koran sekolah memiliki manfaat positif. “Jadi anak-anak SMA bisa menyalurkan ekspresi. Daripada melakukan hal negatif, mending disalurkan dengan kegiatan positif seperti kegiatan tulis menulis ini,” ungkapnya. (her)

MUJADI/PONTIANAKPOST

IMBAUAN

Tampaknya pihak sekolah di sepanjang Jalan Ahamd Yani perlu melakukan imbauan terhadap anak didiknya. Sampah bekas kemasan minuman atau makanan ringan menumpuk di samping trotoar.

Polisi Tunggu Hasil Lab Forensik Sambungan dari halaman 9

Kapolsekta Pontianak Utara, Kompol Tober Sirait mengatakan peristiwa kebakaran yang menimpa dua rumah warga tersebut diduga bersumber dari arus pendek listrik. “Hasil identifikasi sementara,  tidak ada korban jiwa dalam insiden itu. Hanya saja ada dua orang yang mengalami luka-luka akibat terjun dari lantai dua. Kerugian material akibat kerugian belum ditaksir,”kata Tober, kemarin. Sementara itu Atheng, pemadam kebakaran senior mengatakan, terjadinya kebakaran yang selama ini terjadi di Kota Pontianak dikarenakan human error atau ulah manusia itu sendiri. Menurut Atheng, lebih baik mencegah daripada menanggulangi. “Sebenarnya kita kembalikan lagi kepada manusianya itu sendiri. Karena peristiwa kebakaran yang ada di Pontianak ini didominasi oleh ulah manusia atau human error itu sendiri. Kelalaian dan ketidakwaspadaan manusia

Sambungan dari halaman 16

Sambungan dari halaman 9

Ia menyatakan masyarakat tidak perlu khawatir atas keselamatan warga Indonesia, termasuk dari Kalbar yang berada di Sabah. Permasalahan ini sudah ditangani dan diatasi

telah diserahkan kepada Kejati Kalbar yang mana telah telah menetapkan satu orang sebagai tersangka. Namun, lanjutnya, proses penyidikan dari Polda Kalbar selalu mentah dan dikembalikan kembali karena dianggap tidak lengkap. “Kami menilai ada indikasi seolah-olah penegak hukum di Kalbar ini ingin lepas tangan dan terindikasi ingin memperlambat kasus ini dengan mengoper-ngoper kasus ini dengan alasan tidak wajar,” katanya. Belum lagi, lanjutnya, kasus yang diduga mengakibatkan kerugian negara hingga Rp22,14 miliar itu melibatkan dua pejabat daerah yang hingga kini masih aktif. Menurut Yunus, saat ini penegak hukum di Kalbar tidak mempunyai ketegasan dalam melakukan tugasnya. “Penegak hukum ini terkesan saling menyalahkan. Sehingga penanganan kasusnya menjadi terbengkalai. Jelas ini terjadi keanehan dan sampai di mana komitmen kejaksaan tinggi untuk menangani kasus korupsi,” katanya. Menanggapi hal itu, Didik Istiyanta, Asisten Pidana Khusus Kejaksaan Tinggi Kalimantan Barat mengungkapkan penanganan kasus tindak pidana korupsi bansos sudah masuk ke tahap P19 atau tahap satu dimana pada tahap tersebut, berkas perkara diperiksa dan diteliti, apakah berkas perkara itu sudah leg-

pemeriksaan terhadap pejabat negara yang diduga terlibat. “Kita pahami kasus bansos menjadi sorotan masyarakat. Namun perlu diketahui, hingga kini perkiraan kerugian negara belum dipastikan. Selain itu, kasus tersebut melibatkan pejabat negara. Sehingga kami harus meminta izin tertulis presiden dengan harus ekspose terlebih dahulu ke Mabes Polri dan Kementerian,” jelas Andi. Ia menambahkan, anggaran turut menjadi kendala tersendiri dalam penanganan kasus korupsi. Sebab untuk penyelesaian satu kasus tersedia anggaran Rp 14 juta, dinilai tidak cukup. Kendati demikian, Kepolisian memiliki komitmen penuh dalam upaya pemberantasan korupsi. Pakar Hukum Tata Penyelenggaraan Daerah, Turiman Faturahman menyatakan ada modus operandi kasus korupsi. Misal, ada sebuah perusahaan memenangkan tender. Ternyata terdapat kerugian negara dalam proses penyelenggaraannya. Kemudian saat digugat ternyata menang dan pemerintah dirugikan. Lantas diajukan ke dewan dan nilai kerugian dianggarkan. “Hukum tidak hidup di ruang hampa namun diantara manusia. Maka penegakan hukum harus humanis, bersikap progresif dengan mengedepankan rasa kemanusiaan,” pungkasnya. (rmn/arf )

lai tidak rata dan tidak layak untuk sebuah pertandingan sekelas divisi utama yang akan dipergunakan oleh Persipon pada Maret ini, sehingga perlu kami lakukan beberapa perbaikan,” ungkap dia. Ditanya mengenai dana yang akan digunakan untuk pendanaan, apakah sharing dengan pihak manajemen Persipon atau tidak. Utin mengatakn, Dispora memiliki dana perawatan sendiri yang memang dianggarkan setiap tahunnya. “Ini bentuk dukungan kita terhadap sepakbola Kalbar. Pemerintah Propinsi Kalbar, melalui Dispora mendukung persiapan yang dilakukan Persipon,

termasuk melakukan perbaikan terhadap homebase yang akan digunakan untuk lokasi pertandingan nanti,” ungkap dia. Sementara itu beberapa insan olahraga mengatakan bahwa kondisi GOR Pangsuma memang perlu diperbaiki. Dalam beberapa kegiatan yang digelar apalagi dalam level nasional, GOR kebanggaan masyarakat masyarakat Kalbar itu dinilai tidak layak. “Jika hujan banyak bocor, WCnya juga tidak layak. Memang sudah harus diperbaiki. Kita ingin GOR kita lebih baik,” harap Joko, salah satu penggiat olahraga Kalbar. (bdi)

Benahi Dua Aset Sambungan dari halaman 9

Jika berkaca pada beberapa daerah, pengelolaan WC dan parkir di kawasan GOR dan stadion diserahkan kepada pihak yang profesional. Sehingga, dana yang masuk lebih jelas dan transparan. “Itu rencana kita dan akan kita koordinasikan dengan pihak KONI segera. Kita ingin kondisi GOR semakin baik dan tertata dengan rapi dengan pengelolaan yang lebih profesional,” harap dia. Sementara itu, ungkap Utin, untuk kawasan Stadion SSA, Dispora dalam waktu dekat juga akan melakukan perbaikan. “Kondisi lapangan dan rumput yang sudah mu-

C

m

gunakan fom, yakni air yang dicampurdenganlarutankimia yang menghasilkan busa untuk menutupsenyawaoksigenyang ditimbulkan api. Klasifikasi berikutnya adalah klasifikasi C, yakni kebakaran yang disebabkan oleh hubungan arus pendek listrik. Mengatisipasinya juga menggunakanfom.Danyangterakhir adalah klasifikasi D, yakni kebakaran yang disebabkan oleh logam. Terjadi titik panas yang mengkibatkan benda logam terbakar. Mengantisipasinya dengan air, untuk mendinginkannya. “Masyarakat harus tau karakter api jika ingin memadamkan api dalam peristiwa kebakaran. Yang penting mereka tidak panik,”tambahnya. Untuk penggunaan alat-alat kelistrikan, Atheng menghimbau agar masyarakat terus memperhatikan Standar Nasional Indonesia, seperti halnya penggunaan kabel dan lampu. Selain itu harus didukung dengan tenaga ahli dalam pemasangannya. (arf)

Upaya Pemulangan

Datangi Kejati Tanya Progres Korupsi Bansos kap atau belum sesuai dengan formil dan materil. “Kalau belum lengkap, diajukan ke pengadilan pun akan sia-sia. Untuk itu, kami minta untuk dilengkapi dulu,” jelasnya. Menurut Didik, dalam kasus itu, satu orang sudah ditetapkan sebagai tersangka dan hari ini (kemarin) merupakan hari terakhir pihak Kejati melakukan penelitian berkas. “Satu orang bernama Iswanto sudah ditetapkan sebagai tersangka. Hari ini kita menentukan sikap, apakah berkas perkara lengkap atau tidak. Mudah-mudahan saja lengkap. Harapan kami begitu,” katanya. Penanganan kasus korupsi melibatkan oknum pejabat negara sulit ditangani. Pasalnya, dibutuhkan rentetan proses penyelidikan yang panjang hingga turunnya surat persetujuan Presiden. Seperti pengusutan kasus dugaan korupsi dana Bansos Provinsi Kalbar yang masih jalan di tempat diduga melibatkan dua anggota DPR asal dapil Kalbar. “Kami juga merasa tidak nyaman dengan kasus ini. Tapi kenyataannya, diperlukan proses panjang yang membutuhkan waktu,” kata Wadir Krimsus Polda Kalbar AKBP Andi Pairan. Menurut dia, proses panjang penanganan yang dilakukan yakni gelar perkara diinternal Polda berlanjut ke Mabes Polri dan di Sekretaris Kabinet. Setelah itu, mesti menunggu turunnya surat Presiden untuk melakukan

sering kali mengakibatkan bencana kebakaran,” katanya. MenurutAtheng,masyarakat diharapkan selalu waspada dalam pemakaian alat yang dapat menimbulkan bencana kebakaran. Dikatakan Atheng, peristiwa kebakaran sangat akrab dengan kehidupan manusia,dimanapenggunaanalatalat seperti alat masak, lampu, kabel, gas atau alat-alat yang bisa menimbulkan kebakaran. “Itu semua adalah sumber api. Untuk itu masyarakat harus waspada,”lanjutnya. Dijelaskan Atheng, ada Empat klasifikasi penyebab kebakaran, diantaranya Klasifikasi A,yangmanapadaklasifikasiini disebabkan oleh benda padat seperti kayu yang mudah terbakar.Untukmengatasikebakaran yang disebabkan oleh media ia, maka cukup dengan air. Selanjutnya klasifikasi B, yakni kebakaran yang disebabkan oleh benda cair, seperti gas atau minyak. Untuk mengatasi kebakaran yang disebabkan oleh klasifikasi B ini harus meng-

pemerintah. “Tetapi jika memanas, pemulangan lebih baik. KecualidiKBRIadatempatyang aman,” ujarnya. Menurut Christiandy, persoalan di Sabah sangat pelik. Melibatkan Kesultanan Sulu dengan Kerajaan Malaysia.

Bahkan dalam konflik tersebut masuk Filipina. “Jadi ini sudah persoalan antarkerajaan. Terkait warga kita, ini antarnegara. Warga kita masih aman. Tidak ada yang perlu dikhawatirkan,” timpalnya. (uni)

Banyak Pelanggan Belum Terlayani Sambungan dari halaman 16

“Selisih tersebut sangat riskan kalau ada salah satu pembangkit kita yang mengalami kerusakan,” ucap Manager PT Perusahaan Listrik Negara Area Pontianak, Pugi Wasi Jatmika. Pembangkit yang kurang kapasitasnya tersebut juga mempengaruhi pelayanan terhadap permohonan pemasangan listrik baru. Disebutkan Pugi, saat ini pihaknya telah menunda pemasangan sambungan listrik ke pelanggan baru sekira 5 Mega Watt. “Kalau diibaratkan pelanggan rumahan, 5 MW itu kira-kirasamadenganlistrikuntuk 5.000 rumah,” tandas dia. Namun, lanjut dia, PLN tetap menerima permohonan pemasangan lsitrik baru, hanya saja lebih selektif. “Tetap kita pasang tapi secara selektif. Kita mengutamakan kepentingan umum terlebih dahulu seperti sekolah, rumah ibadah, rumah sakit, terminal dan pelanggan perumahan yang mendesak. Tapi yang belum tetap akan kami proses sambil menunggu tambahan mesin,” ungkap Pugi. Dia mengungkapkan, pada bulan April mendatang PLN ketambahan PLTD berkemampuan 20 MW. Sementara pada bulan Agustus akan ada PLTD terapung berkekuatan 30 MW dari Sumatera. “Sekarang sedang tahap mobilisasi. Dengan

tambahankekuatanitumudahmudahan masalah teratasi,” katanya. Sementara itu, proyek Pembangkit Listrik Tenaga Uap berskala besar di Tanjung Gundul, Bengkayang dan Jungkat, Kabupaten Pontianak saat ini masih menunggu kepastian pihak kontraktor. “Pihak PLN sudah dorong agar ini cepat dilakukan. Hanya saja kontraktor yang dari Tiongkok yang masih bermasalah. Kemungkinan akhir 2013 baru akan dimulai,” ucap Pugi. Sementara itu, saat ini kemampuan pembangkit PLN tengah mengalami kendala akibat cuaca panas. Pugi Wasi Jatmika mengatakan cuaca panas akhir-akhir ini membuat kemampuan pembangkit PLN menurun. “Ini gejala musim panas. Mesin kita mengalami penurunan kemampuan hingga tinggal 80 persen,” ungkapnya. Di sisi lain, penggunaan listrik oleh pelanggan pada cuaca seperti ini malah meningkat drastis hingga hampir melebihi kemampuan pembangkit PLN. “Cuaca panas memang menaikkan angka pemakaian listrik, misalnya pemakaian AC, kipas angin dan kulkas.  AC dan kulkas itu peralatan yang mengkonsumsi listrik cukup besar. Jadi ini adalah masa-masa dimana kemampuan kami menurun,

sementara permintaan meningkat,” jelas dia. Selain itu, dijelaskan Pugi, PLN kini juga tengah melakukan penggantian Load Break Switch (LBS). Alat seukuran drum ini adalah pemutus jaringan tegangan menengah yang dilakukan secara manual dengan cara memutar stang sehingga pisau yang ada dijaringan terbuka ataupun tertutup, yang tujuannya untuk memutus dan menyambungkan arus listrik. Sejak beberapa hari terakhir ini PLN Pontianak melakukan pemeliharaan LBS. Untuk itu, di beberapa daerah, perlu dilakukan pemutusan aliran listrik sekira 6 jam. “Total ada 40 LBS yang mau kita ganti. Yang kita pasang teknologinya menggunakan remote dari control center. Saat alat baru itu dipasang, mohon maaf padam dulu,” katanya. Rencananya pemeliharaan ini akan tuntas dalam dua minggu ke depan. Pugi mengimbau para pelanggan untuk melakukan penghematan listrik. “Di saat seperti ini penting bagi pelanggan untuk menghemat. Jangan gunakan listrik secara berlebihan pada jam-jam beban puncakyaitupukul18.00hingga 22.00.Kamimohonpengertiannya untuk kelancaran penggunaan listrik yang lebih luas,” pungkas dia. (ars)

mendidik anak lebih disiplin dalam hal membuang sampah pada tempatnya serta mendaur ulang sampah agar lebih bermanfaat. Terkait masalah sampah, Satuan Kerja Pengembangan Penyehatan Lingkungan Pemukiman Kalimantan Barat telah menyediakan bangunan prasarana dan sarana pengolahan sampah terpadu sistem 3R (reduce, recycle, reuse) di Kelurahan Siantan Tengah dan Sanitasi Berbasis Masyarakat (Sanimas) berupa WC Umum dan tempat wudhu di Kelurahan Siantan Hulu Kecamatan Pontianak Utara.

Sanimas, yakni sanitasi berbasis masyarakat berupa MCK, septiktank komunal dan lainnya juga menjadi perhatian Pemkot. “Tahun ini saja Pemkot akan membantu memperbaiki sanitasi atau WC masyarakat bagi seribu rumah,” jelasnya. Pemkot Pontianak mendukung penuh dengan adanya program ini sebagai upaya menjaga kebersihan lingkungan yang melibatkan peran serta masyarakat baik dalam mengelola sampah menjadi sesuatu yang berguna maupun penggunaan sanitasi yang bersih dan sehat.(her)

Bank Sampah Sambungan dari halaman 16

Tak hanya itu, ia pun berharappendidikananakusiadini ikut berperan dalam mendidik anak-anak sejak dini untuk bisa memilah sampah.  “Jadi meskipun PAUD itu gratis tetapi sebagai gantinya dibayar dengan sampah yang sudah dipilah, misalnya bekas botol minuman mineral dan sebagainya. Itu sebagai sumbangan siswa untuk PAUD,” ungkapnya. Dia menilai, inovasi-inovasi seperti itu perlu didukung sebagai upaya menjaga kebersihan lingkungan sekaligus untuk y

k


metropolis

16

Pontianak Post

Kamis 7 Maret 2013

beranda Metro

Upaya Pemulangan JIKA situasi di Sabah terus memanas, Wakil Gubernur Kalimantan Barat, Christiandy Sanjaya menyarankan warga Indonesia di sana dipulangkan. “Jika semakin membahayakan, sebaiknya dipulangkan. Tetapi secara teknis harus melalui Kementerian,” ujar Christiandy seusai membuka Rakor Forum Christiandy Sanjaya SKPD Pemberdayaan Koperasi dan UMKM di Kalbar, Rabu (6/3) di Hotel Orchardz Perdana. Christiandy mengungkapkan hingga saat ini belum mendapat laporan mengenai kondisi warga Kalbar di sana. Tetapi Pemprov Kalbar terus mengikuti kebijakan dan upaya yang dilakukan pemerintah. “Pemerintah pusat sudah melakukan upaya,” kata Christiandy.

BANJIR NANAS Ryan (22) menjual nanas di pinggir Jalan Dr. Wahidin yang diambil langsung dari kebun di Rasau Jaya. Harganya relatif murah kisaran Rp3.000 dan peminatnya pun lebih meningkat dari hari-hari biasanya. MEIDY KHADAFI/PONTIANAKPOST

Ke Halaman 15 kolom 5

perkotaan

Bank Sampah WALI Kota Pontianak Sutarmidji mengharapkan setiap kelurahan di Pontianak memiliki bank sampah. Selama ini sampah kerap menjadi masalah bagi warga kota. Padahal menurutnya jika dikelola dengan baik, sampah bisa memberi banyak manfaat. “Sampah itu bukan hanya sekedar barang yang tidak berguna tetapi boleh dikatakan sampah itu ibarat emas. Jika dikelola bisa menjadi sesuatu yang sangat berguna,” kata Sutarmidji, Rabu (6/3). Sutarmidji mencontohkan, Sutarmidji sampah bisa diubah menjadi kompos, terutama untuk sampah organik. Sementara untuk sampah anorganik, seperti plastik, bisa didaur ulang menjadi berbagai barang berguna. Sutarmidji menyatakan, dirinya telah meminta Dinas Kebersihan dan Pertamanan Kota Pontianak setiap tahun bisa memfasilitasi masyarakat membuat bank sampah. Ke Halaman 15 kolom 5

Koperasi Masuk Daftar Terbesar PONTIANAK - Sebanyak 16 koperasi di Kalimantan Barat masuk dalam daftar 100 koperasi terbesar di Indonesia. Kepala Dinas Koperasi dan UMKM Kalbar Ignatius IK mengatakan dari jumlah tersebut, satu koperasi berada pada posisi dua terbesar secara nasional. “Koperasi Lantang Tipo berada pada urutan kedua dari 100 koperasi terbesar di Indonesia,” ujar Ignatius seusai pembukaan Rakor Forum SKPD Pemberdayaan Koperasi dan UMKM di Kalbar, Rabu (6/3) di Hotel Orchardz Perdana. Ignatius menuturkan di Kalbar terdapat sekitar empat ribu koperasi dan lebih dari 70 ribu Usaha Mikro Kecil Menengah. Dari total koperasi yang ada, sekitar seribu koperasi bermasalah. Beberapa masalah yang dihadapi yakni keberadaan pengurus yang sulit dilacak, hanya ada plang nama, maupun administrasi.

Menurut Ignatius, Pemerintah Provinsi Kalbar melalui instansinya berupaya membantu menyelesaikan per masala han koperasi yang ada. Saat ini direkrut sebanyak tujuh konsultan untuk melakukan pendampingan terhadap koperasi dan UMKM. Satu konsultan mendampingi 20 UMKM dan dua koperasi. “Untuk usaha mikro, database sulit diperoleh karena mereka tidak terdaftar. Total asetnya kurang dari Rp50 juta. Ini yang menyulitkan kami dalam hal pembinaan. Usaha mikro ini cepat muncul, mudah tenggelam juga,” katanya. Wakil Gubernur Kalbar Christiandy Sanjaya mengatakan pemerintah mengadakan berbagai program dan kegiatan untuk pemberdayaan koperasi maupun UMKM. Pembinaan juga terus dilakukan agar dapat menghasilkan wira usaha baru yang profesional, sehingga

mampu menyerap tenaga kerja yang potensial. “Memang disadari koperasi di Kalbar ini masih memiliki keterbatasan dengan berbagai permasalahan kelembagaan, usaha, maupun permodalan. Hal ini membatasi ruang gerak koperasi dan UMKM,” ungkap Christiandy, kemarin. Tetapi, lanjut Christiandy, berdasarkan pertemuannya dengan Bank Indonesia beberapa waktu lalu dinyatakan kredit macet UMKM maupun koperasi rendah. “Hal ini berarti bagus. Harusnya perbankan bisa lebih menyalurkan dananya,” katanya. Christiandy mengungkapkan hanya saja saat ini banyak pemerintah kabupaten dan kota yang menempatkan koperasi bersama dinas lainnya, sehingga diurus oleh eselon tiga. “Kalau dinas, jalur koordinasi lebih baik. Bisa langsung fokus,” timpalnya. (uni)

Banyak Pelanggan Belum Terlayani PONTIANAK–PTPerusahaanListrikNegara(Persero) Area Pontianak saat ini mengalami kendala dengan kemampuan pembangkitnya. Kemampuan pembangkit listrik di Jaringan Khatulistiwa hanya sekitar 213 Mega Watt. Sementara beban puncak pelanggan mencapai 203 MW. Ke Halaman 15 kolom 5

Ke Halaman 15 kolom 5

c

M

y

K


Kamis 7 Maret 2013

pro-kalbar Pontianak Post

Pencurian

KEPOLISIAN Resor Sanggau mengaku baru menerima laporan dari Kepala Dinas Energi Sumber Daya Alam dan Mineral (ESDM) Kabupaten Sanggau, Christian Antonius yang juga selaku korban dalam kasus pembobolan mobil dinas (mobdin) miliknya, Selasa (06/03) kemarin. “ Ke m a r i n b a r u terima laporan,” kata Kapolres Sanggau, AKBP Winarto melalui Winarto Kasat Reskrim Polres Sanggau, AKP Husni Ramli kepada wartawan, Rabu (06/03) via seluler. Setelah memperoleh laporan dari korban, pihak kepolisian langsung menindaklanjutinya dengan melakukan upaya penyidikan. Namun begitu, kata Ramli, hingga saat ini kepolisian belum menemukan jejak pelaku lebih lanjut. Bahkan ciri-ciri dari pelaku pembobol sendiri belum dapat terungkap. “Belum ada, masih lidik,” katanya. Sebelumnya, mobdin bernopol KB5957D

Pengisian BBM

ISTIMEWA

ANTRE: Antrean panjang di SPBU. Ada yang gunakan tanki siluman.

