Page 1

Skills on Site

July 2011

1


VISIT OUR WEBSITE TO FIND YOUR NEAREST STORE www.cashbuild.co.za

All our everyday prices are the

lowest in town,

SERVICES

CEMENT

SKIL CORDLESS

6002AA IMPACT DRILL ,FZFE$IVDL 500 WtSKU: 972107

L O C A L D E L I V E RY

226,95

DRILL DRIVER "#t7

NEW! SKIL

SKU: 300954

485,95

HEAT GUN $"t8

NEW!

BOSCH

SKU: 300956

IMPACT DRILL 14#t 8 ,FZFE$IVDL

Handling fee applies to bricks and cement, enquire in-store for details.

289,95

SKU: 971101

377,95

BOSCH PST 680E JIGSAW +*(4"8t 8 500W Bow Handle Bow Handle

BOSCH

SKIL 4003AA

IMPACT DRILL (4#3&t8 ,FZFE$IVDL

SKU: 972111

544,95

THE CHEAPEST WAY TO BUY;

BOSCH PSB70 IMPACT DRILL ,FZMFTT$IVDL 700 W

- Cement - Bricks - Rooftiles

SKU: 971113

715,95 SKIL IMPACT DRILL ."t8

CASHBUILD GUARANTEES LOWEST PRICES ON CEMENT!

MELODY PVA

848,95

DULUX BERGERMASTER NUKOTE PVAt8IJUF

MEDAL CONTRACTORS PVA

8IJUF 20 Litres

8IJUF -JUSFTtSKU: 5056

SKU: 300002

134,95 CHAMPION EXTRA THICK PVAt8IJUF -JUSFTtSKU: 5002

62,95 -JUSFTtSKU: 5037 109,95 -JUSFTtSKU: 5001 189,95

79,95 -JUSFTtSKU: 5068 149,95 -JUSFTtSKU: 5057 272,95

-JUSFTtSKU: 5062

PLASCON CROWN ARCTIC PVAt8IJUF

DULUX ACRYLIC PVAt8IJUF

89,95 -JUSFTtSKU: 5051 279,95

259,95 -JUSFTtSKU: 6122727 949,95

116,95 -JUSFTtSKU: 5071 199,95 -JUSFTtSKU: 5063 329,95

-JUSFTtSKU: 5050

-JUSFTtSKU: 6122726

BUILDERS TOOLS WOODEN FLOAT

PLASTIC FLOAT

19,95

23,95

SKU: 975

BOSCH ANGLE GRINDER 184t 8

BOSCH ANGLE GRINDER (84t 8

378,95

544,95

BOSCH ANGLE GRINDER (84t 8

SKIL ANGLE GRINDER

1152,95

SKU: 972103

SKIL ANGLE GRINDER

STRAIGHT EDGE  NtSKU: 905102

194,95 TYROLEAN MACHINE

SKU: 9121524

37,95

NEW! SKIL SKIL ORBITAL SANDER

$*3$6-"34"8t5003AC 1200 W

SKU: 300955

SKU: 972608

229,95

POINTING TROWEL

SKU: 9741122

NNt SKU: 9121510

654,95

663,95

CONCRETE WHEELBARROW SKU: 915

#3*$,5308&-tWooden Handle NNtSKU: 9121511

47,95 52,95 60,95

OUTSIDE SHARP TROWEL

BUILDER’S LINE

37,95

SKU: 941052

SKU: 9121526

718,95

SKU: 974129

WHEELBARROWS

24,95 NNt SKU: 912122 31,95  NNtSKU: 9121512

BOSCH BELT SANDER 1#4"t8

335,95

LASHER CONCRETE WHEELBARROW SKU: 914

394,95

70lb 4211

33,95

POLY WHEELBARROW SKU: 300133

DELIVERY 2 CASHBUILD SkillsOFFERS on SiteFREE LOCAL July 2011

849,95

38,95

NNtSKU: 912204

OUTSIDE COVE TROWEL

SKU: 300973

SKU: 9121514

24,95 NNtSKU: 912120 33,95

38,95

1758AA

817,95

SKU: 974237

280 x 6mm

 NNtSKU: 912103

SKU: 9121516

SKIL PNEUMATIC HAMMER

""t 8

PLASTERING TROWEL NOTCHED

GAUGING TROWEL

Plastic

226,95

NEW!

SKIL PLANER ""t 8 HAWK PLASTERING

9004AA 550W

SKU: 9741119

""t8

SKU: 9121517

SKU: 971112

SKU: 9741115

NEW!

SKU: 300953

Check your local store for price.

PVA PAINT

199,95

SKU: 9741112

226,95 476,95

SKU: 9741118

SKU: 941701

0860 100 582

POWER TOOLS SKIL

FREE

Is to buy large loads directly delivered from the supplier. No handling fee applies.

CASHBUILD SHARECALL

we’ve checked!

QUALITY BUILDING MATERIALS AT THE LOWEST PRICES 193 stores and expanding throughout southern Africa

408,95

Selected products may not be available in all stores. Prices include 14% VAT and are only valid in RSA until 24 July 2011. E & O.E. &2'(5('‡GO%HZIVXMWMRK


July 2011

4

COVER STORY

SUCCESS STORY 26 Doing it Differently

SURVEYING AND MEASUREMENT 7 How to Read Architect’s Drawings

14 36

BUSINESS MANAGEMENT 29 Win More Work With Professionally Done Quotes

CONCRETE AND CEMENT 12 Draining Around Foundations

32 LEADING INFO

INSULATION 14 No Cost Home Insulation

FINANCE 33 Insight Into Housing Developments

FLOORS AND FLOORING 19 You Can Calculate How Much Grout You Need

SAVING MONEY 34 Control Wastage On Site

ELECTRICAL 22 Solving Common Geyser Problems TRANSPORT 24 Truck Tyre Maintenance

PAVING 35 New Variety in Pavers WINDOWS AND DOORS 36 How to Clean-up Windows 38 IN TOUCH

Proprietor and Publisher: PROMECH PUBLISHING Tel: (011) 781-1401 Fax: (011) 781-1403 E-mail: skillsonsite@promech.co.za Website: www.promech.co.za Printed by: CTP Printers Tel: (011) 230-7000

Acknowledgements In order to bring you the most up-to-date information from around the globe, we make use of Internet websites that are current and provide information that is relevant to local builders. Information from the following sites has been included in this issue: WikiHow – www.wikihow. com, Stock.Xchange – www.sxc.hu

The “Skills On Site” team - Top: Susan Custers, publisher; Zinobia Docrat, production; Raymond Campling, editor. Seated: Candis Allen, advertising sales; Catherine Macdiva, administration; Jackie Nene, subscriptions/circulation.

Promech Publishing has a BEE rating of 97.2%

Copyright All rights reserved. No editorial matter published in “Skills On Site” may be reproduced in any form or language without written permission of the publishers. While every effort is made to ensure accurate reproduction, the editor, authors, publishers and their employees or agents shall not be responsible or in any way liable for any errors, omissions or inaccuracies in the publication - whether arising from negligence or otherwise or for any consequences arising therefrom. The inclusion or exclusion of any product does not mean that the publisher or editorial ERDUGDGYRFDWHVRUUHMHFWVLWVXVHHLWKHUJHQHUDOO\RULQDQ\SDUWLFXODU¿HOGRU¿HOGV

Skills on Site

July 2011

3


4

Skills on Site

July 2011


Skills on Site

July 2011

5


6

Skills on Site

July 2011


SURVEYING AND MEASUREMENT

How to Read Architect’s Drawings Often when building for a client you will need to know the whole plan. This is when being able to read an architect’s drawing helps you understand what the electrician and plumber needs, which means you can do your job better.

1

7KHÀUVWUHTXLUHPHQW in constructing a building project is to understand architectural drawings. ‡ &RYHUVKHHW7KLVFRQWDLQVWKHSURMHFWQDPHWKH DUFKLWHFW VQDPHDGGUHVVDQGFRQWDFWLQIRUPDWLRQ WKHSURMHFWORFDWLRQDQGWKHGDWH ‡   

3ODQ ,QGH[ 7KHVH SDJHV ZLOO KDYH DQ LQGH[ RI SODQVKHHWV,WDOVRZLOOLQFOXGHDQDEEUHYLDWLRQ NH\ D VFDOH EDU ZLWK WKH SODQ VFDOH DQG VRPHWLPHVGHVLJQQRWHV

‡   

/RFDWLRQSODQ7KLVZLOOKDYHDQDUHDPDSZLWK DQ HQODUJHG ORFDWLRQ PDS XVXDOO\ ZLWK LQIRUPDWLRQ WR ORFDWH WKH SURMHFW VLWH ,W LV QRW IRXQGLQDOOVHWVRISODQV

‡   

6LWH SODQV 7KHVH SDJHV DUH XVXDOO\ QXPEHUHG VWDUWLQJZLWKD&VXFKDVVKHHW&& 7KLV ZLOO FRQWDLQ VHYHUDO VKHHWV VKRZLQJ WRSR JUDSKLFDO ,QIRUPDWLRQ GHPROLWLRQ SODQ DQG site utility plans.

‡ 

$UFKLWHFWXUDO VKHHWV 7KHVH ZLOO XVXDOO\ EH QXPEHUHG$VXFKDV$DQGZLOOGHVFULEH

            

DQGJLYHPHDVXUHPHQWVIRUWKHEXLOGLQJIRRWSULQW 7KHVHVKRXOGLQFOXGH)ORRUSODQV²WKHORFDWLRQRI WKHEXLOGLQJZDOOVDQGWKLQJVOLNHGRRUVZLQGRZV DQGEDWKURRPVFHLOLQJSODQVURRIIUDPLQJSODQ ²VKRZVWKHOD\RXWDQGRWKHUGHWDLOVÀQLVKVFKHGXOH  ² D WDEOH OLVWLQJ WKH GLIIHUHQW ÀQLVKHV LQ HDFK LQGLYLGXDOURRPDQGRWKHUQRWHVGRRUZLQGRZ VFKHGXOH GHWDLOV ² WKLQJV OLNH EDWKURRP À[WXUH OD\RXWV FDELQHWV FXSERDUG ÀWWLQJV DQG RWKHU SDUWVHOHYDWLRQV UDLVHV ²YLHZVIURPWKHRXWVLGH ZKLFKVKRZPDWHULDOXVHGLQZDOOVWKHORFDWLRQRI ZLQGRZV DQG GRRUV IURP D VLGH YLHZ WKH URRI VORSHVDQGRWKHUEDVLFVVHHQIURPWKHRXWVLGH

‡        

6WUXFWXUDO SODQV 7KHVH DUH XVXDOO\ QXPEHUHG EHJLQQLQJ ZLWK 6 DV LQ 6  DQG LQFOXGHV UHLQIRUFHPHQWIRXQGDWLRQVVODEWKLFNQHVVHVDQG IUDPLQJ PDWHULDOV DV ZHOO DV WKH IRXQGDWLRQ SODQZKLFKVKRZVWKHVL]HWKLFNQHVVDQGKHLJKW VORSH RI IRRWLQJV ZLWK QRWHV DERXW WKH SODFHPHQW RI UHLQIRUFLQJ EDUV DV ZHOO DV RWKHU WKLQJVVXFKDVDIRRWLQJVFKHGXOHZKLFKLVRIWHQ VKRZQRQWKHÀUVWVKHHWRIVWUXFWXUDOQRWHVDQG Skills on Site

July 2011

7


cement innovation tŝƚŚ ŽǀĞƌ ϲϬ ƉƌŽĚƵĐƚƐ ƌĂŶŐŝŶŐ ĨƌŽŵ ďĞĂƵƟĨƵů ƐǁŝŵŵŝŶŐ ƉŽŽů ƉůĂƐƚĞƌƐ͕ ƚŽ ŝŶƚĞƌŶĂů ĂŶĚ ĞdžƚĞƌŶĂů ǁĂůů ĂŶĚ ŇŽŽƌ ĮŶŝƐŚĞƐ͕ ĐĞŵĞŶƚ ĂŶĚ ĂĐƌLJůŝĐͲďĂƐĞĚ ǁĂƚĞƌƉƌŽŽĮŶŐ ƐLJƐƚĞŵƐ͕ ĂĚŚĞƐŝǀĞƐ͕ ŐƌŽƵƚƐ ĂŶĚ ŵŽƌƚĂƌƐ͖ĂŶĚŵŽƌĞ͖LJŽƵ͛ƌĞďŽƵŶĚƚŽĮŶĚƚŚĞƉĞƌĨĞĐƚƉƌŽĚƵĐƚĨŽƌĂŶLJ ƌĞŶŽǀĂƟŽŶŽƌĐŽŶƐƚƌƵĐƟŽŶƉƌŽũĞĐƚ͘ CreteCote, Cemcrete’sŶĞǁŝŶŶŽǀĂƟǀĞŇŽŽƌƉƌŽĚƵĐƚ͕ĚŽĞƐŵŽƌĞƚŚĂŶ ũƵƐƚ ŐŝǀĞ LJŽƵ Ă ďĞĂƵƟĨƵů ŇŽŽƌ ĮŶŝƐŚ͘ /ƚ͛Ɛ ĂŵĂnjŝŶŐ ĂĚŚĞƐŝǀĞ ƋƵĂůŝƟĞƐ ĂůůŽǁƐŝƚƚŽďĞĂƉƉůŝĞĚƚŽĞǀĞŶƚŚĞŵŽƐƚĚŝĸĐƵůƚŽĨƐƵƌĨĂĐĞƐƐƵĐŚĂƐ ŽůĚƐĐƌĞĞĚƐĂŶĚĐŽŶĐƌĞƚĞ͕ĞǀĞŶĂŌĞƌƚŚĞƌĞŵŽǀĂůŽĨĐĂƌƉĞƚƐ͖ƐĂǀŝŶŐ LJŽƵƟŵĞĂŶĚŵŽŶĞLJ͘CreteCoteŝƐĞdžƚƌĞŵĞůLJĚƵƌĂďůĞ;ďĞŝŶŐĐĞŵĞŶƚͲ ďĂƐĞĚͿ͕ ĂŶĚ ŝƐ ǁĂƚĞƌƉƌŽŽĨ͕ ĞĂƐLJ ƚŽ ĐůĞĂŶ ĂŶĚ ĞĂƐLJ ƚŽ ŵĂŝŶƚĂŝŶ͘ CreteCote ŝƐ ĂǀĂŝůĂďůĞ ŝŶ ƚĞŶ ĂƩƌĂĐƟǀĞ ĐŽůŽƵƌƐ ĂŶĚ ĐĂŶ ďĞ ĨƵƌƚŚĞƌ ĞŶŚĂŶĐĞĚǁŝƚŚCemcrete’s CreteStainĐŽůŽƵƌƐLJƐƚĞŵƐ͘

