Page 1

Pilkada Binjai, Dhani-Meutya Gugat ke MK

7

Baca Hal

Tahun ke VIII Bung! Hari Ini MINGGU 16 MEI 2010

edisi Minggu Calon Total Suara

1 18.656 (2,78%)

2 93.267 (13.90%)

Menyajikan Fakta, Peristiwa & Fenomena Paling Aktual

3 8.790 (1,31%)

4 35.585 (5,30%)

5 28.719 (4,28%)

6 150.577 (22,09%)

7 29.010 (4,32%)

8 76.300 (11,37%)

9 93.135 (13,88%)

10 140.050 (20,87%)

Sumber: Data Media Center Panwaslukada Kota Medan

Kerasukan Jin Kafir Siswi Niat Bunuh Teman Kondisi gedung SMA itu mendadak heboh pada Sabtu (15/5) pagi. Kesurupan massal terjadi di sekolah tersebut, mengakibatkan beberapa siswinya mengamuk dan memecahkan kaca jendela. Kepingan beling tajam itu diambil, lalu mengejar teman-teman mereka. Jika tak segera diamankan, insiden itu nyaris menuai (Bersambung ke hal 2) pembunuhan.

(Bersambung ke hal 2)

(Bersambung ke hal 2)

Kantor Kelurahan Pancuran Dewa salah satu dari 5 kantor Kelurahan yang dirusak massa.

SAAT belanja di mall, Lae Togar tak sengaja menyenggol belanjaan seorang wanita yang membawa 5 anak gadisnya. Beruntung si ibu tak marah karena melihat Lae Togar sigap mengangkat belanjaannya yang jatuh. Apalagi, Lae Togar mengajak makan di sebuah foodcourt sebagai permintaan maaf. Lae Togar:”Aduh, saya benar(Bersambung ke hal 2)

LONDON Chelsea mencatat rekor baru dengan merebut gelar ganda atau double winners usai menekuk Portsmouth di final Piala FA de-

ngan skor 1-0, Sabtu (15/ 5). Yang menjadi pahlawan kemenangan The Blues yakni Didier Drogba dengan gol tunggalnya di menit ke-60. (Bersambung ke hal 2)

nel Tri Satriya yang dihubungi via telepon. Dikatakannya, permasalahan 15 oknum TNI yang diduga telah melakukan kesalahan dalam tugasnya bakal diberikan sanksi. Apabila sanksi itu dilanggar hingga 3 kali maka dapat dipecat. “Kita lihat dulu apa persoalannya, kalau memang (Bersambung ke hal 2)

PM/FELIKS MANALU/SMG

PASCA KERUSUHAN PEMILUKADA

Sibolga Mencekam, 5 Kantor Lurah Dirusak

Karo OPS Poldasu Kombes Anang didampingi Kapolresta Sibolga AKBP PM/FELIKS MANALU/SMG Jhonni Sebayang.

SIBOLGA Aksi anarkis massa yang merusak 3 Kantor Camat di Sibolga, Jumat (14/5) lalu terus berlanjut hingga malam hari menjelang Sabtu (15/5). Di kegelapan malam, lima kantor Lurah kembali dirusak massa. Amatan METRO TABAGSEL grup POSMETRO MEDAN, situasi malam itu di

Sibolga saat itu semakin mencekam. Aksi bakar ban terjadi di sepanjang Jl Sisingamangaraja Sibolga khususnya di depan kantor-kantor pemerintahan yang sebelumnya telah dirusak massa. Begitu juga di sejumlah wilayah hingga larut malam. Di per(Bersambung ke hal 2)

Rencanakan Pembentukan Negara Emirat Islam Indonesia (1)

Ibu Beranak 5

CHELSEA DOUBLE WINNERS

BELAWAN Pascabentrok antara oknum TNI Yon Zipur dengan oknum TNI-AL yang terjadi di lokasi judi yang baru berdiri 3 hari di Jl M Basir Pasar V, Kel Paya Pasir, Kec Medan Marelan Kamis (13/5) lalu, berujung ancaman pemecatan. Hal itu ditegaskan asisten operasional TNI AL, Kolo-