Tolak Tangki Siluman KEPALA Dinas Perhubungan Kabupaten Sintang Hatta berharap antrian panjang yang kerap terjadi di Stasiun Pengisian Bahan Bakar Umum (SPBU) dapat diatur dengan baik. Pasalnya tidak jarang Antrean tersebut mengganggu aktifitas pengguna jalan. “Ini Jelas sangat mengganggu. Karena itu perlu adanya ketegasan pemilik SPBU untuk mengatur jam pengisian BBM,” kata Hatta ketika di ruang kerjanya Rabu (6/3).Aturan yang dimaksud menurut Hatta salah satunya memberikan waktu khusus untuk kendaraan ekpedisi. “Coba kalau diberi waktu. Pagi untuk umum. sedangkan sore untuk ekpedisi. Pasti tidak Ke Halaman 27 kolom 5

HGK PKK

SUTAMI/PONTIANAKPOST

Partai Diperbolehkan Kampanye SINGKAWANG-Meski partai massa, sejak tiga hari setelah ditetappolitik yang dinyatakan lolos oleh kan sebagai peserta Pemilu 2014. KPU untuk mengikuti Hal ini sesuai dengan pemilu legislatif dan UU Nomor 18/2012 dan pemilu presiden pada Peraturan KPU Nomor tahun 2014, sudah 1 Nomor 2013 tentang diperbolehkan melakupedoman pelaksanaan kan kampanye. Namun kampanye. tetap harus memperha“Sejak mereka tikan ketentuan dalam ditetapkan, tiga hari melakukan kampanye. ditetapkan sebagai peKetentuan itu, berserta pemilu khususnya, dasarkan undang-unpartai yang dinyatakan dang dan peraturan bisa melakukan kamKo m i s i P e m i l i h a n panye, terkecuali dalam Umum (KPU). Dimana bentuk rapat umum dan Solling parpol peserta pemilu kampanye menggunasudah bisa melakukan kampanye, kan media eletronik atau iklan,” selain rapat umum dan iklan media jelas Ketua KPU Kota Singkawang,

Solling, kemarin. Menurutnya bentuk kampanye yang bisa dilakukan misalnya, dalam pertemuan terbatas, tatap muka, pemasangan baliho, spanduk maupun kampanye dalam bentuk sticker. Meski demikian, KPU sendiri masin menunggu peraturan daerah mengenai pemasangan alat peraga kampanye, seperti baliho, spandul dan umbul-umbul. “Inipun juga menunggu peraturan dari pemerintah daerah tentang pemasangan alat peraga kampanye dan tidak boleh sembarang. Karena seperti terjadi di Kota Pontianak, kami melihat foto salah Ke Halaman 27 kolom 1

9 Mobil Boks Ditahan

MENGGAIRAHKAN dan mensukseskan Program Pokok PKK (Pemberdayaan dan Kesejahteraan Keluarga) di Kabupaten Sanggau, maka Tim Penggerak (TP PKK) Kabupaten Sanggau akan menyelenggarakan berbagai lomba. Diantaranya, lomba administrasi PKK, l o mba Ke lo mp o k Dasa Wisma, lomba Kader Posyandu (Pos Pelayanan Terpadu), lomba Hatinya (HalaArita Paolus Hadi man Teratur Indah dan Nyaman), PKK, dan lomba Pembinaan BKB (Bina Keluarga Balita). Wakil Ketua TP PKK Kabupaten Sanggau, Ny Arita Paolus Hadi menyampaikan, bahwa kegiatan ini juga diselenggarakan dalam rangka peringatan HKG (Hari Kesatuan Gerak)

kegiatan pramuka/kemah dan pulang besok sore. Ternyata saat di crosscek ke sekolah karena tidak ada kabar, ternyata di sekolah tidak ada kegiatan pramuka,” ungkap Budi Hartono kepada Pontianak Post. Setelah mengetahui anaknya tidak ada di sekolah dan tanpa kabar, pihak keluarga melaporkan ke Polsek atas kejadian tersebut. Pelaku dan korban diketahui sempat Ke Halaman 27 kolom 1

Ke Halaman 27 kolom 1

ENTIKONG - Selasa (5/3) pukul 16.00 WIB lalu, Polsek Entikong, mengamankan sembilan unit mobil boks dalam operasi rutin di jalur darat lintas Malindo. “Sembilan unit mobil boks tersebut membawa muatan ikan, minuman dan makanan ringan. Dan semuanya tanpa dilengkapi dokumen yang semestinya,” ungkap Kapolsek Entikong, Kompol Aries Aminulla Sik, Rabu (6/3)

Ke Halaman 27 kolom 5

BIDIK

PEMERIKSAAN: Deretan mobil box ketika dilakukan pemeriksaan di Jalur Lintas Malindo Entikong, kemarin. Agus Alfian

Bawa Kabur Gadis ke Surabaya SANGGAU--Seorang pemuda berinisial Va (21) diamankan kepolisian Sektor Kembayan karena dilaporkan telah membawa lari seorang gadis berinisial Wh (17). Kejadian tersebut terjadi pada 26 Februari 2013 lalu dan pelaku berhasil diamankan setelah pihak Polsek Kembayan berkoordinasi dengan kepolisian pelabuhan Surabaya. Kapolsek Kembayan, Iptu Budi Hartono, Selasa (5/3) malam menyampaikan bahwa pihaknya

menindaklanjuti aduan dengan nomor Lp/62/II/2013/Kalbar/Res Sgu/Sek Kby, tanggal 28 Februari 2013. Va dikabarkan melarikan anak di bawah umur tanpa persetujuan orang tua atau wali. Korban masih berstatus pelajar di salah satu sekolah di Kembayan. “Kejadiannya tanggal 26 Februari 2012 sekira pukul 06.30 WIB, korban pamit kepada ibunya ke sekolah dan memberitahukan bahwa ia tidak pulang karena ada

Kelompok Tani Pamule Memilih Usaha Kolam Terpal

Setor Rp150 Ribu Buat Beli Terpal Cukup banyak cara budidaya lele. Ada yang menggunakan tambak atau kolam. Ada yang mengembangbiakkannya di bak, tetapi ada pula yang kini tengah dikembangkan, yakni beternak lele menggunakan kolam terpal. Heri Irawan, Jelimpo

ISTIMEWA

KELAPA MUDA: Ketika cuaca panas dan terik, buah kelapa muda menjadi pilihan menghilangkan dahaga. Dipastikan, saat panas menyengat, kelapa muda pun laris manis.

PU Provinsi Kerjakan Jalan Kabupaten SINTANG – Tanpa ada koordinasi dengan Dinas PU Kabupaten Sintang, Dinas PU Provinsi Kalbar bagian Cipta Karya mengerjakan pembangunan Jalan Dara Juanti, Kelurahan Kapuas Kiri Hulu Sintang yang berstatus jalan kabupaten. Salah satu tokoh pemuda Kelurahan Kapuas Kiri Hulu (KKU) Sintang, Morjiri mengungkapkan, masyarakat KKI sangat mempertanyakan masuknya Cipta Karya Dinas PU Kalbar yang tiba-tiba mengerjakan pembangunan Jalan Dara Juanti. “Padahal yang kami tahu jalan tersebut statusnya jalan kabupaten,” ujarnya. Dia menegaskan pada prinsipnya masyarakat KKU tidak menolak adanya pembangunan yang masuk. Hanya saja persoalannya, jika Jalan Dara Juanti yang statusnya sebagai jalan kabupaten dikerjakan oleh Cipta Karya Dinas PU Kalbar maka status jalan tersebut menjadi jalan lingkungan. “Status jalan Dara Juanti menjadi turun padahal kami maunya status jalan tersebut ditingkatkan. Harusnya pembangunan jalan tersebut dikerjakan Bina Marga Dinas PU Kabupaten Sintang. Karena jalan ini kewenangan kabupaten,” tegasnya. Morjiri mengungkapkan ketika pihaknya mencoba menanyakan masalah pembangunan tersebut pada Dinas PU Kabupaten Sintang ternyata Dinas PU Kabupaten Sintang juga tidak mengetahui adanya pembangunan di ruas jalan tersebut. Artinya, dalam melakukan pembangunan Jalan Dara Juanti, Dinas PU Provinsi Kalbar tidak berkoordinasi dengan Dinas PU Kabupaten Sintang. Ia mengatakan masyarakat memang diuntungkan dengan masuknya Cipta Karya Dinas PU Kalbar mengerjakan pembangunan jalan tersebut. Tapi untuk tahun ini saja. Untuk tahun-tahun ke depan, bagaimana dengan pemeliharaan jalan tersebut. Tidak mungkin lagi Dinas PU Kabupaten Sintang akan menganggarkan pemeliharan jalan tersebut karena status Jalan Dara Juanti ini menjadi jalan lingkungan yang sudah dikerjakan oleh Dinas PU Kalbar. “Ketika jalan ini dikerjakan Cipta Marga Provinsi tanpa berkoordinasi dengan Dinas PU Kabupaten Sintang, nanti siapa yang akan

Ke Halaman 27 kolom 1

Gelar Berbagai Lomba

17

BAHAYA: Tiang listrik bisa tegak dengan bertahan di sisa tanah galian yang semula perbukitan di jalan Kelam-Kapuas Hulu. Kondisi itu bisa membahayakan apalagi jika sampai longsor.

Bongkar Mobil Kadis

Ke Halaman 27 kolom 1

3

HAL inilah yang dibincangkan dalam rapat yang di laksanakan Selasa (5/3), sore dari kelompok Tani Pamule. Kelompok tani yang beranggotakan sekitar 28 orang tersebut melalui suara terbanyak sudah memilih usaha di sektor pengembangan kolam terpal dari dua usulan yakni kolam biasa yang juga ditawarkan dalam forum tersebut. Ketua Kelompok Tani (keltan) Pamule,

ISTIMEWA

PANEN: Kelompok tani kolam terpal sedang memanen lele yang berhasil dibudidayakan. Akan lebih menguntungkan disbanding tambah dan lainnya.

c

M

y

K

Dogo Nurman, mengatakan pemilihan usaha yang harus dijalankan oleh kelompok tersebut juga harus dilakukan melalui rapat kelompok sehingga dapat di ketahui potensi mana yang akan di kembangkan. “Sebenarnya kelompok ini sudah lama ada, hanya memang sempat terhenti beberapa waktu lalu sehingga kita kembali memilih ketua kembali, “ akunya. Dikatakannya, dengan antusiasnya semangat kelompok tersebut untuk mengembangkan usaha di sektor perikanan kolam terpal. Selain itu dalam rapat yang di hadiri oleh Heri irawan, selaku fasilitator tersebut juga di hadiri oleh semua anggota kelompok Tani Pamule juga hadir masyarakat lainnya di Wisma TK Makedonia Tubang Raeng. “Keinginan kelompokkan tidak harus menunggu bantuan. Tapi kita harus memulai dengan usaha swadaya kelompok bersama,” katanya. Dari kesepakatan bersama itu, diputuskan, mengumpulkan dana sesama anggota untuk Ke Halaman 27 kolom 1


KUBU RAYA

18 EVENT

Pagelaran Seni Budaya PEMERINTAH KabupatenKubuRayaterus berupaya melakukan pelestarian budaya. Salah satunya dengan menggelar seni budaya yang akan dilaksanakan, pada 6 sampai dengan 7 Maret mendatang. Kepala Bidang Kebudayaan Dinas Budaya Pariwisata Pemuda dan Olahraga Kabupaten Kubu Raya, Busri Ismail mengatakan pagelaran seni budaya tersebut digelar bekerjasama dengan Dewan Kesenian Pemkab KubuRaya.Rencanyapagelarantersebutakan diikutisemuabudayayangada,sepertibudaya Melayu, Dayak, Tionghoa, Bugis, Banjar, Jawa dan budaya-budaya dari etnis lainnya. Dia menuturkan budaya di Kabupaten Kubu Raya semakin hari terus berkambang. Akan tetapi budaya yang ada masih bersifat lokal dan tidak pernah terjamah oleh media. Padahal jika budaya lokal yang ada terpublikasikan, akan banyak potensi-potensi budayakitayangbermunculan,sehinggabisadijual menjadi industri seni yang menguntungkan bagi daerah. “Kita berharap dengan adanya kegiatan ini mampu mempromosikan seni budaya kita,” katanya, Rabu (6/3). Busri Ismail yang juga menjabat sebagai Ketua Umum Dewan Kesenian Kabupaten Kubu Raya mengungkapkan pelaksanaan pagelaransenibudayatersebutpadadasarnya bertujuan untuk membangkitkan kembali semangat mencitai seni budaya lokal dan memberikan informasi kepada masyarakat umum bahwa seni budaya kita tidak kalah saing dengan budaya-budaya yang ada di daerag lain. Selain menumbuhkembangkan semangat mencintai seni budaya kepada masyarakat, dari kegiatan ini peserta juga diharapkan dapat menjadi manajer seni dan budaya,” harapnya. Selain itu lanjut dia dukungan yang diberikanPemkabKubuRayacukupbaikkhususnya pada anggaran yang disediakan. Meskipun anggaranyangdiperuntukantidakterlalubanyak, pemerintah tetap memberikan motivasi agar kegiatan ini dapat berjalan sukses. Itu terbukti seniman-seniman Kabupaten Kubu Raya masih mampu bersaing dengan daerahdaerahlainhalitu terbuktiduatahunyanglalu, senimanKubuRayamenjuaraifestivalbudaya khatulistiwa Kalbar dan juara umum nasional di tari dan budaya daerah. (adg)

FOTO DOKUMEN

PAWAI BUDAYA: Berbagai budaya mengikuti kegiatan pawai budaya beberapa waktu lalu.

Pontianak Post

Kamis

7 Maret 2013

Polresta Siap Amankan Pilkada

ADONG EKO/ PONTIANAK POST

TERBENGKALAI: Satu dari sekian banyak papan reklame yang ada di Kabupaten Kubu Raya terbengkalai. Dikhawatirkan dapat membahayakan pengguna jalan jika tidak dirawat karena mulai terlihat keropos..

Papan Reklame Tak Terawat SUNGAI RAYA-Papan reklame yang berada di beberapa titik, yakni Jalan SoekarnoHatta, Adisucipto Kabupaten Kubu Raya tampak tak terawat. Selain tidak berisi reklame , kondisinyapun memprihatinkan, seperti konstruksi besi berkarat dan tidak memiliki dinding, sehinga dikhawatirkan sudah tidak layak. Kondisi tersebut selain merusak pemandangan kota, juga dikhawatirkan dapat menimbulkan hal-hal yang tidak diinginkan, seperti robohnya kontruksi papan reklame yang saban hari terus keropos. Kepala Dinas Pendapatan, Pengelolaan Keuangan dan Aset Daerah (DPPKAD) Kabupaten Kubu Raya, Yusran Anizam mengatakan pada dasarnya papan-papan reklame yang tampak terbengkalai tersebut bukanlan milik Pemkab Kubu Raya melainkan milik perusahaan swasta. “Kami hanya memberikan izin dengan sistem kontrak per tahun. Jadi yang bertanggungjawab dengan papan reklame itu adalah pihak perusahaan, apakah akan me-

makainya atau tidak,” katanya, Rabu (6/3). Dia menjelaskan, meski papan reklame tersebut milik perusahaan swasta, bebera waktu lalu pihaknya telah menyurati enam perusahan, agar segera menggunakan papan reklame yang ada. “Kami sudah melakukan pemantauan terkait kondisi papan reklame memang tidak dipungkiri banyak papan reklame yang terbengkalai,” ucapnya. Dia menjelaskan, pada dasarnya instansi yang bertanggungjawab untuk melakukan pengawasan adalah dinas teknis dalam hal ini adalah Dinas Cipta Karya, Tata Ruang, dan Kebersihan. Selama ini tidak dipungkiri kontribusi pajak reklame pada pendapatan asli daerah cukup tinggi, dimana per tahun bisa mencapai ratusan juta rupiah. Sementara itu, Kepala Dinas Cipta Karya, Tata Ruang, dan Kebersihan Kabupaten Kubu Raya, Rusnaldi mengatakan pengawasan papan reklame tersebut memang menjadi tanggungjawab pihaknya. Namun seperti yang diketahui, bahwa papan re-

klame tersebut memiliki batas waktu sesuai kontrak yang dilakukan pihak perusahaan dengan Pemkab. Terkait apakah kontruksi papan reklame layak atau tidak, lanjut dia yang harus dilakukan terlebih dahulu adalah melakukan pengecekan. Jika memang ditemukan konturksi papan reklame yang sudah tidak layak, maka mau tidak mau harus dirobohkan ketimbang menelan korban jiwa dalam hal ini masyarakat. Apalagi menurutnya, jika papan reklame sudah tidak layak dan masa kontraknya dengan Pemkab sudah berakhir maka pihaknya tidak segan untuk menertibkannya. Dari pada dibiarkan tanpa ada kejelasan dan malah menelan korban, seperti pengguna jalan. “Kita akan coba berkoordinasi dengan instansi terkait untuk mendata masa kontrak papan reklame itu. Jika memang ada yang sudah tidak layak dan masa kontraknya habis, maka akan kita tertibkan,” terangnya. (adg)

SUNGAI RAYA-Tidak dapat dipungkiri pada saat pelaksanaan pemilihan kepala daerah (Pilkada) yang diselenggarakan di sejumlah daerah menjadi rawan kriminalitas. Kapolresta Pontianak, AKBP Harianta menyatakan siap mengamankan Pilkada bupati dan wakil bupati Kabupaten Kubu Raya yang akan dilaksanakan pada September mendatang. Dengan mengerahkan 2/3 dari jumlah kekuatan yang ada. “Kita juga akan minta bantuan anggota yang berada di BKO kan dari Brimob Polda, Sabhara termasuk dari TNI,” katanya, setelah menerima tahapan pemilukada dari KPU Kabupaten Kubu Raya kemarin pagi di Mapolresta Pontianak.. Kapolresta menuturkan, pola pengamanan yang diterapkan nantinya akan menyesuaikan dengan tahapan-tahapan pilkada tersebut, misalnya, tahapan untuk pendaftaran maka pengamanannya berbeda dengan tahapan kampanye. Begitu pula tahapan pencoblosan, pengamanannya akan berbeda dengan tahapan penghitungan suara. Penyesuaian pengamanan dengan tahapan Pilkada itu, lanjut dia karena setiap tahapan memiliki eskalasi ancamannya yang berbeda. Setiap tahapan ada rawan satu, rawan dua, rawan tiga dan seterusnya. Sehingga pelaksanaan Pilkada yang akan dilaksanakan dapat berjalan dengan aman dan lancar. Sementara itu Ketua KPU Kabupaten Kubu Raya, Idris Maheru mengatakan bahwa wilayah hukum di Kabupaten Kubu Raya terbagi dua. Empat kecamatan antara lain Teluk Pakedai, Kubu, Batu Ampar, dan Terentang dibawah wilayah hukum Polres Pontianak (Mempawah). Sedangkan lima kecamatan lainnya yaitu Sui Raya, Sui Ambawang, Kuala Mandor, Rasau Jaya dan Sui Kakap dibawah wilayah hukum Polresta Pontianak. Pada dasarnya, lanjut dia penyerahan tahapan Pilkada ke pihak kepolisian tersebut adalah untuk meminta bantuan pengamanan. Sehingga pelaksanaan Pilkada Kabupaten Kubu Raya akan berjalan aman dan lancar. Menurutnya, yang terpenting dalam pengamanan Pilkada, seperti pelaksanaan kampanye pemilukada yang kerap melibatkan massa ramai. Kemudian distribusi logistik mengingat kondisi geografis Kabupaten Kubu Raya wilayah perairan dan daerah yang sulit terjangkau, seperti di Kecamatan Sui Raya, Desa Gunung Tamang, serta beberapa desa lainnya. Sehingga diperlukan pengamanan khusus untuk mengawal logistik sampai di tujuan. “Pengaman ini sangat penting agar tidak terjadi hal-hal yang tidak diinginkan,” katanya. (adg)


Pontianak Post

Kamis

PINYUH

7 Maret 2013

FORKORPIMDA

Sosok yang Dekat WAKIL Bupati Drs H Rubijanto, merupakan sosok pejabat yang dekat dengan Forum Koordinator Pimpinan Daerah (Forkorpimda). Kedekatan itu kadang terlihat dalam kegiatan sosial kemasyarakatan maupun olahraga seperti sepeda misalnya. Hal seperti itu, dalam rangka menjalin tali silaturahmi dan keakraban sesama pejabat di Kabupaten Mempawah. Kesederhanaan dan low profil Rubijanto memang tidak perlu diragukan lagi. Konon menur ut orang-orang dekatnya, hal itu yang membuat kedekaH Rubijanto tan dengan Forkorpimda itu berjalan baik. “Pak Wakil itu sudah beberapa kali saya lihat makan bersama Kajari, Kapolres, Waka Polres serta Dandim 1201 Mph,” nilai Umar warga Kelurahan Pasir Wan Salim, lantaran hobby Wakil Bupati adalah makan ikan pedas di warungnya Pak Wahab. Menurut orang dekat Wakil Bupati, disebabkan tidak ada agenda yang mendasar, sehingga masuk pada waktu istirahat jam makan siang, beliau mengajak kawan-kawannya itu untuk makan bersama. “Kalau pimpinan makan otomatis, kami supir dan ajudan juga ikut makan bersama,” kata salh satu supir Forkorpimda santai. Hal semacam itu memang sering terjadi, tak hanya oleh Wakil Bupati. Tetapi juga forkorpimda lainnya saling mengajak makan bersama. Sebab, mereka memang menyukai makanan ikan pedas, masakan pak Wahab. “Makan di Kuala ini, hanya bisa siang. Kalau sore tidak buka ,” aku mereka. (ham)

19

KPU Proses Caleg

HAMDAN PONTIANAKPOST

PERDA: Pimpinan paripurna H Rusli Abdullah menyerahkan Perda tentang Keterbukaan Informasi Publik (KIP) setelah mendapat persetujuan dari smua fraksi DPRD.

Semua Fraksi Setujui Raperda KIP MEMPAWAH- Lima Fraksi DPRD Mempawha akhirnya menyetujui Rancangan Peraturan Daerah (Raperda) tentang Keterbukaan Informasi Publik (KIP) dalam pendapat akhir (PA) fraksifraksi- kemarin. Pada rapat paripurna itu, hanya satu unsur pimpinan DPRD yang hadir yakni H Rusli Abdullah M.Si. Pasalnya Ketua DPRD Rahmad Satria sedang ada tugas di DPP Golkar pusat. Wakil Ketua H Amin HAM izin menunaikan umroh. Sementara Sabli

Awaludin berhalangan hadir. Sementara dari eksekutif tampak hadir Sekda bersama para asisten, staf ahli dan Pimpina SKPD. Norsan mengatakan infiormasi atas jalannya roda pemerintahan bagi warga Negara adalah bagian tak terpisahkan dari sistim demokrasi itu sendiri. “Apabila dikaji secara mendalam, maka sesungguhnya hak atas informasi merupakan entry point atas pemenuhan hak-hak asasilainnya,baikhak-hak bidangekonomi sosial budaya, maupun hak bidang sipil

dan politik, ” kata dia saat memberikan sambutan seusai Raperda itu disetujui semua fraksi menjadi Perda no 3 tahun 2013 tanggal 5 Maret 2013. Keterbuka informasi dari seluruh badan publik lanjut Bupati akan menghasilkan suatu elemen yang mengantarkan pada kematangan demokrasi, dimana warga Negara dapat berpartisipasi pada pemerintahandalamrangkamewujudkan tata kelola pemerintahan yang baik (good Gavernance). (ham)

Baliho di Halaman Kantor Pemerintah MEMPAWAH- Penetapan pemilu legislatif KabupatenMempawah,membuatfigurbalon Kada bergerak cepat melakukan sosialisasi dengan beragam kegiatan. Satu diantaranya adalah pemasangan baliho dibanyak lokasi yang dinilai strategis. Halitudimaksudkan,agarbalonKadayang lain tidak kebagian tempat strategis dalam memasang baliho mereka. Namun sangat disayangkan, dalam pemasangan baliho raksasa oleh tim dilapangan kurang memahami tempat-tempat yang boleh dan yang tidak dibolehkan untuk dipasang baliho. Kini muncul lagi pemasangan baliho raksasa dihalaman kantor Kelurahan Anjongan Melancar. Padahal, seperti diketahui, lokasi perkantoran tidak dibenarkan untuk

dipasang. “Kami minta panitia pengawas Pemilu (panwaslu) secepatnya membuat larangan bagi balon kada dalam hal pemasangan baliho,” pinta Murdian, warga setempat. Disisi lain, balon kada hendaknya memberikan pandangan kepada tim-tim dilapangan, untuk memperhatikan prihal larangan. Sebagai warga yang punya hak pilih, dia pribadi merasa prihatin. “Jikaberkali-kaliterjadi,tentuakanmenimbulkan imaj yang kurang baik,” sorotnya. Terlebih pula, hingga kini belum ada baliho balon kada yang lain memasang ditempattempat seperti difasilitas umum maupun dilingkungan kantor pemerintah serta tempattempat ibadah. Terkait genderang KPU yang

sudah ditabuhkan, hingga kini dipastikan sudah empat Balon kada yang dimungkinkan maju dalam perhelatan pesta demokrasi yang akan digelar serentak di sembilan kecamatan di Kabupaten Mempawah pada 19 September 2013.Namun begitu, hasil pantauan koran ini dilapangan, selain Golkar, PDIP, Demokrat dan Hanura yang sudah membuka proses penjaringan Balon kada. Selebih seperti PPP baru mulai penerimaan pendaftaran tanggal 6 hingga 21 Maret. “Kami memang baru mulai menerima pendaftaran balon kada hari rabu (6/3), “aku Basri Ketua DPC PPP Kabupaten Mempawah menjawab konfirmasi koran ini usai paripurna tentang RaperdaKeterbukaanInformasiPublik (KIP)padapenyampaianpendapatakhirfraksi-

fraksi. Sedangkan Darwis Sanjaya, ketua DPC PBRmengakubelummembukaprosespendaftaran. Dilangan sempat mencuat rumor, yang menyebutkan, salah satu mantan Bupati Mempawah akan kembali bersaing dalam Pemilu Kada 2013 ini. Karena kuat dugaan akan diusung salah satu parpol sebagai orang nomor satu. Selanjutnya bidikan sebagai pendampingadalahfiguryangmasihmenjadi dambaan pemilih di Kabupaten Mempawah. Munculnya rumor itupun sempat membuat analisis kekuatan peta politik yang bergerak sepertinya bakal mengalami perubahan. “Bisa terjadi, mantan Bupati mencalonkan diri lagi. Mengambil wakilnya adalah orang yang dinilai bisa diajak bekerjasama,” nilai Mardia lagi. (ham)

