Page 1

Pontianak Post P er t a m a da n Ter ut a m a di Kal im an t an Barat

Sabtu 1 Januari 2011 M / 26 Muharam 1432 H

Aksi Nekat Akhir Tahun 2010

Kolom Tahun Baru

Bangun Apa Saja dengan Modal Hemat Rp 2 Triliun

Cinta Ditolak, Ingin Bunuh Diri

INDONESIA akan tetap jadi salah satu bintang ekonomi dunia pada 2011. Tidak ada satu pun faktor yang membuat Indonesia tidak lebih baik. Dari sektor yang kini saya tangani, sinyal itu terlihat lebih jelas. Sektor listrik yang merupakan penggerak utama Catatan: ekonomi jauh membaik pada Dahlan Iskan 2011. ceo PLN Dua minggu lalu, ketika ke Sumut, saya minta diantar ke Kawasan Industri Medan (KIM). Saya dengar di kawasan ini sudah berhasil dibangun satu pabrik keramik yang sangat besar dengan investasi hampir Rp1 triliun. Pabrik itu tidak bisa dijalankan karena tidak mendapatkan listrik. u

3

Nampak ada seorang yang berinisiatif mengingatkan.

2

Ke Hal 7 Kolom 5

4

selebritas

Talak Cerai Teh Nini PERNIKAHAN dai kondang, KH Abdullah Gymnastiar atau Aa Gym dengan istri pertamanya, Teh Nini kandas sudah. Mereka dikabarkan sudah bercerai secara agama sekitar tiga bulan lalu. “Sudah bercerai secara agama. Kalau waktunya saya lupa,” kata sahabat keluarga Aa Gym, KH Miftah Faridl kepada wartawan, belum lama ini. Miftah mengaku mengetahui kabar perceraian Aa Gym dengan Aa Gym Teh Ninih dari sebuah majalah. Ia kemudian menanyakan kepada Teh Ninih kebenaran informasi tersebut via SMS. “Teh Ninih membenarkan informasi itu,” kata Miftah yang juga Ketua MUI Kota Bandung ini. Ia pun mengaku prihatin dan meminta Teh Ninih tabah. “Saya waktu itu meminta Teh Ninih tabah menghadapi cobaan,” kata Miftah. Kabar perceraian Aa Gym dengan Teh Ninih sudah u

Ke Hal 7 Kolom 5

Eceran Pontianak Rp.2.500

Iwan melompat terjun bebas.

PONTIANAK—Gara-gara cintanya ditolak pujaan hatinya, Iwan (30) nekat bunuh diri. Dia terjun dari ketinggian 25 meter menara Masjid Al Fallah, Sungai Jawi Jalan HRA Rahman, Pontianak Barat, kemarin (31/12). Niat bunuh diri itu diketahui warga setelah sholat Jumat. Salah satu jamaah melihat seorang pemuda berada di atas kubah menara masjid. Iwan diduga naik ke lokasi tersebut saat warga sedang shalat Jumat. Seketika lokasi kejadian langsung dikerumuni manusia yang ingin melihat. Tidak lama berselang masyarakat serta aparat langsung mencari bantuan berupa terpal plastik untuk menadah pemuda tersebut jika sewaktuwaktu meloncat dari atas. Untuk mengurung niat Iwan, sanak saudara serta sahabatnya membujuknya dengan berteriak dari bawah, namun Iwan seakan tidak mempedulikannya. Iwan tetap mengelilingi lokasi kubah, dengan sesekali berusaha untuk terjun dan melepaskan bajunya. Ia tidak mempedulikan adik sepupunya yang meraung keras hingga pingsan agar Iwan turun dan u

Iwan mendapat pertolongan setelah disambut dengan terpal oleh beberapa orang. Namun dia mengalami cidera berat, patah tulang kaki dan leher.

Ke Halaman 7 Kolom 5

foto-foto: SHANDO SAFELA/PONTIANAK POST

1

Iwan memanjat dan berdiri dari menara tertinggi (25 meter) Masjid Al Falah Sungai Jawi setelah shalat Jumat kemarin (31/12).

Senjatai Teroris dari Narkoba

Fadli Sadama Bisnis Sabu-Sabu dari Malaysia

JAKARTA – Beberapa otak teroris yang tertangkap di Indonesia diketahui beraksi secara gelap mata. Tidak hanya merampok dan menyerang markas polisi di Medan, mereka diduga menggunakan uang penjualan narkoba untuk kegiatan teroris. Salah seorang di antaranya adalah tersangka kasus terorisme Fadli Sadama yang sekarang ditahan di Rutan Brimob Kelapa Dua. Dia diketahui menjalani bisnis haram narkoba itu sejak lama. Uang hasil bisnis tersebut digunakan untuk membeli senjata dan peralatan

latihan ala militer yang lain. ”Fadli berbisnis sabu-sabu dari Malaysia. Dia menjualnya di Indonesia untuk aksi teror,” ujar Kepala Badan Narkotika Nasional (BNN) Komjen Pol Gories Mere di Jakarta kemarin (31/12). Menurut jenderal bintang tiga yang dikenal sebagai perwira tinggi yang berfokus mem-

erangi terorisme di Indonesia itu, Fadli menjual sabu-sabu secara terselubung bersama dengan jaringan Malaysia. ”Itu namanya narcotic terrorism, transaksi narkoba untuk aksi terorisme,” ujarnya. Fadli ditangkap pada u

Ke Halaman 7 Kolom 5

TN Komodo Perlu Dukungan Bersaing Menjadi Tujuh Keajaiban Dunia JAKARTA – Kementerian Kebudayaan dan Pariwisata (Kemenbudpar) terus berupaya menjadikan Taman Nasional Komodo (TMK) satu di antara tujuh keajaiban dunia. TMK saat ini masih berada di urutan ketujuh di antara 28 nomine. Kampanye pun terus digalakkan oleh Kemenbudpar di dalam dan luar negeri. Direktur Promosi dan Publikasi Ditjen Pemasaran Kemenbudpar Esthy Reko Astuty menjelaskan, ranking itu dilansir pengelola u

Ke Halaman 7 Kolom 5

Timnas Garuda setelah Gagal Raih Trofi AFF 2010 11:47

15:13

17:52

19:06 04:20

Sumber : Kanwil Depag Kalbar

Terharu Dielu-elukan Suporter hingga Kamar Hotel masyarakat Indonesia yang sudah habishabisan mendukung. Wajah para pemain makin terlihat memelas saat di depan hidung mereka para pemain Malaysia bersorak-sorai mengangkat trofi juara. Saat skuad Harimau Malaya, julukan timnas Malaysia, masih merayakan kemenangan di atas podium, satu per satu pemain Indonesia beringsut meninggalkan lapangan menuju ruang ganti. Kepala mereka tertunduk. Mata mereka sembap. Tidak satu pun kata keluar dari mulut mereka. Padahal, dalam lima laga home sebelumnya, mata para pemain selalu berbinar-binar setiap melewati jalan menuju ruang ganti. Bibir asisten pelatih

Timnas Indonesia gagal menjuarai Piala AFF 2010. Tapi, Firman Utina dkk berhasil ’’memenangkan’’ hati masyarakat Indonesia. Mereka pun terus dielu-elukan bak pahlawan. M. ALI MAHRUS-M. AMJAD, Jakarta

Tangis para pemain Indonesia pecah begitu wasit asal Australia Peter Daniel Green meniup peluit panjang tanda pertandingan berakhir. Saat para pemain Malaysia bersujud syukur atas gelar juara Piala AFF yang diraih, beberapa penggawa skuad Merah Putih bersujud lemas. Kecewa. Sedih. Merasa bersalah kepada

Online: http://www.pontianakpost.com/

FOTO ALI MAHRUS/JAWA POS

KELUARGA : Bek tim nasional, Zulkifli Syukur, bersama istrinya keluarganya saat ditemui di hotel Sultan Jakarta.

*Mempawah, Sambas, Singkawang, Bengkayang Rp 2.500 *Landak, Sanggau, Sintang Rp 3.000 *Ketapang & KKU Rp 4.000 *Kapuas Hulu Rp 3.000

u

Ke Halaman 7 Kolom 1

Jawa Pos Group Media


OPINI

2 editorial

Setgab Perlu Dievaluasi

+

KETUA MPR Taufik Kiemas mengkritik Setgab (Sekretariat Gabungan) koalisi parpol pendukung SBY-Boediono. Lembaga yang diciptakan SBY dan Aburizal Bakrie dengan tujuan mengelola kekuatan partai pendukung pemerintah itu dinilai Kiemas justru kontraproduktif dalam proses demokratisasi. Politikus senior PDIP tersebut mengistilahkan Setgab telah melawan demokrasi. Seharusnya, kritik Kiemas itu menjadi bahan renungan bagi Presiden SBY dan seluruh anggota Setgab. Bukannya melawan seperti sikap yang ditunjukkan Syarif Hasan, sekretaris Setgab. Dia justru menantang Kiemas menunjukkan pasal dalam konstitusi atau UU yang dilanggar Setgab. Memang, kalau bicara pasal atau aturan, tak ada yang diterabas oleh Setgab. Yang harus dipahami di sini bukan masalah aturan. Tapi sebuah substansi. Apakah Setgab kontraproduktif dengan proses demokratisasi? Apakah Setgab itu menguntungkan rakyat? Apakah mengganggu pembangunan? Itulah yang seharusnya dijawab. Dilihat dari kacamata demokrasi, kekuatan politik memang harus terpolarisasi. Ada yang berdiri sebagai koalisi yang menjadi bagian atau pendukung pemerintah. Di sisi lain, ada oposisi yang mengambil peran sebagai penyeimbang untuk menciptakan check and balance pemerintahan. Setgab pun sebenarnya bukan barang haram karena merupakan elemen demokrasi sebagai pendukung pemerintah (koalisi). Koalisi tersebut terdiri atas Demokrat, Golkar, PKS, PAN, PPP, dan PKB yang menguasai parlemen lebih dari 70 persen. Namun, masalah Setgab yang merupakan lembaga operasional koalisi adalah cara kerja dan etika. Kesan yang muncul, Setgab merupakan panggung parpol anggotanya untuk saling menekan dan menjadi alat tawar-menawar politik terhadap jalannya pemerintahan. Lewat lembaga itulah para anggota koalisi memperjuangkan kepentingan masingmasing daripada kepentingan yang lebih luas untuk rakyat. Anggota DPR dari Partai Hanura Akbar Faisal, misalnya, menilai Setgab justru mengganggu parlemen. Setgab telah menjadi lembaga di luar parlemen yang menentukan parlemen. ’’Setgab telah membuat proses demokrasi berjalan di luar kotak atau forum sebenarnya,’’ kritik Akbar. Intrik politik di internal Setgab juga sangat terasa. Selama ini, mereka tak pernah kompak. Contohnya, kasus hak angket Bank Century di DPR. Demokrat, PAN, dan PKB berada dalam satu kubu. Sementara itu, Golkar, PPP, dan PKS memilih jalan berseberangan yang berkumpul dengan parpol nonpemerintah. Selain itu, dalam kasus boleh tidaknya parpol masuk KPU, formasinya berbeda lagi. Demokrat dan PAN memilih KPU harus diisi orang independen. Namun, PKB yang bergabung dengan PKS, Golkar, dan PPP memperbolehkan orang parpol langsung bisa masuk KPU. Saling ancam antaranggota koalisi juga merupakan hal biasa. Golkar yang tersinggung oleh Demokrat, misalnya, langsung menggertak dengan ancaman akan menebar risiko politik. Contohnya, yang diucapkan Ketua Golkar Priyo Budi Santoso ketika tersinggung ucapan Ruhut Sitompul dalam isu reshuffle kabinet. Dengan terbuka Priyo menegaskan, tak masalah bila menteri dari Golkar diganti, namun Demokrat harus menanggung risiko politik. Fakta itu menunjukkan bahwa Setgab tak ubahnya sebuah lembaga tempat parpol anggotanya tawarmenawar kepentingan. Yang berkembang di Setgab adalah manuver parpol memperjuangkan kepentingan masing-masing. Suara Setgab ditentukan oleh parpol yang pandai bermanuver yang akhirnya manuver itulah yang mengacak arah kebijakan nasional. Tampaknya, Setgab memang harus dievaluasi untuk kepentingan yang lebih luas. (*)

+

Pontianak Post

l

Sabtu 1 Januari 2011

Guru dan Kualitas Pembelajaran Niatan membangun kualitas pendidikan tidak bisa lepas dari peran guru sebagai pendidik. Beberapa peristiwa yang sempat menodai citra guru, seperti kekerasan terhadap siswa, pelecehan terhadap anak didik, kebocoran soal ujian, bahkan perilaku oknum guru yang tidak mencerminkan sebagaimana sosok yang layak ditiru, dari beberapa pemberitaan negatif sempat menodai martabat guru yang telah sejak dahulu merupakan sosok pribadi tauladan. Berkaitan dengan profesi guru pada tanggal 2 Desember 2004 silam Presiden RI Susilo Bambang Yudhoyono (SBY) telah mencanangkan pengakuan formal terhadap guru sebagai profesi yang bermartabat. Pada pencanangan itu, Presiden SBY menegaskan bahwa profesi mulia dan luhur yang patut diberi penghargaan dan penghormatan. Pengakuan itu kian menegaskan bahwa guru menjadi pahlawan tanpa tanda jasa yang memiliki kontribusi besar pembentukan karakter siswa. Pengakuan itu kemudian dipertegas dengan terbitnya Undang-Undang No 14 Tahun 2005 tentang Guru dan Dosen yang kian memberi penegasan profesi dan martabat guru. Pengakuan guru sebagai profesi tidak saja memberi peluang mendapatkan tunjangan

Progam penanaman sejuta pohon trambesi maupun kebijakan one man one tree yang dicanangkan Kementerian Kehutanan pada Hari Tanam Pohon Sedunia tahun 2010 beberapa waktu lalu hanyalah mengandung makna simbolik dan semu belaka. Setidaknya hal tersebut bisa terbaca dengan laporan WWF maupun Greenpeace dalam kurun waktu 2005-2010 menyebutkan bahwa Indonesia merupakan juara pertama dalam pembatatan hutan (deforestasion) terbesar dunia dengan rekor 1,2 juta hektar per hari di hutan Kalimantan, Papua, maupun Sumatra. Tentunya hal ini sangatlah ironis bagi Indonesia yang merupakan pemilik hutan hujan tropis terbesar kedua di dunia setelah Brazil, dimana para negara maju sangat mengharapkan kontribusi hutan tropis Indonesia sebagai penahan laju emisi karbon yang semakin meningkat dalam kurun waktu sekarang. Posisi Indonesia

profesi satu kali gaji tetapi juga memberi tantangan dan peluang guru menjadi berkompeten. Kompetensi diperlukan sebagai dasar untuk berpikir dan bertindak sebagai guru profesional. Seorang guru profesional memiliki kompetensi akademis dan pedagogis untuk mendidik. Kompetensi guru memaksa untuk terus belajar dan mengembangkan diri. Tugas pertama guru adalah menjadi model bagi proses pembelajaran karena kegiatan utama belajar mengajar adalah belajar. Guru yang berhenti belajar akan mandek dan mengalami kesulitan mendidik secara inovatif dan menarik. Dengan banyak belajar, membaca dan berkreasi guru mendapatkan banyak pengayaan dan referensi yang menjadi daya tarik siswa yang terlibat dalam keseluruhan proses pembelajaran. Mengingat peran sentral guru dalam proses pembelajaran dan keberhasilan pendidikan berbicara kualitas pendidikan tidak bisa dilepaskan dari peran guru. Dalam kegiatan belajar mengajar guru adalah tokoh sentral. Guru menjadi pemain kunci dalam seluruh kegiatan belajar mengajar di sekolah. Guru yang kompeten menjadi faktor kunci keberhasilan pendidikan yang berkualitas dan efektivitas belajar mengajar di sekolah.

Oleh: Paulus Mujiran Pada saat ini terdapat beberapa persoalan yang masih melilit guru sehingga tidak optimal dalam menjalankan perannya sebagai pendidik. Harus diakui, kita memiliki keterbatasan jumlah jumlah guru. Disadari jumlah guru belum sebanding dengan jumlah siswa. Hal ini berkorelasi dengan rendahnya kesejahteraan menyebabkan minat menjadi guru cenderung rendah. Minat menjadi guru pun banyak didominasi dari kelas menengah ke bawah dan pedesaan. Selain kualitas guru amat rendah karena bibit yang masuk ke jurusan keguruan juga dengan kualitas yang rendah bahkan pas-pasan. Masih dengan kualitas yang kurang memadai ditunjang dengan sebaran yang tidak merata. Banyak guru lebih suka mengajar di perkotaan terutama di sekolah-sekolah elit dan sedikit guru yang mau mengabdi di kawasan terpencil apalagi pelosok pedalaman. Kondisi ini ditopang oleh kesejahteraan yang rendah sehingga guru tidak fokus dalam pekerjaan sebagai guru. Kisah guru nyambi menjadi tukang ojek, beternak atau bertani sudah sering kita dengar. Kesejahteraan yang

rendah memaksa banyak guru mencari obyekan sehingga tidak fokus dalam tugas utamanya sebagai pendidik. Demi mengejar setoran banyak guru nyambi menjadi guru les sehingga nyaris tidak ada waktu untuk mempersiapkan bahan ajar kepada siswa. Pendidikan yang berkualitas hanya mungkin ketika guru mampu menjadi guru ideal bagi siswa. Guru ideal adalah dambaan semua peserta didik. Dalam bahasa JB Mangunwijaya (1996) guru yang memberikan dirinya untuk seluruh aktivitas pendidikan. Guru ideal adalah guru yang mampu menjadi panutan dan keteladanan bagi siswa. Ilmunya bak mata air yang tidak pernah berhenti, semangatnya selalu bernyala-nyala dalam memberikan motivasi kepada siswa. Guru ideal seperti sumur yang semakin memberikan ilmunya justru semakin jernih dan menunjukkan kemurnian sebagai guru. John Dewey dalam Experience and Eduction (1938) menyatakan buku adalah sumber pengetahuan dan kebijaksanaan dari masa lalu, sedangkan guru adalah organ utama di mana siswa dibawa ke dalam hubungan yang efektif dengan bahan pengajaran yang mendidik. Guru adalah agen pengetahuan dan keterampilan yang dikomu-

Reforestasi dan Emisi Karbon kemudian juga semakin pelik dengan dinobatkannya Indonesia sebagai sepuluh besar negara penyumbang emisi karbon global di dunia dengan emisi karbon sebesar 5 - 10 % dari total emisi dunia. Oleh karena itu, kepemilikan hutan di Indonesia sendiri juga mengalami ambiguitas dimana di satu sisi hasil hutan sendiri menyumbang sektor APBN nomor dua setelah sektor migas dan juga sebagai pu n d i u a ng u t a ma da la m PAD di beberapa pemerintah daerah Kalimantan, Sumatera, maupun Papua. Sementara di sisi lainnya ancaman global semakin hari semakin nyata dimana diramalkan tahun 2050, jumlah kepulauan di dunia terutama Indonesia akan mengalami abrasi massif sehingga mengancam eksistensi pulau – pulau besar Indonesia dalam kurun waktu mendatang. Maka seharusnya kebijakan akan reforestasi hutan di pulau besar terutama Kalimantan,

Oleh: Wasisto Raharjo Jati Sumatera, maupun Papua merupakan hal yang urgen dan signifikan demi kelangsungan kehidupan di masa mendatang. Ekonomi Hijau Dilihat dari berbagai perda yang dibuat mengenai kehutanan di beberapa pemda terutama Kalimantan menunjukkan bahwa pemberian konsesi HPH, HTI, maupun HPHH sendiri kepada sektor swasta sangatlah minim mencantumkan usaha reforestasi ekologi hutan setelah dieksplorasi dan eksploitasi. Minimnya tersebut berarti menunjukkan bahwa tidak adanya itikad baik dari pemerintah daerah untuk mempunyai tanggung jawab sosial kepada lingkungan yang selama ini berjasa kepada mereka dalam bentuk pajak kehutanan yang disetorkan ke rekening PAD beberapa pemda tersebut. Padahal selama ini beberapa pemda di Kalimantan, Sumatera, maupun Papua sendiri sudah diamanatkan dalam tugas pembantuan oleh pemerintah pusat untuk menjaga kelestarian hutan di lingkungan mereka dengan stimulus 2 milyar krona dari Pemerintah Norwegia

yang setiap tahunnya memberikan insentif khusus bagi negara – negara berkembang yang memiliki hutan lebat untuk dijaga dalam rangka sebagai paru-paru dunia pengurang emisi karbon dunia. Lalu kemana larinya dana asing tersebut setelah ditransferkan ke rekening PAD pemerintah daerah, yang kini permasalahan reforestasi hutan belum menjadi isu sentral dalam pembuatan kebijakan di beberapa pemda tersebut. Adapun bilamana pemerintah daerah di Kalimantan, Papua, maupun Sumatera mau untuk melakukan skema reforestasi tersebut sama saja mereka telah melakukan kegiatan ekonomi hijau dalam bentuk reduksionalisasi karbon. Dalam hal ini perlu di ketahu i, p e rdagangan karbon menjadi isu sentral di beberapa negara dunia mengingat pemanasan global telah terasa efeknya satu dasarwasa terkahir kini. Dalam perdagangan karbon sendiri, jumlah emisi karbon hasil industrialisasi pabrik, asap kendaraan bermotor, mau p u n l i m b a h r u ma h tangga itu dihitung seberapa efeknya kepada pencemaran udara global sehingga kini membuat beberapa negara maju mulai merelokasinya industrinya ke negara berkembang, mengurangi jumlah kendaraan bermotor,

nikasikan dan aturan-aturan ditegakkan. Dengan kata lain tanpa guru pesan kebijaksanaan dan nasihat dari masa lalu tidak akan pernah sampai kepada siswa. Profesi guru mengajar dan mendidik bukan sekedar mentransfer ilmu apalagi sekedar menjejali pikiran murid dengan pengetahuan dan teknologi. Tetapi lebih dari itu tugas guru adalah mewariskan keutamaan hidup kepada generasi penerus sebagai pedoman hidup. Sekolah sebagai the second home bagi siswa dan guru sebagai the second parents bertanggung jawab terhadap penanaman nilai terhadap siswa. Penanaman nilai tidak hanya dengan ceramah atau bahasa verbal tetapi harus melalui contoh konkret melalui perilaku hidup nyata. Guru harus menjadi model pembelajaran perilaku yang cinta kehidupan, sopan santun, jujur, mencintai lingkungan dan solider dengan orang lain. Dengan begitu, profesi guru bukan saja karena kesejahteraan mereka dihargai tetapi jiwa panutan mereka tetap menjadi keutamaan bagi siswa. ** Penulis, praktisi pendidikan, Ketua Pelaksana Yayasan Kesejahteraan Keluarga Soegijapranata Semarang.

dan mereduksi konsumsi BBM semata – mata untuk menghindari pembiayaan karbon yang mereka hasilkan agar tidak semakin besar dalam transaksi perdagangan karbon. Maka sebagai gantinya, beberapa negara maju membeli jumlah emisi karbon yang dihasilkan oleh beberapa negara berkembang seperti halnya Indonesia dalam bentuk insentif pelestarian hutan hujan trop i s u nt u k m e n g ha mb at emisi global. Oleh karena itulah, penjualan emisi karbon dengan disertai usaha reforestasi hutan hujan tropis merupakan bentuk ekonomi hijau yang brilian bilamana hal itu dilakukan oleh pemerintah nasional, terlebih pemerintah daerah yang kebetulan memiliki jumlah hutan hujan tropis yang ratusan hektar seperti halnya Provinsi Kalimantan Barat, Kalimantan Tengah, Kalimantan Timur, Kalimantan Selatan, Papua Barat maupun Papua, dan juga Provinsi Riau maupun Jambi dikarenakan dari praktik perdagangan karbon saja sudah dapat memiliki sumber dana melimpah dari pihak luar. Sehingga emisi karbon dapat menjadi PAD baru dan menjanjikan. Keuntungan lain yang dipetik dengan reforestasi ialah dapat meminimalisir dampak bencana susulan yang diakibatkan oleh penggundulan hutan, penyelamatan habitat binatang endemik seperti halnya orang utan, owa, maupun burung bekantan dari ancaman kepunahan. Dan yang paling penting ikut serta dalam usaha meminimalisir pemanasan global saat ini. Maka, alangkah baiknya jika kini beberapa pemda memulai menginisiasi untuk melakukan progam ekonomi hijau dalam rencana kerja pemerintahnya dalam berbagai progam yang meyangkut tentang konservasi hutan dikarenakan potensi yang begitu besar dan menjanjikan yang didapat dari ekonomi hijau tersebut. Oleh karena itulah kerangka regulasi perlu s etidaknya diundangkan untuk menopang progam tersebut agar terjadi kejelasan hukum mengenai hal tersebut dan ikut menjaga kelestarian alam Indonesia untuk generasi mendatang. ** * Penulis, Aktif sebagai Deputi Riset & Kajian Sosial Politik Institut KOMAP FISIP Universitas Gadjah Mada.

Pontianak Post

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Per­setujuan Peru­bahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11­September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redak­si: (0561) 735070.Telepon Iklan/Pema­saran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: redaksi@pon­tianakpost.com. Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Re­daksi/Penang­gung Jawab: B Salman. Redaktur Pelaksana: Khairul­rahman, Muslim Minhard, Donatus Budiono, Basilius Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar. Sekre­taris Redaksi: Silvina. Staf Redaksi: Marius AP, U Ronald, Efrizan, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari KurJawa Pos Group niatama, Hendy Irwandi, Pracetak/Artistik: A Riyanto (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto, Sigit. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: Thoriq (Jl P Anom Telp (0562) 392683) Biro Sanggau: Anto Winarno (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Andi Chandra, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Mustaan, Budiman. Pema­saran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie, Bank: BPD Kalbar, BEII, Bapin­do. Harga Lang­ganan per 1 Bulan dalam kota Rp 65.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 25.000,- spot colour Rp 30.000,- full colour Rp 37.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, mak­­si­mal 10 baris) pem­bayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Ming­gu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.

cmyk

+

+


Pontianak Post

Pontianak bisnis

l

Sabtu 1 Januari 2011

Lokomotif Kemajuan Ekonomi Kalbar

Cukai Raup Rp65,5 T

Saham Asing Berkurang JAKARTA- Badan Pengawas Pasar Modal dan Lembaga Keuangan (Bapepam LK) dan Bursa Efek Indonesia (BEI) terus menggenjot peningkatan investor domestik seiring dengan menurunnya kepemilikan saham oleh asing. Jumlah emiten juga diupayakan terus bertambah agar harga saham tidak melonjak tajam. Ketua Bapepam LK, Fuad Rachmany, mengatakan total kapital inflow yang masuk kebanyakan mampir di Surat Utang Negara (SUN) dan Sertifikat Bank Indonesia (SBI). Yang masuk ke saham relatif kecil. “Sampai 22 Desember 2010, nett buy asing kurang lebih Rp 22 triliun. Itu tidak besar, tidak mengkhawatirkan,” ujarnya jelang penutupan perdagangan 2010 di Bursa Efek Indonesia (BEI), kemarin. Sebagian besar transaksi di bursa, kata Fuad, sepanjang tahun ini sudah didominasi oleh pelaku dalam negeri. “Kepemilikan asing terhadap saham menurun 10 persen di Indonesia. Tapi secara nilai memang naik. Tahun 2007, sebelum krisis, nett buy asing itu mencapai Rp 33 triliun,” paparnya. DirekturUtamaPTKustodian Sentral Efek Indonesia (KSEI), Ananta Wiyogo, mengatakan pada 2009 kepemilikan asing terhadap saham mencapai 67 persen sedangkan tahun ini berkurang menjadi 63 persen. “Berarti domestik meningkat 4 persen,” katanya. Fuad mengatakan, kenaikan pelaku pasar domestik adalah sesuai dengan harapan. Memang, menurutnya, pihak asing juga terus bertambah sehingga nilainya meningkat tetapi secara persentase peningkatan-

Fuad Rachmany

nya justru dimenangkan oleh pelaku domestik. Maka, kata Fuad, fokus pekerjaan saat ini adalah bukan kepada pencarian investor lagi tetapi bagaimana mendorong banyak perusahaan untuk masuk pasar modal. Semakin banyak yang listing semakin memancing investor karena harganya bisa lebih murah. “Saya sekarang bekerja keras mendorong perusahaan untuk masuk pasar modal supaya supplynya cukup. Sekarang kan demandnya banyak. Jadi permintaan harus match sama penawaran. Kalau nggak imbang nanti harganya naik. Kayak Beras dan Mangga. Sama, saham juga begitu,” ulasnya. Data Bursa Efek Indonesia (BEI) sampai kuartal ketiga menunjukkan, kepemilikan saham asing mencapai USD 125,891 miliar atau 66,7 persen dari total nilai saham di pasar modal. Sisanya, USD 62,9 miliar atau 33,3 persen dimiliki investor lokal. Minimnya investor dalam negeri terlihat dari sub-account yang terdaftar di PT Kustodian Sentral Efek Indonesia (KSEI) sebanyak 299.219 nasabah. Kepemilikan investor lokal masih didominasi oleh institusi dengan nilai USD 51,111 miliar. Sedangkan untuk investor individu tercatat USD 11,705 miliar.(gen)

3

ARUNDONO/JPNN

KE DEPO : Di penghujung 2010 Menteri ESDM mengadakan kunjungan ke Depo Pertamina Plum pang guna mengecek stok BBM 2011.

Alternatif Kiriman Remitan TKI HONGKONG - Bank Indonesia (BI) mencatat, ada sekitar 60 agen remitan yang maraup penghasilan dari tenaga kerja INDONESIA (TKI) di luar negeri. Hongkong, masih menjadi jujukan utama TKI mencari duit. Dari 60 agen resmi tersebut, terekam 125.718 pengiriman uang ke tanah air. Dengan kisaran mencapai Rp 545 miliar. Bagi TKI yang ada di Hongkong dan Malaysia, memiliki alternatif baru untuk mengirim uang ke tanah air. Pemain baru dalam dua remiteniniadalahkolaborasiantara PTArtajasaPembayaranElektronis, selaku pengelola ATM Bersama, dengan Shinetown Multimedia Services Ltd. Kolaborasi ini lantas meluncurkan produk GoldREXATM Bersama. Kepala Biro Pengembangan dan Kebijaksanaan Sistem Pembayaran Direktorat Akunting dan Sistem Pembayaran BI Aribowo mengatakan, bertambahnya alternatif pengiriman hasil kerja TKI ini merupakan sebuah perkembangan. “Mereka (TKI) jadi memiliki banyak pilihan,” kata dia saat Grand Launching GoldREX-ATM Ber-

sama di Quee Elizabeth Stadium, Hongkong. Ari menjelaskan, dengan terus bertambahnya agen pengiriman ini, bisa meningkatkan persaingan antara agen. Sehingga, bisa muncul harga yang juga ikut bersaing. Kedepan, masih kata Ari, BI terus mengawasi pelaksanaan pengiriman remitan. Ini dilakukan untuk menekan resiko uang dari TKI tidak sampai ke keluarga yang ada di tanah air. Janji pengawasan sistem pengiriman uang oleh TKI juga dikatakan oleh Konjen RI untuk Hongkong Teguh Wardoyo. Dia mengatakan, uang TKI harus dilindungi. Khusus untuk perlindungan keamanan dan standar gaji, Teguh menjelaskan di Hongkong lebih baik dari negara lainnya. Tapi dia mengaku tetap mengawal standar gaji TKI. Di tempatnya, TKI mendapat gaji HK $ 3.580 per bulan. Selain itu, terang Teguh, TKI di Hongkong juga mendapat kebebasan untuk berorganisasi. “Di tempat kami juga ada pendidikan bahasa,” papar mantan

Direktur Pengawasan WNI dan Badan Hukum Kemenlu itu. Direktur Utama Artajasa Arya Damar menjelaskan, dengan menggunakan GoldREX-ATM Bersama, para TKI bisa mengirim uang ke seluruh bank yang masuk jaringan ATM Bersama. “Seketika itu juga bisa diterima uangnya,” terang Arya. Selain kemudahan kecematan waktu, Arya juga mengatakan dengan inovasi ini, akan mendukung program BI Ayo Ke Bank. Sebab, seluruh penerima uang tersebut, harus membuka rekening dulu. Berbeda dengan salah satu agen remitan yang bisa mengirim via pos. Sejak soft launching tahun lalu, Artajasamencatatsudahada18.000 anggota. Setiap bulan, dari anggota tersebut tercatat ada 15 ribu pengirimanremitan.Rata-rata,satu TKI mengirim HK $ 1.000 sekali transaksi dalam satu bulan. Setiap kali transaksi, pengirim remitan dikenakanbiayaHK$20.NurulEko, diantara TKI yang menggunakan jasa GoldREX-ATM Bersama menjelaskan, potongan yang ditetapkan tidak terlalu besar. (wan)

JAKARTA - Sektor cukai menunjukkan kinerja yang menggembirakan. Tahun ini, realisasi penerimaan cukai berhasil melampaui target yang dipatok dalam APBN-P 2010. Direktur Penerimaan dan Peraturan Kepabenan dan Cukai Ditjen Bea dan Cukai (DJBC) Kushari Supriyanto mengatakan, hingga 29 Desember lalu, realisasi penerimaan cukai mencapai Rp 65,50 triliun atau melampaui target Rp 59,26 triliun. “Artinya, realisasi cukai mencapai 110 persen dari target,” ujarnya di Kantor Bea dan Cukai kemarin(31/12).MenurutKushari,tingginyapenerimaan cukai terutama didorong oleh pencapaian dari pos cukai rokok(tembakaudanhasiltembakau).Selainrokok,cukai juga dipungut untuk produk minuman mengandung etil alkohol (MMEA). “Tapi, mayoritas penerimaan cukai disumbang oleh rokok,” katanya. Tak hanya cukai yang melampaui target, penerimaan dari pos bea masuk dan bea keluar juga lebih tinggi dari target APBN-P 2010. Kushari menyebut, dari target penerimaan bea masuk sebesar Rp 17,10 triliun, tahun ini pihaknya berhasil meraup penerimaan hingga Rp 19,76 triliun. “Atau 115 persen,” sebutnya. Adapun untuk bea keluar, kinerjanya lebih moncer. Menurut Kushari, dari total target Rp 5,45 triliun, realisasi penerimaan yang berhasil dibukukan mencapai Rp 8,03 triliun. “Artinya, 147 persen dari target. Ini luar biasa,” ujarnya. Dirjen Bea dan Cukai Kementerian Keuangan Thomas Sugijata menambahkan, dengan pencapaian-pencapaian tersebut, maka total penerimaan bea cukai tahun ini menembus angka Rp 93,29 triliun, atau melampaui target sebesar Rp 81,81 triliun. “Dibandingkan tahun lalu, penerimaan kita naik 25,3 persen. Ini menunjukkan bahwa industri kita bergerak, perekonomian kita tumbuh,” katanya. Sementara itu, di luar penerimaan cukai serta bea masuk dan bea keluar, Ditjen Bea dan Cukai juga memungut Pajak Pertambahan Nilai (PPN) impor dan Pajak Penjualan Barang Mewah (PPnBM) impor. “Dari pos itu, kita collect Rp 87 triliun,” ucapnya. Thomas melanjutkan, pihaknya juga memungut Pajak Penghasilan (PPh) Pasal 22 Impor yang tahun 2010 mencapai Rp 23,5 triliun. Adapun pungutan PPN atas hasil tembakau mencapai Rp 11,1 triliun. “Sehingga, jika ditotal, seluruh penerimaan melalui Bea dan Cukai mencapai Rp 214,9 triliun,” ujarnya. Dengan demikian, kata Thomas, total konstribusi setoran Bea Cukai ke mencapai 21,6 persen dari target penerimaan APBN-P 2010 atau 28,9 persen dari target APBN-P dari pos Penerimaan Perpajakan. (owi/kim)


cmyk

Pilkada Sambas

4

Kandidat Calon Bupati dan Wakil Bupati Sambas

Darwin Muhammad 35.69 %

Juliarti 24.98 %

Prabasa 16.12 %

Tufitriandi 14.69 %

Pabali Musa 6.93 %

Munawar M Saad 1.58 %

Pontianak Post

Sabtu 1 Januari 2011

Posisi Tetap, Darwin Makin Mantap

Hasanusi 0.02 %

Hingga kemarin, perolehan suara masih tetap. Darwin masih memantapkan diri menempati posisi pertama. Sedangkan Juliarti menyusul diurutan ke dua. Bedan dua kandidat ini hanya tinggal 11 persen. Sementara posisi dan angka persentase calon lainnya tidak mengalami perubahan berarti. Masih tetap berada diposisi ketiga, Prabasa Anantatur dengan 6,93 persen dan Tufitriandi pada posisi keempat dengan 14,69 persen. Sementara Darwin tetap kokoh di puncak dengan 35,69 persen. Pembaca budiman, kirimkan terus dukungan anda kepada kandidat pemimpin masa depan Kabupaten Sambas. Caranya dengan mengirimkan guntingan polling dari koran yang asli (bukan fotocopy atau hasil scan) ke biro Pontianak Post di Sambas Jalan P. Anom.(*)

Tim JPM Kian Mengakar +

HENDY/PONTIANAK POST

RUSAK : Pemandangan seperti ini biasa bagi warga Galing. Berharap bupati terpilih mampu memperjuangkan aspirasi masyarakat, memperbaiki infrastruktur di Sambas.

Bupati Harus Pandai Melobi SAMBAS – Hari ini Pas Lin­tas Batas (PLB) Aruk dibuka. Akses ke Malaysia bagi warga Sambas menjadi dekat. Namun tidak dengan infrastruktur, jalan menuju Sajingan masih belum layak disebut jalur internasioa­ nal. Hal ini dikeluhkan warga Galing. Berharap pemimpin baru Sambas melanjutkan pembangunan jalan. Galing merupakan keca­ matan yang dilintasi jika me­nuju Sajingan. Termasuk jalur internasional, jalan di kecamatan tersebut rusak berat. Pemandangan biasa bagi warga jika kendaraan roda empat amblas. “Setiap hari terjadi, kami sudah biasa menyaksikannya,” kata warga Galing, Wahyudi. Memang jalan dari Sambas ke Sajingan akan dibangun pada 2011 oleh pemerintah pusat. Tapi warga pesimis jika bupati terpilih nanti tidak giat memperjuangkan­ nya. Pemerintah pusat tidak akan serta-merta memberi­ kan anggaran jika pemer­ intah daerah malas melobi. “Pembangunan mengguna-

Pembangunan meng­ gunakan anggaran pusat butuh lobi. Walau sudah ada a­ngin segar jalan Sam­ bas – Galing – Sajingan akan dibangun, tapi kalau bupatinya diam saja tidak akan men­ jadi kenyataan” Wahyudi

kan anggaran pusat butuh lobi. Walau sudah ada angin segar jalan Sambas – Galing – Sajingan akan dibangun, tapi kalau bupatinya diam saja tidak akan menjadi ke­ nyataan,” ungkapnya. Dia berharap pemilihan Bupati dan Wakil Bupati Sam­ bas ini membawa perubahan. Warga kecamatan perbatasan menginginkan infrastruktur

yang layak. “Tidak banyak yang diinginkan warga. Hanya infrastruktur yang nyaman dilalui,” ujarnya. Keluhan rusaknya jalan Ga­ling juga disampaikan Jeni Barka. Walau berdomisili di Sambas, setiap hari dia me­ lintasi jalan tersebut untuk berdagang. Jeni tidak heran melihat kendaraan amblas, tergelincir atau jatuh di sepa­ njang jalan. Bukan karena kelalaian atau tidak mematuhi aturan lalu lintas, melainkan kondisi jalan yang membuat kecelakaan itu terjadi. Sebagai pengguna jalan dia meminta Bupati Sam­ bas terpilih mampu men­ gakomodir keinginan war­ ga. Memperjuangkan jalan Sambas – Galing – Sajingan menurutnya tidak sulit, kar­ ena bupati nanti bakal mem­ bawa isu nasional sebagai senjata untuk melobi pusat. “Inikan jalan nasional bah­ kan internasional, bupati nanti tidak sulit lagi melobi pemerintah pusat. Ini wajah negara kita, malu dengan Malaysia,” tuturnya.(hen)

SAMBAS – Tim Pemenangan Juliarti Djuhardi Alwi – Pabali Musa bertam­ bah solid. Simpatisan dan massa pen­ dukung makin mengakar. Mereka siap memenangkan pasangan JPM pada hari pemilihan 24 Maret mendatang. “Langkah JPM semakin mantap, tim di semua lini kian solid,” ungkap Ketua Pemenangan JPM Anwari. Solidnya tim JPM ini terlihat dari rapat koordinasi pada Kamis (30/12). Semua koordinator kecamatan yang ada di Sambas berkumpul. Mere­ka memantapkan strategi, terutama peng­galangan dukungan. “Tim JPM sangat bangga dengan simpatisan dan pendukung. Ini menjadi modal dasar untuk kami memenangkan Pilkada Sambas 2011,” tegas Anwari. Dalam waktu dekat, JPM akan me­ lakukan konsolidasi pada tingkat desa dan dusun. Banyak masyarakat biasa dan tokoh yang datang menyatakan kesediaannya menjadi relawan JPM. Ini yang membuat Anwari dan jajaran pengurus tim terharu. Masyarakat melihat sosok Juliarti-Pabali Musa sebagai calon yang pantas menjadi Bupati dan Wakil Bupati Sambas 20112016. “Kami tidak menyangka banyak yang menyatakan kesanggupannya memenangkan Juliarti-Pabali Musa.

KOORDINASI : Tim Pemenangan JPM tengah melakukan rapat koordinasi. Tim ini semakin solid memenangkan Juliarti-Pabali Musa.

Bahkan dengan sukarela,” katanya. Tim Pemenangan JPM tidak hentihentinya bekerja membangun koor­ dinasi di semua lini. Tidak ada per­ bedaan latar belakang, agama dan suku. Semuanya menyatu dengan satu tujuan. Memenangkan JuliartiPabali Musa pada pilkada. “Tim tidak memilah-milah siapa dan dari mana orang itu. Hanya ada satu tujuan ber­ sama,” tegasnya. Pasangan Juliarti-Pabali Musa akan menjalankan amanah melanjutkan program Kabupaten Sambas Terpika

Terigas yang selama ini menjadi visi dan misi pemerintahan sekarang. Visi dan misi terpikat terigas ialah program lanjutan yang harus diper­ juangkan bersama. JPM sendiri bukan sekedar akro­ nim dari Juliarti-Pabali Musa, namun penuh makna dari tiga kata tersebut. JPM dijabarkan juga sebagai Jujur kar­ ena niat, Peduli karena tekad, Merakyat merupakan itikad. “Dengan filosofis kata-kata itulah pasangan ini maju sebagai calon Bupati dan Wakil Bupati Sambas,” jelas Anwari.(hen/*)

n Gus Dur Dalam Ingatan Putri dan Sahabat Saat Peringatan Haul I

Kondisi Kritis, Masih Ingat Saja Ucapkan Selamat Natal Tepat setahun, pada 30 Desember lalu, Presiden ke-4 RI KH Abdurrahman Wahid (Gus Dur) wafat. Namun, kenangan mendalam terhadap sosok yang dikenal kontroversial semasa hidupnya itu sulit dihapus. Terutama, di mata keluarga dan sahabatsahabat terdekatnya. PUTRI bungsu Gus Dur, Inayah Wulandari Wahid, ter­ masuk salah satu yang banyak mendampingi ayahandanya, di saat-saat akhir menjelang wafat. Dia merekam cukup banyak kejadian dan sisi-si­ si lain, hingga tiba saat Gus Dur menghembus­kan nafas terakhirnya di RS Cipto Man­ gunkusumo (RSCM), Jakarta. Masa-masa terakhir itu ada­ lah saat Gus Dur untuk kes­ ekian kalinya terpaksa kem­ bali dirawat di rumah sakit sejak 24 Desember 2009, akibat komplikasi sejumlah penyakit. “Meski sedih, tapi itu adalah

+

+

saat-saat pa­ling mengesankan bagi saya sebagai seorang anak,” kata Inayah, saat perin­ gatan Haul Gus Dur I, di kedia­ man Ciganjur, Jakarta Selatan, Kamis (30/12) lalu. Menurut dia, banyak ke­ san men­dalam hingga pela­ jaran penting yang didapatnya sekitar seminggu menemani ayahnya di rumah sakit terse­ but. Diantaranya, saat temanteman Gus Dur dari umat Kristiani datang menjenguk. Saat itu, bertepatan 25 De­ sember 2009, kondisi keseha­ tan Gus Dur sebenarnya sudah memprihatinkan. “Tapi, ya itu, Bapak ternyata masih ingat saja untuk mengucapkan Selamat Natal bagi teman-temannya itu,” papar Inayah. Kesan lain yang masih di­ ingatnya adalah kebesaran hati ayahandanya. Dia meng­ isahkan, di saat-saat terakhir tersebut, ada seseorang yang dianggap pihak keluarga banyak menyakiti Gus Dur tiba-tiba datang menjenguk ke rumah sakit. Mengetahui hal itu, pihak keluarga berusaha menolak orang tersebut bertemu Gus Dur. “Kami sekeluarga meno­

lak, sampai perlu berkalikali menegaskan kalau tidak boleh masuk ke ruangan,” kata Inayah. Gus Dur yang kebetulan saat itu sedang terjaga, mengeta­ hui kalau ada orang yang terus mendesak untuk bisa bertemu dengannya. Se­telah bertanya dan akhirnya mengetahui siapa orang di luar ruangan yang ngotot min­t a masuk tersebut, Gus Dur ternyata mempersilahkan. “Itu salah satu luar biasan­ ya Bapak, gampang sekali me­ maafkan orang. Tapi, aneh­nya orang itu justru se­­perti tanpa dosa, padahal selama ini me­ nganggap Bapak se­perti tidak ada bahkan disakiti,” beber Inayah. Beberapa tokoh yang hadir antara lain, Ketua Mahka­ mah Konstitusi Mahfudz MD, Wakil Ketua MPR RI Lukman Hakim Saifuddin, mantan Ketua DPR Akbar Tanjung, mantan Menko Perekonomi­ an Rizal Ramli, Jaya Suprana, dan banyak lainnya. Beberapa diantara mereka diminta untuk ikut memberi­ kan sambutan dan kesankesan terhadap sosok Gus

Dur. Diantaranya, yang diberi kesempatan adalah Mahfud MD. “Tiba-tiba malam ini saya seperti jadi kiai lagi ka­ rena diminta memberikan tausyiah,” kata Mahfud, men­ gawali sambutannya. Diantara yang dikisahkan kembali oleh mantan menteri pertahanan itu adalah dialog­ nya bersama Gus Dur, saat muncul tudingan keterlibatan mantan ketua umum PB NU tersebut dalam skandal Bu­ log Gate. Waktu itu, saat-saat menjelang lengsernya Gus Dur dari kursi kepresidenan. Mahfud mengaku sang­ at heran adanya tudingan keterlibatan Gus Dur dalam skandal yang dianggap mer­ ugikan uang negara sebesar Rp 3 milyar itu. Saat itu, man­ tan politisi PKB itu sempat bertanya, mengapa sampai muncul tudingan tersebut. Padahal, menurut dia, ka­ lau seorang presiden butuh uang, ratusan milyar pun ada. “Dan itu sah untuk ke­ butuhan darurat. Tapi, men­ gapa hanya Rp 3 milyar Gus,” kata Mahfud, mengulang dialognya dengan Gus Dur, saat itu.(dyn) +

cmyk


HALO PUBLIK

18

Pontianak Post Sabtu, 1 Januari 2011

Reward untuk Vania

Pontianak Post

berlangsung. Dia menyanyikan lagu-lagu klasik. Berarti masyarakatmasihmerindukan lagu-lagu seriosa. 0811571901

Vania Larissa dari Pontianak memenangkan juara pertama ajang Got Talent di stasiun televisi Indosiar tadi malam. Karena mengharumkan nama daerah, Pemda hendaknya memberikan penghargaan. Lomba ini sudah 6 bulan

Timnas ke Luar Negeri

Saran dari saya, agar para pemain pilihan di Timnas bisa

Jadilah PNS yang Berkualitas Menjadi seorang Pegawai Negeri Sipil (PNS) merupakan impian bagi sebagian besar masyarakat, dan tentunya sangat menyenangkan. Karena menurut sebagian dari mereka, bahwa CPNS adalah segala-galanya. Sebenarnya ini bukanlah merupakan sesuatu yang besar, karena yang menjadi prioritas dari segalanya adalah bagaimana CPNS tersebut menjadikan dirinya profesional dan berkualitas, sebagai seorang penyandang gelar PNS. Realitasnya, mereka yang sudah diumumkan lulus, sangatlah berperan penting untuk mengisi formasi-formasi di lingkungan pemerintahan, baik di pusat maupun di daerah-daerah lainnya.