Aku Jadi Budak Seks Ayah Tiri Selama 7 Tahun PERBUATAN oknum Sekretaris Desa (sekdes) Kampung Perdamaian, Kecamatan Pintu Rime Gayo, Kabupaten Bener Meriah, Isa Ismail (39), takkan pernah kumaafkan lagi. Selama 7 tahun aku

Juarai Piala FA

15 Prajurit TNI Terancam Dipecat

z Sebabkan Serangan Jantung saat membeli produk makanan dan minuman. Terutama, untuk produk luar negeri. Pasalnya, di Medan beredar produk

PM/JPNN

BENTROK JUDI BELAWAN

Beredar, Produk Bercafein Tanpa Izin MEDAN MASYARAKAT Sumatera Utara, khususnya Kota Medan harus lebih waspada dan berhati-hati

Para pemain Chelsea merayakan kemenangan.

Teroris Siapkan Pengganti SBY LAPORAN:

PM/FACHRIL

Massa FPI melakukan orasi tentang maraknya judi di Belawan.

Soal Pembacokan Mantan Anggota KPU Asahan

Polisi Kehilangan Jejak KISARAN Satreskrim Polres Asahan masih memburu pelaku pembacokan mantan anggota KPU Asahan, Darwis Sianipar SAg. Diduga kuat pelaku telah melarikan diri dan bersembunyi di luar daerah.

Kuat dugaan polisi kehilangan jejak pelaku. “Kita masih terus melakukan pengejaran terhadap pelaku yang diduga kuat telah melarikan diri keluar daerah. Mudah-mudahan pelaku bisa (Bersambung ke hal 2)

TIM/JPNN

SERANGAN besar sedang disiapkan jaringan teroris di Indonesia. Bukan lagi menggunakan bom, namun menyerang langsung dengan senjata api layaknya perang terbuka. Tak tanggung-tanggung, targetnya adalah membuat kolaps pemerintah Indonesia dan menggantinya dengan negara baru bernama Emirat Islam Indonesia. (Bersambung ke hal 6)

PM/JPNN

Iklan

Alamat Redaksi: Graha Pena Medan Jl. SM Raja KM 8.5 No. 134 Medan Telp : Sekretariat (061) 7881661, Redaksi 08126309088, Iklan: 061-91013355, Pemasaran:081362235898, Fax (061) 7881733, Klik : www.posmetro-medan.com


MINGGU 16 MEI 2010

Chelsea Double Winners Kemenanganitujugamenjadirekor baru bagi pelatih—The Blues— julukan Chelsea, Carlo Ancelotti. Sebelumnya, ia menjadi pelatih pertama asal Italia yang berhasil membawaChelseajuaraLigaInggris. Carlettomenjadipelatihkeduayang suksesmemberigelarPialaFAsetelah GianlucaViallimelakukannyapada 2000. Pada laga di Stadion Wembley, Chelseasemestinyabisamencetak lebihdarisatugoldilagatersebut.Di babakpertama,takkurangdarilima seranganmerekamembenturtiangdan mistargawangThePompey—julukan Portsmouth.Salahsatunyadibuatoleh

Drogbadanlayakdisahkansebagai gol. DewiFortunamenghalangiupaya pertamaTerrydkkketikatendangan FrankLampardmembenturtiang kanandimenitke-13.Tujuhmenit kemudian,tendanganjarakdekatdari Drogbamentaldikakilawan. Chelseamasihterusmengepung pertahananPortsmouth.Padamenit 21, sebuah umpan dari sisi kanan diterimaolehDidierDrogbadikotak penalti. Drogba lalu melepaskan sepakan,namunberhasildiblokoleh AaronMokoena.Bolakembalijatuh di kaki Drogba dan ia kembali melepaskantembakan,namunbola