tĂůůŽĂƟŶŐƐ

Cemcrete’sŐƌŽǁŝŶŐƐǁŝŵŵŝŶŐƉŽŽůƌĂŶŐĞŶŽǁŝŶĐůƵĚĞƐBeadCrete͖Ă ƐƉĞĐŝĂůŝƐĞĚƐǁŝŵŵŝŶŐƉŽŽůƉůĂƐƚĞƌǁŝƚŚƐƚƵŶŶŝŶŐŐůĂƐƐďĞĂĚƐƚŽďƌŝŶŐ ĞǀĞŶŵŽƌĞƐƉĂƌŬůĞƚŽLJŽƵƌƉŽŽů͘PoolCreteĂŶĚWŽŽůŽĂƟŶŐ;ĂŶĞĂƐLJ ƚŽ ĂƉƉůLJ ƐǁŝŵŵŝŶŐ ƉŽŽů ƉĂŝŶƚ ƚŚĂƚ ĐĂŶ ƌĞǀŝƚĂůŝƐĞ LJŽƵƌ ƉŽŽůͿ ƌĞŵĂŝŶ ĞǀĞƌƉŽƉƵůĂƌŝŶƚŚŝƐŝŶĚƵƐƚƌLJ͘

^ǁŝŵŵŝŶŐƉŽŽůŽĂƟŶŐƐ

EŽƚŽŶůLJĚŽǁĞƉƌŽǀŝĚĞƋƵĂůŝƚLJƉƌŽĚƵĐƚƐ͕ďƵƚŽƵƌŶĂƟŽŶĂůƐĂůĞƐƚĞĂŵ ŽīĞƌƐĞdžƉĞƌƚĂĚǀŝĐĞĂŶĚƚĞĐŚŶŝĐĂůĂƐƐŝƐƚĂŶĐĞ͕ŚĞůƉŝŶŐLJŽƵĐŚŽŽƐĞƚŚĞ ŵŽƐƚƐƵŝƚĂďůĞƉƌŽĚƵĐƚĂŶĚĂƉƉůŝĐĂƟŽŶĂƐŶĞĞĚĞĚ͘ View www.cemcrete.co.za for our full range or visit our show room at 227 Jan Smuts Avenue, Parktown North, Johannesburg. Or our Ideas Centres at 10 Telford Road, Industria, Johannesburg and 1 Franschhoek Crescent, Panorama, Cape Town for loads of inspiration...

Cemcrete- the cement innovation company &ůŽŽƌŽĂƟŶŐƐ

Free Application Demonstrations Looking to expand your business offering? :ŽŝŶ ĞŵĐƌĞƚĞ͛Ɛ ^ƚĞǀĞ ǀĂŶ ^ƚƌĂĂƚĞŶ Ăƚ ŽŶĞ ŽĨ ŽƵƌ &Z ŽŶĞ ĚĂLJ ƉƌŽĚƵĐƚ ĚĞŵŽŶƐƚƌĂƟŽŶƐ͘ >ĞĂƌŶ ƚŚĞ ŵŝdžŝŶŐ ĂŶĚ ĂƉƉůŝĐĂƟŽŶ ŽĨ ƚŚĞƐĞ ďĞĂƵƟĨƵů ĐĞŵĞŶƚͲďĂƐĞĚ ĐŽĂƟŶŐƐ ĂŶĚ ŵŽƌĞ͘ ^ƚĞǀĞ ŚĂƐ ŵŽƌĞ ƚŚĂŶ ϯϯ LJĞĂƌƐ ĞdžƉĞƌŝĞŶĐĞ ŝŶ ƚŚĞ ĐŽŶƐƚƌƵĐƟŽŶ ŝŶĚƵƐƚƌLJ͕ ƚŚĞ ůĂƐƚ ϭϯ ǁŚŝĐŚ ŚĞŚĂƐƐƉĞĐŝĂůŝnjĞĚŝŶĞŵĐƌĞƚĞ͛ƐǁŝĚĞƌĂŶŐĞŽĨ ĚĞĐŽƌĂƟǀĞĐŽĂƟŶŐƐ͘ >>EKtdK^hZzKhZW>͗ ^ƚĞǀĞǀĂŶ^ƚƌĂĂƚĞŶ ƐƚĞǀĞΛĐĞŵĐƌĞƚĞ͘ĐŽ͘njĂ ϬϴϯϮϲϳϳϰϱϲ

the cement innovation company Cemcrete (Pty) Ltd 8 Skills on Site

www.cemcrete.co.za July 2011

info@cemcrete.co.za

Tel. (011) 474 2415

Fax. (011) 474 2416


SURVEYING AND MEASUREMENT   

WKHQRWHVUHJDUGLQJWKHUHLQIRUFLQJUHTXLUHPHQWV WKH IUDPLQJ SODQ DQG LQWHUPHGLDWH VWUXFWXUDO IUDPLQJ SODQV ZKLFK DUH XVHG IRU PXOWLVWRUH\ construction.

‡         

3OXPELQJSODQV7KHVHDUHQXPEHUHGEHJLQQLQJ ZLWK3DQGVKHHWVZLOOVKRZWKHSODFHDQGW\SHRI SOXPELQJ LQ WKH EXLOGLQJ 7KH SODQV LQFOXGH SOXPELQJURXJKLQZKLFKVKRZVWKHORFDWLRQRI SLSHVWRFRQQHFWWKHSOXPELQJÀ[WXUHVWRZDWHU VXSSO\GUDLQZDVWHDQGYHQWV\VWHPVDQGWKH SOXPELQJÁRRUSODQZKLFKVKRZVWKHORFDWLRQDQG W\SH RI SOXPELQJ À[WXUHV DV ZHOO DV ZKHUH WKH SLSHV ZLOO EH UXQ IRU SRWDEOH ZDWHU DQG GUDLQ ZDVWHDQGYHQWV

‡   

%03 %HVW0DQDJHPHQW3UDFWLFHV GUDZLQJVRU HQYLURQPHQWDOSODQV6KRZVSURWHFWHGDUHDVRI WKH VLWH HURVLRQ FRQWURO SODQV DQG ZD\V RI SUHYHQWLQJ HQYLURQPHQWDO GDPDJH GXULQJ construction.



Locate the part of construction you are checking to do a portion of your work.,I\RXDUHOD\LQJRXWWKH ORFDWLRQRIWKHEXLOGLQJ\RXZLOOÀUVWORRNDWWKHVLWH SODQ IRU ORFDWLRQ RI H[LVWLQJ EXLOGLQJV VWUXFWXUHV RU SURSHUW\OLQHVVR\RXKDYHDUHIHUHQFHSRLQWWREH JLQPHDVXULQJ\RXUEXLOGLQJIRRWSULQW+HUHDUHVRPH H[DPSOHVWHSVIRUOD\LQJRXWDEXLOGLQJIRRWSULQWIURP architectural plans. ‡    

/D\ RXW \RXU EXLOGLQJ RQ WKH VLWH E\ WKH PHDVXUHPHQWV JLYHQ RQ WKH VLWH SODQ 0HDVXUH WRORFDWLRQVSUHIHUDEO\FRUQHUVRQRQHVLGHRIWKH EXLOGLQJ DQG FKHFN IRU DQ\ FKHFNSRLQWV WR FRQÀUPWKHFRUUHFWQHVVRI\RXUOD\RXW

‡     

(VWDEOLVKWKHKHLJKW\RXZLOOZRUNIURP7KLVPD\EH LQ UHODWLRQ WR D QHDUE\ URDGZD\ RU RQH GHWHUPLQHG IURP VHD OHYHO <RXU VLWH SODQ RU DUFKLWHFWXUDOÁRRUSODQVKRXOGKDYHDEHQFKPDUN DPDQKROHOLGIRUH[DPSOH HOHYDWLRQRUDKHLJKW DERYHH[LVWLQJJUDGHDVDVWDUWLQJSRLQW

‡ 8VH \RXU SODQ WR PHDVXUH WKH ORFDWLRQ RI HDFK  FRUQHURIWKHEXLOGLQJLQFOXGLQJRIIVHWV5HPHPEHU  ZKDWH[DFWSDUWRIFRQVWUXFWLRQ\RXDUHXVLQJIRU your layout.

‡   

0HFKDQLFDOGUDZLQJV1XPEHUHGEHJLQQLQJZLWK 0 DQG VKRZV WKH ORFDWLRQ RI KHDWLQJ YHQWLODWLRQ DQG DLU FRQGLWLRQLQJ +9$&  WRROV GXFWZRUN UHIULJHUDQW SLSLQJ DQG control wiring.

‡         

(OHFWULFDO SODQ 1XPEHUHG EHJLQQLQJ ZLWK ( 7KLV VKRZV WKH ORFDWLRQ RI HOHFWULFDO FLUFXLWV SDQHOER[HVDQGÀ[WXUHVWKURXJKRXWWKHEXLOGLQJ DV ZHOO DV VZLWFKJHDUV VXESDQHOV DQG WUDQVIRUPHUVLIWKH\DUHLQWKHEXLOGLQJ6SHFLDO SDJHVIRXQGPD\EHULVHUGHWDLOVVKRZLQJWKH RXWOLQHRISRZHUVXSSO\ZLULQJSDQHOVFKHGXOHV LGHQWLI\LQJ VSHFLÀF EUHDNHU DPSHUDJHV DQG FLUFXLWVDQGQRWHVUHJDUGLQJW\SHVDQGJDXJHV RIZLUHVDQGFRQGXLWVL]HV

3

0DUNWKHGHVFULSWLRQRIYDULRXVVKHHWVWRÀQGDSDUWRI construction you are going to use in the work you do.

4

Use the dimension scale where measurements are not provided $UFKLWHFWXUDO SODQV DUH GUDZQ WR D VFDOH$QH[DPSOHZRXOGEHFPHTXDOVPHWUHV VRPHDVXULQJEHWZHHQWZRZDOOVRQWKHSODQVKHHW PHDQVIRUHDFKFPWKHGLVWDQFHLVP7KLVLVRQO\ DQH[DPSOH<RXZLOOQHHGWRFKHFNWKHGLPHQVLRQV on each drawing. Skills on Site

July 2011

9


SURVEYING AND MEASUREMENT

 6

Read all notes on a page. 2IWHQDFHUWDLQSDUWKDVVSH cial points which are easier WR ZULWH WKDQ GUDZ 1RWHV are a tool the architect will XVHWRH[SODLQWKHVHSRLQWV

Learn to know the different types of lines the architects use.<RXVKRXOGKDYHDNH\ QRWHWDEOHIRUVHFWLRQRISODQV 7KLV ZLOOJLYHLQIRUPDWLRQRQ WKH DEEUHYLDWLRQV V\PEROV DQG VSHFLĂ&#x20AC;F OLQHV XVHG LQ HDFK VHFWLRQ RI WKH SODQV %HFDXVH WKHUH DUH PDQ\ GLIIHUHQWZD\VRIXVLQJOLQHV WR VKRZ GLIIHUHQW W\SHV RI ZDOOVSLSLQJDQGZLULQJ\RX ZLOOKDYHWRVHHWKHVLQJOHSODQSDJHNH\QRWHVWR XQGHUVWDQGWKHP

7

Use a "Builder's" calculator to add dimensions when working out distances on your plans.7KHVHDUHFDO FXODWRUVZKLFKDGGIUDFWLRQVRUPHWULFPHDVXUHPHQWV $QDUFKLWHFWPLJKWQRWJLYHDPHDVXUHPHQWWRDVSH FLĂ&#x20AC;FSODQLWHPVR\RXZLOOQHHGWREHDEOHWRDGGWKH GLVWDQFHVWRHDFKIHDWXUHZKLFKKDVDPHDVXUHPHQW SURYLGHGWRJHWWKHWRWDOGLVWDQFH$VDQH[DPSOH \RX PD\KDYH WR DGG WKH GLVWDQFH JLYHQ IURP WKH RXWVLGHEXLOGLQJOLQHWRWKHORXQJHZDOOWKHQWKHGLV WDQFHWRDSDVVDJHZDOOWKHQDFURVVDEHGURRPWR WKHEDWKURRPZDOO

9

Learn how to handle architect's plans.7KHVHDUHODUJH VKHHWVDQGIXOOFRQVWUXFWLRQVHWVPD\LQFOXGHGR]HQVRU KXQGUHGVRISDJHV7KH\FDQFRVWKXQGUHGVRIUDQGV WR UHSODFH VR WU\ WR SURWHFW WKHP DQG KDYH D Ă DW ZLGHSURWHFWHGZRUNDUHDWRXQUROODQGUHDGWKHPRQ 5HPHPEHUWKHEXLOGLQJSODQVIRUDSURMHFWRIWHQLQ FOXGHFRQWUDFWGRFXPHQWVDVZHOODVWKHDUFKLWHFW V GUDZLQJV5HTXLUHPHQWVDUHXVXDOO\SULQWHGDQGNHSW LQDELQGHUDQGOLVWPHWKRGVDQGPDWHULDOVXVHGDV ZHOODVWHVWLQJPHWKRGVDQGDORWRIXVHIXOLQIRUPDWLRQ used in building the project.