T

entu para insan blogger mungkin sudah sering mendengar nama SITTI. Yah benar sekali, tepat sekali exactly. SITTI adalah salah satu situs penyedia konten iklan berbasis teks di situs berbahasa Indonesia. SITTI adalah salah satu situs iklan kebanggaan negeri ini yang fitur dan performanya tidak kalah dengan konten iklan kondang yang sudah mendunia lainnya seperti Google Adsense. Walaupun format iklannya tidak secanggih Google Adsense yang memiliki format iklan bergambar dan bisa dikostumasi. Situs penyedia iklan teks Bahasa Indonesia, SITTI , bisa menjadi salah satu sumber potensial memaksimalkan homepage atau blog anda agar bisa menghasilkan pundit-pundi uang dari internet. Dari sekian banyak situs iklan berbahasa Indonesia, mungkin hanya SITTI yang nekat menantang Google Adsense dari Amerika itu. Kok bisa sih? Siapa pun pasti mengakui bahwa Google adalah situs web penyedia iklan yang sangat populer di dunia. Namun, bukan berarti Google tidak memiliki penantang atau pesaing di Indonesia. SITTI Menantang Google Adsense Suatu ketika Andy Syarif, Chief Executive Officer SITTI ,

Mereka juga dituntut untuk merealisasikan atas sumpah dan janji jabatannya. Dengan demikian sangat diharapkan bahwa hal itu bukanlah hanya sebagai seremonial belaka. PNS sebagai unsur penting aparatur pemerintah yang bertugas melayani masyarakat luas, dituntut untuk selalu mengedepankan sikap profesionalisme dalam menjalankan tugasnya. Mereka juga dituntut untuk mereformasi diri agar semakin profesional, proporsional, dan responsif dengan mengedepankan akuntabilitas publik. Demikian juga pelayanan pemerintahan yang selama ini selalu diidentikkan dengan pelayanan yang lamban dan

birokrasi kompleks, haruslah bisa dibenahi menjadi format yang semakin baik sesuai dengan prinsip good government and good governance yang ada. Hal ini sejalan dengan bergulirnya otonomi daerah yang harus mengedepankan kemampuan untuk selalu berbenah diri, dan menumbuhkembangkan segala potensi daerah yang ada, guna meningkatkan kesejahteraan bagi masyarakat umum. Selain itu pembinaan terhadap PNS mestilah dilaksanakan, dengan tujuan terwujudnya PNS yang bersih, jujur dan sadar akan tanggung jawabnya sebagaimana yang diamanatkan dalam peraturan pemer-

intah RI No. 21 Tahun 1975 tentang Sumpah dan Janji Pegawai Negeri Sipil. Karena sudah menjadi harapan dan keinginan bersama untuk menciptakan PNS yang bersih, jujur dan sadar akan tanggung jawabnya. \Hal itu juga hanya akan terwujud, apabila setiap PNS dapat memposisikan dirinya sebagai abdi masyarakat, serta mau bekerja keras dengan penuh keikhlasan, kejujuran dan penuh rasa tanggung jawab. Kemudian, seiring dengan proses pembangunan yang sedang berjalan, dan perkembangan dinamika masyarakat dewasa ini, tuntutan masyarakat terhadap peningkatan kinerja dan kualitas pelayanan aparatur

pemerintah juga semakin tinggi. Faktanya adalah selalu ditandai dengan terus mengalirnya kritikan dan apresiasi yang diberikan masyarakat kepada kinerja dan kebijakan pemerintah, yang berhubungan langsung dengan pelayanan publik. Selamat kepada PNS yang telah lulus secara murni. Mudah-mudahan Anda semuanya bisa menjadi PNS yang profesional dalam bidang kalian dan berkualitas tentunya. Serta lebih-lebih lagi dalam hal memajukan bangsa kita yang tercinta ini. Semoga! Nurhasnan Mahasiswa STAIN Pontianak

Selamat Datang SITTI! pernah berteriak dengan lantang "Hey, Google. Silahkan datang ke Indonesia. Kami siap bersaing dengan Anda!" Pernyataan ini terlontar seperti bernada nekat mengingat SITTI bukan siapa-siapa dibandingkan Google yang merajai internet secara global dalam satu dekade terakhir. Namun ucapan itu bukan sekedar isapan jempol semata. Sejak 1 Oktober 2010 lalu, SITTI sudah memulai uji coba kuantitatif versi BETAnya secara live. Yang menjadi pertanyaan di sini adalah apakah sistem iklan SITTI lebih baik dari system dari raksasa Google? Jawabannya tentu saja tidak. SITTI kini sedang belajar, dan mbah Google mengajar. Meski begitu, Andy Syarif juga menegaskan bahwa SITTI diklaim lebih efektif. Dari pengukuran impresi, SITTI mendapat skor 86,5 persen, sedangkan Google 44,5 persen. Dari jumlah klik, SITTI mendapatkan 51 persen, sedangkan Google 49 persen. Click through ratio (CTR) SITTI 64,06 persen, Google 20,57 persen, dan sisanya sama. Hal inilah, kata Andy, yang menyebabkan SITTI makin percaya diri bersaing dengan Google Adsense di Indonesia. Salah satu kekuatan SITTI adalah selain iklan berbasis konstekstual berbahasa

Oleh :

Asep Haryono Indonesia, teknologi SITTI yang tidak dapat diungguli oleh Google Adsense adalah kemampuannya dalam mengakomodir bahasa Indonesia dengan baik. Mesin SITTI bisa mengindentifikasi bahasa Indonesia yang dipakai users, bahasa daerah, bahasa prokem, atau bahasa superalay sekalipun, mesin SITTI bisa bekerja dengan baik. Sedangkan mesin Google Adsense hanya mengandalkan Google Translator yang menerjemahkan isi konten website atau blog lalu mencocokkannya dengan konten iklan yang memiliki kesamaan yang tinggi, namun mesin Google ini mengalami kesulitan dalam penerapan Google Adsense-nya walaupun sudah diterjemahkan kedalam 129 Bahasa di seluruh dunia. Teknologi dan mesin SITTI bisa unggul di ranah ini, dan ini merupakan peluang untuk mewujudkan kenekatannya untuk menantang Google Adsense di Indonesia mungkin sebentar lagi akan mendekati kenyataan. Jangan bandingkan kekuatan Google Adsense dengan SITTI. Sangat jauh berbeda. Ribuan karyawan Google Adsense, dan ratusan diantaranya bergelar P.Hd,

dan SITTI hanya memiliki 1 tenaga bergelar P.Hd. Google menghasilkan pemasukan terbesar dari UKM sebesar Rp 170 milyar, sedangkan SITTI baru menghasilkan pendapatan 600 ribuan rupiah dari produksi minuman Teh Botol sebagai penghasil terbesar perusahaan milik Andy Syarif yang namanya diilhami oleh novel Sitti Nurbaya. Kesimpulan Dalam situs resminya SITTI yang beralamat di http:// www.sitti.co.id itu disebutkan bahwa visi SITTI membantu para pemilik situs dan blog untuk memanfaatkan halaman-halaman di situs/blog mereka dengan pemasangan iklan dari jaringan SITTI. Iklan kontekstual adalah penyajian iklan yang sesuai dengan aspirasi (atau kecenderungan) pembaca iklan. Mekanisme ini dimungkinkan dalam platform digital. Berbeda dengan format Google Adsense yang mudah dimodifikasi dan disesuaikan dengan keinginan para publisher nya, maka format iklan SITTI masih kalah jauh dengan perusahaan milik Google Inc itu. Format iklan SITTI masih sederhana dan belum dapat dikostumasi oleh para penggunanya saat ini. Namun format iklan kontekstual andalan SITTI menjadi senjata pemungkas yang

dapat diandalkan. Dalam situs resminya disebutkan bahwa Format iklan kontekstual adalah pola iklan masa kini yang bertumpu pada teknologi untuk membidik calon pelanggan berdasarkan kata kunci (keyword) yang mereka ketik di kolom pencari. Semoga dengan hadirnya SITTI bisa lebih menyemarakkan dan menggairahkan perekonomian di Indonesia. Kemudahannya dalam mengakomodir iklan kontekstual berbahasa Indonesia akan menyemarakan para pemain Adsense di Indonesia yang sudah dahulu ada seperti klik saya, adsense camp, kumpul blogger dan lain sebagainya. SITTI bisa sangat terkenal karena SITTI memiliki berbagai platform iklan kontekstual dalam bahasa Indonesia yang relevan dan akurat. Relevan karena memudahkan pemasang iklan untuk menempatkan iklannya di situs berbahasa Indonesia yang isinya sesuai dengan pesan iklan atau produknya. Akurat karena iklan tersebut dibaca oleh orang yang tepat pada saat yang tepat sehingga terukur dan dipertanggung jawabkan. Selamat Datang SITTI. Semoga menang! * Penulis, Web Content Updater Pontianak Post.

diberikan program latihan/ belajar ke luar negeri untuk memb e l a Negara di ajang sepakbola. Ini dimaksudkan agar para pemain kita

5

Rabu 3 Juni 2009

punya pengalaman main di luar negeri. Dan kembali ke Indonesia sudah mantap. Semoga ini jadi PR untuk Menpora. 081352621117


internasional

6 abidjan

Seruannya Diabaikan

+

KRISIS politik di Pantai Gading mengundang keprihatinan Sekjen PBB Ban Ki-moon. Kemarin (31/12), diplomat Korea Selatan (Korsel) itu khawatir republik yang terletak di Afrika Barat itu kembali jatuh dalam perang sipil. Sementara, Presiden Nicolas Sarkozy mengimbau seluruh warga Prancis meninggalkan Pantai Gading. “ P rov o k a s i kubu incumbent (Laurent Gbagbo) Kamis lalu (30/12) bisa memantik kekerasan yang berbuntut pada perang sipil. Ban Ki-moon Karena itu, Beliau (Ban) mengimbau mereka yang merencanakan serangan ke Hotel Golf bisa menahan diri dan mengurungkan niat tersebut,” papar Jubir PBB Martin Nesirky, membacakan reaksi tertulis Ban, seperti dilansir Associated Press. Tapi, kubu Gbagbo tidak menghiraukan imbauan Ban. Kemarin, para pemuda pendukung politikus 65 tahun itu tetap menyerukan serangan tangan kosong ke hotel tempat kubu Alassane Ouattara bersembunyi. Mereka memberikan waktu sampai Sabtu ini kepada kubu presiden terpilih versi Amerika Serikat (AS) untuk mengemasi barangbarang dan meninggalkan Hotel Golf. Untuk mengantisipasi serangan yang diserukan Charles Ble Goude, jenderal jalanan kubu Gbagbo tersebut, PBB menyiagakan lebih banyak serdadu di hotel. “Pasukan Penjaga Perdamaian PBB di Pantai Gading telah menempatkan sejumlah besar serdadu dan polisi di Hotel Golf untuk melindungi Ouattara dan para pendukungnya,” ungkap Nesirky. Menurut dia, seluruh personel Pasukan Penjaga Perdamaian PBB itu diberi wewenang untuk menggunakan cara apapun demi menegakan keamanan. Juga untuk menyelamatkan diri mereka sendiri, serta melindungi Ouattara dan para pendukungnya yang bersembunyi di hotel. Sebab, sejak dua hari terakhir, pasukan PBB juga menjadi sasaran serangan kubu Gbagbo. Bersamaan dengan itu, Prancis mengimbau seluruh warganya yang berada di Pantai Gading untuk meninggalkan negara tersebut. (hep/kim)

sydney

Tempat Menggelinding Tahun Baru PESATNYA peradaban membuat pergantian tahun tidak lagi dimaknai hanya sekedar waktu bergantinya penanggalan. Di berbagai tempat di muka bumi, datangnya detik-detik tahun baru selalu dirayakan dengan meriah dan penuh suka cita. Semuanya berharap krisis, bencana, konflik, dan segala jenis kemurungan yang terjadi di tahun lama akan sirna seiring hadirnya tahun yang baru. Posisi geografis membuat Sydney selalu menjadi kota besar dunia pertama yang menyambut Tahun Baru. Menjelang pergantian tahun 2010 ke 2011, diperkirakan ada 1,5 juta orang menonton pesta kembang api di pelabuhan Sydney. Jutaan warga itu memasang tenda di taman-taman kota di sekitar Jembatan Harbour, Sydney, pusat pagelaran kembang api Tahun Baru paling meriah di Negeri Kangguru. Acara sudah dimulai sejak sore ditandai dengan parade pesawat kuno dan perahu-perahu. (AP/ AFP/rtr/kim)

Pontianak Post

l

Sabtu 1 Januari 2011

Siap Serang Quattara Incumbent Terus Tebar Ancaman ABIDJAN – Tensi politik di Pantai Gading kian meningkat. Kemarin (30/12), kubu incumbent Laurent Gbagbo kembali menebar ancaman mematikan terhadap kelompok lawan. Yakni, kubu Alassane Ouattara –presiden terpilih versi Amerika Serikat (AS) dan sekutunya– serta PBB. Menteri Pemuda Charles Ble Goude yang berjuluk ‘jenderal jalanan’ kubu Gbagbo mengimbau seluruh pemuda Pantai Gading untuk menyerbu pertahanan kubu Ouattara. Sejak kekerasan merebak, Ouattara dan para pendukungnya serta para pejabat PBB bersembunyi di Hotel Golf. Kemarin, Ble Goude mengajak para pendukung Gbagbo menyerang hotel yang menjadi pertahanan lawan itu Sabtu besok (1/1). Komandan lapangan kubu Gbagbo itu mengusulkan serangan ke markas lawan dengan tangan kosong. “Mulai 1 Januari nanti, Charles Ble Goude dan para pemuda Pantai Gading akan membebaskan Hotel Golf dari cengkeraman para pemberontak dengan tangan kosong,” tandasnya di hadapan para pendukung Gbagbo, seperti dilansir Agence France-Presse. Ble Goude dan para pendukung setia Gbagbo menyebut Hotel Golf sebagai markas pemberontak. Karena itu, mereka menganggap operasi pembebasan salah satu aset Kota Abidjan tersebut sah. Bukan hanya Ble Goude dan warga

+

REUTERS / LUC GNAGO

BERTEMU GBAGBO: Mantan Menteri Luar Negeri (Menlu) Prancis Roland Dumas (kanan) berbicara dengan pemimpin Pantai Gading Laurent Gbagbo di Istana Kepresidenan di Abidjan, kemarin (30/12).

sipil pendukung Gbagbo yang menyepakatinya, tapi juga para personel Pasukan Keamanan dan Pertahanan (FDS). Di ibu kota, pasukan FDS pro-Gbagbo juga menyerang pasukan PBB. Bersamaan dengan itu, Kepala Pasukan Perdamaian PBB Alain Le Roy menuding Gbagbo menggunakan media pemerintah untuk menebar kebencian terhadap pasukan PBB. Akibatnya, pasukan PBB harus menghadapi berbagai ancaman dan serangan dari masyarakat Pantai Gading.

Tapi, para pemimpin negara Afrika Barat tidak menyerah. Kemarin, mereka kembali mengupayakan negosiasi damai untuk mencegah perang sipil. Sementara itu, Ouattara yang terpaksa mendekam di Hotel Golf bersama para pendukung setianya, kembali angkat bicara. Lewat Anne Ouluto, jubirnya, Ouattara menyebut rencana penyerbuan dengan tangan kosong itu sebagai provokasi Gbagbo. “Ini hanya upaya provokasi terbaru kubu Gbagbo. Semua ancaman

itu palsu,” tegasnya menanggapi deklarasi Ble Goude. Kendati demikian, Ouattara dan para pendukung setianya tetap khawatir.Meskimerekatelahdilindungi oleh lebih dari 800 serdadu PBB dan Pasukan Baru –sempalan dari mantan pasukan pemberontak –serta helikopter dan kendaraan lapis baja, kubu presiden yang didukung AS dan PBB itu gentar mendengar ancaman Ble Goude. Mereka tidak ingin ribuan pemuda Pantai Gading tiba-tiba menyerbu hotel dengan tangan kosong. Sebab, militer tidak

diperkenankan melawan musuh yang tidak bersenjata. Terkait ancaman tersebut, Dubes PBB Pantai Gading yang baru, Youssoufou Bamba, mengaku khawatir negerinyaakanterperangkapdalam genosida. Pria yang baru Rabu lalu (29/12) menerima pengakuan dari Sekjen PBB Ban Ki-moon itu mengatakanbahwabayang-bayang perang sipil dan genosida sudah semakin jelas. “Kita sudah berada di ambang genosida. Sesuatu harus segera dilakukan,” serunya. (hep/ ami)

Washington-Caracas Memanas Banjir Seluas Prancis – Jerman WASHINGTON – Krisis diplomatik Washington dan Caracas tak kunjung usai. Presiden Venezuela Hugo Chavez menolak duta besar Amerika Serikat yang baru saja ditunjuk. Sementara Washington mencabut kembali visa AS untuk duta besar Venezuela. Hanya berselang beberapa jam setelah Departemen Luar Negeri AS menyatakan ingin menjaga hubungan baik dengan Caracas, wakil Menteri Luar Negeri Venezuela Temir Porras menyatakan dalam akun Twitter-nya, “Saya pastikan bahwa AS menarik kembali visa duta besar kami Bernardo Alvarez”. Kementerian Informasi Venezuela kemudian membenarkan pernyataan Porras tersebut dalam sebuah surat elektronik kepada wartawan. Juru Bicara Departemen Luar Negeri AS Mark Toner di Washington menyatakan, pencabutan visa tersebut merupakan respons dari penolakan Chavez terhadap duta besar AS di Caracas yang baru ditunjuk Presiden Barack Obama. “Ya, kami katakan bahwa selalu ada konsekuensi ketika pemerintah Venezuela melanggar kesepakatan terkait dengan

penunjukan Larry Palmer. Kami sudah mengambil langkah tepat, proporsional, dan timbal balik,” terang Toner kepada AFP. Sebelumnya, Deplu AS menolak berkomentar tentang isu pengusiran Alvarez yang sedang berlibur di Venezuela. Namun, Deplu mengulangi kembali peringatan akan adanya konsekuensi terkait penolakan Palmer. Penarikan kembali visa diplomatik berarti Alvarez tidak bisa memasuki Amerika Serikat. Namun tidak secara langsung berimplikasi pada pengusiran Alvarez dari Washington. Di Amerika Serikat, visa bisa dicabut dan diberikan kembali dalam waktu singkat. Dua negara tersebut telah lama bermusuhan secara politik. Hubungan diplomatik kedua negara mengalami pasang surut beberapa tahun belakangan. Chavez telah berulangkali mengecam imperialisme Amerika dan menjalin hubungan baik dengan musuh-musuh AS seperti Kuba, Syria, dan Iran. Selasa lalu (28/12), Chavez mengancam akan memutus hubungan diplomatik dengan Washington atas penolakannya terhadap penunjukan Palmer. Palmer dikenal sebagai tokoh yang

kritis terhadap Chavez saat proses pemilihannya sebagai duta besar di depan senat AS. “Kalau pemerintah (AS) ingin mengusir duta besar kita di sana, biarkan saja! Kalau mereka akan memutus hubungan diplomatik dengan kita, biarkan saja!,” seru Chavez dalam sebuah siaran televisi nasional seperti dilansir AFP. Penunjukan Palmer masih harus menunggu persetujuan senat. Juni lalu, Obama menunjuk Palmer menggantikan Patrick Duddy sebagai duta besar untuk Caracas. Dari September 2008 hingga Juni 2009, Washington dan Caracas saling menarik duta besar mereka sebagai akibat memburuknya hubungan diplomatik kedua negara. Khususnya terkait isu pembangunan pangkalan militer AS di Kolombia. Agustus lalu Chavez menyatakan akan memveto penujukan Palmer setelah muncul pernyataan darinya bahwa Venezuela melindungi gerakan kelompok pemberontak kiri Kolombia. Selain itu, di depan senat, Palmer juga menyatakan militer Venezuela berada di bawah pengaruh Kuba dan tidak bermoral. (cak/ ami)

BRISBANE - Sekitar 200 ribu warga 22 kota di Negara Bagian Queensland, Australia, harus berkubang banjir pada malam pergantian tahun kemarin (31/12). Pemerintah setempat pun terus mengevakuasi ribuan warga yang terjebak banjir di sekitar Kota Bundaberg. Sambil melawat lokasi banjir, PM Julia Gillard menjanjikan bantuan. Banjir dilaporkan merendam wilayah yang lebih luas dari gabungan area Prancis dan Jerman. Kemarin, pesawat-pesawat militer mendistribusikan bantuan logistik di beberapa kota wilayah timur laut yang terisolasi. Selain makanan, bantuan obat-obatan juga diberikan. “Saya sangat prihatin melihat begitu banyak warga yang harus menanggung dampak banjir,” ungkapnya seperti dilansir Associated Press. Saat melawat Kota Bundaberg, PM perempuan pertama Negeri Kanguru itu juga menjanjikan lebih banyak bantuan terhadap korban banjir. Gillard menyatakan bahwa keluarga yang kehilangan rumah akibat banjir, akan menerima

ganti rugi. Tiap warga dewasa akan mendapatkan bantuan sebesar AUD1.000 atau sekitar Rp9 juta. Sedangkan, masing-masing anak akan menerima AUD400 atau sekitar Rp3,6 juta. Sebelumnya, dari Canberra, Gillard menjanjikan bantuan senilai AUD1 juta atau sekitar Rp9 miliar untuk Queensland. Dana tersebut akan dialokasikan untuk membiayai pemulihan pascabencana. Sumbangan tersebut diambilkan dari dana pemerintah pusat. Selain itu, pemerintah juga akan memberikan bantuan berupa materi, selain makanan dan obatobatan, kepada para korban banjir. Meski hujan sudah tidak turun lagi, sungai-sungai di Queensland tetap meluap.Akibatnya,semakinbanyak wilayah yang terendam air bercampur lumpur. Kandungan lumpur dalam air tersebut juga membuat warga kekurangan air bersih. Terutama, air minum. “Ini benar-benar tragedi. Pascabanjir, kami masih harus menghadapi kesulitan yang tidak sedikit. Salah satunya adalah penyakit,” kata PM Queensland, Anna Bligh. (hep/kim)

Resolusi 2011: Enyahkan Kantong Plastik di Semua Toko dan Supermarket

Warga yang Habiskan 20 Miliar Kantong Plastik per Tahun Mendukung Italia punya cara unik menyambut 2011. Mulai hari ini, pemerintahan Perdana Menteri (PM) Silvio Berlusconi melarang penggunaan kantong plastik di pertokoan dan supermarket. Sebagai gantinya, pemerintah mewajibkan pemakaian tas yang terbuat dari kertas dan kain.

+

cmyk

“DEKRIT yang mulai diberlakukan 1 Januari itu merupakan terobosan terbaru pemerintah dalam upayanya memerangi pencemaran (plastik). Masyarakat pun diajak mampu mempertanggungjawabkan seluruh tindakan mereka dalam konteks lingkungan,” ungkap Menteri Lingkungan Hidup Italia Stefania Prestigiacomo, seperti dilansir BBC kemarin (31/12). Mulai hari ini, kebijakan ramah lingkungan itu diberlakukan serentak di seluruh penjuru Italia. Larangan pemakaian kantong plastik itu menjadikan Italia negara pertama Uni Eropa (UE)yangmemberlakukankebijakanramah lingkungan. Sebelumnya, Inggris serta Belgia, Belanda dan Jerman, juga menerapkan kebijakan senada. Tapi, empat negara UE tersebut tidak menjadikan kebijakan ramah lingkungan itu sebagai aturan atau dekrit seperti Italia. Rata-rata, negara Eropa lainnya hanya memajaki pertokoan atau supermarket yang membagikan kantong plastik gratis kepada konsumen. Menyusul Italia, konon Prancis juga akan segeramemberlakukanlaranganyangsama. Kendati pemerintah belum bertindak, beberapa ritel tenar Negeri Anggur itu sudah lebih dulu menerapkan kebijakan serupa. Salah satunya adalah aturan yang dikenakan kepada jaringan hypermarket terbesar di dunia, Carrefour. Sejak Maret 2007, Carrefour tidak lagi membagikan kantong plastik gratis kepada para konsumen. Mereka yang membutuhkan kantong untuk membawa belanjaan harus membelinya. Di Inggris, larangan tas plastik diterapkan kalipertamaolehpemerintahKotaModbury

+

INTERNET

PLASTIK: Sampah kantong plastik yang sulit terurai menjadikan pemerintah Italia memberlakukan dekrit kepada warganya untuk tidak secara gratis menggunakan kantong plastik. Entah kapan Indonesia akan tertarik memberlakukan kebijakan serupa.

di Devon County. Mulai April 2007, pemkot setempat melarang pemakaian kantong plastik di seluruh toko dan supermarket. Kebijakan senada lantas diterapkan beberapa pemkot lain di Negeri Ratu Elizabeth II itu. Pada Februari 2008, ritel terbesar Inggris Marks and Spencer tidak lagi membagikan kantong plastik gratis kepada konsumen. Sebenarnya, jauh sebelum Italia atau negara-negara anggota UE lain melarang penggunaan kantong plastik, Republik Irlandia sudah lebih dulu memberlakukannya. Pemerintahan Presiden Mary McAleese menerbitkan aturan yang melarang setiap toko dan supermarket memberikan kantong plastik gratis kepada konsumen. Untuk tiap kantong yang mereka gunakan, konsumen dikenai biaya. Dampaknya sungguh fantastis. Sejak aturan itu diberlakukan, pemakaian kantong plastik berkurang hingga 90 persen. Keberhasilan Republik Irlandia itulah yang lantas membuat pemerintah Italia serius menggodok dekrit anti-kantong plastik tersebut. Apalagi, dibandingkan negaranegara Eropa lainnya, pemakaian kantong plastik di Negeri Menara Pisa itu merupakan yang tertinggi. Tiap tahunnya, masyarakat

Italia menggunakan sedikitnya 20 miliar kantong plastik. Artinya, tiap individu memanfaatkan sekitar 300 kantong plastik dalam waktu setahun. Kemarin, kelompok pecinta lingkungan Italia menyambut baik pengumuman resmi pemerintah soal pemberlakuan dekrit anti-kantong plastik tersebut. Menurut mereka, plastik yang menjadi bahan baku kantong-kantong belanja gratis di hampir seluruh toko dan supermarket dunia itu merupakan polutan paling jahat. Sebab, selain membutuhkan banyak bahan bakar dalam memproduksinya, kantong plastik juga sangat sulit terurai saat sudah menjadi sampah. Dengandiberlakukannyaaturantersebut, Legambiente (organisasi lingkungan hidup Italia) optimistis Italia akan mampu memangkas emisi karbondioksida. “Larangan menggunakan kantong belanja yang terbuat dari polythene (plastik) itu akan mengurangi emisiCO2sampaisekitar180ributon,”terang Legambiente dalam keterangan tertulis seperti dikutip The Telegraph. Berdasar survei lembaga tersebut, hampir seluruh warga Italia pun mendukung larangan pemakaian kantong plastik itu. (hep)


Pontianak Post

Aneka

Sabtu 1 Januari 2011

Antasari Segera Huni Sel Baru Kejagung Eksekusi Putusan Kasasi MA Pekan Depan

+

JAKARTA – Antasari Azhar, terpidana 18 tahun kasus pembunuhan Dirut PT Putra Rajawali Banjaran (PRB) Nasrudin Zulkarnaen, bakal memiliki hunian baru awal tahun ini. Kejaksaan Agung (Kejagung) telah menerima salinan kasasi Mahkamah Agung (MA) dan segera mengeksekusi mantan ketua Komisi Pemberantasan Korupsi (KPK) itu. ”Rencananya, pada 3 Januari kami eksekusi. Sekarang salinan putusan dipelajari jaksa,” ujar Kepala Kejaksaan Negeri Jakarta Selatan M. Yusuf saat dihubungi kemarin (31/12). Namun, dia belum memastikan lembaga pemasyarakatan (lapas) mana yang akan ditempati Antasari.

Yusuf mengungkapkan, lokasi tahanan bagi mantan direktur penuntutan pidana umum Kejagung tersebut saat ini masih dikoordinasikan. ”Akan kami serahkan ke lapas yang kosong,” ungkap mantan Kajari Klaten, Jawa Tengah, itu. Selama ini, Antasari mendekam di Rutan Narkoba Polda Metro Jaya. Selain Antasari, Kejari Jaksel telah mengeksekusi terpidana lain dalam kasus pembunuhan Nasrudin. Yakni, Sigid Haryo Wibisono (terpidana 15 tahun) dan Jerry Hermawan Lo (lima tahun). Keduanya dijebloskan ke Lapas Cipinang berdasar putusan MA. Secara terpisah, Jaksa Agung Muda Pidana Umum (JAM

Pidum) Hamzah Tadja menerangkan, salinan putusan kasus Antasari dari MA tersebut diterima pekan lalu. Selanjutnya, dia sudah memerintah Kejari Jaksel melaksanakan eksekusi. Soal permohonan keluarga Antasari agar eksekusi dilakukan di Lapas Tangerang, Hamzah belum bisa memastikannya. Sebab, putusan menunjuk ke locus delicti (tempat kejadian perkara) sehingga diserahkan Kejari Jaksel. Pun, hal tersebut menjadi kewenangan pihak pemasyarakatan. ”Nanti bisa mengajukan dan pihak pemasyarakatan akan berkoordinasi dengan kami (kejaksaan, Red),” papar mantan kepala Kejaksaan Tinggi

Sumatera Selatan itu. Seperti diketahui, hukuman bagi Antasari tetap 18 tahun setelah kasasinya ditolak MA. Putusan kasasi tersebut memperkuat hukuman 18 tahun penjara yang diketuk di Pengadilan Negeri Jaksel dan Pengadilan Tinggi DKI Jakarta. Hukuman pun dijatuhkan kepada tiga terdakwa lain, yakni Sigid, Wiliardi Wizar, dan Jerry. Masing-masing tetap dihukum 15, 12, dan 5 tahun penjara. Dengan begitu, putusan untuk mereka telah berkekuatan hukum tetap (inkracht). Dalam putusan tersebut, mereka dinilai telah bekerja sama untuk membunuh Nasrudin. (fal/c11/iro)

Terharu Dielu-elukan Suporter hingga Kamar Hotel Sambungan dari halaman 1

Wolfgang Pikal bahkan masih terlihat bergetar. Hanya pelatih Alfred Riedl yang tetap terlihat ’’dingin’’, gaya khasnya. Suasana beku tersebut belum berubah ketika tim meninggalkan Stadion Utama Gelora Bung Karno (SUGBK) pukul 22.15. Hal itu terjadi tak lain karena ribuan suporter Merah Putih ternyata masih setia menanti dan mendukung penuh para pahlawan timnas tersebut. Ribuan suporter sengaja menunggu bus PSSI yang mengangkut para pemain karena ingin tetap memberikan semangat kepada Firman Utina dkk. Di dalam bus yang berjalan lambat, skuad timnas hanya bisa melambaikan tangan kepada para pendukung fanatik tersebut. Di sepanjang jalan menuju Hotel Sultan tempat mereka menginap, massa di kanan kiri jalan juga tak henti-henti mengelukan nama para pemain. Skuad timnas pun tampak terharu melihat antusias para penggila bola (gibol) tersebut. Situasi itu masih berlanjut kemarin (30/12). Pukul 09.00, tim resmi dibubarkan. Acara seremonial terakhir sebelum para pemain kembali ke klub masing-masing berupa jamuan

makan siang oleh sponsor apparel timnas di sebuah restoran di Mal Senayan City, Jakarta. Seluruh pemain dan ofisial tampak hadir dalam acara yang tertutup untuk media itu. Mengetahui ada skuad timnas di mal tersebut, para pengunjung pun akhirnya ’’menyerbu’’ ke tempat acara makan siang para pemain itu. Para pemain yang tampak rileks terlihat antusias menerima permintaan para penggemar untuk berfoto bersama atau permintaan tanda tangan. Irfan Bachdim, Christian Gonzales, dan Firman Utina menjadi pemain yang paling banyak diburu fans. Begitu acara makan siang selesai dan timnas hendak kembali ke hotel, sekitar pukul 14.00, suasana semakin heboh saat Firman Utina dkk keluar mal dan menuju bus yang mereka tumpangi. Bukan hanya pengunjung mal yang menyerbu, warga yang kebetulan lewat di dekat Senayan City ikut merangsek ingin melihat lebih dekat pemain pujaan mereka. Akibatnya, jalan di depan pusat perbelanjaan elite tersebut macet beberapa saat karena banyak kendaraan yang berhenti mendadak. Para penggemar yang mayoritas perempuan itu berteriakteriak histeris dan berusaha

mendekat ke arah para pemain. Beruntung, petugas keamanan sigap sehingga mereka tidak terlalu dekat dengan pemain. Tak hanya di mal, di hotel tempat timnas menginap pun ratusan penggemar timnas Merah Putih antre ingin bertemu. Timnas tiba di Hotel Sultan sekitar pukul 15.00. Begitu turun dari bus, mereka langsung diserbu penggemar. Ada yang minta foto, tanda tangan, atau sekadar berjabat tangan. Namun, kali ini pemain tidak lama melayani penggemarnya. Mereka segera naik lift menuju ke lantai kamarnya masing-masing. Tetapi, para fans belum menyerah. Tahu sore kemarin tim akan check out dari hotel, mereka setia menunggu di lobi. Benar saja, sekitar satu jam kemudian satu per satu pemain turun dengan membawa koper masing-masing. Yang turun pertama adalah Bambang Pamungkas. Dia dijemput keluraganya. Kemudian, Christian Gonzalez, Yongky Aribowo, Zulkifli Syukur, M. Robbi, dan Johan Juansyah, lalu diikuti pemain yang lain. Sebelum naik mobil atau taksi yang dipesan, para pemain menyempatkan diri berfoto atau melayani permintaan tanda tangan penggemar. ’’Saya ingin istirahat dulu sebelum kembali

bergabung dengan klub (Sriwijaya FC). Saya sudah kangen keluarga,’’ kata Firman Utina yang sudah bisa tersenyum setelah malam sebelumnya tertunduk lesu karena gagal mengeksekusi penalti. ’’Saya bosan, sebulan terakhir tiap bangun tidur yang saya lihat wajah Bambang Pamungkas,’’ candanya. Selama TC dan berlaga di Piala AFF, Firman memang sekamar dengan Bambang. Jika para pemain check out dari hotel kemarin, tim pelatih baru keluar hari ini (31/12). Asisten pelatih Wolfgang Pikal telah menjadwalkan pulang dan menemui keluarganya di Bali. Pria berkebangsaan Austria itu akan berada Pulau Dewata hingga 5 Januari mendatang. Setelah itu, Wolf –panggilan Wolfgang– bakal terbang lagi ke Jakarta untuk menyiapkan pembentukan timnas U-23. ’’Saya akan istirahat di Bali. Saya akan refreshing dulu sebelum kembali bertugas untuk seleksi timnas U-23,’’ ujarnya. Pelatih kepala timnas Indonesia Alfred Riedl juga berencana berlibur ke Bali bersama istri. ’’Dia (Riedl) masih mencari tiket. Tanggal 2 atau tanggal 3 dia berangkat ke Bali. Kemungkinan akan mampir ke rumah saya,’’ kata Wolf. (*/c4/ari)

itu adalah Indra Warman alias Tony Togar, Fadli Sadama alias Acin, Purwadi alias Sony, Ramli alias Tono, Syahrudin Harahap alias Ramses, Tatang alias Aryo, Ramli alias Gogon, dan Mustafa alias Hendra. Selain merampok Bank Lippo, mereka berupaya mengambil uang Rp 5 juta dari money changer Dumai. Kelompok tersebut juga didakwa menyimpan dan menggunakan senjata api secara ilegal. Ada beberapa barang bukti senjata api yang ditemukan oleh polisi ketika itu. Antara lain, sepucuk revolver PPS dengan nomor tidak jelas atau rusak, sapucuk senjata api FN Bareta berkaliber 9 mm buatan Italia, 31 amunisi berkaliber 32 mm, enam peluru revolver berkaliber 38 mm, dan sebuah kardus penyimpanan senjata api. Acin yang merupakan anak pasangan Mahyuddin-Susilawati itu mengaku lahir di Tanjung Pinang, Kepulauan Riau, 28 tahun lalu. Dia menempuh pendidikan formal sampai SMU di Pekanbaru, Riau. Dulu, dia bercita-cita menjadi ahli kimia. Namun, keinginan itu kandas karena orang tuanya tidak sanggup membiayainya kuliah. Padahal, waktu itu Acin mendapatkan undangan bebas tes dari Universitas Riau (Unri) di Pekanbaru. Walaupun hanya tamatan

SMU, Acin tergolong pemuda cerdas. Dia sangat menguasai teknologi. ”Dia sangat ahli menyusup ke server-server dengan software yang diutak-atik sendiri,” ucap seorang perwira di lingkungan cyber crime kepada Pontianak Post kemarin. Acin juga mahir berbahasa Inggris dan sangat fasih berbahasa Aceh. Dia jago berbahasa Aceh karena dulu belajar kepada warga Aceh ketika meringkuk di Lapas Tanjung Gusta. Menurut sumber Pontianak Post, Acin punya jaringan di Malaysia sejak 2007, setelah bebas dari hukuman yang dijalani gara-gara kasus Lippo. Di negeri jiran itu, dia bekerja sebagai buruh bangunan. Pemuda berwajah alim tersebut juga sering bergabung dengan kelompokkelompok pengedar narkoba dari Aceh. Saat ditangkap pada 2009, kepada penyidik dia mengaku terlibat dalam jaringan sabu-sabu dan memasok bubuk kristal itu ke Aceh. Uang hasil bisnis tersebut digunakan untuk membeli pistol yang dimanfaatkan dalam perampokan di Bireuen. Atas terungkapnya modus Acin itu, Gories meminta anggotanya di BNN semakin waspada. ”Kita menghadapi kejahatan transnasional baru, yakni menggabungkan dua tindak pidana sekaligus, narkoba dan terorisme,” papar dia. (rdl/c11/iro)

ada tadi malam, dia biasanya suka ke tempat cewek yang disukainya yaitu Iin, di jalan Johar. Tapi tidak ia lakukan. Saat markir motorpun dia lebih tidak bersemangat,” jelasnya saat di Antonius. Sementara Nina, Sepupu korban menjelaskan memang Iwan saat masih di rumahnya sekitar pukul 09.00 wib. Dengan bernada mengancam akan bunuh diri. Namun tidak dindahkan, karena mikir itu hanya gurauan saja. Dia juga mengatakan mengirim surat ke Iin, wanita yang bekerja di warung Siti Fatimah. “Saya tidak menyangka ini terjadi dan apa yang dikatakannya benar. Saya menyayangkan, apalagi ayahnya sekarang sedang sakit parah. Dia anak pertama dari empat bersaudara.

Dulu dia tidak begitu,saat baru datang dari Sukabumi. Sekarang memang dia berubah sejak kenal dengan minuman dan obat-obatan,” katanya kepada Pontianak Post kemarin. Menurut keterangan warga sekitar Iwan Setiawan nama lengkapnya memang bukan warga asal Kalimantan Barat. Ia sering tidur di masjid seusai bekerja sebagai tukang parkir di depan Antonius. Ia nekat melakukan aksi bunuh diri, karena sang pujaan hati tidak pernah menyukainya, dan malah memilih lelaki lain dibandingkan dirinya. Karena putus asa, akhirnya ia memutuskan diri untuk mengakhiri hidupnya dengan meloncat dari atas menara masjid Al Fallah. (tin)

Senjatai Teroris dari Narkoba Sambungan dari halaman 1

+

Oktober 2010 oleh Special Branch Polis Diraja Malaysia (PDRM), unit khusus penanganan teror, masalah keamanan dalam negeri berintensitas tinggi di Malaysia. Penangkapan tersebut merupakan hasil kerja sama Polri dengan PDRM. Saat ditangkap, Fadli membawaduapistol.Dalampengembangan penyelidikan kasus tersebut, diketahui pistol itu hendak dibawa ke Indonesia setelah dibeli dari Malaysia. Fadli pernah ditahan karena kasus perampokan Bank Lippo Medan pada 2003. Setelah bebas, pada 2009 dia ditangkap lagi karena kepemilikan senjata api. Dia pun baru bebas dari penjara Tanjung Gusta, Medan, pada Juli 2010. Dia ditangkap lagi karena diduga bersama Toni Togar (sudah ditahan) merancang perampokan Bank CIMB Niaga pada Agustus 2010 dan penyerangan Mapolsek Hamparan Perak, Sumatera Utara, pada September 2010. Fadli diekstradisi ke Indonesia pada 4 Desember 2010 dengan menggunakan pesawat MH 723 dari Kuala Lumpur. Dia dijemput langsung oleh Direktur Penindakan Badan Nasional Penanggulangan Terorisme Petrus Reinhard Golose. Dia punya nama samaran Acin dan

sudah ”kenyang” diburu polisi. Dua pistol itu digunakan oleh jaringan Safrizal untuk merampok BRI Unit Kutablang, Kabupaten Bireuen, pada Selasa, 12 Mei 2009. Acin adalah anggota lama Jamaah Islamiyah (JI). Dia ditugasi melakukan operasi teror di Pekanbaru, Riau, pada 2003, tapi gagal. Pada 2010, dia sebenarnya sudah merancang serangan yang sama di Pekanbaru. Targetnya adalah petinggi perusahaan minyak asing. Namun, rencana tersebut batal. Acin juga pernah ikut berjihad ke Ambon. Ketika itu daerah tersebut berkecamuk gara-gara perang saudara antara pemeluk agama Islam dan Kristen. Saat terlibat perampokan Bank Lippo Medan pada 6 Mei 2003, dia masih berusia 21 tahun. Dalam aksi tersebut, dia bertindak sebagai salah seorang penyusun strategi. Saat itu Acin berperan sebagai bendahara yang memegang uang hasil perampokan. Dialah yang menerima dan mentransfer uang tersebut kepada sejumlah orang sesuai dengan perintah atasannya. Kala beraksi di Bank Lippo Medan, para perampok berhasil menguras uang tunai Rp 113 juta. Kasus tersebut melibatkan delapan anggota JI Waqala Sumatera Utara dan Riau. Tersangka perampokan

Aksi Nekat Akhir Tahun 2010 Sambungan dari halaman 1

mengurungkan niatnya. Iwan terus saja mencari-cari sang wanita yang dicintainya bernama Iin, karena tidak kunjung tiba. Suara warga terus saja menyuruh turun, namun tetap tidak diindahkan Irwan. Hingga seseorang berusaha naik secara diam- diam untuk menghentikan aksi nekat bunuh diri tersebut. Ternyata diketahui Iwan, langsung saja Iwan meloncat dari ketinggian 25 Meter. Terjun bebas tersebut langsung ditadah dibawah. Namun sayang alas berupa terpal tersebut tidak mampu menahan tubuh Irwan dari atas dan lansung menembus terpal tersebut. Beruntung seorang bapak bernama Asnawi, berhasil

cmyk

menyelamatkan dan mengena kebadannya. Tubuh Iwan tidak langsung jatuh ke tanah. Malang bagi Asnawi, ia malah terkena luka bocor daerah kepala karena benturan. Sementara Iwan, patah daerah paha, leher dan lecet bagian kepala. Langsung saja kedua korban diselamatkan ke rumah sakitSantoAntoniusyangberada tidak jauh dari TKP. Keduanya berhasil diselamatkan, hingga berita ini ditulis kedua korban masih belum bisa diwawancarai dan berhasil diselamatkan. Menurut Heri Jek, teman akrab Iwan, malam sebelumnya saat ia bersama-sama bekerja sebagai tukang parkir di depan Antonius. Iwan memang tampak lebih pendiam dari biasanya. “Tandanya memang

7

MA Siapkan Hakim Pengganti Arsyad Sanusi JAKARTA – Mahkamah Agung (MA) cepat merespons keinginan hakim Arsyad Sanusi mundur dari Mahkamah Konstitusi (MK). Lembaga pimpinan Harifin Tumpa itu kini mempersiapkan pengganti Arsyad yang tersandung kasus dugaan pelanggaran kode etik dan perilaku hakim. ’’Kami sedang menyeleksi. Beberapa nama sudah ada, tapi belum ada keputusan siapa,’’ kata Harifin di gedung MA kemarin (31/12). Menurut dia, ada tiga nama yang disiapkan MA. Mereka berasal dari hakim tata usaha negara (TUN), agama, dan peradilan umum. Arsyad adalah hakim konstitusi dari unsur MA. Dia diduga melanggar kode etik hakim lantaran membiarkan anak dan iparnya, Neshawaty dan Zaimar, bertemu dengan pihak beperkara. MK membentuk panel etik untuk membawa

Arsyad ke majelis kehormatan hakim (MKH). Arsyad kepada wartawan mengatakan akan tetap mundur dari MK kendati panel etik menyatakan dirinya tidak bersalah. Meski begitu, pada Mei tahun ini, Arsyad sejatinya sudah harus pensiun dari MK. ’’Kita jaga asas praduga tak bersalah. Belum tentu juga dia bersalah. Anak bertemu dengan pihak beperkara, siapa yang tahu,’’ kata Harifin. Di bagian lain, data pelapor LHKPN di KPK menyebutkan, hakim MK Akil Mochtar kali terakhir melaporkan harta kekayaannya pada 2002. Saat itu dia menjabat anggota komisi III DPR. Selama menjadi hakim konstitusi, dia belum pernah melaporkan harta kekayaannya. ’’Ya, benar, Pak Akil lapor tahun 2002 sebagai anggota DPR,’’ ujar Direktur LHKPN KPK

Cahya Hardianto di gedung KPK kemarin. Cahya juga membenarkan bahwa Akil belum pernah melapor sejak menjabat hakim konstitusi. Dia juga membeberkan harta kekayaan Akil bertanggal 31 Juli 2002 sebesar Rp Rp 3.463.032.320. Rinciannya, terdapat akumulasi tanah dan bangunan senilai Rp 2,06,725 miliar. Aset-aset Akil tersebut berada di Pontianak, Kalbar. Untuk rincian harta bergerak, tercatat Akil memiliki mobil BMW dan mobil Nissan senilai Rp 346,5 juta. Ada pula logam mulia, batu mulia, dan barang antik senilai Rp 408,875 juta. Selain itu, Akil tercatat memiliki aset di bidang peternakan, perikanan, perkebunan, dan petanian senilai Rp 30 juta. Harta tak bergerak senilai Rp 101 juta, serta giro dan setara kas Rp 512 juta dan USD 4514. (aga/ken/c4/agm)

+

TN Komodo Perlu Dukungan Sambungan dari halaman 1

www.new7wonders.com berdasar perkembangan pilihan pengunjung situs tersebut. ”Tapi, mereka tidak pernah menunjukkan jumlah orang yang sudah mengeklik Taman Nasional Komodo,” papar Esthy di ruang kerjanya kemarin (31/12). Esthy menjelaskan, TMK bersaing ketat dengan kandidat lain. Tujuh keajaiban dunia itu ditentukan pada 11 November 2011. Dia berharap, masyarakat terus mendukung TMK. Sebelumnya, Indonesia menjadi nomine tujuh keajaiban dunia dengan Candi Borubudur. Namun, candi yang pernah diselimuti abu vulkanis letusan Gunung Merapi tersebut sudah gugur.

”Tinggal TMK yang tersisa. Jadi, harus terus didukung,” tegas dia. Kemenbudpar masih mengandalkan pemilih dari dalam negeri. Pertimbangannya, perkembangan dunia informasi di negeri ini sudah lebih maju. Dalam pameran pariwisata Kemenbudpar di Jakarta pada 30–31 Desember, ditjen pemasaran menyiapkan stan untuk memdukung langsung. Untuk promosi dan penggenjotan antusiame masyarakat agar memilih TMK, Kemenbudpar menyiapkan anggaran hampir Rp 10 miliar. Esthy menjelaskan, anggaran itu digunakan untuk menghelat sosialisasi offline. Di antaranya, menggunjungi sekolah-sekolah dan perguruan tinggi. Selain itu,

Kemenbudpar memanfaatkan pameran-pameran promosi kebudayaan di dalam dan luar negeri. Perkembangan terbaru, di TMK saat ini terdapat 250 komodo yang hidup bebas. Biawak raksasa bernama Latin Varanus komodoensis tersebut mendiami beberapa pulau yang terpisah. Habitat mereka yang dominanadalahPulauKomodo, Rinca, dan Padar. Pada 2010, wisatawan yang mengunjungi TMK sebanyak 43 ribu orang. Dari jumlah tersebut, 90 persen adalah wisatawan Nusantara (wisnus). Sisanya adalah wisatawan mancanegara (wisman). Capaian 2010 meningkat dari jumlah kunjungan 2009 yang hanya 30 ribuan wisatawan. (wan/c11/ari)

Talak Cerai Teh Nini Sambungan dari halaman 1

beredar sejak lama, saat Aa Gym memutuskan berpoligami denganmenikahiAlfariniEridani atau akrab disapa Teh Rini, janda beranak tiga, pada Desember 2006 lalu.