Sibolga Mencekam, simpanganjalanterlihatkaummuda berjaga-jaga sambil memegang pentungandansenjatatajam. Kepadawartawan,parapemudaitu mengaku,hanyauntukberjaga-jaga demi mengantisipasi adanya aksi demo yang akan merambat ke lingkunganmereka. Sementaraitu,terlihatsekitarratusan polisi tersebar di sepanjang Jl Sisingamangaraja.Merekadilengkapi denganpentungandansebahagian menyandangsenjatalaraspanjang. Tiba-tibaaparatkepolisianmendesak seluruhwargauntuktidakmelakukan aktivitas,termasuktakdiperbolehkan keluar rumah. Bahkan seluruh kendaraanyangmelintasdidesak untukmencarijalanlainataumemilih mencaritempataman. Salahseorangpetugasyangsempat ditanya mengaku, massa sudah melakukan tindakan anarkis di sepanjang Jl Sisingamangaraja. “Merekamelakukanpengerusakan kantorKelurahandanmelempari petugasdanwargayangberadadijalan. Makauntukitu,agarwargalaintidak terkena imbasnya, sebaiknya masyarakatdisarankanagarmenutup pintunyadantidakdiperbolehkan melewatijalanSisingamangaraja,” katapetugasberseragamlengkapitu. PersonilPolisiDitambah Massasemakinbrutal.Takhanya membakar ban di jalan raya, aksi semakinmenggiladenganmelakukan pelemparan dan pengerusakan sejumlah kantor pemerintahan di antaranya5kantorlurah. Masing-masing Kelurahan Aek Parombunan,AekManis,Pancuran Dewa,PancuranKerambildanAek Habildansebelumnya3dari4Kantor Camatmasing-masingKecamatan SibolgaUtara,SibolgaSelatandan Sibolga,semuanyadirusakmassa. Begitujugahalnyasituasidisekitar rumahpasangancalonWaliKotapada malam itu, terlihat dijaga massa pendukungmasing-masingcalondan aparatkepolisian.Sepertidirumah kediamancalonWaliKotaDrsHM Syarfi Hutauruk di Jl S Parman Sibolga,rumahcalonWakilWaliKota MarudutSitumorangAPMSPdiJl SutomoSibolgadanrumahkediaman calonWaliKotaHAfifiLubisSHdi JlTenggiriSibolga. Kondisiinimemaksapolisiuntuk menambahpersonil,termasukdari PolresTapunuliUtara(Taput),Polres Tapanuli Tengah (Tapteng) dan Brimob Detasemen-C Poldasu di SipirokTapanuliSelatan(Tapsel),plus sejumlahperwiraPoldasu. “Saatini,limapletonBrigadeMo-

bile(Brimob)dariSipirokditambah duapletonDalmasPolresTaptengdan Taput sudah ditambah untuk melakukan pengamanan di Kota Sibolga,” kata Karo OPS Poldasu KombesAnang. Kemarin malam, Sabtu (15/5), KombesAnangdidampingiKapolrestaSibolgaAKBPJhonniSebayang danKapolresTaptengAKBPDicky PNegaradiMapolresTapTengahdi JalanDrFLTobingSibolga. Usaimengelarrapattertutupbersama seluruhpasangancalonwalikotayang ikutbertarungdipemilukadaSibolga bersamaKPUDdanPanwaslukada Sibolga. KombesAnangmenegaskan,situasi keamanandiKotaSibolgasaatini sudah mulai berangsur kondusif. Namundemikiankonsentrasimassa masih terdeteksi di sejumlah titik, khususnyadibasissalahsatupasangan calonWaliKotaSibolga. “Secara umum situasi sudah terkendalidanberangsurkondusif karenatidakadalagiaksimasayang digelar hari ini,” katanya seraya berharap,situasikondusifinitetap terjagaterlebihadanyakesepakatan dariparapasangancalonuntuksamasamamenenangkanmassamasingmasing. “Terkaittahapanpemilukadatetap dilanjutkan,demikianjugadengan temuan-temuan pelanggaran Pemilukadaakantetapdiprosessesuai perundang-undanganyangberlaku,” katanyaserayamenjelaskanpihaknya dari kepolisian sudah berhasil mengamankansebanyak10warga yangdidugaterlibatlangsungdalam aksipengerusakanfasilitasnegera seperti kantor Camat dan kantor Kelurahan. PemilihanUlang Sementaraitu,banyakkalangan masyarakat Sibolga masih berkeinginanagarpelaksanaanpemilukada diSibolgadiulang.Sebabmenurut merekapelaksanaanpemilukada12 Meilalupenuhkecurangan. “Inilah akibat ketidak beresan pelaksanaanpemilukadadiSibolga. Kalaulahpemilukadadilaksanakan denganjujurpastikerusuhaninitidak terjadi,karenabarukaliinilahSibolga terjadikerusuhan.Tapikamiyakin bapak-bapakkamidarikepolisian tanggapdengankondisiini.Mereka tahukalauhatimasyarakattidakdilukai pastimasyarakattidakmauberbuat sepertiini.Inilahsuaradarimasyarakat yangsudahterluka,”katasejumlah masyarakatyangmasihmenyaksikan puing-puingsisapembakaran,Sabtu (15/5).(smg)