8

Use CAD (computer assisted design) building plans. ,I\RXKDYHDVHWRIDUFKLWHFWXUDOSODQVRQD&'\RX ZLOOQHHGDYHUVLRQRIWKHRULJLQDOFDGSURJUDPPH which created it.



Look for notes and symbol discussing "alternate bid items" and "addendums". 7KHVHVKRZVSLHFHVRIZRUN LQ WKH DUFKLWHFW V GUDZLQJV EXW QRW LQ WKH EXLOGHU V FRQWUDFWWREXLOGVXSSO\RULQVWDOO1,&PHDQVÂśQRW LQ FRQWUDFW¡ ZKLFK PHDQV VRPHWKLQJ ZLOO EH SXW LQ SODFHE\WKHRZQHUDIWHUWKHSURMHFWLVĂ&#x20AC;QLVKHG2)&, RZQHUIXUQLVKHGFRQWUDFWRULQVWDOOHG RU*)&, JRY HUQPHQW IXUQLVKHG FRQWUDFWRU LQVWDOOHG  VKRZV WKH LWHPLVVXSSOLHGE\WKHFXVWRPHUEXWLQVWDOOHGE\WKH FRQWUDFWRU5HDGDQGXQGHUVWDQGDOODEEUHYLDWLRQV used in your plans.

10

Skills on Site

July 2011


SURVEYING AND MEASUREMENT

11  13

Be careful your set of drawings are "original size". 0DQ\ SODQV DUH JLYHQ LQ IXOO DQG KDOI VL]HV <RX ZLOOEHDEOHWRVFDOHGLVWDQFHVZLWKIXOOVL]HGUDZLQJV without needing to calculate the scale.

WARNINGS

,IWKHGUDZLQJVDUHWUXHKDOIVL]H\RXZLOOQHHGWRGLYLGH \RXUUHDGLQJVIURP\RXUUXOHUE\WZR1RWHPRVWKDOI VL]HGUDZLQJVGRQRWVWDWHWKH\DUHKDOIVL]H

‡   

When doing real constructionIURPDUFKLWHFW VSODQV keep one set with you to record changes with red LQN7KHVHDUHFDOOHGUHGOLQHGUDZLQJV:KHQDMRELV ÀQLVKHGUHGOLQHVDUHXVXDOO\JLYHQEDFNWRWKHGUDIWHU 7KHVHDUHFDOOHG5HFRUG'UDZLQJV 5' V RU$V%XLOWV 7KLVVKRZVWKHFRUUHFWLRQVRQWKHGUDZLQJV

Use a "triangle"W\SHDUFKLWHFW VRUHQJLQHHU VUXOHIRU VFDOLQJGLVWDQFHVRQSODQV/RRNDWKRXVHSODQERRNV RURQOLQHWRJHWDQLGHDRIWKHOLQHVPHDVXUHPHQWV DQGEDVLFDSSHDUDQFHRISODQV

‡ ,I\RX·UHQRWVXUHRIDPHDVXUHPHQWLQWKHSODQV ask the architect rather than taking a chance.  ,I\RXGRLWPLJKWEHGLIÀFXOWWRÀ[ 3OXPELQJHOHFWULFDODQGPHFKDQLFDOSODQVGRQRW DOZD\VDOORZIRUHDFKWUDGHWRKDYHHQRXJKURRP LQ VLQJOH ORFDWLRQV 6R EH FDUHIXO WR PDQDJH LQVWDOODWLRQE\HDFKWUDGHWRDYRLGFRQÁLFW

‡ *HW DOOEXLOGLQJ SHUPLWV EHIRUH DQ\ FRQVWUXFWLRQ  ZRUNLVVWDUWHG%XLOGLQJLQVSHFWRUVFDQVWRSZRUN  RQDQ\SURMHFWDQG\RXFDQEHÀQHG

Things You'll Need ‡ $3ODQ7DEOH

‡ $UFKLWHFW VWULDQJOHVFDOH ‡ (QJLQHHU VWULDQJOHVFDOH ‡ +LJKOLJKWHUV ‡ %XLOGHU VFDOFXODWRU ‡ 5HGSHQ Skills on Site

July 2011

11


CONCRETE AND CEMENT

Draining Around Foundations It is very important to drain water and prevent moisture from building up around a buildingâ&#x20AC;&#x2122;s foundations and lower part of the wall. This can lead to damp problems in future and in some cases where aggressive compounds are found in the soil can attack the concrete.

7

RPDNHVXUHWKDWWKHZDOOVDQGIRXQGDWLRQVVWD\ GU\ LW LV D JRRG LGHD WR HQVXUH WKDW \RX SODQ \RXUGHYHORSPHQWVZLWKGUDLQDJHDWWKHWRSRI WKHOLVWRISULRULWLHV,QVRPHFDVHV\RXPD\KDYH WRPDNHVSHFLDOGUDLQDJHV\VWHPVWRJHWWKHZDWHU DZD\IURPDKRXVHLQ\RXUGHYHORSPHQW+HUHLVKRZ

Steps

1.

'LJDWUHQFKDURXQGWKHHGJHRIWKHIRXQGD WLRQ 7KH WUHQFK ZLOO QHHG WR EH GXJ GRZQ WR WKH ERWWRPRIWKHIRXQGDWLRQDQGEHDERXWFPZLGH <RXDOVRQHHGWRGLJDWUHQFKDZD\IURPWKHIRXQ GDWLRQ WR HLWKHU DQ LQÃ&#x20AC;OWUDWLRQ WUHQFK VLPLODU WR WKH WUHQFKDURXQGWKHIRXQGDWLRQ RUGU\ZHOO<RXPXVW DGGSHUIRUDWHGSLSHDWWKHLQÃ&#x20AC;OWUDWLRQWUHQFK7KLVLV WKHEHVWZD\WRPDQDJHWKHUXQRII$GU\ZHOOLVD SLWÃ&#x20AC;OOHGZLWKFUXVKHGVWRQH

3.

 /D\HUFUXVKHGVWRQHDQGSLSH&RYHUWKHÃ&#x20AC;OWHU IDEULFZLWKDWRFPOD\HURIFUXVKHGVWRQH1RZ LQVWDOO WKH FP SHUIRUDWHG SLSH DURXQG WKH ZKROH SHULPHWHURIWKHIRXQGDWLRQ3HUIRUDWHGSLSHFDQEH LQVWDOOHGRQOHYHOJURXQG8VHDVROLGFP39&WHHWR FRQQHFWWKHHQGVRIWKHSHUIRUDWHGSLSH<RXZLOOQRZ FRQQHFWWKHVROLGFP39&SLSHWRWKHWHHZKLFK OHDGVWRDQLQÃ&#x20AC;OWUDWLRQWUHQFKGU\ZHOORUWRGD\OLJKW &RYHUWKHSLSHZLWKFUXVKHGVWRQHWRFPDERYH WKHIRRWLQJRIWKHIRXQGDWLRQ7KHQSXOOWKHH[WUDÃ&#x20AC;O WHUIDEULFRYHUWKHFUXVKHGVWRQHPDNLQJVXUHLWODSV DJDLQVWWKHIRXQGDWLRQ,WLVLPSRUWDQWWKDWWKHIDEULF FRPSOHWHO\FRYHUWKHFUXVKHGVWRQHWKLVZLOOVWRSWKH VRLOIURPFORJJLQJWKHSLSH



/D\ WKH Ã&#x20AC;OWHU IDEULF 8QUROO WKH Ã&#x20AC;OWHU IDEULF DORQJWKHERWWRPRIWKHWUHQFKODSSLQJWKHÃ&#x20AC;OWHU IDEULFXSWKHVLGHZDOOVRIWKHIRXQGDWLRQ6PRRWK WKHUHPDLQLQJIDEULFDZD\IURPWKHIRXQGDWLRQ

4.

 &RYHU ZLWK JUDYHO )LOO ZLWK D PLQLPXP RI FPRIJUDYHOWRVWRSVRLOJHWWLQJXQGHUWKHIDEULF DQGFORJJLQJWKHGUDLQDJHV\VWHP1RZEDFNÃ&#x20AC;OO WKHWUHQFKHV7KHVRLOVKRXOGZDVKDZD\IURPWKH IRXQGDWLRQ



 /DQGVFDSH WKLVLVRSWLRQDO 7KHGUDLQDJHV\V WHPLVFRPSOHWH/D\DOD\HURIÃ&#x20AC;OWHUIDEULFRYHUWKH VRLO3ODQWVRPHSODQWVDQGFRYHUÃ&#x20AC;OWHUIDEULFZLWKEDUN PXOFK1RWRQO\ZLOO\RXKDYHDGU\EDVHPHQW\RX ZLOOKDYHORYHO\ODQGVFDSLQJ

12

Skills on Site

July 2011


CONCRETE AND CEMENT Tips

‡ ,QVWDOO JXWWHUV DURXQG DQ H[WHQVLRQ WR GLUHFW  UDLQZDWHUDZD\IURPWKHIRXQGDWLRQ ‡ $SSO\DJRRGTXDOLW\ZDWHUSURRÀQJPDWHULDOWRWKH  IRXQGDWLRQZDOOVEHIRUH\RXEDFNÀOO:DWHUEDVHG  PDWHULDOLVHDVLHUZKHQLWFRPHVWRFOHDQXS ‡ 0DNHVXUH\RXJOXHWKHSLSHWRJHWKHU

WARNINGS

‡ 6RPH ZDWHUSURRÀQJ PDWHULDOV DUH UHDOO\ RQO\ GDPSSURRI ‡ :HDUSURWHFWLYHJORYHVDQGH\HJRJJOHV

Things you’ll need

‡ FPÀOWHUIDEULF ‡ FPSHUIRUDWHGSLSH ‡ 6ROLGFP39&SLSH ‡ 6ROLGFP39&WHH ‡ *UDYHO ‡ &UXVKHGVWRQH

Skills on Site

July 2011

13


INSULATION

No Cost Home Insulation Increasing prices of electricity and paraffin means that the heating of houses in winter and cooling in summer has become an important point to consider when buying a house.

W

KHQEXLOGLQJ5'3KRXVHVFRQWUDFWRUV RIWHQKDYHQREXGJHWIRUVSHFLDOLVHG LQVXODWLRQPDWHULDOVDQGWKLVPHDQVWKDW WKHSHRSOHWKDWUHFHLYHWKHKRXVHZLOO VSHQGDORWRIPRQH\HYHU\PRQWKMXVWRQNHHSLQJ WKHKRXVH·VWHPSHUDWXUHDWDUHDVRQDEOHOHYHO

2

$OLJQKLQJHVRIGRRUVDQGZLQGRZVSURSHUO\ VRWKDWWKH\FORVHVQXJO\DJDLQVWWKHIUDPH

%XWZLWKDOLWWOHELWRIGLVFLSOLQHFRQWUDFWRUVFDQPDNH VXUHWKDWDWOHDVWWKHQDWXUDOLQVXODWLRQRIWKHEXLOG LQJLVPDLQWDLQHG

HERE IS HOW:

1

14

,QVWDOOGRRUVDQGZLQGRZVWRH[DFWPHDVXUH PHQWVDQGLQWKLVZD\NHHSJDSVWRDPLQLPXP

Skills on Site

3

July 2011

,IWKHUHLVDVPDOOJDSDWWKHERWWRPRIWKH GRRULQVWDOODUXEEHUZHDWKHUVWULSWRNHHS out the wind.


INSULATION

4

5

0DNHVXUHWKDWWKHURRIHDYHVDUHSURSHUO\ VHDOHGDQGJURXWHGULJKWXSWRWKHURRI

:KHUHFHLOLQJVDUHLQVWDOOHGPDNHVXUHWKDW MRLQWVDUHSURSHUO\PDGHDQGFRUQLFHVDUH grouted properly

6

7

8QOHVVVSHFLÀHGGRQRWLQVWDOOEULFNZDOOYHQWV

2ULHQWDWHKRXVHVVRWKDWWKHOLYLQJDUHDDQG PDLQEHGURRPIDFH1RUWK

Skills on Site

July 2011

15


DONâ&#x20AC;&#x2122;T LET DAMP DAMPEN YOUR SPIRIT! DAMPLOC Effectively Treats And Combats Rising And Penetrating Damp! DAMPLOC is suitable for use on interior and exterior surfaces such as concrete, brick and cement based plaster. It is not, however, suitable for use on gypsum based plasters.

1

t%".1-0$NVTUCFBQQMJFEUPBTPVOEBOEDMFBOTVSGBDF preferably brushed on in crossed layers. t3FNPWFBMMPMEBOEQFFMJOHQBJOUBOEMPPTFEFCSJTGSPNUIF surface with a scraper and wire brush. t4BOEEPXOBOZIBSE JNQFSWJPVTTVSGBDFTUPGPSNBSPVHI key. t #FGPSF BQQMZJOH %".1-0$  XBTI UIF surface with sugar water or degreaser and rinse. t 1SJNF DSBDLT XJUI %".1-0$ CFGPSF repairing.

DAMPLOC Available in 1, 2 & 5 Litres

2

Scrape Off Paint

3

Wire Brush Surface

4

Fix This With DAMPLOC... DIY Made EASY!

Brush Apply Crossed Layers

Open DAMPLOC

6WLU'$03/2&ZHOOZLWKDSDGGOHEHIRUHXVLQJ$SSO\WZRFRDWVE\EUXVK7KHÂżUVWFRDWLVEHVW thinned slightly with turps. A very damp surface is better treated in sections. Divide the wall into 3 or 4 sections horisontally. Start with the bottom section and let dry for 24 hours before going to the next section, and so on. Overcoat the entire area with a second coat of DAMPLOC. Prime, paint!