Teh Rini merupakan mantan Sekretaris di MQ Corporation. Pernikahan mereka juga disaksikan Miftah Faridl. Dari pernikahan dengan Teh Rini, Aa Gym dikaruniai seorang anak. Sementara Aa Gym menikahi Teh Ninih pada tahun 1987. Dari

pernikahannya tersebut, Aa Gym dikaruniaitujuhanak,yakniGhaida Tsuraya, Muhammad Ghazi Al-Ghifari, Ghina Raudhatul Jannah, Ghaitsa Zahira Shofa, Ghefira Nur Fatimah, Ghaza Muhammad Al-Ghazali, dan Gheriya Rahima. (OTK)

Bangun Apa Saja dengan Modal Hemat ... Sambungan dari halaman 1

Ternyata benar. Bahkan, pembangunanpabriktersebutsudah selesai sejak dua tahun lalu. Pabrik itu dibangun dengan serius. Mesin-mesinnya baru buatan Eropa. Tapi, nganggur. Saya bayangkan berapa bunga yang harus dibayar investornya setiap bulan. Berapa banyak tenaga kerja yang mestinya bisa tertampung di situ. Berapa besar devisa yang bisa diperoleh karena keramik tersebut sudah punya pasar di Taiwan. Tentu, sayatidakbisamelihathalseperti itu. Saya minta teman-teman di Medan segera mengalirkan listrik ke pabrik itu. Di Jakarta saya juga menerima surat dan SMS yang sangat banyak. Asalnya dari kalangan industri. Isinya minta tambahan listrik. Mereka berencana mengembangkan usaha pada 2011. Tentu, tidak baik kalau saya melayani permintaan seperti itu satu per satu. Karena itu, saya umumkan saja secara terbuka melalui iklan di surat kabar: pengusaha yang memerlukan listrik silakan hubungi e-mail PLN. Pada 15 Desember 2010, permintaan itu, berapa pun besarnya, akan dipenuhi oleh PLN. Ketika mengumumkan itu, kami mengira permintaan listrik dari pengusaha akan mencapai 1.000 MW. Karena itu, acara pada 15 Desember 2010 tersebut kami beri nama ”Kado 1.000 MW untuk Pengusaha”. Ternyata meleset. Permintaan itu mencapai 1.600 MW. Satu jumlah yang amat besar. Yang saya bayangkan adalah: tahun 2011 akan sangat bergairah. Dari permintaan listrik itu saja, sudah bisadiketahuiberaparibupabrik yang akan mengembangkan usahanya. Berapa tenaga kerja yang akan terserap ke dalamnya. Bahkan, salah satu perusahaan yang minta listrik tersebut ternyata pabrik baja baru yang akan membangun pabrik lebih besar daripada Krakatau Steel. Ketika saya mendampingi wakil presiden ke Ambalat di perbatasan dengan Malaysia

pertengahanDesember,direktur Bank Papan mengungkapkan kegembiraannya bahwa banyak kredit macet di banknya yang membaik. Mengapa? Sebab, para pengusaha perumahan (real estate) sudah mulai bisa menjual rumah mereka. Ini juga karena perumahan mulai mendapatkan listrik. Gerakan ”satu hari satu juta sambungan” yang diadakan PLN pada 27 Oktober 2010 ternyata bukan hanya menyenangkan para pemilik rumah, tapi juga menyelesaikan banyak persoalan kredit macet. Pengurus Pusat REI (Real Estate Indonesia) memang merasa sangat tertolong oleh gerakan sehari sejuta sambungan itu. Apalagi kami masih akan memprogramkan bahwa pada Mei 2011 ini akan ada lagi gerakan sejuta sambungan. Bahkan, pada 2011 ini, seluruh daftar tunggu di seluruh Indonesia harus sudah tidak ada lagi. Artinya, orang yang memerlukan listrik bisa langsung mendapatkan listriknya. Kecuali yang rumahnya amat jauh dari jaringan listrik, yang untuk melayaninya masih memerlukan pembangunan tiang-tiang listrik yang banyak. Untuk yang seperti ini, memang banyak pekerjaan pendahuluan yang harus diselesaikan. Dari mana PLN memiliki listrik yang demikian banyak? Listrik itu, untuk Jawa, sebenarnya ada. Hanya saja, selama ini terjadi bottle-neck dalam penyalurannya. Untuk menyalurkan listrik itu diperlukan infrastruktur yang banyak. Mulai dari gardu induk tegangan ekstra tinggi (GITET) sampai ke trafotrafo distribusi. Pada akhir 2010, PLN sudah mendatangkan lima trafo IBT untuk lima GITET di sekitar Jakarta. Sembilan trafo IBT lagi akan tiba awal tahun 2011 untuk Jabar, Jateng, dan Jatim. Termasuk untuk mengganti trafo GITET Krian (Sidoarjo, Jatim) yang dulu dipinjam Cawang ketika GITET di Jakarta Timur itu meledak pada 2009. Demikian juga trafo distribusi. Pada akhir 2010, PLN membeli hampir 10.000 unit trafo

distribusi. Ini pembelian trafo terbesar yang pernah dilakukan PLN dalam satu periode. Kebetulan, dengan perubahan sistem pengadaan, PLN kini bisa membeli trafo GITET maupun trafo distribusi dengan harga hanya separo daripada harga pembelian dulu. Dari mana PLN tiba-tiba punya uang? Bisa membeli begitu banyak trafo? Selama 2010, dari berubahnya sistem pembelian, direktur pengadaan strategis bisa menghemat uang Rp 2 triliun! Sebuah penghematan yang bisa dipakai untuk membangun apa saja! Pada 2011, perubahan sistem pembelian itu akan dilanjutkan ke bidang pembelian suku cadang.Masihbesarpeluanguntuk berhemat di sektor pembelian spare-part itu. Jangan dilupakan pula, pada 2011 ini akan ada tambahan listrik 5.000 MW. Ini sama saja dengan stimulus ekonomi senilai Rp75 triliun. Tidak mungkin stimulus yang begitu besar tidak mampu menggerakkan ekonomi. Ekonomi pada 2011, dengan demikian, akan lebih baik. Setidaknya, tidak akan lebih buruk. Satu-satunya penghambat adalah kenaikan harga minyak mentah yang di luar kendali kita. Apalagi target produksi minyak mentah kita, rasanya, tidak tercapai tahun ini. Padahal, targetnya hanya 986.000 barel. Kalau saja produksi minyak mentah kita sangat baik, tentu justru kita yang akan ikut menikmati lonjakan harga minyak mentah dunia itu. Politik tidak akan lebih buruk tahun ini. Bahkan, bisa lebih baik. Kabar penyederhanaan partai lewat undang-undang yang kini sedang dibahas juga modal yang baik bagi kemajuan dan kematangan bangsa. Pada 2010, energi kita habis untuk Bank Century. Pada 2011, tidak perlu ada heboh-heboh seperti itu. Tahun 2011, tahun kelinci ini, akan membuat siapa pun yang lincah akan menguasai keadaan! (*)

+


8

Pontianak Post Meletus Lagi, Warga Panik

Sabtu 1 Januari 2011

Sosok

Susul Istri-Anak ke Bali Menko Perekonomian Hatta Rajasa, 57, berharap bisa merayakan Tahun Baru 2011 bersama istri dan anak-anaknya yang lebih dulu berlibur di Bali. Dia berharap, retreat bidang ekonomi di Istana Bogor yang dimulai pada 30 Desember bisa selesai dalam sehari saja. ’’Kebetulan anak saya liburan, ya kalau sempat menyusul ke Bali. Tapi, kalau masih disambung lagi (rapatnya), ya Hatta Rajasa berarti cukup di Jakarta,” kata Hatta. Harapan ketua umum Partai Amanat Nasional (PAN) tersebut bisa menjadi kenyataan. Sebab, Presiden Susilo Bambang Yudhoyono (SBY) memberikan libur sehari pada 31 Desember kepada para menteri yang mengikuti retreat di Bogor. Hatta mengatakan, tugas di pemerintahan akan tetap menjadi nomor satu. Dia tidak berkeberatan jika tidak bisa bersama dengan keluarga pada momen istimewa seperti perayaan tahun baru. ’’Ya, kerja kan nomor satu. Bagaimana lagi,’’ jelas lulusan teknik perminyakan Institut Teknologi Bandung (ITB) tersebut. Mantan Menristek, Menhub, dan Mensesneg itu memang cukup sibuk menjelang akhir tahun. Dia harus menyiapkan masterplan bidang perekonomian untuk dipresentasikan kepada para gubernur pada awal 2011. (sof/c7/ari)

HUKUM

SBY Tak Akan Dihadirkan Kejaksaan Agung sudah menjadwalkan pemeriksaan Jusuf Kalla dan Kwik Kian Gie sebagai saksi meringankan (a decharge) bagi Yusril Ihza Mahendra, tersangka kasus korupsi biaya akses Sistem Administrasi Badan Hukum (Sisminbakum) pada Rabu (5/1) mendatang. Kejagung yakin keterangan keduanya tidak akan melemahkan sangkaan tindak pidana terhadap Yusril. Pemeriksaan itu diyakini juga tidak akan Basrief Arief berujung pada terbitnya SP3 (surat perintah penghentian penyidikan) kasus Sisminbakum. ”Tidak. Itu (SP3) jauh banget hubungannya,” ujar Jaksa Agung Basrief Arief setelah salat Jumat di Masjid Baitul Adli, Kejagung, kemarin (31/12). Basrief beralasan, pemeriksaan terhadap JK dan Kwik merupakan pelaksanaan ketentuan undang-undang, yakni KUHAP. ”Baik itu saksi dari jaksa atau dari tersangka, semuanya diatur dalam undang-undang,” tutur mantan wakil jaksa agung itu. Menurut pasal 116 ayat (3) KUHAP, tersangka memiliki hak untuk mengajukan saksi meringankan kepada penyidik. Kemudian, dalam ayat (4) pasal yang sama, penyidik berkewajiban memeriksa saksi yang diminta tersangka. ”Jadi, kita memenuhi ketentuan undang-undang,” kata Basrief. Seperti diberitakan, JK dan Kwik diajukan sebagai saksi yang meringankan oleh Yusril. JK diperiksa dalam kapasitas sebagai mantan Menperin dan Kwik sebagai mantan Menko Ekuin. Mereka disebut ikut dalam rapat kabinet yang membahas masalah Sisminbakum di era Presiden Gus Dur.(fal/iro)

MILITER

Klaim Hemat Anggaran MARKAS Besar Tentara Nasional Indonesia (Mabes TNI) mengklaim mampu melakukan efisiensi dalam memanfaatkan jatah anggaran dari negara. Selama 2010, TNI berhasil menyerap seratus persen anggaran yang dialokasikan dari Kementerian Pertahanan. Bahkan, ada sisa anggaran yang diperoleh dari penghematandandikembalikan ke negara.’’Kami bisa mengembalikan sekitar Rp600 juta ke kas negara,’’ ujar Panglima TNI Laksamana TNI Agus Suhartono dalam konferAgus Suhartono ensi pers evaluasi kinerja satu tahun TNI di Mabes TNI Cilangkap kemarin (31/12). Anggaran yang dikembalikan ke negara, kata Agus, berasal dari penghematan saat melakukan kontrak atau tender pengadaan barang dan jasa. ’’Setiap kontrak ada lebih Rp2 juta, ada lebih Rp500 ribu. Itu semua dihitung,’’ ujarnya. Agus mengatakan, anggaran tersisa tidak berarti TNI tak mampu menyerap anggaran, tetapi mampu menyusun perencanaan dengan baik. ’’Kalau kita rencananya benar, pasti sisanya tidak akan banyak. Kalau kita tendernya benar dan bisa menghemat banyak, ya itu bagus,’’ katanya. Selain penyerapan anggaran yang maksimal, Agus juga mengatakan bahwa semua program kerja yang ditargetkan selama tahun 2010 sudah terlaksana dengan baik. ’’Kalau dari sisi program, semuanya sudah terlaksana. Efektivitasnya sudah bagus,’’ kata mantan KSAL itu. Dari Rp42,5 triliun anggaran Kemenhan 2010, alokasi anggaran yang dikelola TNI untuk pembinaan kekuatan dan pembangunan kekuatan Rp19,77 triliun. Hampir separonya digunakan untuk pengadaan dan pemeliharaan alat utama sistem persenjataan (alutsista).(rdl/ari)

Bupati Tawari Mengungsi PROBOLINGGO – Setelah memuntahkan material pijar setinggi hingga 300 meter dari bibir kawah pada Kamis (30/12) sore, aktivitas Gunung Bromo kemarin (31/12) cenderung menurun. Kendati begitu, warga masih khawatir akan tabiat Bromo yang masih labil. Sejak pukul 07.45 WIB, gempa tremor tercatat dengan amplitudo 5 – 28 mm saja. Asap yang membubung tidak lagi abu-abu kehitaman seperti sehari sebelumnya, melainkan putih kelabu dengan tinggi 600 – 800 meter dari bibir kawah. Angin mengarah ke timur dan timur laut. Kondisi tersebut berbeda dengan Kamis lalu (30/12). Mulai pukul 17.03 WIB hingga 24.00 WIB, Gunung Bromo mengeluarkan material pijar yang disebut stromboli yang terlempar hingga radius 500 meter. Selepas pukul 24.00 WIB, meterial pijar terhenti. Namun, suara gemuruh gunung berketinggian 2.329 meter tersebut terus terdengar hingga pukul 07.45 WIB kemarin. Gemuruh tersebut terdengar hingga Kecamatan Sukapura, bahkan Kecamatan Kuripan. Tetapi, suara itu menghilang pada siang. Muntahan material dan hujan abu vulkanis itu membuat suasana di sekitar Gunung Bromo suram mencekam. Terutama di kawasan Cemoro Lawang yang jaraknya hanya 3 km dari kawah Bromo. Rumah-rumah penduduk diselimuti abu tebal sehingga mengganggu aktivitas warga. Bahkan, beberapa rumah warga hancur dan roboh karena tidak kuat menahan beban pasir yang dimuntahkan gunung berapi itu. Pantas kemudian 50 warga Desa Ngadirejo, kawasan yang juga masuk ring satu takut dan mengungsi ke Kecamatan

ZAINAL ARIFIN/RADAR BROMO

DAMPAK BROMO: Terlihat sebuah rumah yang roboh karena tak kuat menahan beban berupa material pasir dari letusan Gunung Bromo. Hingga kemarin kondisi Bromo masih terus menyemburkan awan panas pekat warna kelabu dengan ketinggian mencapai 1.200 meter.

Sukapura. Mereka mengungsi di rumah-rumah saudaranya. Sebagian lain di aula kantor kecamatan. ’’Kami ketakutan mendengar suara bergemuruh dari Gunung Bromo,’’ ujar Suparno, salah seorang warga. Menurut warga, gemuruh suara letusan itu terus-menerus hingga menggetarkan tembok dan kaca-kaca rumah. Karena itu, untuk menghindari hal-hal yang tidak diinginkan, sebagian warga memutuskan untuk mencari perlindungan di tempat yang aman. Bupati Probolinggo Hasan Aminuddin merespons suasana yang dihadapi warga di

Desa Ngadirejo itu. Butapi pun menyiapkan tempat khusus untuk menampung warga yang mengungsi. ’’Kalau memang khawatir, saya tawarkan dengan hormat warga untuk mengungsi di tempat yang sudah saya siapkan,’’ ujar Hasan kepada wakil warga Desa Ngadirejo yang kemarin (31/12) mendapat bantuan pangan dari pemkab. Menurut Hasan, pemkab telah menyiapkan tempat pengungsian bagi 562 KK (kepala keluarga) warga Desa Ngadirejo. Tempat yang dipilih adalah gudang PT Kertas Leces (Persero) di Kecamatan Leces. Di tempat

sementara tersebut, para pengungsi akan difasilitasi dengan kebutuhan sehari-hari. Hasan mengakui, tawaran mengungsi diberikan karena pemkab tidak ingin ada warga yang menjadi korban. ’’Nyawa njenengan hanya satu,’’ tambahnya. Kelak jika warga mengungsi, rumah-rumah mereka akan dijaga anggota TNI dan Polri. Selain menjaga keamanan barang, petugas juga akan membersihkan atap-atap rumah warga yang dipenuhi abu dan pasir yang cukup tebal. Bila rumahrumah tersebut telah bersih, para pengungsi akan dikemba-

likan ke rumah masing-masing. ’’Kulo ngeman panjenengan,” ujar Hasan lagi. Tawaran mengungsi itu tidak hanya berlaku bagi warga Ngadirejo. Warga desa lain yang terkena dampak hujan abu juga ditawari. Namun, Desa Ngadirejo menjadi prioritas karena paling parah. Kades Ngadirejo Kembar Sanyoto mengatakan akan bermusyawarah dengan para kepala dusun serta ketua RT dan RW dulu untuk merespons tawaran bupati. ’’Besok (hari ini, Red) kami musyawarahkan dulu,” katanya. (qb/yud/jpnn/ ari)

Hakim Nakal Naik 40 Persen Animo Berhaji MA Klaim Selamatkan Duit Negara Rp10 T JAKARTA – Perilaku hakim nakal masih menghantui penegakan hukum. Berdasar catatan akhir tahun Mahkamah Agung (MA), jumlah pengadil nakal selama 2010 meningkat 40 persen jika dibandingkan dengan temuan tahun sebelumnya. Selama 2010, terdapat pelanggaran disiplin oleh 107 hakim, 15 panitera/sekretaris, enam wakil panitera, lima wakil sekretaris, sebelas panitera muda, 21 panitera pengganti, dua pejabat struktural, dan 26 pegawai negeri sipil. Umumnya, mereka dikenai sanksi ringan, sedang, hingga berat, bergantung pelanggaran masing-masing. ”Pada 2010, ada lima hakim yang diberhentikan secara tidak hormat melalui MKH (majelis kehormatan hakim, Red),” beber Ketua MA Harifin Andi Tumpa di gedung MA kemarin (31/12). Menurut Harifin, dengan data tersebut, jumlah hakim nakal meningkat 40 persen jika dibandingkan dengan catatan 2009. Selama 2009, hanya tiga hakim yang dipecat melalui MKH. Selain itu, 78 hakim mendapatkan sanksi

Harifin Andi Tumpa

disiplin. ”Itu yang kami sesalkan. Pengawasan terhadap para hakim harus ditingkatkan dengan pembinaan dan pengawasan yang melekat,” papar dia. Selain perilaku nakal aparat pengadilan, MA membeber prestasinya selama 2010. Harifin mengklaim, selama setahun itu lembaga peradilan tertinggi tersebut menyelamatkan duit negara Rp10 triliun. Jumlah itu jauh lebih tinggi daripada uang negara yang diselamatkan oleh Komisi Pemberantasan Korupsi (KPK), yang ‘hanya’ Rp176 miliar. Uang tersebut diperoleh dari kemenangan pemerintah atas sejumlah pihak dalam kasus perdata plus tindak pidana korupsi. Jumlah itu pun bisa meningkat jika ditambah dengan uang negara yang diselamatkan

dari perkara pidana khusus, seperti illegal logging, narkotika, dan psikotropika. Adapun uang negara yang diselamatkan oleh MA, Rp1,3 triliun diraup dari kemenangan Departemen Keuangan (kini Kementerian Keuangan) atas Tommy Soeharto, USD315 juta (setara Rp2,8 triliun), dan Rp68 miliar didapatkan dari Yayasan Supersemar yang juga kalah oleh Depkeu. Selain itu, dalam semua kasus tindak pidana korupsi, MA menjatuhkan denda Rp33,3 miliar dan mewajibkan pembayaran uang pengganti Rp5,98 triliun. Harifin menjelaskan, tidak semua uang tersebut diserahkan langsung kepada pemerintah oleh MA. Sebab, beberapa putusan denda harus dieksekusi oleh kejaksaan. ”Tapi kan karena putusan MA, uang itu diserahkan kepada pemerintah,” kata hakim dari Makassar tersebut, lantas tersenyum. Paparan laporan akhir tahun kemarin merupakan kegiatan anyar di lembaga peradilan tertinggi itu. Sebelumnya, MA tidak pernah mengungkapkan kepada publik laporan akhir tahunnya. Biasanya, mereka langsung menyampaikan laporan tersebut kepada pemerintah. ”Kepada pemerintah, kami sampaikan lebih detail pada Februari nanti,” tutur dia. (aga/agm)

Makin Tinggi 2 ribu Pendaftar Baru Tiap Hari

JAKARTA – Musim haji baru saja selesai berlangsung dua pekan silam tapi animo masyarakat menunaikan ibadah haji ke Tanah Suci kian tak terbendung. Data terbaru Kementerian Agama (Kemenag) menyebutkan, tiap hari rata-rata 2 ribu orang menyetor di berbagai BPS-BPIH (Bank Penerima Setoran-Biaya Penyelenggaraan Ibadah Haji). Mereka mendaftar untuk mendapatkan nomor kursi antrean untuk berangkat rata-rata 4-5 tahun mendatang. “Waiting list ke Tanah Suci secara nasional sudah mencapai 1 juta antrean,” kata Dirjen Haji dan Umrah Kemenag Slamet Riyanto di kantornya jalan lapangan Banteng, Jakarta, kemarin (30/12). Walaupun antrean haji semakin menumpuk, Slamet menjamin pihaknya akan meningkatkan layanan pendaftaran haji. Kemenag menjamin mekanisme penerimaan dan pembayaran setoran BPIH akan berjalan lancar sesuai dengan asas pengelolaan dana yang adil, akuntabel, dan profesional. “Tentunya tanpa

melupakan prinsip nirlaba,” kata dia. Direktur Pengelolaan BPIH dan Sistem Informasi Haji, Achmad Djunaedi mengatakan, setoran baru pendaftaran haji mencapai 60 ribu orang. Empat bank baru yang dipercaya menerima dana haji adalah BNI Syariah, BRI Syariah, BTN Syariah dan BPD Jateng Syariah. Keberadaan empat bank ini dengan demikian menambah jumlah BPS BPIH yang telah ada, antara lain 4 bank pemerintah (Bank Mandiri, BNI, BRI, dan BTN), 2 bank syariah (Bank Syariah Mandiri dan Bank Muamalat Indonesia), 1 bank swasta (Bank Bukopin), dan 14 bank pemerintah daerah. “Dana setoran haji di perbankan saat ini telah mencapai jumlah Rp22 triliun. Dana tersebut tidak termasuk Dana Abadi Umat (DAU) sebesar Rp1,6 triliun. DAU belum digunakan sejak masa Menag Maftuh Basyuni,” papar SlametDana setoran awal terkumpul dari setiap calon haji yang diwajibkan setor ke bank sebagai setoran awal Rp 20 juta, yang kini naik menjadi Rp 25 juta. Penggunaan bunga dari dana calon haji Rp 22 triliun tersebut akan dikembalikan untuk operasional jamaah haji. (zul)

Diusulkan Perlunya Kementerian Kependudukan JAKARTA – Permasalahan kependudukan yang begitu kompliks dipandang tidak bisa diselesaikan hanya dengan mengandalkan lembaga negara selevel Badan Koordinasi Keluarga Berencana Nasional (BKKBN). Karena persoalan kependudukan bersifat lintas sektor, Presiden SBY disarankan untuk membentuk Kementerian Kependudukan. “Koordinasi lintas sektor terkait kependudukan itu nggak mungkin dikerjakan BKKBN. Ini harus dilakukan menteri. Makanya, perlu menteri kependudukan,” kata Kepala Lembaga Demografi Fakultas Ekonomi UI Sonny Harry B Harmadi dalam diskusi Politik Kependudukan 2010 di Gedung DPR, Kamis (29/12) lalu. Turut berbicara Kepala BKKBN Sugiri Syarief dan anggota Komisi II DPR RI Akbar Faisal. Pembentukan kementerian

ini sepenuhnya tergantung dari political will Presiden. Apalagi, UU Nomor 39 tahun 2008 tentang Kementerian Negara sebenarnya juga menyebut kependudukan sebagai salah satu urusan pemerintahan yang bisa dibentuk kementerian tersendiri. “Lebih butuh mana Menteri PDT atau Menteri Kependudukan. Kalau ada reshuffle, saya usul sekaligus dibentuk kementerian kependudukan,” tegas Sonny. Dia mengungkapkan sejumlah negara lain yang jumlah penduduknya lebih sedikit dari Indonesia sudah terlebih dulu memiliki menteri kependudukan. Di antaranya Australia dan Mesir. Dia menjelaskan permasalahan kependudukan di Indonesia cukup serius. Berdasarkan sensus 2010, jumlah penduduk di Indonesia mencapai 237,6 juta. Untuk itu, Indonesia menduduki peringkat

ke-4 negara dengan penduduk terpadat setelah Tiongkok, India, dan Amerika Serikat. Saat ini, Indonesia juga berada di urutan ke-5 dalam hal konstribusi terhadap pertambahan penduduk dunia setelah Tiongkok, India, Brasil, dan Nigeria. “Banyak persoalan bangsa ini yang berpangkal dari masalah kependudukan,” ujar Sonny. Dia mencontohkan persoalan TKI tidak terlepas dari tekanan penduduk di dalam negeri yang membuat lapangan kerja terbatas. “Begitu juga soal isu lingkungan, perubahan iklim, sampah, banjir, transportasi, korupsi, semuanya terkait dengan penduduk,” tambahnya. Sonny menyampaikan BKKBN sekarang ini tidak mampu menekan pemerintah daerah untuk lebih memperhatikan program KB. Padahal, di era otonomi daerah,

kewenangan KB berada di daerah kabupaten/kota. Sementara mayoritas kepala daerah tidak memiliki komitment yang kuat terhadap program KB dan kependudukan. Lebih lanjut, Sonny mengingatkan DPR telah mengesahkan UU Nomor 52/2009 tentang Perkembangan Kependudukan dan Pembangunan Keluarga. Ada beberapa tuntutan Peraturan Pemerintah (PP) yang harus disiapkan. “Tapi, sampai akhir tahun ini, saya belum mendengar adanya upaya penyusunan PP tersebut. Apa gunanya ada UU tersebut, kalau belum bisa diimplementasikan,” tandasnya. Kepala BKKBN Sugiri Syarief mengatakan BKKBN bukan anggota kabinet. Karena itu, power politiknya lebih lebih rendah dari kementerian. “Dalam menjalankan tugas tidak sekuat kementerian, misalnya untuk mendorong

kabupaten/kota (terkait program KB, Red),” katanya. Karena itu, menanggapi gagasan perlunya dibentuk Kementerian Kependudukan, Sugiri sangat mendukung. “Insyaallah saya setuju,” tegasnya. Sugiri menyampaikan ketidakpedulian terhadap program KB di periode awal reformasi telah dibayar saat ini dengan percepatan pertumbuhan penduduk di Indonesia yang mencpai 5 juta. Menurut dia, baru pada 2007, pemerintah merevitalisasi program KB. Anggaran untuk BKKBN dinaikkan dari Rp700 miliar pada 2006 menjadi Rp1 triliun pada 2007. Anggaran itu terus meningkat menjadi Rp2,4 triliun pada 2011 mendatang. “Walaupun kebutuhan rilnya sekitar Rp3 – 4 triliun, namun dengan anggaran itu kami sudah bisa lari kencang seperti era 1980 – 1990 yang lalu,” janji Sugiri.(pri)


2010 - 2011

LFP

Pontianak Post l Sabtu 1 Januari 2011

Soccer P r e m i e r

Klasemen Sementara 1. Man United 18 10 8 0 2. Man City 20 11 5 4 3. Arsenal 19 11 3 5 4. Chelsea 19 10 4 5 5. Tottenham 19 9 6 4 6 . Bolton 20 7 8 5 7. Sunderland 20 6 9 5 8. Blackpool 17 7 4 6 9 . Blackburn 20 7 4 9 1 0. Stoke City 19 7 3 9 11. Everton 19 4 10 5 12 . Liverpool 18 6 4 8 1 3. Newcastle 19 6 4 9 1 4. West Brom 19 6 4 9 15. Aston Villa 19 5 5 9 16. Wigan 19 4 8 7 17. Birmingham 18 3 10 5 18. Fulham 19 3 10 6 19. Wolverhampton 19 5 3 11 20. West Ham 20 3 8 9

+

39-17 32-16 39-22 33-15 29-23 32-26 21-22 26-29 26-31 23-24 21-22 21-23 28-31 25-34 20-34 17-31 18-21 19-23 20-32 20-33

38 38 36 34 33 29 27 25 25 24 22 22 22 22 20 20 19 19 18 17

cmyk

9

L e a g u e

BENCI SERI

WEST BROMWICH - Manchester sejak menit awal. Selain Fletcher, United memang masih berstatus pe- winger Portugal Nani juga mungkin muncak klasemen Premier League di tampil setelah absen di dua laga terapergantian tahun. United juga belum khir karena cedera pinggul. terkalahkan hingga 18 laga. Namun, Keberadaan Nani merupakan ke­ ada satu hal yang menceuntungan bagi United kare­ maskan United kala melana skill “wanna be Cristiano wat ke The Hawthorns, kanRonaldo” itu bisa mendodang West Bromwich Albion, brak pertahanan tuan rumah malam nanti (siaran langsung yang kehilangan dua pemain MNCTV pukul 19.45 WIB). pilarnya. Pelatih West Brom Itu terkait handicap Setan Roberto Di Matteo dipusLangsung Merah - sebutan United - saat ingkan dengan skors yang MNC TV menjalani laga tandang sepamenimpa bek tengah Ganjang musim ini. Bagaimana Pukul 19.45 WIB briel Tamas dan bek kanan tidak, dari delapan away, United tujuh Gonzalo Jara. Bek tengah lainnya, kali mencatat seri dan hanya mampu Paul Scharner, juga masih berjuang menang sekali di kandang Stoke City pulih dari problem kebugaran. (2-1) pada 24 Oktober lalu. Menilik kondisi itu, The Baggies Catatan seri United itu paling banyak - sebutan West Brom - butuh kerja dibandingkan 19 kontestan liga lainnya. ekstrakeras untuk mengulang hasil Tak heran apabila tim besutan Sir Alex imbang 2-2 melawan United di Old Ferguson itu dicap sebagai raja seri di Trafford (16/10). “Yang membuat saya kandang lawan. Di laga terakhirnya bangga dengan pemain saya adalah, (28/12), Nemanja Vidic dkk juga ber- ketika mereka bermain tanpa rasa main 1-1 melawan Birmingham City. takut melawan tim mana pun. Itu pula “Kami tidak suka dengan hasil di yang menjadi kekuatan utama kami,” Birmingham karena gol penyeimbang ungkap Di Matteo kepada The Sun. lawan tercipta di menit-menit akhir. “Saya harap kami bisa melaluHasil itu sama mengecewakannya ke- kan sesuatu yang mengejutkan lagi tika kami bermain di kandang Fulham menghadapi Manchester United. dan Everton. Ada masalah dengan Dengan semakin matangnya pemain konsentrasi kami selama 90 menit,” kami, saya rasa kami bisa,” tambah ungkap Darren Fletcher, gelandang pelatih asal Italia tapi kelahiran Swiss United, kepada Sky Sports. 40 tahun lalu itu.(dns/bas) Seiring dengan bergulirnya Tahun Baru 2011, Fletcher percaya handicap Perkiraan Pemain timnya bakal berakhir. Dengan kata West Bromwich (4-5-1) : lain, Fletcher mengatakan apabila kemenangan away menjadi resolusi 1-Carson (g/c); 12-Reid, 6-Ibanez, 33United. “Itu apabila kami ingin meScharner, 20-Shorey; 7-Morrison, 5-Tchoyi, menangi gelar musim ini,” tandas 17-Dorrans, 21-Mulumbu, 14-Thomas; kapten timnas Skotlandia itu. 24-Odemwingie Fletcher sekaligus menanggapi Pelatih : Roberto Di Matteo pernyataan asisten pelatih Manchester City Brian Kidd, yang mengunggulkan Man United (4-3-3) : United bakal merebut titel ke-19. Kidd 1-Van der Sar (g); 21-Rafael, 5-Ferdinand, 15yang eks pemain United itu menilai Vidic, 3-Evra; 24-Fletcher, 16-Carrick, 8-AnSetan Merah sulit digusur, karena derson; 17-Nani, 9-Berbatov, 10-Rooney memainkan laga lebih sedikit dibandPelatih : Sir Alex Ferguson ingkan rivalnya. Rival terdekat United Stadion : The Hawthorns, West Bromwich saat ini adalah City yang sama-sama mengoleksi 38 poin, tapi memainkan Di Atas Kertas dua laga lebih banyak (18-20). “Saya kira itu hanya kidologi (stra­ MANCHESTER United memiliki catatan tegi dengan cara melempar pujian superior melawan West Brom di Premier kepada tim lawan dengan harapan League dengan menang delapan kali dan tim tersebut terbuai lalu lengah, sekali seri. Kali terakhir United kalah di The Red). Persaingan masih awal, dan Hawthorns, kandang West Brom, adalah ada beberapa tim yang memiliki tujuh tahun lalu di putaran keempat Piala kapabilitas memenangi liga. Kami Liga. United kalah 0-2. hanya salah satunya,” papar pemain asli binaan United itu. Bursa Asian Handicap Di sisi lain, Fletcher yang hanya menjadi cameo saat melawan BirWest Brom v Man United 1:0 mingham, kemungkinan bakal turun

Sudah Puas Dapat Lindegaard

+

2

West Brom Man United v

Anders Lindegaard

PENGGEMAR Manchester United harus menerima kenyataan jika Januari nanti mereka tak akan melihat hadirnya pemain baru di Old Trafford. Itu mengacu pernyataan pelatih United Sir Alex Ferguson yang kembali menegaskan tidak akan ada perekrutan pemain di paro musim ini. Ferguson mengatakan, apabila kiper Anders Lindegaard merupakan satu-satunya amunisi baru di pertengahan musim. Lindegaard, 26, digaet dari klub Norwegia Aalesund pada 27 November lalu. KIper timnas Denmark itu sudah menjalani latihan sejak bulan lalu dan sudah bisa diturunkan sejak Januari 2011. “Kami tidak memiliki rencana mendatangkan seseorang Januari ini. Kami sudah puas dengan Anders,” ungkap Ferguson kepada MUTV kemarin. Ferguson tahu apabila kebijakannya terkesan gambling. Pasalnya, United sedang menghadapi krisis pemain, khususnya di lini tengah. Park Ji-sung membela Korea Selatan di Piala Asia sepanjang Januari, Antonio Valencia dan Owen Hargreaves masih cedera, sedangkan Paul Scholes dan Ryan Giggs sudah berumur. Tapi, Ferguson bakal mengantisipasi­ nya dengan memaksimalkan peran pemain reserve-nya seperti Corry Evans, Ravel Morrison, Robert Brady, dan Magnus Eikrem. Tom Cleverly yang dipinjamkan ke Wigan Athletic sejak awal musim juga bisa ditarik. “Terbatasnya pemain di lini tengah akan diisi pemain muda kami,” jelasnya. Ferguson sekaligus memastikan status Federico “Kiko” Macheda. Penyerang 19 tahun asal Italia itu dipastikan akan dipinjamkan sampai akhir musim. Kiko sudah dikaitkan dengan klub di awal karir juniornya, Lazio. Tidak menutup kemungkinan, Kiko bakal pindah permanen karena peluang tampil striker Italia U-21 itu makin sulit musim depan. Di posisi penyerang, United masih memiliki Javier “Chicharito” Hernandez dan Bebe sebagai pelapis Wayne Rooney dan Dimitar Berbatov. Juga ada Danny Welbeck dan Mame Biram Diouf yang musim ini tampil bagus di klub pinjamannya. Welbeck di Sunderland dan Diouf di Blackburn. “Saya sudah berbicara dengan Kiko. Saya tidak ingin dia pergi, tapi ada beberapa pemain yang satu posisi dengannya mengalami progres bagus. Semoga Kiko bisa meraih apa yang diraih Welbek dan Diouf musim ini,” terang Ferguson.(dns/bas)

KORAN

cmyk

Wayne Rooney Manchester United

+

Balas Dendam Pemecatan Anak AYAH mana yang rela anaknya disakiti. Pelatih Manchester United Sir Alex Ferguson paham akan hal itu. Fergie - sapaan akrab Ferguson - bereaksi ketika anaknya, Darren Ferguson, dipecat sebagai pelatih klub Championship (level kompetisi dibawah Premier League) Preston North End. Apa yang dilakukan Fergie ? Tak lain memutuskan untuk menarik pulang dua

pemain muda United yang dipinjamkan di Preston. Keduanya adalah defender Ritchie de Laet dan gelandang Joshua King. Padahal, kontrak peminjaman keduanya baru habis akhir musim. “Itu (keputusan United menarik pulang De Laet dan King, Red) merupakan kejutan dan pukulan telak bagi klub kami. Sebagaimana klausul kontrak peminjaman,

Manchester United bisa melakukan hal itu,” ungkap Chairman Preston Maurice Lindsay kepada Soccernet. Tidak hanya De Laet dan King, Uni­ted juga sudah meminta agar gelandang bertahan sekaligus kapten Inggris U-19, Matty James, segera dikembalikan Preston ke Old Trafford. “United juga meminta Matty, tapi kami mungkin masih bisa menahannya karena ada perbedaan klausul kontrak dengan Ritchie dan Joshua. Kami tidak mengerti alasan United melakukannya,” tambah Lindsay. Pertengahan pekan lalu (29/12), Darren dilengserkan menyusul kekalahan 1-3 dari Middlesbrough sehari sebelumnya. Kekalahan dari Boro sebutan Middlesbrough - makin membenamkan Preston di dasar klasemen dengan 19 poin dari 22 laga. Asisten pelatih David Unsworth sudah ditunjuk sebagai pengganti Darren dengan status karteker. “Itu (pemecatan) merupakan sesuatu yang kerap terjadi pada seorang pelatih di akhir tahun. Darren akan baik-baik saja. Saya yakin dia bisa cepat melupakannya karena dia pernah mengalaminya dan dengan pengalamannya dia akan kembali bangkit,” terang Fergie

Darren Ferguson

menanggapi pemecatan Darren. Fergie diketahui bukan kali ini me­ nunjukkan pembelaannya kepada anak­nya. Enam tahun lalu, Fergie mem­ boikot wawancara dengan BBC karena menayangkan dokumenter anaknya, Jason. Dalam acara itu, Jason disebut kerap memanfaatkan kepopuleran Fergie dalam menjalankan profesinya sebagai agen pemain. Sampai sekarang, Fergie tetap me­ neruskan aksi boikotnya kepada situs resmi Premier League itu. Pelatih yang kemarin (31/12) genap 69 tahun itu pun rela didenda karena tindakannya bertentangan dengan peraturan liga tentang kewajiban pelatih memberikan siaran pers setelah pertandingan.(dns)

+


10 Belum Pasti Berangkat Sepak Takraw Pelatnas 1 Juni JAKARTA - PB PSTI (Persatuan Sepak Takraw Seluruh Indonesia) terus menebar optimisme tampil di Asian Games XVI/2010. Achmad Sofyan Hanif, kabidbinpres induk organisasi olahraga itu menyatakan, pihaknya telah mengupayakan berbagai cara untuk membuat sepak takraw juga ikut tampil pada multieven di Guangzhou, November mendatang. “Kami terus mempromosikan, kalau kami layak untuk berangkat di setiap forum dengan KONI dan Prima (Program Indonesia Emas),” ungkap Sofyan kala ditemui di kantornya, kemarin (25/5). “Sepertinya, usaha kami membuahkan hasil. Saya mendengar kabar, sudah ada draft SK dari KONI untuk memberangkatkan sepak takraw,” tambahnya. Dia pun menyatakan, pihaknya siap mengeluarkan dana swadaya untuk membiayai keberangkatan mereka di pesta olahraga antarbangsa Asia tersebut. Tapi, kepatstian itu masih harus menunggu turunnya SK dari KONI. Optimisime PSTI semakin terlihat dengan keputusan mer-

eka untuk melakukan pelatnas mulai 1 Juni nanti, kendati masih belum ada kepastian mereka menjadi bagian dari kontingen Merah-Putih. Pelatnas itu akan dilakukan di kawasan Pondok Cabe, Tangerang Selatan Pria yang juga dosen Pascarsajana Universitas Negeri Jakarta (UNJ) itu menuturkan, total ada 30 atlet pria dan wanita yang dipanggil untuk mengikuti pelatnas. Atlet-atlet itu berasal dari 12 daerah. Di antaranya adalah DKI Jakarta, Jawa Timur (Jatim), dan Jawa Tengah (Jateng). Sedangkan pelatih yang akan dilibatkan berjumlah empat orang. “Mereka harus sudah masuk pelatnas 1 Juni. Setelah masuk, mereka langsung kami tes kondisi fisiknya,” paparnya. Dia menambahkan, kalau memang ada di antara mereka yang kondisi fisiknya tidak bagus, akan langsung dipulangkan, dan dicari penggantinya. Menurutnya, hal itu harus dilakukan, mengingat waktu persiapan yang hanya tersisa lima bulan. Sebab, mereka akan langsung digenjot dalam persiapan teknik dan taktik, karena tak ada lagi waktu menggarap kondisi fisik atlet. Tanpa fisik prima, peningkatan teknik dan taktik tidak akan efektif. (nar)

METRO SPORT

Pontianak Post Sabtu 1 Januari 2011

Lima Pemain Masuk Tim U-23 JAKARTA - Usai gelaran Piala AFF 2010, pelatih Alfred Riedl dan kepelatihannya langsung menyongsong even yang tak kalah bergengsi. Yaitu SEA Games 2011. Tapi yang tampil di multi even dua tahunan itu adalah timnas U-23. Dari skuad timnas senior yang kemarin berlaga di Piala AFF ada lima pemain yang dipastikan bakal memperkuat timnas U-23 di SEA Games 2011. Mereka adalah Irfan Bachdim (Persema), Yongki Aribowo (Arema), Octovianus Maniani (Sriwijaya), Johan Johansyah (Persijap), dan kiper Kurnia Meiga (Arema). Dua nama terakhir di Piala AFF kemarin tidak sempat dimainkan satu menit pun oleh pelatih Alfred Riedl. Sebelum berlaga di SEA Games 2011, pada 23 Februari dan 3 Maret mendatang timnas U-23 terlebih dulu akan berlaga di pra kualifikasi Olimpaide 2012 melawan Turkmenistan. Memakai sistem home dan away Indonesia akan menjadi tuan rumah lebih dulu. Dari lima pemain tersebut di atas, karena batasan usia hanya tiga

pemain yang bisa bergabung dengan tim pra kualifikasi olimpiade. Yaitu Yongki Aribowo, Octovianus Maniani, dan Kurnia Mega. Irfan dan Johan melewati batas usia di Olimpiade 2012. Untuk SEA Games, karena Indonesia menjadi tuan rumah, Alfred Riedl dibebani target meraih medali emas. Kali terakhir Indonesia menggondol medali emas SEA Games sudah terjadi 1991 silam. Sekjen PSSI Nugraha Besoes mengungkapkan, pelatih Alfred Riedl sudah membuat rancangan program pelatihan sekaligus uji coba untuk timnas U-23. Salah satu program uji coba adalah turun di turnamen U-23 ASEAN yang rencananya akan dihelat Juni mendatang di Jakarta. “Kami sedang merancang adanya sejumlah turnamen internasional di Jakarta. Baik yang nanti melibatkan tim SEA Games atau timnas senior,” kata Nugraha. Saat ini Badan Tim Nasional ( BTN) sudah mengantongi 74 nama yang akan dipanggil mengikuti seleksi timnas U-23. Seleksi dijadwalkan

mulai digelar pada 6 Januari di Jakarta. Seleksi nanti akan diikuti oleh pemain berdarah Indonesia yang baru saja resmi menjadi Warga Negara Indonesia ( WNI), Kim Jefrrey Kurniawan. Kepada Koran ini beberapa hari lalu Kim menyatakan sangat senang akhirnya proses naturaliasinya beres dan bisa ikut seleksi masuk timnas U-23 Indonesia. “Saya siap menunjukkan kemampuan terbaik saya dan bersaing dengan pemain yang lain untuk mendapatkan satu tempat di timnas,” kata Kim. “Target saya adalah membantu timnas Indonesia menjadi juara SEA Games tahun depan,” lanjut pemain yang lahir dan besar di Jerman ini. (ali/ko)

MASUK TIM 21: Pemain Indonesia, Irfan Bachdim dan pemain Malaysia, Mohamad Sabre bin Mat Abu , saat pertadingan final AFF 2010 di Stadion Utama Gelora Bung Karno,(29/12). HENDRA EKA/JAWA POS

WTC Gelar Open Tournament Tenis NasionMeriahkan HUT WTC PONTIANAK--Memeriahkan Hari Ulang Tahun Wisda Tennis Club (WTC) yang pertama, klub tenis pendatang baru tersebut berencana akan menggulirkan open tournament tenis tingkat nasional. Kejuaraan tersebut rencananya akan dilaksanakan pada Juni 2011 di Kota Pontianak. Hal itu diungkapkan Ketua WTC H Sawon Subandiyo SSos MM kemarin. ”Di ulang tahun klub kita yang pertama, kita berencana akan menyelenggarakan pertandingan tenis lapangan terbuka untuk tunggal dan ganda veteran perorangan,”

kata Sawon. Menurutnya, rencana tersebut sudah semakin matang dengan dukungan berbagai pihak, terutama Pemprov Kalbar, Pelti Kalbar, Pemkot Pontianak dan Pencab Pelti Kota Pontianak. Pertandingan, menurut Sawon, akan dibagi menjadi dua kelompok, yakni, tunggal perorangan umum untuk semua umur. Sedangkan kelompok kedua ganda veteran perorangan untuk usia 45 s/d 50 tahun, usia 50 s/d 55 tahun dan 55 s/d 60 tahun. ”Diluar usia dimaksud tidak diperkenankan ikutserta dan kelompok ini hanya dikhususkan untuk petenis Kalimantan Barat,” kata pria yang biasa disapa AA Sigan itu.