Polisi Kehilangan Jejak segeradiringkusdalamwaktudekat”, ungkapKasatreskrimAKPSonyM NugrohomelaluiKabagbinamitra KompolZulkarnainSH,Sabtu(15/5). Menurutnya, selain melakukan pengejaranterhadappelakupihaknya juga masih menyelidiki motif pembacokanitu.Hinggakinipihaknya belummengetahuimotifpembacokan tersebut,namundidugakarenapelaku tersinggungdenganucapankorban. Pihak kepolisian belum dapat menyimpulkanmotifpembacokanitu karenamasihfokusmelakukanpengejaranterhadappelaku.Apalagiperistiwa pembacokanituterjadisetelahkorban terlibatperangmulutdenganpelaku. Gunapengusutanlebihlanjutpetugas Polres Asahan telah meminta keterangandaribeberapaorangsaksi. Dari beberapa orang saksi yang dimintaiketerangandiketahuipelaku melakukan pembacokan karena keberatandenganucapankorban. Danperistiwapembacokanituterjadi secaratidaksengajakarenakorbandan pelakutidaksalingmengenal.Peristiwa itu terjadi secara kebetulan ketika korbanberbicaraterdengarolehpelaku

yangsaatitubarudatangdilokasi. Sepertidiketahui,korbansedang minum dengan beberapa orang temannyasembarimembahassoal PilkadaAsahanyangsempatterjadi kampanyehitam(blackcampaign) dilakukansalahseorangkepalaDinas di Asahan beberapa waktu lalu. Merekanongkrongdiwarungkopi yangberadadiJalanHAgusSalim Kisaran. Buyung (42) warga Jl SisingamangarajaKisarannekatmembacok mantananggotaKomisiPemilihan Umum(KPU)Asahanperiode20042009,Kamis,(13/5)sekirapukul01.30 Wib.Akibatnya,DarwisSianiparSAg (36)wargaJlSetiabudi,GgCempedak MutiaraKisaraninimengalamiluka bacokpadabahagiankepala. Korbanlangsungdilarikanmenuju rumah sakit Haji Abdul Manan Simatupang(HAMS)Kisaranguna menjalaniperawatan.Usaimenjalani perawatan secara intensif korban langsungmelaporkankejadianituke MapolresAsahan.Sedangkan,tersangkaBuyunglangsungmelarikan diri.(arnes)

Catatan LAE TOGAR benar minta maaf ya Bu. Nggak sengaja,” Ibu:”Ah,gak apa-apa kok. Lagian Anda orang baik. Saya yang jadi ngerepotin karena Anda jadi membayar makanan kami,” Lae Togar:”Ah, gak-apa-apa Bu. Sebagai permintaan maaf. Tadi saya lagi sibuk cari toko elektronik bernomor (TEMPAT NOMOR LANG), jadi gak lihat

ibu. Tapi saya heran, kok semua nama putri ibu sama, Bunga. Gimana cara Ibu memanggil seorang diantara mereka?” Ibu:”Gampang saja dok, cukup dengan memanggil nama bapaknya aja, mereka akan datang dengan sendiri?” Lae Togar:” Hah!!Kok bisa ya?” Ibu:”Ya,iyalah. Kan kelima anak saya memiliki bapak yang berbeda,” Lae Togar:%$$#@*&^^#.(*)