MEMPAWAH- Sejak memasuki Maret 2013, semua pimpinan partai politik di tanah air, termasuk pula yang ada di Kabupaten Mempawah, mulai menjaring figur calon anggota legislatif (caleg) untuk Pemilu 2014. Munir Putra ST MT, Ketua KPU Mempawah mengakui, saat ini pihaknya sednag melaksanakan dua agenda sekaligus. “Selain mulai proses Pemilu kada, juga ada agenda lain yakni proses penjaringan caleg parpol 2014,” katanya menjawab konfirmasi koran ini. Saat ini proses penjaringan caleg sudah dilaksanakan ditingkat pimpinan parpol. Sebab, tanggap 9 April 2013, semua caleg sudah mulai didaftarkan untuk penentuan masuk dalam daftar calon sementara (DCS). Sedangkan untuk daftar calon tetap (DCT) akan ditetapkan pada 4 Agustus 2013. Terkait besarnya kemungkinan mereka yang saat ini ma s i h d u d u k d i DPRD, melakukan Munir Putra satu terobosan dengan lompat pagar kepada parpol lain untuk masuk dalam DCS, Munir mengaku hal itu belum ada peraturan bagi mereka yang lompat pagar. “Kan masih ada proses lain yang dapat dilakukan parpol itu sendiri. Terutama untuk memberikan kepada no urut berikutnya, melalui proses pergantian antar waktu (PAW), karena usulan parpol yang tidak lolos verifikasi faktual KPU,” sebutnya. Disinggung kebenaran, adanya aspirasi yang menghendaki daerah pemilihan di Kabupaten Mempawah ditambah dari empat menjadi lima dapil serta melakukan perubahan. Munir saat mendengar pertanyaan itu kembali meluruskan, kalau awalnya KPU memang menghendaki empat dapil dengan komposisi masing-masing dapil Jungkat-Segedong dengan 8 kursi, dapil dua Pinyuh-Anjongan 8 kursi, dapil tiga Mempawah Hilir dan Mempawah Timru juga dengan 8 kursi serta dapil empat Toho, Sadaniang dan Sui Kunyit dengan 6 kursi. Pasalnya, untuk pemilu legislatif 2014, jumlah kursi pada DPRD Mempawah yang semula berjumlah 45 kursi tersisa 30 kursi lantaran adanya pengurangan kouta sebesar 15 kursi. “Pada rapat dengan pimpinan parpol, sempat mencuat aspriasi perubahan dari empat dapil menjadi lima. Dengan komposisi, dapil satu tetap. Dapil dua Pinyuh berdiris endir. Dapil tiga tetap, dapil empat masuk anjongan dan Sui Kunyit berdiri menjadi dapil sendiri. Namun, banyak parpol yang melihat komposisi baru yang diajukan itu dinilai kurang bijak. “Menyangkut komposisi dapil, akan ditetapkan oleh KPU pusat dan keputusan itu akan dikeluarkan pada 9 Maret 2013 ini. (ham)


20 UPT KEBERSIHAN

Tambahan Honorer KEPALA UPT Kebersihan Kota Singkawang, Rustam Efendi mengatakan tahun ini, di intansinya mendapatkan tambahan tenaga honorer sebanyak 15 orang. Direncanakan mulai bulan depan sudah mulai bekerja mengurusi persampahan di kota ini. “Kita sebenarnya mengajukan lebih dari jumlah itu, tapi kita dapatkan 15 tambahan tenaga honorer, jadi untuk total keseluruhan pasukan kuning sebanyak 217 dimana sebelumnya 202 orang,” kata Rustam, Rabu (6/3). Menurut Rustam, adanya penambahan ini bisa membantu menutupi kekurangan tenaga kebersihan atau pasukan kuning yang masih kurang selama ini. Terlebih volume sampah tiap hari selalu ada peningkatan. “Adanya tambahan ini dapat meningkatkan kinerja kami,” katanya.(fah)

SINGKAWANG

Pontianak Post

PERBANKAN di Kota Singkawang dapat memberikan kontribusi yang baik pemerintah setempat dan masyarakat. Wakil Walikota Singkawang kata H Abdul Mutalib SE ME mengatakan perbankan dapat mendorong dan meningkatkan peran masyarakat dalam pembangunan. Ia sendiri mengakui jika pernah merasakan dampak positif dari pendampingan itu, lantaran sebelum menjadi Wakil Wali Kota, dia menekuni dunia usaha, diantaranya sebagai pengusaha jasa angkutan material bangunan dan menekuni usaha perumahan. “Usaha itu saya mulai dengan menggunakan jasa bank, dan akhirnya tumbuh dan berkembang. Dengan bantuan bank, saya bisa berusaha, bahkan dengan usaha itu saya bisa berdiri di depan ibu-bapak sekalian sebagai Wakil Walikota Singkawang,” ungkapnya. (mse)

7 Maret 2013

Minta Anggota Ambil Bagian di JSS Kapolres Siapkan Doorprize

WAKIL WALI KOTA

Pernah Dibantu Bank

Kamis

IST/PONTIANAK POST

DUKUNGAN: Kapolres Singkawang Ajun Komisaris Besar Prianto saat menerima kunjungan Kepala Biro Pontianak Post Singkawang Zulkarnain S Sos serta panitia di ruang kerjanya, kemarin.

SINGKAWANG-Kapolres Singkawang, Ajun Komisaris Besar Prianto mendukung penuh kegiatan Jalan Sehat Spektakuler Pontianak Post yang dilaksanakan 24 Maret

mendatang di Halaman Kantor Wali Kota Singkawang. Bahkan, Kapolres Prianto juga minta kepada anggotanyayangtidakmelaksanakantugasdapat mengikuti kegiatan tersebut. Tak

hanya itu, Prianto yang sudah dua tahun bertugas di Kota Singkawang menyediakan doorprize. “Kegiatan ini sangat positif. Apalagi, hadiah utamanya rumah yang

TO Kedua Kurang Memuaskan SINGKAWANG-Waka Kurikulum SMA Negeri 2 Singkawang, Siti Nurul Fatimah mengungkapkan jika hasil Try Out (TO)

kedua yang dilakukan sekolahnya mengalami penurunan dibandingkan hasil TO pertama kali. “Kita hanya melakukan satu kali TO, dibarengi dengan TO dari dinas. Tapi hasil TO kedua dari dinas kurang memuaskan dari TO yang kita laksanakan pertama kali,” kata Siti Nurul Fatimah, Selasa (5/3) siang. Menurunya pencapaian hasil itu, kata Siti, karena siswa menganggap sepele dengan pelaksanaan TO. Padahal TO itu dilakukan sebagai barometer para siswa dalam mempersiapkan diri untuk menghadapi UN. “Ada siswa yang memang rutin mendapat rangking. Ketika hasil TO pertamanya lumayan baik, tetapi perolehan nilainya malah menurun ketika pada pelaksanaan TO kedua. Ini menjadi pertanyaan, kemungkinan mereka menganggap sepele padahal ini penting,” ungkap Siti. Meskipun demikian, Siti tak menampik jika dari Dinas

Pendidikan sendiri mengakui ada peningkatan nilai TO para siswa. Namun peningkatakan itu jika dilihat secara umum. “Secara umum, dinas memang melihat ada peningkatan. Tapi kami menilai diri sendiri, dengan hasil yang diperoleh kurang memuaskan. Dalam kondisi ini, kepala sekolah paling sedih ketika meliha hasil yang diterima para siswa. Apalagi kita sekolah yang sudah lama berdiri, sementara rangking sekolah kita malah berada di bawah sekolah yang baru muncul,” tuturnya. Untuk itu, lanjut Siti, pihaknya tetap berharap siswa dapat memperoleh hasil terbaik dalam pelaksanaan UAS yang digelar delapan hari ke depan. “UAS sudah dimulai dari kemarin, dan tidak ada TO lagi, kita tetap berharap yang terbaik. Jangan sampai hasil yang mereka peroleh lebih buruk dari TO, karena nilai UAS juga memiliki pengaruh,” pungkasnya. (mse)

disediakan oleh Pontianak Post. Mungkin saja, peserta dari Singkawang yang beruntung. Saya sangat mendukung dan saya siap menyediakan doorprize untuk masyarakat Singkawang yang ikut jalan sehat ini,” kata Prianto, ketika menerima kunjungan Kepala Biro Pontianak Post Singkawang Zulkarnain S Sos, Koordinator Pemasaran Biro Pontianak Post Herly Kusmayadi SE, Reporter RRI Singkawang Ari Satriansyah dan EO Dede Hardi di ruang kerjanya, kemarin. Pria ramah ini menambahkan, sejak dulu selalu mendukung jalan sehat. “Dulu, saya baru bertugas di Kota Singkawang juga ikut meramaikan jalan sehat ini. Sekarang kita juga berpartisipasi,” kata perwira dua melati di pundaknya ini. Selain itu, Prianto juga siap mengerahkan anggotanya untuk mengamankan jalannya jalan sehat tersebut. “Rute-rute yang dilalui akan kita amankan supaya berjalan sukses,” kata Prianto setelah melihat rute yang akan digunakan oleh

panitia JSSP ini. Rute yang akan dilalui, sudah dibuat oleh panitia, yakni start dan finish di Halaman Kantor Wali Kota Singkawang. Setelah dilepas Wali Kota Awang Ishak peserta melintas Jalan Firdaus kemudian berbelok ke kiri menuju Jalan Diponegoro. Peserta kemudian masuk ke Jalan Komyos Soedarso dan berbelok ke kanan memasuki Jalan Masjid. Setelah itu berbelok ke kanan dan masuk ke Jalan Niaga dan masuk ke Jalan Sejahtera dan masuk lagi ke Jalan Diponegoro. Setelah itu, berbelok ke kanan kembali ke Jalan Firdaus dan masuk di halaman pemkot. “Usai itu, barulah pencabutan undian yang disediakan oleh Pontianak Post dan sejumlah donatur. Kepada masyarakat yang belum memiliki tiket, segeralah menghubungi Pontianak Post Biro Singkawang Jalan Gunung Raya nomor 15 Singkawang Barat atau menghubungi 085751449565 (Uddin Alsani),” kata Dede Hardi. (*)

Kota Perlu Pemimpin Gaya Baru SINGKAWANG-Kotainimembutuhkan pemimpin dengan gaya baru, yang tentunya dapat membawa perubahan ke arah yang lebih baik lagi. Selain itu, pemimpin tersebut juga harus merakyat,bukanmalahbertindak seperti raja. Hal ini dikatakan Pemerhati Pemerintahan Kota Singkawang, Dedi Wahyudi kepada Pontianak Post kemarin. Diungkapkannya, sosok figur pemimpin dengan gaya yang baru sangat dirindukan oleh banyak warga kota ini. “Bukan pemimpin yang masih membawa gaya lama. Banyak tingkah yang tidak perlu dilakukan, angkuh, sombong dan bergaya bak raja yang ingin selalu dilayani. Akan tetapi masyarakat kota ini memerlukan gaya kepemimpi-

nan yang sederhana, kemanamanamenggunakanmobilyang biasa saja tanpa pengawalan yang berlebihan. Itulah yang banyak warga kota ini inginkan,” tutur Dedi. Menurut Dedi, pasangan Wali Kota dan Wakil Wali Kota Awang Ishak-Abdul Mutalib hampir berjalan kurang lebih tiga bulan. Namun pertanyaan besar hadir di benak banyak warga kota seribu kelenteng ini. “Apa yang sudah diperbuat oleh pasangan yang menamakan dirinya AIDOL ini. Itu menjadi pertanyaan yang selalu terlontar yang sering kita dengar dan sering didiskusikan oleh banyak warga,” kata Dedi yang terlahir di Kota Singkawang ini. (zrf)

Kemenag Kota Tunggu Instruksi Pusat SINGKAWANG- Rencana pelimpahan pembinaan Guru Bidang Studi Agama dari Keme-

nag ke Kementerian Pendidikan dan Kebudayaan diprediksi tak bakal menimbulkan per-

soalan. Kepala Seksi Madrasah dan Pendidikan Agama (Mapenda) Kantor Kementerian Agama Kota Singkawang Azhari mengutarakan pihaknya masih menunggu keputusan dari pemerintah pusat. “Sebagai orang di daerah kita menunggu saja. Bagi kami, itu tidak masalah, karena secara kepegawaian guru di bawah dinas,namunsecarateknistetap di Kemenag,” kata Azhari. Bahkan mengenai rencana tersebut, dikatakan Azhari, dirinya berpendapat sebaliknya, karena agama tidak otonom. Perludiketahui,selamainiposisi guru agama di sekolah umum (SD, SMP, SMA, dan SMK), institusi tempat bekerja ada di bawah Kementerian Pendidikan dan Kebudayaan (Kemendikbud). Sedangkansecarakepegawaian, mereka ada di bawah Kementerian Agama (Kemenag). Posisi guru agama seperti itu, mulai dari unsur pembinaan, peningkatan karier, hingga penguatan kompetensi membuat sejumlah guru agama yang sulit naik pangkat, karena terbelit birokrasi. Kemendikbud saat ini sedang menggodok ketentuan baru terkait keberadaan guru agama

di sekolah umum. Kementerian yangdipimpinMohammadNuh itu berencana akan mengambil alih wewenang pembinaan dari tangan Kemenag. Paling cepat, upayainimulaidijalankantahun ajaran 2013-2014 nanti. Menanggapi rencana tersebut, pihak Kemenag menyatakan legawa. Direktur Jenderal Pendidikan Islam (Dirjen Pendis) Kemenag Nur Syam mengatakan, tidak jadi persoalan ketika urusan pembinaan guru agama disekolahumumitudiambilalih Kemendikbud. Namun kerelaan tersebut, dirinya tetap menekankan tidak serta merta wewenang pembinaan itu diambil alih seluruhnya oleh Kemendikbud, artinya pengambil alihan wewenang itu sebatas untuk urusan pembinaan karier saja. SikapKemenagyangsiapmenyerahkan urusan pembinaan karier itu, tidak terlepas dari polemik yang muncul saat ini. Di antaranya adalah, peningkatan jenjang karier guru agama di sekolah swasta yang cenderung lama. Sebaliknya, Nur Syam meminta jika untuk pembinaan dan penetapan kompetensi guru agama tetap ada di tangan Kemendikbud. (fah)


Pontianak Post .DPLV0DUHW

5#/$#5



7(5,*$6

Siap Sambut Mendikbud

 +

 +

JIKA tidak ada halangan, Sabtu (9/6) mendatang, bakal menjadi lembaran sejarah baru di bumi yang berjuluk Serambi Makkah ini, bagi seluruh warga Kabupaten Sambas dan Kalimantan Barat umumnya. Terutama, tentu saja keluarga besar civitas akademika Politeknik Terpikat Sambas (Poltesa). Momen paling bersejarah itu adalah akan diresmikannya Politeknik Terpikat Sambas menjadi Politeknik Negeri Sambas oleh Menteri Pendidikan dan Kebudayaan (Mendikbud), Muhammad Nuh. Berdasarkan surat resmi dari Kemendikbud, Nuh dijadwalkan hadir ke Sambas beserta rombongan di lingkungan Kemendikbud. “Acara peresmian pendirian Politeknik Negeri Sambas ini merupakan lanjutan rangkaian tahapan setelah ditandatanganinya Peraturan Menteri Pendidikan dan Kebudayaan RI Nomor 15 Tahun 2013 tentang -XOLDQV\DK Pendirian, Organisasi, dan Tata Kerja Politeknik Negeri Sambas oleh Bapak Mendikbud pada tanggal 22 Februari 2013 lalu,� ungkap pembantu direktur Bidang Hubungan Industri dan Kerjasama Poltesa, Yuliansyah, kepada koran ini, kemarin. Acara ini juga diprediksi bakal dihadiri seribu tamu undangan, yang terdiri dari rombongan Kemendikbud yang dipimpin langsung Mendikbud, Dirjen Dikmen, Sekdirjen Dikti, para direktur di lingkungan Kemendikbud, Anggota DPRI RI Dapil Kalbar dari Komisi X. Acara ini dijadwalkan dimulai pukul 12.00 WIB di Halaman Gedung Poltesa, dikarenakan Mendikbud direncanakan akan berangkat dari Pontianak sekitar pukul 06.30 pagi melalui kendaraan darat. Sedangkan undangan lainnya terdiri dari Gubernur Kalbar, Ketua DPRD Kalbar, para pimpinan perguruan tinggi di Kalbar, Kopertis Wilayah XI, anggota DPRD Kalbar Dapil Sambas, para pimpinan DPRD Kabupaten Sambas, para tokoh perintis awal Poltesa, dunia industri dan usaha, para tokoh masyarakat, para kepala SMA/ SMK, serta keluarga besar civitas akademika Poltesa. “Kami mengajak seluruh warga Sambas untuk bersama-sama mendoakan kesuksesan acara ini, karena ini adalah kebahagiaan kita semua. Dan ini juga merupakan pertama kalinya Mendikbud berkunjung ke Kabupaten Sambas,� jelas figur yang juga seketaris KAHMI Sambas ini. Pihak Poltesa, dikatakan dia, begitu menghaturkan ribuan terima kasih kepada segenap pihak, baik dalam lingkup keluarga besar Poltesa, yang sudah berjibaku mendorong proses penegerian ini, maupun pihak-pihak yang memberikan sumbangsih dalam pembangunan Poltesa secara akademik maupun nonakademik. “Ucapan terima kasih sedalam-dalamnya kepada Ir H Burhanuddin A Rasyid dan Bupati Sambas Hj Juliarti Juhardi Alwi. Karena sejarah nantinya akan mencatat di era kepemimpinan Beliau (Burhanuddin A Rasyid, Red) lah, Politeknik Terpikat Sambas berdiri, dan dilanjutkan kembali perjuangannya oleh Bupati Sambas Periode 2011 – 2016, Hj Juliarti Djuhardi Alwi, yang Alhamdulillah pada periode bupati perempuan pertama di Kalbar inilah, Politeknik terpikat Sambas disetujui menjadi Politeknik Negeri Sambas,� ungkapnya. (har)

 +

+$5,.851,$7+$0$3217,$1$.3267

02%,/'$05,'XDEXDKEXV'DPUL-XUXVDQ6DPEDVÂą3RQWLDQDNGLUHVPLNDQ+DOLQLPHUXSDNDQXSD\D3HPNDE6DPEDVGDODPPHOD\DQLPDV\DUDNDWXQWXN NHQ\DPDQDQGDQNHPXGDKDDQWUDQVSRUWDVLPDVVDOEDJLZDUJDGLNDEXSDWHQLQL

Kini ke Pontianak Bisa Naik Damri Bupati Resmikan Trayek Baru SAMBAS – Bupati Sambas Juliarti Djuhardi Alwi meresmikan trayek baru angkutan antar-kota dalam provinsi bus Damri kelas non-ekonomi Sambas –Pontianak. Peresmian ditandai dengan pemotongan pita yang terpasang di dua armada bus Damri, di Halaman Terminal Sambas, Rabu (6/3). Pemotongan pita disaksikan beberapa anggota DPRD Kabupaten Sambas, Kapolres Sambas, Dandim 1202 Singkawang, Ketua Pengadilan Agama, Sekda Sambas, Kadishub Kominfo Sambas, Danramil Sambas, Perwakilan Perum Damri Pontianak, para tokoh masyarakat Sambas, beberapa pimpinan SKPD, serta undangan lainnya. Dalam sambutannya, Bupati mengapresiasi upaya jajaran Perum Damri yang telah menyediakan layanan

angkutan kepada masyarakat. “Ini sebagai bentuk kepedulian dan keinginan untuk ikut berpartisipasi dalam pembangunan di Kabupaten Sambas,� ujar dia. Usai peresmian, Bupati dan jajaran Forkopinda mencoba armada bus Damri yang akan beroperasi tersebut. Mereka pun langsung berkeliling Kota Sambas dengan menggunakan kendaraan tersebut. Kadishub Kominfo Kabupaten Sambas, Asyir A Bakar, mengatakan dengan tersedianya angkutan dalam provinsi kelas non ekonomi Sambas – Pontianak, merupakan suatu babak baru dalam pelayanan kepada masyarakat di bidang lalu lintas dan angkutan jalan. Sebelumnya, dia mengungkapkan, untuk trayek angkutan antarkota dalam propinsi, Sambas – Pontianak baik pulang maupun pergi, hanya menyediakan kelas ekonomi dan angkutan khusus seperti taksi.

Untuk kelas non ekonomi ini, dijelaskan Asyir, dilengkapi fasilitas pendingin udara, tidak menaikkan atau menurunkan penumpang di jalan, selain pada tempat yang telah ditentukan, kemudian biaya atau tarif angkutan lebih tinggi dari tarif angkutan umum ekonomi, namun lebih rendah dari angkutan khusus taksi. Menurut Kadis, keinginan pihak Damri ini, sebetulnya sudah lama dan sudah disosialisasikan kepada operator atau penyedia jasa lainnya, yakni sejak tahun 2010. “Peresmian trayek ini merupakan suatu kemajuan dan tentunya tidak dapat dilihat dari keinginan Perum Damri, untuk mengembangkan usahanya saja, tetapi seyogyanya harus dilihat dari perspektif bahwa perkembangan pembangunan daerah Kabupaten Sambas, telah memberi ruang kepada pihak swasta, untuk ikut berpartisipasi dalam pembangunan

daerah di Kabupaten Sambas,� papar dia. Dipilihnya Kota Sambas, sebagai kota tempat keberangkatan dan sekaligus tempat tujuan, menurut dia, sudah tentu telah dipertimbangkan dari berbagai aspek. Di antaranya, diungkapkan Kadis, load factor yang tersedia, kemampuan perekonomian masyarakat, dan yang lebih penting adalah prospek ke depan dari pelayanan tersebut. Disebutkan Asyir, dinas yang dipimpinnya telah berupaya memberikan peluang seluasluasnya kepada pengusaha angkutan umum di daerah, untuk mengambil peluang dalam perkembangan lalu lintas angkutan jalan, dengan meningkatkan pelayanan kepada masyarakat pengguna jasa angkutan. “Salah satunya adalah, mereka harus memperbaharui kendaraan yang dimiliki, karena hal itu akan memberikan rasa keamanan keselamatan

ketertiban dan kelancaran berlalu lintas, di mana sekarang kecenderungan peningkatan masyarakat pengguna jasa, untuk mempergunakan kendaraan angkutan umum biasa atau kelas non-ekonomi. Salah satu faktornya adalah pengguna jasa sudah begitu memahami pentingnya keselamatan, kenyamanan, serta ketepatan waktu dalam perjalanan dari dan ketempat tujuan,� tegas dia. Kadis berharap agar kehadiran trayek baru ini memberikan tambahan alternatif pilihan kepada masyarakat pengguna jasa angkutan darat dan lalu lintas, dalam menentukan angkutan yang dipilihnya. (har)

 +


22

sanggau

Pontianak Post

Tertibkan Gerobak

pemerintahan

SANGGAU--Kepala Satuan Polisi Pamong Praja (Satpol PP) Kabupaten Sanggau, Chairuddin Rais, Selasa (5/3) mengharapkan kepada Pedagang Kaki Lima (PKL) yang bekerja pada malam hari agar dapat menertibkan gerobak dagangannya dengan baik. Jangan disimpan di sembarang tempat jika tidak ingin ditertibkan secara paksa. “Himbauan

Tolak Mutasi Kasi Kesra Sebanyak empat Ketua RT dari 15 RT di Kelurahan Sungai Sengkuang menolak mutasi Kepala Seksi Kesejahteraan Rakyat (Kasi Kesra) Muhammad Yamin. Muhammad Yamin sebelumnya bertugas di Kantor Lurah Sungai Sengkuang dan dipromasikan menjadi Sekretaris Kantor Kelurahan Ilir Kota. Keempat ketua RT tersebut adalah Nasir Ketua RT XII, Iwan Ketua RT X, Dayang Noni Ketua RT IV dan Arifin Ketua RT VII. Mereka mengaku sudah mempunyai hubungan cukup baik dengan Muhammad Yamin karena sangat dekat dengan warga dan kinerjanya dirasakan sangat membantu warga. “Kami merasa sering berhubungan setiap hari, dengan adanya Pak Yamin cukup terbantu, beliau orangnya gesit. Kalau diminta bantuan, malam-malampun beliau siap membantu warga, bahkan tanpa pamrih lagi, selama ini kami tidak pernah menemukan pegawai seperti beliau. Kami berharap dia dibalikkan lagi ke Sungai Sengkuang,” kata Nasir Ketua RT XII. Ketua RT IV, Dayang Noni mengaku, dahulunya ketika Muhammad Yamin ada urusan surat-menyurat lancar. Sebab Muhammad Yamin yang langsung turun tangan. Hal serupa disampaikan Ketua RT X, Iwan. Ia menjelaskan terkait permintaan tersebut intinya warga hanya ingin agar urusan warga lancar. Karena, selama ini setiap urusan administrasi dengan Muhammad Yamin selalu lancar. Terkait keinginannya itu, keempat ketua RT itu mengaku sudah melakukan komunikasi dengan Muhammad Yamin. Intinya, Muhammad Yamin siap bertugas kembali di Sungai Sengkuang meskipun harus merelakan jabatan promsinya sebagai sekretaris di Kantor Kelurahan Ilir Kota. Terpisah, Kepala Badan Kepegawaian Daerah (BKD) Kabupaten Sanggau, Thambie CHR menjelaskan akan mengevaluasi setiap pegawai yang ada. Menurutnya, pihaknya tidak bisa melihat seluruh pegawai yang ada di Kabupaten Sanggau. “Tapi, kalau memang ada hal seperti itu terjadi, silakan laporkan saja kepada Camat, sebab usulan mutasi pertama disampaikan oleh Camat,” ujarnya. (sgg)

Kamis 7 Maret 2013

kita kepada PKL khususnya malam hari, tolong barangbarang mereka disimpan dengan baik jangan sembarangan. Kalau tidak bisa tertib sendiri, nanti kita yang tertibkan,” ujarnya. Secara keseluruhan, dikatakannya bahwa pihaknya tetap bekerja sesuai dengan aturan, makanya saat ini pihaknya terus melakukan monitoring terkait PKL (sgg)

Kades Dituding Bohongi Warga Ist/Pontianak Post

DUKUNGAN: Wabup Sanggau Paolus Hadi secara simbolis memberikan dukungan untuk jalan sehat Pontianak Post kepada Perwakilan Biro Sanggau, Sugeng Rohadi.