2311. Skills On Site July 2011

TILE OVER TILES? EASY! TileLocÂŽ Is Formulated To Adhere Even To Glass! Try It! No More Chipping Away At Painted Or Smooth Surfaces To â&#x20AC;&#x2DC;Keyâ&#x20AC;&#x2122; Them! t.JYDFNFOUXJUIQMBTUFSTBOE t"EE5JMF-PDÂŽBOENJYUIPSPVHIMZJOUPBTMVSSZ t#SVTINJYUVSFPOUPTVSGBDFXJUICMPDLCSVTI t8BJUUPESZ t5JMFPWFSBQQMJDBUJPO

1

/#4VSGBDFTTIPVMECFGSFFPGMPPTFQBSUJDMFT  scaling or ďŹ&#x201A;aking material prior to applying TMVSSZ8JSFCSVTIBOESJOTFJGOFDFTTBSZ 'PSBOFWFOTUSPOHFS BEIFTJPO NJY5JMF-PDÂŽ with your Tile cement. "MXBZTUFTUGPSTVCUSBUF integrity!

5 "EE5JMF-PD5P.JY

TileLocÂŽ

Available in 1 litre, 5 litres and 25 litres

16

Skills on Site

July 2011

2

.FBTVSF1MBTUFS4BOE

.FBTVSF$FNFOU

6 .JY*OUP4MVSSZ

3

4

.JY5IPSPVHIMZ

7 #MPDL#SVTI"QQMZ

.FBTVSF5JMF-PD

8 5JMF0OUP%SJFE4VSGBDF

Once the TileLocÂŽ slurry is applied to the surface you want to tile, merely wait for it to dry and tile as normal. The adhesion quality of TileLocÂŽ will ensure a ďŹ rm grip that will last as long as the substrate does!


INSULATION

8

9

.HHS1RUWKIDFLQJZLQGRZVFOHDUDQGXQ REVWUXFWHGVRWKDWVXQOLJKWFDQIUHHO\HQWHU the house.

10

,I\RXKDYHDFKRLFHRIPDWHULDOV XVH ZRRG RU DOXPLQLXP H[WHULRU GRRUVLQVWHDGRIVWHHO

,IWKHURRILVWLOHGLQVWDOOSODVWLFZHDWKHUSURRI sheeting underneath

Contact Candis Allen on Tel (011) 781-1401 Fax (011) 781-1403 or E-mail: skillsonsite@promech.co.za to place your advertisement bookings

Skills on Site

July 2011

17


UD Trucks implements Global Training Standards across Southern African Region

S

ince taking over responsibility for the UD Trucks Corporation’s entire subSaharan region in January 2010, UD Trucks Southern Africa has been working hard to develop and strengthen its footprint across the region. One of the company’s key focus areas is roll-out of global quality standards in dealerships across Southern Africa. For this reason, the UD Trucks Academy in Pretoria forms part of the UD Trucks Global Competence Development project, which is tasked to develop and implement global best practices for UD Trucks dealerships across all regions. UD Trucks Southern Africa’s dealer network already has to adhere to stringent quality standards, and is continuously measured across all disciplines, from parts to sales, service and admin, to bring customers only the best service and after sales support. “In a highly competitive market, we believe the key differentiator is the level of service provided to customers, no matter the size of their fleet,” said Johan Richards, CEO of UD Trucks Southern Africa. “That means that our customers can expect the same world-class quality service, no matter where they are in southern Africa.” UD Trucks Southern Africa has dealers in Angola, Botswana, Lesotho, Madagascar, Malawi, Mauritius, Mozambique, Namibia, Seychelles, Swaziland, Zambia and Zimbabwe.

Product shown in photograph is for illustration purposes only, and is subject to stock availability.

Richards said that by matching customer business insight with the global expertise inherent in the company, UD Trucks are continuously aiming to get the fundamentals right, here in South Africa and across the region. Dealer staff are therefore continuously trained to keep abreast of the latest developments within the industry, and to service customers in a passionate, professional and dependable manner. As a result, staff is enabled to solve problems faster and assist customers in finding the right solution in the shortest space of time. “The emphasis has moved away from purely training staff for the sake of training, to helping each person develop their various competencies to reach their full potential in their specific job role,” said Richards. “As a result, our customers are dealing with competent and well-informed staff.” “We believe that 70% of learning should take place on-the-job, and are therefore moving the focus away from a purely classroom based approach to a combination of self-study, on-the-job coaching and classroom training, managers at the various dealerships are taking on the responsibility of training their staff,” said Richards. “This means that our dealer staff all across the region are able to develop their competencies and skills to a level of global quality.” To support the increased demand for competence development in its export markets, the company is also introducing a train-the-trainer concept. This approach ensures that more learners can be reached in a shorter timeframe, and also eliminates the problem of language barriers. He said that this new approach provides the company with the opportunity to establish a so-called Competency Development Network across the southern African region. All of these activities will be supported by the UD Trucks Academy in Pretoria, which is Merseta-accredited and offers high-level training in sales, parts, technical skills, driver training and advanced leadership to dealers and customers. “Trucking forms an integral part of the regional economy and it is of great importance to ensure that the wheels of industry and business continue to rotate effectively and productively,” said Richards.

Passionate, Professional, Dependable 18

Skills on Site

July 2011 24 Hour Roadside Assist 0800 008 800 www.udtrucks.co.za


FLOORS AND FLOORING

The LD10 is a dry-cut core bit that was designed DQGPDQXIDFWXUHGVSHFLÃ&#x20AC;FDOO\IRUWKHSOXPELQJ electrical and air-conditioning industries. It is used on a standard drill (800-1200 Watt Drill) running between 1800 - 2200 RPM.

Calculate the amount of grout you need so you donâ&#x20AC;&#x2122;t waste

You can calculate how much grout you need TAL has a handy grout calculator to help you work out how much grout you will need when tiling. The calculator can be found on the TAL website www.tal.co.za under the DIY section. Contractors can use it for any size job as well.

T

R FDOFXODWH WKH DPRXQW RI JURXW LQVHUW WKH ZLGWKOHQJWKDQGWKLFNQHVVRI\RXUWLOHV<RX will also need to add the joint thickness you QHHG WKH WRWDO VTXDUH PHWUHV RI WLOHV LQ WKH URRP DV ZHOO DV WKH SDFNDJLQJ VL]H RI WKH JURXW LQ NLORJUDPV´7KHJURXWFDOFXODWRUDOORZV\RXWRVHHWKH H[DFWDPRXQWRIJURXW\RX·OOQHHGWRJHWWKHWLOOLQJMRE GRQHDQGZLOOVDYH\RXIURPEX\LQJPRUHJURXWWKDQ \RXQHHGµVD\V6KDURQ+LOOWHFKQLFDODGYLVHUIRU7$/ 2QFH\RXKDYHSXWLQWKHUHTXLUHGLQIRUPDWLRQWKH WRROZLOOFDOFXODWHWKHSDFNDJLQJVL]HVDQGQXPEHU RIEDJVQHHGHGWRFRPSOHWHWKHMRE7KHFDOFXODWRU LVTXLFNDQGHDV\WRXVHDQGDKHOSIXOWRROWKDWZLOO DVVLVW\RXLQEX\LQJWKHFRUUHFWDPRXQWRIPDWHULDO IRUWKHMREVRWKDW\RXFDQFXWGRZQRQFRVWV

TAL, Sharon Hill, (011) 206 9700, TAL Technical Advice Centre, Tel: 0860 000 TAL(825), Web: www.tal.co.za.

LE PURP

enduro purple segmented

Tel: +27 (0) 11 552-8310 int Tel: 0861 75 75 75 Fax: +27 (0) 11 552 8312 E-mail: info@diamondpc.co.za www.diamondpc.co.za

Skills on Site

July 2011

19


Synthetic resin polymer, which is used as a morter / screed improver and adhesive.

duralatex

USES: Â&#x2021; ,PSURYLQJDGKHVLRQRIWKLQVHFWLRQVRIFHPHQW patches, mortars and screeds to their substrates. Â&#x2021; ,PSURYLQJWHQVLOHDQGĂ&#x20AC;H[XUDOVWUHQJWKVRIVDQG and cement mix permitting thinner layers to be used.

7

his synthetic resin polymer, which is used as a mortar/ screed improver and adhesive is an additive to improve adhesion, WHQVLOHDQGĂ&#x20AC;H[XUDOVWUHQJWKVRIVFUHHGVDQGSODVWHU

Benefits Â&#x2021; 6LQJOHFRPSRQHQWOLTXLGFDQEHHDVLO\JDXJHGDVUHTXLUHG Â&#x2021; ,PSURYHVFRKHVLRQDQGZRUNDELOLW\ Â&#x2021; ,PSURYHVPRUWDUVWRSURYLGHZDWHUSURRIUHSDLUVUHQGHUVDQG toppings that are highly resistant to freeze/thaw cycling. Â&#x2021; ,PSURYHVWHQVLOHDQGĂ&#x20AC;H[XUDOSURSHUWLHVDOORZLQJWKLQDSSOLFDWLRQV Â&#x2021; ([FHOOHQWERQGWRFRQFUHWHPDVRQU\VWRQHZRUNSODVWHUDQG blockboard. Â&#x2021; &RQWDLQVQRFKORULGHV Â&#x2021; &DQEHDSSOLHGWRGDPSVXEVWUDWHV Â&#x2021; 7HQVLOHVWUHQJWKLPSURYHGE\Â&#x201C;DQGĂ&#x20AC;H[XUDOVWUHQJWK  E\Â&#x201C;XVLQJVDQGFHPHQWPRUWDU

W ha t yo u ne ed:

Â&#x2021;6WLIIEUXVK

Su rfa ce prep arat io

n: Surfaces screeded, pla stered or patched must be thoroughly clean and sound. These surfaces must be free from grease, oil and other foreign matter. Laitance, dus t, loose particles DQGDQ\VSDOOLQJRUĂ&#x20AC;DNL QJVXUIDFHVPXVWEHUH PRYHG3RURXV surfaces such as bric kwork must be thorou ghly dampened before application to prevent suction.

Cleaning Tools, brushes and mixing equipment should be cleaned immediately after use and before material has set with abe super brush cleaner followed by washing with soap and water.

Protection On Completion

Coverage Dependant on application and thickness of application. As an Adhesive SlurryÂ&#x201C;POGXUDODWH[PĂ° ÂżJXUHVDUHDSSUR[LPDWH as quantity of duralatex used to produce workability will depend on variations in mixâ&#x20AC;&#x2122;s water demand).

The newly applied mortar must be protected from rain, direct strong sunlight and wind since too rapid drying will produce shrinkage, cracking and reduce cohesion. The newly laid surface must be kept GDPSIRUDWOHDVWGD\VWRSURPRWHJRRGFXULQJRIWKH3RUWODQGFHPHQW

As a mortar or cement screed...

As an adhesive

As a mortar )RUĂ&#x20AC;RRUVFUHHGV

For more information please call an a.b.e branch or visit www.abe.co.za

20

Skills on Site

July 2011


Two component epoxy adhesive / repair compound.

epidermix 318

USES: Â&#x2021; 5HSDLULQJDQGSDWFKLQJGHIHFWVLQFRQFUHWH such as honey comb and spalls. Â&#x2021; )DEULFDWLQJFRPSRQHQWVDQGUHSDLULQJGHIHFWV  LQÂżEUHFHPHQWSURGXFWV

W ha t yo u ne ed:

T

his two component epoxy adhesive and repair compound makes it easy to patch & repair concrete holes.

Benefits Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021;

0D[LPXPVHUYLFHWHPSHUDWXUHÂ&#x17E;& &RPSUHVVLYH VWUHQJWK # Â&#x17E; & 03D LQ  KRXUV 03D in 7 days 7HQVLOHVWUHQJWK#Â&#x17E;&03D /DS VKHDU RQ JULW EODVWHG VWHHO 03D XVLQJ PP ERQG OLQH thickness 1RQWR[LFDIWHUFXUHG ([FHOOHQWZDWHUUHVLVWDQFH 5HVLVWVDOLSKDWLFVROYHQWVRLOVSHWUROGLHVHOIXHO 5HVLVWVGLOXWHLQRUJDQLFDFLGVDQGGLOXWHDONDOLV &DQEHSDLQWHGRYHU

Â&#x2021; Â&#x2021; Â&#x2021;

$FOHDQERDUGWRPL [HSLGHUPL[ WURZHORUVSDWXODWRP L[ JORYHVRUDVWHHOWURZ HOWRDSSO\PL[WXUH

Su rfa ce prep arat

io n Surfaces treated mu st be clean, sound and dry. Concrete should be chipped to expose main aggregate.

Packaging POPOOWZRFRPSRQHQWFRQWDLQHUV

Colour Grey (mixed material).

Bonding/Priming No priming is required.

Mixing Set up equal volumes of Base and Activator side by side on a clean ERDUG'RQRWWDNHPRUHWKDQDERXWPORIHDFKFRPSRXQG0L[ thoroughly with a trowel or spatula. Mixing ratio - 1 base : 1 activator.

Floor holes

Application Mixed epidermix 318 should be pressed into place in the repair area XVLQJDVPDOODPRXQWÂżUVWWRZHWRXWWKHVXUIDFHDQGWKHQEXLOGLQJXS WKHUHTXLUHGWKLFNQHVV7KHYLVFRVLW\RIHSLGHUPL[LVVXIÂżFLHQWWR KROGLWVSODFHLQVRIÂżWUHSDLUVDQGRQYHUWLFDOIDFHV,IWKHYROXPHLVWRR big to repair in one placing, leave the contact surface rough to act as a NH\IRUDVXEVHTXHQWSODFLQJRQFHWKHÂżUVWRQHKDVVHW$ÂżQDOVPRRWK ÂżQLVKPD\EHREWDLQHGE\WURZHOOLQJRIIWKHVXUIDFHRIWKHVWLOOXQFXUHG epidermix 318 with water dampened steel trowel. Apply using a gloved hand or steel trowel.