Agar pada selain menyalurpertandingan kan hobi dan bakat nanti berlangsung tentunya,” ungkap ketat dan alot, SaAA Sigan. won meminta keUntuk para pada para petenis petenis muda, Kalbar untuk sedikata Sawon, denni mungkin memgan berlatih tenis persiapkan diri. dari awal memTak hanya untuk berikan banyak usia veteran, usia manfaat, teruremaja dan junior tama pematanjuga diharapkan Sawon Subandiyo gan kemampuan, bisa menunjukualitas dan kan kualitas tandingnya agar skill bertanding. “Selain itu mampu menyaingi permainan menghindari kegiatan negatif petenis luar Kalbar. juga,” tukasnya. “Saran saya, khusus untuk Pada kesempatan itu juga usia veteran latihan sudah harus AA Sigan mengucapkan sedilakukan sejak sekarang dalam lamat natal kepada gubernur melatih kekompakan dan saling beserta keluarga dan selamat mengetahui karakter partner, tahun baru kepada gubernur,

wakil gubernur, sekda, walikota, wakil walikota, sekda kota Pontianak dan para pejabat struktural di lingkungan Pemerintah Provinsi dan Pemerintah Kota Pontianak. “Dan tentunya bagi masyarakat Kalimantan Barat yang merayakannya,” ucapnya. Dia juga meminta doa dan dukungan agar rencana besarnya mennggulirkan even berkelas nasional ini bisa terwujud di Bumi Khatulistiwa Pontianak. Selain itu AA Sigan juga berencana pada 8 dan 9 Januari 2011 iniakanmenggelarpertandingan persahabatan dengan beberapa klub yang selama ini menjadi mitra WTC yakni, Klub Tenis PU, Klub Tenis Kota Pontianak dan Klub Tenis Untan. (bdi)

Firdaus Kembali Pimpin PTMSI Kalbar PONTIANAK—FirdausZar’in kembali kembali menjadi Ketua

Umum Pengprov PTMSI Kalbar pada musyawarah provinsi

Bertekad Lolos Pra PON dan Berprestasi di PON XVIII (Musprov) di Hotel Kartika Kamis (30/12). Dia terpilih secara aklamasi setelah 12 suara yang dari 11 pengkab/ pengkot ditambah 1 suara dari provinsi secara bulat memilihnya kembali sebagai Ketua PTSMI periode 2010-2014. Dengan terpilihnya lagi Firdaus Zar’in sebagai Ketua PTMSI Kalbar, pria yang juga menjabat sebagai Sekretaris KONI Kalimantan Barat tersebut bertekad mengulang kembali sejarah membawa tim tenis meja Kalbar lolos Pra PON 2011 sehingga bisa berprestasi di ajang PON 2012. Tekad ini menjadi target dirinya setelah berkaca dari empat tahun lalu, dimana tenis meja Kalbar lolos di PON XVII Kaltim tahun 2008 lalu. “Tentunya mesti dengan dukungan dan kerja keras dari insan tenis meja untuk mendorong atlet-atlet kita,” katanya. Pada Musoprov yang minus dihadiri Singkawang, Bengkayang dan Sintang itu, Firdauz juga mengatakan akan melakukan perampingan terhadap anggota di setiap bidang organisasi. Dimana akan menjadi dua orang dari sebelumnya empat orang setiap bidang yang bertujuan efektivitas kepengurusan. Namun,iamenyatakanmasih belum puas atas kinerjanya di periode pertama lalu 2006-2010. Karena itu berbagai terobosan telah dirancang dalam rangka meningkatkan prestasi tenis

BUDIANTO/PONTIANAK POST

MUSPROV: Ketua Umum Terpilih, Firdaus Zar’in (tengah) diabadikan bersama para pengurus pengkab dan pengkot PTMSI se-Kalbar usai Musprov Jumat kemarin.

meja Kalbar. “Saya belum merasa puas karena masih banyak PR yang perlu ditingkatkan terus seperti pembinaan atlet mulai dari skill, speed dan power. Begitu juga dengan pelatih level nasional yang kedepannya akan kita datangkan untuk melatih atlet tenis meja kita,” ucapnya. Selain itu Firdauz juga mengatakan Kalbar masih butuh sarana dan prasarana yang memadai untuk mendukung prestasi tenis meja Kalbar, terutam tempat untuk berlatih maupun bertanding. “Kalbar hingga kini belum memilikinya,” tukasnya. “Kita sedang mencarikan solusinya soal asset ini. PB siap membantu. Kita akan bekerja keras untuk melobi pemerintah agar sarana yang representatif dapat terpenuhi,” tambahnya. Figur Firdaus Zar’in bagi insan olahraga Kalbar sudah tidak asing lagi. Ia juga dikenal memegang jabatan di KONI Ka-

lbar sebagai Sekretaris Umum mendampingi Sy. Machmud Alkadri sebagai Ketua Umum. Dibawah kepemimpinannya selama empat tahun lalu, olah raga tenis meja Kalbar mulai merangkak naik bahkan menunjukan taringnya di tingkat nasional antara lain lolos PON XVII Kaltim dan juara tiga bersama beregu saat kejurnas 2009 lalu. Iskandar AR Sekretaris Umum Pengkab PTMSI Kubu Raya menilai tidak salah mencalonkan kembali Firdaus Zar’in karena telah banyak program terobosan yang dilakukannya cukup berhasil mengangkat tenis meja. “Selama kepemimpinan beliau tenis meja Kalbar mulai bergerak. Bahkan selama sejarah ia berhasil membawa tenis meja Kalbar ke PON. Ini prestasi yang sangat baik,” tandasnya seraya berharap Kalbar memiliki hall atau gedung tenis meja. (bdi)


cmyk

Pontianak Post l Sabtu 1 Januari 2011

Agenda Premier League Sabtu, 1 Januari 2011 West Bromwich v Man United (siaran langsung MNCTV pukul 19.45 WIB) Man City v Blackpool (siaran langsung MNCTV pukul 22.00 WIB) Liverpool v Bolton (siaran langsung Global TV pukul 22.00 WIB)

All Soccer

Real Ikut Kejar Fabregas Kaka Takkan Dilego pada Januari

Minggu, 2 Januari 2011 Birmingham City v Arsenal (siaran langsung MNCTV pukul 00.30 WIB) Chelsea v Aston Villa (siaran langsung MNCTV pukul 20.30 WIB) Tottenham Hotspur v Fulham (siaran langsung MNCTV pukul 22.00 WIB) Liga Primera Minggu, 2 Januari 2011 Athletic Bilbao v Deportivo La Coruna (siaran langsung TV One pukul 22.00 WIB)

+

Senin, 3 Januari 2011 Barcelona v Levante (siaran langsung TV One pukul 00.00 WIB) Sevilla v Osasuna (siaran langsung TV One pukul 02.00 WIB) Valencia v Espanyol (siaran langsung TV One pukul 04.00 WIB)

Laga Pekan ke-17 Sesuai Jadwal

+

MADRID - Tuntutan para pemain sepak bola profesional Spanyol supaya laga pekan ke-17 Liga Primera Spanyol pada 2 Januari nanti ditunda gagal tercapai. Pengadilan tinggi di Spanyol menilai tuntutan dari pemain itu di luar yuridiksinya. Ya, AFE (asosiasi pemain sepak bola profesional Spanyol) menuntut kepada LFP (pengelola Liga Primera) menunda pertandingan pada 2 Januari karena keluhan para pemain. Karena negosiasi gagal, mereka mengajukan tuntutan ke pengadilan tinggi. AFE berpedoman pada kesepakatan antara mereka dengan LFP bahwa tidak ada pertandingan yang dihelat sejak 23 Desember hingga 2 Januari. Itu biasanya dianggap sebagai hari libur. AFE menuntut, setidaknya laga dihelat malam hari, bukan sore hari. Ternyata, jadwal yang dibuat LFP tetap menempatkan beberapa laga di sore dan petang. Yakni, partai antara Athletic Bilbao versus Deportivo La Coruna di Stadion San Mames, yang berlangsung pada pukul tiga sore waktu setempat. Makanya, AFE gerah. Selain itu, dua laga lainnya dihelat pada pukul lima sore waktu setempat. Yakni, antara Barcelona melawan Levante di Nou Camp dan Sporting Gijon menghadapi Malaga di El Molina. Jadwal kick-off yang terlalu sore itulah yang dipersoalkan. Setelah negosiasi AFE dengan LFP buntu, AFE mengajukan kasus itu ke pengadilan tinggi. Sayang, tidak mendapat respons positif. “Pengadilan tinggi menyatakan bahwa tidak kompeten untuk memutuskan masalah itu,” begitu keterangan di Reuters. Tanpa adanya keputusan baru, maka otomatis jadwal takkan berubah. Penyebabnya, AFE tidak punya lagi kesempatan untuk mengajukan tuntutan ulang ke pengadilan arbitrase atau lainnya. Masalahnya, pengadilan sudah tutup pada 31 Desember dan 1 Januari. Dengan begitu, mereka sudah tidak pu­nya waktu lagi. Sebab, pada 2 Januari, pertandingan sudah harus dilangsungkan. Tapi, belakangan media-media di Spanyol mengabarkan, itu hanya upaya AFE untuk menaikkan isu lainnya. Sejatinya, perhatian utama AFE adalah problem belum dibayarnya gaji para pemain di klub kasta kedua Real Betis. AFE dan para pemain di Real Betis menuntut kepastian bayaran. Hanya saja, bila langsung menarik pada isu itu, banyak klub Liga Primera yang tidak tertarik.(ham)

cmyk

11

Cesc Fabregas Arsenal

P r e m i e r

Liverpool

v

MADRID - Keinginan Bar­ celona menggaet kapten Arsenal Cesc Fabregas bakal mendapat pesaing. Rival aba­ dinya Real Madrid nampaknya berminat kepada gelandang jebolan akademi Barcelona itu. Mereka bersedia merogoh saku dalam-dalam. Berdasarkan kabar yang dilaporkan Daily Mail, entrenador Real Jose Mourinho menilai Fabregas merupakan sosok yang ideal untuk mengisi lini tengah Real. Fabregas akan dipasangkan dengan rekannya di timnas Spanyol Xabi Alonso. Tidak tanggung-tanggung. Demi mendapatkan Fabregas, tim berjuluk Los Blancos itu rela menggelontorkan dana senilai 40,5 juta euro atau setara Rp 476,2 miliar. Mourinho meminta Real bekerja keras merayu sang pemain agar mau bergabung. Memang, sulit untuk diwujudkan di bursa transfer tengah musim ini, tapi dipersiapkan untuk bursa transfer awal musim depan. Kebetulan, Real memiliki kemungkinan melepas playmaker asal Brazil Kaka di awal tahun depan. Surat kabar terkemuka Spanyol AS mengklaim, Real telah siap untuk melepas Kaka pada awal musim depan. Namun, bukan bergabung ke Inter Milan. Peluang terbesar, mantan pemain AC Milan itu akan bergabung ke Chelsea. Kemungkinan itu disampaikan Ernesto Bronzetti, agen kenamaan asal Italia. “Saya berani bilang hampir 90 persen Kaka berpeluang

angkat kaki ke Chelsea dengan nilai transfer mencapai 50 juta euro (setara Rp 587 miliar),” ujar Bronzetti kepada Football Italia. Keberadaan Carlo Ancelotti sebagai manajer Chelsea jadi daya tarik tersendiri bagi Kaka. Sebab, keduanya pernah berkolaborasi apik selama di AC Milan. Rumor itu seolah menjadi jabawan atas rumor Kaka bergabung ke Inter. "Kaka ke Inter” Saya mengenal Presiden Real Florentino Perez cukup baik. Saya baru berbicara dengan dia beberapa hari lalu dan dengan jelas dia bilang tidak akan menjual Kaka selama Januari nanti. Kaka akan bertahan,” lanjut Bronzetti. Ya, sekarang tenaga Kaka memang sangat dibutuhkan Mourinho. Dia akan menjadi sosok yang penting di lini tengah Real. Tactician asal Portugal itu menyatakan tidak akan melepas Kaka pada Januari ini dengan alasan dia tidak mungkin dapat pengganti lebih baik. Memang, sekarang Kaka bakal kesulitan mendapatkan tempat utama di lini tengah Real. Sebab, sudah ada Mesut Oezil yang tampil hebat selama musim ini. Sedikit ke belakang, ada Xabi Alonso dan Sami Khedira. Belum lagi Real juga punya pemain muda berbakat Sergio Canales. Kaka belum pernah dimainkan sepanjang musim ini karena dia baru saja pulih dari cederanya. Sejak pertengahan Desember lalu, dia mulai ikut berlatih bersama rekan-rekannya. Mourinho menilai, Kaka akan memberikan suntikan tenaga baru buat Real. (ham)

+

L e a g u e

Bolton

Penentu Nasib Hodgson LIVERPOOL - Awal tahun 2011 bisa menjadi akhir karir Roy Hodgson di Liverpool. Ya, jabatan pelatih Liverpool itu berada di ujung tanduk setelah kekalahan memalukan 0-1 dari Wolverhampton Wanderers di Anfield midweek lalu (29/11). Efeknya, jabatan Hodgson jadi pertaruhan ketika Liverpool menjamu Bolton Wanderers (siaran langsung Global TV pukul 22.00 WIB). Laga di Anfield itu merupakan do or die bagi Hodgson. Pemilik The Reds - sebutan Liverpool - John Henry dikabarkan telah mengultimatum pelatih 63 tahun itu, seiring derasnya tuntutan pemecatan yang disuarakan Liverpudlians - sebutan fans Liverpool. Liverpudlians pantas kecewa. Pasalnya, 22 poin yang diraih Liverpool saat ini merupakan angka terendah di awal tahun baru sejak musim 1953-1954. Liverpudlians kembali mendesak agar mantan pemain dan pelatih The Reds Kenny Dalglish ditunjuk sebagai pengganti Hodgson. Liverpudlians bahkan telah menggalang petisi untuk menyingkirkan pelatih pengganti Rafael Benitez itu. Apa

yang dilakukan Liverpudlians kembali memantik emosi Hodgson. “Saya selalu berada dalam situasi itu (tidak disenangi LIverpudlians, Red) sejak awal sekalipun kami tidak kalah. Saya tidak suka mendapat rival dalam jabatan yang masih saya tempati,” ungkap Hodgson kepada Liverpool Echo. Meski kesal, Hodgson tetap meminta maaf kepada Liverpudlians karena belum mampu memberikan hasil terbaik bagi tim. “Saya tahu saya adalah orang yang harus bertanggung jawab atas semuanya, sekalipun itu sungguh berat bagi saya memikulnya,” tambah mantan pelatih Fulham itu. Beban Hodgson memang berat untuk mempertahankan jabatannya. Pasalnya, Bolton merupakan tim kuda hitam musim ini. The Trotter - sebutan Bolton - kini menduduki peringkat keenam atau enam tingkat di atas Liverpool. Kendati kalah 0-1 melawan Chelsea di laga terakhirnya (29/12), tim asuhan Owen Coyle itu layak diapresiasi karena turun dengan kekuatan hanya 17 pemain. “Skuad kami memang sangat

terbatas saat ini karena banyak pemain cedera. Skors Paul Robinson (bek kiri Bolton, Red) menambah masalah yang kami hadapi,” ungkap Coyle kepada Daily Mail. “Meski begitu, semangat luar biasa pemain ketika melawan Chelsea membuat saya yakin kami bisa meraih hasil lebih baik melawan Liverpool,” tambah pelatih berwajah mirip aktor Hollywood George Clooney itu.(dns/bas) Perkiraan Pemain Liverpool (4-4-1-1) 23-Reina (g); 2-Johnson, 37-Skrtel, 5-Agger, 6-Aurelio; 18-Kuyt, 21-Lucas, 4-Meireles, 17-Maxi; 8-Gerrard; 9-Torres Pelatih : Roy Hodgson Bolton (4-4-2) 22-Jaaskelainen (g); 18-Rickett, 5-Cahill, 12-Knight, 25-Alonso; 10-Petrov, 6-Muamba, 8-Holden, 7-Taylor; 9-Elmander, 14-K.Davies Pelatih : Owen Coyle Bursa Asian Handicap Liverpool v Bolton 0 : 3/4

FERNANDO Torres

+


12

Dekati Van Persie TURIN - Juventus akan sibuk pada bursa transfer tengah musim yang mulai dibuka hari ini (1/1). Pasalnya, klub berjuluk Nyonya Tua tersebut memang berambisi untuk menambah daya gedor di lini depan. Sederet striker top masuk dalam daftar bidikan mereka. Dari sekian nama yang dilirik, striker Arsenal asal Belanda Robin van Persie berada dalam daftar teratas incaran direktur olahraga Juve Giuseppe Marotta. Bahkan, Juve sudah siap melayangkan tawaran sebesar 27 juta euro atau setara Rp 317,4 miliar. Sejatinya, Van Persie bukan satu-satunya pemain yang berada dalam skala prioritas. Sebab, Juve juga mengincar striker Wolsfburg asal Bosnia-Herzegovina Edin Dzeko. Namun, Dzeko tampaknya telah merapat ke Manchester City. Berdasarkan kabar yang dilansir Tuttosport, selain menawarkan uang tunai, Juve juga berencana menjadikan gelandang asal Brazil Felipe Melo sebagai alat tukar. Kebetulan, manajer Arsenal Arsene Wenger sudah lama meminati Melo. Pemain timnas Brazil tersebut disiapkan untuk memperkokoh lini tengah The Gunners-julukan Arsenal, yang selama ini disesaki pemain muda. Tapi, Marotta juga tidak buru-buru dalam upayanya mengejar Van Persie. Bila gagal mendapatkanya pada bursa tengah musim ini, maka mereka akan kembali melakukan negosiasi pada awal musim depan. Juve memang membutuhkan striker gres. Stok yang ada sekarang, yakni Alessandro Del Piero, Vincenzo Iaquinta, Amauri, dan Fabio Quagliarella dinilai masih minim. Del Piero sudah termakan usia, sementara performa Amauri naik turun. Sembari menunggu Van Persie, surat kabar terkemuka Italia Corriere dello Sport mengklaim, Marotta sudah membidik dua striker asli Italia. Mereka adalah striker Sampdoria Giampaolo Pazzini dan Alberto Gilardino (Fiorentina). “Dari sisi profil, Pazzini memang berguna bagi Juve. Bila Sampdoria menempatkannya dalam daftar jual, kami akan langsung menawarnya. Itu juga berlaku untuk Gilardino. Masalahnya, klub mereka enggan melepas,” kata Marotta, sepetri dikutip Football Italia. (ham/bas)

Robin van Persie

world soccer

Pontianak Post l Sabtu 1 Januari 2011

John Rooney, Adik Wayne Rooney Mengadu Nasib di MLS

Terbang ke AS Setelah Dapat Saran dari sang Kakak Kendati memiliki pertalian darah, tapi bakat sepak bola John Rooney tidak secemerlang kakaknya Wayne Rooney. Bila sang kakak jadi bintang di Manchester United, John justru sedang sibuk seleksi di MLS. John Rooney memulai karirnya di level junior bersamaandengan sang kakak Wayne Rooney di akademi Everton. Namun, karir sang kakak melesat begitu cepat. Ketika masih berusia 16 tahun, Rooney telah menembus skuad senior Everton. Di tahun debutnya pada 2002, Rooney sudah menarik perhatian publik Inggris. Dia disebut-sebut sebagai bakat paling cemerlang. BBC Sports pun langsung menempatkannya sebagai sosok muda terbaik 2002, tepat di tahun debutnya. Nah, di kala sang kakak dipuji sebagai talenta muda berbakat dengan masa depan cemerlang, sang adik John justru dilepas Everton junior karena dianggap kurang berbakat. Sempat menghilang beberapa tahun, pada 2008 dia berlabuh di Macclesfield Town F.C. Mulanya, dia hanya berstatus pemain seleksi di klub kasta keempat liga Inggris. Akhirnya dia mendapatkan kontrak profesional pertamanya di Macclesfield Town. Sayang, begitu kontraknya habis pada 2010, dia tidak dapat perpanjangan. Sejak itu, karirnya terkatung-katung lagi. Dia sempat seleksi di klub kasta kedua Derby County pada Februari lalu. Sayang, dia tidak mendapat kontrak dari Derby. Berikutnya dia seleksi di klub kasta ketiga Huddersfield Town, tapi nasibnya kurang beruntung. Manajer Huddersfield Lee Clark sempat memainkannyadibeberapalagapramusim. Namun, begitu kompetisi akan dimulai, dia tidak mendapat kontrak dari Huddersfield. Makanya, begitu klub-klub Major League Soocer(MLS)membukaseleksidialangsung

terbang ke Amerika Serikat. John sudah pernah menjalani seleksi di klub MLS Seattle Sounders FC dan Portland Timbers pada Agustus lalu. Dan, kini dia kembali lagi ke Amerika untuk berjuang masuk dalam daftar superdraft. Bila lolos maka dia akan ditempatkan di salah satu klub MLS. Seleksinya akan dimulai, 13 Januari nanti. “Sebenarnya Macclesfield menawari saya kontrak. Namun, saya lebih fokus ke Amerika. Inilah waktu terbaik dalam karir saya dan saya harus mengejarnya,” bilang John, seperti dikutip Daily Mail. John memang sengaja mempersiapkan diri secara khusus agar lolos di superdraft. Dia memilih berlatih bersama klub Tranmere Rovers. “Selama empat bulan terakhir saya terus berlatih agar siap menghadapi momen ini,” ujar pemain berusia 20 tahun itu.Keputusan menjajal karir di Amerika tak lepas dari nasihat sang kakak yang menjalani pramusim lalu bersama United. “Wayne bercerita tentang beberapa tim yang dihadapinya selama tur. Katanya, dia sangat enjoy,” jelas John. Lagipula persaingan di MLS tidak seketat di Inggris. John terinpirasi kiprah Darren Huckerby yang bisa eksis di sepak bola Amerika. Sekarang dia menjadi striker di San Jose Earthquakes. Sebelumnya, dia selalu gagal di Inggris. John berharap, dengan mendapatkan klub di MLS dan bermain secara rutin akan memberikannya kesempatan baginya meningkatkan karirnya. Dia juga memiliki ambisi untuk berkostum timnas suatu saat nanti. Namun, John cukup tahu diri. Sadar bahwa persaingan menjadi anggota skuad timnas Inggris sangat berat, John berpaling ke negara tetangganya sesama Britania Raya, yakni Republik Irlandia. Dia bahkan sempat bermain di timnas Irlandia U-17 pada Euro U-17 2008. Langkah John juga diiringi sepupunya Tommy Amos yang bermain di timnas Irlandia junior. Mereka bisa membela Irlandia karena nenek mereka lahir di Dublin, Irlandia. John berharap bisa mendapatkan panggilan dari tim senior Irlandia. (ham)


Pontianak Post l Sabtu 1 Januari 2011

&

show

Harus Fokus Urus Anak

STATUS sebagai single parents membuat Olla Ramlan harus serius mengurus perkembangan anaknya, Sean Michael Alexander dengan baik. Pasca bercerai dari Alex Tian, praktis tanggung jawab Olla sebagai ibu sekaligus orang tua tunggal di tahun 2011 menjadi semakin besar. “Olla harus bisa memenej dirinya untuk tetap menghidupi anaknya hingga tumbuh dewasa. Dengan usia anaknya yang masih kecil, Olla harus memprioritaskan waktunya untuk anak, kalau tidak anaknya nanti bisa stress,” ucap psikolog Lita Gading soal resolusi yang harus dilakukan Olla tahun depan. Saat ini, Olla dinilai memiliki kesiapan untuk menjadi orangtua tunggal. Dengan pekerjaannya di dunia entertainment, Olla sepertinya tak bermasalah untuk urusan finansial. “Tapi, masalahnya terletak pada jam kerja. Bagaimana mungkin jika Olla bekerja tanpa memperhitungkan waktu yang optimal untuk memperhatikan anaknya, tentu akan jadi bumerang bagi Olla sendiri,” tambah Lita. Menurut Lita, jangan sampai konsentrasi Olla dalam bekerja

berbanding terbalik dengan kewajibannya sebagai seorang ibu yang harus membesarkan dan mengurus anaknya hingga besar. Kendala semacam ini memang banyak ditemui pada orang-orang yang memiliki status sebagai single parents. “Untuk itu, Olla harus bisa melihat skala prioritasnya di 2011. Kalau memang waktunya untuk mengurus anak, jangan digabungkan dengan waktunya bekerja, begitupun sebaliknya. Karena jika anak terlalu sering diurus orang lain (baby sitter), nantinya ibu kandungnya akan kesulitan melihat karakter dan perangai asli anak n y a ,” beber

psikolog berusia 39 tahun itu. Seperti diberitakan sebelumnya, rumah tangga bintang sitkom OKB dan Alex berakhir dengan perceraian. Olla diceraikan secara Islam oleh Alex, lelaki keturunan Belanda berdarah Spanyol dan Cina, pada 7 Juli 2010. Kesepakatan perceraian secara tertulis telah dibuat di hadapan notaris pada 16 Juli 2010. Rumor perselingkuhan Olla dengan vokalis Ungu, Pasha, dan kesibukannya di luar rumah menjadi bumbu yang mewarnai perceraian itu. “Sekarang dia punya tanggung jawab sebagai seorang ibu, itu dulu yang harus dia pikirkan, baru yang lain,” tutup Lita. (gfie)

13

Bikin Film Statement Bukan Komersial

Ide Hanung Akan Toleransi Beragama JAKARTA - Sutradara kenamaan tanah air Hanung Bramantyo, 35, kembali akan meramaikan produksi film tanah air. Setelah sukses dengan Sang Pencerah pada 2010, laki-laki kelahiran Jogjakarta tersebut lagilagi akan mengangkat tema film yang sarat dengan keagamaan pada 2011. Film kali ini bercerita tentang toleransi umat beragama. Menurut bapak dua anak itu, filmnya kali ini tidak diberi judul dan hanya diberi nama “?”. “Itu bukan film komersial seperti biasa. Itu film statement. Kami mau bicara kepada masyarakat tentang kondisi keagamaan kita. Karena itu, saya kasih tanda tanya. Saya serahkan semua kepada penonton. Biar mereka yang memberi judul apa. Sebab, saya sendiri bingung mau memberi judul apa,” jelasnya pada Kamis malam (30/12) di Restoran Radja Ketjil, Gandaria City Mall, Jakarta Selatan.

Sebenarnya, film yang akan mulai syuting di Semarang pada 5 Januari mendatang tersebut merupakan film ke-14 Hanung. Tapi, dia menyebut bahwa film itu adalah film keduanya setelah Sang Pencerah. “Saya bilang begitu karena setelah membuat Sang Pencerah, saya mulai merasa dewasa sebagai pembuat film,” terangnya. Kenapa berani mengambil tema keagamaan yang cukup sensitif ” Peraih penghargaan Sutradara Terbaik FFI 2007 lewat film Get Married tersebut mengungkapkan bahwa itu merupakan kebimbangan hatinya. Dia bercerita, sejak kecil, dirinya hidup harmonis dengan beragam agama. “Ibu saya adalah Tionghoa yang keluarganya masih merayakan Natal dan Imlek, sementara ayah saya merayakan Idul Fitri,” ungkapnya. Sekarang pun, kata suami artis Zaskia Adya Mecca itu, masih sering

ditemui penganut agama tertentu yang kemudian memutuskan untuk berpindah ke agama lain. Sebagai penduduk Indonesia yang memiliki beragam agama, dia merasa sudah semestinya bertoleransi akan hal tersebut. Karena itu, kali ini Hanung mengajak aktor yang berasal dari beragam kalangan. Dia juga mengajak penyanyi beragama Kristen, Glenn Fredly. “Glenn juga memiliki kebimbangan hati yang sama dengan saya akan toleransi beragama yang sekarang mulai tidak kuat lagi,” katanya. Tak seperti Sang Pencerah yang menelan biaya sekitar Rp 12 miliar, film terbarunya itu hanya menghabiskan biaya Rp 5 miliar. Dia juga tidak menggandeng production house (PH) besar. Dia menggunakan PH Dapur Film dan Mahaka. (jan/ c12/tia)

Dewi Perssik Wajib Tutup Aurat

Olla Ramlan

Happy Salma Bakal Hidup Nyaman Aktris Happy Salma telah menikahi kekasihnya asal Bali, Tjokorda Bagus pada 3 Oktober lalu. Sudah banyak yang tahu kalau Tjokorda adalah keturunan raja. Dan ini juga diperkuat dengan kartu tarot bergambar raja yang dibuka Mbak Endang mengenai kehidupan perkawinan Happy di tahun 2011. “Happy bahagia bersanding dengan suaminya yang bijaksana memang kehidupan seperti ini yang diinginkan happy. Happy merasa hidupnya dibimbing dengan baik, auranya terlihat dan dia nyaman banget. Financialnya juga tercukupi,” kata Mbak Endang. Wanita yang juga humas Asosiasi

Selebritas

Konsultan Spiritual Indonesia ini melihat gambar di kartu tarot malaikat sedang menuang yang dihadapannya ada dua piala. “Mereka agama masing-masing tapi saling toleransi, saling mengisi dan diberkahi. Secara keseluruhan hidup mereka istimewa,” tambah Mbak Endang. Sampai saat ini happy dan suaminya sedang berusaha untuk memiliki anak meski tidak ngotot. Penulis buku ini masih ingin merasakan honeymoon dengan suaminya. “Tapi happy juga harus hati-hati ada ujian di dalam pernikahannya. Memang setiap pernikahan itu pasti ada masalah, dan Happy harus kuat menghadapinya,” tutup Mbak Endang. (aal)

PEDANGDUT Dewi Perssik terus diingatkan menjaga penampilannya di depan publik. Ketua DPD Front Pembela Islam (FPI) Jakarta, Habib Salim Alatas menyarankan Depe tobat di tahun 2011. “Harusnya dia (Depe) tetap menjaga agar auratnya tertutup. Masa sih, aurat mau dibuka terus, 2011 harusnya dia sadar dirilah,” tegas Ketua DPD Front Pembela Islam (FPI) Jakarta, Habib Salim Alatas. Habib Salim menilai aksi Depe banyak mempengaruhi moral anakanak. “Harusnya dia bisa berpikirlah, apa yang dia lakukan nantinya bisa merusak moral bangsa. Temantemannya yang lain saja bisa tutup aurat, masa dia enggak sih,” cetus Habib Salim. Bintang film Paku Kuntilanak itu juga didesak serius memperhatikan laporan FPI terhadap foto toplessnya beberapa waktu lalu. Menurut Habib

Salim, laporannya ke Polda Metro Jaya beberapa waktu lalu terkait foto topless untuk menyadarkan Depe sendiri. “Kami ingin mengarahkan agar Dewi Perssik mau kembali ke jalan yang benar, mau untuk malu terhadap diri sendiri kalau selalu pamer aurat di depan orang. Itu sama sekali nggak pantas dilihat,” kata Habib Salim.

Di 2011, FPI juga menghimbau seluruh artis menyadari sikapnya sebelum ia melaporkan ke polisi. “Kita nggak akan memberi toleransi buat artis-artis yang dekat dengan pornografi, jangankan tahun depan, sekarang saja kalau ada yang berani (pamer tubuh) akan kita proses ke jalur hukum,” pungkasnya. (liv)


14

Pontianak Post

Sabtu 1 Januari 2011

K

EBIASAAN jelek dari tahun ke tahun kok masih di pelihara. Ayo buang kebiasaan jelek deh per bulannya. Pssst...kalau bisa lebih cepat dari 12 bulan, lebih bagus tuh guys!

Januari

"Nggak males bangun pagi!" C A R A N YA : Pasang weker 30 menit lebih cepat dari biasanya terus taruh weker di tempat yang butuh perjuangan buat meraihnya. Supaya kita nggak pencet tombol snooze setiap kali weker kita bunyi. Kalau udah punya pacar, bisa juga minta dia bangunin. Motivasi paling oke tuh.

Februari

"Mulai 'bergerak' cepat supaya nggak dikasih nickname miss lelet lagi." CARANYA : Majukan jam tangan kita 15 lebih cepat. Usahakan untuk bergerak menurut 'jam baru' kita itu. Kalau kita terus ingat bahwa itu 15 menit lebih cepat, ya percuma aja,dong.....

Maret

"Nggak cuek lagi ama penampilan. Terutama ama kesehatan tubuh. Termasuk tetap mandi dua kali sehari pas liburan ya." ILUSTRASI & LAYOUT : FIQRIE YUDHISTIRA

Hari ini Tetap Indah LIFE is beautiful or not? Indah atau nggak, semua tergantung kita, kok... Mau lihat dari sisi mana. Tapi 2011 adalah saat yang pas untuk berhenti jadi nenek doyan ngomel! KASUS#1: Belanja pas sale itu paling asyik. Tapi pas mau bayar... Parah! Panjang amat, ya, antriannya. Tetap tersenyum dengan: Sambil ngantri, kita bisa cek lagi belanjaan kita. Benar-benar perlu atau nggak. Yang nggak perlu, dibalikin aja. Biar kantung nggak cepat jebol. KASUS#2: Pengen cepat-cepat sampai rumah teman, eh, motor betingkah pula bocor di tengah jalan. Rese banget, sih... Tetap tersenyum dengan: Cari bengkel/ tukang tambal ban terdekat, nikmati waktu nunggu sambil ngobrol ama montirnya about dunia perbengkelan. Dapet pengetahuan baru khan hehe.

KASUS#3: Kenapa sih, setiap kali kerja kelompok pasti dapat jatah paling banyak? Tetap tersenyum dengan: Biarpun nambah kerjaan, tapi coba lihat sisi positifnya. Kita bisa tambah pintar, lho. KASUS#4: Pekerjaan paling menyebalkan di dunia? Menunggu! Tetap tersenyum dengan: Biar nggak tambah jengkel, alihkan fikiran kita dengan kegiatan lain. Bisa baca buku, merapikan kuku, atau... melamun. Siapa tahu dapat ide buat bikin buku atau film. KASUS#5: Hidup, kok, susah banget, ya. Baru satu masalah kelar, masalah lain udah menunggu. Capek deeeh... Tetap tersenyum dengan: Kita bukan orang pertama di dunia ini yang punya masalah, dan kita nggak bakal jadi orang terakhir. Hidup memang penuh masalah, kok. Jadi sabar aja ya. Semua masalah pasti ada jalan keluarnya. Lagi pula masalah

bisa bikin kita tambah dewasa, lho. KASUS#6: Polusi udara bikin stres. panasnya sinar matahari menyerang kulit, menyebalkan deh mau jalan keluar! Tetap tersenyum dengan: Coba lihat disekeliling. Yang mengalami hal itu nggak cuma kita kan? just nikmatin aja perjalanan kita, kan masih ada angin sepoisepoi dikit hihihi. Bisa juga pasang masker ato slayer kalo nggak mau menghirup polusi udara yang bikin idung sumbat. KASUS#8: Ada satu orang di sekolah yang sukaaa banget gosipin kita. Mulai dari baju, sampai teman main kita. Kurang kerjaan banget, sih. Tetap tersenyum dengan: Hei, you should be proud. Kita pasti keren banget kalau sampai diomongin terus. Ngapain juga pusing mikirin orang yang iri ama kita, lebih baik nikmati saja 'kepopuleran' kita. (*/bbsb)

Mei

"Mengerjakan apa yang bisa kita kerjakan, secepat yang kita bisa." CARANYA : Selesaikan deadline kita minimal tiga hari lebih cepat. Tulis itu semua di organizer biar nggak lupa.

Juni

"Be positive dan jangan suka complain!" CARANYA : Pas ada kejadian buruk menimpa kita, pikirkan 10 alasan baik yang bisa muncul dari kejadian itu. Misal pas difitnah orang, lihat itu sebagai kesempatan untuk melihat siapa teman sejati kita.

Juli

"Nggak NATO (No Action Talk Only) lagi." CARANYA : Bikin janji untuk selalu melakukan apa yang kita katakan. Kalau perlu, tetapkan hukuman kalau kita nggak berhasil menjalankan aturan tersebut. Jadi mesti hati-hati sebelum ngomong ya!

CARANYA : Belilah produk mandi dengan wangi favorit kita. Cari juga produk dengan kemasan cute, kita pasti lebih suka pakainya....

April

"Stop jadi drama queen. Nggak lagi membesar-besarkan masalah dan mengekpresikan perasaan secara berlebihan." CARANYA : Gabung di kelompok teater. Habiskan energi dan 'bakat' drama kita di situ.

September

"Punya kamar yang rapi" CARANYA : Biasanya kita bakal malas beresberes kalau bentuk kamar kita udah kayak kapal pecah. Jadi sebelum jadi terlalu berantakan, bersihkan kamar kita setiap hari.

Oktober

"Ingat hari-hari penting. Termasuk hari-hari penting orang yang kita sayang." CARANYA : Beli kalender lucu dan tandai hari-hari penting seperti anniversary ortu, ultah teman dan keluarga, dengan warna-warna ngejreng. Terus gantung di tempat yang sering kita lewati. Taruh juga ultah mereka di reminder HP, paling efektif nih!

November

"Punya tabungan pribadi." CARANYA : Buat dua rekening terpisah. Satu rekening berisi uang harihari kita, dan satunya lagi nggak ada ATM nya. Apapun keperluan kita (selama bukan masalah hidup dan mati), pasti kita nggak bakal nyentuh rekening yang satu itu.

Desember

Agustus

"Mulai olahraga! Minimal seminggu sekali." CARANYA : Daftar di gym. Biasanya sih kita bisa lebih rajin kalau sudah bayar. By the way cari yang dekat rumah aja ya. Supaya nggak malas pas mau berangkat. Ajak teman dekat atau pacar juga bisa bikin kita lebih termotivasi.

Follow Twitter X-presi di :

@XpresiPtkPost

"Nggak gosipin orang lain sebelum kita dapat konfirmasi kalau berita itu benar." CARANYA : Lakukan kegiatan paling spektakuler yang bisa kita pikirkan (yang positif pastinya). Bikin orang lain kagum dan ngeposin kita. Ngapain juga buang-buang waktu gosipin orang, lebih baik kita yang ‘digosipin’ kan ?! hihihi. (*/bbsb)

Add Facebook X-presi di : http://www.facebook.com/ xpresipontianak


cmyk

Pontianak Post l Sabtu 1 Januari 2011

15

+

+

+

+

cmyk


TOTAL SPORT

16

Pontianak Post

Sabtu, 1 Januari 2011

Mercedes GP Bersiap Lebih Dini LONDON-Formula1musim 2010 tak bisa dilalui Mercedes GP dengan gebrakan besar. Mercedes GP gagal mengulangi prestasi besar Brawn GP yang merupakan pendahulunya dengan menjadi juara dunia di musim sebelumnya. Meski demikian, tim tetap akan melakukan restrukturisasi memasuki tahun 2011. Beredar rumor yang menyebutkan bahwa rencana restrukturisasi Mercedes GP pada 2011 akan membuat kewenangan Team Principal Ross Brawn dibatasi. Ada pula yang menyebut dia akan mengambil keputusan pensiun dari tim yang berbasis di Brackley, Inggris itu. Namun, Brawn menepis rumor tersebut. Dia mengaku belum siap mundur. “Saya tak akan mundur sampai tim ini sukses,” tegas Brawn seperti dikutip SkySports dari Auto Motor Und Sport. Saat ditanya apakah Mercedes bisa mengulangi prestasi

hebat Brawn GP pada 2009, mantan Technical Director Ferrari itu menjawab diplomatis. “Keadaannya sudah berbeda. Di 2008 kami punya 750 orang di Brackley dan beberapa ratus orang di Jepang untuk Honda. (Sekarang) Kami tak punya jumlah itu lagi,” ucapnya. Dia masih menyebut masih banyak tim hebat yang harus mereka kalahkan untuk menjadi besar. Brawn menyebut Red Bull-Renault, Ferrari, dan McLaren-Mercedes menjadi rival yang harus ditaklukkan untuk menunjukkan gebrakan. “Memang benar bahwa kami memulai lebih awal pengembangan mobil untuk 2011, tapi itu tidak berarti kami menempatkan sumber daya lebih dibandingkan tiga tim lain di depan kami (Red Bull, Ferrari dan McLaren),” terangnya. Karena itu, tetap akan sulit bagi timnya untuk mengulangi prestasi besar Brawn GP di

tahun 2009. Baginya, prestasi tersebut menjadi dongeng yang memotivasi dia dan timnya untuk terus mencari peningkatan. “Tidak, kita tidak akan mengalami dongeng tahun 2009 tersebut untuk kedua kalinya. Tapi saya yakin kami akan memiliki mobil yang sangat bagus. Kita hanya akan tahu seberapa baik mobil kita kalau kita mengendarainya. Jika itu sudah sebaik yang kita pikirkan, maka kita juga akan punya organisasi di belakang yang akan mengembangkannya di sepanjang musim,” harapnya. Brawn juga memastikan kalau dia tetap mengandalkan Michael Schumacher dan Nico Rosberg. Musim 2010, Mercedes GP ada di peringkat keempat di bawah Red Bull, McLaren dan Ferrari. Nico Rosberg ada di posisi ketujuh sedangkan Schumacher di posisi sepuluh. (ady/diq)

Tim Mercedes

Bibir Bonyok, D-Wade Ngamuk

bintang

Olahragawan Terbaik 2010 Setelah menolak disebut sebagai The Special One dari Spanyol, kemarin (30/12) Rafael Nadal justru terpilih sebagai Olahragawan Terbaik 2010. Petenis nomor satu dunia itu mengumpulkan poin terbanyak dari 515 jurnalis olahraga seluruh dunia.Hebatnya, sebagaimana dilansir AFP, Nadal berhasil mengungguli angka Lionel Messi, Andres Iniesta, dan Sebastian Vettel. Petenis ketujuh sepanjang sejarah yang bisa memenangi empat grand slam tersebut berhasil menyingkirkan rival-rivalnya yang mayoritas adalah pemain sepak bola. Dalam daftar 10 olahragawan terbaik, pemain kulit bundar memang mendominasi. Selain nama Messi dan Iniesta, ada nama Diego Forlan di peringkat 6 dan David Villa di peringkat 10. Sisanya berasal dari beragam cabang. Mulai tenis, Formula 1 (Sebastian Vettel), atletik (David Rudisha), tinju (Manny Pacquiao), dan ski (Carlo Janka). Pemain bola lain yang masuk daftar tersebut adalah Wesley Sneijder, namun dia hanya menempati peringkat 11. Sukses Nadal itu terkait dengan prestasi gemilang merebut gelar grand slam ke-9 di US Open 2010. Bahkan, rekor tersebut mengantarkan Nadal sebagai petenis termuda dengan gelar terlengkap. Di usia yang baru menginjak 24 tahun, Nadal sudah mengumpulkan seluruh gelar grand slam dan medali emas Olimpiade. Mulai France Open (lima gelar), Australian Open, Wimbledon (dua gelar), dan terakhir US Open. Atas hal itu, Nadal berhak menerima Career Golden Slam karena sudah mengoleksi gelar grand slam dan medali emas Olimpiade. Dia menjadi petenis pria kedua yang bisa melakukan hal itu sesudah Andre Aggasi. “Saya sangat berterima masih. Ini pujian luar biasa,” kata Nadal. (AFP/AP/c7/iro)

Irfan Bachdim

Kim Jeffrey Kurniawan

Pelita Ingin Tampung Irfan-Kim JAKARTA - Habis dieluk-elukkan saat membela timnas Indonesia di ajang Piala AFF 2010 Irfan Bachdim kini dalam posisi terombang-ambing. Itu terkait dengan klub yang diperkuatnya Persema Malang yang menyeberang ke Liga Primer Indonesia ( LPI). Selain Irfan, nasib sama juga dialami pemain yang baru saja menjadi Warga Negara Indonesia (WNI) Kim Jeffrey Kurniawan yang kabarnya sudah terikat kontrak dengan Persema. Seperti diketahui, PSSI menolak mentah-mentah adanya liga yang digagas miliarder Arifin Panigoro dan timnya itu. PSSI mengancam akan memberi sanksi tegas kepada siapa saja yang terlibat dengan LPI. Termasuk para pemain. Mereka akan diblacklist untuk memperkuat timnas Merah Putih. Padahal seperti halnya Irfan,

Kim yang lahir dan besar di Jerman sangat ingin membela timnas Indonesia. Nah, di tengah situasi yang tidak menentu ini Pelita Jaya Karawang ingin memanfaatkan situasi. Kepada media di Jakarta, Direktur Teknik Pelita Jaya, Rahim Soekasah, mengatakan pihaknya siap menampung Irfan Bachdim dan Kim Jeffrey Kurniawan. “Tapi sejauh ini saya belum tahu kondisi yang sebenarnya. Semua tergantung dari kontrak mereka, bagaimana status mereka. Kalau memang mereka terbuka, boleh saja. Tapi sesuai dengan kondisi keuangan kami,” kata Rahim Soekasah. Sementara itu, manajemen Persema Malang tetap berjuang agar Irfan dan Kim tetap bisa bermain bersama klub berjuluk Laskar Ken Arok itu. (ali/ko)

HOUSTON - Miami Heat terus menjaga momentum. Terseok pada awal musim lalu, selama Desember mereka berhasil menjelma sebagai salah satu tim paling mengerikan bagi para lawan. Kemarin WIB (30/12), mereka berhasil merebut kemenangan ke-15 selama Desember dengan mengalahkan Houston Rockets 125-119 di Toyota Center, Houston. Hasil itu membuat Heat hanya kalah sekali di bulan Desember yakni dari Dallas Mavericks. “Saya merasa tim saya adalah tim yang paling improved di bulan Desember ini. Saya harus memuji para pemain saya karena mereka sudah mulai bisa bermain kompak dan chemistry mereka juga sangat meningkat,” ungkap pelatih Heat Erick Spoelstra setelah pertandingan. Kekuatan Heat juga bertambah dengan kembalinya shooter mereka Mike Miller. Menit Miller masih sangat terbatas, tapi dia akan menjadi faktor untuk membawa Heat juara di akhir musim nanti. Pertandingan kemarin sempat terhenti di kuarter keempat saat waktu tersisa 10 menit. Guard Heat Dwyane Wade yang mencoba untuk melakukan dunk di foul dengan keras oleh guard Rockets Aaron Brooks. Wade sempat tergeletak di lapangan sekitar 1 menit, lalu dia mulai berjalan ke bench sambil menutupi bibirnya

yang berkucuran darah. Wade pun mengungkapkan kekesalan setelah pertandingan. “Foul itu sangat keras. Tapi itulah basket, pasti foul seperti itu terjadi. Saya hanya kesal karena sekarang bibir saya perlu di jahit,” ungkap Wade setelah pertandingan dengan perban putih di bibirnya. Untungnya, Wade masih bisa menjaga performa. Foul tersebut tidak membuatnya frustasi dan menggagu permainannya. Bahkan, luka itu seolah menjadi cambuk baginya untuk tampil lebih baik. Wade mengamuk dengan mencetak 45 poin. Sehari sebelum pertandingan ini Wade juga berhasil mencetak 40 poin saat Heat mengalahkan New York Knicks. “Saya hanya bermain dengan agresif. Untungnya, saya selalu berhasil menemukan celah di defense lawan untuk melakukan lay-up. Irama tembakan saya juga sedang bagus,” terang Wade tentang keberhasilannya mencetak 40 poin atau lebih dalam dua game terkahir. LeBron James sempat menggangu Wade saat dia sedang dikelilingi para wartawan. “Bibir bonyok kaya gitu masih bisa ngomong!” teriak LeBron kepada Wade yang di sambut dengan tawa oleh para juru tulis. LeBron juga tampil baik di pertandingan itu dengan catatan 20 poin dan 9 assists. (ang)

Nadal Siap Sapu Grand Slam

Rafael Nadal

MADRID - Tahun 2010 kembali menjadi milik Rafael Nadal. Petenis Spanyol itu nyaris berhasil melakukan sapu bersih terhadap grand slam. Meski peluang itu amat terbuka baginya, Nadal menilai bakal sulit untuk memenangi empat gelar grand slam sekaligus dalam setahun. Langkah Nadal di grand slam edisi 2010 cukup mantap. Dari empat grand slam 2010, hanya Australia Terbuka saja yang gagal dimenangi oleh petenis 24 tahun itu. Di grand slam pembuka tersebut, Nadal hanya sampai babak perempatfinal usai tersingkir karena mundur akibat cedera. Namun selanjutnya petenis

asal Spanyol itu berhasil bangkit dan memenangi tiga turnamen Grand Slam lainnya, termasuk meraih gelar untuk pertama kalinya di AS Terbuka. “Tahun 2010 berlangsung emosional dalam karir saya dan yang terbaik bila berdasarkan pada hasil yang saya dapatkan. Saya sangat gembira dengan apa yang telah terjadi sepanjang tahun ini dan saya benar-benar tidak bisa meminta lebih lagi,” kata Nadal pada media terbiatan Spanyol, Diario AS. Nadal mengungkapkan, hasil positif yang dia dapat di sepanjang tahun 2010 membuatnya bisa memulai musim 2011 tanpa

tekanan yang terlalu besar. Meski begitu, petenis yang dikenal sebagai raja di lapangan tanah liat itu mengaku bahwa berat bisa melakukan sapu bersih dengan memenangi empat grand slam tahun depan. “ (Prestasi) itu nyaris mustahil dan bisa dikatakan hanya utopia. Bisa menjuarai tiga grand slam saja sudah cukup sulit,” kata petenis yang tahun ini kembali mengakhiri musim sebagai petenis nomor satu ATP (Asosiasi Tenis Pria) itu. Untuk tahun depan, Nadal optimistis bisa membuka dengan catatan positif denan menjadi yang terbaik Australia Terbuka,

mulai pertengahan Januari mendatang. Dia menjadi juar di turnamen itu pada musim 2009. “Saya memang punya kesempatan untuk melakukan itu, namun saya pikir satu-satunya peluang bagi saya adalah memenangi empat titel grand slam secara berturut-turut. Bila saya mampu melakukannya, maka ini merupakan waktunya,” terang Nadal. Tahun 2011 bakal dimulai Nadal di sebuah turnamen ekshibisi yang berlangsung di Abu Dhabi, Uni Emirat Arab (UEA). DI turnamen itu, dia berpeluang kembali bersua Roger Federer. Meski sifatnya eksebisi, peserta Mubadala

World Tennis Championship dijamin berkualitas. Selain Nadal dan Federer yang merupakan petenis nomor satu dan dua dunia saat ini, ada juga petenis-petenis elit lain seperti Robin Soderling (Swedia), Tomas Berdych (Republik Ceko), JoWilfried Tsonga (Prancis) dan Marcos Baghdatis (Siprus). Seperti dikutip dari situs resmi turnamen, Nadal dan Federer langsung mendapat bye di babak perempatfinal dan langsung lolos ke semifinal. Nadal akan berjumpa pemenang antara Baghdatis melawan Berdych dan Federer bakal bertemu Soderling atau Tsonga. (ady)


Sabtu 1 Januari 2011

metropolis Pontianak Post

Kinerja 2010

Pemerintahan Buram KETUA Umum Pimpinan Pusat Muhammadiyah, Din Syamsuddin menilai pemerintah yang berjalan masih buram hingga akhir 2010. “Terlalu banyak mengedepankan pencitraan diri, bukan menyelesaikan masalah yang ada,” ujar Din seusai membuka musyawarah wilayah Muhammadiyah Kalimantan Barat, Jumat (31/12) di Asrama Haji Pontianak. Menurut Din, salah satu permasalahan yang belum terselesaikan adalah kawasan perbatasan. Din Syamsuddin Tak hanya Kalimantan Barat, Indonesia memiliki propinsi lain yang berbatasan dengan Malaysia. Tetapi hingga saat ini kehidupan masyarakat di sana sangat kentara jika dibandingkan dengan warga Malaysia yang ada di perbatasan negaranya. Berdasarkan pantauan Pontianak Post, di Kalimantan Barat sendiri, warga yang tinggal di perbatasan dengan Malaysia masih banyak yang

17

Pencatut Pejabat Ditangkap Dua Diringkus, Polda Kejar Tiga DPO PONTIANAK—Dua pelaku kejahatan penipuan via telepon berhasil diringkus. Aparat Polda Kalbar menciduk keduanya saat bersembunyi di kawasan Tanjung Periuk Jakarta Utara, Jumat (24/12). Kedua tersangka kini ditahan di Mapolda Kal-

bar. Mereka diduga merupakan komplotan yang berpusat di Jakarta. Kini kasusnya terus dikembangkan. Kedua tersangka yaitu Anis Alias Dewa (25) dan Rustan alias Reza (26). Mereka adalah dua dari lima kawanan penjahat yang sering melakukan penipuan via telepon. Dengan lokasi kejahatan di seluruh Indonesia. Sedang tiga rekan pelaku kini ditetapkan sebagai Daftar Pencarian Orang u Ke Halaman 23 kolom 1

TRANSNASIONAL: Tersangka dan barang bukti sejumlah perangkat komputer untuk melakukan tindak penipuan transnasional. Kasusnya sedang ditangani Polda Kalbar. MU-

u Ke Halaman 23 kolom 1

KESEHATAN

JADI/PONTIANAK POST

Tingkatkan SDM Dokter Gigi Semakin pesatnya berkembangan ilmu pengetahuan dan teknologi diera globalisasi saat ini, secara tidak langsung membuat masyarakat pribumi harus bekerja lebih ekstra. Ini agar dapat meningkatkan kualitas SDM (Sumer Daya Manusia) dan mampu bersaing dengan Negara lain. Demikian dikatakan ketua Ikatan Dokter Gigi Indonesia cabang Pontianak, Hary Agung Tjahyadi. “Untuk peningkatan kualitas SDM, selain Hary Agung Tjahyadi bekerja keras sendiri tidak ada salahnya jika kita belajar dari Negara lain. Jadi selain dapat meningkatkan kerjasama antara negara kita juga bisa mendapat berbagai informasi dan pengetahuan baru dari negara lain,” ujarnya kepada Pontianak Post, kemarin. Karena itu lanjutnya, untuk peningkatan kapasitas dan kualitas para dokter gigi yang ada di Indonesia umumnya dan Kalbar khususnya, maka pada u Ke Halaman 23 kolom 1

DOMPET SIMPATIK

Reziq Perlu Bantuan MUHAMMAD Reziq, 2,7 tahun, menderita penyakit liver. Perlu dana untuk kesembuhannya. Melalui Program Dompet Simpatik ini, kami mengajak pembaca membantu Reziq. Bantuan dapat diserahkan langsung ke Pontianak Post Ruang Redaksi (Lantai 5) Gedung Graha Pena Jalan Gajah Mada No 2-4 Pontianak, setiap jam kerja pukul 08.00 – 16.00, atau via Bank Kalbar di nomor rekening 1025057887 an Dompet Simpatik Pontianak Post. (*) Sumbangan Hingga Kamis (30/12)

Rp 5,450,000

Sumbangan Jumat (31/12) 1. Audrey Xing Rp 500,000 2. PWRI kota Pontianak Rp 100,000 3. Majlis Takllim Al Wasilah Rp 100,000 4. Koperasi Wredatama Pontianak Rp 100,000 5. Alya,Aura,Nayla,Kak linda,Kak lisa Rp 150,000 6. Hamba Allah Rp 70,000 7. Zaky & Zidan Rp 400,000 Jumlah Rp 1,420,000 Total Rp 6,870,000

Bekelit

Deteksi Korban Via Telepon PONTIANAK— Modus kejahatan semakin berkembang mengikuti keadaan. Butuh kewaspdaan bersama dalam menanggulanginya. Terutama pemilik rumah yang meninggalkan kediaman untuk berlibur menikmati suasana tahun baru.

Menurut Kasat Reskrim Polresta Pontianak Komisaris Puji Priyanto pelaku kejahatan dalam menjalankan aksinya banyak memanfaatkan layanan telepon rumah. Sebagai cara untuk mendeteksi keadaan rumah yang diincar, berpenghuni atau tidak. Jika

telepon diangkat berarti tuan rumah sedang standby. Begitu sebaliknya. Kasat menambahkan, modus tersebut dipakai pelaku sebelum menyelinap masuk ke sasaran tempat kejahatan. Sehingga jika positif rumah sedang penghuni tinggalkan,

kawanan pelaku kejahatan langsung menguras harta benda yang tersimpan. Sementara menyelinap masuknya melalui jendela atau tempat yang dipastikan mudah dilalui. Modus tersebut menjadi salah satu bentuk kejahatan yang menjadi ancaman bagi

warga masyarakat. Karena itu, lanjut Kasat, pemilik telepon rumah diimbau dapat mewaspadai bentuk kejahatan itu. Selain dengan terus meningkatkan kewaspadaan di lingkungan tempat tinggal. Sementara warga yang u Ke Halaman 23 kolom 1

Paripurna Dewan Ricuh

Mikrofon Baru Diganti

PONTIANAK-Sidang Paripurna Perubahan Fraksi di DPRD Kota Pontianak kemarin (31/12), berlangsung ricuh. Sidang dihentikan dalam waktu yang tidak ditentukan. Sidang awalnya akan dilaksanakan untuk menyatakan ada beberapa fraksi yang akan merubah reformasi dan ada anggota fraksi yang akan pindah ke fraksi lain. Namun lantaran persoalan teknis mikrofon akhirnya harus ditunda. Mansyur, Wakil Ketua Komisi D DPRD Kota Pontianak mempertanyakan administrasi perpindahan, sudah lengkap atau belum. Saat Mansyur bicara, mikrofon yang digunakan tiba-tiba mati. Mansyur tidak terima dan marah. Ia mengira ada yang melakukan sabotase atau kurang senang dengan pembicaraannya. Semua bicara. Suasana jadi ramai sehingga sidang ricuh. Akhirnya Pimpinan Sidang, Hartono Azas menskor sidang selama 15 menit. Hartono Azas menjelaskan, harusnya hari ini akan dilaksanakan sidang paripurna perubahan formasi dan perpindahan anggota dari dua fraksi, yaitu Alfian Aminardi dari PKB dan Fraksi Hanura. Sementara Awaludin yang semula dari Fraksi Bintang Reformasi akan bergabung ke Fraksi Demokrat. “Sesuai dengan tata tertib DPRD Kota, boleh saja mereka pindah, jika tugas mereka di fraksi sebelumnya belum optimal. Dua orang ini pindah atas inisiatif mereka sendiri. Saya sebagai Ketua Partai Demokrat menerima,” kata Hartono Azas. Awaludin, yang akrab dipanggil H Kalut dari Fraksi Bintang Reformasi menjelaskan bahwa ia diminta dari partainya Partai Bulan Bintang untuk

Sekwan Siap Ubah Sistem

u Ke Halaman 23 kolom 1

SHANDO SAFELA/PONTIANAK POST

DISKORS: Hartono Azas, Ketua DPRD Kota Pontianak saat keluar dari ruang sidang DPRD Kota Pontianak kemarin. Sidang paripurna diskor karena sempat terjadi kericuhan.