JSS Pontianak Post

Pemda Borong Tiket dan Siapkan Televisi SANGGAU--Pemerintah Kabupaten (Pemkab) Sanggau memberikan dukungan dalam gelaran jalan sehat spektakuler dalam rangka ulang tahun ke-40 Pontianak Post. Selain memborong tiket, Pemkab Sanggau juga memberikan dukungan berupa satu unit televisi untuk jalan sehat yang akan digelar di Sanggau 24 Maret 2013 mendatang. Wakil Bupati Sanggau,

Paolus Hadi yang juga mewakili Pemerintah Kabupaten Sanggau menyambut baik acara tersebut. Menurutnya jalan sehat spektakuler tersebut diharapkan dapat menjadi motivasi masyarakat di Sanggau bahwa kesehatan dan kebugaran fisik sangat diperlukan sebelum melaksanakan aktivitas sehari-hari. Paolus juga mengajak warga Sanggau untuk beramairamai memeriahkan dan mer-

C

m

y

k

amaikan gelaran jalan sehat spektakuler berhadiah grand prize satu unit rumah impian dan perlengkapan isinya. Momen jalan sehat tersebut dapat dijadikan sebagai ajang kebersamaan dan silaturahmi semua masyarakat Kabupaten Sanggau dalam rangka mewujudkan Sanggau sehat. Paolus mewakili Pemerintah Daerah juga menyampaikan selamat ulang tahun kepada Pontianak Post. (sgg)

S AN G G AU - - S e j u m l a h bola dan bola volly. Dikatakanmasyarakat yang tergabung nya, untuk pembayaran wasit dalam tim peduli masyarakat bola volly kepada enam orang Meliau Hilir, Selasa (5/3) ke- wasit dengan besaran Rp7,7 marin menyampaikan kekece- juta, namun buktinya tidak ada waan mereka kepada pembayaran sama Kepala Desa Meliau sekali. Ia juga sudah Hilir terkait dugaan mewanti-wanti sebelpembohongan pubumnya akan terjadi hal lik dalam gelaran semacam ini. peringatan HUT “Kita sangat ke-67 Proklamasi RI sayangkan sikap pak beberapa waktu lalu. Kades sampai seperti Kades dianggap tidak ini. Inikan namanya menepati janji terkait pembohongan publik dengan hadiah yang kepada masyarakat di Sudiman akan diberikan melaMeliau Hilir. Apalagi lui suratnya tertangpara juara dijanjikan gal 1 Mei 2012. hadiah jutaan rupiah, tetapi janji Perwakilan tim, Sudiman ke- tersebut tidak ada yang dibapada wartawan menyampaikan yarkan oleh panitia dan Kades bahwa Kades melalui suratnya sebagai penanggungjawab,” tertanggal disebutkan di atas ujar Sudiman yang juga Ketua mengimbau lomba kebersihan RT 05 Meliau Hilir yang juga didi tingkat RT. Selain itu juga janji dampingi beberapa perwakilan membayar honor wasit sepak lainnya. (sgg)


Pontianak Post

Kamis 7 Maret 2013

SINTANG

PTPN Gelar Kejuaraan Voli SINTANG—Memperingati ulang Kejuaran bola voli ini sendiri merupakan tahun ke-17 PTPN XIII menyelenggararangkaian kegiatan ulang tahun PTPN kan kejuaran bola voli antar karyawan. XIII yang jatuh pada 11 Maret mendatang. Kegiatan di pusatkan di PTPN XIII Nanga Kurang lebih satu pekan digelar, pertandinJetak Sintang, dengan dibuka secara resmi gan akan ditutup di hari saat tanggal ulang oleh SPP Kebun, Leonardi, kemarin (Rabu tahun PTPN XIII. Dan, kebun di Nanga 6/12). Turut hadir dalam pembukaan, Jetak Sintang, baru kali pertama menjadi para unsur muspika kecamatan Dedai, tuan rumah. Tuan rumah pada 2014 menmanager kebun PTPN XIII Nanga Jetak datang akan ditentukan di saat hari peSintang Jondi, segenap karyawan, serta nutupan.Manager PTPN XIII Nanga Jetak masyarakat setempat. Agenda pembuSintang Jondi, mengatakan, ulang tahun kaan secara simbolis ditandai dengan PTPN XIII ikut digandeng dengan kegiatan pelepasan balon ke udara oleh SPP hari jadi untuk serikat pekerja perkebunan Kebun, Leonard) yang didampingi tamu PTPN (SP BUN CUP III). Pencapaian yang SUTAMI/PONTIANAK POST undangan. Kemudian dirangkai acara HUT 17: Pelepasan balon menandai pembukaan kejuaraan bola diinginkan adalah antar semua karyawan hiburan serta senam aerobik, sebelum voli memperingati HUT ke-17 PTPN XIII. bisa saling menyatu melalui silaturahmi mengawali pertandingan perdana. kejuaraan bola voli. Misalkan saling berLeonard berpesan kepada semua kontukar informasi mengenai tantangan dan persaudaraan antar karyawan. Peserta adalah karytingen menjunjung tinggi sportivitas. Pertandingan awan PTPN XIII-se Kalimantan Barat, yang dengan hambatan memajukan perusahaan di unit petersebut merupakan bagian untuk mempererat kejuaraan bola voli itu dapat saling bertemu. rusahaan. (stm)

PNS Dinsosnakertrans Siapkan Diri Untuk JSS KEMERIAHAN jalan sehat spektakuler dalam rangka Hari Ulang Tahun ke-40 Pontianak Post kian terasa. Kupon terus diborong berbagai lapisan masyarakat yang ingin ambil bagian di agenda jalan sehat. Tanpa terkecuali pegawai Dinas Sosial, Tenaga Kerja dan Transmigrasi Sintang tidak ketinggalan, memborong kupon jalan

SUTAMI/PONTIANAK POST

PNS menunjukkan kupon JSS.

sehat yang dihelat serentak di enam kabupaten/Kota di Kalbar pada 24 Maret mendatang. Mendatangi langsung kantor biro Pontianak Post Sintang di jalan JC Oevang Oeray, Syafrudin, menyatakan akan keikutsertaannya di jalan sehat. Agenda yang akan memberikan kesempatan kepada semua peserta untuk mendapatkan satu unit rumah lengkap

furniture di Pontianak. Jalan sehat ini, selain berhadiah utama satu unit rumah lengkap furniture, juga menyiapkan hadiah menarik seperti sepeda motor, televisi dan berbagai macam lainnya juga akan diberikan kepada peserta yang beruntung. Dan semua peserta akan mempunyai kesempatan sama. Untuk menjadi peserta jalan sehat sendiri sangat mudah. Cukup dengan membayar Rp.10.000, satu kupon jalan sehat bisa didapatkan. Yang tiap kupon tersebut nanti

akan diundi buat menentukan pemenang. Baik untuk hadiah utama berupa satu unit rumah maupun hadiah menarik lainnya. Sementara untuk mendapatkan kupon jalan sehat bisa dengan mendatangi kantor Biro Pontianak Post Sintang jalan JC Oevang Oeray atau menghubungi nomor telepon 081345107773 (Sutami Biro Pontianak Post Sintang). Pelaksanaan jalan sehat HUT ke 40 Pontianak Post di Sintang ini juga turut didukung harian Kapuas Post. (stm)

23

Perekaman e-KTP Capai 71,31 Persen SINTANG - Hingga akhir Februari 2013, perekaman Kartu Tanda Penduduk Eletronik di Kabupaten Sintang sudah mencapai 197.651 data dari total target 277.177 atau 71,31 persen. Sejumlah kendala masih ditemui, terutama letak geografis daerah yang jauh dari kecamatan, pendataan di lapangan akan segera dilaksanakan. Kepala Dinas Kependudukan dan Catatan Sipil Kabupaten Sintang, Syarif Muhammad Taufik mengatakan evaluasi terhadap pelaksanaan perekaman data KTP elektronik sudah dilakukan dengan dihadiri para camat dan sekda, sekaligus membahas kerja perekaman reguler untuk 2013 sampai masa yang telah ditetantukan yakni 31 Oktober 2013. “Dalam evaluasi itu memang ada sejumlah poin yang kami simpulkan dan jadi masukan untuk pelaksanaan kegiatan di 2013 ini,” kata Taufik kemarin(6/3). Dia mengatakan untuk KTP elektronik yang sudah dicetak dan didistribusikan dari pusat sebanyak 87.245 keping. “Sudah kami distribusikan juga ke camat, dari camat ke desa atau kelurahan

hingga ke RT,” kata dia.Dalam evaluasi itu menurutnya ada beberapa kecamatan yang perlu pendataan khusus karena capaian perekaman data baru 50 persen. Hal itu terjadi karena medannya berat dan secara geografis memang letaknya sangat jauh dengan pusat pelayanan di kecamatan. “Terutama untuk Kayan Hulu dan Ambalau yang medannya berat, kami sudah agendakan untuk pelayanan langsung di lapangan dengan menggunakan peralatan mobile, itu dilakukan untuk memacu perekaman,” kata dia. Dia mengatakan setelah selesai gerakan massal perekaman KTP elektronik hingga 31 Desember lalu, sejak Januari dimulai perekaman reguler, namun perekaman ini tetap digratiskan hingga 31 Oktober 2013 mendatang. “Pelayanan masih tetap di kantor camat dan ke depannya khusus untuk KTP akan permanen di kantor camat, kami harapkan yang belum merekam data atau yang sudah memasuki usia 17 tahun bisa segera melakukan perekaman,” kata dia. (stm)




-#27#5

Empat Dusun Masih Gelap

,1)2

Pasarkan Produk UKM

 +

DINAS Perindustrian, Perdagangan, Koperasi dan Usaha Kecil Menengah (Diperindagkop UKM) Kabupaten Sekadau menginginkan seluruh UKM yang ada di Kabupaten Sekadau bisa terus eksis dan berkembang. Sejumlah strategi dipersiapkan untuk mewujudkan keinginan tersebut. Kepala Diperindagkop dan UKM Kabupaten Sekadau, H Isdianto SE kepada Pontianak Post mengatakan, mereka melakukan berbagai upaya untuk mendorong UKM bisa berkembang pesat. �Kita inginkan semua UKM yang ada di Kabupaten Sekadau ini bisa berkembang pesat,� ujarnya. +,VGLDQWR6( Menurut Isdianto, pihaknya memiliki sejumlah cara agar UKM di Sekadau bisa mengembangkan usahanya. Cara yang dimaksud adalah menggandeng perusahaan lain untuk bekerjasama dengan UKM. Kerjasama yang dibidik adalah kerjasama dalam bidang pemasaran. �Nantinya produk-produk dari UKM kita kerjasama dengan toko atau mini market yang ada di Kabupaten Sekadau. Mini market tersebut kita mintakan untuk ikut serta memasarkan produk-produk dari UKM kita,� jelas Isdianto. (nie)

+$5$3$1

Lelang Proyek Segera ANGGOTA DPRD Kabupaten Sekadau, Yefray Raja Tugam mendesak SKPD di lingkungan Pemkab Sekadau untuk segera menuntaskan proses pelelangan proyek fisik. Hal ini penting dilakukan agar semua proyek fisik yang dilaksanakan tahun anggaran 2013 ini bisa selesai tepat waktu. â&#x20AC;&#x153;Kita minta dinas secepatnya menyelesaikan lelang, takutnya pekerjaan yang direncanakan tidak dapat terselesaikan tepat waktu jika pelelangan terlambat,â&#x20AC;? <HSUD\57XJDP tutur Jefray. Belum lagi tahapan-tahapan yang harus dilewati dalam proses lelang yang cukup memakan waktu, misalnya proses pemasukan penawaran, verifikasi dan seleksi. Apabila tidak segera dilaksanakan pelelangan, dikhawatirkan pekerjaan yang direncanakan menjadi terbengkalai. Sementara, saat ini sudah memasuki akhir triwulan pertama dan mendekati dan hampir memasuki triwulan dua. â&#x20AC;&#x153;Belum lagi kalau tingkat kesulitan proyek cukup tinggi, tentunya lebih banyak waktu yang dibutuhkan untuk mengerjakannya. Takutnya, pekerjaan tidak selesai tepat waktu,â&#x20AC;? tutur Yefray. (nie)

 +

Pontianak Post .DPLV0DUHW

SEKADAU - Warga Desa Seberang Kapuas, Kecamatan Sekadau Hilir, belum seluruh)272+80$660$16(.$'$8 nya bisa menikmati listrik dari .$5$.7(5:RUNVKRS3HQGLGLNDQ.DUDNWHU60$16HNDGDX3HPEDQJXQDQNDUDNWHUGDQ PT PLN. Sebagian besar warga SHQGLGLNDQNDUDNWHUPHQMDGLVDODKVDWXNHKDUXVDQ masih mengandalkan pembangkit listrik yang dibagikan oleh desa di tiap-tiap dusun. â&#x20AC;&#x153;Dari tujuh dusun yang ada

Bentuk Manusia Berkarakter Sejak Dini

SEKADAU - Dunia pendidikan diharapkan sebagai motor penggerak untuk memfasilitasi pembangunan karakter, sehingga para pelajar mempunyai kesadaran kehidupan berkarakter, yang membuat mereka mampu menyadari kehidupan berbangsa dan bernegara harmonis dan demokratis tetap memperhatikan sendi-sendi Negara Kesatuan Republik Indonesia (NKRI). Normanorma sosial di masyarakat yang telah menjadi kesepakatan bersama. Hal inilah mendorong SMA N 1 Sekadau untuk mengadakan workshop pendidikan karakter pada para pelajarnya Sabtu akhir pekan kemarin. Pembangunan karakter dan pendidikan karakter menjadi suatu keharusan, karena pendidikan tidak hanya menjadikan peserta didik menjadi cerdas juga mempunyai budi pekerti dan sopan santun, sehingga keberadaannya sebagai siswa menjadi bermakna baik bagi dirinya maupun di masyarakat sebagai tempat tinggalnya.

Hj. Utin Diana Kumala, Kabid Dikmen Dinas Pendidikan, Pemuda dan Olahraga Kabupaten Sekadau mengatakan diharapkan terwujudnya pembangun manusia Indonesia yang berakhlak, berbudi pekerti dan berperilaku baik. â&#x20AC;&#x153;Bangsa kita ingin pula memiliki peradaban yang unggul dan mulia,â&#x20AC;? katanya. Tujuan tersebut diyakini tercapai apabila masyarakat juga merupakan masyarakat yang baik (good society) dan masyarakat idaman. Selain itu dapat pula manusia berkarakter baik dapat terwujud manakala manusia-manusia Indonesia adalah manusia berakhlak dan berwatak baik, manusia yang bermoral dan beretika baik, serta manusia yang bertutur dan berperilaku baik pula. â&#x20AC;&#x153;Itulah sebabnya, kita sungguh menggaris bawahi pentingnya pendidikan dan pembangunan karakter bangsa dalam arti luas. Bangsa yang berkarakter unggul, di samping tercermin dari moral, etika dan budi pekerti yang baik,â&#x20AC;?papar Utin.

Selanjutnya totalitas dari karakter bangsa yang kuat dan unggul, yang pada kelanjutannya bisa meningkatkan kemandirian dan daya saing bangsa, menuju Indonesia yang maju, bermartabat. Kepala Sekolah, Drs. Dominikus melaporkan landasan dan sumber pendanaan dari pelaksanaan kegiatan ini, beliau menyampaikan workshop ini menindaklanjuti program Pemerintah yang bersumber dari APBN-P 2012, harapannya dapat berlanjut â&#x20AC;&#x153;Kepada peserta workshop agar menyimak dengan seksama, tertib sehingga materi apa yang disampaikan oleh masing-masing narasumber dapat dipahami dan dimengerti,â&#x20AC;? ujar Domi. Narasumber yang diundang dalam kegiatan workshop ini dari beberapa instansi diantaranya Dinas Pendidikan Pemuda dan Olahraga Kab. Sekadau, Polsek Sekadau Hilir, Koramil Sekadau Hilir, Kemenag Kab. Sekadau dan Pemuka Agama. (nie/humas)

Selabi masih belum mendapatkan listrik PLN. â&#x20AC;&#x153;Mereka yang belum teraliri listrik PLN ini mengandalkan mesin pembangkit yang dibagikan tiap dusun. Operasional pembangkit ini dilakukan secara swakelola dari uang swadaya masyarakat,â&#x20AC;?

Kita sudah beberapa kali minta ke PLN dan pemerintah, tapi belum terealisasi. Pihak PLN mengakui biaya untuk membangun jaringan ke dusun-dusun yang belum teraliri listrik itu sangat mahal. di sini (Seberang Kapuas, red), baru tiga dusun yang sudah dilayani listrik PLN,â&#x20AC;? ujar Abdul Maulana, Kepala Desa Seberang Kapuas. Pria yang akrab disapa Oteng itu mengungkapkan, tiga dusun yang sudah terlayani listrik dari PT PLN itu adalah Dusun Seberang Kapuas II dan Dusun Seberang Kapuas III, serta Dusun Sui Akar. Sementara Dusun Seberang Kapuas I, Dusun Kelulut, Dusun Sejirak, dan Dusun

 +

jelas Oteng. Pihaknya, kata Oteng, sangat mengharapkan agar seluruh warga Seberang Kapuas bisa menikmati listrik PLN. Namun harapan itu tampaknya akan sulit terwujud karena berbagai faktor. â&#x20AC;&#x153;Kita sudah beberapa kali minta ke PLN dan pemerintah, tapi belum terealisasi. Pihak PLN mengakui biaya untuk membangun jaringan ke dusun-dusun yang belum teraliri listrik itu sangat mahal,â&#x20AC;? tukasnya. (nie)

Dekranasda Kembangkan Ciri Khas Daerah SEKADAU - Ketua Dekranasda Kabupaten Sekadau, Ny. Scolastika Simon Petrus mengatakan, Dekranasda sudah memiliki tekad mengembangkan dan melestarikan kerajinan di daerah ini. Selama ini pihaknya sudah bekerjasama dengan pihak lain termasuk dengan Dekranasda Provinsi Kalbar teru-

tama dalam hal promosi. â&#x20AC;&#x153;Kita akan kembangkan terus kerajinan yang ada, dengan begitu kita juga meminta dukungan dari ibu-ibu pengrajin tenun, manik-manik, anyaman atau bentuk kerajinan lain yang memiliki nilai jual,â&#x20AC;? ucap Dikatakannya, tugas yang diemban oleh Dekranasda cu-

kup berat yaitu membina pengrajin, menampung produkproduk hasil kerajinan dan mempromosikannya kepada masyarakat luas melalui berbagai macam media (hanscrape), termasuk mengikuti pameran-pameran. Potensi kerajinan di Sekadau cukup banyak, hanya saja selama ini belum be-

gitu berkembang. Jika ada kerajinan baik dari kulit kayu, manik-manik, tenun, kerajinan rotan, miniatur kayu dan lainnya hanya dikelola oleh perorangan. Dekranasda, menginginkan agar kerajinan yang terus dikembangkan masyarakat di berbagai pelosok di Sekadau, tanpa meninggalkan ciri khas

motif asli daerah. â&#x20AC;&#x153;Masya rakat silahkan membuat kerajinan sebanyak-banyaknya, pertahankan ciri khas, boleh dikembangkan tapi pertahankan keasliannya agar menjadi khas Sekadau. Pemerintah Daerah dan Dekranasda ini siap membantu promosi,â&#x20AC;? serunya. (nie)

 +


Pontianak Post

Kamis 7 Maret 2013

ketapang

25

Tarik Tabung 3 Kg Merek SKT

+

KETAPANG – Manajemen PT Bumi Persada Sentosa, Yusman, mengatakan dalam sepekan terakhir, Pertamina mengeluarkan keputusan tentang larangan terhadap peredaran tabung gas elpiji ukuran 3 kilogram (kg) yang bermerek SKT keluaran terbaru. Pasalnya, tabung SKT keluaran terbaru ini, diperkirakan belum memenuhi standar, karena belum pernah diujicoba keamanannya. Pangkalan juga diimbau untuk tidak menerima tabung tersebut dari masyarakat. Sedangkan untuk tabung dengan merek yang sama, namun sudah pernah diisi oleh Pertamina, dikatakan dia, tetap diperbolehkan beredar. “Ini khusus untuk tabung yang masih baru, belum pernah isi ulang,” kata Yusman. Dia menjelaskan, larangan tersebut dikeluarkan oleh Pertamina karena tabung dengan merek SKT yang belum pernah diisi tersebut, dikhawatirkan jika diisi dan digunakan, akan terjadi hal-hal yang membahayakan. Karena, dikatakan dia kembali bahwa sampai saat ini, masih belum pernah dilakukan ujicoba resmi oleh Pertamina. Yusman juga mengungkapkan, tabung dengan merek SKT keluaran terbaru ini adalah buatan dari Semarang, Jawa Tengah. Namun, dia menyayangkan, oleh sebagian pengusaha dibeli di Jakarta, yang kemudian dibawa ke Kalbar, termasuk juga ke Ketapang. “Pelarangan ini bukan cuma untuk Ketapang saja, namun seluruh Kalbar,” tandas Yusman. Lebih lanjut dia juga mengimbau agar masyarakat yang hendak membeli tabung gas elpiji yang baru, hendaknya lebih teliti dan jeli, agar tidak salah. “Jika masyarakat sudah

terlanjur membeli, baiknya masyarakat memulangkan kembali ke tempat asal membeli. Daripada nanti ditolak agen atau pangkalan waktu mau isi,” paparnya. Sementara itu, salah satu pemilik pangkalan gas elpiji di Ketapang, Setiawan, mengaku kurang setuju atas kebijakan yang diambil oleh pihak Pertamina ini. Ditakutkan dia, penolakan terhadap tabung gas yang bermerek SKT tersebut akan menimbulkan keresahan di tengah masyarakat. “Orang yang sudah beli tabung dan mau menukar sama kita, lalu ditolak, bisa-bisa mereka marah dengan pangkalan. Kalau seperti itu, ribut jadinya,” ungkapnya. Untuk menghindari halhal yang tidak diinginkan, Setiawan mengatakan bahwa mereka tetap akan menerima setiap tabung SKT dari masyarakat yang mau menukar. “Daripada membuat keributan, lebih baik saya terima,” ujar Setiawan. Setiawan juga tak menampik jika belum lama ini Pertamina menahan sekitar 200 tabung gas elpiji ukuran 3 kg yang bermerak SKT. Penahanan tersebut, menurutnya, terjadi saat tabung gas milik Setiawan ini masuk ke SPBE di Kota Pontianak. Namun, dia menambahkan, belum sempat diisi, tabung tersebut langsung disita oleh Pertamina, dengan alasan tabung tersebut bermerek SKT. “Saya terkejut, kenapa tabung gas milik saya ditahan? Padahal sebelumnya belum pernah terjadi hal seperti ini. Jadi saya tidak tahu harus seperti apalagi. Kalau memang ingin melakukan penarikan, kami minta agar Pertamina tidak hanya menarik, namun menggantinya dengan yang layak,” pungkas Setiawan. (afi)

FOTO : TENDER-INDONESIA.COM

LEBIH TELITI: Masyarakat diminta lebih teliti saat membeli tabung gas elpiji terutama untuk ukuran 3 kilogram. Ini lantaran Pertamina telah melarang penggunaan tabung gas bermerek SKT.