1:1 Ratio

Time needed: 0L[HGSURGXFWOLIH#Â&#x17E;&ÂąPLQVPO &XULQJWLPH#Â&#x17E;&7RXFKGU\KRXUV Practical cure : 12 hours, Full cure : 7 days 2YHUFRDWLQJWLPH#Â&#x17E;&0LQKRXUV0D[KRXUV

Mix well

Coverage 1m2OLWUHSHUPPWKLFNQHVV PD[UHFRPPHQGHGWKLFNQHVVPP

Cleaning Tools, brushes and mixing equipment should be cleaned immediately after use and before material has set with abe super brush cleaner followed by washing with soap and water.

Apply epidermix 318

For more information please call an a.b.e branch or visit www.abe.co.za Skills on Site

July 2011

21


ELECTRICAL

:

hen working on large scale housing GHYHORSPHQWVLWLVWREHH[SHFWHGWKDW WKHUH PD\ EH D SUREOHP RU WZR ZLWK VRPH RI WKH JH\VHUV :H ORRN DW WKH FRPPRQHOHFWULFDOSUREOHPVWKDWFDQ EHÃ&#x20AC;[HGHDVLO\ZLWKRXWWKHQHHGWRFDOOWKHHOHFWULFLDQV ZLULQJ RUSOXPEHUVEDFN /LRQHO6FKXOW]RI.ZLNRW6RXWK$IULFD·VOHDGLQJVXSSOLHU RIJH\VHUVJLYHV6NLOOV2Q6LWHUHDGHUVVRPHDGYLFH ´$VDJH\VHUGRHVQRWKDYLQJZRUNLQJSDUWVDVVXFK

QRWPXFKFDQJRZURQJZLWKDJH\VHULILWLVLQVWDOOHG SURSHUO\DQGFRUUHFWO\"%DVHGRQ.ZLNRW·VH[SHULHQFH PRVWSUREOHPVDUHUHODWHGWRWKHJH\VHULQVWDOODWLRQ DQGQRWWKHJH\VHULWVHOIµ

What to do if a geyser gives problems

D'HWHUPLQHZKHWKHUWKHJH\VHULVVWLOOXQGHUJXDUDQ WHH,IVWLOOXQGHUJXDUDQWHHFRQWDFWWKHPDQXIDFWXUHU RUWKHLUVHUYLFHDJHQWLINQRZQLQ\RXUDUHD E,IWKHJH\VHULVQRORQJHUXQGHUJXDUDQWHHFRQWDFW DTXDOLÃ&#x20AC;HGSOXPEHULQ \ \RXU DUHD ,W DOZD\V J JRRG WR KDYH WKH Q QDPH DQG QXPEHU R RIDUHSXWDEOHTXDOL Ã&#x20AC; Ã&#x20AC;HGSOXPEHUDOZD\V a hand. at F F,WLVLPSRUWDQWDOVR W WRHVWDEOLVKIURPWKH S SOXPEHUZKHWKHUWKH J JH\VHU SUREOHP LV F FRYHUHG E\ KRXVH R RZQHUVLQVXUDQFH)RU H H[DPSOHLIWKHJH\VHU L LWVHOILVOHDNLQJDQGWKH g guarantee period has H H[SLUHGWKLVPD\EH r result in an insurance F FODLP7KLVLVQRUPDOO\ H H[SODLQHGLQWKHLQVXU a ance handbook. K Kwikot, Lionel Schultz, Tel: ((011) 897 4600, Fax: 086 6634 8913, Email: lionel. sschultz@kwikot.com

22

Skill Skills on Sit Site

JJuly l 2011


Skills on Site

July 2011

23


TRANSPORT

Truck Tyre Maintenance In most operations where trucks are used, tyrerelated costs are second only to fuel, especially where neglect of tyres leads to increased downtime.

6

NLOOV2Q6LWHµZHQWWROHDGLQJW\UHSURGXFHU %ULGJHVWRQH6RXWK$IULFDWRÀQGRXWKRZWR PDLQWDLQ W\UHV SURSHUO\ 7KHLU H[SHUWV VD\ D W\UH PDLQWHQDQFH SURJUDPPH ZLOO KHOS WR contain costs.

7KHPDLQWHQDQFHRIW\UHVLQYROYHVDGDLO\LQVSHFWLRQ URXWLQHZKLFKVKRXOGLQFOXGH ‡,QÁDWLRQSUHVVXUHFKHFNV

To maintain correct inflation pressures: ‡ 8VHFRUUHFWULPFRPSRQHQWV

‡ &KHFN \RXU SUHVVXUH JDXJH DJDLQVW D  PDVWHUJDXJH ‡ &KHFNW\UHDSSHDUDQFHDQGFKHFNIRUDLUOHDNV ‡ &KHFNSUHVVXUHVGDLO\

Tyre appearance

‡7\UHDSSHDUDQFH )ROORZ WKHVH VWHSV WR LPSOHPHQW D PDLQWHQDQFH VFKHGXOHDFURVV\RXUÁHHWRIYHKLFOHV

$OO W\UHV VKRXOG EH LQVSHFWHG GDLO\ (DUO\ GLVFRYHU\ RI W\UH GDPDJH FDQ DYRLG WKH QHHG IRU H[WHQVLYH W\UHUHSDLUVDWDODWHUVWDJH+HUHDUHZD\VWRDYRLG SURJUHVVLYHGDPDJH

Inflation-pressure checks

1

0LVDOLJQPHQW DQG RWKHU PHFKDQLFDOGHIHFWVFDXVH UDSLGW\UHZHDU'DLO\LQVSHF tions help to highlight such GHIHFWV VR WKDW FRUUHFWLYH action can be taken early.

7\UHV KHDW XS GXULQJ RSHUDWLRQ DQG WKH SUHVVXUH LQFUHDVHV DV D UHVXOW E\DVPXFKDV7KHW\UHPXVWQRWEHEOHGWRUHGXFHWKHSUHVVXUH LQFUHDVH,IWKHSUHVVXUHLQFUHDVHVE\PRUHWKDQWKHW\UHVKRXOGEH allowed to cool and then be rechecked. $OWHUQDWLYHO\LWVKRXOGEHUHPRYHGIRU LQVSHFWLRQ3UHVVXUHVKRXOGEHFKHFNHG G Damage Action GDLO\EHIRUHVWDUWLQJWKHYHKLFOH,IWKLV V )RUHLJQPDWWHULQWUHDG 5HPRYHDQGUHSDLU LV QRW SRVVLEOH KRW SUHVVXUHV VKRXOG G 6HSDUDWLRQ 5HPRYHDQGLQVSHFW EHUHFRUGHGGDLO\$QDQDO\VLVRIWKH H UHFRUGVZLOOUHYHDOSRVVLEOHOHDNVDQG G 7UHDGFXWVLQWKHERG\ 5HPRYHDQGUHSDLU RWKHUSUREOHPVEHIRUHW\UHVEHFRPH H 7UHDGJURRYHFUDFNV &KHFNLQÁDWLRQKLVWRU\DQGUXQ EDGO\GDPDJHG 8QHYHQZHDU &KHFNDOLJQPHQWDQGLQÁDWLRQ 3UHVVXUHV PXVW EH FKHFNHG DQG G &OHDQ DGMXVWHG EHIRUH RSHUDWLQJ WKH H 2LOLPSUHJQDWLRQ YHKLFOH7KLVHQVXUHVWKDWWKHW\UHV V 7\UHWRXFKLQJYHKLFOH 5HSRUWWRPDLQWHQDQFHDQGLQVSHFW VWDUW ZRUNLQJ DW WKH UHFRPPHQGHG G FROG LQÁDWLRQ SUHVVXUHV DV VWLSXODWHG G E\%ULGJHVWRQH7KHFROGLQÁDWLRQSUHVVXUHLVWKHSUHVVXUHZKHQWKHLQWHUQDO WHPSHUDWXUHRIWKHW\UHLVWKHVDPHDVWKHRXWVLGHWHPSHUDWXUH

 3 24

3UHVVXUHJDXJHVPXVWEHDFFXUDWHDQGVKRXOGEHFKHFNHGDJDLQVWD PDVWHUSUHVVXUHJDXJHUHJXODUO\7KHPDVWHUJDXJHVKRXOGEHH[DPLQHG IUHTXHQWO\E\WKHPDQXIDFWXUHUDQGUHJXODUO\FDOLEUDWHGE\WKH6$%6 Skills on Site

July 2011


TRANSPORT

Rim and valve maintenance

/HDNVFDXVHGE\IDXOW\ULPFRPSRQHQWVZLOOOHDGWR XQGHULQĂ DWLRQH[FHVVLYHKHDWEXLOGXSDQGHYHQWXDO IDLOXUH9DOYHFDSVDQGH[WHQVLRQVDQGWKHFRQGLWLRQ RIULPVPXVWEHFKHFNHGGDLO\ Â&#x2021; 5LPV PXVW EH IUHH RI UXVW UHPRYH DQ\ UXVW E\  ZLUHEUXVKLQJRUVDQGEODVWLQJWKHQSDLQWZLWKDQ  HWFKLQJSULPHU Â&#x2021; +DQGOHULPVFDUHIXOO\WRDYRLGGDPDJLQJWKHEHDG  VHDWVDQGGLVWRUWLQJWKHULPĂ DQJHV Â&#x2021; 7DNHFDUHQRWWRGDPDJHWKHYDOYHKROH

A powerful, versatile and dust-free cutter.

Â&#x2021; ULQJVVKRXOGEHVWRUHGLQDFRROGU\SODFH

Husqvarna K 3000 Cut-n-Break

Â&#x2021; 8VH D QHZ ULQJ HDFK WLPH D W\UH LV PRXQWHG  RQDULP

Electric 230V - 2700 W - max cutting depth 400 mm - 10.4 kg

Â&#x2021; (QVXUHWKDWWKHFRUUHFWVL]HULQJLVXVHG Â&#x2021; 7DNHFDUHQRWWRGDPDJHWKHULQJGXULQJĂ&#x20AC;WWLQJ Bridgestone SA, Julio Fava, Tel: (011) 923 7500, Fax: (011) 974 1865, www.bridgestone.co.za

Contact Candis Allen on Tel (011) 781-1401 Fax (011) 781-1403 or E-mail: skillsonsite@promech.co.za to place your advertisement bookings

The Husqvarna K 3000 Cut-n-Break is a completely new electric power cutter, featuring our unique Cut-n-Break method, which allows you to make cuts up to 400 mm deep, at a very low tool cost. With the Husqvarna K 3000 Cut-n-Break we deliver new opportunities for deep cutting, in particular indoors Vut also outdoors. =t is elcellent for Ă&#x192;ush cutting, making it ideal for cutting close to walls and Ă&#x192;oors. =tÂťs also well suited for smaller jobs like window openings where you want to avoid overcutting at the corners. And the K 3000 Cut-nBreak is ideal for cutting pipes in trenches, cutting grooves for cabling and expansion joints, and for crack renovation.

www.husqvarna.co.za Share Call: 08600 48759 info@husqvarna.co.za Husqvarna is a registered trademark. Copyright Š 2010 HUSQVARNA. All rights reserved.

Skills on Site

July 2011

25


SUCCESS STORY

Doing it differently When Daddy Mabe decided to go into construction he didnâ&#x20AC;&#x2122;t want to â&#x20AC;&#x153;playâ&#x20AC;? in the usual market and rather set up a business making and fitting aluminium framed windows and doors for big scale building projects. his deci sion has VHWKLPRQ the road to success DQG SURYHV WKDW LW SD\VWRWKLQNGLIIHU HQWO\ DQG ORRN IRU opportunities in the PDUNHWZKHUHIHZ RWKHUVDUHFRPSHW LQJ IRU WKH VDPH business.

T

The new Department of Public Works Building in Bloemfontein 26

Skills on Site

July 2011

´7KHUH DUH VWLOO QRW PDQ\%((FRQWUDF WRUVLQWKHDOXPLQL XPPDQXIDFWXULQJ DQGĂ&#x20AC;WWLQJVPDUNHW who are able to GRELJMREV$ERXW VHYHQ \HDUV DJR , VDZLWDVDSHUIHFW opportunity to get into the construc tion industry and GHFLGHGWRWDNHP\ chances and only WHQGHU IRU WKH ELJ MREV1RZ,FDQVD\ it is starting to pay RIIÂľ'DGG\DGGV


SUCCESS STORY

Quality work

:LWKPDQ\VXFFHVVIXOSURMHFWVDOUHDG\XQGHUWKHEHOW KLVFRPSDQ\/DPGD3URMHFWVFFLVJHWWLQJUHFRJQL WLRQIRUTXDOLW\RIZRUNGRQHDQGLVEHFRPLQJDZHOO UHVSHFWHGPHPEHURIWKH$VVRFLDWLRQRI$UFKLWHFWXUDO $OXPLQLXP0DQXIDFWXUHUVRI6RXWK$IULFD $DDPVD  +LV ELJJHVW DQG PRVW UHFHQW SURMHFW ZDV WKH QHZ 3XEOLF :RUNV EXLOGLQJ LQ %ORHPIRQWHLQ ZKHUH WKH\ ZHUHUHVSRQVLEOHIRUWKHDOXPLQLXPDQGJODVVZRUN

Daddy Lamdaâ&#x20AC;&#x2122;s most recent project was the manufacture and installation of all the alumium and glass for the Department of Public Works Building in Bloemfontein. It included everything from standard 38 casement, to shop fronts, frameless screens and folding doors 85% of which is double glazed. All-inall the total glass coverage was about 2600m² throughout the 6-storey building.