Teroris Siapkan Pengganti SBY lagi-lagidiblokolehbekPortsmouth. Semenitkemudian,Portsmouth mendapatkanpeluangemaspertama merekadalamlagaini.Tendangan kerasKevin-PrinceBoatengdaridalam kotakpenaltidibelokkanolehFrederic Piquionneyangberdiritepatdidepan gawang. Namun, ketangkasan Petr Cech menggagalkanpeluangini.Dengan tangan kanannya, Cech berhasil menepisbolasehinggagawangnya tetapaman. Gedoran Chelsea terus berlanjut setelahnya.Padamenit27,Salomon Kaloumembuangsatupeluangbersih. Umpan Ashley Cole dari sisi kiri langsung disepaknya dari depan gawang.Sialbagikalou,sepakannya masihmembenturmistar. Padababak kedua,Boatengmemberikanancaman terhadapgawangChelseadimenit50. Namunsepakanpenyerangbernomor 23itudarisisikirimasihmelambung diatasmistar. Chelsea akhirnya memecah kebuntuan mereka di menit 59. TendanganbebasDrogbayangmengarah ketiangjauhgagaldihalauolehJames danbolameluncurmasukkedalam gawang. (int)

Daripengakuantersangkateroris yangtertangkap,merekaakanbergerak pada upacara bendera tanggal 17 Agustus2010.“TargetnyaadalahRI1,pejabatnegara,dandutabesarnegara sahabatyangsedangberkumpuldi Istana.Iniancamannyata,”ujarKapolri JenderalBambangHendarsoDanuri diMabesPolri,Jakartakemarin. Target kelompok itu adalah menjatuhkanpemerintahanyangsah. “Menggantisistemdemokrasidengan syariatIslamataunegaraIslam,”ujar BHD dengan raut muka tanpa senyum.KeningBHDberkerutdan tampakadakeraguansaatmenyebut kataIslamsebagaidasarterorisberaksi.Sesekali BHD juga berhenti menghelanafas. MenurutKapolri,seranganitusudah dipersiapkansecaramatangdanterencanadenganrapi.Buktinya,ratusan ribuamunisi(peluru),puluhansenjata apilaraspanjangdanlaraspendek,serta seragamdanperlengkapanmilitersudahdisitaDensus88.Perangkatitulah yangakandigunakanuntukmenyerbu. “Merekasudahmenugaskanorang mengambilsenjatakeMindanao23 pucukM-16danlauncher(peluncur roketsemaca,rudalpanggul,red),”kata

alumnus Akpol 1974, yang juga mantanKapoldasuitu. Menjelangupacara17Agustustahun lalu, sebenarnya aparat sudah mewaspadairencanaini.Namun, karenasaatitujaringanmerekakocar kacirsetelahpenangkapanbeberapa tersangkapeledakanbomJWMarriott. Jika diukur dengan logika taktik pertahanan,menyerangIstanapada saatupacara17Agustussebenarnya bisadisebutdenganaksibunuhdiri. Sebab,PolridanTNImengerahkan ribuan pasukan bersenjata untuk mengamankanacarasakralitu. JawaPosgrupnyaPOSMETRO MEDANyangberulangkalimeliput upacara17Agustusselalumerasakan sterilisasipengamananyangketat. Jalan-jalandiblokadedanundangan terbatassajayangbisamendekatdan masukkomplekIstana. Namun,MenkopolhukamMarsekal (purn)DjokoSuyantomemintaanak buahnyadanmasyarakattetapwaspada.“Tolong,janganunderestimate ataumeremehkaninformasiKapolri ini.Negaratidakbolehkalah,”kata Djokoyangkemarinkhususdatang keMabesPolriuntukmenyampaikan apresiasipresidenpadaDensus88.

Beredar, Produk Bercafein Tanpa Izin minumanasalmancanegarayang masuktanpalabelsahBalaiPengawasan ObatdanMakanan(BPOM). Makanandanminumanyangditemukanitu,terindikasiberisicaffeinediluar standardketentuan.Halinitentumenyalahiaturan.Produkinisangatberbahaya bagikesehatanbiladikonsumsi.Salah satunya,dapatmemicupenyakitjantung. Sepertidikutipdarisumberdna,produk jenisminumanberenergiiniasalThailanddanbisadibelidigrosirdengan mudahdenganhargaRp6ribu.Selain tanpaizinedar,produkinijugamenyalahi standard kadar cafein yang sudah ditentukanolehduniainternasional.Di manakadarcafeinsebuahprodukminumanhanyadiberbolehkanmaksimal 50mg.TapiprodukasalThailandtersebut memilikikadarcafeinmencapai80mg zattrimethyixanthine/cafein. HalIniterungkapusaiseorangpemuda membeliminumanberenergitersebutdi sebuahgrosirdiMedan.Merasacuriga, priabernamaArafat(28)inilangsung berkonsultasidenganBBPOM.“Karena sayasebelumnyatahuprodukinisempat dilarangedar,jaditidaksempatdiminum, sayakonsultasiapakahbenaryangsaya