+

AHMAD SOFI/PONTIANAK POST

RAWAN : Gedung yang pembangunannya belum selesai, yang terletak di Lapangan Sepakat ini, menjadi salah satu tempat bagi muda-mudi berkumpul pada malam hari. Tempat ini juga rawan terjadi tindakan yang menyimpang.

Masih Banyak Perusahaan Nakal Dinsosnakertrans Segera Beri Sanksi KETAPANG – Dinas Sosial, Tenaga Kerja, dan Transmigrasi (Dinsosnakertrans) Kabupaten Ketapang berjanji akan lebih fokus kepada pengawasan dan pembinaan di tingkat perusahaan. Karena, diakui mereka, sejauh ini masih banyak perusahaan yang belum memenuhi kewajiban dan melanggar peraturan yang sudah ada. Kasi Pengawasan Dinsosnakertrans, Uti Ilmu Royen, mengungkapkan, salah satu pelanggaran yang sering dilakukan oleh pihak perusahaan adalah masalah ketenagakerjaan. Antara lain, disebutkan dia, dengan mempekerjakan karyawannya menggunakan sistem kontrak. Padahal, menurut dia, pekerjaan yang dilakukan tersebut merupakan pekerjaan inti perusahaan. Dia menegaskan, pihaknya akan fokus kepada pengawasan dan pembinaan terhadap perusahaan. Di antaranya PKWT (perjanjian kerja waktu tertentu) yang cendrung dilakukan oleh perusahaan untuk menghemat biaya. “Di Ketapang ini masih ada bahkan lebih banyak perusahaan yang mengontrak tenaga

kerjanya. Inilah masalahnya yang kita hadapi,” kata Royen, kemarin (5/3) di Ketapang. Dia menegaskan bahwa pihaknya akan memberikan sanksi yang berat, jika pelanggaran yang terjadi cukup fatal. Namun, sampai saat ini pihaknya masih melakukan pembinaan dan peringatan, serta memberikan nota pemeriksaan. “Nota ini sama halnya dengan teguran. Dengan keluarnya nota pemeriksaan ini, berarti kami telah memberikan tenggang waktu kepada perusahaan untuk segera memperbaiki kekurangan dan kesalahan. Sementara untuk perlengkapan alat pelindung diri, harus lebih cepat prosesnya. Karena itu menyangkut masalah keselamatan tenaga kerja,” ujarnya. Royen juga menjelaskan, K3 itu juga termasuk dalam alat pelindung diri. Dari hasil pengawasan yang dilaku-

+

kan di lapangan, diakui dia, masih banyak perusahaan yang memberikan pekerjaan kepada karyawannya, yang bukan bidangnya. Akibatnya, ditambahkan dia, banyak karyawan yang bekerja ternyata tidak memiliki sertifikat. Dia memisalkan pada operator alat berat. Dia menegaskan bahwa sebetulnya yang boleh menjadi operator alat berat ini adalah mereka yang sudah memiliki sertifikat, yang dikeluarkan langsung dari pusat. Namun, dia menyayangkan, yang ada di Ketapang ini, kebanyakan mereka yang bekerja sebagai operator alat berat, tidak memilki sertifikat Selain itu, lanjut Royen, izin pengesahan pemakaian untuk alat angkat dan angkut, ternyata masih banyak perusahaan yang belum memilikinya. Sedangkan untuk boyler atau pabrik yang ada di Ketapang,

menurut dia, masih ada beberapa pabrik yang data atau dokumen tentang izin pemakaian dan akte hasil uji berkala tidak tercatat di kantor Dinsosnaker Ketapang. “Banyak perusahaan yang masih belum menyampaikan izinnya ke kita,” keluhnya. Saat melakukan peme­ riksaan terharap beberapa perusahaan beberapa waktu lalu, dia mengungkapkan bagaimana begitu banyak perusahaan yang tidak bisa

memperlihatkan berbagai perizinan dimaksud. Alasannya, menurut dia, perusahaan berkilah bahwa izin akte tersebut berada di pusat. “Mestinya mereka harus menyediakan copy untuk memudahkan kontrol terhadap boyler dari Dinsosnaker. Ke depan, kita akan memberikan teguran kepada perusahaan yang nakal, karena sudah berdampak negatif, salah satunya kebakaran,” pungkasnya. (afi)

+

C

m

y

k


KAYONG UTARA

26 PETUAH

Hanya di Kayong Utara PEMERINTAH Kabupaten (Pemkab) Kayong Utara resmi meluncurkan Program Infrastruktur Dana Desa (Infradades) pada tahun 2012. Program ini sangat berdampak positif untuk pemerataan dan percepatan pembangunan di tingkat dusun seKabupaten Kayong Utara. “Program Infradades ini tidak ada di daerah lain. Di Indonesia, program ini hanya ada di Kayong Hildi Hamid Utara. Program ini ada di Bogor, Jawa Barat. Namun di Bogor, alokasi dananya hanya untuk tingkat desa. Kalau di Kayong Utara, semua dusun mendapat Infradades,” kata Bupati Kayong Utara Hildi Hamid, belum lama ini, di Sukadana. Program Infradades yang diluncurkan untuk tingkat dusun, diungkapkan dia, berkisar dari Rp10 juga hingga Rp50 juta. Setiap dusun melalui desa masingmasing, dikatakan Bupati, harus menyampaikan proposal. Dana yang dicairkan Pemkab, dikatakan Bupati kembali, tetap berdasarkan proposal yang disampaikan. “Jadi kisaran dananya Rp10 (juta) hingga 50 juta. Setiap dusun biasanya berbeda, tergantung proposal yang disampaikan,” kata Bupati menjelaskan. Sementara itu, kepala Dusun (Kadus) Pematang Baros, Riam Berasap Jaya, Marwi, menyambut positif dengan diluncurkannya Program Infradades tersebut. Dia menilai, selain alokasi dana desa (ADD), Infradades sangat strategis untuk percepatan pembangunan di setiap dusun. “Di Dusun banyak hal-hal yang mesti kita bangun, seperti jembatan dan jalan. Untuk itu, dengan Infradades kita bisa mengusulkan pembangunan,” ujarnya. (mik)

Pontianak Post

l

Kamis 7 Maret 2013

Dua Ambulans untuk Warga Kepulauan SUKADANA – Tidak berhenti pada kapal rampasan yang dijadikan sebagai Puskesmas Keliling, Pemkab Kayong Utara terus memberikan kemudahan bagi warga di kepulauan, untuk mendapatkan pelayanan di bidang kesehatan, melalui Ambulans Air. Pada tahun ini, Pemkab mendapat dua unit Ambulace Air. Keduanya merupakan bantuan dari Kementerian Kesehatan (Kemenkes) Republik Indonesia, untuk Pemkab Kayong Utara. “Dua unit Ambulans Air itu sudah kita terima dan kita serahkan ke Dinas Kesehatan, untuk memanfaatkannya,” ungkap Bupati Kayong Utara, Hildi Hamid, ditemui di ruang kerjanya, Selasa (5/3) lalu. Dijelaskan kepala daerah, satu unit ambulans tersebut nantinya ditempatkan di Pelapis, ibukota Kecamatan Kepulauan Karimata. Hal ini, ditambahkan dia, bertujuan agar kendaraan tersebut bisa menjangkau wilayah-wilayah kepulauan di sekitarnya. Untuk diketahui, Kecamatan Kepulauan Karimata terdiri dari tiga desa yakni Desa Pela-

galami kemajuan pesat. Hal ini dibenarkan ketua Badan Permusyawaratan Desa (BPD) Pelapis, Kadri. Menurutnya, geliat pembangunan di kawasan wisata bahari ini sangat terasa, mulai dari infrastruktur dan pembangunan sarana perkantoran. “Kami sangat bersukur karena seriusnya Pemerintah Kabupaten membangun daerah kami ini,” ujar Kadri. Bupati sendiri, sebelumnya mengatakan, untuk sekarang ini dirinya tidak lagi ragu ketika membawa tamu dari luar daerah saat datang ke Pelapis. Pasalnya, di sana telah dibangun mess di sekitar komplek Kantor Camat Kepulauan Karimata. “Bahkan di mess itu ada kamar VIV,” jelas Bupati. M SURIMIK UNTUK PONTIANAK POST Selanjutnya, untuk satu KUNJUNGI KEPULAUAN: Bupati Kayong Utara Hildi Hamid didampingi istri, Ny Diah Permata, saat Ambulans Air lainnya akan berkunjung ke Kecamatan Kepulauan Karimata, beberapa waktu lalu. ditempatkan di Teluk Batang. “Sengaja kita letakkan di Teluk Batang, supaya pis, Desa Betok, dan Desa Pa- air termasuk Ambulans Air Sejak dimekarkan dari Kedang. Sementara akses jalur ini menjadi penting, untuk camatan Pulau Maya Karimata bisa menjangkau wilayah darat yang menghubungkan menjangkau warga dalam –sekarang menjadi Kecama- sekitar hingga ke desa-desa antar desa sama sekali belum memberikan pelayanan kes- tan Pulau Maya, Kecamatan di Kecamatan Pulau Maya,” tersedia. Sehingga, kendaraan ehatan secara maksimal. Kepulauan Karimata men- tutupnya. (mik)

Panwaslu Diminta Kerja Ekstra SUKADANA - Wakil Ketua DPRD Kabupaten Kayong Utara, Sukardi, mengharapkan agar Panitia Pengawas Pemilu (Panwaslu) bekerja ekstra, dalam melakukan tugas pengawasan yang melekat pada lembaga tersebut. Hal itu dikarenakan dalam sebuah pesta demokrasi, menurutnya, banyak hal yang dilakukan baik oleh pasangan calon atau tim suksesnya, bahkan penyelenggara pemi-

lu, baik sengaja atau tidak, terkadang menyalahi aturan. Sehingga, dia menambahkan, jika dirunut sesuai aturan itu sendiri, dapat mencederai makna dari sebuah pesta demokrasi. “Walau DPRD memiliki fungsi pengawasan internal dalam pemilu, namun dipastikan pengawasan akan tidak maksimal dan tidak seimbang. Karena anggota DPRD yang merupakan im-

C

m

y

k

plementasi dari sebuah partai dan partai-partai tersebut memiliki komitmen tersendiri dalam mengusung dan memenangkan pasangan yang diusung, maka keindependensiannya diragukan,” kata Sukardi, beberapa waktu lalu, di Gedung DPRD Kabupaten Kayong Utara. “Karena memang independen, maka panwas harus dapat menjaga keindependenannya,” kata Sukardi.

Selain di tingkat kabupaten, Panwaslu yang memiliki kepanjangan tangan hingga ke tingkat kecamatan dan desa, diingatkan dia agar bekerja eksta, karena tidak seimbangnya jumlah pengawas dan yang diawasi. Inilah, yang disoroti dia, kadang membuat hal kecil terlewatkan dan justru menjadi bumerang. “Jangan ragu, kalau memang melanggar, buat itu benar-benar mendapat sank-

si, bukan justru didiamkan,” pesannya. Demikian juga dalam penindakan, dia tak menampik jika Panwaslu memang tidak memiliki personil di lapangan untuk melakukan eksekusi, seperti penertiban baliho atau sejenisnya. Namun Sukardi tegas meminta kepada Pemerintah Kabupaten, dalam hal ini instansi terkait, agar dapat bekerjasama dengan Panwaslu, dalam hal tersebut. (mik)


Pontianak Post

aneka kalbar

Kamis 7 Maret 2013

Sumber Air Tirtayasa Tercemar SINGKAWANG-Pemerintah Kota Singkawang telah menerima laporan dari PDAM Gunung Poteng mengenai dugaan pencemaran salah satu sumber air yakni Tirtayasa, yang disebabkan adanya aktivitas penambangan ilegal di sekitar area tersebut. Kepala Bagian Administrasi Sumber Daya Alam, Sekretariat Daerah Kota Singkawang, Efi Mega Lazuardi menyebutkan PDAM Gunung poteng telah melaporkan adanya dugaan pencemaran sumber air. Sesuai laporan yang diterimanya, kalau biasanya keruh nya air di tempat itu dikarenakan hujan turun, tapi ini bukan musim hujan, sementara air di Tirtayasa keruh. “Keruhnya salah satu sumber air permukaan tersebut, biasanya dikarenakan adanya hujan, tapi sekarang ini di-

duga dikarenakan limbah air PETI,” kata Efi, Rabu (6/3). Adanya laporan dari PDAM, lanjut Efi, pihaknya akan mempelajari nya. Lantaran, sampai hari ini kondisi keruh nya air masih terjadi. “Kita lihat lah nanti, seperti apa kondisi sebenarnya,” katanya. Kalaupun memang ada pencemaran seperti yang dilaporkan, dikatakan Efi, pihaknya juga akan mengambil sampel air ditempat tersebut. Tapi kalau air itu berasal dari aktivitas Penambangan, air raksa yang digunakan mengandung merkuri yang cukup tinggi. “Tapi apapun hasilnya, harus ada pengujian terlebih dahulu, lantaran seperti sungai yang ada di Seluang yang juga aliran peti, tapi setelah diuji oleh BLHD masih di ambang batas. Jadi lihat dulu sampel nya, baku mutunya kan ber-

beda antara air permukaan dan lainnya kemudian bakteri koli nya,” katanya. Kalaupun memang dugaan pencemaran dilakukan oleh penambangan, lanjut Efi, penindakan akan dilakukan, sesuai dengan Undangundang Nomor 32 Tahun 2009 tentang perlindungan dan pengelolaan Lingkungan Hidup. Disebutkan dalam UU tersebut, yakni Pasal 20 ayat (1) Penentuan terjadinya pencemaran lingkungan hidup diukur melalui baku mutu lingkungan hidup meliputi baku mutu air, baku mutu air limbah, baku mutu air laut, baku mutu udara ambient, baku mutu emisi, baku mutu gangguan dan baku mutu lain sesuai dengan perkembangan ilmu pengetahuan dan teknologi. Disebutkan juga dalam pasal tersebut, setiap orang

diperbolehkan untuk membuang limbah ke media lingkungan hidup dengan persyaratan memenuhi baku mutu lingkungan hidup dan dan mendapat izin dari Menteri,gubernur,atau bupati/walikota sesuai dengan kewenangannya. Dirut PDAM Gunung Poteng Singkawang, Kristina Kilin mengatakan salah satu sumber air PDAM selain grativasi, yakni Tirtayasa biasanya airnya jernih. Namun diduga ada kegiatan penambangan emas yang kemungkinan limbahnya masuk membuat air yang ada keruh seperti air kopi susu. “Kondisi itu sangat memengaruhi pengolahan air yang dipakai PDAM. Kalau itu kita pompa, secara langsung akan berdampak pada kualitas air yang disitribusikan ke masyarakat sebagai pelanggan,” kata Kristina Kilin.(fah)

ceceran di samping tempat sampah RSUD. Barang-barang ini ditemukan ketika tenaga kebersihan yang kebetulan satu kampung dengan korban sedang membersihkan halaman RSUD. Sebagian barang-barang ini, yang diduga korban dibuang oleh pelaku saat hendak melarikan diri. Barang-barang yang “dikembalikan” tersebut diantaranya hanya buku tabungan CU dan buku

tabungan DSM serta kwitansikwitansi belanja. Sedangkan selebihnya, seperti uang gaji istrinya Rp6,2 juta, BPKB mobil, motor, kartu pegawai, Askes dan lainnya tidak ditemukan. “Slip gaji ada, uangnya sudah tidak ada. Untuk yang rekening bank, pas hari kejadian sudah dilapor minta diblokir. Ke Polres juga setelah kejadian sudah saya lapor, sekitar 4 jam saya di BAP,” pungkasnya. (fik)

adanya kelompok yang di bentuk oleh masyarakat seperti itu, karena melalui hal yang seperti inilah kedepannya masyarakat akan lebih semangat dalam menekuni usaha di sektor perikana ini. Menurutnya, seperti inilah yang di harapkan oleh pemda dalam arti kedepan otomatis pembinaan akan lebih baik.

“Ini jadi sebuah potensi yang cukup baik sekali karena sebenarnya Kolam terpal inikan baru kita kembangkan di Landak tetapi peminatnya sudah cukup banyak, dan ini bertanda,bahwa usaha n kedepan akan lebih baikmakanya untuk tahun depan akan kita tambahkan jumlah untuk anggaran disektor ini,”

telah dilimpah kepada Bea dan Cukai, untuk dilakukan proses lebih lanjut. Menurut Husni, dalam kasus kepabeanan para pemilik maupun pelaku usaha dipermudah dengan adanya kuota belanja 600 RM (Ringgit Malaysia) untuk memenuhi kebutuhan bahan pokok warga di dua kecamatan, yakni Entikong dan Balai Karangan. Apabila barang tersebut keluar dari wilayah kepabeanan maka tidak diperbolehkan. Karena mereka belanja menggunakan KLB. “Barang yang dibelanjakan dengan KLB hanya 600 RM, dengan kuota 300 Kilogram. Jika lebih akan dikenakan pajak bea masuk,” jelasnya. Sedangkan untuk membawa barang-barang tersebut keluar daerah kepabeanan atau

keluar wilayah Entikong dan Sekayam, harus memenuhi ketentuan-ketentuan yang berlaku. Dan tidak bisa hanya menggunakan fasilitas belanja KLB. “Untuk kesembilan unit mobil box yang dilimpahkan Polsek Entikong, kita akan melakukan pemulangan barang tersebut ke negara asal Malaysia. Sedangkan jika barang-barang itu hanya diperuntukan bagi warga di dua kecamatan, maka akan kita panggil pemiliknya dan kita serahkan kembali dengan sayarat harus melengkapi dulu dokumennya. Seperti kasuskasus kepabeanan yang kerap kita tangani di perbatasan ini, langkah yang kita lakukan hanya mengembalikan barang ke Negara asal,” pungkasnya. (ags)

Bongkar Mobil Kadis Sambungan dari halaman 17

jenis Hilux warna hitam milik Kadis ESDM Kabupaten Sanggau ini, dibengkas oleh Orang Tak Dikenal (OTK) pada Jumat (01/03). Kejadian tersebut berlangsung sekitar pukul 12.00 WIB siang, di parkiran depan Toko Sport Music Jalan Jendral Ahmad Yani Kota Sanggau. Dimana Tempat Kejadian Perkara (TKP) tersebut juga berlokasi

tepat atau berseberangan jalan dengan kantor Markas Kepolisian Resor (Mapolres) Sanggau. Christian yang ditemui wartawan secara terpisah, Rabu (06/03) menyatakan, dua hari kemudian setelah kejadian pembobolan berlangsung, dirinya telah dihubungi oleh salah satu tenaga kebersihan di RSUD Sanggau, bahwa barang-barang milik Christian telah ditemukan ber-

Setor Rp150 Ribu Buat Beli Terpal Sambungan dari halaman 17

membeli berbagai keperluan dalam usaha ikan lele terpal. Adapun besaran dana yang di kumpulkan, masing -masing dalam anggota kelompok tersebut adalah Rp.150.000/ orang dan uang tersebut akan di gunakan untuk pembelian terpal dan

bibit ikan. Sedangkan mengenai pelaksanaan kegiatan akan di lakukab dengan cara gotong royong setiap Minggu sore. Di tempat terpisah Kepala Dinas Pertanian Melalui Kepala Bidang peternakan dan perikanan Labupaten Landak,Gusti Basrun,mengatakan sangat mendukung sekali dengan

9 Mobil Boks Ditahan Sambungan dari halaman 17

kemarin. Dijelaskannya, sembilan unit mobil boks tersebut kebanyakan akan membawa muatan ke luar wilayah kepabeanan, yakni Pontianak. Ketika akan melintas sore kemarin, anggota Polsek Entikong yang dibackup Brimob Mapolda Kalbar sedang mengadakan Operasi Panah Kapuas. “Operasi panah atensinya adalah C3 (Curat, Curas dan Curanmor). Tetapi kita di perbatasan melakukan pemeriksaan menyeluruh juga terhadap kendaraan yang melintas guna mengantisipasi penyeludupan, baik makanan olahan, daging, ikan dan elektronik serta senpi maupun narkoba,” terang Aries. Karena sembilan unit mo-

bil boks tersebut tidak bisa menunjukkan dokumen yang lengkap maka diamankan. Setelah dilakukan pemeriksaan secara marathon terhadap supir dan pemilik barang, maka dilimpahkan ke Bea dan Cukai untuk diambil langkah hukum. Apakah nantinya, kesembilan unit boks tersebut yang bermuatan ikan dan makanan olahan itu diproses atau dilakukan pengembalian ke negara asal (Rekspor). “Yang jelas kita di lapangan sudah melakukan langkah pengamanan masuknya barang-barang yang tidak dilengkapi dokumen resmi,” tegasnya. Sementara itu Kasi Kepabeanan dan Cukai Entikong, Husni Thamrin mengakui, sembilan unit mobil box yang diamankan pihak kepolisian

PU Provinsi Kerjakan Jalan Kabupaten Sambungan dari halaman 17

bertanggungjawab untuk pemeliharaan jalan tersebut. Apakah Provinsi mau mengalokasikan anggaran untuk pemeliharaan Jalan Dara Juanti,” tanyanya. Seharusnya, lanjut Morjiri, Jalan Dara Juanti ini dikerjakan oleh Bina Marga Dinas PU Kabupaten Sintang agar ada pemeliharaan jalan setiap tahunnya. Dia menegaskan secara aturan kewenangan, pengerjaan jalan tersebut sudah salah. Kalau pun jalan tersebut dianggap sebagai jalan menuju kawasan cagar budaya karena adanya Museum Dara Juanti dan Masjid Jami. Pembangunan jalan

tersebut tidak harus dilakukan disemua ruas jalan yang ada. “Pembangunan yang dilakukan oleh Cipta Karya cukup di sekitar kawasan Museum dan Masjid Jami saja. Tidak masalah jika jalan di sekitar kawasan ini dijadikan jalan lingkungan tapi akses jalan lain tetap menjadi jalan kabupaten,” ujarnya. Morjiri juga mempertanyakan kalau jalan ini dikerjakan oleh Cipta Marga Dinas PU Provinsi dan menjadi jalan lingkungan, siapa nantinya yang akan bertanggungjawab terhadap pemeliharaan jembatan yang ada di sepanjang Jalan Dara Juanti. Plt Dinas PU Kabupaten Sintang, Askiman membenar-

kan adanya pengerjaan Jalan Dara Juanti yang dikerjakan oleh Cipta Marga PU Kalbar. Dia mengatakan pihaknya baru mengetahui kemarin karena ada laporan dari masyarakat. Sementara dari Dinas PU Kalbar tidak pernah melakukan koordinasi ke Dinas PU Kabupaten Sintang untuk pengerjaan jalan tersebut. “Kami tidak tahu mengapa jalan tersebut dikerjakan PU Provinsi padahal status jalan tersebut jalan kabupaten yang belum pernah ada perubahan status,” ungkapnya. Kalau pun kawasan tersebut, lanjutnya dianggap kawasan cagar budaya sehingga harus ada pembangunan jalan

lingkungan. Seharusnya tidak semua ruas jalan yang dikerjakan. Dia mengatakan kalau jalan tersebut dijadikan jalan lingkungan maka kekuatan Jalan Dara Juanti menjadi berkurang. Tapi kalau jalan ini tetap menjadi jalan kabupaten kekuatannya mencapai 8 ton. “Sangat disayangkan jika jalan tersebut kekuatannya berkurang karena di kawasan ini merupakan kawasan industri juga bukan hanya kawasan cagar budaya,” ujarnya. Askiman sangat mempertanyakan mengapa ada pengerjaan pembangunan di Jalan Dara Juanti ini. Apalagi pembangunan dilakukan tanpa koordinasi. (tra)

Partai diperbolehkan Kampanye Sambungan dari halaman 17

satu ketua partai di buka oleh Satpol PP karena tidak mengikuti aturan,” jelasnya. Karena itu, ia mengingatkan meskipun parpol su-

dah diperbolehkan melakukan kampanye tetap harus mengiktui aturan yang telah dikeluarkan pemerintah setempat. “Meskipun boleh, parpol tetap harus mengikuti

aturan. Jika dari KPU belum ada memberikan tempat untuk pemasangan alat peraga itu, jadi tunggu dulu. Karena KPU akan melakukan koordinasi terlebih dahulu,” jelasnya.