RZQSURMHFWVÂľKHVD\V

Inspiration to succeed

7KHVWRU\RIKRZWKHEXVLQHVVZDVVWDUWHGFDQVHUYH DV DQ LQVSLUDWLRQ WR PDQ\ 'DGG\ H[SODLQV WKDW KLV EDFNJURXQG LV  WHOHFRPPXQLFDWLRQV  ZKHUH KH OHIW ZLWKWKHLQWHQWLRQRIVWDUWLQJKLVRZQEXVLQHVVEXWDOO KLVLQLWLDWLYHVIDLOHGGXHWRKLVREYLRXVODFNRINQRZO HGJHDQGH[SHULHQFHLQEXVLQHVV7KDW¡VZKHQKLVOLIH VWDUWHGWRFUXPEOHDURXQGKLP ´ ´%ULHà \,JRWGLYRUFHGQHDUO\ORVWP\KRXVH D DQG LQ WLPH KDG WR HYHQ VZDOORZ P\ SULGH DQGJRDVNP\QHLJKERXUVIRUIRRG7KDWZDV D P\ORZHVWSRLQWDQGRQHGD\,MXVWGHFLGHG P WRFKDQJHP\OLIH,UHDOLVHG,GLGQRWZDQWWR W IDLOP\FKLOGUHQ I VR , WRRN WKH GHFLVLRQ WKHUH DQGWKHQWRGRVRPHWKLQJDERXWLW D ´ ´,DOVRGHFLGHG,GLGQ¡WZDQWWRMXVWVXUYLYH, Z ZDQWHGWROLYHQRWKLQJPRGHVW,GHFLGHGWR J JRELJULJKWIURPWKHVWDUW$QG,OHDUQHGWKDW Z ZLWKGHWHUPLQDWLRQKDUGZRUNDQGDOLWWOHKHOS I IURPHYHU\GD\SHRSOH\RXFDQDFKLHYHZKDW H HYHU\RXZDQWWRDVORQJDV\RXKDYHDSODQ DQGGR\RXUUHVHDUFKXSIURQW¾ 'DGG\WHOOVXVHQWKXVLDVWLFDOO\

BEE contractors

'HWHUPLQHG WR Ă&#x20AC;QG D ZD\ RI breaking into the construc WLRQ LQGXVWU\ KH GLG GD\V RI UHVHDUFKXQWLOKHZDVVDWLVĂ&#x20AC;HG WKDWWKHUHZDVDELJFDOOIRU%(( FRQWUDFWRUVLQDOXPLQLXPDQG JODVV:LWKLQMXVWRQHPRQWKKH VHW XS DQ RSHUDWLRQ VROG KLV ROG .RPEL DQG JRW D PXFK QHHGHGĂ&#x20AC;QDQFLDODVVLVWDQWDQG ERXJKWDOOWKHEDVLFHTXLSPHQW KH QHHGHG WR PDQXIDFWXUH DOXPLQLXP FDVHPHQWV GRRU DQG ZLQGRZ IUDPHV  %\ WKH HQGRIWKDWPRQWKKHDOUHDG\ ZRQ KLV Ă&#x20AC;UVW FRQWUDFW DQG KLV OHDUQLQJFXUYHEHJDQ

7KH FRPSDQ\ KDV DOVR VXE FRQWUDFWHGRQRWKHUHTXDOO\ ZHOONQRZQSURMHFWVLQFOXGLQJ WKH'HVLJQ4XDUWHULQ)RXUZD\V $WKROO 6TXDUH :DOWHU 6LVXOX 6TXDUH2I'HGLFDWLRQ :66'  LQ.OLSWRZQ(PSHURUV3DODFH DVZHOODVVHYHUDO3RVW2IĂ&#x20AC;FHV DQG7HONRPUHWDLORXWOHWV:LWK WKLVNLQGRIH[SHULHQFHWKHFRP pany is surely on the right path WR WDFNOH HYHQ PXFK ELJJHU SURMHFWVDQGWKHFRPSDQ\LV Daddy Mabe of Lamda Construction on its way to winning contracts DVWKHPDLQFRQWUDFWRU +HUHDOLVHGTXLFNO\HQRXJKWKDWHYHQZLWKWKHJUHDWHVW ´1DWXUDOO\ZHHQWHUHGWKHLQGXVWU\DVDVXEFRQWUDFWRU GHWHUPLQDWLRQDQGZLOOWRVXFFHHGWKDWKHQHHGHG ZRUNLQJXQGHUWKHPDQDJHPHQWDQGVXSHUYLVLRQRI KHOSWHFKQLFDOO\DQGIURPDPDQDJHPHQWSRLQWRI WKHDSSRLQWHGPDLQDOXPLQLXPFRQWUDFWRUEXWWRGD\ YLHZ(PSOR\HHVZKRWKH\KLUHGWRPDQXIDFWXUHDQG KHUHZHDUHVWLOOSURYLGLQJODERXURQO\EXWLQGHSHQ LQVWDOOWKHDOXPLQLXPZRXOGRIWHQGHOLYHUSRRUTXDOLW\ GHQWO\FDSDEOHRIRUJDQL]LQJPDQDJLQJVXSHUYLVLQJ work knowing that he was not technically able to tell DQG WHFKQLFDOO\ H[HFXWLQJ WKH ZRUNV WKDQNV WR WKH whether work was up to standard. VXSSRUW DQG WUXVW .HUHQ .XOD &RQVWUXFWLRQ SXW RQ 3',CVOLNH/DPGD7KHH[SHULHQFHDQGPRQH\UDLVHG as capital will soon put us in a position where we are VWURQJHQRXJKĂ&#x20AC;QDQFLDOO\DQGWHFKQLFDOO\WRGRRXU

´<RXKDYHWROHDUQTXLFNO\DQGWKHVHNLQGRIOHVVRQV IRUFH\RXWRGRLWTXLFNO\7KHRQO\ZD\\RXFDQJHW WRDSRVLWLRQZKHUH\RXFDQ¡WEHWDNHQDGYDQWDJH Skills on Site

July 2011

27


SUCCESS STORY

Ingredients for success

'DGG\ LV TXLFN WR 'DGG\LVTXLFNWRSRLQWRXWWKDWGHVSLWHDOOWKDWWKH\ KDYH VR KDYH VR IDU IDU DFKL DFKLHYHG  WKH\ DUH VWLOO  OHDUQLQJ DQG HYHQZLWKVHYHQVXFFHVVIXO\HDUVLQFRQVWUXFWLRQKH HYHQ ZLWK VHYHQ OHDUQV VRPHWKLQJ QHZ HYHU\ GD\ ´,I \RX GRQ·W OHDUQV VRPHWK NQRZVRPHWKLQJQHYHUQHYHUEHDIUDLGWRDVNµ NQRZ VRPHW +H +H ZDQW ZDQWV /DPGD 3URMHFWV WR EH XVHG DV D PRGHO PRGHOIRUWKHGHYHORSPHQWRI%((LQWKH LQGXV LQGXVWU\DQGRWKHUVPDOOEXVLQHVVHVLQWKH FRX FRXQWU\+LVURDGPDSIRUVXFFHVVLVQRW WRR WRRGLIÀFXOWIRUDQ\HQWUHSUHQHXUWRSXW LQ LQ SODFH ,W VWDUWV ZLWK GHWHUPLQDWLRQ D DQGFUHDWLQJDSDWKWRVXFFHVVWKHQ DSODQDQGFRXUDJHWRLPSOHPHQWLW D 1 1H[WLWWDNHVQHUYHVRIVWHHOWRWHQGHU IR IRUWKHSURMHFWV\RXZDQWDQGGHDO Z ZLWKWKHVQDJVDORQJWKHZD\/HDUQ LQ LQJDOOWKHZD\DQGVWULYLQJWREHWKH EH KHOSV WR NHHS WKH PRPHQWXP EHVW JRL JRLQJIRUZDUGDQGÀQDOO\LPSOHPHQWLQJ HIIHF HIIHFWLYHEXVLQHVVPDQDJHPHQWDFURVV WKH F WKH FRPSDQ\ WR HQVXUH WHFKQLFDO DQG ÀQDQFLD ÀQDQFLDOVWDELOLW\RIWKHFRPSDQ\WRPDNH LW FRPSOH LWFRPSOHWH

Constant im improvement

RILVWRDVNH[SHUWVDQGWKRVHSHRSOHZLWKWKHH[SHUL ence and patience to help you.

Helpful hands

´'XULQJP\YHU\ÀUVWFRQWUDFWZRUNLQJRQWKH:DOWHU 6LVXOX6TXDUHLQ.OLSWRZQ,ZDVIRUWXQDWHHQRXJKWR PHHWDQGZRUNZLWK$QGUHZ5LOH\RI*ULQDNHU)DFDGHV +HZDVDJUHDWKHOSDQGWRRNWKHWLPHWRHQFRXUDJH PH DQG PHQWRU PH +H ZDV QRW WKH RQO\ RQH ZKR KHOSHGPHWKRXJK ´, ZDV OXFN\ LQ PDQ\ ZD\V DQG ZKHQ , VWDUWHG WKH EXVLQHVV KDG SHRSOH ZKR SXW WKHLU WUXVW LQ PH DQG P\DELOLW\WRPDNHDVXFFHVVRIWKHRSSRUWXQLW\-XVW WR PHQWLRQ D IHZ SHRSOH OLNH 7OKDOHIDQJ 6HNDQR ZKRZDVP\XQLRQOHDGHUDW7HONRPDQGP\FXUUHQW SDUWQHU6WHYH0DOHNDEHOLHYHGLQPHHQRXJKWRRIIHU ÀQDQFLDODVVLVWDQFHWRVWDUWWKHEXVLQHVV ´7KHQWKHUHDUHSUR%((FKDPSLRQVOLNH&KDUOHV+RI PDQRI.HUHQ.XOD&RQVWUXFWLRQZKRKDVJRQHRXWRI KLVZD\WRKHOSXVVXFFHHG+HIUHHO\OHQGVKLV\HDUV RIH[SHULHQFHWRKHOSRXUFRPSDQ\VXFFHHG/DPGD has to thank all these people along the way and in IXWXUHZHDUHFRPPLWWHGWRKHOSSHRSOHLQWKHVDPH ZD\DVZHKDYHEHHQKHOSHGµ

28

Skills on Site

July 2011

´:KHQ WKH ZRUN LV ´:KHQWKHZRUNLVGRQHDIWHUHDFKSURMHFWLWSD\VWR WDNHDEUHDNWRUHÁHFWDQGLGHQWLI\WKHKLJKOLJKWVRI WDNH D EUHDN WR UH HDFKSURMHFW$OVRWRORRNDWWKLQJVWKDWZHQWZURQJ HDFK SURMHFW $OV DQGKRZWRVWRSLWKDSSHQLQJDJDLQLQIXWXUH,QWKLV ZD\\RXFRQVWDQWO\LPSURYHDQGHQWHUWKHQH[WSURM ect with a clear head. )URPWKHGDUNGD\VEHIRUHVWDUWLQJ/DPGD3URMHFWV WKHFRPSDQ\LVQRZVXUHO\RQWKHULJKWSDWKWRVXFFHVV DQGEXVLQHVVLVSURPLVLQJ´7KHJRDOLVWRJURZWKH EXVLQHVVIURPZRUNLQJDVDODERXURQO\FRQWUDFWRUWR DIXOO\LQGHSHQGHQWFRQWUDFWRUVRWKDWZHFDQHDV LO\ZLQWHQGHUVDVWKHPDLQFRQWUDFWRU$OVRWRVWDUW ELJPDQXIDFWXULQJSODQWVLQWKHWRZQVKLSVZKHUHZH FDQKHOSGHYHORSWKHFRPPXQLWLHVDQGSHRSOHLQWKH VDPHZD\DVZHKDYHEHHQGHYHORSHG ´$VVLVWDQFHWKDWZHKDGDORQJWKHZD\KDVKHOSHG XVWRJURZWKHEXVLQHVVWHFKQLFDOO\LQWRDVXFFHVVIXO RQHDQGZKHQZHDUHLQDSRVLWLRQWRGRWKHVDPH IRURXUFRPPXQLW\ZHZLOO ´$VDPDWWHURIIDFWLQDOORXUSURMHFWVZHFRQVWDQWO\ UHFUXLWSHRSOHZKRNQRZQRWKLQJDERXWDOXPLQLXP DQGJODVVDQGJLYHWKHPWKHVNLOOV$JRRGQXPEHU RIWKHPKDYHVLQFHMRLQHGELJFRPSDQLHVDQGZH DUHKDSS\DERXWWKDW:KDWZHFULWLFDOO\QHHGQRZ LVWRGHYHORSVRPHV\VWHPVZKLFKZLOOHQVXUHWKDWWKH EXVLQHVVLVVXVWDLQDEOHµFRQFOXGHV'DGG\ Lamda Projects, Daddy Lamda, Tel: 071 124 5966, Email: lamda@ webmail.co.za


BUSINESS MANAGEMENT

Win More Work With Professionally Done Quotes Disagreements are common between clients and contractors in the building industry and sorting them out can be difficult, often leaving both parties unhappy. By doing quotes for jobs you are trying to get, you look more professional and let the client know exactly what to expect. It is also proof of what you agreed on, in case there is a problem later.

What is a quote?