PONTIANAK—Sekretaris Dewan Perwakilan Rakyat Daerah Kota Pontianak, Khairil Anwar mengatakan mikrofon yang dalam ruang rapat paripurna baru diganti pada tahun 2010. “Mikrofon yang ada di ruang paripurna merupakan peralatan baru untuk tahun pengadaan 2010,” ujar Khairil ketika dikonfirmasi tentang mikrofon yang menjadi pemicu pertengkaran di ruang paripurna DPRD Kota Pontianak, Jumat (31/12) siang. Menurut Khairil, sistem mikrofon ini mengacu pada sistem yang lama. Hanya bisa menyala satu. Jika ada yang menekan mikrofon, yang lainnya tidak dapat berfungsi. Kecuali mikrofon pada meja ketua dan pimpinan, bisa menyala lebih dari satu. Pengaturan ini dimaksudkan agar tidak ada tumpang tindih yang berbicara. “Tadi setelah paripurna semua mikrofon kami periksa, ternyata bagus semuanya. Mungkin ada kabel yang tersenggol,” katanya. Dengan adanya keributan yang disebabkan mikrofon, Khairil akan mengembalikan sistem mikrofon kepada anggota dewan dan jajaran pimpinan. “Jika memang ingin bisa berfungsi semuanya, akan disistem seperti itu,” ujar mantan Kepala Dinas Sosial dan Tenaga Kerja Kota Pontianak ini. Ketua Fraksi Partai Amanat Nasional, Mujiono mengatakan beberapa anggota dewan memang merasa kesal karena mikrofon tidak berfungsi ketika akan berbicara dalam rapat paripurna pergantian ketua fraksi, kemarin. “Termasuk saya, saya juga kesal. Ketika saya mau berbicara tiba-tiba mikrofonnya mati,” kata Mujiono. Menurut Mujiono, ada lima kali mikrofon tidak berfungsi saat dirinya berbicara. Ketika itu ia akan u Ke Halaman 23 kolom 1

Sepenggal Asa Menatap Lebih Baik di 2011

Infrastruktur dan Layanan Publik Harus Lebih Baik Seluruh penjuru dunia merayakan pergantian tahun dari 2010 ke 2011. Tidak terkecuali di Kota Pontianak. Terbentang asa di benak masyarakat dalam menatap kehidupan di tahun 2011 mendatang. Bagaimana mereka menggantungkan ekspekstasi di tahun 2011 nanti? M. Kusdharmadi, Pontianak

Memiliki asa pada 2011 nanti tentunya hal yang wajar. Apalagi itu demi kebaikan dan kepentingan bersama. Terlebih untuk kesejahteraan masyarakat. Itu menjadi tanggungjawab pemerintah sebagai pelayan publik. Sejumlah ruas jalan di Kota

MUJADI/PONTIANAK POST

JALAN : Infrastruktur jalan sangat penting untuk memerlancar roda pembangunan. Pemeliharaan dan pembangunan yang simultan perlu terlaksana dengan baik.

Ilustrasi sigit

Pontianak masih rusak. Padahal infrastruktur sangat menunjang sekali untuk keberhasilan pembangunan. Karena infrastruktur merupakan sarana transpor-

tasi untuk menjalankan berbagai aktivitas. Mulai dari sekolah, bekerja, membawa barang hasil perekonomian dan lainnya. u Ke Halaman 23 kolom 1


metropolitan

18

Pontianak Post Sabtu 1 Januari 2011

Kapolresta Resmi Kombes (31/12) di Mapolda Kalbar. Kapolda mengatakan bahwa kenaikan pangkat diberikan melalui proses dewan kebijaksanaan. Semua berdasarkan legitimasi serta legalitas yang didukung dengan prestasi, dedikasi, loyalitas, dan tidak tercela. “Artinya secara legitimasi mereka (yang naik pangkat) memang pantas memperoleh penghargaan berupa kenaikan pangkat,” tambah dia. Kapolda mengingatkan bahwa kenaikan pangkat bukan hak setiap anggota. Melainkan sebagai penghargaan yang diberikan pimpinan terhadap anggotanya. Tentu saja semua berdasarkan penilaian secara objektif. Kapolda berharap momentum korp rapor kenaikan pangkat dapat dijadikan pemicu atau

1.334 Polisi Naik Pangkat PONTIANAK – Sebanyak 1.334 anggota Kepolisian Daerah (Polda) Kalbar naik pangkat. Dari mereka diharapkan terjadi perubahan yang signifikan terhadap kualitas kinerja. “Dengan kenaikan pangkat diharapkan ada peningkatan kualitas kerja bagi anggota (Polisi, Red). Untuk peningkatan kinerja kepolisian secara keseluruhan,” kata Kapolda Kalbar Brigjen Pol Sukrawardi Dahlan saat memimpin Upacara Korp Raport Kenaikan Pangkat Perwira dan Bintara Polda Kalbar, Jumat

motivasi bagi setiap anggota, untuk mengaktualisasikan diri terhadap tugas yang dibebankan. Rincian kenaikan pangkat yaitu terdiri atas satu orang berpangkat Ajun Komisaris Besar Polisi (AKBP) menjadi Komisaris Besar (Kombes), dua Komisaris Polisi (Kompol) naik pangkat menjadi AKBP, dan 36 Ajun Komisaris Polisi (AKP) ke Kompol. Sementara sisanya merupakan perwira pertama dan bintara. Mereka yang mengalami kenaikan pangkat kemarin di antaranya adalah Kapolresta Pontianak AKBP Muharrom Riyadi, yang langsung menyandang pangkat Kombes. “Kita menyadari, reformasi yang kita lakukan selama ini belum membuahkan

hasil sesuai harapan masyarakat. Bahkan penilaian komisi hukum nasional, mengungkap bahwa sepuluh tahun terakhir penegakan hukum di Indonesia belum menunjukkan perkembangan signifikan. Dengan memberikan penilaian 70 persen aparat kepolisian, kejaksaan, dan kehakiman terindikasi korupsi. Aparat hukum tidak berpihak kepada masyarakat kecil. Keadilan keras diterapkan kepada rakyat kecil, tetapi tidak bagi kaum elite,” kata Kapolda mengingatkan. Kapolda mengajak seluruh anggota Polda Kalbar, menyikapi penilaian dengan berinstropeksi diri. Mereka diminta membenahi diri dengan melaksanakan perubahan. (stm)

Muharrom Riyadi

Keberlanjutan BKM Perlu Kemitraan

ANDRI JANUARDI/PONTIANAK POST

SALAH KAPRAH: Sering masyarakat sepanjang bantaran parit di Kota Pontianak salah kaprah terhadap fungsi parit. Mereka kerap menjadikan batas alam tersebut sebagai tempat pembuangan sampah. Ini yang kadang menjadi persoalan bagi pemerintah, terlebih dengan ketaktersediaan sarana pembuangan sampah sepanjang bantaran.

Tumbuhkan Bela Negara di Perbatasan KOMANDAN Korem 121/ABW Kolonel Inf Toto Rinanto mengatakan, selain menjaga perbatasan, aparat TNI yang berada di sana juga membantu masyarakat sebagai guru bantu. Hal tersebut dilakukan sebab melihat kondisi tenaga pengajar yang dinilai kurang di wilayah tersebut. “Mereka menjadi guru secara sukarela karena memang TNI melihat di kawasan perbatasan masih kekurangan guru, sehingga para prajurit itu dengan senang hati memberikan pelajaran kepada masyarakat setempat. Kegiatan ini murni dilakukan karena memang itulah yang dibutuhkan warga,” ungkap Danrem.

Lebih lanjut Danrem mengatakan, anggota yang bertugas juga memberikan pelajaran tentang wawasan kebangsaan kepada siswa di kawasan itu. Selain itu anggota juga memberikan pelajaran ekstrakurikuler, baik pemahaman tentang NKRI atau tentang wawasan kebangsaan agar para siswa semakin cinta terhadap Indonesia. ”Jadi, selain para prajurit mengamankan kawasan perbatasan sebagai bakti kepada bangsa dan negara, mereka juga mengabdi kepada masyarakat dengan berbagai kegiatan sosial, termasuk menjadi guru di perbatasan,” tutur Danrem.

Menurut Danrem, di wilayah sepanjang perbatasan negara ini juga rawan akan illegal logging, Illegal trading dan ilegal apa saja yang bisa berpeluang mendatangkan keuntungan bagi pihak-pihak tertentu. Hal demikianlah yang dapat membuat masyarakat perbatasan, akan sangat mudah sekali terkontaminasi atau terkena dampak negatif tersebut. Sehingga tidak mustahil akan berdampak lebih jauh melunturnya rasa nasionalisme, jiwa patriotisme, rasa persatuan dan keutuhan bangsa, cinta tanah air termasuk pemahaman akan kesadaran bela negara. (wah)

PONTIANAK han Benua Melayu – Heri Purwanto, Laut, Kecamatan korkotBadanKeswaPontianak Selatan, dayaan Masyarakat bersama Brimob (BKM) Pontianak merehap gerwtak menilai perlunya sepanjang 48 mekemitraan pemerter di Gang Taha intah daerah dan dan Gang Landak masyarakat untuk dengan stimultan keberlanjutaan probantuan langsung gram BKM. Terumasyarakat (BLM) tama dalam penangRp18.241.000 dan Heri Purwanto gulangan kemiskidana swadaya nan terpadu dan program Rp7.323.000. channeling aspek tridaya. BKM Pilar Khatulistiwa, Kelu”Soalkemiskinanmakinkom- rahan Batu Layang, Kecamatan pleksdankronis,tidaksatupihak Pontianak Utara, melaksanaan pun dapat mengklaim mema- rabat beton di Gang Sinar Pelita hami persoalan yang dihadapi Dalam, Jalan Khatulistiwa denpihak lain. Penyelesaian sepihak gan dana BLM Rp13.233.000 tidak lagi memadai. Perlu ker- dan swadaya Rp6.202.000. BKM jasama antara penyelenggara ini bersama Yayasan Vihara dan pelaku pembangunan yang Dewi Mulia membangun turap lebih intim, bersama memecah- batu kali dengan dana Rp12 juta kan masalah kemiskinan,” ka- dan PT Cahaya Kalbar memtanya belum lama ini. bangun jalan lingkungan. Menurutnya, program yang BKM Mitra Beliung bersama diberikan pemerintah atau program Menpera memperswasta sering tidak sesuai baiki jalan lingkungan dan sanikebutuhan masyarakat. Pe- tasi di RW 25 dengan gertak cor merintah dan swasta sebagai gantung sepanjang 558 meter di pemasok dan masyarakat seba- sembilan lokasi, dengan total gai pemanfaat, perlu hubungan dana Rp427.970.000. Kemudian baru bersifat jangka panjang turap batu kali 1.897 meter di dan berorientasi pemecahan delapan lokasi dengan total masalah. dana Rp460.800.000. ”BKM wadah masyarakat BKM Mentari Timur, Keluramenanggulangi kemiskinan han Tanjung Hilir, Kecamatan tidak dapat menyelesaian per- Pontianak Timur bermitra masalahan sendiri, jika tidak dengan PT Rimba Ramin memdidukung pemerintah kota. De- bangun jalan rabat beton sepamikian juga ketika BKM dapat njang 39 meter, mengunakan menyelesaikan masalah secara stimulan BLM Rp5.608.000 otomatis telah membantu dan swadaya Rp1.840.000, juga masyarakat dan pemerintah, sedikit sumbangan PT Damri. sehingga kesempatan beruSedangkan di Jalan Askot Dasaha bagi pihak swasta jauh lam Gang Assalam, pekerjaan lebih kondusif dan didukung cor gantung 50 meter mengumasyarakat,” jelasnya. nakan BLM Rp27.745.000, serta Disampaikannya pula, BKM kerjasama dengan Akademi telah melakukan beberapa keg- Militer Magelang untuk pengeriatan. BKM Hang Tuah, Kelura- jaan sisa 40 meternya. (r/*)

Kali Pertama Pelaksanaan APBD Tepat Waktu

Kalbar Peringkat 26 untuk Ketepatan Waktu Pemerintah Provinsi (Pemprov) Kalimantan Barat menutup 2010 dengan prestasi. Buat kali pertama pelaksanaan anggaran pendapatan dan belanja daerah (APBD) tepat waktu. CHAIRUNNISYA, Pontianak “BERDASARKAN catatan Kementerian Dalam Negeri (Kemendagri), (Provinsi) Kalbar termasuk urutan ke 26 dari 33 provinsi yang APBD 2011 masuk tepat waktu di tahun

anggaran 2010. Kami berharap awal Januari dokumen pelaksana anggaran bisa dilaksanakan,” ujar Pjw Kepala Biro Pengelola Keuangan Sekretariat Daerah Pemprov Kalbar Syarifuddin di ruang kerjanya, Jumat (31/12) sore. Menurut Syarifuddin, Menteri Dalam Negeri telah mengeluarkan surat keputusan nomor 903-1121 mengenai evaluasi Rancangan Peraturan Daerah (Raperda) tentang APBD Tahun Anggaran 2011 dan Rancangan Peraturan Gubernur Kalbar tentang APBD 2011. Tahap selanjutnya adalah surat jawaban Gubernur Kalbar terhadap Hasil Evaluasi Mendagri mengenai Raperda Kalbar tentang

Syarifuddin

APBD 2011 dan Raperda Gubernur tentang Penjabaran APBD 2011. “Semuanya sesuai mekanisme yang ditetapkan Mendagri. Peraturan Gubernur Nomor 55 Tahun 2010 tanggal 31 Desember 2010 tentang Penjabaran APBD 2011 juga sudah ada dan dimuat dalam berita daerah nomor 31,” ujarnya. Untuk melaksanaan APBD 2011, tinggal menunggu dokumen pelaksana anggaran. “Tetapi tidak masalah, diharapkan APBD 2011 bisa dilaksanakan awal tahun. Diperkirakan 4 Januari akan datang bisa dilaksanakan. Pada tahun sebelumnya paling cepat dilaksanakan pada 14 Januari,” ungkap Syarifuddin.

Anggaran paling besar berada pada Dinas Pekerjaan Umum (PU) Kalbar. Total anggaran baik belanja langsung maupun tidak langsung instansi tersebut sebesar Rp312.992.636.000. Diikuti RSUD RSUD Sudarso sebesar Rp116.128.572.750, Dinas Pendapatan Daerah (Dispenda) Rp68.951.598.950, Dinas Pertanian Rp64.719.955.396, Dinas Kesehatan 83.907.532.648,51, Sekretariat DPRD Kalbar Rp42.427.974.500, Badan Pendidikan dan Pelatihan (Bandiklat) Rp39.322.673.600, Dinas Perhubungan (Dishub) Rp38.237.343.450, dan Dinas Kelautan dan Perikanan (DKP) Rp33.802.964.540. (*)

Iklan sebuah sarana yang paling efektif dalam memasarkan sebuah produk.. Contact person:

0561 735071


Pontianak Post

kubu raya

Sabtu 1 Januari 2011

19

Donasi Supadio Merosot

sorot

Serahkan Bantuan

+

PEMERINTAH Kabupaten (Pemkab) Kubu Raya akhirnya memberikan bantuan kepada korban banjir rob di Kecamatan Sungai Kakap. Bantuan tersebut diberikan dengan tujuan agar mereka yang tertimpa musibah bisa hidup normal kembali. ”Mereka harus lebih produktif, cepat. Makanya kita berikan bantuan,” kata Bupati Kubu Raya Muda Mahendrawan kemarin. Menurutnya, bantuan tersebut diberikan agar korban yang sebelumMuda Mahendrawan nya tidak melaut dapat membudidayakan perikanan. Harapan Bupati agar mereka tidak perlu lagi mengungsi ke tempat lain. ”Ini persoalan bersama dan penanganan harus cepat kita lakukan,” ujarnya. Bantuan ini sendiri disampaikan sesegera mungkin agar penanganan dan penuntasan dapat dilakukan. Bupati sendiri berharap pekerjaan tertuda warga dapat terlaksana dengan baik. “Mudah-mudahan bantuan akan berguna,” ungkap dia. (den)

ragam

Proyek Awal Tahun WAKIL Bupati Kubu Raya Andreas Muhrotien mengatakan bahwa proyek-proyek yang dikerjakan mendekati akhir tahun bisa dilakukan perubahan pada tahun 2011 mendatang. ”Ini supaya tidak timbul keributan, sehingga para kontraktor juga dinas teknis pemberi proyek bisa tenang. Sangat rancu apabila pekerjaan diberikan menjelang tutup tahun,” kata dia kepada Pontianak Post, kemarin di ruang kerjanya. Menurutnya, proyek-proyek awal tahun kalau tidak termasuk jadwal perubahan, pengerjaannya bisa dilakukan tepat waktu. Namun yang terpenting, ditambahkan dia, sistem dari pelaksanaan pekerjaan diikuti sesuai aturan. ”Misalnya ada proses pelelangan,” ujarnya. Ia mengatakan bahwa proyek-proyek yang sudah diketokpalu dapat dilakukan pengerjaannya. “Jangan tunggu lagi, kalau memang kesiapan segala sesuatunya juga ada. Pihak pemberi dan pelaksana proyek tinggal melaksanakan di lapangan saja,” ucapnya. Meski begitu, figur yang sebelumnya merupakan Kepala UPPTP ini memaklumi kalau pada akhir tahun, masih ada dilakukan pelelangan proyek. Kendala-kendala tersebut, dimaklumi dia, biasanya terkait kesiapan pendanaan dan masalah teknis lain. Proyek tersebut, diingatkan dia, tidak mungkin diumumkan pemerintah kalau tidak ada halangan. ”Yang terpenting siap saja. Pelaksana proyek juga harus siap,” ungkap dia. (den)

+

INTERNET

PASAR PUNGGUR: Beginilah kondisi Pasar Punggur di Desa Punggur, Kecamatan Sungai Kakap. Sungai Punggur menjadi urat nadi berlangsungnya aktivitas di pasar tersebut.

Pelayanan Capil Meningkat Tajam SUNGAI RAYA – Kepala Dinas Kependudukan dan Catatan Sipil (Disdukcapil) Kubu Raya Lilik Kurniasih mengakui, pelayanan menjelang tutup tahun 2010 mengalami peningkatan signifikan. “Masyarakat ingin pelayanan terbaik. Akan tetapi dengan berbagai upaya yang ada kita terus berusaha dengan dengan tak menyampingkan pemutakhiran data,” katanya. Lilik yang kerap menerima laporan dan keluhan warga terkait pembuatan administrasi kependudukan berupa kartu keluarga (KK), kartu tanda penduduk (KTP) dan akte kelahiran menanggapi serius. Banyak keluhan kalau administrasi kependudukan agak lama pembuatannya. “Disdukcapil Kubu Raya di masa transisi. Kita fokus melakukan pemutakhiran data, juga memberikan pelayanan menyeluruh,” katanya. Dengan begitu, sambungnya,

dampaknya saat ini di setiap kecamatan masih menggunakan sistem off line. Artinya, Disdukcapil menerapkan di setiap kecamatan dengan mengeluarkan nomor induk kependudukan (NIK). ”Akan tetapi data disetorkan ke Dukcapil setiap satu minggu. Ini kami lakukan supaya pengeluaran NIK tidak terkesan ganda,” ujar dia. Ia meminta agar masyarakat memahami kondisi. Apalagi keterbatasan fasilitas dan staf. Disdukcapil tetap memberikan pelayanan secara prima. Terlebih dalam beberapa pekan terakhir pelayanan mengalami lonjakan. ”Itu yang terus kami sonsong dan berlakukan,” katanya. Untuk mendukung agar proses pemutakhiran data berjalan sesuai target, Bupati Kubu Raya Muda Mahendrawan mengeluarkan kebijakan memperbantukan Disdukcapil dengan peminjaman staf. “Ada sepuluh staf diperban-

tukan dalam proses pemutakhiran data. Untuk memaksimalkan pemutakhiran data, kita membagi 3 shift. Mulai pagi hari dari pukul tujuh hingga 4 sore (07.00 WIB – 16.00 WIB), pukul 5 hingga 9 malam (17.00 WIB – 21.00 WIB) dan 10 malam hingga pukul 2 pagi (22.00 WIB – 02.00 WIB),” ungkap dia. Ia juga meminta proses pemutakiran data, didukung kepala desa. Pasalnya mereka memiliki peran penting dalam pengisian dan input data valid. Apalagi, ditambahkan dia, pemutakiran harus benar dan tidak salah. Mengenai persoalan biaya, ia mengatakan hal itu sudah diatur dalam peraturan daerah (perda) yang dikeluarkan Bupati. “Seluruh biaya tertera. Saya pikir tak akan memberatkan masyarakat. Hanya saja kebanyakan warga enggan mengurus sendiri dan menggunakan jasa orang lain,” pungkasnya. (den)

SUNGAI RAYA – Pungutan berupa donasi Bandar Udara (Bandara) Supadio yang ditarik dari setiap penumpang belum maksimal. Target tertinggi yang pernah dicapai Kabupaten Pontianak sebesar lebih dari Rp2 miliar tidak terjadi di Kubu Raya. “Banyak kendala dan masalah. Padahal dinas teknisnya seperti Dishub (Dinas Perhubungan) dan PPKAD selaku koordinator pendapatan daerah sudah berbuat maksimal,” ungkap Sutrisno, kepala Dinas PendapatanPengelolaanKeuangan dan Aset Daerah (PPKAD) Kubu Raya, kemarin di Sungai Raya. Menurut dia, secara pendekatan di pusat dan daerah, Pemkab Kubu Raya sudah berbuat maksimal. Bahkan PT Angkasa Pura berbasis di Jakarta tidak keberatan jika pungutan terjadi. “Namun kendala kita sepertinya berada di lokasi agak kurang strategis,” ujarnya. Ia menjelaskan bahwa pungutan donasi sekarang sebetulnya sama dengan asuransi. Maka, ditambahkan dia, membutuhkan kelincahan dan kelihaian petugas pemungut donasi. “Kita tahu donasi sumbangan ke kita berbentuk semi memaksa. Itu karena kondisi loket letaknya tidak strategis. Tidak heran banyak penumpang lolos,” katanya. Dengan kejadian tersebut, maka pendapatan berupa donasi terjadi kemerosotan secara tajam. Target

pungutan yakni sebesar Rp2 miliar tidak tergapai. “Yang ada target turun menjadi Rp700 juta. Namun itu juga tidak sampai mendekati Rp500 juta. Jadi donasi kita memang tidak maksimal,” ungkap dia. Sutrisno mengatakan bahwa sebetulnya dinas teknis yang menangani masalah ini adalah Dishub Kubu Raya. Namun PPKAD selaku koordinator lapangan juga turut prihatin. Kendala sepertinya, diakui dia, masih menjadi persoalan kebijakan PT Angkasa Pura II Bandara Supadio Pontianak yang belum menyeluruh. ”Kita maunya meja pungutan berdekatan dengan airportax. Jadi ketika penumpang bertolak, mereka juga akan membayar donasi kita,” ujarnya. Ia memaparkan bahwa jumlah penumpang setiap tahunnya yang bertolak ke luar Kalbar mengalami peningkatan. Dari segi pungutan, diakui dia bahwa donasi cukup potensial dan menjanjikan perekonomian lebih baik. Bahkan tidak sedikit tren penumpang baru dari warga ekonomi menengah ke bawah menggunakan pesawat. ”Karena harga tiket sudah hampir sama dengan harga kapal laut,” jelasnya. Sutrisno mengungkapkan bahwa saat ini dia tengah memikirkan langkah strategis bersama Dishub Kubu Raya. Itu adalah tempat yang lama dikaji kembali. Dalam benaknya, ada beberapa alternatif pilihan tempat. (den)

+

Tarik Minat, Perpustakaan Harus Cantik SUNGAI RAYA – Roqib, anggota Komisi D DPRD Kubu Raya memiliki pemikiran tersendiri seiring dengan gebrakan Kantor Arsip dan Perpustakaan Daerah (Arpusda) Kabupaten Kubu Raya. Menurut dia, perpustakaan harus cantik. “Tidak saja cantik segi sarana dan prasarana, juga koleksi buku-bukunya harus lengkap. Sehingga minat membaca warga akan tinggi,” usulnya.

Ia memaparkan setiap daerah di Kalbar tentunya memiliki Arpusda. Sebagai Kabupaten terbaru di Kalbar, Kubu Raya, diakui dia, termasuk gesit. Setelah menerima bantuan mobil keliling, juga diselingi dengan bantuan buku-buku. ”Itu sudah luar biasa sekali,” katanya. Politikus PAN Kubu Raya ini menambahkan bahwa untuk menambah minat baca masyarakat, ada baiknya kesiapan sarana dan

prasarana setiap daerah dipertajam. Caranya dengan melengkapi koleksi buku-buku yang menjadi dahaga pengetahuan warga Kubu Raya. ”Dengan demikian, masyarakat akan lebih tertarik dalam membaca,” ucap dia. Komisi D DPRD Kabupaten Kubu Raya sendiri, diungkapkan dia, akan mengajak pemerintah daerah menyiapkan sarana dan prasarana berupa perpustakaan daerah. Secepatnya ia akan

melakukan koordinasi dengan rekan-rekannya di Komisi D. ”Kami siap melakukan sharring pendapat,” terangnya. Selain itu, ia juga meminta Kantor Arpusda Kubu Raya meramu strategi untuk menumbuhkan minat baca. Masyarakat penyuka buku bacaan harus ditarik beramai-ramai untuk dan bertukar fikiran. ”Kalau mereka melihat dengan sendirinya buku-buku tersebut, maka

menumbuhkan semangat untuk menggali informasi. Itu berarti akan ada penciptaan generasi cerdas,” ungkap dia. Roqib berharap kalaupun ke depan ada kantor perpustakaan permanen, hendaknya menciptakan iklim sarana dan prasarana yang nyaman, aman, dan mudah terjangkau. Oleh karena itu, ke depannya sudah harus difikirkan bagaimana tempat tersebut bisa terwujud. (den)

+

cmyk


20

Komunikasi bisnis

Pontianak Post

Advertorial

Tahun Ini, Saat Tepat Genjot Produksi Beras HARGA pangan dunia diperkirakan akan terus melonjak, sehingga akan sangat menyulitkan jika sampai Indonesia kekurangan stok beras seperti tahun ini. Untuk mengantisipasinya, maka pemerintah akan menggenjot produksi beras. “Untuk antisipasi harga pangan dunia, langkah kita yakni dengan menjaga stabilitas dalam sisi suplay dan demand,” kata Menteri Koordinator Perekonomian Hatta Rajasa di Istana Bogor, Jawa Barat, kemarin. Dikatakannya, untuk dari sisi suplai, maka wajib hukumnya untuk menjaga produksi beras. Untuk memastikan hal itu, lanjut Hatta, maka pemerintah akan Hatta Rajasa mengeluarkan dua buah instruksi presiden. Inpres pertama yakni mengenai antisipasi perubahan iklim global menyangkut bagaimana respons menghadapi perubahan iklim mendadak, serangan hama, dan sebagainya. Inpres kedua adalah terkait fleksibilitas Bulog untuk pengadaan beras dan gabah agar tidak terpaku pada kualitas tertentu. Hatta menjelaskan, dua aturan ini akan diterbitkan pada Januari 2011. Sehingga nantinya, pada saat panen raya di bulan Februari 2011, Bulog bisa melakukan mekanisme pembelian sesuai dengan kebijakan baru ini. “Dengan aturan ini, maka akan memungkinkan Bulog melakukan pengadaan di daerah yang kualitas berasnya rendah,” tukasnya. Menjelang penutupan tahun 2010 kali ini, pemerintah melakukan impor beras sebesar 1,2 juta ton. Langkah ini dilakukan untuk memenuhi stok beras minimum 1,5 juta ton dengan pengadaan prioritas dalam negeri. “Mungkin jika iklim dunia terus ekstrem, besar kemungkinan untuk mencari pasar besar impor, karena semua negara akan menghambat ekspornya,” ujar Hatta. Hatta juga mengakui, bahwa semakin tingginya harga pangan, akan meberikan kesenjangan yang cukup besar terhadap daya beli masyarakat miskin. Untuk itulah, lanjut Hatta, maka penyaluran beras miskin di tahun 2011. “Masaah pangan jadi perhatian sangat serius,” tegasnya. (mad)

Muhammadiyah Tak Terpisahkan dengan NKRI Hadir sebagai Problem Solver MENILIK sejarah berdirinya Negara Kesatuan Republik Indonesia (NKRI), tak terlepas dari tokoh-tokoh Muhammadiyah terdahulu. Hubungan Muhammadiyah dengan NKRI tidak bisa dipisahkan. Muhammadiyah pemegang saham sah Republik Indonesia. “Maju mundurnya bangsa jadi tanggungjawab Muhammadiyah bersama kelompok masyarakat lain,” ungkap Ketua PP Muhammadiyah Prof Dr H Din Syamsudin dalam arahannya saat membuka Musyawarah Wilayah (Muswil) ke-13 Muhammadiyah Kalbar di Asrama Haji Pontianak, Jum`at (31/12). Ditegaskannya, dalam bermitra dengan Pemerintah, Muhammadiyah memiliki pedoman, partisipatif, loyal, dan kritis. “Partisipasi Muhammadiyah terhadap negara bukan sekedar katakata. Muhammadiyah dengan sekolah dan ratusan universitas dan perguruan tingginya telah turut mencerdaskan kehidupan bangsa,” ujar Din. Dengan amal usaha yang dimiliki,

AGUS/SEREMONI

MUSWIL: (Dari Kiri) Din Syamsudin, Cornelis, dan Pabali Musa dalam pembukaan Musyawarah Wilayah, kemarin.

Muhammadiyah menjadi salah satu ormas terbesar di Indonesia. Hal ini diakui masyarakat internasional. Di Amerika, Muhammadiyah dinobatkan sebagai The Larger Modernis Islamic Organization atau Organisasi Islam Modern Terbesar. “Terbesar dari sudut aksi dan amal usaha,” katanya sembari berpesan, kedepan Muhammadiyah harus lebih maju. “Yang akan datang harus lebih

baik. Tingkatkan apa yang menjadi ciri khas Muhammadiyah yakni ajaran kepada kemajuan,” ujarnya. Muhammadiyah harus menjadi problem solver (penyelesai masalah) masyarakat. “Jangan justru jadi bagian apalagi pembuat masalah,” ingatnya. Pembukaan Muswil juga dihadiri Gubernur Kalbar Drs Cornelis MH. Dalam sambutannya, Cornelis meminta Muhammadiyah terus membantu

PENETAPAN HARGA TANDAN BUAH SEGAR (TBS) Hasil Rapat Tim Pengkajian dan Kesepakatan Penetapan Harga TBS Kelapa Sawit Produksi Petani Kalbar bln Desember 2010 PATOKAN HARGA / KG TBS KELAPA SAWIT PRODUKSI PETANI KALBAR SBB : • Umur Tanaman 3 tahun Rp. 1.280.80,• Umur Tanaman 4 tahun Rp. 1.377.42,• Umur Tanaman 5 tahun Rp. 1.476.87,• Umur Tanaman 6 tahun Rp. 1.528.57,• Umur Tanaman 7 tahun Rp. 1.561.67,• Umur Tanaman 8 tahun Rp. 1.639.57,• Umur Tanaman 9 tahun Rp. 1.686.87,• Umur Tan. 10 s/d 20 tn Rp. 1.740.89,Harga CPO/ Kg Rp. 7.912.17 Harga Kernel/Kg : (tidak termasuk PPN) Rp. 5.171.70,- (tidak termasuk PPN) Indeks “K” : 89.74 % TIM PENETAPAN HARGA PEMDA TINGKAT I KALBAR

memberikan pencerahan dan mencerdaskan kehidupan bangsa. “Sudah sejak kecil saya kenal dengan pendidikan Muhammadiyah,” akunya. Ketua PW Muhammadiyah Kalbar, Dr Pabali Musa dalam pidato iftitah mengatakan, Muhammadiyah adalah gerakan yang cukup tua di Kalbar. “Muhammadiyah mulai dikenal di Kalbar sejak 1932. Oleh karena itu, Muhammadiyah harus menjadi organisasi pertama yang merasa dan menyadari sebagai komponen yang memiliki tanggungjawab utama sebagai perwujudan keimanan dan komitmen kebangsaan,” ungkapnya. Masyarakat Kalbar saat ini, jelas Pabali, sangat maju. Namun, ancaman krisis identitas dan moralitas tidak kalah lajunya. “Kehidupan amoral memberhala, hutan tinggal rimba, air sungai menjadi tuba, kemanusiaan pelan-pelan menjadi serigala. Disatu sisi kita tebar infrastruktur pembangunan, di sisi lain kian menyebar infrastruktur bencana,” jelasnya. Itu sebabnya, lanjut Pabali. Muhammadiyah Kalbar bekerjasama dengan siapa dan pihak mana saja dalam upaya nyata memaksimalkan infrastruktur pembangunan dan meminimalkan infrastruktur bencana. (ags/ser)

BBN Naik, Pasar Motor Tetap Tumbuh

Zyrex OnePad, Gadget Hemat dengan Android 2,2 INDONESIA negara yang tergolong subur mejadi target pasar gadget canggih high end keluaran terbaru. Itu terbukti dari penjualan Ipad maupun Galaxy Tab yang cukup mengejutkan. Nah, di kelas low end, ada OnePad yang merupakan gadget besutan Zyrex. Ini bisa jadi tablet alternatif untuk yang berkantong pas-pasan. Ditemui di Service Centre Zyrex Jalan Rappocini Nomor187,ArmySumarli, karyawan Zyrex membeberkan keandalan tablet ini. “OnePad memilki ukuran cukup tipis dengan dimensi 275mm x FOTO IST MENARIK: Army memamerkan 178mmx13,6mmdengan berat hanya 750gram dan produk gadget Zyrex OnePad di ukuran layarnya hanya Service Centre Zyrex, kemarin. 10,1 inci. Cukup ringan untuk dibawa kemana saja,” katanya Army menyebut OnePad sudah dibenami aplikasi OSAndroid2,2.“Beberapaaplikasilainyangtersediadidalamnya mampuberjalandenganbaikpadaOnePad.Jikaaplikasitersebut dirasa masih kurang, bisa ditambahkan aplikasi lain. Hanya dengan mengklik icon market maka akan terhubung dengan situs android market. Namun perlu diaktifkan dulu koneksi internet dengan menggunakan koneksi WiFi yang memang sudah tersedia di dalamnya,” lanjutnya. Dengan tampilan yang bisa berubah horizontal maupun vertikal, menghadap sisi atas, bawah maupun samping kanan dan kiri, akan memudahkan aktivitas membaca, browsing ataupun bermain game. (sam)

Sabtu 1 Januari 2011

FOTO IST

TETAP TUMUBUH: Meskipun BBN terjadi kenaikan, pasar motor nasional tahun depan diprediksi tetap mengalami pertumbuhan.

Kondisi Bromo Memburuk

XL Pastikan Jaringan Tetap Beroperasi HINGGA akhir Desember 2010, aktivitas Gunung Bromo belum menunjukkan tandatanda akan menurun, bahkan sebaliknya. Erupsi terus terjadi setiap hari. Hujan debu vulkanik pun tidak terhindarkan, melanda desa-desa disekitar Bromo. Hujan yang turun hampir setiap hari semakin memperparah kondisi daerah tersebut. Dampaknya adalah terputusnya aliran listrik PLN karena kabel yang terputus dan tiangting listrik roboh. Pasokan listrik ke BTS milik PT XL Axiata Tbk (XL) menjadi terganggu. VP east Region XL, Djunaedy Hermawanto mengatakan, ”Kondisi di sana benar-benar berat. Namun XL telah berkomitmen untuk sekuat tenaga

HARGA KOMODITI DAN PAKAN TERNAK DI PONTIANAK

Komoditi Doc Broiler FS/Ekor Broiler Hidup/kg Ayam Buras hidup/kg Daging Sapi/Kg Daging Babi/Kg Karkas Kambing/Kg Telur Ayam Ras/Kg Pakan Petelur Stater/Kg Pakan Petelur Grower/Kg Pakan Layer/Kg Pakan Pedaging Starter/ kg Pakan Pedaging Finisher/kg Kulit Sapi / Kg Kulit Kambing / Lembar

MINGGU KE 3 DESEMBER 2010

Harga Rp. 8.000,Rp. 22.500,Rp. 40.000,Rp. 75.000,Rp. 50.000,Rp. 70.000,Rp. 17.000,Rp. 5.700,Rp. 5.600,Rp. 4.500,Rp. 6.000,Rp. 5.800,Rp. 7.500,Rp. 20.000,-

menjaga agar BTS kami tetap nyala dan bisa melayani pelanggan. Kami sadar, dalam kondisi seperti itu, layanan seluler menjadi sangat penting untuk dijaga, baik untuk para pelanggan, maupun aparat pemerintah dan petugas balabantuan. BTS XL kini satu-satunya yang terus inservice di daerah ini.” Para teknisi XL di lapangan mengabarkan, saat ini untuk listrik, genset portable masih bisa mencukupi listrik untuk 5 BTS XL yang ada di sekitar Bromo. BTS terdekat berada di Dusun Cemoro Lawang, Desa Ngadisari, Kecamatan Sukapura, Kab Probolinggo, yang berjarak darat sekitar 3 km (jarak udara sekitar 2,6km) dari kawah Gunung Bromo. Para teknisi XL terus berjaga dan

memastikan BTS tetap menyala meski hujan abu vulkanik bahkan pasir juga menerjang dan membebani bangunan shelter BTS. Sementara itu, rumah-rumah di sekitar site banyak yang roboh tidak kuat menahan tumpukan pasir. Sejak akhir pekan lalu, abu vulkaniknya sudah sampai kota Probolinggo dan sekitarnya. Selain memastikan jaringan, XL juga terus menyalurkan bantuan tanggap darurat bagi warga sekitar Bromo. Bantuan yang diberikan selain bagian komunikasi bagi aparat dan warga, juga berupa donasi kesehatan pembagian masker dan obatobatan. XL akan terus memantau kondisi warga di sana dan akan berusaha memberikan bantuan lanjutan.(*/biz)

PASAR sepeda motor di pada 2011 diperkirakan masih tumbuh meski kendala perpajakan menghantui pasar otomotif tanah air. Para pelaku bisnis optimistis kenaikan penjualan mencapai 10 sampai 15 persen. Menurut Pemimpin Operasional Surabaya PT IndoJakarta Motor Gemilang (main dealer Suzuki) Dekriswan Zihono, kenaikan Bea Balik Nama (BBN) bisa membuat harga sepeda motor naik berkisar Rp 400 ribu hingga 800 ribu. “Untuk sementara, awal tahun depan tidak ada pabrikan motor yang menaikkan harga,” ujarnya. Per 1 Januari 2011, Pemprov Jatim memang memberlakukan kebijakan baru tentang BBN. Jika semula 10 persen, tahun depan dinaikkan menjadi 15 persen dari harga off the road. Beruntung, mayoritas jenis kendaraan roda dua (R2) yang beredar di pasaran terkena pajak progresif. Ketentuan itu hanya berlaku untuk bagi kendaraan bermotor roda empat (R4) dan roda dua (R2) 250 cc ke atas. Ketentuan pajak progresif adalah 1,5 persen untuk kendaraan pertama, 2 persen kendaraan kedua, 2,5 persen bagi kendaraan ketiga, 3 persen kendaraan keempat, 3,5 persen untuk kendaraan kelima dan seterusnya. “Kalau semua jenis motor sampai terkena pajak progresif, sangat telak pukulannya,” katanya. Menurutnya, sampai saat ini

PERKEMBANGAN HARGA KOMUDITI T.PANGAN & HORTIKULTURA BULAN NOVEMBER 20110

PERKEMBANGAN HARGA RATA-RATA BEBERAPA BAHAN POKOK PENTING DI KOTA PONTIANAK NO. 1 2 3 4 5 6 7 8 9 10 11 12 13

NAMA BARANG BAHAN KEBUTUHAN POKOK Beras Lokal/Kampung Beras IR64 Gula Pasir Minyak Goreng Bimoli Minyak Goreng Curah Daging Sapi Murni Daging Ayam Ras Daging Ayam Kampung Telur Ayam Ras Susu Kental Manis Bendera Susu Bubuk Putih Cap Bendera Jagung Pipilan Kering Garam Beryodium

SATUAN

HARGA

KET.

NO.

NAMA BARANG

SATUAN

HARGA KET.

NO. JENIS SATUAN HARGA KOMODITAS

KG KG BKS KG KG KG KG KG KG LITER KG KG KG

7.000 6.625 1.175 23.000 23.000 45.500 16.000 16.500 2.375 7.000 31.950 30.750 21.250

1 2 3 4 5 6 7 8 9 10 11 12 13

BAHAN KEBUTUHAN POKOK KG KG KG LITER KG KG KG KG KG KLG 400 GR/KTK KG 250 GR/BKS

6.525 8.000 10.125 Luar Negeri 12.000 11.000 75.000 Kualitas A 22.500 36.000 15.050 7.975 23.925 4.125 900

14 15 16 17 18 19 20 21 22 23 24 25 26

Tepung Terigu Segitiga Biru Kacang Kedelai Mie Instan (Indomi Rasa Kaldu Ayam) Cabe Merah Besar (Biasa) Bawang Merah Ikan Asin Teri Kacang Hijau Kacang Tanah Ketelah Pohon Minyak Tanah Telur Ayam Kampung Cabe Keriting Bawang Putih

Sumber Data : Dinas Perindag Prop. Kalbar

belum ada sosialisasi tentang juklak pengenaan kendaraan yang terkena pajak progresif. “Kalau pemilikan satu nama sudah jelas. Bagaimana dengan satu alamat. Ini yang harus dipertegas agar calon konsumen tidak bimbang membeli kendaraan,” ujarnya. Kebijakan baru di sektor perpajakan itu pula yang menyebabkan pelaku bisnis kendaraan roda empat di Jatim agak pesimistis pada tahun depan. Mereka berasumsi pasar bakal turun sampai 30 persen. Prediksi itu sangat kontras dengan kinerja penjualan tahun ini yang hingga November lalu tumbuh 40 persen dibanding tahun lalu. Untuk pasar motor, Kris memprediksi pasar mengalami shock pada awal tahun depan. Penjualan juga terancam menurun sampai 20 persen. Namun, Kris yakin pasar bakal kembali bangkit dan tumbuh. “Pertumbuhannya tidak terlalu optimistis, sekitar 10 sampai 15 persen,” terangnya. Hal senada juga diungkapkan General Manager Marketing PT MPM (Mitra Pinasthika Mustika), Honda Motorcycle Main Dealer & Parts East Java & NTT Area, Dendy Sean. Menurutnya, tren penjualan akhir tahun ini berbeda dengan tahun-tahun sebelumnya. “Biasanya orang malas membeli motor pada Desember karena surat kendaraannya berdampak pada penjualan second. Tapi, sekarang malah naik,” paparnya.(dio/fat)

Jeruk Grade A Jeruk Grade B Jeruk Grade C Tomat Aloe Vera K.panjang Buncis Cab rawit lokal Jeruk Sambal Sawi Keriting Jagung Manis Timun Terong

Kg Kg Kg Kg Kg Kg Kg Kg Kg Kg Buah Kg Kg

7000 6000 5000 10000 2500 12000 15000 28000 4000 7000 2500 7000 10000

JENIS KOMODITAS

14 15 16 17 18 19 20 21 22 23 24 25 26

Alpokat Nanas Pepaya Madu Pepaya Kampung Pisang Nipah Pisang Berangan lengkeng Pisang Ambon Semangka Biji Semangka Non Biji Sawo Salak Bers Cehereng

SATUAN HARGA KET Kg Buah Kg Kg Sisir Sisir Kg Sisir Kg Kg Buah Kg Kg

20000 3000 6000 4000 7000 15000 20000 15000 4000 6000 12000 20000 7000


Pontianak Post

Tubuh Terasa Melayang Ketika Kolesterol Tinggi HIDUP sehat merupakan dambaan setiap orang. Namun terkadang, kenikmatan itu terganggu ketika di usia senjanya, seseorang terserang penyakit. Sebut saja Gunem, seorang ibu rumah tangga dan penjual jamu gendong yang kenyamanan hidupnya terganggu, di mana 8 tahun lalu dirinya mengetahui bahwa kadar kolesterol ditubuhnya sudah di atas normal. “Sudah bertahun-tahun kolesterol saya tinggi. Rasanya benarbenar tidak enak. Saya sering merasa pegal-pegal dan badan terasa melayang,” terang wanita berusia 68 tahun ini memulai percakapan. Faktor usia diduga Gunem sebagai penyebab dirinya menderita kolesterol. Setiap orang memiliki kolesterol di dalam darahnya, di mana 80% diproduksi oleh tubuh sendiri dan 20% berasal dari makanan. Kolesterol yang diproduksi terdiri atas 2 jenis yaitu kolesterol baik (HDL) dan kolesterol jahat (LDL). Tubuh kita sebetulnya akan menghasilkan sendiri kolesterol yang kita perlukan. Tetapi, karena produk hewani yang kita konsumsi, menyebabkan banyak orang memiliki kelebihan kolesterol. Selain itu, kurang olahraga dan bergerak, disinyalir dapat menjadi salah satu pemicu seseorang mengalami masalah dengan kolesterolnya. Tak tinggal diam, ia terus berupaya mengatasi keluhannya tersebut, tapi belum ada perubahan. Namun, saat ditemui di kediamannya di Jln. Podomoro, Pontianak, Kalimantan Barat, ia tampak sehat dan segar. Gunem pun membagi rahasianya dengan kami. “Beberapa bulan yang lalu, saya mulai minum Gentong Mas. Alhamdulillah sekarang kondisi saya sudah sehat, kadar kolesterol saya sudah turun,” ungkap nenek 12 orang cucu tersebut dengan bahagia. Gentong Mas adalah minuman herbal alami yang terbuat dari gula aren dan nigella sativa (habbatussauda) yang aman dikonsumsi, dan terbukti sangat bermanfaat bagi kesehatan. Gula aren banyak mengandung nutrisi yang dibutuhkan tubuh. Niacin pada gula aren meningkatkan fungsi kerja otak dan menurunkan kadar kolesterol LDL (kolesterol jahat). Sementara ascorbis acid memiliki fungsi menghancurkan radikal bebas. Untuk mendapatkan hasil yang lebih baik dan lebih cepat, pola hidup sehat seperti olahraga teratur, mengurangi makanan yang tinggi lemak jenuhnya dan makanan yang dimasak dengan minyak sawit. Manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Informasi lebih lanjut kunjungi www.gentongmas.com. Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek dan toko obat terdekat. Pontianak: 081376179880/05617020305. Kabupaten Pontianak: Apt Mempawah, TO Ceria. Singkawang: 085220713000. Kubu Raya: Apt Amelia, Apt Arwana. Sambas: TO Sehat, Apt Mitra Jaya, TO Aman. Sanggau: TO Mulia, Apt Mandiri. Ngabang: Apt Meriba, TO Sehat. Sintang: TO Tiara, TO Setia Budi. Bengkayang: TO Berkat, TO Meriba. Ketapang: 081256520280, Apt Medistra Farma, TO Murni, Apt Mulia. Terdaftar di Depkes:PIRT:812.3205.01.114.(biz)

Stroke Akibat Tekanan Darah Tinggi

Kisman

komunikasi bisnis

Sabtu 1 Januari 2011

MENGAPA orang bisa stroke? Stroke akibat tekanan darah tinggi disebabkan tersumbatnya pembulu darah di otak. Penyakit ini cukup kejam, sehingga orang menginginkan lebih baik mati daripada hidup menderita dan menyusahkan keluarga. Presentase kasus stroke yang meninggal masih di atas 20 persen. Gejala awal dari hipertensi adalah sakit kepala, pusing, kejang pada tangan dan kaki yang sering dirasakan, mudah lelah, penglihatan kabur, sering mimisan dan bumi terasa berputar. Apabila aliran darah tidak lancar (pembuluh darah tersumbat) dapat menyebabkan pusat pergerakan maupun pembicaraan tertekan, sehingga merasa lumpuh, mati rasa, berbicara tidak jelas, karena mulut miring dan tidak mampu mengurus diri sendiri. Kisman, warga Pontianak Tenggara, sudah 5 tahun stroke akibat tekanan darah tinggi. Tangan dan kakinya sudah hilang rasa, sehingga tak dapat mengurus dirinya sendiri. Kapsul Prima Tensi sudah teruji dan terbukti secara klinis dapat menormalkan tekanan darah tinggi, membuka sumbatan pembuluh darah yang tersumbat, baik yang lama maupun baru, memperlancar peredaran darah ke jantung dan otak, memperbaiki jaringan yang sakit karena dapat melancarkan metabolisme tubuh. (POM TR. 053 349531). Prima Tensi tersedia di apotek dan toko obat terdekat di kota Anda. Pontianak: Apt Imam Bonjol Jl. Imam Bonjol, Apt Sei Raya Dalam, Apt Murni, Apt Amelia, Toko Batara Jl. Sungai Raya Dalam, Apt Makmur 2, Apt Gajah Mada, Apt Bintang, TO SinarAbadi I dan 2 Jl. Gajahmada. Apt Kimia Farma, Apt Sehat, TO Murni, Apt Utama Jl. Tanjungpura, Apt Merdeka Timur Jl. Cokroaminoto, Apt Mulia Jl. Urip, Apt Mandiri I dan 2 Jl. Merdeka Barat. TO Jenaka, TO S Lestari Jl.Ahmad Dahlan. TO Fajar Jl. Komyos Sudarso. Apt Kharitas Bhakti Jl. Siam, Apt Makmur Jl. Serayu, Apt Abadi Jl. Dipanegoro, Apt Mega S Farma Jl. Veteran, TO Paris Jl. Parit Husin 2. Kota Singkawang: Apt Singkawang, Apt Merdeka Jl. Dipanegoro. Mempawah: Apt Mempawa Jl. GM Taufik. Sambas: The Santos Jl. Keramat. Sanggau: Apt Yoga Jl. A Yani. Ketapang: Apt Lestari Farma, Apt Medistra Farma Jl. R Suprapto. Informasi lebih lanjut hubungi perwakilan kami di nomor 081352022980.(biz)

21

Advertorial

Taman Pasir Panjang Indah Singkawang

Happy New Year 2011 Jumat 31 Desember 2010-Minggu 2 Januari 2011

MOMENT Long Weekend liburan akhir tahun dan pergantian tahun segera tiba. Untuk menunjang obyek dan daya tarik wisata Taman Pasir Panjang Indah Singkawang, dan menarik minat kunjungan wisatawan ke  Kota Singkawang sebagai daerah tujuan wisata, managemen Taman Pasir Panjang Indah Singkawang menggelar event dengan tajuk “Happy New Year 2011” pada 31 Desember 2010 hingga Minggu 2 Januari 2011. Happy New New Year 2011, merupakan event agenda entertainment dikemas dalam rangkaian acara yang akan menjadi atraksi wisata menarik dengan background open space bibir pantai/laut lepas, tepatnya di T-Stage

Taman Pasir Panjang  Indah Singkawang. Berbagai kegiatan yang akan digelar meliputi: Pertama, Pesta Kembang Api 1 jam nonstop atraksi spectakuler menjelang detikdetik pergantian tahun. Jenis kembang api yang disiapkan berukuran besar dan tipe-tipe terbaru. Kedua, Live Music Band Performance pentas hiburan live music dengan mengambil posisi  T-Stage Pasir panjang. Ketiga, Modern Dance Competition, merupakan ajang kompetisi modern dance yang hingg saat ini sudah lebih dari 15 group dancer mendaftarkan diri. Juga akan diselingi Kids Dancer, merupakan aksi para dancer anak-anak dalam gerakan-gerakan atraktif, centil dan lucu dan diikuti

badut-badut yang fun. Keempat, Live Dj Show @ Palapa Diskotik. Merupakan aksi Dj-Dj ternama dari Jakarta dan Home Dj Palapa Diskotik, yang menghentakkan house music menciptakan nuansa clubbing yang sangat berbeda untuk para cluber mania didukung kekuatan soundsystem puluhan ribu watt untuk memanjakan telinga dugem mania. Kelima, Triathlon Wisata digelar Minggu 2 Januari 2011, merupakan ajang olahraga renang, balap sepeda dan lari yang baru kali ini diadakan di Kalbar dengan temapta start dan finish di Taman Pasir Panjang Indah Singkawang. Keenam, Happy  New Year 2011 di Pasir Panjang, dipastikan akan disaksikan oleh ribuan pengunjung mem-

banjiri Pantai Pasir Panjang. Mengingat padatnya lalu lintas sepanjang jalur pantai utara, maka kami mereferensikan kepada para pengunjung yang akan merayakan tahun baru di Pantai Pasir Panjang dapat melakukan perjalanan lebih awal, sehingga tiba di pasir panjang pada sore hari dikarenakan sebagian besar pengunjung masuk pada ma-

lam hari yang mengakibatkan kepadatan lalu lintas di kawasan obyek wisata Taman Pasir Panjang Indah pada tengah malam. Event ini didukung oleh; Palapa Diskotik, Randayan Island, Palapa Sport Club, Randayan Meeting Room, Palapa Function Hall dan Palapa Beach Hotel Singkawang.(biz)

Program MM Ciptakan Lulusan Teruji & Profesional Pendaftaran Terakhir 29 Januari 2011 Kuliah Perdana Angkatan XXV & IX Fresh Graduate, 14 Februari 2011

FOTO IST

CINDERAMATA: Dosen program MM Untan H. Ali Alwi SE, MS, Ph.D (kanan) menyerahkan cinderamata pada DR. Bambang PS Brodjonegoro usai kuliah umum.