Untuk pemasangan alat peraga itu, tambah dia, dibuat dalam Surat Keputusan Walikota, yang tetap memperhatikan keindahan, ketertiban dan estetika kebersihan kota. (mse)

bagi orang tua yang memiliki anak remaja terutama anak perempuan agar selalu di kontrol betul-betul anaknya pergi kemana dan dengan siapa agar tidak terjadi hal yang seperti ini lagi,” katanya.

Pelaku diamankan beberapa hari lalu tepatnya 2 Maret lalu oleh kepolisian pelabuhan. Saat ini prosesnya sedang dalam pemeriksaan lebih lanjut untuk pengembangan kasusnya. (sgg)

Bawa Kabur Gadis ke Surabaya Sambungan dari halaman 17

sudah dibawa ke Surabaya dengan menggunakan kapal dari Pontianak ke Surabaya. Kepolisian kemudian berkoordinasi dengan kepolisian

pelabuhan di Surabaya dan kemudian berhasil menemukan pelaku dan korban. “Penangkapannya, Polsek Kembayan bekerja sama dengan Polres Pelabuhan Surabaya. Ia menghimbau

27

Intai Penampung Curanmor SANGGAU--Kapolsek Mukok, Iptu Deni Gumelar, Rabu (6/3) kemarin menyampaikan bahwa dalam rangka operasi panah 2013, pihaknya   telah melakukan razia kendaraan yang melintas di kawasan Kecamatan Semuntai dalam rangka kegiatan imbangan Operasi Panah Kapuas 2013 yang dilaksanakan tanggal 28 Februari-14 Maret 2013 dengan sasaran kendaraan bermotor yang dicurigai hasil kejahatan. “Jadi kita lakukan monitoring dan pengawasan dengan ranmor yang ada hubungannya dengan pencurian, dalam kegiatan tersebut di samping melakukan identifikasi kendaraan dengan menanyakan

surat menyurat kendaraan juga memberikan imbauan kepada masyarakat agar masyarakat waspada dalam menyimpan kendaraan baik di pelataran parkir ataupun dirumah,” ujarnya. Ia juga mengharapkan warga menggunakan kunci ganda. Sedangkan untuk rumah yang akan ditinggalkan dalam keadaan kosong hendaknya diperiksa sebelum bepergian agar tidak dimasuki oleh pencuri. “Dalam kegiatan tersebut yang berlangsung beberapa hari kemarin polisi belum menemukan kendaraan dimaksud, namun Kapolsek tetap akan secara terus menerus melakukan kegiatan razia tersebut dan

tempatnya akan berpindah pindah, terutama di jalur yang ramai dilalui kendaraan, dan juga tempat atau lokasi yang mungkin dijadikan sebagai penampungan barang atau kendaraan hasil curian,” katanya. Sejauh ini di wilkum Polsek Mukok belum ada indikasi tempat atau lokasi yang dijadikan sebagai penampungan kendaraan hasil curian. Namun, pihaknya akan tetap terus melakukan penyelidikan. “Saya sudah perintahkan kepada kanit reskrim, kanit intel dan para babin kamtibmas seyogyanya bekerja sama dengan tokoh masyarakat untuk mengantisipasi hal tersebut,” tambahnya. (sgg)

Tolak Tangki Siluman Sambungan dari halaman 17

terjadi kemacetan,” ujar Hatta. Dari banyaknya SPBU yang ada di Kabupaten Sintang hampir setiap harinya di penuhi dengan kendaraan yang hendak mengisi Bahan Bakar Minyak (BBM). Salah satu contoh yang kerap menjadi sorotan adalah SPBU dikawasan Tugu BI Sintang. “Coba kalau kita lihat dipagi hari, Kendaraan berjubel di areal tugu BI,” imbuh Hatta. Tidak hanya di Areal SPBU Tugu Bank Indonesia (BI) di SPBU Abang Adek tepatnya di Jalan Sintang Pontianak juga terjadi hal yang sama. “Saya lihat memang hampir semua SPBU yang selalu dipa-

dati kendaraan,” imbuhnya. Lebih lanjut Hatta berharap dengan SPBU yang ada untuk memperketat aturan besaran pengisian BBM. Pasalnya tidak jarang ada segelintir masyarakat yang melakukan pengisian BBM menggunakan tangki siluman. “Saya berharap Kalau ada yang menggunakan tangki siluman SPBU jangan dilayani alias harus ditolak,” kata Hatta. Banyaknya kendaraan yang menggunakan tangki siluman diakui Hatta memang sudah melanggar aturan hak cipta kendaraan. Hal tersebut sangat tidak di benarkan. “Selama ini kami belum pernah mengeluarkan izin penggunaan tangki siluman.

Kalau ada kendaran menggunakan tangki siluman itu pasti ilegal dan pihak berwajib bisa melakukan tindakan,” ujarnya. Sementara Fahmi salah satu pengelola SPBU Tugu BI Sintang mengakui aturan pengisian BBM bagi kendaraan ekpedisi sudah pernah di buat. Namun aturan tersebeut kurang berjalan dengan maksimal.” Kami sudah penah membuat aturan seperti itu. Khusus ekpedisi itu sebenarnya sudah kami beri waktu siang hari sekitar pukul 14.00 Wib namun mereka tidak menghiraukan, justru terkadang dari subuh sudah ada mobil ekpedisi mengantri,” pungkas Fahmi.(jie)

Gelar Berbagai Lomba Sambungan dari halaman 17

PKK ke 41 Tahun 2013 tingkat Kabupaten Sanggau. “Lomba tersebut melibatkan seluruh TP PKK kecamatan atau antar kecamatan, dan kegiatan penilaiannya akan dilakukan oleh tim penilai. Lomba ini akan

dilaksanakan dimulai tanggal 7 Maret 2013 dan berakhir  tanggal 4 April 2013,” katanya. Sehubungan dengan kegiatan ini, TP PKK Kabupaten Sanggau mengharapkan agar TP PKK Kecamatan dapat untuk mempersiapkan diri dengan sebaik-baiknya.

Ditambahkan Apolina juga, bahwa kegaiatan lomba ini sebagai seleksi dan persiapan dalam mengikuti berbagai lomba pada peringatan HKG 41 Th 2013 Tingkat Provinsi yang akan diadakan di Nanga Pinoh Kabupaten Melawi pada Bulan Juli atau Agustus mendatang. (fik)

Pacu Perekonomian Sambungan dari halaman 28

sinkronisasi. Dengan membangun infrastruktur terlebih dahulu, diharapkan investor akan melihat Kapuas Hulu. “Selanjutnya tinggal ba-

gaimana investor mau menanamkan modalnya. keamanan dan kepastian hukum harus jelas,” ujar Ade. Dampak lain lanjutnya, masyarakat yang semula pasif akan tertantang untuk bisa

lebih aktif. Hal ini yang harus diupayakan Pemkab dalam meningkatkan perekonomian. Sehingga perlu adanya program pembangunan yang diupayakan mampu mengubah keadaan lebih baik lagi. (w@Nk)

Kota Sintang Terancam Kumuh Sambungan dari halaman 28

jalan lingkungan perumahan akan diperbaiki. Dinas PU, lanjut Askiman juga sedang merencanakan membuat kawasan permukiman baru untuk mengantisipasi terbentuknya permukiman kumuh karena tidak teraturnya kawasan permukiman. “Genjala-gejala terbentuknya permukiman kumuh sudah mulai

tampak di Kota Sintang. Hal ini harus segera diantisipasi,” tegasnya. Rencana pengembangan kawasan permukiman baru, kata Askiman, direncanakan akan diarahkan ke arah Jalan Lingkar Sungai Durian untuk kawasan Sungai Durian. Untuk kawasan Tanjung Puri, pengembangan kawasan permukiman baru direncanakan ke arah Baning Kota, Sungai

Ana dan Jelora. Sementara di daerah KKI dan KKU, permukiman diarahkan ke daerah daratannya. Namun kendalanya, masih ada kebiasaan penduduk yang membudaya yaitu masyarakat suka hidup dan mendirikan permukinan di tepian sungai. Seharusnya kawasan permukiman diarahkan menjauh dari tepian sungai agar kawasan permukiman tidak terkena banjir. (tra)

Garuda akan Ambil Rute Putussibau Sambungan dari halaman 28

penerbangan kedepan, terangnya, akan dilihat dari trafik penguna jasa penerbangan. Apabila besar, Garuda bisa melayani penerbangan setiap hari. Untuk tahap awal akan dicoba 3 hari sekali karena Bandara Pangsuma Putussibau tidak memiliki tempat untuk refuel (pengisian ulang bahan bakar). “Jadi pesawat tersebut harus bawa tiga kali lipat bahan bakar yang maksudnya untuk Pontianak-Putussibau pulang pergi plus alternatif kalau belum bisa mendarat. Ini menambah beban pesawat, sebab itu membutuhkan landasan yang panjang juga,”jelas Sony. Sedangkan untuk harga tiket, Sony mengatakan akan disesuaikan dengan kisaran antara Rp 700.000,- hingga Rp. 1.200.000,-. Dengan keunggulan ayoman pesawat CRJ-

1000 yang juga merupakan pesawat yang tercangih buatan Canada ini diharapkan dapat memenuhi keinginan para penguna jasa. “Ini pesawat baru tercangih buatan Canada, tentu jauh lebih nyaman dari pesawat Garuda yang ada dan sudah dipakai di beberapa rute,”ujarnya. “Kita berharap perluasan bandara bisa hingga 1800 meter sehingga load penumpang bisa lebih banyak,” imbuh Soni. Dengan hadirnya respon positif dari pihak maskapai penerbangan Garuda, Bupati Kapuas Hulu, AM Nasir SH menuturkan pihaknya sangat menyambut baik apabila dibuka rute penerbangan dari Putussibau ke Pontianak. Dengan demikian para investor perlu lagi takut-takut datang ke Kapuas Hulu untuk mengambil bagian mengembangkan daerah ini. “Pihak Garuda datang untuk

merespon surat yang kita sampaikan waktu itu, yang diberkan kepada Kementrian Perhubungan dan Garuda. Dengan ini tentu memudahkan datangnya investor. Jadi mereka tidak takuttakut lagi,”ungkap Nasir. Orang nomor satu di Bumi Uncak Kapuas ini pun mengutarakan terkait persiapan Bandara Pangsuma Putussibau, di tahun 2013 ini Pemerintah Pusat telah menyiapkan dana senilai 25 Milyar untuk penambahan landasan selebar 250 meter. “Sebingga landasan tersebut jadi 1650 meter. Selanjutnya akan kita upayakan bertahap hingga 1800 meter, karena kita juga terbatas pada anggaran,”imbuh Nasir. Bupati mengharapkan agar Pemerintah Pusat dan RPR RI dapat segera merealisasikan pelebaran bandara sehingga Maskapai Penerbangan Garuda bisa segera beroprasi. (w@Nk)

Anggaran Pilkades Sambungan dari halaman 28

“Panitia juga tidak bisa berbuat banyak, terpaksa dana semua proses dibebankan kepada cakades, padahal masa pelaksanaan pilkades itu jelas dan terdata dengan baik, desa mana saja yang akan melaksanakan pilkades juga bisa diketahui sehingga pemkab tinggal mengalokasikan dana untuk penyelenggaraan pilkades itu, ini juga bagian dari proses demokrasi yang berkeadilan,” tukasnyanya. Menurutnya, bisa saja konflik pemilihan kepala desa muncul lantaran calon yang kalah ternyata tidak terima dan menginginkan dana yang

sudah disetorkan untuk kebutuhan panitia itu minta dikembalikan. “Uang sudah keluar tidak sedikit, tapi tidak terpilih, itu bisa jadi akan pemicu persoalan dikemudian hari,” tukasnya. Sementara lanjut dia, bagi yang terpilih juga akan berpotensi melakukan kecurangan dalam penggunaan anggaran desa karena sejak proses hingga terpilih, mereka juga keluar dana yang tidak sedikit. Sementara itu, Sekda Sintang, Zulkifli HA mengatakan sejauh ini memang belum ada alokasi anggaran untuk mendukung terlaksananya Pilkades dari Pemkab Sin-

tang. “ Yang ada bar u ADD, khusus untuk pilkades itu belum ada karena belum ada aturan di tingkat daerah yang mengatur itu, entah kedepan juga kita belum tahu seperti apa,” ujarnya. Secara aturan juga menurutnya desa itu memiliki aturan khusus dan kalau belum ada aturan yang membolehkan daerah membantu alokasi anggaran untuk pilkades, tentunya pemkab juga tidak berani. “Khawatir malah nanti jadi temuan, tapi hal ini bisa jadi pertimbangan, damn sejauh ini memang belum ada kebijakan mengarah kepada hal itu,” pungkasnya. (mus)


28

PRO-KALBAR Pontianak Post

Sosialisasi

Anggaran Pilkades ANGGOTA Dewan Perwakilan Rakyat Daerah (DPRD) Kabupaten Sintang, Usmandy S meminta Pemkab Sintang mengalokasikan anggaran untuk membantu penyelenggaraan pemilihan kepala desa, karena selama ini calon kepala desa yang terpaksa keluar uang untuk membiayai proses pemilihan. “Saya pikir sah sahsaja ada alokasi dari daerah dan itu bisa saja dititip lewat alokasi dana desa ketika pada Usmandy S tahun anggaran dimana pemilihan akan dilaksanakan,” kata dia kepada Kapuas Post, Rabu (6/3) di Sintang. Artinya kata dia ADD yang dialokasikan pemerintah itu untuk desa yang akan melaksanakan Pilkades bisa ditambah, meskipun mungkin masih belum bisa membiayai sepenuhnya, setidaknya ada dukungan besar dari pemerintah daerah untuk menyukseskan pesta demokrasi yang ada di desa. “Pilkades ini sangat demokratis, bahkan ketika orde baru pun, saat bupati masih ditunjuk, kepala desa sudah dipilih langsung rakyat,” ujar mantan kepala desa era orde baru ini. Kalau bisa dikatakan ketidakadilan tentunya hal yang wajar karena kata dia selama ini untuk pemilihan bupati, gubernur sampai presiden, semua proses yang dijalankan didanai oleh negara, sementara dalam pilkades, terpaksa calon kades yang akan meramaikan pesta demokrasi merogoh saku mereka untuk membiayai proses pemilihan.

Kamis 7 Maret 2013

Garuda akan Ambil Rute Putussibau PUTUSSIBAU – Maskapai penerbangan Garuda Indonesia merencanakan masuk ke Putussibau. Melayani kebutuhan masyarakat akan penerbangan dari Putussibau ke Pontianak. Pihak maskapai Garuda, Rabu (6/3) kemarin hadir di Putussibau dan melakukan tatap muka ke Pemerintah Kabupaten Kapuas Hulu. Hadir dalam pertemuan itu, Bupati Kapuas Hulu, AM Nasir. Sedangkan dari pihak Garuda di hadiri Sony,

Manager Marketing Maskapai Garuda Pontianak. Manager Marketing Maskapai Garuda Pontianak, Sony menuturkan tatap muka sekaligus rapat bersama tersebut berhubungan dengan Surat Bupati Kapuas Hulu agar Maskapai Garuda bisa terbang ke Putussibau. Untuk itu pihak garuda meninjau dulu teknis dilapangan seperti kapasitas Bandara Pangsuma Putussibau. “Pesawat kami yang terkecil

itu adalah CRJ-1000. Ini yang paling kecil dengan kapasitas 12 eksekutif 84 ekonomi yang membutuhkan landasan kurang lebih 1800 meter. Sedangkan yang ada saat ini 1400an meter tetapi akan ada peningkatan dari Pemerintah. Kalau sudah siap baru Garuda bisa dari Pontianak terbang ke Putussibau,” papar Sony. Untuk penentuan jadwal Ke Halaman 27 kolom 5

Mentebah Segera Gelar MTQ

Ke Halaman 27 kolom 5

Infrastruktur

Pacu Perekonomian KETUA DPRD Kapuas Hulu, Ade M Zulkifli mengatakan, guna meningkatkan perekonomian masyarakat, Pemkab Kapuas Hulu mesti terus meningkatkan p e mb a n g u na n i n frastruktur. “Kita minta Pemkab Kapuas Hulu untuk terus melakukan pembangunan infrastruktur untuk meningkatkan perekonomian masyarakat. Sehingga seluruh lapisan masyarakat sampai tingkat bawah merasaAde M Zulkifli kannya,” katanya. Menurutnya, semua program tersebut bisa dilakukan. Ia mencontohkan, pembangunan jalan dilakukan secara swakelola oleh masyarakat, rehabilitasi sosial daerah kumuh berupa pemberian bahan bangunan, dan program lain yang menyentuh kehidupan masyarakat. Dengan program pembangunan yang baik dan diterapkan oleh Pemkab Kapuas Hulu, diharapkan dapat meningkatkan perekonomian masyarakat sehingga terjadi

ISTIMEWA

RENCANA: Jenis pesawat CRJ 1000 yang bakal dioperasikan Garuda untuk melayani rute Pontianak-Putussibau.

ISTIMEWA

TERANCAM: Kota Sintang dari ketinggian, bakal terancam kumuh apabila pembangunan ke depannya tidak tertata dengan baik dan sesuai dengan tata ruang kota yang ada.

Kota Sintang Terancam Kumuh SINTANG – Dalam beberapa tahun ke depan, jika penataan kota tidak baik maka Kota Sintang bakal menjadi kota yang kumuh. Pasalnya selama ini tidak ada perencanaan sebaran kawasan permukiman yang teratur. Saat ini sebagian besar sebaran kawasan permukiman penduduk berada ditepian sungai. “Inilah yang menyebabkan Kota Sintang rawan menjadi kota yang kumuh,” ungkap Plt Dinas PU Kabupaten Sintang, Askiman, Rabu (6/3). Dia mengatakan belum lagi

persoalan tidak terawatnya drainase di sektor kota. Kondisi ini akan mempercepat Kota Sintang menjadi kota yang kumuh. Untuk itu, mulai tahun 2013, Dinas PU Kabupaten Sintang sedang mempersiapkan dana khusus untuk perencanaan perbaikan drainase seluruh sektor kota. Sekarang ini, lanjut Askiman banyak sekali titik-titik genangan air karena drainase kota jarang sekali mendapatkan perawatan sementara sebaran permukiman penduduk semakin banyak. Kondisi tersebut membuat per-

Ke Halaman 27 kolom 5

c

M

y

K

mukaan tanah semakin tertutup sehingga membuat resapan air berkurang. Akibatnya akan terjadi genangan air di saat hujan turun. “Inilah yang membuat harus dilakukan survey secara total untuk penanganan drainase baik itu drainase primer maupun sekunder yang ada di dalam kota,” ujarnya. Dia mengatakan ke depan seluruh drainase di kota baik itu drainase pada jalan utama yang berstatus jalan kabupaten dan Ke Halaman 27 kolom 5

PUTUSSIBAU – MTQ ke-4 tingkat Kecamatan Mentebah siap digelar. Kegiatan rencananya akan dibuka langsung Bupati Kapuas Hulu AM Nasir SH sekitar pukul 19.30, Kamis (7/3), di Pesantren Syahrun Nur, Desa Suka Maju, Kecamatan Mentebah. Abang Ahmad Syarif SHi, ketua panitia mengatakan MTQ yang dipusatkan dikomplek pesantren Syahrun Nur ini diikuti sekitar 35 peserta dari delapan desa. Mereka akan bertanding dicabang Fahmil Quran, Tarhil Quran, Tilawatil Quran, Tartil Quran, Hifzil Quran dan Khattil Quran. “Pelaksanaan dari tanggal 7 - 10 Maret,” kata Syarif, Rabu (6/3). Disamping merupakan ajang memperebutkan piala umum Ketua LPTQ Kapuas Hulu, lanjutnya, MTQ ini sekaligus untuk seleksi kandidat untuk mengikuti MTQ tingkat kabupaten. “Dewan hakim ada dari kecamatan dan ada pula dari kabupaten,” ujarnya.Syarif mengatakan melalui MTQ tersebut diharapkan umat Islam, khususnya di Kecamatan Mentebah dapat memahami dan mengamalkan ajaran dalam Al-Quran. “Kita harap pelaksanaan MTQ ke-4 ini bisa berjalan lancar dan sukses,” katanya. MTQ tingkat kecamatan Mentebah ini, lanjut Syarif sempat terhenti. Untuk itu kedepannya diharapkan kegiatan serupa dapat dilangsungkan setiap tahunnya. Selain untuk mencari bibit-bibit berbakat, ajang MTQ ini diharapkan dapat membentuk insan yang sesuai dengan ajaran Al-Quran. Syarif memaparkan Kecamatan Mentebah memiliki potensi diajang MTQ. Berdasarkan sejarah,Qori atau Qoriah Kecamatan Mentebah sudah beberapa kali mewakili Kapuas Hulu diajang MTQ tingkat Provinsi Kalbar. Malahan pada tahun 2008, Qori dari Kecamatan Mentebah pernah menyabet juara 2 diajang MTQ tingkat Provinsi Kalbar yang diselenggarakan di Singkawang. “Dengan rutinnya kita menggelar event ini diharapkan akan akan lebih banyak lagi bermunculan bibit-bibit MTQ yang dapat mewakili Kapuas Hulu ditingkat provinsi Kalbar. Selain itu dengan rutin diselenggarakan, diharapkan akan menjadi motivasi bagi masyarakat Kecamatan Mentebah,” tutupnya. (w@Nk)


Pontianak Post

29

Kamis 7 Maret 2013

SOCCER Top of the Match

Jika David de Gea mendapat sorotan di leg pertama, kali ini giliran Diego Lopez. Reflek bagus dan kepercayaan diri yang dimilikinya berbuah tujuh penyelamatan. Di antaranya dua kali sundulan Nemanja Vidic serta beberapa kali peluang dari Robin van Persie dan Danny Welbeck.