$4XRWHLVDGRFXPHQWWKDWDFRQWUDFWRUGUDZVXS,W LVOLNHDSURSRVDOWRWKHFXVWRPHUDQGLQFOXGHVDOOWKH FRVWVVHUYLFHVPDWHULDOVDQGODERXUWKH\DUHJRLQJ WRXVHWRFRPSOHWHWKHMRE,IWKHTXRWHLVDFFHSWHG E\ WKH FOLHQW LW FUHDWHV D OHJDO FRQWUDFW EHWZHHQ WKHFRQWUDFWRUDQGWKHFXVWRPHU7KHFXVWRPHUFDQ DFFHSWWKHTXRWHE\HLWKHUVD\LQJWKH\DJUHHWRLW RUE\VLJQLQJLWDQGJLYLQJLWEDFNWRFRQWUDFWRU 7R ZRUN RXW D TXRWH \RX Ã&#x20AC;UVW QHHG WR ZRUN RXW HY HU\WKLQJ\RXQHHGWRGRIRUWKHMREDQGKRZPXFK WLPHLWLVJRLQJWRWDNH7KDWLVKRZ\RXZRUNRXWWKH ODERXU'RQ·WIRUJHWDERXWFOHDQLQJXSWKHVLWHDQG UHPRYLQJUXEEOHDIWHUZDUGVWKLVZLOOWDNH\RXWLPHDV ZHOOVR\RXPXVWFKDUJHIRUWKLV 7KHQ\RXQHHGWRZRUNRXWZKDWPDWHULDOV\RXDUH JRLQJWRXVHDQGKRZPXFKRIWKHVHPDWHULDOVWKH job needs.

What a quote needs to have in it

Â&#x2021;$OORI\RXUFRPSDQ\·VRU\RXURZQGHWDLOVVXFKDV \RXUQDPHDGGUHVVFRQWDFWLQIRUPDWLRQDQGEDQN ing details.

Â&#x2021; 'DWHWKDW\RXZURWHWKHTXRWH Â&#x2021; 4XRWHQXPEHU7KLVKHOSV\RXNHHSWUDFNRI\RXU TXRWHVDOZD\VNHHS\RXURZQVSDUHFRS\RIDQ\ TXRWH\RXVHQG Â&#x2021; 'HWDLOHGOLVWLQJRIZKDWPDWHULDOVDQGKRZPXFKRI WKHVHPDWHULDOV\RXDUHJRLQJWRQHHG$OVRZRUNRXW KRZPXFKHDFKRIWKRVHPDWHULDOVLVJRLQJWRFRVW Â&#x2021; :KDW WKH TXRWH LQFOXGHV DQG H[FOXGHV LQ VRPH

Always know the current cost of materials

Helpful hints

,I \RXU FXVWRPHU ZDQWV WR FKDQJH DQ\WKLQJ RU \RXQHJRWLDWHDGLIIHUHQWSULFHVHQGDUHYLVHG TXRWHWKDWKDVDOOWKHFKDQJHVPDGHWKDW\RX GLVFXVVHG7KHPRUHHYLGHQFH\RXKDYHRIWKH RULJLQDODJUHHPHQWWKHPRUHSURRI\RXKDYHLV DSUREOHPDULVHVODWHU &KHFNSULFHVRIPDWHULDOVUHJXODUO\WKHVHSULFHV FDQFKDQJHRIWHQDQG\RXGRQ·WZDQWWRTXRWH SULFHVIURPPRQWKVDJRDQGKDYHWRSD\PRUH IRUWKHPDWHULDOVRXWRI\RXURZQSRFNHW 'RQ·WWU\DQGEHWKHFKHDSHVWMXVWWRJHWWKHMRE \RXQHHGWRTXRWHDUHDOLVWLFSULFHRU\RXZLOOUXQ LQWRWURXEOHODWHURQZKHQ\RXJRRYHUEXGJHW :RUGRIPRXWKLVWKHEHVWZD\WRJHWPRUHEXVL QHVV'RQ·WWU\DQGEHWKHFKHDSHVWEHFDXVHLI \RXPDNH\RXUTXRWHWRRFKHDS\RXPLJKWJHW WKHMREEXW\RXPLJKWQRWEHDEOHWRGRDSURSHU MREIRUWKDWDPRXQWRIPRQH\2U\RXFRXOGUXQ RXWRIPRQH\DQGKDYHWRDVNWKHFOLHQWIRUPRUH PRQH\WKDQWKH\RULJLQDOO\SODQQHGRQVSHQGLQJ 7KLVPHDQV\RXZLOOKDYHDQXQKDSS\FXVWRPHU ZKRZLOOWHOOWKHLUIULHQGVQRWWRXVH\RX

Skills on Site

July 2011

29


30

how can we help you? Skills on Site

July 2011


BUSINESS MANAGEMENT

An example of a quote

FDVHVWKHFOLHQWPLJKWVXSSO\WKHPDWHULDOV Â&#x2021; )LQDO DPRXQW RI PRQH\ RQFH HYHU\WKLQJ RQ WKH TXRWHKDVEHHQDGGHGXS Â&#x2021; :KHWKHURUQRW\RXDVNIRUDGHSRVLWDQGKRZPXFK the deposit is going to be. Â&#x2021; 7KHGDWHZKHQWKHTXRWHH[SLUHV7KLVLVEHFDXVH you donâ&#x20AC;&#x2122;t want your client thinking they can still get

Calculate how many materials you need for a job so you donâ&#x20AC;&#x2122;t over or under quote on materials

\RXWRGRWKHVDPHMREGRQHIRUWKHVDPHSULFHD \HDUODWHUZKHQSULFHVKDYHJRQHXS Â&#x2021; 3D\PHQWV WHUPV 7KHVH FRXOG EH KRZ ORQJ DIWHU FRPSOHWLRQRIWKHMREWKHFOLHQWPXVWSD\\RXRU LI \RX ZDQW SURJUHVV SD\PHQWV ZKLOH ZRUNLQJ RQ the job.

A happy client will give you more business

Skills on Site

July 2011

31


LEADING INFO These statistics are provided exclusively for Skills on Site readers by Databuild, the leading provider of construction related information in South Africa. Databuild has been providing information for thirty five years and tracks projects from SODQQLQJWKURXJKWRDZDUGHGVWDJHV(DFKPRQWK'DWDEXLOGZLOOSURYLGHVWDWLVWLFVUHIOHFWLQJWUHQGVLQWKHLQGXVWU\)RUPRUHLQIRUPDWLRQDERXW 'DWDEXLOGSOHDVHFRQWDFWXVRQ  RUYLVLWXVDWZZZGDWDEXLOGFR]D

Value of awarded projects by province in Rmillions May 2011 Province

Value in Rbillions

(DVWHUQ&DSH



Free State

130

Gauteng



KwaZulu Natal

814

Limpopo



Mpumalanga



North West



Northern Cape



Western Cape



Grand Total

6,197

CIDB GRADING

CIDB Value in Grade 1 Rmillion

(DVWHUQ&DSH Free State Gauteng 1 KwaZulu Natal Limpopo Mpumalanga North West Northern Cape Western Cape Total value per grading 1 in Rmillions

 32

Skills on Site

0.3

0.3

July 2011

CIDB Value in CIDB Value in Grade 2 Rmillion Grade 3 Rmillion 2 4   2  2 1 7 17 21 31 2   11 4 4 3 3 1 1 2 3 8 4 8 12 19 23 53 89

CIDB Grade 4  1 1 8 12 17 3 3 11 61

Value in Rmillion 12 4 3 20   11  38 194

CIDB Grade 5 3 3  17  2 2 3 11 53

Value in Rmillion  21   44 4 148 12  457

CIDB Grade 6   13 14 14

Value in Rmillion 43   134 112

3 2 10 67

 8  589


FINANCE

Insight Into Housing Developments FNB agrees with the call by Human Settlements Minister Tokyo Sexwale for an increased focus on housing the emerging middle class, but cautions that Government needs to address several other pressing challenges if it is to meet its target of 600 000 houses by 2014.

0

inister 6H[ wale w a s TXRWHG UHFHQWO\ DVVD\LQJKHH[ pects banks to JUDQW   KRPH ORDQV WR WKH HPHUJLQJ P L G G O H  F O D V V  WKHVRFDOOHGDI IRUGDEOHKRXVLQJ PDUNHWRYHUWKH QH[WPRQWKV

)1%LVRQHRIWKH OHDGLQJÃ&#x20AC;QDQFLHUV LQWKHDIIRUGDEOH KRXVLQJ PDUNHW VSDFH LQ 6RXWK )1%+RXVLQJ)LQDQFH&(20DULXV0DUDLV $IULFD ZLWK RYHU RIQHZEXVL QHVVPDUNHWVKDUH6LQFHWKHEDQNKDVÃ&#x20AC;QDQFHG PRUHWKDQXQLWVLQWKLVPDUNHW )1%+RXVLQJ)LQDQFH&(20DULXV0DUDLVVD\VEDQNV KDYHDVLJQLÃ&#x20AC;FDQWSDUWWRSOD\LQJURZLQJWKHPDUNHW 7DLORUPDGHÃ&#x20AC;QDQFLDOVROXWLRQVDUHUHTXLUHGWRHQDEOH FXVWRPHUV WR RZQ WKHLU Ã&#x20AC;UVW KRPHV DQG Ã&#x20AC;QDQFLDO LQ VWLWXWLRQVDOVRKDYHWRZRUNDURXQGWKHIDFWWKDWWKH ODFNRIDGHSRVLWFRXOGEHDPDMRUVWXPEOLQJEORFN IRUFXVWRPHUVZDQWLQJWRJHWRQWKHSURSHUW\ODGGHU ´,QDGGLWLRQZHQHHGWRLQFUHDVHFRQVXPHUHGXFD WLRQRQKRPHRZQHUVKLSLVVXHVVRWKDWWKH\GRQ·WEX\ DKRXVHWKH\FDQ·WDIIRUGDQGZKDWWRGRLQWKHFDVH RIÃ&#x20AC;QDQFLDOGLIÃ&#x20AC;FXOWLHVµKHDGGV %XWKHSRLQWVRXWPDQ\RIWKHLVVXHVZKLFKVORZGRZQ

WKHJURZWKRIDIIRUGDEOHKRXVLQJIDOORXWVLGHWKHUH VSRQVLELOLW\RIÃ&#x20AC;QDQFLDOLQVWLWXWLRQVDQGZRXOGKDYHWR EHDGGUHVVHGGLUHFWO\E\*RYHUQPHQW7KHVHLQFOXGH Â&#x2021;7KHDYDLODELOLW\RIVXLWDEOHODQG Â&#x2021;7KHUDSLGSURYLVLRQRILQIUDVWUXFWXUHVXFKDV URDGVZDWHUHOHFWULFLW\DQGVDQLWDWLRQ Â&#x2021;7KHIDVWWUDFNLQJRIDWDLORUHGKRXVLQJVROX WLRQIRUJRYHUQPHQWHPSOR\HHV Â&#x2021;7KHHVWDEOLVKPHQWRIWKHJRYHUQPHQWEDFNHG PRUWJDJHLQVXUDQFHIXQG Â&#x2021;7KHLQYROYHPHQWRIPRUHSURSHUW\GHYHORS HUVLQWKLVPDUNHW Â&#x2021; 7KH XVH RI DOWHUQDWLYH WHFKQRORJLHV DQG HQHUJ\HIÃ&#x20AC;FLHQWEXLOGLQJV\VWHPV Â&#x2021;7KHIRUHYHUFKDQJLQJHFRQRPLFHQYLURQPHQW VXFKDVHPSOR\PHQWLQWHUHVWUDWHVF\FOHVHWF  DOO WKHVH LPSDFW RQ DIIRUGDELOLW\ SRVLWLYHO\ RUQHJDWLYHO\

´(DFKRIWKHVHGULYHUVQHHGVFDUHIXODWWHQWLRQ7KH\ UHTXLUHFDUHIXOWKRXJKWSURFHVVHVSROLFLHVDQGLPSOH PHQWDWLRQSODQVWKDWZRUNLQWDQGHPWRGHOLYHUWKH EHVWUHVXOWµ0DULXVVD\V ´:KHQDOOLVVDLGDQGGRQHWKHVXFFHVVIXOSURYLVLRQ RIDIIRUGDEOHKRXVLQJLQ6RXWK$IULFDUHTXLUHVHIIRUW IURPPXOWLSOHVWDNHKROGHUVDQGDVPDUNHWOHDGHU)1% LVIXOO\FRPPLWWHGWRFRQWLQXHSOD\LQJLWVSDUW%XWZH FDQQRWGRLWDORQHDQGDPRUHHQDEOLQJHQYLURQPHQW LV UHTXLUHG DFURVV WKH ERDUG :LWKRXW WKLV LW ZLOO EH GLIÃ&#x20AC;FXOWWRUHDFKWKHVHWDUJHWVµKHFRQFOXGHV First National Bank, Busi Mngomezulu, Tel: (011) 371 9124, Email: bmngomezulu@fnb.co.za Skills on Site

July 2011

33


SAVING MONEY

Control of wastage and breakage on site is the key to more profits from building construction. Here are a few simple ways to cut wastage and increase productivity on your site:

S 5

1

torage

6WRUHVDQGVIRUFRQFUHWHPRUWDUDQGSODVWHU VHSDUDWHO\DVQHDUWRWKHVWUXFWXUHDQGPL[ ing area as possible.