maksud,”ujarnya. KepalaSeksiSertifikasidanLembaga LayananInformasiKonsumenBalai BesarPengawasanObatdanMakanan (BPOM)SumateraUtara,Sacramento Tariganmengatakan,setiapproduk makanan,minumansertakosmetik berasaldariluarharusmemilikikodelML (makanandanminumandariluarnegeri) barubisaberedardimasyarakat. “Jikatidakadalabelinimakatidakakan lolosdaribandarajikapengirimannya lewatudaraatauBelawanjikalewatlaut. Namunkitajugatidaktahuapakahitu memangprodukluarnegeriatauhanya pemalsuan,”terangnya. Dijelaskannya,jikasebuahproduk terdaftar di negeranya, maka pihak beacukai akan mengonfirmasi ke negaranya,barubolehlewatataumasuk Indonesiasetelahmendapatkannomor registrasi. Sacramentomenambahkan,labelitu tidakhanyaberlakuuntukprodukluar negeri,namunjugauntukprodukdalam negeri dengan MD (makanan dan minumandalamnegeri)danCDuntuk kosmetikdalamnegeri.“Tanpalabelini berartibelumkitatelitizat-zatyangadadi

dalamproduktersebut,bisajadisemuanya berbahaya,termasukzatpewarnadan cafeinnyayangberlebihandiatas50mg,” ungkapnya. Kadar80mgsudahberlebihankarena dapatmemacujantung.“Terutamauntuk orang yang memiliki sakit jantung bawaan.Danyangbelumadasakit jantungnyaakanmemicusakitjantung. “Kadar50mgitusudahhasilanalisa keamanan untuk produk secara internasional.Jadiinisudahmelanggar,” ucapnyategas. Pentingnyasebuahprodukterdaftar karenaakanmenjalaniprosespenelitian mikrobiologi.“Kalauyangsudahterdafar kitahanyamelakukanpenelitianselama duaharisedangkanyangbelumterdaftar kitaagaklamakarenaharusmenelitisatu persatubahannyadanmingguduaminggubarubisaselesai,”beberalumniITB ini. Sacramentomenghimbau,agarmasyarakatlebihjelisetiapmembeliproduk. “Yangdilihatbukanhanyaexpirednya namunjugakoderegistrasinya,kalau tidakterdaftarsiapayangtahubahanapa yangadadidalamnya,”pungkasnya.(tim/ dna)

Terpisah,sumberJawaPosmenceritakanrencanaoperasi17Agustusitu ditemukandalamdokumenyang beradadiranselSaptono,DPOteroris yangtewastertembakdiBabakanJati, CikampekTimurRabu(12/05)lalu. “SebelumnyaDenidanTonoyang tertangkapdiMedanmemangsudah mengakuakanmembunuhRI-1tapi tak sedetail dokumen yang kita temukanitu,”ujarsumberituusai jumpaperskemarinpetang. Teroris menyebutnya sebagai amaliyahBadaratauoperasitujuh Ramadhan.Bulanpuasaakandimulai tanggal11Agustus2010.“Itubulan yangmenurutmerekamenjadibulan terbaikuntukmatisyahid,”katanya. Merekamengakuterinspirasidari perangBadaryangjugaterjadidibulan Ramadhantahun2Hijriah. Merekajugasudahmenyiapkan pemimpinjikapresidendanpemerintahan berhasil dikuasai. “Akan diangkat seorang amir sebagai pemimpinnegara,danmengganti namaNKRImenjadiEmiratIslam