Flop of the Match Nani (Man United)

Keane Merah, Mou Kuning

9

Diego Lopez (Real Madrid)

3,5

Terlepas layak atau tidak kartu merah yang diterimanya, nama winger Portugal ini akan dikenang sebagai faktor dibalik kekalahan United. Setidaknya, ekspektasi Sir Alex Ferguson dengan memberi kepercayaan starter kepadanya ketimbang Wayne Rooney tak memberikan implikasi di lapangan. (dns/bas) Keterangan: 1-5 flop of the match, 6-10 top of the match

PRO kontra mewarnai kartu merah yang diterima Nani pada menit ke-56. Ada yang setuju winger Manchester United itu memang layak diusir karena aksinya terhadap Alvaro Arbeloa. Ada pula suara yang menilai keputusan wasit Cuneyt Cakir berlebihan. Roy Keane, eks kapten United, termasuk yang pro dengan kartu merah. Keane yang menjadi komentator di sebuah stasiun televisi mengatakan, wasit telah membuat keputusan tepat. ”Itu merupakan pelanggaran dan sangat berbahaya,” kata Keane kepada ITV. “Sudah jelas pelanggaran itu layak mendapat kartu merah. Nani tahu

ada pemain lain yang mengincar bola dan kredit untuk wasit karena dia sempat berbicara dengan asisten wasit sebelum membuat keputusan,” imbuh pria 41 tahun yang membela United periode 1993 sampai 2005 itu. Keane lantas membandingkan dirinya yang semasa pemain dikenal sebagai salah satu pemain yang akrab dengan kartu merah. “Setiap saya diusir wasit, saya selalu berpikir apakah saya layak menerimanya ? Jawabannya adalah ya. Saya tahu semua orang di Manchester United sangat kesal sekarang. Tapi, Nani melakukan pelanggaran keras. Disengaja atau tidak, itu tetap

Reaksi Kartu Merah Nani via Twitter

Man United

@Joey7Barton (Joey Barton, gelandang Olympique Marseille)

@nmartyn25 (Nigel Martyn, mantan kiper Inggris)

”Malu oleh penilaian Roy Keane di ITV bahwa kartu merah Nani tepat. Membuktikan bahwa gagasan eks pemain selalu memberikan wawasan adalah omong-kosong. #MUFC” @DesKellyDM (Des Kelly, eks pemain dan kolomnis Daily Mail)

”Keputusan buruk yang sulit dipercaya dari wasit. Kartu merah mengubah keseluruhan laga untuk #manchesterunited” @GullitR (Ruud Gullit, legenda Belanda)

MERAH: Wasit asal Turki Cuneyt Cakir memberikan kartu merah langsung kepada Nani karena menganggap melakukan pelanggaran keras. AFP PHOTO / ANDREW YATES

sebelum laga mengadakan kesepakatan personal dengan pelatih

United Sir Alex Ferguson untuk menjaga sportivitas itu. (dns)

Real MADRID lolos dengan agregat 3-2

“Kartu merah untuk itu adalah lelucon!” “Wasit sampah, mata (Nani) hanya tertuju pada bola!!!”

berbahaya,” tutur mantan pelatih Sunderland dan Ipswich itu. Berbeda dengan Keane, pelatih Real Jose Mourinho menganggap kartu merah Nani terlalu keras. Di sisi lain, Mourinho menyangkal bahwa Arbeloa berpura-pura kesakitan. ”Saya selalu melarang keras pemain untuk berpura-pura demi menekan wasit untuk membuat keputusan yang salah,” kata Mourinho seperti dilansir Marca. ”Kasus antara Nani dan Arbeloa sangat berbeda. Ada kontak fisik yang keras antarmereka. Wasit lalu memberikan kartu merah meskipun saya setuju itu seharusnya kartu kuning saja,” imbuh pelatih yang

1 v 2

Real Madrid

Berubah Setelah Kartu Merah

”Man of match-nya adalah Diego Lopez dan wasit...” @Elia22Mangala (Eliaquim Mangala, defender FC Porto)

”Bagaimana mungkin Anda memberi kartu merah untuk itu?” Apakah dia serius...?” Menyedihkan membunuh laga besar seperti itu... #ManUvRealM” @KPBofficial (Kevin Prince Boateng, gelandang serang AC Milan)

”Itu tak layak (berbuah)kartu merah” @VincentKompany (Vincent Kompany, kapten Manchester City)

“Selamat wasit, Anda merusak laga” @JozyAltidore (Jozy Altidore, penyerang AZ Alkmaar)

”Wasit benar-benar membunuh Manchester United!” @GaryLineker (Gary Lineker, eks kapten Inggris)

”Manchester United superior bahkan tanpa bola, mendominasi tanpa possession. Wasit memberikan pengaruh lebih besar ketimbang yang seharusnya” @GuillemBalague (Guillem Balague, jurnalis harian Spanyol AS)

Nani Ceroboh, Cakir Taat Regulasi Regulasi Regulasi pertandingan FIFA (FIFA Laws of Game) dalam Law 12 Article 21 mengenai kartu kuning dan kartu merah menyatakan : “Seorang pemain bersalah karena melakukan pelanggaran serius (serious foul play) apabila dia menggunakan kekuatan yang berlebihan atau brutal terhadap pemain lawan saat memperebutkan bola dalam permainan. Menggunakan kekuatan berlebihan berarti pemain memiliki kesengajaan membahayakan keselamatan lawan”. Insiden Nani Nani tidak menunjukkan unsur kesengajaan. Dia hanya berusaha menyambut bola di udara dalam upaya mengontrolnya. Dia juga terlihat baru mengetahui keberadaan Alvaro Arbeloa di depannya pada detik-detik terakhir. Analisa Dalam hal ini, Nani menunjukkan aksi “ceroboh” (reckless). Dan, menurut regulasi FIFA, kecerobohan yang membahayakan atau memberikan konsekuensi berbahaya kepada pemain lawan hanya berbuah kartu kuning.Yang jadi masalah, pemikiran wasit tidak sama seperti pemain atau penonton. Wasit punya otoritas dan pengamatan tersendiri, termasuk telah mempertimbangkan track record pemain bersangkutan. Jadi, Cuneyt Cakir tak bisa disalahkan karena dia hanya berusaha menaati regulasi. (dns/bas)

MANCHESTER -- Sampai menit ke-55, laga di Old Trafford kemarin sepertinya bakal menjadi milik Manchester United. Apalagi United telah memimpin 1-0 atas Real Madrid berkat gol bunuh diri Sergio Ramos pada menit ke-48. Gol yang tercatat sebagai gol ke-6.000 di era Liga Champions. Tapi, situasinya berubah semenit kemudian. Kartu merah kontroversial diberikan wasit Cuneyt Cakir kepada Nani setelah kaki winger United itu mengenai dada bek kanan Real Alvaro Arbeloa. Jika dengan pemain lengkap saja Setan Merah - sebutan United - bersusah payah meredam serangan Real, apalagi hanya dengan 10 orang. Benar saja. Real sukses membalikan keadaan dengan dua gol hanya dalam rentang tiga menit (63’ dan 66’). Setelah Luka Modric memecah kebuntuan Real, Cristiano Ronaldo menjadi penentu tiket perempat final untuk Los Merengues (sebutan Real) dengan agregat 3-2. Itu berarti dua kali CR7 sukses mem-

bobol gawang mantan klubnya. Sebiji gol Ronaldo tak hanya menjadikannya sebagai pemain tersubur Liga Champions musim ini dengan 8 gol. Tapi, Ronaldo yang disambut hangat di Old Trafford itu telah menyalip torehan gol legenda Portugal, Eusebio, dalam sejarah Liga Champions. Ronaldo 48, Eusebio 47. Sukses Real melewati hadangan United berarti menjaga asa La Decima atau misi Los Merengues memenangi gelar kesepuluh di Liga Champions. Juga sebagai kado ultah klub yang ke-111 (6/3). “Sampai sejauh ini, kami belum memenangi apapun,” kata entrenador Real Jose Mourinho seakan mengerem ekspektasi berlebihan klubnya kepada Reuters. Mourinho juga mengatakan, timnya beruntung melewati United. Real, lanjutnya, belum tentu mencetak gol dan menang dengan 11 lawan 11. Tidak semata karena kartu merah, melainkan juga karena performa tim yang tidak optimal. Itu

C

M

Y

K

karena pemain terbaik dalam laga kemarin adalah kiper Real Diego Lopez. “Kami tidak layak menang, tapi beginilah sepak bola. Tim terbaik lah yang kalah hari ini (kemarin, Red). Ketika seorang kiper menjadi pemain terbaik, berarti tim Anda tidak bermain bagus,” tutur pelatih berjuluk The Special One itu. Mourinho juga menyebut koleganya, pelatih United Sir Alex Ferguson, memainkan strategi yang tepat untuk meredam Real. Itu termasuk keputusan tidak menurunkan Wayne Rooney sebagai starter. Rooney yang dalam leg pertama tak berbuat banyak itu baru masuk 17 menit terakhir atau setelah kedudukan 1-2. Sayang, tak ada reaksi dari Ferguson. Pelatih yang akrab disapa Fergie itu memilih bungkam seusai laga karena sangat kecewa dengan wasit. Itu bisa terlihat dari telunjuknya ke arah wasit seusai laga. Asisten pelatih Mike Phelan pun bertindak sebagai perwakilan Fergie.

“Penampilan hebat harus dirusak dengan satu keputusan. Semua orang di ruang ganti kami hanya bisa bersedih, termasuk pelatih. Keputusan itu (mencadangkan Rooney) juga bagian dari strategi,” kata Phelan kepada Sky Sports. Kartu merah Nani memang mengubah jalannya pertandingan. Tapi, Ferguson yang sarat pengalaman itu seharusnya bisa menata ulang strategi untuk mencegah gawang David de Gea kebobolan dua gol terlalu cepat. Bukankah Mourinho pernah mengatakan sebelum leg pertama, United bisa melewati Real dengan catatan Setan Merah tidak membuat kesalahan ? ”Berhadapan dengan 10 pemain mungkin lebih mudah bagi Real Madrid. Tapi, kita harus menghormati keputusan wasit. Jika Anda sudah unggul satu gol, lalu terkena kartu merah, kemudian kebobolan dua gol, kekalahan seperti itu memang sulit diterima. Tapi, sekali lagi, kita tetap harus menghormati keputusan wasit,” papar Ronaldo seperti dilansir Eurosport. (dns)


ALL SPORT

30 Klitscho Pilih Mantan Sparring Partner

Pontianak Post

z

Kamis 7 Maret 2013

Lakers Terus Berjuang ke Delapan Besar MINIMAL 35 POIN, 10 REBOUND, 5 ASSIST VS LAKERS (20 Musim Terakhir) 2012-2013 2000-2001 1997-1998 1996-1997 1995-1996 1995-1996 1993-1994

Wladimir Klitschko (kiri) dan calon penantangnya Francesco Pianeta

+

BERLIN N - Juara dunia tinju kelas berat Wladimir Klitschko akan mempertahankan empat sabuknya 4 Mei mendatang. Petinju asal Ukraina memilih menghadapi mantan sparring partnernya Francesco Pianeta di Mannheim, Jerman. Klitschko sekarangmemegangempatsabukjuara dunia kelas berat yakni IBF, IBO, WBO, dan WBA. Pianeta petinju berdarah Jerman-Italia tersebut adalah sparring partner Klitschko tahun lalu. Klitschko, 36 tahun memang adalah petinju kelas berat terhebat saat ini. Rekornya mengagumkan, 59 menang (50 KO) dan tiga kalah. Tahun lalu, Klitschko sukses tiga kali mempertahankan gelarnya termasuk menang angka telak atas petinju Polandia Mariusz Wach November lalu di O2 World Arena, Altona, Hamburg. Pianetadiprediksiakanmenjadilawantangguhbagi Klitschko. Memiliki tinggi 193 sentimeter, lima sentimeter lebih pendek ketimbang Klitschko, rekor bertanding Pianeta juga luar biasa. Dia tidak pernah terkalahkan dalam 29 pertandingan (28 menang dan satu seri). “Saya memiliki respek yang besar bagi Pianeta karena dia sangat muda dan memiliki fighting spirit yangt sangat besar,” ucap Klitschko mengenai lawannya yang berusia 28 tahun tersebut kepad Reuters. (nur/ang)

MURDOCH JR./NBAE VIA A GETTY IMAGES/AFP

CETAK POINT: Pemain Oklahoma City Thunder Russell Westbrook (tengah) saat akan mencetak point diganggu pemain Los Angeles Lakers Dwight Howard (#12) pada pertandingan NBA di Chesapeake Energy Arena, Oklahoma City (6/3).

OKLAHOMA CITY-Jika Los Angeles Lakers berhadapan dengan Oklahoma City Thunder sejak 2009, ada satu nama yang konsisten menjadi momok. Namanya Russell Westbrook. Point guard muda berusia 24 tahun tersebut selalu tampil luar biasa, tak terhentikan.

Kemarin Westbrook menjadi inspirator penting kemenangan Thunder atas Lakers 122-105 di kandang sendiri Chesapeake Energy Arena, Oklahoma City. Anggota tim nasional Amerika Serikat di Olimpiade London 2012 tersebut tampil lengkap dengan 37 poin, 10 rebound,

+

lima assist, dan dua steal dalam 36 menit. Westbrook menjadi orang pertama setelah Antawn Jamison (Golden State Warriors) pada musim 2000-2001 yang mencetak setidaknya 35 poin, 10 rebound, 5 assist melawan Lakers.

Russell Westbrook (Oklahoma City Thunder) r Antawn Jamison (Golden State Warriors) Clyde Drexler (Houston Rockets) Scottie Pippen (Chicago Bulls) David Robinson (San Antonio Spurs) Karl Malone (Utah Jazz) David Robinson (San Antonio Spurs)

Kecepatan Westbrook meninggalkan penjaga utamanya, superstar Kobe Bryant. Pada pertandingan tersebut terlihat jelas bahwa Kobe yang berusia 10 tahun lebih tua sudah kehabisan nafas untuk meredam laju Westbrook. KomponenLakerslainnya seperti Steve Nash, Steve Blake, Steve Carell yang bergantian menjaga juga tak mampu menghentikan tiga kali NBA All-Star tersebut. Westbrook bermain dengan kecepatan yang konstan. Juga agresif. Dia terus meneror barisan pertahanan Lakers dengan drive tajam dan beberapa dunk bertenaga. “Yeah, itu sangat menyenangkan,” ucap Westbrook seperti dilansir ESPN ketika ditanya tentang pertarungannya dengan Kobe. “Dia adalah kompetitor. Saya suka berkompetisi sebaik mungkin. Namun saya juga suka kemenangan,” tandas jebolan University of California, Los Angeles (UCLA) itu. Partner sehati Westbrook, Kevin Durant juga tampil lu-

mayan dengan 26 poin. Di luar kedua bintang tersebut, ada empat pemain lainnya yang mencetak double digit poin. Di sisi lain, walau sempat mengalami cedera siku, Kobe masih mampu mendulang 30 poin, terbanyak di timnya. “Kita tak seatletis mereka. Jadi, jika kita membiarkan mereka bermain dengan kekuatannya, kita dalam masalah,” ucap Kobe. Mike D”Antoni, head coach Lakers menambahkan. “Saya sudah bilang ke pemain, mereka sangat bagus. Mereka mungkin adalah tim terbaik di Wilayah Barat,” ujarnya. Thunder sekarang nyaman berada di peringkat dua wilayah barat dengan rekor menangkalah 44-16. Mereka satu tingkat di bawah San Antonio Spurs (47-14). Sedangkan Lakers masih berkutat di peringkat 9 Wilayah Barat (30-31). Butuh kerja sangat keras bagi Lakers untuk bisa berada di zona delapan besar agar bisa menembus playoff musim ini. (nur)

+

+

C cmyk

M

Y

K


Pontianak Post

Football lovers

Kamis 7 Maret 2013

31

Europa League

Spurs Bakal Ganas ASIAN Handicap dan rumah bursa dunia kompak mengunggulkan Tottenham Hotspur yang tengah dalam performa terbaiknya. Dengan memberikan voor sampai 3/4 kepada Inter, berarti Spurs diprediksi bisa menang dengan margin dua gol. Keuntungan yuang ditawarkan rumah bursa pun hanya maksimal 1,83 kali lipat untuk petaruh Spurs (Paddy Power), sedangkan yang berani menjagokan Nerazzurri bakal sukses di White Hart Lane bakal diganjar keuntungan 5,01 kali lipat oleh Pinnacle. (dns) Bursa Home Draw Away William Hill 1,75 3,75 4,5 Bwin 1,72 3,7 4,6 Pinnacle 1,74 4 5,01 Paddy Power 1,83 3,6 4,33 Data dan Fakta *Satu-satunya duel kedua kubu di kompetisi Eropa terjadi pada fase grup Liga Champions 2010/2011. Jika di agregat, Tottenham unggul 6-5 setelah menang di kandang 3-1 dan kalah 3-4 di San Siro. *I Nerazzurri memiliki catatan buruk pada delapan laga tandang terakhir di Serie A. Mereka hanya sanggup menang sekali dan seri sekali. Sedang sisanya, enam kali kalah. (sbn)

tOttenham

Inter Coba Hentikan Bale! LONDON - Inter Milan memiliki performa yang naik turun di pertengahan musim ini. Meski demikian, saat ini mereka ingin menemukan momentum bangkit saat menghadapi Tottenham Spurs di babak 16 besar Liga Europa. Kedua tim akan saling beradu di White Hart Lane, Kamis (7/3/2013) malam atau Jumat dinihari nanti. Gelandang bertahan Esteban Cambiasso meyakini

dapat menghentikan laju positif bintang Tottenham, Gareth Bale pada leg pertama 16 besar Liga Europa, Jumat (08/03) dini hari. Masih jelas pada ingatan kita aksi gemilang Bale, kala mencetak hattrick ke gawang Internazionale di Liga Champion musim 2010/11. Kini, kedua tim tersebut kembali bertemu di atas lapangan hijau guna memperebutkan tiket ke delapan besar. Sadar performa Bale ten-

INTER

4-2-3-1 TOTTENHAM 32

11

Assou-Ekoto

Bale

20 1

28

Alvarez

14

9

Holtby Adebayor

19

Walker

4 Zanetti 40

21

Lloris

Vertonghen

4-2-3-1

11

8

Dawson Parker

5

Dua Pertemuan di Eropa 03/11/10 Tottenham 3-1 Inter Liga Champions 21/10/10 Inter 4-3 Tottenham Liga Champions

inter

v

8

29

Palacio

57

Gargano

1

Handanovic

Kovacic

26

19

Dembele

Lennon

Juan

Chivu

Cambiasso 7

31

Schelotto

Perreira

Stadion : White hart Lane, London Pelatih :Andre Villas-Boas Pelatih: Andrea Stramaccioni

C

m

y

gah on-fire, Cambiasso; mantan pemain Real Madrid, yakin timnya kompeten bisa menghentikan pemain Timnas Wales tersebut.”Untuk saat ini Bale memang berada dalam performa terbaik dan saya tak terkejut dengan hal itu. Dia adalah salah satu pemain terbaik di dunia.” ungkap Cambiasso mengenai kualitas mantan pemain Southampton tersebut.”Tetapi Nerazzurri juga memiliki skuad yang kuat, saya yakin kami bisa menghentikan Bale,” lanjutnya. Eks asisten Harry Redknapp semasa menangani Tottenham Hotspur, Joe Jordan, yakin jika Inter Milan bisa melewati The Lilywhites di babak 16 besar Liga Europa. Bahkan Nerazzurri dinilai mampu menjuarai kompetisi itu. Spurs sendiri sedang hot di mana mereka saat ini ada di posisi ketiga klasemen Liga Inggris dan punya Gareth Bale yang tengah tajamtajamnya. Dengan kondisi terkini jelas Spurs lebih diunggulkan bisa menyingkirkan Inter di kompetisi ini. Tapi menurut Jordan, La Beneamata punya peluang sama besar dan bahkan lebih besar untuk bisa melewati Spurs sekaligus tampil di final serta jadi juara.

k

Apalagi Int e r su d a h m e n u n j u kkan perbaikan mental para pemain pasca laga comeback kontra Catania akhir pekan lalu. Kebetulan Jordan bersama Redknapp pernah menghadapi Inter di fase grup Liga Champions dua musim lalu. “Saya rasa laga ini akan sulit untuk Inter. Wajar jika mereka akan sedikit mengorbankan sesuatu di London dan Spurs akan jadi favorit di leg pertama,” ujar Jordan seperti dilansir Football Italia. “Saya melihat pertandingan Inter melawan Catania dan mereka terlihat bagus. Mereka tim solid dan terbangun dengan baik. Saya pikir Inter punya segalanya untuk bisa melaju lebih jauh di Liga Europa,” demikian Jordan.(ran)


ANDREW GARFIELD

32

D

â&#x20AC;&#x153;Ahem, you know, if youâ&#x20AC;&#x2122;re going to steal cars, donâ&#x20AC;&#x2122;t dress like a car thief.â&#x20AC;?

ISNEY kembali membuat film bergenre Action/Adventure/ Fantasy dengan judul â&#x20AC;&#x153;Oz the Great and Powerfulâ&#x20AC;? yang akan dirilis pada bulan Maret 2013. Film ini disutradarai oleh Sam Raimi, yang terkenal dengan The Spiderman Trilogy dan Alice in Wonderland! Begitu mendengar judul â&#x20AC;&#x153;Alice in Wonderlandâ&#x20AC;?, kamu pasti langsung terbayang landscape yang indah bak negeri dongeng dan segala keunikan dunia

IN FACT:

Pontianak Post Ę Kamis 7 Maret 2013

- Spiderman -

fantasi di dalamnya. Dan benar saja, kalau kamu menyaksikan trailer Oz the Great and Powerful, kamu akan langsung terkagum dengan dunia dongeng yang digambarkan di dalamnya. Film ini berkisah tentang Oscar Diggs (James Franco), seorang ahli sulap dari sebuah sirkus kecil dengan karakter eksentrik, yang menemukan dirinya â&#x20AC;&#x153;Oz, the Great and Powerfulâ&#x20AC;? diadaptasi dari buku tahun 1939, berjudul â&#x20AC;&#x153;The Wonderful Wizard of Ozâ&#x20AC;? oleh L. Frank Baum. Film ini akan disutradarai oleh Sam Raimi (Drag Me to Hell) dan skripnya ditulis oleh David Lindsay-Abaire (Rabbit Hole), lalu ada Joe Roth (Alice in Wonderland) yang akan duduk di bangku produser. Film yang sedianya akan menjadi prekuel dari â&#x20AC;&#x153;The Wizard of Ozâ&#x20AC;? yang terkenal itu.

Pendalaman Srintil Selama Setahun PRISIA NASUTION sangat sukses dengan perannya sebagai penari ronggeng dalam film Sang Penari. Cewek yang akrab disapa Pia ini pun sukses membawa pulang Piala Citra berkat perannya sebagai Srintil. Sebelumnya, Pia memang sangat tertarik menjadi bagian dalam Sang Penari. Ia sampe menjalani 2x casting dan mengambil kursus singkat akting di Sydney. Casting pertama gagal, kemudian ia membaca bukunya dan berpikir akan sayang kalau nggak dapat peran di cerita itu. Dia pun nggak mempermasalahkan jika hanya mendapat peran pembantu walaupun hanya dapat 3 adegan. Namun ternyata di-casting lagi dan dapat peran Srintil. Setelah mendapat peran Srintil, ternyata tantangan yang dihadapinya nggak sedikit. Mulai

terbawa dari Kansas yang membosankan, ke Land of Oz. Saat pertama kali tiba di negeri ajaib ini, ia mengira dirinya telah menemukan puncak kejayaan dan ketenaran akan menjadi miliknya hanya

dari dialek, kebutuhan menari, sampai latar belakang cerita di tahun 1960-an. Ia menjalani pendalaman akting untuk peran Srintil sekitar setahun, belajar langsung dari penari ronggeng dan banyak berbaur dengan masyarakat. Nggakhanyaitu,kesehariannya yang akrab dengan perkotaan bertolak belakang dengan kehidupan desa karakternya. Dia rela tak membawa laptop dan gadget. Padahal sebenarnya dia adalah gadget-freak, hanya telepon genggam yang dibawa. Wah, total banget ya kakak satu ini demi mendalami peran. Wajar lah kalau banyak memboyong piala. Salute! FYI, untuk proyek selanjutnya Prisia akan berperan sebagai Laura bersama Adinia Wirasti dalam film Laura & Marsha yang akan membawa penonton keliling Eropa.**

Movie Freak

Twilight Saga memang PHQMDGLÂżOPYDPSLUH\DQJ SDOLQJGLJHPDULDQDNPXGD WHWDSLGLEDOLNLWXDGDMXJD OKRVDODKVDWXVHULDOYDPSLUH EHUMXGXOVampire Diaries. 6HULDOVDWXLQLPHQMDGLVHULDO IDYRULW$\X$IULDQL\DQJ NHEHWXODQVDQJDWPHQ\XNDL ÂżOPEHUEDXYDPSLUHVampire DiariesPHPLOLNLNHPDVDQ FHULWD\DQJMXJDQJJDNMDXK KHEDWQ\DGDUL7ZLOLJKW6DJD BY : GHEA LIDYAZA SAFITRI

Sebelum James Franco, Robert Downey Jr. & Johnny Depp pernah masuk daftar yang ditawari untuk berperan sebagai karakter utama, namun keduanya menolak. Franco, yang berusia 32 tahun sebelumnya juga membintangi â&#x20AC;&#x153;127 Hoursâ&#x20AC;? dan â&#x20AC;&#x153;Rise of the Apesâ&#x20AC;?.

denganmenjentikkanjari. Semuanya itu berubah ketika ia bertemu dengan ketiga penyihir: Theodora (Mila Kunis) Evanora (Rachel Weisz) dan Glinda (Michelle Williams). Ketiga penyihir tidak yakin bahwa Oscar adalah penyihir terhebat yang dinanti-nantikan oleh semua orang. Oscar pun terlibat dalam pertempuran epik yang melanda Land of Oz dan penduduknya.

James Franco melakukan persiapan khusus untuk peran dalam film ini. Ia mengaku banyak belajar sulap. Ia menghabiskan waktu berbulan-bulan bersama Lance Burton di Las Vegas untuk pendalaman peran. Ia pun belajar mengeluarkan kelinci dari topi.