PROGRAM Magister Manajemen Universitas Tanjungpura Pontianak, merupakan program pendidikan di bidang manajemen berjenjang Strata 2 (S2), yang didirikan berdasarkan SK.Dirjen Dikti

Nomor: 204/Dikti/Kep/1998 tentang Pembentukan Program Magister Manajemen di Untan. Dan sesuai dengan SK Badan Akreditasi Nasional Perguruan Tinggi nomor: 019/ BAN-PT/Ak-VI/S2/l/2009.

Program magister manajamen Untan telah terakreditasi dengan predikat ”baik”. Dan Ini sebagai satu-satunya program magister manajemen yang ada di Kalbar hingga 2010. Program S2 Magister Manajemen (MM) Untan telah meluluskan lebih dari 900 wisudawan, yang sekarang menduduki posisi maupun jabatan strategis diberbagai instansi maupun perusahaan, baik BUMN/BUMS yang tersebar di seluruh Kalbar maupun nasional. Untuk itu, kami memberikan kesempatan bagi para lulusan sarjana (S1) dari berbagai disiplin ilmu untuk diterima menjadi mahasiswa baru di Program S2, untuk

angkatan XXV dan Angkatan IX Fresh Graduate. Program S2 MM Untan sendiri terbagi menjadi tiga kelas. Yakni Kelas Intensif A, perkuliahanya dilaksanakan setiap Sabtu dan Minggu, pukul 08.0017.00 WIB. Kelas Intensif B (kuliah malam), perkuliahan dilaksanakan Senin-Jumat, pukul 19.00-21.45 WIB. Dan Kelas Fresh Graduate (kuliah pagi), perkulihan dilaksanakan setiap Senin-Jumat, pukul 08.30-11.00 WIB. Program S2 MM juga memiliki tiga konsentrasi program studi. Pertama, Manajemen Keuangan atau Keuangan Daerah. Kedua, Manajemen Pemasaran, dan ketiga, Manajemen Sumber Daya Manusia. Pendaftaraan gelombang II

semula dijadwalkan dari 1 November-4 Desember 2010, namun akan diperpanjang sampai dengan 29 Januari 2011. Untuk tes potensi akademik dan Toefl akan dilaksanakan pada 30 Januari 2011. Hasil seleksinya akan diumumkan pada 3 Februari 2011. Pastikan diri Anda telah terdaftar di Program S2 Magister Manajemen Untan. Sekretariat pendaftaraan bertempat di gedung Magister Manajemen Untan Jl. Imam Bonjol Pontianak, kode pos 78124 atau dapat menghubungi Susi, Ali dan Fara di telepon (0561) 571512/ (0561) 3055949. Hp. 085245417222, 081256534100 atau fax (0561) 571513 dan email: pasca_mmuntan@ yahoo.com.(and/biz)

Kisah Nyata Ny. Sainur Koesyiro:

Sembuh dari Kanker Rahim Tanpa Operasi Dengan Obat Shinse Husein BERMULA dari ngilu dan sakit di seluruh tubuh, berlanjut dengan sakit kepala yang luar biasa, terakhir mengalami pendarahan hebat. Setelah dideteksi dokter, ternyata Ny. Sainur Koesyiro (72 th) mengidap kanker rahim kronis. Terbatasnya peralatan di salah satu rumah sakit Tulung Agung, Sainur dirujuk ke rumah sakit Surabaya untuk operasi. “Karena faktor usia, dokter tidak bisa memastikan kesembuhan pascaoperasi. Karena itu, anak saya yang di Jakarta mencari solusi lain, yakni mengirimi obat dari Shinse Husein yang buka praktik di Muara

Karang Jakarta Utara. Hasilnya, Alhamdulillah dalam waktu 6 bulan penyakit saya tuntas. Ini telah dibuktikan secara medis,” kata pensiunan guru SD, warga Tulung Agung Jatim itu. Diceritakan, sejak diambil inisiatif untuk mengkonsultasikan penyakitnya dengan ahli kanker Shinse Husein, yang buka praktik di Perumahan Muara Karang Blok B-4 Barat No. 45 Jakarta Utara. “Obat dari Shinse Husein dipaketkan ke alamat saya. Lalu saya konsumsi. Sebagai reaksi obat, seminggu pertama, perut saya agak sakit dari biasanya. Namun bersamaan itu, keluar darah bergumpal-gumpal seperti sampah, ada yang menyerupai serpihan daging. Anehnya, kondisi saya waktu itu makin hari makin kuat dari sebelum-

nya. Dalam waktu tiga minggu pendarahannya berhenti. Sejak itulah, kondisi saya makin membaik, sehinga kini tidak pernah sakit lagi dan tak ada keluhan

sama sekali, baik di bagian perut maupun di bagian laindibadansaya,” kata Sainur. Agar penyakitnya benar-benar tuntas, selama hampir setahun Sainurmasihtetap mengkonsumsi obat Shinse Husein yang dikirim secara rutin oleh anaknya dari Jakarta. Hasilnya, m a k i n w a kt u diketahui, kanker di rahimnya makin mengecil. Terakhir 15 Juli 2008 Sainur kontrol, dinyatakan dokter, rahimnya sudah bersih. Praktik Shinse Husein ber-

Keberhasilan Usaha dan Sukses Anda Ada di Bintasik Persyaratan Mudah, Tak Tamat SD Bisa Diterima Belajar DI akhir tahun 2010 ini, isu sedang beredar adalah semakin meningkatnya jumlah kendaraan yang terjadi di kota-kota berkembang dan berpotensi kemacetan. Bagaimana dengan Kalimantan Barat, khususnya di Pontianak? Kota Pontianak yang kita lihat saat ini merupakan kota yang mulai berkembang, yang pada akhirnya mendapatkan pelebaran jalan di mana-mana karena jumlah kendaraan dari tahun ke tahun kian meningkat, membuat peluang pasar di bidang otomotif semakin meningkat pula. Mulai dari servis kendaraan, penjualan spare part kendaraan, punya harapan untuk meraih keuntungan. Saat sekarang, data penyerapan tenaga kerja bidang otomotif diperkirakan bertambah setiap tahunnya. Menurut data kendaraan di showroom mobil atau motor di Pontianak baik yang baru maupun second, jumlah kendaraan yang terjual semakin meningkat baik kendaraan roda dua maupun roda empat. Dengan memaksimalkan tenaga kerja bidang otomotif, jelas akan membuat masyarakat semakin mudah dalam pelayanan jasa otomotif dalam perbaikan baik dibidang pengelasan, pengecatan maupun masalah mesinnya. Yayasan Bintasik memberikan jawa-

ban bagi yang ingin bekerja atau mulai membuka usaha. Untuk bekerja atau memulai suatu usaha dibutuhkan sebuah keterampilan. Yayasan Bintasik adalah lembaga pendidikan di bidang otomotif yang berani berkompetensi di segala aspek kehidupan sosial masyarakat, baik di bidang pendidikan dan latihan, bidang jasa dan usaha ekonomi produktif yang sedang trend saat ini. Lembaga pendidikan otomotif sangat digemari kaum muda bahkan orang tua saat ini baik dari kalangan ekonomi atas, menengah, maupun bawah. Kurikulum atau metode yang disesuaikan dengan kebutuhan dan peluang pangsa pasar yang ada, sehingga kelulusannya sangat cocok dan sangat

dibutuhkan di setiap instansi baik pemerintah maupun swasta. Bintasik pendidikan tidak melihat latar belakang pendidikan dari tamat SD, SMP, SMU, D3 atau sarjana mesin. Yayasan Bintasik berprinsip bahwa kunci kesuksesan sebuah lembaga adalah keberhasilan siswa-siswa didikannya. Yayasan Bintasik Pontianak telah meluluskan 1408 orang/anak yang langsung begitu cepat mendapatkan peluang pekerjaan, bahkan sampai mandiri (berwirausaha) hanya dengan belajar keterampilan hidup khususnya di bidang otomotif. Pelatihan otomotif yang diselenggarakan Yayasan Bintasik terdiri dari beberapa jurusan antara lain: Mekanik mobil bensin & solar, mekanik motor 2 tak & 4 tak, pengelasan body & interior, pengecatan cat duco & oven, jahit jok & interior, paket mengemudi + SIM A, kursus komputer. Semua jurusan digaransi sampai bisa dan semua jurusan mendapatkan sertifikat. Persyaratan belajar sangat mudah, walaupun tidak tamat SD bisa diterima. Daftar segera hubungi Yayasan Bintasik Jl. Prof. M Yamin No 45 depan Masjid Al-Asyraf simpang Ampera Kotabaru Pontianak, telp (0561) 767508, HP 08522562229/085750606162, 081345708984.(biz)

dasarkan ijin praktik DepkesNo. 1.3.01.3175.091. Konsultasi gratis hubungi: 0816903378 dan obat bisa juga didapatkan di: Sinar Mutiara Jl. Gajahmada No.3, telp (0561) 738566-7061088 Pontianak. Penyalur TO Mulia Jl. A Yani No.21 telp (0564) 22970 Sanggau Kapuas. TO Tiara Jl. Jendral Sudirman No.7-8 telp (0565) 23229 Sintang. TO Swallow Jl. Koper Makmur No.2 telp (0562) 631111 Singkawang. TO Aman Jl. Moh Hambal Pemangkat telp (0562) 241618 Singkawang. TO Ceria Jl. Pasar Baru Blok D No. 1 telp (0561) 652351 Sei Pinyuh. TO Duri Jl. Raya No. 16 telp (0562) 675151 Sei Duri. TO Tulus Budi Jl. A Yani No. 74C Ketapang telp (0534) 32517. TO Sinar Abadi Jaya Jl. Gajahmada 37/199 telp (0561) 739670 Pontianak.(biz)

Wah, China Nyatakan Skype Ilegal KINI, China menyatakan ilegal penggunaan telepon internet Skype di negari Tirai Bambu itu. Sebelumnya, Facebook, Twitter, dan YouTube telah diblokir di China. Tahun lalu, server Google di China pun telah di tutup. Menurut koran China, semua layanan telepon internet dilarang di China selain layanan milik negara, China Unicom dan China Telecom. Menurut regulasi baru, telepon dari komputer ke telepon rumah melalui Skype dilarang. Namun Skype masih legal jika digunakan menelepon antarkomputer. Deputi Kepala Chinese Propaganda Department Wang Chen mengatakan, “November, 350 juta informasi penting, termasuk teks, gambar dan video dihapus dari internet China”. Skype menanggapi, “Pengguna di China saat ini dapat mengakses Skype melalui Tom Online, mitra kami”. Skype menolak mengomentari ‘spekulasi’ layanan mereka akan dilarang. Menurut Telegraph, China merupakan pasar telepon internet terbesar dunia. “Sangat tak mungkin China malarang Skype, Skype merupakan pemimpin pasar, begitu juga MSN dan Gmail Talk. (mor)


cmyk

22

Pontianak Post l Sabtu 1 Januari 2011

+

+

+

+

cmyk


Pontianak Post l Sabtu 1 Januari 2011

23

AnEKA PONTIANAK

Pencatut Pejabat Ditangkap Sambungan dari halaman 17 (DPO) Polda Kalbar. Ketiganya yakni Asr, Asl dan Ope. Modus kejahatan komplotan tersebut yakni menghubungi korban ingin dikirim sejumlah uang. Pengirimannya via transfer bank. Dengan mencatut nama pejabat. Terutama ketika menjelang serah terima jabatan. Sebagai cara dalam mengelabui korban. Setelah mampu dipengaruhi dan menyakinkannya, korban segera diminta mengirim uang. Pelaku langsung menonaktifkan nomor telepon yang dipergunakan untuk menghubungi korban. Agar tidak terlacak keberadaannya, ketika uang yang diminta telah korban kirim. Kasus tersebut sempat menimpa jajaran kepolisian di Polsek Pemangkat. Hingga kasusnya mampu terungkap dan dua pelaku sudah ditangkap. Kronoligis kejadian penipuan yakni, Selasa (30/11) tersangka

Asr menghubungi Polsek Pemangkat. Melalui pembicaraan telepon, tersangka mengaku sebagai pejabat Polda Kalbar. Menyampaikan ingin berbicara dengan bendahara Polsek. Penerima telepon, Aiptu Usman, memberikan nomor Briptu Eko Pitriadi (bendehara,red). Usai mengantongi nomor Bendahara, tersangka langsung menghubunginya pada 1 Desember. Ingin meminjam gaji anggota (Polsek Pemangkat,red) dengan mengaku sebagai Ajun Komisaris Lintar Mahardono, Kapolsek baru. Ters angka lalu mengarahkan korban mengirim uang yang dipesan ke rekening nomor rekening salah satu Bank Pemerintah. Setelah mengirim uang, korban menanti sejenak di pintu keluar bank. Karena menurut tersangka, Kapolsek akan menjumpai korban disana. Namun setelah sekian lama ditunggu, Kapolsek tidak kunjung tiba. Nomor telepon yang

minta dikirimi uang juga sudah tidak aktif. Setelah korban mengkonfirmasi dengan IPDA Anwar, ternyata bukan nomor Kapolsek yang menghubunginya. Usai kroscek, korban baru sadar, telah menjadi korban penipuan. Pelaku berhasil menipu korban senilai Rp150 juta. Kapolda Kalbar Brigjen Pol Sukrawardi Dahlan mengatakan, kasus penipuan terungkap setelah ditelusuri secara mendalam. Namun dia tidak menjelaskan secara rinci mengenai kronologis pengungkapan. Tapi, lanjut dia, pengungkapan kasus itu terlacak dengan menggunakan teknologi. Sebab pelaku dalam modus operandinya dibantu kecanggihan teknologi. Selain mengamankan kedua pelaku, barang bukti ikut diamankan. Diduga barang tersebut digunakan dalam melancarkan setiap aksi kejahatan. Barang bukti itu terdiri atas satu unit mobil Avanza, uang tunai Rp23 juta,

sebuah laptop, 18 unit PC dan 17 monitor komputer, tiga buku telepon rekap nama pejabat dan nomor telepon, satu bundel kliping koran berita kasus penipuan, satu buah buku daftar nomor rekening, Sembilan buah HP dan dua buah ATM. Sementara kedua pelaku memilih aksi bungkam. Tidak bersedia menjawab pertanyaan para jurnalis. Ketika diminta merinci soal modus operandi komplotan mereka. “Aksi bungkam juga keduanya terapkan terhadap penyidik kepolisian. Pelaku masih bungkam, tapi kita akan terus kembangkan kasus ini (penipuan via telepon,red),” kata Kapolda.Karena itu, Kapolda mengimbau segenap pihak tidak menggubris permintaan uang mengatas namakan pejabat. “Kalau ada yang mencatut nama pejabat lalu minta uang, itu modus penipuan. Jadi masyarakat jangan menghiraukan apalagi sampai mengirim,” kata Kapolda. (stm)

rofon. Perubahan sistemnya terjadi sejak empat bulan lalu. Sebelumnya mikrofon tetap berfungsi walaupun ada yang menekan mikrofon lainnya. “Tetapi sekarang mikrofon akan mati jika ada yang menekan mikrofon lainnya,” kata

anggota komisi D ini. Dengan adanya keributan yang dipicu mikrofon, Mujiono meminta agar sistem mikrofon dikembalikan ke sebelumnya. “Empat bulan lalu juga ada marah karena persoalan mikrofon ini,” katanya. (uni)

“Jadi kita berupaya dengan adanya event akbar yang baru kali ini digelar di Pontianak, maka dapat membantu kita para dokter gigi untuk bekerjasama dengan asosiasi dokter gigi yang ada di negara tetangga, untuk bersama-sama mengembangkan profesi kelimuan dokter gigi,”paparnya. Dengan semakin meningkatnya kualitas dan kapasitas para dokter gigi yang ada lan-

jutnya, maka kedepan akan mampu memberikan pelayanan yang baik dan profesional bagi para masyarakat sehingga dapat terlayani dengan baik. Tidak hanya itu, dengan adanya event akbar tersebut, Harry juga berharap dapat semakin mengenalkan Kalbar kepada dunia luar yang secara tidak langsung juga mempromosikan berbagai potensi yang dimiliki Kalbar ke dunia luar. (ash)

Mikrofon Baru Diganti Sambungan dari halaman 17 menyampaikan persoalan kelengkapan administrasi perpindahan anggota fraksi. Ia meminta jika ada anggota fraksi ingin pindah, seharusnya ada surat rekomendari dari fraksi lama ke fraksi tujuan.

“Saya terus berbicara walaupun mikrofon tidak berfungsi. Ketika mikrofon mati, saya tekan lagi. Mati lagi, saya tekan lagi. Begitu terus sampai saya selesai berbicara,” ujarnya. Ia mengatakan seluruh meja anggota dewan terdapat mik-

Tingkatkan SDM Dokter Gigi Sambungan dari halaman 17 13 hingga 15 Januari 2011 mendatang, PDGI (Persatuan Dokter Gigi) cabang Pontianak bekerjasama dengan Pengurus Wilayah PDGI Kalbar akan menyelenggarakan kegiatan ilmiah. Namanya Borneo Internasional Dentistry yang akan diikuti oleh tiga Negara ASEAN sperti Sarawak, Brunei Darussalam, Indonesia dan Singapura.

“Jadi nanti dalam kegiatan itu kita menyelenggarakan dua even sekaligus baik event nasional dan event internasional,”jelasnya. Untuk event Nasional kata dia, akan digelar pertemuan dokter gigi keluarga se-Indonesia di Pontianak. Sedangkan untuk event internasionalnya akan diselenggarakan seminar ilmiah bagi para dokter gigi dan dibarengi dengan pameran kedokteran gigi

Pemerintahan Buram Sambungan dari halaman 17 kesulitan mendapatkan pelayanan kesehatan. Infrastruktur yang ada di sana kurang memadai, termasuk sarana pendidikan. Kondisi ini berbeda dengan warga Malaysia, mereka mendapat pelayanan kesehatan dan pendidikan gratis. Puskesmas Malaysia dilengkapi dengan fasilitas memadai. “Seharusnya ada

perhatian khusus, terutama peningkatan perekonomian di perbatasan,” katanya. Persoalan lainnya yang perlu dibenahi adalah rasa persatuan dan kesatuan bangsanya. Sejauh ini masih ditemukan konflik yang menimbulkan perkelahian antar dusun, desa, maupun perkampungan. Beruntung konflik antar masyarakat beragama relatif kurang. Din

mengatakan perlu ada upaya dari pemerintah untuk meningkatkan rasa persatuan dan kesatuan bangsa. Proses penegakan hukum yang ada juga amburadul. “Proses penegakan hukum ini bukan hanya masih lemah, tetapi juga amburadul,” katanya. Permasalahan pada bidang penegakan hukum ini bukan disebabkan pada masyarakat-

nya, tetapi aparat penegak hukumnya. Tekad penegakan hukum yang ada masih sebatas retorika. Proses yang berjalan seperti hanya membongkar gunung es, masih banyak masalah hukum yang lebih besar dan merugikan bangsa. “Sejauh ini kita masih mengabdikan politik untuk kekuasaan, bukan kesejahteraan rakyat,” ujarnya. (uni)

tata tertib sebetulnya tidak masalah. Tapi Alfian tidak berada di tempat, makanya harus menunggu kehadiran Alfian. Beberapa anggota DPRD berpikir itu mosi tidak percaya pada Hartono Azas. Tapi ternyata bukan. Mungkin juga ada permainan politik. Namun politikan harus beretika. Kericuhan tadi itu sebagai pembelajaran. ”Malu dengan rakyat. Masalah mikrofon itu kan hanya kesalahan teknis saja. Apakah ada yang sabotase kan, masih

belum jelas. Saya sangat menyayangkan kejadian tadi,” papar anggota dewan yang lain. Sidang dilanjutkan, namun berlangsung singkat. Hartono Azas menjelaskan sidang akan dilanjutkan dalam waktu yang tidak ditentukan. Ricuh yang terjadi didewan, awalnya para pencari berita boleh masuk akhirnya tidak diperkenankan dengan alasan yang tidak jelas. Sidang dilanjutkan secara tertutup dan hanya lima menit. (tin)

juga kawanan yang sama. Mereka beraksi menjalankan kejahatan dengan membongkar rumah. Dengan mengawali menghubungi nomor telepon rumah korban. Kepolisian terus memburu. Serta melacak keberadaannya. Sebab tindakan pelaku sangat meresahkan masyarakat. Karena itu, Kasat mengimbau, masyarakat terus meningkat-

kan kewaspadaan terhadap kejahatan. Sebagai langkah untuk mempersempit ruang bagi pelaku kejahatan. Menurut Kasat, pihaknya juga terus berupaya memberikan jaminan keamanan kepada masyarakat. Dengan memantau pemukiman yang ditinggal pemilik saat berlibur merayakan tahun baru. (stm)

Paripurna Dewan Ricuh Sambungan dari halaman 17 pindah ke Fraksi lain. ”Saya heran, tapi yah sudahlah. Memang mungkin secara halus saya dikeluarkan. Kepindahannya ke Fraksi Demokrat dari Fraksi Bintang Reformasi adalah inisiatif fraksi. Secara tidak langsung memang dari fraksi yang sekarang tidak merasa keberatan atas kepindahannya. Apalagi tugas nya dianggap tidak signifikan, sehingga ia tidak dapat tugas dan peran.

“Ricuh tadi itu berawal dari miss komunikasi. Ketua DPRD langsung menggelar sidang paripurna tanpa bertanya dulu dengan kami yang mau pindah fraksi, tidak ada kontak dari ketua DPRD,” terang Awaludin. Hery Mustamin mengatakan, Perubahan ketua fraksi dan pergantian fraksi tersebut semula ia ketahui dari temantemannya atas perpindahan tersebut. Selain itu mereka mempertanyakan kelengkapan administrasi. Menurut

Deteksi Korban Via Telepon Sambungan dari halaman 17 ingin meninggalkan rumah ikut diimbau berkoordiansi dengan tetangga. Terutama yang berangkat berlibur ke luar kota. Kasat menambahkan pelaku kejahatan dalam beraksi sepenuhnya memanfaatkan kesempatan. Misal rumah yang sedang ditinggal

penghuni. Celah tersebut mendominasi kasus pencurian. Dan terjadi tidak sebatas malam hari. Melainkan biasa di siang hari. Selama peluang terbuka bagi pelaku kejahatan. Kasat merincikan sedikitnya dua kasus pencurian dalam sepekan terakhir. Modus operandinya hampir mirip. Pihaknya mengendus pelaku

Infrastruktur dan Layanan Publik Harus Lebih Baik Sambungan dari halaman 17 “Kita berharap jalan di Pontianak tidak ada yang berlobang lagi lah seperti sekarang ini. Memang sudah banyak yang mulus, dan sedang dikerjakan, tapi masih banyak juga yang rusak dan berlobang-lobang. Ini membuat tidak nyaman,” kata Nani (52) seorang ibu rumah tangga, saat berbincang-bincang dengan Pontianak Post, kemarin. Warga Pontianak Barat ini berharap agar pemerintah cepat merealisasikan untuk perbaikan jalan. Jangan ditunda lagi. Kualitas pengerjaan juga mesti diperhatikan. Jangan asal-asalan memperbaiki atau mengerjakannya. “Kami ini butuh jalan yang bagus. Tiap hari kan kita ke pasar, naik sepeda motor. Kalau jalan rusak, bahaya juga untuk keselamatan,” katanya. Imran (40) yang mengaku tinggal di Pontianak Utara

berharap agar pelayanan pemerintah bisa lebih baik di 2011 nanti. “Saat ini memang sudah baik. Tapi, kadang masih banyak juga yang berbelit-belit. Kita sebagai orang kecil bingung kalau berurusan dengan pemerintah,” katanya ditemui di Kantor Terpadu Kota Pontianak saat menemani saudaranya mengurus dokumen kependudukan, kemarin pagi. Ia meminta kalau masyarakat kecil yang berurusan dengan pemerintah, janganlah dipersulit. “Harusnya kami ini dipermudah dan dibimbing, karena kami banyak yang tak ngerti,” ungkapnya lirih. Ada juga warga yang menilai, pembangunan saat ini lebih baik dari sebelumnya. Kondisi seperti ini, setidaknya mesti dipertahankan. Bila perlu ditingkatkan. “Sejauh ini sudah bagus, Pontianak tampak lebih maju. Tapi, jangan berpuas diri dulu. Teruskan pembangunan, terutama

berantas kemiskinan dan pengangguran,” kata Joni, di Pontianak, kemarin. Pemerintah Kota Pontianak terus berupaya memberikan pelayanan yang terbaik bagi masyarakat. Wali Kota Pontianak Sutarmidji mengaku, pada 2010 juga sudah banyak berbuat. “Yang jelas, pada 2010 saya katakan, sudah banyak sekali kita berbuat. Salah satu yang paling utama adalah meningkatkan pelayanan. Januari (2011), pelayanan akan semakin baik,” ungkapnya kemarin di Kantor Terpadu. Untuk Infrastruktur, Midji bilang terus melakukan perbaikan. Pada 2011 nanti, banyak jalan yang dilakukan maupun dilanjutkan perbaikannya. Misalnya di Jalan Kom Yos Sudarso, 28 Oktober, Tanjung Raya I dan II, Suwignyo, Ampera, H. Rais A Rahman. “Semua kita tangani secara simultan. Saya yakin semakin hari, jalan semakin baik infrastrukturnya

SHANDO/PONTIANAK POST

SELAMAT: Penolong Iwan seorang pemuda yang mencoba bunuh diri mengalami luka-luka. Pelaku Iwan, nekat terjun dari kubah tower Masjid Al Falah, kemarin (31/12) selamat.

2010 Industri Usaha berkembang PONTIANAK- Meski belum maksimal namun sepanjang tahun 2010 perkembangan dunia usaha di Kalimantan Barat tampak tumbuh baik, hal ini ditandai dengan mulai banyaknya pelaku dunia usaha khususnya UMKM (Usaha Mikro Kecil Menengah) dengan menjalankan berbagai usaha terutama usaha home industri. Demikian dikatakan Ketua HIPMI Kalbar, Iwan Gunawan. Meski begitu kata Iwan, hingga saat ini usaha yang ditekuni para pelaku usha tersbut masih terbentur pada kurangnya modal usaha dan masih minimnya pengetahuan para pelaku usaha tersebut dalam hal manajemen pemasaran

pemahamannya dalam menjalankan usahanya. “Untuk pelaku dunia usaha juga saya brpesan, jika mau maju mari kita bersama-sama membuat suatu kelompok untuk mensharingkan atau mendiskusikan masalah-masalah apa dalam dunia usaha yang masih menjadi kendala hingga saat ini,”jelasnya. Jadi lanjutnya, peran serta pemerintah memang penting dalam perkembangan dunia usaha, namun berkembang atau tidaknya suatu usaha pada dasarnya itu tergantung pada kesungguhan dan kerja keras pelaku usaha itu sendiri dalam menjalankan usaha yang ditekuninya. (ash)

Tingkatkan Kualitas Jurnalis dengan Kompetisi Writing PONTIANAK- Besarnya peran jurnalis untuk mengedukasi masyarakat melalui tulisannya diberbagai media massa, adalah suatu hal yang perlu didukung. Agar para insane juranalis semakin giat dan gencar mengedukasi masyarakat melalu berbagi karya tulisnya sebai salah satu perusahaan telekomunikasi beberapa waktu lalu Indosat kembali menggelar lomba karya tulis bagi para insane jurnalis dengan yang dikenal dengan KRO Journalist Writing Competititon 2010. Coordinator Marketing Com-

munication Indosat Cabang Pontianak, David Alexander menjelaskan KRO Writing Competition 2010 dipersembahkan bagi seluruh wartawan media baik lokal/daerah di Kalimantan dengan mengambil tema peran industri seluler dalam mendukung aspek kehidupan masyarakat Kalimantan. “Karena itu setelah melalui seleksi dari 28 karya yang masuk berdasarkan penilaian dari juri eksternal, maka didapatkan enam orang pemenang, dan saya senang karena dalam kompetisi kali ini meski hanya satu

orang jurnalis Kalbar yang ikut namun mampu meraih juara ke II pada ajang KRO Writing Communication 2010,”paparnya kemarin (30/12) saat melakukan konferensi pers pengumuman pemenang KRO Writing Communication 2010, di TapazIa berharap berhasilnya salah satu jurnalis Kalbar yang meraih juara ke dua dalam ajang tersebut, dapat membangkitkan semangat para insan media lainnya, untuk bersama-sama meningkatkan kualitas agar dapat selalu menyajikan perkembangan informasi terkini yang dibutuhkan. (ash)

Inflasi Nasional Rendah INFLASI nasional yang rendah dan stabil, diperlukan guna meningkatkan kesejahteraan masyarakat. Dengan menjaga kemampuan daya beli riilnya. Selain itu juga untuk menciptakan iklim yg kondusif bagi investasi, sehingga dalam jangka panjang dapat meningkatkan pertumbuhan ekonomi. Demikian dikatakan Pemimpin Bank

Indonesia Pontianak, Samasta Pradhana, belum lama ini. Menurutnya upaya untuk membawa inflasi nasional ke arah yang rendah dan stabil memerlukan peran yang lebih besar dari ekonomi daerah. “Jadi upaya meredam sumber-sumber tekanan inflasi daerah memang memerlukan langkah-langkah koordinasi lintas instansi di

daerah, seperti dari pemda, dinas terkait dan KBI (Kantor Bank Indonesia),”jelasnya. Selain itu kata dia, kegiatan pemantauan harga dan pengendalian inflasi di daerah juga perlu disertai dengan identifikasi sumber-sumber tekanan inflasi dan rekomendasi langkah-langkah konkrit yang dapat diimplementasikan dan dimonitor. (ash)

Sehari 23 Kasus Kejahatan Sambungan dari halaman 24 point satu jam bersama masyarakat, membuka layanan sms aduan serta program kemitraan. Sebagai bentuk upaya meningkatkan pelayanan pengayoman dan perlindungan kepada masyarakat.

Atas pemetaan banyak kasus yang terjadi sepanjang 2010, kepolisian menginventarisi bentuk kejahatan yang menjadi ancaman pada 2011. Perkiraan tersebut yakni kasus menyangkut kejahatan konvensional. Seperti kasus curanmor, narkoba, curas, cu-

rat, penganiayaan, pembunuhan maupun selundupan. Sementara menyangkut pelaksanaan Pilkada Bupati di Sambas dan Landak pada 2011, kepolisian tetap menerapkan pola pengamanan persuasif. “Kita harapkan 2011 Kalbar tetap aman dan kondusif,” kata Kapolda. (stm)

Saya Tanggung Dosanya Sambungan dari halaman 24

yang merupakan kebutuhan masyarakat Kota Pontianak,” ujarnya. Terkait pelayanan publik, 2011 nanti Midji memprioritaskan mengenai masalah perizinan, dan kemudahan bagi masyarakat. Midji juga meminta kepada masyarakat, yang banyak mengeluh ada pungutan liar saat mengurus dokumen kependudukan, harus berani menunjukkan siapa oknum pegawai yang melakukannya tersebut. Dia tidak mau, kalau berani ngomong di media, tetapi setelah diminta untuk menunjukkan siapa orangnya malah tidak mau menyebutkan. “Ini sulit kita. Alasannya karena masa depan yang bersangkutan. Tapi, ngomong di media seperti apa. Saya tidak mau sepeti itu. Harusnya tunjuk siapa orangnya, supaya kita bisa memberikan pembinaan kepada yang bersangkutan agar tidak melakukan hal seperti itu lagi,” tegas Midji. (**)

produk yang akan dipasrakan. “Mereka, (para pelaku usaha) itu pada dasarnya mampu membuat berbagai produk-produk yang baik dan layak untuk dipasarkan, namun karena masih minimnya pengetahuan untuk memasrakan produk akhirnya usaha yang meraka tekuni lamban majunya,”paparnya. Karena itu, lanjut Iwan, agar usaha yang dijalankan para pelaku usaha tersebut dapat berkembang pesat diperlukan adanya peran serta pemerintah untuk memberikan berbagai fasilitas yang dapat meningkatkan pemahaman para pelaku usaha khususnya UMKM sehingga mampu meningkatkan

Kalbar, Jumat (31/12) pagi. Perkataan Cornelis dengan nada kocak ini disambut gelak tawa hadirin yang mendengar

kata sambutannya dalam acara tersebut. Menurut Cornelis, sekarang ini bupati dan wali kota yang ada di Kalbar harus dapat memanfaatkan lahan yang sudah rusak tersebut.

Upaya yang bisa dilakukan diantaranya dengan menanami karet atau sawit pada lahan tersebut. “Daripada dibiarkan rusak lahan tersebut,” katanya. (uni)

Proses Hukum Penyelundupan Masih Lemah Sambungan dari halaman 24 semua berkas perkara yang diajukan polisi,” kata Suhadi kemarin terpisah. Pada dasarnya kata Suhadi, polisi siap untuk mengamankan dan melakukan penegakan hukum terkait kasus penyelundupan. “Tapi, dengan adanya surat edaran itu, buat apa juga polisi capek-capek melakukan penangkapan, tapi tidak bisa diproses. Namun, kita tetap siap melakukan penangkapan yang pada akhirnya diserahkan penyidikannya ke bea cukai,” ujarnya. Menurut Suhadi, tinggal sekarang ini bagaimana dengan bea cukainya saja. Jangan terkesan arogan, merasa tidak membutuhkan dukungan dari

pihak lainnya. “Bea cukai juga harus ada dukungan semua pihak,” tegasnya.Ia menambahkan, terkait masalah UU kepabeanan, sudah menyampaikan ke DPRD Provinsi, DPR RI, Kompolnas. Karena, sanksi yang diberikan cukup lemah. “Paling barang hanya dikembalikan. Enak sekali kalau seperti itu. Ini dikhawatirkan bisa berdampak luas kepada masyarakat. Misalnya ada barang yang ditangkap ternyata tidak baik untuk dikonsumsi, lalu dikembalikan lagi dan beredar di masyarakat,” katanya. Tapi, tegas dia polisi juga bisa menerapkan dengan Undang-undang perlindungan konsumen, jika ada hal demikian. Tentunya masyarakat

harus melaporkan ke polisi. “Kalau melapor, polisi akan menindaklanjutinya,” kata Suhadi. Terkait dengan adanya informasi soal banyaknya barang yang hilang di Pelabuhan, baik di kapal maupun container, kata Suhadi, akan menjadi atensi dari pihak kepolisian. “Kalau wilayah pelabuhan itu juga menyangkut UU Kepabeanan. Jadi ini perlu peran bersama bea cukai, selain kepolisian,” katanya. Kepolisian juga melakukan patroli rutin di wilayah perairan. Selain itu juga dari DKP mempunyai kapal, jadi tetap harus melakukan pemantauan. “Bea Cukai juga harus melakukan berperan,” tuntasnya. (ody)


metropolis

24

Pontianak Post

Sehari 23 Kasus Kejahatan

KEHUTANAN

Saya Tanggung Dosanya Gubernur Kalimantan Barat, Cornelis mengatakan hutan di Indonesia mengalami kerusakan sejak dulu, yakni ketika pemerintah memberikan izin hak pengelolaan hutan satu juta hektar. Hak Pengusahaan Hutan (HPH) adalah izin yang diberikan u nt u k m e l a ku k a n pembalakan mekanis diatas hutan alam yang dikeluarkan berdasarkan Peraturan pemerintah No 21 Tahun Cornelis 1970 tentang Hak Pengusahaan Hutan dan Hak Pemungutan Hasil Hutan. Ketika itu pemerintah memfokuskan kebijakannya untuk mengumpulkan devisa sebanyak-banyaknya dari ekstraksi hutan di luar jawa, melalui ekspor log (kayu bulat) dan hutan menjadi agen pembangunan selama tiga dasawarsa. Seiring berjalan waktu, hutan pun semakin habis. “Sekarang ini saya yang tanggung dosanya,” ujar Cornelis di hadapan Ketua Umum Pusat Muhammadiyah, Din Syamsudin, dan peserta musyawarah wilayah Muhammadiyah Ke Halaman 23 kolom 5

PENDIDIKAN

Himatika Gelar Kompetisi Untuk menjalankan salah satu program kerja pada periode 2010/2011, Himpunan Mahasiswa Matematika (Himatika) Fakultas Matematika dan Ilmu Pengetahuan Alam (Fmipa) akan menggelar Kompetisi Matematika (Komet) ke-7 bagi pelajar SMA (sederajat) se Kalimantan Barat pada 8 Januari 2011 di Auditorium Untan. Ketua Himatika Fmipa Untan, Yudha Pratama mengatakan tujuan kegiatan tersebut selain sebagai upaya menjalankan program kerjanya. Selain itu pihaknya juga berharap Komet dapat menjadi salah satu ajang untuk menambah wawasan serta pola pikir bagi para pelajar tentang ilmu Matematika sebagai ilmu dasar maupun ilmu terapan untuk mengembangkan ilmu-ilmu lainnya demi kemajuan pendidikan di daerah ini. (ash)

Sabtu 1 Januari 2011

Ekspose Akhir Tahun Polda Kalbar

MUJADI/PONTIANAK POST

EVALUASI DAN KADO: Press release evaluasi Kamtibmas akhir 2010 jajaran Polda Kalbar. Tingkat kejahatan kota Pontianak menempati rangking pertama.

Proses Hukum Penyelundupan Masih Lemah PONTIANAK – Koordinasi antar aparat dalam penanganan penegakan hukum kasus penyelundupan barang ilegal di Kalbar masih lemah. Kondisi ini dimanfaatkan oleh oknum-oknum tertentu untuk memperkaya dirinya. “Bea cukai, kepolisian dan kejaksaan berjalan sendiri-sendiri. Sehingga tidak ada satupun kasus-kasus penyelundupan selama ini di Kalbar diproses hukum dengan tuntas,” tegas Ketua Komisi A Dewan Perwakilan Rakyat Daerah Provinsi Kalbar kemarin (31/12) Dijelaskan Retno, sesuai dengan Undang-undang kepabeanan bahwa penanganan kasus-kasus penyelundupan atau kepabeanan merupakan kewenangan bea dan cukai. “Akan tetapi bukan berarti UU kepabeanan tersebut menghilangkan kewenangan aparat penegak hukum lainnya seperti kepolisian dan kejaksaan dalam penanganan kasus-kasus penyelun-

dupan tersebut. Tetap harus saling koordinasi dalam penanganannya,” jelas dia. Untuk itu, kata Retno, Bea Cukai Kalbar harus lebih meningkatkan pengawasan kinerja aparatnya di lapangan, jangan sampai ada yang menjadi beking penyelundup. Ketua Gabungan Forwarder dan Ekspedisi Indonesia Kalbar ini juga menyampaikan bahwa, pelayaran dan ekspedisi mengeluhkan sering terjadinya kehilangan barang-barang di pelabuhan. Baik di container maupun di kapal atau ponton di perairan Sungai Kapuas. Terutama, tambah Retno, pada saat kapal-kapal yang lagi berlabuh atau tambat di dermaga-dermaga Siantan atau Wajok. Untuk itulah diharapkan Retno, keamanan di perairan di Sungai Kapuas perlu semakin ditingkatkan. KP3L, Pol Air Polda Kalbar maupun KPLP harus lebih rutin melakukan patroli. “Karena dengan kurang amannya

perairan dan pelabuhan sangat berpengaruh pada performa pelabuhan Pontianak di mata para pengguna jasa dalam negeri maupun luar negeri. Karena pelabuhan Pontianak, pelabuhan internasional harus bisa memberikan keyakinan dan keamanan baik terhadap barang-barang maupun kapal-kapal yang masuk ke Pelabuhan Pontianak,” katanya. Untuk itu perlu segera dilakukan koordinasi pengamanan oleh pihakpihak terkait, seperti Adpel, Pelindo dan Polda Kalbar. “Jangan sampai kapal-kapal enggan mau masuk ke Pelabuhan Pontianak,” tuntas Retno. Kabid Humas Polda Kalbar AKBP Suhadi SW menegaskan, terkait dengan penanganan masalah kasus penyelundupan, ada surat dari Kejaksaan Agung kepada Kepala Kejaksaan Tinggi seluruh Indonesia. “Isi surat itu intinya kejaksaan harus menolak Ke Halaman 23 kolom 5

PONTIANAK—23 kasus angka kejahatan sedikitnya bergulir setiap hari sepanjang 2010. Mulai kejahatan konvensional, transnasional, menyangkut kekayaan negara dan kontinjensi. Hal tersebut terungkap dalam ekspose angka kriminalitas 2010 di Mapolda Kalbar, Jumat (31/12) petang. Sesuai data Polda Kalbar, sejak Januari hingga Desember 2010, angka kriminalitas sebanyak 8.470 kasus. Adapun kasus dominan yakni kejahatan konvensional. Menduduki rangking teratas dibanding kejahatan lain, mencapai 7.889 kasus. Sementara yang dirampungkan dari keseluruhan kasus yakni 4.153. Pemicu pelaku kejahatan beraksi akibat tidak memiliki pekerjaan tetap. Sehingga nekat menjalankan aksi tindak kejahatan karena untuk menutupi kebutuhan. Pelaku kejahatan yang pengangguran angkanya sangat mendominasi. Sebanyak 2.287 orang. Semua tersebar di seluruh wilayah hukum Polda Kalbar di 12 Polres yang ada. Sementara lokasi angka kejahatan paling menonjol berada di kota Pontianak. Menyusul kemudian Kota Singkawang dan paling minim di Kabupaten Sekadau. Antara data 2009 dan 2010 posisi tetap sama untuk rangking angka kejahatan. Kasus yang mengalami peningkatan yaitu masalah premanisme. Bila memandingkan data untuk dua tahun terkahir. Kapolda Kalbar Brigjen Pol Sukrawardi Dahlan didampingi Wakapolda Kombes Syafarudin dan Pejabat utama Polda serta Kapolresta dalam ekspose tersebut menyebutkan menekan angka kriminalitas polisi berupaya semaksimal mungkin. Dengan terus mengintensifkan patroli maupun operasi serta membangun kemitraan. Antara lain menggelar operasi Liong, Simpatik Kapuas, Panah Kapuas, Hutan Lestari, Peti Kapuas hingga HAKI. Serta mengunjungi pemuka dan tokoh masyarakat di Kalbar. Selain itu, kepolisian menggalakkan strong Ke Halaman 23 kolom 5


25

PRO-KALBAR Pontianak Post

Sabtu 1 Januari 2011

Catatan Akhir Tahun dari Ketapang

BUDIDAYA

Potensi Rumput Laut BUPATI mengajak pengusaha di Kabupaten Ketapang untuk memberdayakan berbagai potensi yang ada di Ketapang. Ia melihat potensi ekonomi yang dapat diarahkan untuk mensejahterakan masyarakat di daerah ini sangat besar.Karena itu, para pengusaha yang tergabung dalam Kadin tidak hanya identitik dengan kontraktor. “Mari kita berpikir entrepreneur,” kata Henrikus Drs Henrikus M.Si. Dalam mengembangkan ekonomi masyarakat itu, misalnya daerah ini banyak ditanam karet. Ia melihat saat ini banyak masyarakat maupun pengusaha yang melirik perkebunan karet. Harga karet juga terus membaik dari tahun ke tahun. Ia memprediksi, dalam masa 4-5 tahun kedepan, karet yang ditanam itu sudah bisa ditoreh.

Ditutup BBM Langka dan Sembako Naik Selamat datang 2011. Euforia penyambutan tahun baru sudah terlihat lepas Natal kemarin Warga bersiap melepas tahun 2010. Sayang, keindahan pergantian tahun di Ketapang, tercoreng dengan langkanya BBM jenis premium serta naiknya harga sembako. FAHROZI- Ketapang

FAHROZI/PONTIANAKPOST

ANTRE: Antrean di SPBU Ketapang masih terjadi kemarin.

PEDAGANG terompet musiman sudah menghiasi sudut kota Ketapang. Suasana perayaan pun terlihat di wajah muda-mudi kota ini. Tidak ayal, berbagai acara pun telah di persiapkan guna melepas tahun 2010 dan menyambut 2011. Selain pedagang terompet, pedagang musiman lainnya penjual jagung muda. Seperti tahun-tahun sebelumnya. Di daerah Kalinilam, berjajar pedagang yang menjajakan jenis tanaman ini. Banyak memang keuntungan yang bisa didapatkan. Tentu, jika jeli melihat peluang. Selama itu tidak melanggar, rejeki pasti didapatkan jika pintar Ke Halaman 31 kolom 5

KEMBANG API: Para pedagang kembang api di Pasar Ngabang menanti pembeli. Menjelang tahun baru, permintaan kembang api tinggi dan dijual dengan harga bervariasi.

Ke Halaman 31 kolom 1

HUTAN KOTA

SUGENG/PONTIANAKPOST

Tusuk Perut, Usus Dikantongi ZUL/PONTIANAKPOST

TREMBESI: Penanaman pohon trembesi di pinggir jalan pantai pasir Panjang.