‡ 7KH\VKRXOGEHSODFHGRQZHOOFRPSDFWHGFOHDQ JURXQGRUSODWIRUPVFRQVWUXFWHGRIEURNHQEULFNVDJ JUHJDWHRUHYHQDZHDNFRQFUHWHPL[WXUHIRUODUJHU SURMHFWVWRSUHYHQWFRQWDPLQDWLRQ 3UHIHUDEO\ VWRUH EDJJHG FHPHQW LQDORFNDEOHKXWRQDUDLVHGÁRRU  SURWHFWHG IURP UDLQ DQG ULVLQJ GDPS

easy techniques to use

+DQGPL[LQJRIFRQFUHWHDQGPRUWDUVKRXOGRQO\EHGRQHRQ VPDOOSURMHFWVRUIRUVPDOOTXDQWLWLHVRIPDWHULDO

2

+LULQJDFRQFUHWHPL[HUDWWKHIRXQGDWLRQDQGÁRRUVODEVWDJH FRXOGVDYHPRQH\

3

'UDZXSDVLPSOHEDUFKDUWVKRZLQJWKHFRQVWUXFWLRQVWDJHV RI HDFK FRPSRQHQW RI WKH KRXVH DQG SODQ \RXU GHOLYHU\ VFKHGXOHZLWK\RXUVXSSOLHUVLQDGYDQFH

4

+LJKYDOXHZLQGRZIUDPHVGRRUIUDPHVHWFVKRXOGDUULYHRQ WKHGD\RILQVWDOODWLRQWRUHGXFHWKHFKDQFHRIWKHIWDQGWKH QHHGIRUVWRUDJH 0DUNRXWDQDUHDRQVLWHIRUDOOUXEELVKDQGZDVWH$WLG\EXLOGLQJ VLWHPHDQVDPRUHSURIHVVLRQDOORRNLQJFRQWUDFW

5 34

$WWKHHQGRIHDFKGD\HQVXUHWKDWDOOEXLOGLQJUXEEOHDQG XQXVHGPRUWDULVPRYHGRQWRWKHUXEELVKKHDSEHIRUHLWVHWV

Skills on Site

July 2011

‡ ,IRXWGRRUVVWRUHRQZRRGHQ SDOOHWV ZHOO FRYHUHG ZLWK SODVWLF sheeting or a tarpaulin suitably ZHLJKWHG GRZQ IRU ZLQG\ FRQGL tions. 6WDFNEULFNVRQÀUPKDUGJURXQGDV FORVHWRWKHVWUXFWXUHDVSRVVLEOH SURWHFWHG IURP VWRUP ZDWHU DQG VSODVKLQJZLWKPXG 3URWHFWZRRGHQRUDOXPLQLXPGRRU DQGZLQGRZIUDPHVIURPGDPDJH E\ZKHHOEDUURZVVFDIIROGLQJHWF Clay Brick Association, Tel: (011) 805-4206, Fax: (011) 315-3988, Web: www.claybrick. org.za


PAVING

New

s r e v a P n i y t e i r Va

Corobrik in the Western Cape has developed three exciting new clay paver â&#x20AC;&#x2DC;accessories.

T

KHVOLP3LD]]DUDQJHWKDWZDVLQLWLDOO\SURGXFHG DW WKH 6SULQJV IDFWRU\ DQG WHVW PDUNHWHG LQ *DXWHQJLQWKH+LOOEURZLQQHUFLW\UHGHYHORS PHQWSURMHFWDQGWKHUHDIWHUDWWKH.LQJ6KDND ,QWHUQDWLRQDO$LUSRUWZLOOEHORFDOO\SURGXFHGLQ5XVWLF %OHQG$XWXPQ:KHDWVWRQHDQG5HGFRORXUV7KH3L D]]DSDYHUPHDVXUHV[[PPKDVQREHYHO and works well on its own in courtyard applications RUFRPSOHPHQWLQJRWKHU&RUREULNFOD\SDYHUVLQWKH VWDQGDUGUHFWDQJXODUIRUPDWV 7KHQWKHUHLVWKH&LRWWRORRUFREEOHSDYHUPHDVXULQJ [[PPDYDLODEOHLQWKH$XWXPQ:KHDWVWRQH DQG5HGFRORXUV 7KHSDYHUIRUPDWLVLGHDOIRUFREEOHGSDYHPHQWVDQG SURYLGHVH[FHOOHQWRSSRUWXQLW\WRFUHDWHSDWWHUQVDQG GHÃ&#x20AC;QLWLRQWRERUGHUVLQELJSDYHGDUHDV )LQDOO\WKHUHLVWKH[[PP'RSSLRRUSDYHU WLOHZLWKDQHDUWK\WLOHORRNDQGIHHODQGSDUWLFXODUO\ XVHIXOIRUDGGLQJSDWWHUQVDQGLQWHUHVWWRSDYLQJ &RUREULN KDV EHHQ PDQXIDFWXULQJ DQG PDUNHWLQJ FOD\IDFHEULFNVDQGSDYHUVLQ6RXWK$IULFDIRURYHU \HDUVDQGWKHVHIRUPDWVUHSUHVHQWDQRWKHUVWHS LQWKHLURQJRLQJHYROXWLRQWREULQJQHZRSSRUWXQLWLHV WRWKHPDUNHWWREHDXWLI\RXUFLWLHVWRSURYLGHSDYHG VXUIDFHVZLWKQDWXUDOWH[WXUHVDQGJUHDWORRNV

Corobrik, Christie van Niekerk, Tel: (021) 888 2300

Corobrik Autumn Piazza paver wall with Corobrik Rustic Blend Piazza Paver soldier courses. Corobrik Rustic Blend Piazza Paver paving in front of wall

Skills on Site

July 2011

35


WINDOWS AND DOORS

How to Clean-up Windows

O

QHRIWKHODVWWKLQJVWKDWEXLOGLQJFRQ WUDFWRUV ÀQG WKHPVHOYHV GRLQJ RQ VLWH LVFOHDQLQJXSWKHVLWH:KHQFOHDQLQJ ZLQGRZV WKHUH DUH PDQ\ PHWKRGV WR UHPRYHSDLQWIURPWKHJODVV+HUHLVRQH RIWKHTXLFNHVWDQGPRVWHIIHFWLYHZD\V

1. :HWWKHJODVVZLWKFOHDQZDWHUDQGDUDJ

2. 7DNHDUD]RUVFUDSHU SUHIHUDEOH RUEODGHWKDW\RX EUHDNLQKDOIVRWKDW\RXRQO\KDYHRQHFXWWLQJHGJH IRU\RXURZQVDIHW\

36

Skill Skills on Sit Site

JJuly l 20 2011


WINDOWS AND DOORS

4. *HQWO\ WKLVLVQRWKDUGZRUNWKHUD]RUEODGH ZLOOGRWKHZRUNIRU\RX SXVKWKHEODGHLQWR WKHSDLQWRQWKHZLQGRZ ZKLFKPXVWUHPDLQ ZHW  DQG ZDWFK WKH SDLQW SHHO RII HDVLO\ HLWKHU DOO DW RQFH RU LQ OD\HUV DV WKH EODGH SHHOVSDLQWRII

What you need 1. $UD]RUEODGH SUHIHUDEO\DUD]RUVFUDSHU ZLWKDKDQGOH

:DWHUDQGDEXFNHW 3. $FORWK 4. 6RDS

3. 3XWLWRQWKHJODVVVRWKDWWKHEODGHLVIDFLQJWKHGL UHFWLRQ\RXZDQWWRSXVKLW+ROGLWDWDQDQJOHRIOHVV WKDQGHJUHHVWRWKHZLQGRZ LWPXVWEHFORVHUWR ÁDWZLWKWKHZLQGRZWKDQVWDQGLQJXS 

More tips

‡'RQ·WFOHDQWKHJODVVEHIRUH\RXSDLQW EHFDXVHWKHÀQHOD\HURIGLUWZLOOPDNHLW HDVLHUWRVFUDSHWKHSDLQWRII ‡'RQ·WERWKHUWRSXWWDSHRQWKHZLQGRZV EHFDXVHLI\RXVFUDSHWKHSDLQWRIIZLWKLQ DGD\RUWZRWKHSDLQWFRPHVRIIHDVLO\ ‡:KLOHOHDYLQJWKHEODGHDWDFRQVWDQW DQJOHSXVKDQGSXOOWKHEODGHWRZDUGV DQG DZD\ IURP WKH SDLQW DOORZLQJ WKH EODGHWR´KDYHDQRWKHUWU\µDWWKHPRUH VWXEERUQSLHFHVRISDLQW ‡,IWKHSDLQWLVKDUGDQGLVVWRSSLQJWKHEODGH FRPSOHWHO\DSSO\PRUHIRUFHZKLOHNHHSLQJ WKHEODGHDWWKDWVDPHVKDOORZDQJOH7KH JODVVLVQRWWDNLQJWKHLPSDFWRIWKHEODGH the paint is.

Caution

, +DQGOHWKHUD]RUZLWKFDUHHVSH FLDOO\EHFDXVH\RXPD\QRWIHHO it cut into your skin. , 'RQ·WSUHVVWKHUD]RUDJDLQVWWKH window as it will probably scratch the glass. , 'RQ·WGRWKLVRQDGU\ZLQGRZ , 2OGJODVVLVPRUHEULWWOHEHFDUHIXO DERXWDSSO\LQJWRRPXFKSUHVVXUH WRWKHFHQWUHRIWKHZLQGRZ

Skills on Site

July 2011

37


,Q7RXFK A

cademy trains emerging contractors

7KH5RFOD$FDGHP\UHFHQWO\KHOGWZRWUDLQLQJSUR JUDPPHVDWWKH5RRGHSRRUWSODQWZKHUHFRQ WUDFWRUVZHUHJLYHQWKHRSSRUWXQLW\WRJDLQLQVLJKW RQWKHLQVWDOODWLRQDQGOD\LQJRIVWRUPZDWHUSLSHV DQGFXOYHUWV,QDGGLWLRQWRDIDFWRU\YLVLWXVHIXOLQ IRUPDWLRQZDVVKDUHGUHJDUGLQJEHVWSUDFWLFHDQG FRUUHFWLQVWDOODWLRQWHFKQLTXHVRQDOO5RFODSUHFDVW FRQFUHWHSURGXFWV$GLVFXVVLRQZDVKHOGDIWHUWKH WUDLQLQJVHVVLRQWRDOORZPHPEHUVWRJDLQDGHHSHU XQGHUVWDQGLQJRIWKHPDWHULDOSUHVHQWHG

Training included handling of Roclaâ&#x20AC;&#x2122;s precast products

&UDLJ :DWHUVRQ PDUNHWLQJ GLUHFWRU DW 5RFOD VD\V ´6LQFHWKHHVWDEOLVKPHQWRIWKH5RFOD$FDGHP\LQ WKHVZHDUHFRQWLQXRXVO\DSSURDFKLQJEHQHÃ&#x20AC; FLDULHVZKRFDQEHQHÃ&#x20AC;WE\WKHVNLOODQGNQRZOHGJH WUDQVIHUIURPRXUH[SHUWSDQHO

´%\KDYLQJRXUPHPEHUVDWWHQGWUDLQLQJOLNHWKH5RFOD $FDGHP\ZHHQVXUHWKDWWKH600(VHFWRUVDVWKH JUDVVURRWHFRQRPLFUROHSOD\HUVDUHEHWWHUSUHSDUHG IRUWKHIXWXUHDQGWKHPDLQVWUHDPHFRQRP\µ 5RFOD UXQV  WUDLQLQJ VHVVLRQV SHU \HDU ZKLFK DUH RUJDQLVHGWRPHHWFXVWRPHUQHHGVDQGDUHUXQDWDOO RI 5RFOD·V PDQXIDFWXULQJ VLWHV DFURVV 6RXWK $IULFD DVZHOODVLQDUHDVVXFKDV(DVW/RQGRQDQG/HVRWKR ZKHUH5RFODKDVQRIDFWRU\ Rocla, Erika Gibbens, Tel: (011) 670 7600, Email: erika.gibbens@murrob.com

0HPEHUVRIWKH6RZHWR600(&RQWUDFWRUV)RUXPUHFHQWO\DWWHQGHG skills development training at Rocla Academy

´7KH6&&)LVDQLGHDOUHFLSLHQWDVWKHLUIRUXPPHP EHUV FRPSULVH FRPSDQLHV WKDW DUH LQ EXLOGLQJ DQG FLYLO FRQVWUXFWLRQ $QRWKHU UHDVRQ LV 6&&)·V IRFXV RQ GHYHORSPHQW DQG HPSRZHUPHQW LV LQ OLQH ZLWK 5RFOD·VYDOXHVµ 7KHLQIRUPDWLRQSUHVHQWHGDWWKH5RFOD$FDGHP\KDV EHHQGHYHORSHGLQFRQMXQFWLRQZLWKWKH&RQFUHWH 3URGXFW 0DQXIDFWXUHUV $VVRFLDWLRQ DQG KDV EHHQ UHFRJQLVHG DV D FHUWLÃ&#x20AC;HG WUDLQLQJ LQVWLWXWLRQ E\ WKH (QJLQHHULQJ&RXQFLORI6RXWK$IULFD (&6$  'HVLUH0QFHGLVL0\H]RFRRUGLQDWRUDW66&)FRP PHQWV ´:KHQ 5RFOD LQWURGXFHG WKH WUDLQLQJ SUR JUDPPHWRXVZHWRRNDGYDQWDJHRIWKHRSSRUWXQLW\ DV PHPEHUV DUH JLYHQ WKH FKDQFH WR UHFHLYH WKH PXFKQHHGHG VNLOOV DQG NQRZOHGJH WKDW QRUPDOO\ FRPHV ZLWK DQ DVVRFLDWHG FRVW 7KH SURJUDPPH ERRVWHG PHPEHUV· FRQÃ&#x20AC;GHQFH OHYHOV DV FRQWUDF WRUVDQGWKH\UHFHLYHGFHUWLÃ&#x20AC;FDWHVWKDWDUHDFFUHG LWHG E\ WKH &RQVWUXFWLRQ (GXFDWLRQ DQG 7UDLQLQJ $XWKRULW\ &(7$ 

38

Skills on Site

July 2011

EISH!


Skills on Site

July 2011

39


New generation rotary hammer best in its class

NEW! The new generation Bosch GBH 2-28 DV Professional rotary hammer is an innovation that represents a major advancement in concrete working. With 50 watts more power and 20 percent more impact energy than its predecessors, the 850 watt Bosch GBH 2-28 DV Professional is the most powerful rotary hammer in its class. Thanks to its active vibration damping, it passes nearly 30 percent less vibration on to the user, resulting in longer daily use, more drilled holes and, therefore, higher productivity. Bosch Industrial Professional Power Tools. www.bosch-pt.com/za/en

40

Skills on Site

July 2011

SOS July 2011 smaller linked  

1 Skills on Site

Read more
Read more
Similar to
Popular now
Just for you