Vampire Diaries merupakan salah umurnya yang dewasa terbakar di satu serial yang menceritakan kisah hadapannya. Disitu membuat Ayu seorang perempuan bernama Elena terenyuh seperti ikut merasakan yang memiliki wajah serupa Katrine berada di posisi Elena. Meskipun sang vampire cantik yang mengubah begitu Elena tetap tegar menghadapi warga di sekitarnya menjadi vampire semua masalah yang menerpa dan termasuk Stephan dan Damon. berusaha melindungi adiknya. Scene Akibatnya, ia pun menjadi incaran yang mencerminkan keluarga itu para vampire jahat yang ingin menjadi bagian penting dengan pesan mengubahnya menjadi seorang moral yang dapat banget. vampire. Perjuangan para keluarga Film ini di-recommended olehnya dan sahabat membuat Elena lolos karena nggak hanya menceritakan dari para vampire jahat dengan harus gimana menghadapi masalah keluarga merelakan keluarga dan sahabatnya dan teman, tapi juga menghadapi berubah menjadi vampire. Kehilangan masalah percintaan. Tapi yang nonton keluarga dan sahabat menjadi hal harus berumur 18 tahun keatas ya, terpahit bagi Elena karena banyak adegan yang akhirnya sempat yang nggak boleh berpikir untuk bunuh ditonton. Pokoknya diri dan membuat film ini banyak kekacauan, karena menggambarkan tanpa disadar i ia realita dan sebagai justru disuntikkan pelajaran dalam darah vampire oleh m e n g h a d a p i seorang dokter yang suatu problema. membuatnya hidup K e u n t u n g a n sebagai vampire. menonton serial ini Scene yang menjadi dibandingka film pada favorit mahasiswa umumnya adalah keperawatan FIK serupa dengan yang Untan ini adalah ketika ada di novelnya, Elena menyaksikan nggak mengalami kedua orang tuanya pemotongan seperti Ayu Afriani yang baru ia temui di di dalam film. **

C

M

Y

K

PEMAIN : James Franco, Mila Kunis, Rachel Weisz, Michelle Williams, Zach Braff, Joey King, Abigail Spencer, Bruce Campbell, Natalie Gal Ć&#x201D; SUTRADARA : Sam Raimi Ć&#x201D; GENRE : Petualangan, Fantasi Ć&#x201D; RILIS : 8 Maret 2013

Mariah Carey akan mengisi soundtrack film ini, berjudul â&#x20AC;&#x153;Almost Homeâ&#x20AC;? yang dirilis 19 Februari 2013 lalu. â&#x20AC;&#x153;Almost Homeâ&#x20AC;? ditulis sendiri oleh Mariah Carey dengan bantuan Simone Porter, Justin Gray, dan Lindsey Ray serta diproduseeri oleh Stargate. Video klipnya disutradarai oleh David LaChapelle. Single ini menjadi tanda kembalinya Carey ke dunia musik, setelah lama tidak mengeluarkan album dan single beberapa tahun terakhir.

PENGGEMAR KISAH VAMPIRE

Mahasiswi FKIK Untan

Berbekal keahlian sulap yang dimilikinya, Oscar pun sedikit demi sedikit berubah menjadi penyihir hebat Wizard of Oz, dan juga menjadi pria yang lebih baik. (*/int)


Ada enam makanan yang wajib dikonsumsi jika ingin menurunkan kadar kolesterol. Yakni, yoghurt, serat, kacang-kacangan, minyak sehat seperti minyak zaitun, gandum, serta kedelai dan produk turunannya seperti susu atau tahu. Seperti diungkapkan Gabby Logan, pegiat kampanye antikolesterol di Inggris. DAILY MAIL

Tahukah

Anda?

Pontianak Post Kamis 7 Maret 2013

33

T a s t e

Masakan khas Indonesia seperti tak ada habisnya karena begitu beragam, mulai dari kue ringan tradisional hinga makanan berat pun setiap daerah di penjuru negeri pasti memilikinya. Indonesia memang patut diacungi jempol bila bicara tentang kulinernya tersebut. Kekayaan alam membuat masyarakat Indonesia pandai mengolahnya menjadi makanan yang sedap. Semua tersaji menggugah selera dan membangkitkan keinginan siapapun untuk mencicipinya. Kali ini For Her akan mengulas beberapa diantaranya yang banyak dikenal dan cukup memiliki penggemar.

B

erbicara mengenai apa saja kuliner khas di nusantara, tentu hampir di setiap penjuru daerah di Indonesia memiliki makanan khasnya masing-masing dengan berbagai cita rasa yang berbeda. Kuliner-kuliner ini pun sangat beragam. Ada yang bisa dikategorikan sebagai makanan berat, ada juga yang hanya sekedar sebagai cemilan atau makanan ringan. Kita pun pastinya sudah sering mendengar bahkan pernah merasakan berbagai macam kuliner khas nusantara yang sudah begitu terkenal semisal rendang, makanan dari daging yang merupakan kuliner khas Padang (Sumatra Barat), juga berbagai kuliner makanan ringan semacam Batagor dan Siomay yang berasal dari Bandung (Jawa Barat). Selain itu terdapat juga beberapa kuliner khas nusantara lainnya yang sudah pasti tidak

Oleh: Deliana asing lagi di telinga kita seperti Pempek Palembang (Sumatra Selatan), lalu ada Gudeg di Jogja, Soto Banjar (Kalimantan), Coto Makassar (Sulawesi Selatan), Bubur Manado (Sulawesi Utara) dan masih banyak lagi kuliner nusantara di daerah-daerah lain yang tentunya memiliki keunikan rasa tersendiri pada makanannya. Itulah kelebihanan kita sebagai bangsa Indonesia, bangsa yang begitu kaya akan kulinernya. Makanan khas Indonesia juga dinilai memiliki cita rasa yang tak kalah dengan makanan dari negara lainnya. Mungkin bagi kebanyakan diantara kita meragukannya, namun hal ini begitu terasa saat bepergian atau menetap ke luar negeri. Beberapa diantara kita banyak yang merindukan kuliner Indonesia. Seperti yang pernah dialami oleh Ardian (24) yang dulu sempat mengenyam pendidikan kuliah di Australia. Kepada For Her, ia mengaku rindu dengan

rendang. “Karena saya orang Padang, untuk membiasakan lidah dengan makanan lain agak susah. Rendang itu makanan yang bikin kangen saat dulu menetap di Sydney,” komentarnya. Beruntung disana banyak terdapat komunitas orang-orang Indonesia, Ardian pun tak perlu memendam rindu terlalu dalam terhadap masakan khas Indonesia favoritnya. “Yah, kalau ada gathering, semua yang tersaji itu masakan Indo, jadi bisa makan ngobatin kangen sementara walaupun terkadang tidak seenak seperti kalau kita makan langsung di rumah makan Padang di negeri sendiri,” ujar warga Paris 2 yang selalu berbekal sambal botol saat bepergian ke luar negeri ini. Sebagai warga negara Indonesia, Emilia Astuti (26) mengaku bangga dengan kekayaan kuliner Indonesia yang bisa memanjakan lidahnya. Emil yang menggemari batagor dan pempek sebagai ce-

milan ini kerap menjatuhkan pilihan pada kedua jajanan tersebut untuk dinikmati saat santai atau rehat kerja. “Batagor itu sangat Indonesia, bisa kita lihat dari bumbu kacangnya yang diracik dengan kacang tanah, asam jawa, gula merah, dan bumbu-bumbu lainnya. Pempek juga citarasanya sangat nusantara, rasa ikan tenggirinya, kuahnya yang asam pedas manis segar itu enak sekali,” timpal warga Perum IV Tanjung Hulu ini. Untungnya, untuk memenuhi rasa dahaga akan cemilan khas Indonesia ini dirinya tak perlu jauh-jauh mencari karena di dekat tempat tinggalnya pun sudah banyak yang menjual. “Kalau pempek sih di Tanjung Hulu banyak yang berjualan setiap sore hingga malam, batagor juga sudah ada jualan di Jalan Panglima Aim. Tiap pulang kerja, bisa mampir dan bungkus untuk bawa pulang ke rumah,” tuturnya. Penggemar kuliner khas In-

Rosemary

Tanaman Rosemary ini memiliki aneka manfaat yang berbeda. Mulai dari bunga hingga daunnya dapat dimanfaatkan, baik untuk relaksasi maupun bumbu dapur. Nah, rosemary kering umumnya dimanfaatkan sebagai bumbu rendaman atau olesan pada olahan daging. Memberikan tambahan aroma yang lebih wangi pada menu masakan.

Oregano

Ada beberapa bumbu kering ‘bule’ yang ternyata sudah populer juga di Indonesia. Mudah didapatkan dalam bentuk instant, bumbu-bumbu ini seringkali ditambahkan dalam menu masakan barat yang dihidangkan di meja makan.

Daun oregano seringkali ditemukan dalam menu masakan Italia. Aromanya istimewa dan berbeda. Biasanya ditambahkan pada spaghetti atau saat menyajikan saus pizza dan roti-roti lainnya. Tersedia dalam bentuk bubuk oregano halus dan ada juga yang kasar.

Thyme

Anda mungkin sudah sering mendengar daun yang satu ini. Thyme umumnya ditambahkan pada menu berkuah. Dan kabarnya juga bisa membantu meringankan gejala flu lho.

C

m

y

k

donesia berikutnya, Dwi Rasmana (21) juga mengungkapkan kebanggaan yang serupa akan kayanya kuliner khas Indonesia. Perempuan berhijab ini salut dengan lengkapnya penggunaan bumbu-bumbu tradisional khas Indonesia yang tak kalah dengan masakan-masakan western. “Kita punya banyak rempah, bahkan potensi rempah-rempahan kita yang begitu kaya tersedia di alam itulah yang dijadikan sasaran para penjajah dari Eropa dulu,” ungkap warga Jeruju ini. Berkomentar tentang makanan khas nusantara favoritnya, Dwi jatuh hati pada sate. Menurutnya, sate merupakan makanan yang lezat dan aromanya menggoda. “Sate itu enak, setiap makan sate yang saya cicip terlebih dahulu itu bumbu kacangnya.Ya, apalagi kalau satenya pas lagi dibakar itu sambil dikipas-kipas. Aromanya bikin lapar, pingin makan. Huah! Membicarakannya sekarang saya

Bay leaves

Daun yang satu ini biasanya digunakan untuk membuat masakan berkuah lebih kental. Ditambahkan pada bumbu kaldu dan saus.

saya jadi lapar,” ujar perempuan yang senang makan sate Pak Ali dibilangan Pasar Mawar. Kuliner Indonesia lainnya yang tak kalah digemari adalah Coto Makassar. Di Pontianak, Erik (30) yang menggemari kuliner asal Sulawesi Selatan ini selalu meminta dibuatkan oleh mertuanya yang jago memasak. “Coto Makassar itu citarasanya tidak bisa dilupakan. Bisa gitu jeroan diolah jadi empuk dan enak. Kuahnya juga gurih, mungkin karena penggunaan bumbu-bumbunya yang beragam,” komentarnya. Selain Coto Makassar, Erik juga menggemari kuliner umum lainnya seperti Soto dan Bakso. “Saya pecinta makanan berkuah, jadinya kuliner khas Indonesia yang saya sukai juga pastinya yang berkuah. Makanan-makanan khas Indonesia ini murah meriah dan bisa kita temukan dimana saja, rasanya sudah mendarah daging dengan citarasa seperti itu,” tutupnya. **

Curry leaves

Daun kari, terkenal di India dan dunia barat sebagai bumbu untuk bahan masakan kari. Aromanya sangat khas dan membuat masakan kari jadi lebih kental serta beraroma spesial. (*/bbsb)


34

Pontianak Post

z

Kamis 7 Maret 2013

+

+

+

+

C cmyk

M

Y

K


Pontianak Post

Kamis 7 Maret 2013

ANGGAR

Pahru ke Bangkok PONTIANAK—Pahru Resmana siswa SMA Negeri I Mempawah, yang merupakan atlet floret kadet putra pada Jumat kemarin berangkat ke Jakarta. Dia akan mengikuti kejuaraan anggar Asian Cadets-Juniors Fencing Championship di Bangkok Thailand, 6-11 Maret 2013. “Pahru bergabung bersama kontingen anggar Merah Putih lainnya. Ini kesempatan emas baginya untuk mengembangkan kemampuannya di nasional dan internasional. Apalagi di usianya yang masih remaja,” ungkap Sunardi, Pelatih Anggar Mempawah. Pahru Resmana, ungkap Sunardi, selama ini ditangani oleh Hardianus Samuel yang merupakan atlet peraih medali perunggu di PON lalu. Pahru adalah atlet peringkat satu nasional untuk nomor floret kadet putra. “Dia memiliki bakat yang istimewa dan saya

yakin akan mampu mengikuti jejak paar seniornya,” kata Sunardi. Kejuaraan anggar kadet junior Asia merupakan kalender tetap Federasi Anggar Asia. Untuk tahun 2013 ini digelar di Island Hall, Fashion Island Shoping Centre Bangkok Thailand. Pahru berangkat sebagai atlet Prima Kemengpora. Bayu Indra Gunawan sebagai pelatih dari Jakarta menyertainnya ke Thailand. Selain Pahru Resman dari Mempawah, satu atlet Sintang Devina Septiani, atlet degen putri turut diberangkatkan oleh PB Ikasi. Lebih lanjut Sunardi juga mengucapkan terima kasih atas bantuan dan dukungan yang diberikan oleh KONI Kabupaten Pontianak yang turut mendukung keikutsertaan Pahru di kejuaraan tersebut. (bdi)

WALIKOTA CUP II

SMA 1 Targetkan Juara SMA Negeri 1 Pontianak siap tampil dalam Turnamen Sepakbola Walikota Cup II yang akan berlangsung 23 Maret mendatang di Stadion Keboen Sajoek PSP. Hal itu diungkapkan Manager tim SMAN 1 Joko Mardiono. “Kita siap tampil dan merebut juara di turnamen ini,” ungkap dia kepada Pontianak Post kemarin. Menurut dia, SMAN 1 Pontianak memiliki sejumlah pemain yang siap diandalkan untuk berlaga di even bergengsi ini. Sebanyak 16 pemain telah dipersiapkan baik fisik maupun mental. “Kami sudah mulai mempersiapkan diri sejak beberapa waktu lalu. Terutama mengasah fisik pemain,” katanya. Kendati menargetkan juara, dia mengakui tak mudah untuk merebutnya. Sejumlah tim hebat bakal dihadapi

diantaranya SMAN 3, SMAN 4 dan SMA Muhammadiyah yang selama ini memang memiliki track record baik di dunia sepakbola. “Namun kita akan berusaha sebaik-baiknya,” ungkap dia. Sementara itu Sy Abdurahman panitia Walikota Cup II menegaskan, seluruh SLTA di kota Pontianak baik negeri maupun swasta di harapkan segera mengembalikan formulir atau daftar nama pemain (DNP) paling lambat pada tanggal 16 maret mendatang. Dirinya menghimbau kepada peserta untuk melampirkan dengan lengkap segala persyaratan baik dari foto copy raport dan foto pemain. “Setiap sekolah wajib membawa raport asli saat screening test pada 18,19, 20 Maret mendatang di Stadion PSP Pontianak,” pintanya. (bdi)

METRO SPORT

35

Meteor A Lolos 8 Besar PONTIANAK—Tim bola voli putri, Meteor A semakin optimis setelah berhasil lolos masuk depan besar dalam turnamen antarklub Persatuan Bola Voli Seluruh Indonesia (PBVSI) Kota Pontianak. Di mana Meteor A berhasil menuntaskan pertandingan melawan tim Kapuas dengan skor 3-0. “Pertandingan kedua ini akhirnya berhasil juga kita selesaikan dengan kemenangan. Meskipun lawan bertanding hebat. Mungkin kita menang karena kita lebih kompak saja. Untuk selanjutnya kita akan bertanding dengan club yang lolos delapan besar,” kata Spiker Meteor A, Debby Anindya Putri, Rabu (6/2) usai pertandingan di GOR Pangsuma. Dia menambahkan lawan yang dihadapi di laga delapan besar merupakan lawan-lawan yang tangguh. Pada laga kemarin, mereka masih tetap diperkuat oleh Ayoendari, MEIDY/PONTIANAK POST LOLOS : Perlawanan lumayan ketat diberikan tim Kapuas saat Fransiska, Nurul, Dhita, Erma, Vega, berhadapan dengan tim bola voli putri Meteor A. Namun laga Dea, dan Ria. Di set pertama Metoer A mendapatkan perlawanan itu berakhir dengan kemenangan bagi Meteor A.

lumayan dari Tim Kapuas. Namun set pertama berhasil direbut Metoer A dengan skor 25-14. Tampaknya kemenangan di set awal itu menjadi pertanda bagi mereka untuk menyelesaikan laga secara cepat. Buktinya mereka juga berhasil meraih set kedua meski dengan skor yang relatif tipis 25-21. Di set penentuan, Meteor A menyudahi perlawanan Kapuas 25-18. “Untuk pertandingan di delapan besar kita harus mencabut undian kembali. Di mana nantinya baru kita ketahui tim lawan di delapan besar. (Hari ini, 7/3) tim meteor A akan kembali bertanding untuk memperebutkan lolos di semi final. Untuk itu kita harus tampil optimis. Menang atau kalah tidak jadi persoalan. Tapi jangan pernah sia-siakan keringat yang kita teteskan di dua laga pertandingan yang telah kita lewati bersama,” pungkas Debby dengan semangat. Sementara itu, hingga berita ini diturunkan, sejumlah laga lainnya masih berlangsung. (irn)

One’s Atletik Klub Seleksi Sea Games I PONTIANAK—One’s atletik klub mengikuti kejuaraan nasional Jawa Timur Open 2013 di Stadion Delta Sidoarjo. Di mana kejuaraan atletik tersebut merupakan momentum pertama seleksi Sea Games 2013 di Myanmar. Untuk pesertanya diikuti oleh cabang atletik se Indonesia. “Untuk perwakilan atletik Kalbar ada lima orang. Dimana mereka hadir dikejuaraan Nasional Jatim Open 2013 tersebut. Kejuaraan itu, dilangsungkan pada 9-12 Maret 2013. Kelima atletik tersebut di ikuti dari one’s atletik klub

C

M

Y

dan Kodam XII Tanjungpura,” kata Donny Nurdiansyah, Pelatih Pengprov PASI Kalbar. Donny menyampaikan nama atletik yang akan mengikuti kejuaraan Jatim open 2013. Untuk One’s atletik klub diwakilkan oleh tiga atletik. Fenny Veranika, nomor lomba lompat jauh dan lompat jangkit. Sri Yulianti, nomor jalan cepat 10 ribu meter dan Khairul, nomor lompat jauh. Kemudian lanjut, Donny menyampaikan dua nama peserta dari Kodam XII/Tanjungpura. Erlinawati, nomor lari 100 meter

K

dan 200 meter dan Imran, nomor lari 1500 meter dan 5000 meter. “Keberangkatan atletik disambut baik ketua klub, Arif Krisna, Ketua HIPMI Kalbar,” ungkapnya. Dia mengungkapkan target akan dicapai tidak dapat diperdikisikan. Namun dia berharap maksimal dapat membawa perak. Terutama untuk dikejuaraan lompat jangkit putri. Sendangkan atletik putra masih belum dapat diprediksikannya. Menurutnya, kejuaraan yang dilangsungkan merupakan ajang seleksi Tim Sea Games 2013.

Donny mengulas kembali untuk lolos ke Sea Game haruslah melewati tiga kali penyeleksian Tim pemain. Seleksi pertama di bulan Maret 2013 yang dilaksanankan. Seleksi kedua di bulan April 2013 kejuarnas junior remaja. Seleksi ketiga di bulan Juni kejurnas senior. “Jika ketiga seleksi berhasil memenuhi syarat yang ditetapkan oleh PB PASI. Maka berhak atletik tersebut mewakili Indonesia di ajang Sea Games di bulan Desember 2013 di Myanmar,” pungkasnya. (irn)


36

SOCCER

Pontianak Post

Kamis 7 Maret 2013

Subotic: Mungkin Ini Tahunnya Dortmund DORTMUND - Borussia Dortmund yang kurang impresif di liga domestik, justru tampil apik di Liga Champions musim ini. Neven Subotic, berujar mungkin ini tahun Die Borussen di kompetisi level Eropa. Dortmund tercecer jauh dalam perburuan gelar Bundesliga 2012-2013 dari rival beratnya, Bayern Munich. Mereka yang duduk diperingkat dua dengan koleksi 46 poin tertinggal 17 angka dari Die Roten di puncak klasemen. Sama halnya di kancah Piala Jerman, Dortmund juga kalah bersaing dengan Bayern. Tim besutan Juergen Klopp itu didepak The Bavarians di babak perempatfinal. Kendati begitu, performa Dortmund berbeda 180 derajat saat melakoni laga-laga di Liga Champions. MarioGoetzedkk.mamputampilbagushinggamelajukeperempatfinaldenganrekorbelumterkalahkan. Bahkan, Dortmund yang tergabung bersama Real Madrid, Manchester City, dan Ajax Amsterdam, bisa keluar sebagai juara di babak penyisihan grup. Penampilan apik Dortmund itu berlanjut di babak 16 besar. Mereka sukses menyingkirkan Shakhtar Donetsk dengan agregat 5-2. Bek Dortmund, Subotic, lantas berharap musim ini akan menjadi tahun kejayaan tim yang dibelanya di kompetisi tertinggi antarklub Eropa. “Kami pasti juga berharap (tahun ini akan menjadi kesuksesan Dortmund di Eropa). Kami ada dalam performa yang bagus,” jelas Subotic seperti dilansir Sky Sport. “Kami menunjukkannya hari ini bahwa kami bisa menang melawan tim yang terbiasa bermain di Liga Champions, mereka selalu bermain dalam empat atau lima tahun terakhir.” “Kami juga menunjukkan bahwa bersaing dalam grup berat, kami bisa lolos di posisi pertama. Pastinya sejauh ini, menjadi musim Liga Champions kami, dan kami berharap bisa melaju sejauh yang bisa kami capai,” tambah bek timnas Serbia itu. Sepanjang sejarah berkiprah di Liga Champions, Dortmund pernah sekali menjadi juara. Mereka meraihnya pada musim 1996-1997 usai menang 3-1 atas wakil Italia, Juventus.(int)

KALAHKAN: Gelandang Dortmund Mario Goetze (tengah) diantara pemain Shakhtar Donetsk pada pertandingan leg kedua babak 16 besar Liga Champions dini hari kemarin, Dortmund mengalahkan tamunya 3-0 dan memastikan kiprahnya ke babak perempat final. AFP PHOTO / PATRIK STOLLARZ

DORTMUND LOLOS DENGAN AGREGAT 5-2

DORTMUND

3 V 0

SHAKHTAR

DELAPAN LAGA BELUM TERKALAHKAN Neven Subotic

DORTMUND - Tak salah menahbiskan grup D sebagai grup neraka. Dua wakil dari

grup D menjadi dua tim pertama yang menjejakkan kakinya di perempat final. Selain Real Madrid, Borussia Dortmund lolos setelah menyingkirkan Shakhtar Donetsk dengan agregat 5-2. Dortmund yang menahan seri 2-2 Shakhtar di Ukraina (13/2), bermain luar biasa di kandangnya sendiri, Signa Iduna Park, kemarin. Tiga gol tanpa balas dilesakkan ke gawang Shakhtar masingmasing via Felipe Santana (31”), Mario Goetze (37”), dan Jakub Blaszczykowski (59”).

C

M

Y

K

Lolos ke perempat final Liga Champions menjadi capaian pertama Die Borussen “ sebutan Dortmund “ setelah 15 tahun atau sejak semifinalis pada 1998. Perjalanan Sebastian Kehl cs sampai sejauh ini juga terbilang sensasional dengan belum terkalahkan dalam delapan laga. Itu termasuk menyapu bersih home kontra Real, Manchester City, dan Ajax Amsterdam. “Ini adalah momen luar biasa bagi kami. Perjalanan kami di Liga Champions musim ini memang berjalan mulus. Kami semakin memperlihatkan diri sebagai sebuah tim yang matang dan konsisten,” kata der trainer Dortmund Juergen Klopp di situs resmi UEFA. Lolos ke perempat final sekaligus masih memberi asa Dortmund untuk sebuah trofi. Untuk diketahui, Die Borussen

hampir pasti tanpa gelar di ajang domestik. Tersingkir dari Bayern Munchen di perempat final Piala Jerman (27/2) dan tertinggal 17 poin dari rival utamanya itu di Bundesliga. “Kami tidak berpikir menjadi favorit (juara) karena beberapa tim yang bermain bagus juga banyak yang tersisih. Semua lawan tersisa tangguh dan tidak akan ada undian mudah,” tutur Klopp. Meski begitu, pelatih berjuluk Kloppo itu tak memungkiri munculnya ambisi dari timnya sekarang untuk setidaknya mengulang capaian pendahulunya pada 1998. “Setelah lolos ke perempat final, sangat wajar kami menginginkan lolos ke fase berikutnya. Tapi, itu adalah pekerjaan sulit,” tutur pelatih yang membawa Dortmund juara Bundesliga 2011 dan 2012 itu. (dns)


Pontianak Post