Mulai Ditanami PEMKOT Singkawang mulai melakukan penanaman kawasan hutan kota yang dipusatkan di dua tempat yakni di Pasir Panjang dan Gunung Sari. Namun, program ini bisa berantakan, bila pemerintah tak melakukan upaya penertiban pengambilan pasir di kawasan yang ditanam dengan berbagai jenis pohon tersebut. Menurut Kasie Kehutanan Dinas Pertanian dan Kehutanan Kota Singkawang, Nurdiansyah kepada Pontianak Post, sesuai dengan Surat Keputusan Wali Kota Singkawang nomor 124 tahun 2008, disebutkan ada dua lokasi dijadikan hutan kota. Kedua tempat itu adalah di Ke Halaman 31 kolom 5

EROSI

Jembatan Jalan Nasional Anjlok JEMBATAN yang terletak di Parit Bakau Sui Keran Kabupaten Bengkayang anjlok. Anjloknya jembatan yang terletak di jalan nasional tersebut lantaran erosi oleh air pasang yang selama ini menerjang. Menurut Kepala Desa Sui Keran, Suratman kepada Pontianak Post, beberapa waktu lalu jembatan tersebut diperbaiki oleh Pemerintah Provinsi Kalbar. Namun, sebelah kiri dan kanan jembatan tersebut, terkikis oleh air pasang yang sangat kuat. ‘’Akibatnya, pastilah jembatan ini mengalami kerusakan. Terturun sudah beberapa sentimeter,’’ kata dia. Pemerintah provinsi, diharapkan Suratman, bisa mengecek kebenarannya dan segera memperbaiki. ‘’Jangan sampai jembatan ini memakan korban dan rusak parah. Sebab, lalu lintas sangatlah padat,’’ kata Suratman. (zrf)

Pria Stres Tewas SINGKAWANG-Mengakhiri tahun 2010, Ahin (33) yang tinggal di Gang Parit Ketapang, Singkawang Barat, juga mengakhiri hidupnya. Ahin ditemukan tewas di sebuah gubuk kecil ukuran kurang lebih 2x3 meter persegi dengan tragis, Jumat (31/12) pukul 14.30 WIB. Pisau yang biasanya memotong sayur dan lainnya itu digunakannya untuk membeset perut. Akibatnya, pria stres tersebut menghembuskan napasnya yang terakhir. Mayat korban

lantas dibawa oleh mobil yayasan dan dikawal oleh kepolisian untuk dilakukan visum di Rumah Sakit Abdul Aziz Singkawang. Menurut keterangan yang diperoleh Pontianak Post di lapangan, pria tersebut sudah ditinggal pergi oleh anak dan istrinya sejak lama. “Istrinya kemungkinan ke Malaysia bekerja disana,” kata salah satu warga. Begitu juga dengan saudara termasuk orang tuanya. Semuanya hijrah ke ibu kota. Ahin saja yang ditinggal di Kota Singkawang. “Dia sebatang kara. Memang

gubuk itu dibikinkan oleh keluarganya. Keseharian korban, dia mencari makan sendiri, biasanya juga dia jadi nelayan,” kata warga memberikan informasi. Tak yang tahu bagaimana Ahin tersebut mengakhiri hidupnya tersebut. Namun, di gubuk tempat dia tinggal ditemukan oleh anggota polisi sejumlah barang bukti, seperti pisau dan usus yang berada di kantong plastik. Luka di perutnya ini kurang lebih 80 centimeter. “Kemungkinan sebelum Ke Halaman 31 kolom 5

Kadin Beda dengan Kontraktor Gairahkan Iklim Usaha KETAPANG – Kamar dagang dan Industri (Kadin) merupakan mitra pemerintah. Maka, Bupati Ketapang, Drs Henrikus M.Si berharap kepengurusan Kadin ketapang membuat program kerja yang dapat menggairahkan iklim usaha di daerah ini. Dengan begitu,terobosan yang dilakukan Kadin maka dapat menunjang tujuan pemerintah dalam mewujudkan masyarakat yang sejahtera (walfare state). Pengurus Kadin Ketapang periode 2010-2015 yang dilan-

tik Kadin Kalbar dengan ketua Rasmidi SE MM, dan ketua penasehat Marwan Majid. “Saya berharap, jangan sampai Kadin identik dengan kontraktor,” kata Bupati Ketapang, Drs Henrikus M.Si seraya langsung mendapat tepuk tangan seluruh undangan yang hadir dalam pelantikan pengurus Kadin Ketapang di Hotel Aston. Ia menegaskan dalam kepengurusan Kadin jangan sampai terkesan hanya sebatas untuk memfasilitasi hal-hal yang bersifat proyek. Dalam hal pengadaan barang dan jasa, kata Henrikus, pemerintah tetap berdasarkan pada per Ke Halaman 31 kolom 5

Warga Lega BBM Datang Eceran Rp7 Ribu/ Liter

ANDI/PONTIANAKPOST

PLAKAT: Bupati Ketapang menerima plakat dari ketua Kadin Kalbar, Santyoso Tio.

KETAPANG-Kabar baik buat warga Ketapang. Suplai BBM sudah datang kemarin. Bahkan, Jumat (31/12) siang sedang dilaksanakan bongkar muat di Jober Depot Pertamina Ketapang. Hal ini dikemukakan Pengawas Stasiun Pengisian BBM di Jalan DI Panjaitan, Budi Utomo.“Mudahmudahan sore harinya (kemarin-red), bensin sudah bisa di distribusikan ke SPBU yang ada di Ketapang,” dikatakan Budi, saat di temui wartawan di SPBU DI Panjaitan Berdasarkan , pantauan korang ini kemarin, antrean memang masih panjang dan terlihat di beberapa SPBU di Ketapang. Namun, sedikit yang melegakan, ternyata bensin pun sudah ada di pedagang eceran pinggir jalan. Meski harga di eceran masih tinggi, Rp6 ribu per liter. “Ya, sekarang di eceran memang sudah banyak ada. Tetapi harganya bervariasi. Ada yang enam Ke Halaman 31 kolom 5

Meraup Rejezi Menjelang Tutup Tahun

Rela Begadang Asalkan Terompet Laku TAHUN baru tak lengkap rasanya jika tidak ada terompet. Alat ini menjadi barang wajib di old and new. Tak ayal, para penjual trompet di Singkawang pun ketiban rezeki. Puluhan trompet berbagai bentuk laris terjual. Meski demi acara tutup tahun itu mereka rela menginap di pasar alias begadang semalaman menunggu pembeli. Hari Kurniathama, Singkawang MUJADI/PONTIANAKPOST

NAIK: Bergesernya tahun diwarnai dengan naiknya harga sembako di Ketapang. Bahkan, garam pun ikut naik-naik.

GELIAT aktivitas pasar mulai marak pagi Jumat (31/12) di Jalan Budi Utomo.. Kendaraan berlalu lintas pun tampak ramai. Satu per satu

HARI/PONTIANAKPOST

TEROMPET: Sederet lapak penjual terompet tahun baru di Singkawang.

penjual trompet mulai menyiapkan barang dagangannya. Satu persatu terompet disusun dalam sebuah gantungan. Pesona pernak-pernik dan warna trompet mengundang keinginan untuk membelinya. Ditambah lagi bentukanyua khas ada trompet naga, keong, corong hingga topi. Harga tiap bentuk trompet pun bervariasi. Untuk naga mulai Rp 25-30 ribu, keong Rp 20-25ribu, corong Rp 17-20ribu. Sedangka bentuk topi Rp 10ribu. Setiap pedagang memiliki seluruh stok trompet hingga ratusan buah. Hanya satu permintaa pedagang trompet ini tidak hujan, itulah harapan Adi (35) warga Kelurahan Condong yang sejak tahun 2000 berdagang trompet di Singkawang. Kepada Tuhan Yang Maha Esa, ia meminta agar tidak turun hujan. “Kalau turun hujan pembeli sepi, barang dagangan pun banyak rusak, dan kita pun merugi,” katanya. Apabila cuaca bagus, boleh dikata dagangan Ke Halaman 31 kolom 1


PINYUH - NGABANG

26 naik pangkat

Kado Akhir Tahun SEBANYAK 75 orang anggota di Polres Landak, Jumat (31/12) mendapatkan kenaikan pangkat terdiri dari 2 orang dari AKP ke Kompol, 3 orang Ipda ke Iptu, 1 orang Aipda ke Aiptu, 3 orang Bripka ke Aipda, 1 orang Brigadir ke Bripka, 35 orang dari Briptu ke Brigadir dan 30 orang dari Bripda ke Briptu. Kapolres Landak, AKBP Firman Nainggolan kepada Pontianak Post mengungkapkan bahwa kenaikan pangkat ini tentunya diperoleh melalui proses yang cukup panjang mulai dari pertimbangan-pertimbangan tertentu dari dewan kebijakan karir dan atasan langsung, penilaian atas prestasi, dedikasi, loyalitas dalam arti luas dan pelaksanaan tugas serta memenuhi syarat administrasi untuk diusulkan kenaikan pangkatnya. Menurutnya, tidak semua anggota yang diusulkan kenaikan pangkatnya atau yang telah memenuhipersyaratanuntukdiusulkankenaikan pangkatnyalangsungotomatisnaikpangkat.Akan tetapi melalui penilaian-penilaian yang didasari pada perilaku dan kinerja yang bersangkutan selama diberikan tugas dan tanggungjawab yang dibebankan kepadanya. Dari data yang ada, anggota yang diseleksi sebanyak 85 orang, namun yang memenuhi persyaratan adalah sebanyak 75 orang dan bagi anggota yang tidak lulus seleksi sebanyak 10 orang diantaranya karena pelanggaran disiplin maupun kode etik polri yang saat ini masih dalam pengawasan. Kenaikan pangkat bukan mutlak merupakan hak bagi anggota, tetapi merupakan penghargaan yang diberikan pimpinan kepada anggota karena prestasinya didalam pelaksanaan tugas dan dibebankan kepadanya. (sgg)

(foto sugeng/pontianak post)

PASANG. Kapolres Landak, AKBP Firman Nainggolan saat memasangkan pangkat baru dalam acara corp raport kenaikan pangkat, kemarin.

tahun baru

Pemda Gelar Hiburan KEMBALI Pemerintah Kabupaten Pontianak mengelar hiburan malam pergantian tahun 2011. Kali ini dipusatkan di Depan Kantor Bupati Pontianak. Panitia juga sudah mempersipkan hiburan gratis serta doorprize. Yang pasti, malam pergantian tahun kedua bagi pasanganBupatiRiaNorsandanRubijanto,kondisi kamtibmas sangat kondusif.“Kalau hiburan iktu diadakan dihalaman Kantor Bupati, selain daya tampungnya cukup luas dan meamdai. Penonton diharapkan berada dilingkungandalam sehingga tidak menghambat arus lalu lintas,” sebut panitia. Semua itu juga dalam rangka mendukung tugas aparat dalam pengamanan natal dan malam pergantian tahun 2011. “Bupatyi, wakil Bupati, ketua DPRD, KPN, KPA sertaMuspidaakanberadadiataspentasmenjelang detik-detik pergantian tahun 2011,” jelas Ismayuda kasubbag Protokoler. Dipredeksi, akan ada pesta kembang api begitu serine pertanda malam pergantian tahun 2011 terjadi, akan ada penyulutan kembang api untuk dinyalakan. “KalaudihalamankantorBupatiarealnyacukup luasdantidakakanterjadihal-halyangbisamerugikan penonton,” sebut panitia lainnya. (ham)

Pontianak Post

Sabtu 1 Januari 2011

Tertibkan Pembelian Premium Batasi Pakai Jeriken

hamdan /pontianakpost

KELILING: Pengeliling Indonesia menggunakan sekuter, Hendra Jaya diterima Ketua DPRD Kabupaten Pontianak H Rahmad Satria.

Hendra Jaya Diterima Ketua DPRD Penjelajah 31 Provinsi MEMPAWAH- Secara harfiah memang tidak ada keuntungan dari sisi finansial apa yang dilakukan Hendra Jaya A.Md sebagai pengeliling Indonesia. Dia musti berhari-hari, berbulan-bulan hingga mencapai empat tahun untuk bisa menempuh perjalanan dengan menggunakan skuter bututnya mendatangi 31 provinsi se Indonesia. Sedikitnya sudah 68 buah pengantian ban berikut 106 buah busi. Pria kelahiran Bengkulu, 37 tahun yang tergabung dalam PO VII Generasi Muda FKPPI Provinsi Bengkulu itu mengaku, masih lajang.

“Memang tidak ada keuntungan secara materi, apa yang saya perbuat selama ini. Tapi tidak semua orang punya wakltu dan kesempatan untuk mampu mengelilingi Indonesia dari Sabang sampai Merauke mengunakan kendaraan sekuter,” akunya seusai diterima Ketua DPRD Kabupaten Pontianak dierumah dinasnya, kemarin. Dia mengaku, sisi keuntungan yang didapatkan beragam pengalaman, beragam tempat sudah didatangi, 31 provinsi sudah dijelajahi, beragam kebudayaan sudah disaksikan dan beragam cinderamata yang didapat dari pemberian. “Saya hanya ingin memecahkan rekor mendapatkan tandatangan pejabat se Indonesia untuk masuk dalam Musium Rekord Indonesia

(MURI),” terangnya. Berbagai pengalaman, diakui Hendara Jaya yang memulai star di Provinsi paling Timur yakni Nanggro Aceh Darussalam 18 Juni 2006 sebagai titik nol wilayah daratan Indonesia dan sudah mencapai titik kembar di Provinsi Irian Jaya yakni di Marouke. Hendra punya pengalaman pahit saat memasuki wilayah Wamena, ditengah perjalanan sempat ditahan oleh Organisasi Papua Merdeka (OPM) yang berusaha untuk merobek merah putih yang tertempel didada kirinya. “Saya dipukul mereka, karena mau menanggalkan lambang merah putih,” akunya menghabiskan malam tahun barunya di Kota Singkawang Provinsi Kalimantan Barat. (ham)

itu kan tidak diiperbolehkan. Jangan mencari keuntungan diatas penderitaan orang lain,” M E M PA W A H - U l a h sebut dewan dapil Jungkat masyarakat yang memanfatkan Segedong itu. momentum kelangkaan BBM Kapolda Kalbar musti mensudah mulai meresahkan pemi- ginstruksikan jajaran yang ada lik kendaraan. Pasalnya, ulah dibawahnya untuk tindak temereka yang untuk mencari gas mereka yang nyata-nyata keuntungan sepihak itu sudha membeli pakai jerigen dan tidak boleh ditolerir lagi. distok dalam drum untuk dijual “Sudah dari solar, mereka kembali. membeli untuk dijual eceran “Jangan dilayani pem,belian hingga truk, bus bensin di SPBU yang BBM solar pakai jerigen. seringkali tidak Kecuali warga kebagian,” tanuntuk kebutudas Abdul Fattah, han ginset,” pinta Kalau suplai dari anggota DPRD Abdul Fattah Kabupaten Pon- pertamina memadai, yang sudah risih tianak menoroti. SPPBU tak bakalan ko- melihat pemanBelakangan ini song. Kios dadakan tak dangan seperti BBM jenis preitu dan terjadi mium (bensin) bisa bertahan. Jangan diempat SPBU yang juga disero- biarkan SPBU kosong, mulai Purun, bot pembeli men- pasti kondisi berjala Pinyuh, Kuala gunakan jerigen. dan Anjongan. normal. Ironisnya, Pihak Depot pembelian itu jusPertamina PonAbdul Fatah tru dilokasi SPBU tianak juga janyang semestinya gan diam saja peruntukannya bagi kendaraan melihat kondisi yang terjadi roda dua. Roda empat dan enam belakangan ini. baik itu untuk pertamax plus, Apakah meang karena stok bensin maupun solar. menipis atau ada oknum yang Polda Kalbar melalui jaringan sengaja mengalihkan DO setiap yang ada dibawahnya musti SPBU sehingga acapkali terjadi mengambil tindakan tegas atas kelangkaan. situasi seperti itu. “Kalau suplai dari per“Kalau warga membeli bawa tamina memadai, SPPBU tak jerigen 5 liter untuk kebutuhan bakalan kosong. Kios dadaginset lantaran listrik sering kan tak bisa bertahan. Jangan hidup-mati hal yang wajar. biarkan SPBU kosong, pasti Tapi jika pembeli utnuk jual kondisi berjala ormal,” nilai dikios-kios setelah SPBU kosong Abdul Fatah pula. (ham)

Heri Saman: Tahun 2011 Berharap Lebih Baik NGABANG – Banyak harapan yang diinginkan masyarakat pada tahun 2011. Termasuklah Ketua DPRD Landak Heri Saman. Ia berharap tahun 2011 lebih baik dari pada tahun 2010 yang sebentar lagi beberapa jam ke depan akan datang tahun yang baru. ”Kita berahap tahun 2011 lebih baik, baik masalah Pemerintah maupun kerja DPRD Landak,” kata Heri Saman kepada sejumlah wartawan, Jumat (31/12/11), pagi di ruang kerjanya. Ia mengatakan, sejumlah agenda besar sudah disusun untuk kerja selama 1 tahun punuh pada tahun 2011. seperti agenda masa sidang pertama pada bulan Januari 2011. Yakni 6 Januari membahas usulan 3 Raperda, eksekutif. Termasuk juga Raperda dari Badan Legeslasi yaitu Raprda

prakasrsa DPRD Kabupaten Landak. ”Kemungkinan bukan hanya 3 Raperda yang kita bahas bisa saja ada 5 Raperda. Gabungan dari 3 Raperda dari Eksekuitf dan 3 Raperda dari Badan Legeslasi,” aku anggota Legeslatif dari Dapil Landak 4 ini. Menyinggung tahun 2010 Heri Saman, tidak menapik bahwa tahun 2010 banyak hal yang perlu disikapi. Terutama masalah target Pendapatan Asli Daerah (PAD) Kabupaten Landak tidak sesusi terget. ”Pemerintah Kabupaten Landak dan DPRD kabupaten Landak tetap memberikan yang terbaik untuk seluruh masyarakat Kabupaten Landak. Apalagi ditahun 2010, Pemerintah Kabupaten Landak padat dengan agenda besar. Per-

tama sebagai tuan rumah MTQ se Kalbar dan kedua kita juga sukses menggelar sebagai tuan rumah Jambore Pemuda Indoensia (JPI),” katanya. Kegiatan MTQ ini, kata Heri Saman, boleh dikata sangat berhasil, kendati Kabupaten Landak baru saja lahir dari pemekaran Kabupaten Pontianak, dan masyarakatnya dominan agama Katolik, tapi MTQ tingkat Kalbar bisa berjalan dengan baik. ”Disinilah kita melihat bahwa masyarakat Landak sudah memahami kehidupan berbangsa dan bernegara yang baik. Khsusnya pemahaman kebersamaan keanekaragaman beragama tetap mengedepakan rasa persaudaraan,” jelasnya. Disektor pembangunan, lanjut Heri,

memang dari segi pendanaan sangat sangat terbatas. Pemerintah Kabupaten Landak dan DPRD Kabupaten Landak akan berusaha memberikan yang terbaik untuk masyarakat, kendati dari segi keuangan kita sangat terbatas. ”Selama ini kita masih mengharapkan DAK dan DAU, sedangkan pemanfaatkan PAD Kabupaten Landak kita masih belum bisa berbuat banyak,” katanya seraya mengatakan makanya kita sampai saat ini masih mengharapkan dana dari pusat. Harapan terakhir katanya, bersamasama kita dari segi profepesi apapun di tahun 2011 untuk bisa meningkatkan kinerja masing-masing, dan sesuai dengan tugas fungsi kita masing-masing, maupun sesuai peran dalam menjalan pemerintahan di Kabupaten Landak. (wan)


Pontianak Post

Sabtu 1 Januari 2011

sarana

Lampu Tak Berfungsi MASYARAKAT Pemangkat mengeluhkan tidak maksimalnya fungsi penerangan jalan di kota Pemangkat. Sebut saja di Jalan Abdul Kadir Kasim, Jalan Sejahtera, Jalan Gedung Nasional, Jalan Anom, Jalan Pembangunan dan sebagian pasar. Hampir semua lampu tidak menyala. Bahkan di jalan Abdul kadir Kasim sudah hampir dua bulan tidak menyala. Menurut warga Abdul kadir Kasim Desa Harapan, Sukri, kurang tahu siapa yang bertanggung jawab atas tidak berfungsinya lampu tersebut. Namun dirinya jengkel atas tidak adanya solusi atas matinya lampu penerangan jalan tersebut. Padahal lampu penerangan jalan ini sangat bermanfaat bagi pengendara yang melintas di malam hari. “Lihat sendirilah malam seperti ini gelap padahal sudah ditengah kota,” ungkapnya kepada Pontianak Post Kamis (30/12) kemarin malam. Ia meminta kepada pemerintah daerah agar dapat menindaklanjuti masalah ini secara serius. Dikarenakan hampir dua bulan lampu penerangan tidak berfungsi. “Dulunya hanya dua hingga empat lampu yang mati, tapi sekarang semuanya mati, ada apa ini,” jelasnya. Selaku warga, kata dia, dirinya tidak menginginkan adanya kecelakaan atau hal lainya terjadi akibat minimnya lampu penerangan jalan tersebut. Hal senada diungkapkan Yan Wahyudi warga Jalan Anom. Hampir semua lampu penerangan jalan juga mati. “Kita minta pemda Sambas segera menindaklanjuti masalah ini, jangan sampai ada oknum tertentu meraup untung sementara masyarakat dibiarkan gelap gulita,” jelasnya. Bagaimanapun, lanjut dia, manfaat penerangan jalan bagi masyarakat, selain meminimalisir kecelakaan lalu lintas, juga mengantisipasi terjadinya tindak asusila di lorong jalan yang gelap. Hal ini, kata dia, bukan sekedar ungkapan omong kosong belaka, ini sebuah kenyataan, seperti di Jalan Pangsuma. Makanya diharapkan dalam waktu dekat lampu penerangan jalan difungsikan. (har)

SINGKAWANG

Kejahatan Turun, Laka Lantas Naik Waspadai Aksi Pencurian SINGKAWANG—Polres Singkawang menggelar evaluasi gangguan (Anev) kriminalitas, kecelakaan lalu lintas dan pengamanan tahun baru 2011 di aula Mapolres Singkawang Kamis (230/12) kemarin. Dalam rapat yang dipimpin Kapolres Singkawang AKBP Tony EP Sinambela tersebut tampak angka kriminalitas dan pelanggaran lalu lintas di Singkawang menurun, sedangkan peningkatan jutru terjadi pada kecelakaan lalu lintas. “Secara umum bisa dilihat gangguan kriminalitas di Singkawang bisa ditekan, hal ini menunjukkan tingkat kesadaran hokum masyarakat Singkawang baik,” ungkapnya kepada Pontianak Post. Dilihat dari data pemaparan Kapolres Singkawang. Terlihat angka kejahatan mulai dari kejahatan konvensional, kejahatan tran nasional, kejahatan terhadap kekayaan Negara, serta kontijensi mengalami penurunan dari tahun lalu. “Tahun lalu gangguang kriminalitas yang ditangani Polres Singkawang 1.213 kasus, tahun ini hingga 27 Desember 2010 hanya 973 kasus, jadi trennya menurun,” jelasnya. Sementara dari kasus kejahatan yang ada di tahun 2010 persentase penyelesaian kasusnya mencapai 50,77 persen. “Sisanya inilah pekerjaan rumah yang harus diselesaikan ke

depannya, saya mintakan bagian reskrim untuk bekerja lebih keras lagi,” pintanya. Meskipun kejahatan menurun, Kapolresmemintamasyarakatmewaspadai kejahatan konvensional yang menonjol, seperti pencurian, baik pencurian biasa (curbis), pencurian dengan kekerasan (Curas), pencurian dengan pemberatan (Curat), serta pencurian kendaraan bermotor (Curanmor) lihat tabel. “Karena kasus pencurian ini boleh dibilang paling sering mengganggu masyarakat,” ungkapnya. Target sasarannya pelaku, kata dia, membobol rumah warga yang ditinggal atau lengah, dan mengambil uang, HP, dan Laptop atau notebook. “Jadi masyarakat harus waspada dengan aksi pencurian ini,” pintanya. Kalau kejahatan menurun, lain halnya dengan kecelakaan lalu lintas (laka Lantas). Dimana ditahun sebelumnya jumlah Laka Lantas terdata 38 kasus, namun ditahun 2010 meningkat menjadi 235 kasus. Hanya saja diantara kasus Laka Lantas, korban yang meninggal hanya 45 orang, sedangkan luka berat 79 orang dan luka ringan 268 orang. Hal ini sangat kontras apabila dilihat jumlah pelanggaran lalu lintas. Dimana tahun ini menurun dibandingkan tahun sebelumnya. Dimana jumlah pelanggaran lalu lintas ditahun 2009, 6.553 kasus, sedangkan tahun ini hanya 5.118 kasus. “Berarti kalau kita lihat data yang masuk ini masyarakat Singkawang kesadaran berlalu lintasnya cukup baik, dan pe-

ZUL/PONTIANAKPOST

EVALUASI: Kapolres Singkawang AKBP Tony EP Sinambela saat memaparkan evaluasi gangguan kejahatan dan lakalantas kemarin.

nyelesaian kasus pelanggaran ini semuanya tuntas,” terangnya. Didampingi Wakapolres dan seluruh Kabag, Kasat dan seluruh Kapolsek yang ada di Singkawang. Kapolres Singkawang meminta masyarakat untuk ikut serta mentaati aturan lalu lintas. Banyaknya kasus laka lantas ini lebih disebabkan faktor manusia, karena lalai dalam berkendara. “Misalkan supir tahu bahwa rem mobilnya blong namun masih dioperasikan atau tidak layak jalan, ini contohnya,” kata Kasat Lantas AKP Reza Simanjuntak. Makanya selain mentaati rambu lalu lintas, masyarakat selaku pengendara diharapkan melengkapi seluruh perlengkapan keamanan kendaraan, mulai lampu sen, kaca spion serta pastikan kendaraan layak jalan. (har)

PT Askes Serahkan Bibit Mangrove Peduli Lingkungan SUI RAYA-PT Askes Cabang Singkawang tahun 2010 melalui program kemitraan bina lingkungan menyerahkan bibit mangrove kepada Bupati Bengkayang, Suryatman Gidot SPd. Penyerahan langsung dilakukan oleh Kepala Cabang PT Askes Singkawang, Oktovianus Rimba dan disaksikan oleh Kepala Kabupaten PT Akses Kabupaten Bengkayang, Eko Juni Setianto dan Camat Sui Raya, A hmadi. Bibit yang diserahkan sebanyak sepuluh ribu batang dan masyarakat langsung melakukan penanaman. Penyerahan bibit mangrove tersebut dilaksanakan, 20 Desember 2010 lalu yang dipusatkan di Sanggau Ledo. Bibit yang sudah diserahkan tersebut kemudian ditanam tiga hari berikutnya, tangal 23 Desember 2010. Kepala Cabang PT Askes Singkawang, Oktovianus Ramba menjelaskan, dipilihnya program penanaman bibit mangrove tersebut, karena melihat ke-

27

nyataannya disepanjang bibir pantai Sui Raya sudah abrasi, walaupun oleh pemerintah dibangun balok-balok mengatasinya. “Dengan adanya mangrove tersebut tentu mampu menyelamatkan bibir pantai dan tentu memberikan dampak positif bagi berkembangbiaknya binatang laut,” kata Okto. PT Akses, kata Okto, terus akan melakukan kiprahnya dimasyarakatdenganmelaluiprogramprogram yang langsung menyentuh kepada masyarakat. “Kita akan terus berusaha membuat program yang bersentuhan dengan masyarakat,” kata Okto. Saat ini, sejumlah bibit mangrove tersebut sudah ditanam oleh masyarakat. Bupati Bengkayang, Suryadman Gidot sangat berterima kasih kepada PT Akses Cabang Singkawang yang ikut peduli dengan lingkungan. “Kita semua harus peduli dengan ZUL/PONTIANAKPOST lingkungan. Kerusakan lingkungan tentu akan memberikan dampak buruk TANGKAL EROSI: Seorang pria sedang menaman bibit bagi kelangsungan kehidupan anak mangrove di pantai Sui Raya untuk mencegah erosi yang cucu kita nanti,” kata Gidot. (zrf/ser) terus mengancam.

Kejahatan dan Laka Lantas

Jenis Kejahatan Curat Curas Curanmor

Daerah Rawan Kriminalitas Jl Alianyang, Jl A.Yani, Jl P. Diponegoro Jl. Pasar Turi, Jl Padang Pasir Jl. Alianyang, Jl Bambang Ismoyo, Jl Yos Sudarso,Jl Hermansyah,

Daerah Rawan Pelanggaran Lalu Lintas:

Jl Bambang Ismoyo, Jl Yos Sudarso, Jl Kalimantan, Jl. Raya Bengkayang-Singkawang, Jl Jenderal Sudirman

Daerah Rawan Laka Lantas: Jl. Ratu Sepudak Singkawang Utara, Jl Alianyang Singkawang Barat, Jl. Pasir Panjang Singkawang Selatan, Jl Raya Singkawang-Bengkayang Sumber: Polres Singkawang 2010

Tujuh Perwira Naik Pangkat SINGKAWANG-Tujuh perwira dilingkungan Polres Singkawang naik pangkat. Kenaikan pangkat dari inspektur dua menjadi inspektur satu, inspektur satu menjadi ajun komisaris dan ajun komisaris menjadi komisaris. Sedangkan, ada 60 bintara yang juga ikut menikmati kenaikan pangkat per 1 Januari 2011 ini. Kenaikan pangkat itu diantaranya, Inspektur Dua (IPDA) Saleh menjadi inspektur satu (IPTU). Saleh sendiri bertugas di lingkungan satuan Reskrim Polres Singkawang. IPDA Taufan yang bertugas di satuan lalu lintas juga naik pangkat menjadi IPTU (inspektur satu) atau dua balok di pundak. Begitu juga dengan IPDA Dharma Siregar. Perwira yang bertugas dibagian tipiter (tindak pidana tertentu) Polres Singkawang juga naik pangkat menjadi inspektur satu. Begitu juga IPDA Wan Masno yang menjabat sebagai Waka Polsek Singkawang Utara naik pangkat menjadi IPTU. IPTU Karyana yang menjabat sebagai Kapolsek Singkawang Selatan naik pangkat menjadi ajun komisaris. Begitu juga dengan Kasat Samapta, IPTU Sumarno menjadi AKP (ajun

komisaris polisi). Sedangkan dari ajun komisaris menjadi komisaris adalah, yakni AKP Agus P yang menjabat dibagian sumber daya. Agus sendirilah yang mengumumkan langsung nama-nama perwira yang naik pangkat termasuk dirinya. Kapolres Singkawang, Ajun Komisaris Besar EF Tony Sinambela dalam kesempatan tersebut memberikan selamat atas seluruh anggotanya yang naik pangkat. Kesempatan itu juga kapolres menyebutkan Kapolsek Singkawang Barat sekarang bukan lagi dijabat perwira yang berpangkat ajun komisaris polisi (AKP), melainkan komisaris polisi (kompol). “Nanti, Kapolsek Singkawang Barat akan dijabat perwira berpangkat komisaris, dan sebentar lagi akan ada serah terima jabatan,” kata Tony. Kapolsek Singkawang Barat, AKP Isbullah menjelaskan, Polsek Singkawang Barat berstatus urban. Artinya, mobilisasi sangat tinggi. “Saya dipindahkan di Polres Singkawang. Penggantinya mantan Kasat Reskrim Polres Ketapang yang kini bertugas di Mapolda Kalbar. Kemungkinan awal tahun serah terima jabatan,” kata Isbullah. (zrf)


SAMBAS

28

Pontianak Post

Belanja Publik Meningkat

terigas

Rumuskan Program Kerja Meningkatkan kinerja pengurus Ikatan Cendikiawan Muslim Indonesia Organisasi Daerah Kabupaten Sambas dilakukan perumusan program kerja. Sekretaris ICMI Orda Sambas Misni Safari, kemarin, mengatakan sejumlah agenda kerja sedang disiapkan dan disusun. “ Ha s i l Mu ktamar ICMI V di Bogor beberapa waktu merupakan acuan kegiatan di daerah. Terutama dalam membuat program kerja sehingga lembaga ini makin besar kiprahnya,” kata Misnis dia. Misni menyebutkan terutama yang akan dilakukan yakni pembentukan ICMI Organisasi Satuan. Dikatakannya, tentu saja tidak hanya asal bentuk tetapi tidak memberikan masukan berarti dalam pembangunan. “Penguatan lembaga ini merupakan upaya menghimpun para cendikiawan dalam memberikan masukan kepada pemerintah dalam arti positif. ICMI berusaha memberikan solusi konkrit dalam menjawab setiap persoalan yang dialami pemerintah,” tuturnya. Ia mengharapkan seluruh pengurus kompak dalam membangun sebuah persepsi kelembangaan. “Karena dalam ICMI Orda Sambas banyak para pemikir senior yang diharapkan memajukan organisasi,” harap Misni. (riq)

tilik

Proteksi Produk Indonesia Pembukaan pintu perbatasan ArukBiawak (Indonesia-Malaysia) secara resmi supaya menjadi perhatian semua pihak. Anggota Komisi B DPRD Sambas Sabhan, kemarin, mengatakan dibukanya border akan memudahkan barang dari luar negeri masuk ke Indonesia. “Bila pemerintah tidak siap mengantisipasi untuk memproteksi barang-barang dalam negeri, dikhawatirkan produk kita kalah saing dengan barang luar. Bukan hanya melindungi barang tetapi juga masyarakat sebagai konsumen supaya diperhitungkan,” katanya. Politikus PBR ini menyebutkan jangan berpikir bahwa dengan pembukaan pintu perbatasan dapat meningkatkan perekonomian daerah. Menurutnya, hal ini baru dapat terjawab ketika pemerintah sudah siap di semua bidang. “Kami mengharapkan pengawasan perdagangan barang di perbatasan supaya dilakukan secara ketat. Sehingga daerah atau negara tidak dirugikan dengan perdagangan di kawasan itu,” tutur Sabhan. (riq)

Sabtu 1 Januari 2011

Toriq/pontianakpost

BELUM BERFUNGSI : Traffic light di persimpangan Jalan Gusti Hamzah masih belum berfungsi dalam mengatur lalu lintas. Harapan masyarakat lampu pengatur itu segera difungsikan dalam tertib lalu lintas.

Pencatatan Kelahiran Diperpanjang SAMBAS – Massa dispensasi pencatatan kelahiran yang semula akan berakhir pada 31 Desember ini, diperpanjang. Menteri Dalam Negeri mengeluarkan surat edaran memperpanjang dispensasi hingga 31 Desember 2011. “Pemerintah masih memberi kemudahan bagi masyarakat melakukan pencatatan kelahiran. Ini sudah tahun kelima dispensasi berlaku,” kata Kepala Dinas Kependudukan dan Catatan Sipil Kabupaten Sambas Uray Burhanudin, kemarin. Dengandispensasiini,masyarakat yang belum mencatatkan akta kelahirannya dapat membuat akta kelahiran dengan mudah. Jika sesuai aturan, bagi mereka yang usianya lebih 60 hari tapi belum melakukan pencatatan kelahiran harus mendapat penetapan pengadilan.

“Dengan dispensasi langsung saja ke Disdukcapil,” ungkapnya. Surat edaran yang ditandatangani Mendagri Gemawan Fauzi nomor : 427.11/5111/SJ tanggal 28 Desember 2010, dispensasi pelayanan pencatatan kelahiran diperpanjang hingga 31 Desember 2011. Ini dilakukan untuk mempercepat pencapaian sasaran rencana strategis nasional 2011, semua anak Indonesia tercatat kelahirannya. Burhanudin meminta masyarakat tidak lagi menunda-nunda pencatatan kelahiran anak, keluarga maupun pribadi. Karena belum tentu setelah 2011 dispensasi diperpanjang. “Jangan lagi menunda-nunda, sekaranglah kesempatannya. Masyarakat diminta mencatatkan kelahirannya,” paparnya. Disepensasi juga diberlakukan

sama terhadap warga tionghoa. Uray Burhanudin menekankan, tidak ada diskriminasi dalam hal ini. Hanya saja pencatatan kelahiran warga tionghoa kerap mengalami kesulitan karena identitasnya berubah-ubah. “Semuanya diperlakukan sama, asal jangan berubah-ubah nama dan identitas lainnya,” katanya. Untuk itu, dia meminta warga tionghoa melampirkan surat pengantar dari kapala desa dan camat. Karena sering ditemukan warga tionghoa mengaku membuatkan akte kelahiran untuk keluarga. Belakangan diketahui bukan keluarga, ternyata kewarganegaraannya Taiwan. “Biasa kejadian seperti itu, makanya kami minta pengantar kepala desa dan camat. Karena mereka tahu siapa saja penduduknya,” tutur Burhanudin. (hen)

SAMBAS – Pembahasan Rencana Anggaran Pendapatan dan Belanja Daerah 2011 sempat berjalan alot beberapa hari lalu, Jumat (31/12), disetujui pihak legislatif. Semula belanja publik hanya sebesar 32 persen, setelah pembahasan bersama nilainya meningkat menjadi 43 persen. Mulyadi dari Fraksi Partai Amanat Nasional mengatakan terhadap RAPBD yang disetujui perlu mendapat perhatian pihak eksekutif sebagai pelaksana program. Ia mengemukakan banyak kegiatan masih tumpang tindih sehingga membebani pembiayaan semata. “Kami melihat banyak lembaga belum diberdayakan secara maksimal. Harapan terjadi percepatan pembangunan masih stagnan,” ungkapnya. Menurutnya, perlu diselesaikan kegiatan pembangunan fisik yang telah dianggarkan setiap tahun. Dikatakannya, banyak gedung sudah berdiri tetapi belum dimanfaatkan karena kurang prasarana. “Semoga saja, catatan ini dapat dilaksanakan pihak eksekutif dengan baik,” ujar Mulyadi. Fraksi PIB Sudarwin mengemukakan eksekutif hendaknya transparan dalam menyampaikan data kepegawaian. Ia menyebutkan hal ini dalam melaksanakan amanah reformasi dan birokrasi.

“Kami menilai belanja pegawai yang dianggarkan sekarang masih belum jelas peruntukannya secara utuh selain gaji. Perhitungan perjalanan dinas sendiri juga tidak jelas,” katanya. Sudarwin mengatakan persoalan lain yakni tentang pencatatan akta kelahiran. Ia mengharapkan Pemkab Sambas melakukan perpanjangan pemutihan pembuatan akta tersebut tanpa ada pembedaan. “Kasihan masyarakat kecil yang tidak mengetahui pentingnya bukti kewarganegaraan serta identitas seperti kartu tanda penduduk. Kami berharap pemerintah daerah melakukan tindakan jemput bola dan tidak hanya menunggu di Disdukcapil,” harap Sudarwin. Bupati Sambas Burhanuddin A Rasyid mengatakan catatan yang diberikan legislatif akan dilaksanakan oleh masing-masing SKPD. Menurutnya, anggaran yang dibahas sesuai dengan kesepakatan bersama. “Kami selalu berusaha merespon dengan cepat aspirasi masyarakat. Terutama tentang perpanjangan pembuatan akta kelahiran. Mudah-mudahan pelaksanaan anggaran dapat dilakukan maksimal demi kesejahteraan rakyat,” harapnya. (riq)

Pasokan Listrik Sebelas Kecamatan Aman SAMBAS – Pasokan listrik untuk sebelas kecamatan di Sambas aman. Perusahaan Listrik Negara (PLN) Ranting Sambas, mulai mengoperasikan lima mesin barunya dengan daya 2 megawatt. Dengan demikian daya mampu di Pusat Listrik Sambas menjadi 13.600 kilowatt. “Sebelumnya daya mampu di Pusat

Ingin Pasang Iklan? BIRO SAMBAS Hub : Rabbul 0813-4554-1441

Listrik Sambas 11.600. Sekarang secara resmi kita sudah mengoperasikan lima mesin baru,” ungkap Kepala PLN Ranting Sambas, Ian Mahesa, kemarin. Kecamatan yang pasokan listriknya dari Pusat Listrik Sambas adalah, Sambas, Sebawi, Teluk Keramat, Paloh, Tangaran, Jawai, Jawai Selatan, Tekarang, Galing, Sejangkung dan Subah. Pasokan listrik kecamatan tersebut dari Sambas, berbeda dengan Tebas yang masih menggunakan sistem Pontianak. “Dari Rambi sampai Sebedang selama ini juga menggunakan sistem Pontianak, setelah mesin ini beroperasi jalur tersebut masuk sistem Sambas,” jelasnya.

Mesin baru sudah dioperasikan sejak, Rabu (29/12). Masing-masing mesin berkapasitas 400 KW. “Sebenarnya ada enam mesin yang datang. Tapi dioperasikan hanya lima, satu lagi untuk cadangan,” kata Kepala Pusat Listrik Sambas, Joko Prasetyo. Setelah mesin ini optimal dioperasikan, beberapa mesin lama akan menjalani pemeliharaan. Karena memang selama ini mesin lama dipaksanakan untuk beroperasi. “Tidak semua mesin lama yang mengalami perawatan. Yang lainnya tetap beroperasi,” tambah Ian. Ian berharap dengan tambahan mesin baru ini PLN dapat meningkatkan pelayanannya

Hendi/pontianakpost

MESIN BARU: PLN Sambas mengoperasikan lima mesin baru berkekuatan 2 MW. Pasokan ini cukup untuk mengamankan sebelas kecamatan.

kepadamasyarakat.Namundia juga mengimbau masyarakat sadar dengan kewajibannya membayar rekening listrik. Tidak hanya mengamankan pasokan listrik untuk sebagian besar wilayah Sambas. Keberadaan mesin baru ini juga sebagai cadangan program satu juta pelanggan baru tahap

kedua. Dengan adanya mesin baru, PLN Sambas siap melayani permintaan pemasangan baru pada program tahap kedua nanti. Namun belum dipastikan kapan program satu juta pelanggan diluncurkan lagi oleh Direktur Utama PT PLN Dahlan Iskan. (hen)


Pontianak Post

ketapang

Sabtu 1 Januari 2011

Waspada dan Cegah Penyebaran HIV/AIDS

ragam

102 Personil Naik Pangkat

+

Periode 1 Januari 2011 sebanyak 102 personil Polres Ketapang mengalami kenaikan pangkat. Kapolres Ketapang AKBP Badya Wijaya SH menegaskan kenaikan pangkat di jajaran kepolisian Republik Indonesia (Polri) rutin setiap tahun. ”Ada sebanyak 102 personil kenaikan pangkat anggota periode 1 Januari 2011,” tegas Kapolres Ketapang AKBP Badya Wijaya SH. Rincian personil yang mengalami kenaikan pangkat itu diantaranya: dari AKP ke Kompol berjumlah 1 orang. Dari IPTU ke AKP berjumlah 2 orang. Dari IPDA ke IPTU sebanyak 3 orang. Dari AIPDA ke AIPTU berjumlah 7 orang. Dari Bripka ke AIPTU berjumlah 8 orang. Dari Brigadir ke Bripka berjumlah 3 orang. Dari Briptu ke Brigadir sebanyak 37 orang. Dan dari Bripda ke Briptu berjumlah 41 orang. Menurut Kapolres kenaikan pangkat baru itu akan efektif pada awal Januari 2011. Kenaikan pangkat ini diberikan berdasarkan masa jenjang, prestasi, dan hasil pengamatan pimpinan. (ndi)

ANDI/PONTIANAKPOST

OLAHRAGA: Kejuaraan Bola Voly berakhir, piala diserahkan ketua TP PKK Kabupaten Ketapang.

Olahraga Bangun Kebersamaan

Andi/pontianakpost

NAIK PANGKAT: Kapolres Ketapang AKBP Baya Wijaya SH memimpin upacara kenaikan pangkat personil di lingkungan Mapolres Ketapang.

29

KETAPANG – Kejuaraan bola Voly yang memperebutkan piala ketua TP-PKK Kabupaten Ketapang tahun2010berakhir.Kejuaraanyang diikuti sebanyak 36 klub bola Voly ibu-ibu se-Kabupaten Ketapang tersebut dalam rangka memeriahkan hari Ibu ke 82 tahun 2010. Dari hasil pertandingan yang dilaksanakan di lapangan bola voly kompleks pendopo Bupati Ketapang, juara pertama adalah klub Walet dari sandai. Penyerahan hadiah bagi pemenang dan uang pembinaan langsung diserahkan ketua TP PKK, Ny.Riniwati Henrikus. Sedangkan juara kedua adalah

Klub Muara dari Kecamatan Muara pawan, hadiah diserahkan wakil Ketua TP PKK, Ny.Rachmiwati Boyman Harun SH. Sedangkan juara ketiga adalah Klub PKK Sukabangun. Hadian diserahkan ketua Bhayangkari Kabupaten Ketapang, Kemudian juara keempat adalah Klub Bhayangkari dan hadiahnya diserahkan oleh ketua Persit Ketapang. Dari hasil pertandingan itu juga diketahui Tosser terbaik diraih oleh Tutik dari Klub PKK Sukabangun. Sedangkan penyemis terbaik diraih oleh Sri Suyatmi dari Klub Walet Kecamatan Sandai.

Ketua TP-PKK Kabupaten Ketapang, Ny.Riniwati Henrikus menegaskan melalui kegiatan bola voly itu adalah untuk menjalin kebersamaan antara pemerintah beserta eleman lainnya dalam rangka menciptakan Ketapang yang kondusif. Sehingga pelaksanaan program pembangunan akan berjalan sesuai dengan yang diharapkan. Tak kalah penting dalam mengisi pembangunan di Ketapang, peran kalangan wanita sangat strategis. “Melaluiolahragakitajalinkebersamaan, mari kita bangun Ketapang lebih baik,” kata Ny Riniwati Henrikus. (ndi)

KETAPANG–Setelah Markas Kompi Senapan C pada hari Kamis (30/12), kembali Komisi Penanggulangan AIDS Kabupaten Ketapang melakukan sosialisasi kepada klub sepeda motor di Ketapang. Sosialisasi bahaya Aids/HIV tersebut dilakukan di Gedung Persaudaraan Haji Kabupaten Ketapang, (31/12). Bahaya HIV/AIDS tersebut disampaikan dr Fadilah dari Puskesmas Kedondong dan Zulfahmi dari KPA Ketapang. Sosialisasi menjauhkan diri dari bahaya Aids mulai dari diri sendiri dan dari hal yang paling kecil itu diikuti ratusan anggota klub sepeda motor yang ada di Ketapang. Materi itu diperhatikan anggota klub sepeda motor yang sebagian besar adalah kalanga pemuda. Dalam sosialisasi itu dipaparkan panjang lebar bagaimana mencegah, bentuk penularan dari dan lain-lain. Setelah sosialisasi dilakukan di gedung Persaudaraan Haji KabupatenKetapang,anggtaKlubsepeda motor kemudian melakukan pawai keliling Kota Ketapang yang dikawal ketat aparat kepolisian dari Polres Ketapang. Sementara itu, ketika KPA melakukan sosialisasi di gedung Persaudaraan Haji Ketapang, maka PKBI Ketapang mengunjungi cafécafé di kompleks Rangga sentap.

+

Workshop Pengaktifan Indra Keenam Tahukah Anda bahwa indra keenam bukan hanya milik ‘orang-orang spesial.’ Semenjak dilahirkan manusia telah memiliki indra keenam sebagai anugerah Sang Pencipta untuk manusia. Namun, karena sejak bayi panca indra lebih dominan digunakan, lambat laun kemampuan indra keenam kita hilang. Saat ini keberadaan indra keenam telah diakui baik secara medis

dan psikologis. Dari kacamata medis, ada bagian otak manusia yang disinyalir membuat manusia memiliki kemampuan luar biasa. Kekuatan indra keenam tidak lagi semata-semata dimanfaatkan untuk hal-hal yang beraroma metafisika seperti paradigma orang selama ini. Indra keenam sudah sering digunakan untuk hal-hal yang bersinggungan

dengan kehidupan modern, seperti menarik kesuksesan, membuat deal-deal bisnis, membuat keputusan secara tepat, mempengaruhi orang lain, menganalisis sifat orang, menemukan ide-ide yang super-brilian, untuk kebugaran tubuh dll. Beberapa bentuk indra keenam seperti teleportasi (kemampuan memindahkan sesuatu), telekinesis (kemampuan mempengaruhi orang),

MaU paSanG di KETAPANG

Hub. : Biro Pontianak Post

Ketapang Telp. 0534 - 35514

+

Menurut Ketua PKBI Ketapang, Ny.Hj Hartati MS.Syamli hal tersebut mereka lakukan sebagai bentuk kepedulian pada kelompok marjinal. Dari kunjungan itu berbagai masalah dapat PKBI lakukan identifikasi, antara lain pada warung kondom ternyata PSK lebih minat pada kondom BKKBN, demikian juga dengan teknis pengobatan pada pekerja malam yang dinilai kurang tepat. “kita mash mencari kesepakatan dengan mereka guna diskusi penyulhah dan ketrampilan, dalam bergerak pada kelompok marjinal ini kita akui masih bergerak sendiri dan tanpa dana, ini kita lakukan secara ikhlas untuk berbuat demi kebaikan,” kata Hj.Hartati MS.Syamli. Ketua PKBI Ketapang ini mengatakandalammencegahpenyebaran HIV/Aids pada kelompok marjinal ini maka butuh segala upaya. Begitu juga dalam mengantisipasi penyebaran HIV, maka tak hanya menjadi peran serta lembaga tertentu saja, tetapi menjadi taggungjawab bersama. “Dengan datang langsung ke kelompok-kelompokyangmarjinal, kita megetahui ternyata dalam ada kelompok-kelompok tertentu pada pekerja seks komersial tersebut, karena itu dalam mencari solusinya perlu tindakan yang tepat dan efektif,” paparnya. (ndi)

telepati (komunikasi jarak jauh), levitasi (kemampuan meringankan berat benda), clairvoyance (gambaran batin), clairsentience (perasaan batin), clairaudience (suara batin), psychometri (menggali informasi dari sebuah benda), precognition (melihat masa depan), retrocognition (melihat masa lalu), dan masih banyak lagi. Workshop sehari ini akan mengajarkan rahasia mengaktifkan indra keenam dengan cepat. Mengaktifkan indra keenam ibarat membangkitkan seekor naga yang sedang tidur dalam diri anda. Dibutuhkan kemauan keras dan keyakinan yang kuat untuk melatihnya. Pada workshop ini trainer akan membantu membuka simpulsimpul indra keenam untuk diaktifkan dan dimaksimalkan daya kerjanya. Beberapa teknik rahasia akan diajarkan untuk mengaktifkan indra keenam yang masih tertidur dalam

diri. Selain itu akan dilatih bagaimana mempertajam daya intuisi, dan mengendalikan kekuatan indra keenam yang sudah diaktifkan.Trainer workshop adalah Ekokaf, Konsultan numerologi dan metafisika dari Semarang. Ekokaf adalah seorang Ilustrator dan konsultan metafisika dibeberapa reality show seperti “Asal Usul”, “Kupas Tuntas”, “Dua Dunia” di Trans7, dan tayangan “Dunia Lain” di TransTV, salah satunya episode gedung “Lawang Sewu” Semarang yang menyabet penghargaan The Best Reality Show se - Asia Pasifik di Singapura. Workshop dilaksanakan Minggu, 09 Januari 2011 pukul 09.00 sd 17.00 wib di Hotel Mercure Pontianak. Informasi & Pendaftaran : Olga & Andy (0852 4502 2277 – 0857 5078 6622). Dapatkan diskon khusus bagi pendaftar 2 orang atau lebih. Peserta terbatas. (ser)

+

cmyk


Kayong Utara

30

Pontianak Post

Mental dan Disiplin

+

ale-ale

Kadin Dilantik

+

SETELAH terpilih dalam lanjutan Musyawarah Kabupaten (Muskab) V Kamar Dagang dan Industri (Kadin) Ketapang, (14 Nopember 2010), maka kepengurusan Kadin dilantik pada 30 Desmeber 2010. Pelantikan Ketua Kadin Ketapang periode 2010-2015 dilakukan ketua Kadin Kalbar, Santioso Tyo SH MH di Hotel Aston. Menurut Effendi MT, SH, Wakil Ke tua Kadin Ke tapang bidang UKM dan Koperasi dengan dilantiknya kepengurusan Kadin Ketapang untuk lima tahun kedepan diharapkan semakin menggairahkan iklim usaha di Ke tapang. Ia mencontohkan bagaimana pada bidangnya, akan berusaha menggaet UKM menjadi anggota Kadin Ke tapang. Sebab, selama ini sebagian besar UKM masih belum menjadi anggota Kadin Ketapang.”Kadin kali ini akan mengkomodir mereka, untuk memperkuat organisasi sekaligus sumbangsih membangun daerah,” kata Effendi MT. Dengan dilantiknya kepengurusan Kadin yang juga mitra pemerintah dalam membangun ekonomi Ketapang, maka diharapkan ekonomi daerah ini akan berkembang pesat. Kadin dan pemerintah saling sinergis. Sisi lain, kata Ketua panitia pelantikan kepengurusan Kadin Ketapang bahwa dalam mengembangkan ekonomi daerah ini semakain bergairah, mereka mengharapkan sarana penunjang seperti infrastruktur antar Kabupaten dan menghubungkan ke ibukota propinsi menjadi perhatian serius pemerintah. (ndi)

cmyk

Sabtu 1 Januari 2011

Reformasi Birokrasi Diperlukan

ragam

Puluhan anggota Satuan Pengamanan (Satpam) PT. Cipta Usaha Sejati (CUS) barubaru ini mendapatkan pelatihan pembinaan mental, disiplin dan bela negara dari Tentara Nasional Indonesia (TNI). Secara resmi pelatihan ini dibuka yang diwakili Pandam XII Tanjungpura Letkol Inf Pujo Widodo, dengan melakukan penandatanganan kerjasama pelatihan dan penyematan secara simbolis kepada peserta pelatihan. Dalam sambutannya Pujo mengatakan bahwa keamanan bukanlah semata-mata tugas TNI melainkan ini merupakan tugas kita bersama, katanya. Termasuk masyarakat mempunyai peranan yang sangat penting dalam menjaga keamanan daerahnya, lingkungan dan tempat-tempat melaksanakan tugas. Untuk di PT CUS, salah satunya adalah dengan menjaga lingkungan kerja agar tetap aman dan terkendali sehingga menciptakan suasana kerja tetap harmonis dan jauh dari gangguan. Oleh karena itu, melalui pelatihan ini diharapkan kepada seluruh anggota Satpam di perusahaan ini, katanya harus memiliki mental dan jiwa kedisiplinan yang tinggi. Begitu pula dengan kondisi masyarakat, sebagai sesama anggota pengamanan meski dengan ruanglingkup cakupan pengamanan yang berbeda, tetapi juga perlu menyatu dengan masyarakat. Karena, barang siapa yang bisa melakukan upaya-upaya agar menyatu dengan masyarakat ini, maka bisa menguasai kemenangan. Sekarang kita tidak lagi perang melawan penjajah secara fisik dengan mengandalkan peralatan dan sejata perang. Namun, yang terjadi hingga hari ini yaitu perang dengan perut atau masalah perekonomian. Sebagaimana diketahui, pelatihan mental, bela negara dan disiplin selama hampir memakan waktu satu bulan ini, harus benarbenar membuahkan hasil yang maksimal. Kepada peserta pelatihan dirinya menghimbau agar tidak melakukan diskriminasi etnis yang tentunya itu bertentangan dengan Pancasila dan UUD 1945. Sebagai Satuan Pengamanan di lingkungan perusahaan, sudah barang tentu mempunyai tanggungjawab besar terhadap keamanan lingkungan kerja. Untuk itu seluruh anggota Satpam diharapkan benar-benar dapat mengimplementasikan ilmu dan pengalaman selama mengikuti pelatihan ini. Dan dalam pelatihan ini bukan berarti kami ingin menyiksa, tetapi ini merupakan bentuk kerja yang harus dilaksanakan agar perusahaan yang menjadi tempat bekerja banyak orang ini mempunyai nilai dan karakater yang baik dalam upaya menjunjung tinggi kedisiplinan tanggungjawab terhadap pekerjaan. (tas/hms)

l

Humas foto

TANAM POHON: Menjaga keseimbangan dan kelestarian alam, secara simbolis Bupati Kayong Utara H Hildi Hamid, belum lama ini, melakukan penanaman pohon di halaman Dinas Kesehatan KKU. Itu dilakukan dalam rangkaian peringatan Harkesnas.

Layanan Kesehatan KKU Membanggakan KAYONG VUTARA-“Ini sangat bagus menjadi percontohan dalam memberikan pelayanan kesehatan.” Ungkapan tersebut disampaikan Andy Yap, Kepala Dinas Kesehatan Propinsi Kalimantan Barat, saat menghadiri peringatan Hari Kesehatan Nasional (HKN) ke-46 yang dipusatkan di Sukadana, Kabupaten Kayong Utara, belum lama ini. Menurutnya pemberian pelayanan kesehatan gratis merupakan kebijakan pro rakyat dan sangat positif dalam pengembangan pelayanan kesehatan. Terlebih sebagai kabuapten baru, kata dia, menjadi sebuah kebijakan yang mum-

puni dalam pelayanan kesehatan. “Saya memberikan apresiasi positif kebijakan Pemerintah Kayong Utara”, jelasnya. Apalagi ditambah dengan pembangunan pusat pelayanan kesehatan maksimal, imbuh Andy, membuat kebijakan tersebut sangat perlu menjadi atensi semua kalangan. Ia mengharapkan ke depan kabupaten/kota di seantero Kalbar bisa menerapkan pelayanan kesehatan, seperti yang dilakukan di Kabupaten Kayong Utara. “Apalagi sebagai kabupaten baru pelayanan kesehatan gratis menjadi tolak ukur semua kabupaten yang ada untuk mengikuti jejak KKU.”

Sementera terkait pembangunan Puskesmas Sukadana, Ia mengaku merasa takjub. “Wah adanya diujung Kalbar Puskesmas seperti Rumah Sakit,” terangnya berkelakar. Dan dia mengingatkan bahwa dengan bangunan besar dan megah tersebut harus dibarengi dengan pelayanan prima. Andy mengharapkan dalam memberikan pelayanan tidak terjadi diskriminasi, tidak membedakan antara simiskin dan sikaya sehingga terjadi keselarasan dalam pemberian pelayanan kesehatan. “Saya mengharapkan perbedaan pengobatan tidak terjadi,” tandasnya. (tas/hms)

KAYONG UTARA-“Dengan Netralitas dan Profesionalitas, KORPRI Mendukung Reformasi Birokrasi dalam Rangka Optimalisasi Pelayanan Publik”. Demikian tema yang diangkat pada peringatan HUT KORPRI ke-39 melalui Pidato Presiden RI DR H Susilo Bambang Yudhoyono, sebagaimana dibacakan Bupati Kayong Utara, H. Hildi Hamid pada upacara HUT KORPRI, belum lama ini, di KKU. Melalui tema itu, Bupati mengajak seluruh jajaran KORPRI untuk melanjutkan kerja keras, meningkatkan pengabdian dan produktifitas dalam mewujudkan jajaran birokrasi yang makin profesional. “Jajaran birokrasi yang terbaik bagi seluruh warga bangsa. Jajaran birokrasi yang dapat kita banggakan sebagai salah satu keunggulan bangsa kita di era kompetisi global,” paparnya. Sejak didirikannya pada tanggal 29 Nopember 1971, KORPRI telah menunjukkan peran dan tanggungjawab dalam memberikan pelayanan kepada masyarakat, bangsa dan negara sesuai dengan tuntutan dan kemajuan jaman. Sebagai organisasi yang mewadahi para PNS, KORPRI telah melaksanakan tugas-tugas pemerintahan dan melayani keperluan masyarakat dalam berbagai bidang. Pelaksanaan tugas pemerintahan dan pelayanan masyarakat yang diemban oleh seluruh anggota KORPRI telah memberikan kontribusi konstruktif dalam proses pemban-

gunans selama ini. Dalam perjalanan sejarahnya, KORPRI saat ini telah tampil sebagai organisasi yang profesional dan makin mandiri. Organisasi yang kedudukan dan kegiatannya tidak lepas dari kedinasan, KORPRI telah mampu mendorong para anggotanya untuk mengembangkan tiga peran penting dan strategis sebagai abdi Negara, abdi masyarakat, dan abdi pemerintah. Lebih dari satu dasa warsa, sejak gerakan reformasi gelombang pertama, KORPRI telah ikut mengembalikan peran utama birokrasi sebagai komponen utama pengelolaan pemerintahan. Dan KORPRI telah mampu meningkatkan kapasitas profesionalismenya, seiring dengan sikap netralitasnya sebagai abdi bangsa dan abdi masyarakat. Hal ini sejalan dengan amanat Panca Prasetya KORPRI. Saat ini dan kedepan, tegas Hildi, para anggota KORPRI memeliki tugas sejarah dalam menyesuaikan reformasi gelombang kedua. “Melalui reformasi gelombang kedua, kita bertekad untuk memajukan kualitas penerapan demokrasi, meningkatkan upaya penegakan hukum, dan meningkatkan kesejahteraan rakyat. Kedepan, kita ingin menuntaskan agenda reformasi birokrasi, guna membangun jajaran birokrasi yang makin berkualitas, loyal, berdedikasi tinggi dan berdaya saing,” paparnya.(tas/ hms)

+

Jelang Pergantian Tahun 2010-2011

Happy New Year 2011, Terompet dan Jagung Manis Laris “Galang Rambu Anarki anakku. Lahir awal Januari. Menjelang pemilu.Galang Rambu Anarki dengarlah. Terompet tahun baru. Menyambutmu.Galang Rambu Anarki ingatlah Tangisan pertamamu Ditandai BBM membumbung tinggi…….” Lirik lagu yang dibawakan Iwan Fals ini mengingakan kita menjelang pergantian tahun 2010 ke 2011 di Kota Ketapang. Pasalnya dua hari sebelum pergantian tahun BBM jenis Bensin di Ketapang sempat terlambat pasokan ke SPBU dan menyebabkan antrian. Jika di SPBU BBM jenis bensi dibeli Rp 4.500 per liter, maka pada eceran pada Hari Rabu (29/12) menembus Rp 6000-Rp 7.000/liter. Untungnya, menjelang detik-detk pergantian tahun 2010-2011, pasokan BBM di Kota Ketapang kembali normal. Listrik pada tanggal 31 Desember 2010 juga normal. Konvoi yang biasanya dilakukan di pada pukul 00.00 WIB bersamaan dengan pesta kembang api itu, namun aktivitas pada sore hari di Kota Ketapang lebih ramai dari biasanya. Jalan-jalan raya tak pernah sepi dari kendaraan. Ada juga kendaraan yang menuju ke pantai untuk menikmati malam pergantian tahun. “Menikmati akhir tahun bersama keluarga di pantai datok, menikmati hidup setahun sekali, selamat tahun baru 2011 semoga sukses untuk kita semua,”

kata Pitriyadi S.Hut, M.Si, sekretaris PMI Ketapang. Menjelang pergantian tahun, semaraknya Kota Ketapang begitu terasa. Puluhan penjual terompet menghiasi jalan-jalan utama di Kota Ketapang, mulai dari Jalan Sisingamangaraja, MT.Haryono, R . S o e p rap t o, D I Pa n ja i t a n , S.Parman, dan lain-lain. Terompet dan jagung manis laris manis menjelang pergantian tahun. Ruas jalan Gajahmada dan Sisingamangaraja diramaikan dengan penjual jagung manis. Pedagang jual manis itu sudah muncul sejak hari Kamis (30/12) sampai Jum’at (31/12). Pergantian tahun 2010 ke 2011 bakal lebih meriah. Kafe-kafe sepakbola yang ada di Jalan DI Panjaitan sudah merias lokasi pegelaran musiknya. Para generasi muda Ketapang juga mulai membuat tenda-tenda di sejumlah lokasi untuk kegiatan musik akhir tahun 2010. Kesibukan generasi muda itu terlihat mulai dari Jalan Gajahmada, Di Panjaitan, Sisingamangaraja, MT Haryono, DR Sutomo dan lain-lain. Mulai dari siang sampai petang, para generasi muda ini pun terlihat sibuk menghias malam tenda-tenda untuk acara malam tahun baru. Selain itu ada juga yang menghibur keluarga dengan tamasya ke pantai. Kesibukan menjelang tahun baru 2010 juga tampak di sekitar pendopo Bupati Ketapang. Panggung besar lengkap dengan peralatan musik

berdiri megah.Artis Ibukota seperti Rita Sugiarto dan Ken Dedes diundang khusus Bupati ketapang, Drs Henrikus M.Si bersama Ny.Riiwati henrikus untuk menghibur masyarakat. Pada malam pergantian tahun selain artis Ibukota, Bupati Ketapang Drs Henrikus dan Ny.Riniwati Henrikus juga menyanyi menghibur masyarakat Ketapang. Adanya hiburan untuk masyarakat Ketapang yang dilengkapi dengan pesta kembang

api itu, ditegaskan Drs Henrikus M.Si supaya masyarakat fokus dalam merayakan malam pergantian tahun. “Dipusatkannya lokasi hiburan di kompleks Pendopo Bupati itu,supaya pada detik 00.00 WIB tak ada kebut-kebutan di jalan raya yang dilakukan generasi muda,” kata Drs Henrikus M.Si. Tak hanya masyarakat yang sibuk berbenah merayakan malam pergantian tahun. Polisi lalu lintas juga terlihat sibuk. Kapolres Ketapang, AKBP Badya

Wijaya SH bersama dengan anggotanya jauh hari sudah melakukan persiapan khusus untuk malam pergantian tahun. Sejumlah anggota sejak siang sampai malam sudah ditempatkan di beberapa titik untuk mengantisipasi malam pergantian tahun 2010. Begitu juga kesibukan terlihat di RSUD Agoesdjam dan tempat-tempat lain di Kota Ketapang. Semoga tahun 2011 akan lebih baik. Happy New Year 2011.**

ANDI/PONTIANAKPOST

LARIS MANIS: Terompet dan jagung diantara barang dagangan yang laris manis saat menyambut tahun baru.

+


Pontianak Post

aneka

Sabtu 1 Januari 2011

31

Potensi Rumput Laut Sambungan dari halaman 25

Dengan potensi karet itu, maka pengusaha dapat melirik industri pengolahan karet untuk dibangun di Ketapang. Selain itu, potensi lahan yang luas di Ketapang maka dapat dikembangkan pengolahan pertanian. Menurut Henrikus bahwa analisa orang-orang pintar dalam kurun waktu 20 tahun kedepan, dunia akan mengalami krisis pangan. Sebab, selain permintaan yang selalu men-

ingkat, jumlah penduduk yang terus bertambah, lahan juga semakin sempit. Sisi lain, banyak daerah yang selama ini tidak tergantung pada pagan beras, dalam masa 20 tahun akan beralih ke beras, seperti Papua. “Ini potensi bagi Kabupaten Ketapang, lahan yang luas, maka sudah saatnya kita olah lahan untuk pertanian,” ujar Henrikus. Saat memberi arahan di depan pengusaha dan SKPD ketika pelantikan pengurus

Kadin Ketapang di Hotel Aston, Bupati Ketapang menceritakan pengalaman saat ke Batam mengantar jemaah haji. Ketika itu, ia mengaku ada investor yang ingin bertemu. Semula dibenaknya kalau bukan investor tambang maka investor kebun. Ternyata, setelah bertemu adalah investor yang melirik budidaya rumput laut. Budidaya rumput laut di Ketapang memang masih belum diliriuk. Padahal, kata Bupati po-

tensi itu sangat besar di sekitar Pulau sawi Kendawangan. Jika pengusaha luar Ketapang bisa mengembangkan usaha buidaya rumput lalut, maka mengapa pengusaha dari Ketapang tidak melirik potensi yang ada di depan mata. Karena itulah, berkali-kali, Bupati Ketapang mengajak semua masyarakat Ketapang, untuk memberdayakan potensi yang ada di daerah ini. “Mari kita berpikir Entrepreneur, mari kita bersaing dengan pengusaha luar,” katanya. (ndi)

menurut Nurdin, karena ketiganya memiliki fungsi masingmasing. Dia menyebutkan, soal segong. “Jenis tanaman ini untuk mengembalikan kesuburan tanah, sedangkan trembesi untuk peneduh atau penyerap C 02 yang paling efektif. Di sejumlah negara maju, trembesi ini ditanam ditengah-tengah kota seperti di Singapura dan negara maju lainnya,” kata Nurdin. Selanjutnya, ditanamnya cemara, lantaran di Kota Singkawang sejak lama terkenal dengan cemara. Bahkan, sejak lama tanaman cemara ini sudah tumbuh subur dan menjadi ciri khas kota pariwisata tersebut. “Sekarang cemara banyak yang hilang. Justru itu, kita

kembali bangkitkan cemara ini,” katanya. Tahun 2011, sambung Nurdin, akan ditanam aneka buah-buahan, seperti rambutan, nangka, cempedak mangga, durian dan lainnya. “Aneka buah-buahan atau MPTS itu akan ditanam tahun 2011. Semuanya sudah siap tinggal penanaman,” kata dia. Selanjutnya, tahun 2011 juga akan didirikan beberapa fasilitas penunjang untuk memantau perkembangan penamanan itu sendiri. Dia mencontohkan di lokasi tersebut akan dibangun menara, pos pengamanan dan sebagainya. Bahkan, tahun 2011 akan ada polisi kehutanan untuk menjaga jangan sampai ada yang melakukan pencurian.

Begitu juga dengan kondisi alam seperti kebakaran. Saat ini, kata Nurdin, sudah dibentuk masyarakat pemadam api (MPI). “Masyarakat dilibatkan dalam penanggulangan bencana kebakaran hutan,” kata Nurdin. Dia juga menyebutkan, di lokasi tersebut juga ada pengambilan pasir. Untuk itu, perlu langkah kongrit penyelamatan. “Di lokasi ini bukanlah lokasi yang dibenarkan sesuai dengan Perwako 44 tahun 2009 itu. Perlu ada tindakan nyata untuk mencegahnya. Tanaman yang sudah ditanam biasanya dicabut untuk mengambil pasir. Jadi, perlu tenaga ekstra dan bibitnya bisa mati,” kata Nurdin. (zrf)

Mulai Ditanami Sambungan dari halaman 25

Pasir Panjang dan Gunung Sari. “Khusus di Pasir Panjang, lokasi yang akan ditanam mencapai 381 hektar,” kata Nurdin. Alumnus Fakultas Kehutanan Universitas Tanjungpura ini mengungkapkan, tahun 2010 ini, sedikitnya 48 hektar akan ditanam dengan berbagai jenis tanaman seperti segong trembesi dan cemara. Selanjutnya, tahun 2011, kata Nurdin, akan ditanam seluas 25 hektar. “Penanaman tersebut tentu ingin menjadikan kawasan Pasir Panjang menjadi salah satu paru-paru Kota Singkawang,” katanya. Mengapa ditanam tiga jenis tanaman tersebut,

Ditutup BBM Langka dan Sembako Naik Sambungan dari halaman 25

memanfaatkan momentum. Namun dibalik persiapan melepas 2010, ada catatan hitam yang membuat masyarakat bertanya-tanya. Sepuluh hari terakhir Desember, masyarakat resah dengan kenaikan harga kebutuhan pokok. Kebutuhan pokok paska Natal dan Tahun baru, tibatiba melonjak tinggi. Bahkan harga garam pun ikut naik. Kejadian tersebut tentunya memberatkan masyarakat. Terlebih lagi bagi pemilik warung makan dan resto. Hampir rata-rata harga kebutuhan pokok naik. Ditambah kenaikan yang terjadi pada sector sayur mayur. Bahkan kenaikan, sudah terjadi selama satu bulan ini. “Memang, harga kebutuhan bahan pokok di pasar tradisional sudah melambung

tinggi. Tentunya itu sangat memberatkan bagi kami. Bahkan harga garam ikut-ikutan naik juga,” dikatakan Sularti, salah satu pedagang warung makan di Jalan S Parman. Larti, sapaan sehari-harinya, mengaku terkejut ketika melihat nota belanja untuk kebutuhan warung makannya. Karena memang setiap hari, bahan belanjaan di Pasar Rangga Sentap. Harganya akan dilihat saat berada di rumah. “Jadi hampir rata-rata barang belanjaan saya naik,” keluh Larti. Larti menyebutkan., kebutuhan pokok yang naik sejak satu bulan ini. Diantaranya adalah beras. Dimana biasanya harga beras yang dalam satu karung berisi 19 kilo gram harga biasanya Rp114 ribu. Tetapi sekarang ini sudah menjadi Rp158 ribu. Kenaikan harga bahan

Tusuk Perut, Usus Dikantongi Sambungan dari halaman 25

meninggal dia membeset perutnya. Kemudian, usus yang keluar itu dimasukan didalam kantong. Setelah itu, baru dia tewas,” kata anggota polisi yang berada di lokasi kejadian. Menurut informasi, kata anggota polisi, pria tersebut pernah masuk ke rumah sakit, lantaran menusuk-nusuk pe-

rutnya sendiri. “Dia akhirnya dibawa ke rumah sakit, karena mengeluarkan banyak darah. Nyawanya tertolong kala itu,” kata dia. Polisi pun lantas meminta keterangan sejumlah saksi mata, salah satunya orang yang kali pertama menemukan mayat korban yang telanjang bulat ini, termasuk paman korban. (zrf)

kebutuhan lainnya yang dirasakan signifikan adalah cabe rawit. Harga biasanya Rp50 hingga R60 ribu, saat ini melonjak hingga Rp90 ribu per kilo. Kemudian harga minyak goreng, sekarang menjadi Rp180 ribu, naik dari harga biasanya Rp150 ribu. Selain harga di atas, Larti menambahkan, kenaikan harga juga terjadi pada sayur mayur. Misalkan harga kacang tanah dari Rp13 ribu, menjadi Rp18 ribu per kilogram nya. Kemudian harga kentang yang biasanya delapan ribu Rupiah, naik menjadi Rp12 ribu per kilogram nya. Sayur kubis atau kol, lanjut Larti, sekarang ini harganya sembilan ribu rupiah. Dimana harga itu naik dari biasanya yang hanya enam ribu rupiah. Wortel pun juga ikut naik, dari sepuluh ribu rupiah menjadi Rp12 ribu. Harga tomat juga naik, biasanya sepuluh ribu. Kini menjadi Rp15 ribu. “Lebih heran lagi, harga garam pun ikut naik. Biasanya Rp8.500, sekarang Rp18 ribu per pak,” ungkap Larti. Masyarakat Ketapang dan sekitarnya, sejak dua hari ini susah dapatkan Bahan Bakar Minyak jenis premium. Bahkan, Stasiun Pengisian Bahan Bakar Umum yang ada di Kabupaten ini, tidak lepas dari antrean panjang. Selain naiknya harga sem-

bako. Di akhir tahun 2010. warga Ketapang juga di suguhi dengan langka nya BBM jenis bensin. Hingga Jum’at (31/12), antrean panjang masih nampak di beberapa SPBU di Bumi Ale-ale. Namun pedagang bensin eceran yang sempat tidak lagi menjual bensin. Hari ini (31/12), sudah banyak yang kembali menjual BBM tersebut. Setidaknya hal itu sudah membantu masyarakat untuk mendapatkan bensin. Meski harganya menjadi enam ribu rupiah. Warga Ketapang mengaku sudah agak lega. Meski harganya naik, bukanlah menjadi masalah. Terpenting motornya tidak sampai kekurangan bensin. Terlebih lagi nanti malam akan merayakan tahun baru. “Saya tidak mengantri lagi, karena memang sudah banyak yang menjual bensin di eceran. Meski harga naik,” terang . Sebelumnya, Akbar, warga lainnya juga mengeluhkan kelangkaan bensin di Ketapang. Susahnya mendapatkan premium, memang dirasakan sejak dua hari lalu. Selain itu, pedagang bensin eceran yang ada juga seakan menghilang. “Saya mencoba mencari di pedagang eceran, tetapi memang banyak yang mengaku stoknya habis,” kata Akbar. (*)

Indah Group, jadi untuk sawit saya tidak keluarkan izin, cobalah komiditi lain seperti yangd ikatakan Pak Santioso akan menanamkan investasi di komoditas Ubi, atau komoditas yang lainnya,” kata Henrikus. Sementara itu, Santyoso Tio SH MH Ketua Kadin Kalbar berharap, dengan pelantikan pengurus ini Kadin Ketapang segera menyusun dan melaksanakan program kerja, terutama dalam bekerja sama dengan pemerintah untuk ikut meningkatkan taraf ekonomi penduduk melalui berbagai program Kadin. Dalam pelantikan itu, Ketua Kadin Kalbar memberikan plakat kepada Bupati Ketapang. “Kepegurusan Kadin yang dilantik berarti sudah bertekad mewujudkan program kerja

yang dihasilkan untuk lima tahun kedepan,” kata Santyoso Tyo. Dengan terbentuknya kepengurusan Kadin Ketapang, Rasmidi SE MM, ketua Kadin Ketapang kepengurusan Kadin dibentuk menyesuaikan dengan SKPD yang ada di Pemerintah daerah. Hal tersebut sesuai dengan kepengurusan Kadin Pusat maupun propinsi, sehingga memudahkan koordinasi dengan pemerintah daerah. Dalam kepengurusan kedepan juga akan diupayakan merangkul dan membina UKM dan Koperasi agar dapat menjadi anggota Kadin yang terdaftar. “Inti dari kepengurusan Kadin adalah mewujudkan iklim ekonomi yang kondusif,” kata Rasmidi SE, MM. (ndi)

beroperasi, masyarakat pun berhimpitan untuk mendapatkan antrean lebih depan. Selain masyarakat pembeli, di luar SPBU, pembeli bensin dengan jeriken. Sudah mempersiapkan tempat untuk

menampung minyak tersebut. Baik di sisi kanan atau kiri SPBU. Nampak jeriken yang sudah tersusun rapi, menunggu pengisian dari pihak SPBU. (fah)

Kadin Beda dengan Kontraktor Sambungan dari halaman 25

aturan yang berlaku. Proses tender tetap dilakukan, apalagi saat sekarang sudah memasuki era pengumuman lelang barang dan jasa menggunakan media elektronik. Keberadaan Kadin, kata Henrikus sangat besar perannya dalam mengembangkan ekonomi Ketapang. Pemekab Ketapang mendukung tumbuhnya organisasi dan kondusifnya iklim usaha di daerah ini. Ia mencontohkan bagimana respon pemerintah daerah dalam membangun perizinan dalam satu atap. Pada kesempatan itu, Bupati menyebutkan peluang usaha di daerah ini masih terbuka dengan luas. Dalam menun-

jang tumbuhnya ekonomi di daerah ini, Pemkab Ketapang menyadari kondisi infrastruktur jalan masih terbatas. Maka hal ini menjadi tantangan kedepan. Berbagai potensi yang ada di daerah ini misalnya dalam komoditi perkebunan, pertanian, peternakan dan lainlain. Terkait dengan komoditi perkebunan sawit, secara tegas Bupati mentatakan pada pemerintahannya tidak akan mengeluarkan izin. Terkecuali mencabut izin kebun sawit yang selama ini tidak menunaikan kewajibannya, atau tidak mengurus lahan yang sudah diberikan izin beberapa tahun lalu, sehingga melanggar aturan main yang sudah ada. “Soal sawit, saya sudah capek mengurus PT.Benua

Warga Lega, BBM Datang Sambungan dari halaman 25

ribu ada pula yang menjual Rp7 ribu per liternya,” ujar Yugo, Jumat (31/12) siang yang terpaksa mengisi di sebuah kios bensin eceran, meski

dengan harga yang tinggi. Meski SPBU belum buka. Para pedagang eceran rela menunggu di depan pagar SPBU di DI Panjaitan. Sebentar saja, begitu pintu pagar dibuka dan SPBU mulai

Rela Begadang Asalkan Terompet Laku Sambungan dari halaman 25

pedagang bisa ludes. Untuk hari ini saja sudah sekitar 40 hingga 50 orang datang membeli trompet. Apalagi jelang malam tahun baru sehabis Isya, maka banyak masyarakat akan memadati tempat jualan trompet. Hal ini bercermin

seperti tahun lalu. Mudah-mudahan tahun ini juga sama, sehingga pendapatannya meningkat. Semakin banyak terjual maka keuntungan diraih pun bertambah. Ia juga menambahkan banyak trompet dibuat sendiri maupun didatangkan dari jawa. Namun

kebanyakan trompet di buat dengan melihat contoh baru dari Jawa. Hal senada diungkapkan Udin, penjual trompet lainnya. Tahun ini mudah-mudahan semakin baik. Pasalnya sampai saat ini penjualan yang didapat terbilang lumayan. Meskpin harus dilalui kerja keras.

HARI/PONTIANAKPOST

LANTIK: Walikota Singkawang, Hasan Karman memberikan ucapan selamat kepada 37 orang Kepala Sekolah untuk TK, SD, SMP, dan SMA Negeri di lingkungan Pemkot Singkawang.

Harus Transparan Kelola BOS 37 Kepsek Dilantik SINGKAWANG– Walikota Singkawang, Hasan Karman melantik 37 orang Kepala Sekolah untuk TK, SD, SMP, dan SMA Negeri di lingkungan Pemerintah Kota Singkawang, di aula Dinas Pendidikan jalan Alianyang, (Kamis 30/12). Walikota meminta kepsek bekerja serius membangun kemajuan pendidikan Singkawang. Sementara Kepala dinas pendidikan Singkawang Sofian meminta para kepsek dalam pengelolaan Biaya Operasional Sekolah (BOS) transparan kepada masyarakat. Dalam acara pelantikan tersebut hadir juga Wakil Walikota, Edy R. Yacoub, Sekda, Suhadi Abdullani, Kepala Dinas Pendidikan, Sofian serta para Kepala SKPD di lingkungan Pemerintah Kota Singkawang. Walikota Singkawang, Hasan Karman mengatakan jabatan apa saja adalah amanah termasuk kepala sekolah. Amanah ini, diberikan kepada mereka yang dipercaya memiliki kemampuan, sesuai dengan tuntutan jabatan tersebut. Tidak semua orang mendapat kepercayaan semacam ini, karenanya setiap jabatan, hendaknya dijaga dan dilaksanakan sebaik-baiknya. Ia mengatakan, kepala sekolah diberikan waktu masa jabatan paling lama empat tahun sesuai Permendiknas No. 28

mampu mengamalkan dan menjadikan fungsi-fungsi yang senantiasa dapat beradaptasi dengan berbagai aspek perkembangan pembangunan. Pribadi seorang kepala sekolah yang professional demikian akan mampu mendorong visi dan misi menjadi aksi dalam paradigma baru manajemen pendidikan. Selanjutnya Hasan Karman mengucapkan terima kasih dan penghargaan yang setulus-tulusnya kepada kepala sekolah yang digantikan. “Semoga amal ibadah atas pengabdian yang diberikan menadapat rido dan ganjaran dari Tuhan,” tuturnya Sementara itu, Kepala Dinas Pendidikan Sofian, mengatakan selain meningkatkan mutu pendidikan di sekolah yang dipimpin. Diharapkan kepala sekolah mampu bekerja dengan baik kepada guru dan masyarakat sekitar. Salah satunya caranya penerapan manajemen sekolah berbasis mutu, komptensi dan masyarat. Dimana partisipasi masyarajkat juga berperan penting memajukan sekolah. Terkait urusan BOS, Sofian meminta agar kepala sekolah transpran. “Bila perlu berapa dananya dan untuk apa digunakan dana bos dibuat laporan lalu di tempelkan ke pengumuman di sekolah,” jelasnya. (har)

Pembunuhan Cukup Menonjol 2010 Ada Empat Kasus NGABANG –Kasus kriminal paling menonjol di Landak, setidaknya ada 4 kasus pembunuhan masing-masing di pal 20 Landak, di Pahauman, pembunuhan berencana di jalan raya dengan motif kecemburuan dan perselingkuhan, dan pembunuhan di kawasan gunung Seha yang pelakunya berasal dari Pontianak. Meski demikian, dalam sesi jumpa pers kepada wartawan, Jumat (31/12) Kapolres Landak, AKBP Firman Nainggolan mengakui selama tahun 2010 ini situasi kamtibmas di wilayah polres Landak aman dan lancar. Memang dalam tahun 2010 ditinjau dari segi kamtibmas dapat disampaikan bahwa ada sekitar 220 kasus dari Januari

sampai Desember 2010. Dari 220 kasus tersebut dibagi dalam empat kategori yakni tindak pidana konvensional sebanyak 206 kasus, trans nasional sebanyak 5 kasus, menyangkut kekayaan negara contohnya ilegal loging, ilegal mining sebanyak 8 kasus, dan kejahatan kontijensi hanya 1 kasus. Begitu juga halnya dengan curanmor, selama tahun 2010 pelakuyangberhasildiamankan sebanyak 15 orang, dan barang bukti berjumlah 25 unit sepeda motor. Ketika ditanya mengenai tindakan disiplin kepada anggota selama tahun 2010 bagi yang melanggar aturan tugas, Firman mengatakan sedikitnya 26 orang anggota telah dikenakan hukuman tindakan disiplin, dan satu orang untuk pidana dengan ancaman pemecatan.“Untuk kekayaan negara terdiri dari ilegal loging dengan 4 kasus, diselesaikan

3 kasus, penambangan emas tanpa ijin (PETI) 1 kasus dan sudah diselesaikan, pembajakan 3 kasus dan ketiga kasusnya dilimpahkan ke polda Kalbar, tetapi awal pengungkapannya dari polres Landak. Untuk trans nasional yakni narkoba 2 kasus dan sudah diselesaikan dua kasusnya. Penyelundupan manusia 1 kasus, sudah diselesaikan. Trafficking 2 kasus dan sudahdiselesaikan,”ungkapnya. Untuk kasus konvensional yang telah diselesaikan 98 kasus. Kasusnya terdiri dari ancaman, aniaya ringan dan berat, percobaan pembunuhan, bunuh diri, dansebagainya.Padaumumnya tkpterjadididaerahpemukiman umum, pertokoan, jalan umum dan perparkiran. Sedangkan waktu kejadiannya antara pukul 18.00 wib sampai dengan 00.00 wib. Para pelaku sendiri kebanyakanusiaproduktifyakniantara 21 tahun – 30 tahun. (sgg)

Gunakan PDE Catat Kwh Sambungan dari halaman 32

Dijelaskannya, di dalam PDE tersimpan data pelanggan yang akan dibaca kWh meternya, antara lain nama dan alamat pelanggan, kode lokasi, daya tersambung, golongan tarif, nomor kontrak, nomor kontrol dan rekaman pencatatan

meter kWh sebelumnya. Setelah membaca angka-angka pemakaian kWh yang tertera pada meter kWh, petugas pencatat akan memasukkan ke dalam PDE sesuai data pelanggan yang bersangkutan. PDE akan segera memproses dan menghitung besarnya biaya rekening yang harus dibayar.

“Hasil proses dan perhitungan ini langsung tercetak dalam bentuk struk yang diserahkan petugas kepada pelanggan. Kepada pelanggan saya himbau mintalah dan periksalah struk ini, beritahu petugas bila terdapat kesalahan agar dapat dikoreksi,” kata dia.(wah)

Tumbuhkan Bela Negara di Perbatasan Sambungan dari halaman 32

akan kesadaran bela negara. “Memang, solusi yang tidak bisa ditawar-tawar lagi adalah dengan menumbuhkan lagi rasa semangat memiliki oleh masyarakat kita, terhadap keutuhan bangsa dan negara yang salah satu manifestasinya adalah tegaknya wilayah kedaulatan dan yurisdiksi

negara RI,” tegas Danrem. Selain itu, Danrem mengatakan, ke depan pihaknya akan lebih meningkatkan pemahaman warga perbatasan mengenai bela negara. Hal tersebut akan diwujudkan dengan program kemah kebangsaan, yang akan diisi dengan berbagai macam kegiatan seperti olahraga, outbond dan pendidikan menge-

nai bela negara. “Kita akan membuat program bela negara tersebut untuk memberikan pemahaman kepada warga perbatasan, bahwa kita adalah satu dalam NKRI. Sehingga semangat kebangsaan mereka akan tumbuh, meskipun berada berbatasan dengan negeri tetangga,” tutur Danrem.(wah)

UPPD Sintang Terapkan Sistem Online Sambungan dari halaman 32

Karena kebanyakan pedagang trompet di wilayah ini relah menunggu pembeli hingga berdagang larut malam di pasar. Asalkan semua trompet yang dijajakan habis. “Udah resikolah,namanya juga pedagang jalanan tak masalah asalkan barang dagangan terjual,” katanya. (*)

Tahun 2010 pengganti Permendiknas No. 162/U/2003. Akan tetapi, evaluasi akan terus dilakukan, dan tidak menutup kemungkinan bagi mereka yang menunjukan kinerja baik akan ditinjau kembali. Hal ini bertujuan agar pembangunan pendidikan Kota Singkawang betul-betul berbasis kinerja. “Kepala sekolah, perlu melakukan terobosan-terobosan, caranya menganalisis kekuatan, kelemahan, peluang,dan tantangan dihadapi baik secara personal maupun institusional. Reaktualisasi fungsi dan peran kepala sekolah perlu dilakukan demi perubahan dan pengembangan sekolahnya sebagai organisasi pembelajaran efektif, sekolah unggulan yang bertaraf nasional atau internasional. Disamping itu, yang terpenting adalah melakukan tata kelola sekolah dengan baik (good school governance) sebagai bentuk dukungan terhadap desentralisasi penyelenggaraan pendidikan, Manajemen Berbasis Sekolah (MBS), kurikulum Tingkat Satuan Pendidikan (KTSP), benchmarking, Broad Basic Education, Life Skill, Contextual Learning dan UndangUndang System Pendidikan Nasional dan sebagainya,” jelasnya. Walikota mengingatkan, agar para kepala sekolah

“Online di seluruh kantor pelayanan Samsat telah dilaksanakan di Kalbar. Dengan pembakuan sistem, pembenahan sumber daya manusia dan pengoptimalan sumber daya yang ada, harapan kami target pendapatan yang dibebankan kepada kami bisa tercapai,” harapnya.

Di samping itu, guna peningkatan pendapatan pajak kendaraan bermotor, Mawardi mengatakan, pihaknya dibantu aparat kepolisian dengan melakukan razia gabungan. Sebab, hal tersebut merupakan salah satu cara yang efektif untuk menyadarkan wajib pajak melaksanakan kewajibannya. “Karena kalau sudah razia,

mereka baru mulai membayar pajak kendaraannya. Setelah itu biasanya mereka berduyunduyun mendatangi kantor Samsat. Namun demikian, hal tersebut tentunya memberikan kesadaran bagi wajib pajak untuk menunaikan kewajiban mereka sebagai warga negara yang baik, untuk membayar pajak tepat pada waktunya,” tukas Mawardi.(wah)


32

pro-kalbar Pontianak Post

SINTANG

Gunakan PDE Catat Kwh UNTUK menghindari terjadinya kesalahan pencatatan meter Kwh, saat ini PLN Ranting Sintang telah memanfaatkan kemajuan teknologi di bidang komputer, dengan menerapkan cara pencatatan meter dengan Portable Data Entry (PDE) untuk pelanggan mereka di kota Sintang. Menurut Manager PLN Ranting Sintang Suharman, selama ini pencatatan meter Suharman pada umumnya dilakukan oleh petugas dengan cara manual, yaitu menuliskan hasil pembacaan meter Kwh ke dalam Daftar Pembacaan Meter (DPM). Cara seperti ini membawa resiko terjadinya kesalahan akibat salah tulis, apabila petugas melakukan pencatatan meter melakukan penyalinan atau pemindahan catatan dari daftar yang satu ke daftar yang lain. Kesalahan ini tidak saja akan merugikan pelanggan tetapi juga PLN. Sebab itu dilakukanlah pemeriksaan secara rutin. “Yang perlu diperiksa adalah besarnya angka pemakaian kWh yang tertera pada lembar rekening listrik pelanggan. Bandingkan dengan angka yang ditunjukkan oleh kWh meter maupun yang dicatat pada kartu gantung. Dengan demikian dapat ditemukan kejanggalan apabila terjadi kesalahan dalam pencatatan sebelumnya,” ujar Suharman. Ke Halaman 31 kolom 5

SEKADAU

Keseriusan dalam Jabatan BUPATI Sekadau Simon Petrus mengatakan, ia menginginkan para kepala dinas bekerja dengan efektip dan mencurahkanpikiranuntuk membangun Sekadau, dan dapat memberikan pelayanan yang baik pada masyarakat bukan minta dilayani. “Saya tidak mau mendengar lagi ada kepala dinas atau kantor yang bersantaisantai saja dan malah minta dilayani. Mereka saya tugaskan, untuk Simon Petrus membantu saya dalam memajukan Sekadau,” kata bupati saat melantik pejabat eselon II di jajaran pemerintahan SOPD Kabupaten Sekadau, belum lama ini. Tak hanya itu, masalah disipli dalam bekerja dan keseriusan seorang pejabat sepertinya juga menjadi titik perhatian orang nomor satu di Bumi Lawang Kuari ini, hingga ke depan Simon berharap agar semua jajaran dinas dapat meningkatkan mutu kerja yang dimulai dari keseriusan pribadi masing-masing, guna membangun Sekadau kearah yang lebih maju. Keseriusan dalam diri seorang pimpinan di dinas dan instansi, menurut bupati, akan berdampak pada kinerja para stap hingga segala urusan dan pelayanan pada masyarakat dapat berjalan dengan baik dan benar. “Saya akan perhatikan siapa-siapa yang bekerja dengan benar dan mana yang hanya berpura-pura di depan saya. Ke depan jika ada penggantian pejabat lagi, akan kita pertimbangkan dari sikap dan profesionalisme serta kepangkatanya,” kata Simon menegaskan.(nie)

Sabtu 1 Januari 2011

UPPD Sintang Terapkan Sistem Online SINTANG--Dinas Pendapatan Daerah (Dipenda) terus berupaya memberikan pelayanan terbaik kepada masyarakat. Termasuk membuat program baru dengan mengadopsi pelayanan sistem online di semua Kantor Samsat, termasuk diantaranya Unit Pelayanan Pendapatan Daerah (UPPD) Kabupaten Sintang. Kepala UPPD Kabupaten

Sintang Mawardi, mengatakan pihaknya berharap wajib pajak akan lebih terlayani dalam pembayaran Pajak Kendaraan Bermotor (PKB) diamanapu mereka berada. “Dengan begitu, wajib pajak tidak terikat tempat dalam melakukan pembayaran. Dimanapun mereka dapat melakukan pembayaran di cabang UPPD terdekat,” kata dia. Pengembangan sistem online,

jelas Mawardi, dimaksudkan memudahkan pembayaran, menciptakan transparansi dan biaya pelayanan yang murah. Sebab, di Kabupaten Sintang sendiri banyak kendaraan dengan plat daerah luar. Sementara bagi internal Dispenda akan menciptakan kompetisi yang faktual antarkantor. Ini sebagai bukti kami bekerja seoptimal mungkin untuk mem-

berikan pelayanan yang mantap, sesuai presedur, dan baku. Sehingga, wajib pajak mendapat kemudahan, pelayanan yang cepat, dan tak terbebani biaya tambahan. Dalam pelayanan, tidak akan menemukan waktu yang lama, karena hanya membutuhkan waktu 10 menit, maka wajib pajak dapat menyelesaikan proses pembayaran. Ke Halaman 31 kolom 5

Mawardi

Baru Dua Pejabat Laporkan Kekayaan FOTO SRI WANTO WINARNO

LARIS: Seperti tahun-tahun sebelumnya, perayaan tahun baru selalu diwarnai dengan kemeriahan. Tak pernah absen, penjual kembang api, terompet dan petasanpun marak menghiasi wajah kota Sanggau. Sehingga tidak heran momen itu memberikan rezeki bagi para pedagang musiman yang jualannya selalu laris.

Maksimalkan Fungsi Sawit S I N TA N G - - H a belum lama ini. sil yang didapatkan Menurut Hermanus, masyarakat melalui selain merugikan industri perkebunan masyarakat, perkebusawit dinilai belum nan sawit dinilai sebagai maksimal. Sebab, salah satu penyebab pembagian untuk terjadinya kerusakan masyarakat dinilai kecil jalan. Di mana truk dibandingkan wilayah pengangkut buah sawit lain di Indonesia yang menggunakan jalan terdapat perkebunan dengan beban yang sawit. besar, sehingga jalan di “Masyarakat hanya KabupatenSintangtidak Hermanus/ mendapatkan 20 persbisa menanggung berat en dari hasil. Sisanya angkutan tersebut. diperuntukkan bagi perusahaan. “Dapat dilihat infrastruktur seTak seperti daerah lain seperti di makin parah, jalan semakin hancur Sumatera, di mana masyarakat sehingga berpengaruh terhadap mendapatkan hasil lebih dari itu. Ini pendapatan masyarakat. Di mana merupakan penjajahan terstruktur,” untuk membawa hasil pertanian tegas Ketua Kontak Tani dan Nelayan pasti terganggu. Truk sawit itulah Kabupaten Sintang, Hermanus, yang buat rusak. Bahkan beberapa

diantaranya juga sering terbenam, dan membutuhkan waktu lama untuk menariknya. Hal ini pasti menimbulkan kemacetan, karena kendaraan lain tidak bisa lewat,” jelanya. Oleh sebab itu, Hermanus berharap hal ini menjadi perhatian bagi pemerintah. Karena, meskipun perekonomian tampaknya semakin meningkat dengan masuknya sawit ke Kabupaten Sintang, namun masih belum diiringi perbaikan infrastruktur jalan yang terlihat semakin parah. “Berbicara infrastruktur memang membuat sedikit alergi bagi kami. Kita berbangga karena perekonomian di setiap desa meningkat, namun hal tersebut tak diiringi dengan perbaikan infrastruktur yang memadai, sehingga menjadi hambatan bagi masyarakat,” tukasnya.(wah)

SANGGAU--Penyampaian laporan harta kekayaan pejabat publik adalah sangat penting, guna mengantisipasi terjadinya tindak pidana korupsi yang memang marak terjadi di negara ini. Dengan demikian, kekayaan maupun pendapatan yang tidak wajar seorang pejabat, dapat terdeteksi. Khusus di Kabupaten Sanggau, baru ada dua pejabat di lingkungan eksekutif dan legislatif yang telah menyerahkan laporan harta kekayaan. Yakni Sabinus Kimsuan, anggota Komisi A DPRD Sanggau, dan Wakil Bupati Sanggau Paolus Hadi SIP. Kimsuan ketika dikonfoirmasi kemarin mebenarkan dirinya telah menyerahkan daftar kekayaan yang dimilikinya sebagai anggota DPRD Sanggau, dan yang telah diurusnya sejak 4 bulan lalu. Kini dia telah mendapatkan laporannya langsung dari Komisi Pemberantasan Korupsi (KPK) RI di Jakarta. Dia mengaku bangga, karena menjadi salah satu pejabat yang sadar untuk melaporkan harta kekayaannya kepada negara. “Menurut saya, jika jumlah pejabat yang melaporkan harta kekayaannya sedikit, maka akan memperlambat upaya pemberantasan korupsi di Indonesia ini pada umumnya,” cetusnya. Selain itu, lanjut Kimsuan, dengan rendahnya jumlah pejabat yang melaporkan harta kekayaannya, dapat berpengaruh kepada tingkat kepercayaan masyarakat kepada para pejabat. Karenanya, dengan telah diserahkannya laporan harta kekayaan kepada KPK, berarti menunjukkan adanya itikad baik seorang pejabat, maupun penyelenggara negara dalam mempercepat pemberantasan korupsi sebagaimana diinstruksikan dalam Inpres Nomor 5 Tahun 2004 tentang Percepatan Pemberantasan Korupsi. “Seharunya pejabat sebagai penyelenggara negara wajib melaporkan harta kekayaannya kepada KPJ, sebagai implementasi dari perjuangan memberantas korupsi. Selain itu, perlu pula dipikirkan adanya sanksi bagi pejabat yang enggan melaporkan harta kekayaannya kepada negara,” tandasnya.(nto)

Tumbuhkan Bela Negara di Perbatasan SINTANG--Komandan Korem 121/ABW Kolonel Inf Toto Rinanto, mengatakan selain menjaga perbatasan, aparat TNI yang berada di sana juga membantu masyarakat sebagai guru bantu. Hal tersebut dilakukan, karena melihat kondisi tenaga pengajar yang dinilai kurang di

wilayah tersebut. “Mereka menjadi guru secara sukarela karena memang TNI melihat di kawasan perbatasan masih kekurangan guru, sehingga para prajurit itu dengan senang hati memberikan pelajaran kepada masyarakat setempat. Kegiatan

ini murni dilakukan karena memang itulah yang dibutuhkan warga,” ungkap Danrem. Lebih lanjut Toto mengatakan, anggota yang bertugas juga memberikan pelajaran tentang wawasan kebangsaan kepada siswa di kawasan itu. Selain itu, anggota juga memberikan

pelajaran ekstrakurikuler, baik pemahaman tentang Negara Kesatuan Republik Indonesia (NKRI) atau tentang wawasan kebangsaan agar para siswa semakin cinta terhadap Indonesia. “Jadi, selain para prajurit mengamankan kawasan perbatasan sebagai bakti kepada bangsa dan negara, mereka juga mengabdi kepada masyarakat dengan berbagai kegiatan sosial, termasuk menjadi guru di perbatasan,” tutur Danrem. Menurut dia, di wilayah sepanjang perbatasan negara ini juga rawan akan illegal logging, Illegal trading dan ilegal apa saja yang bisa berpeluang mendatangkan keuntungan bagi pihak-pihak tertentu. Hal demikianlah yang dapat membuat masyarakat perbatasan, akan sangat mudah sekali terkontaminasi atau

Toto Rinanto

terkena dampak negatif tersebut. Sehingga tidak mustahil akan berdampak lebih jauh melunturnya rasa nasionalisme, jiwa patriotisme, rasa persatuan dan keutuhan bangsa, cinta tanah air termasuk pemahaman Ke Halaman 31 kolom 5

Pontianak Post  

1 Januari 2011