Indonesia,”katanya. Siapaamiritu“Karenamasihproses sidik,untukyangsatuinibelumbisa diungkapkannamanya,”ujarnya. Kelompok ini secara ideologis memangterhubungdenganbeberapa gerakanradikallainnyasepertiEmirat IslamAfghanisatan,EmiratIslamIrak, EmiratIslamKaukasusUtara,danAs SahabSomalia.“Kelompokinijuga mempunyairekamanteknikgerilya danmetodeserangandarielemen asing,”katanya. Teroris juga sudah siap dengan amunisidanpersenjataan.“Mereka mendapatkannyadarigudanglogistik Polriyangdibobol,sisakonflikAmbon dan Poso serta kiriman dari Mindanao,”jelasnya. DaripengakuanmerekayangdirekamolehDensus88,seranganituakan dilakukandenganmodelberkelompok danmenyerangsecarabergelombang. “Targetmerekamemangsyahid,maka itusyaratnyadipilihberat,diantaranya harusjobtrainingdulu,”ujarsumber itu.(bersambung)

Aku Jadi Budak Seks diperkosaayahtiriitu.Perbuatanbejad ituterkuak,setelahakumenginjakusia 15tahun. Dia(Isa)memangsudahmendekam dalamseltahanan.Tapihatikubelum puas. Kalau bisa, aku ingin dia dihukummatiatasperbuatannya,telah merusakmasadepanku.Akutaktau apayangmembuatayahtiriitutega memperkosaku. Apalagi, ibuku merupakanistrikeduaayahtiri.Dari istripertamanya,diamemiliki2anak. Tapidaricelotehyangkudengardari orang-orang,diatergodamelihattubuh montokku. Aneh… padahal saat pertamakalidiperkosanyaakumasih berusia8tahun.Entahbagaimana montoknyaanakseusiaitu? Kejadianitubermulasaatibutakada. Hanyaadaakudanayahtiri.Tiba-tiba ayahmenyuruhkumasukkekamar tidur.Takmengerti,permintaanitu kuturuti. Di dalam kamar, ayah membukabajuku.Diajugamembuka bajunya.Namanyaakumasihanakanak, tak mengerti apa yang dilakukannya. Namunusaiayahtirimelampiaskan nafsunya,akumerasakansakitluar biasapadakemaluanku.Setiapkali buangairkecil,akuselalumengeluh kesakitan.Akutakberaningomong denganibu,karenadiancambunuh

oleh ayah tiri. Kesakitan itu pun kupendam. Perbuatan itu berulang-ulang dilakukan ayah tiri. Setiap ada kesempatan,diaselalumemperkosaku. Mungkinkarenasudahtakterhitung lagi perbuatannya, aku pun jadi terbiasa.Memasukiusia15tahun,cara berpikirku berubah. Aku mulai merasakanketertarikandengansosok priasebayaku. Tapiayahtirikutakmembolehkan akukeluar.Diajugamembatasitemantemanyangdatang.Lambatlaunaku sadar,ayahtirikuinginmenguasai dirikusepenuhnya.Karenatertutup, aku jadi dianggap kuper (kurang pergaulan)olehteman-teman. Akutaktahanlagi.Aprillalu,disaat mengunjungikerumahsaudara,aku punberterusterangpadasepupuku. Semuakelakuanjahatayahtirikubuka disitu.Meskiterheran-heran,namun sepupuku melaporkan apa yang didengarnyapadaibunya.Selanjutnya, pengakuankupunditeruskanpadaibu. Ibu kaget. Saat itu juga ibu dan saudaranyamembawakukePolres Bener Meriah. Pada polisi aku mengakutelahmenjadibudakseks ayahtirikuselama7tahun.Polisilangsungbergerakcepatmeringkuslelaki bejaditu.(curhatnarasumber/RA)

Kerasukan Jin Kafir Peristiwamenggegerkantersebutterjadi sekitarpukul10:00WIBdiSMAN-1Julok, AcehTimur.6siswidisekolahitukemasukan jinkafirhinggamengamuktakterkendali. Merekamelempariruangansekolahdengan batu,akibatnyakacajendeladankacameja ruangantatausahapecah.Salahseorangdiantara yangkesurupanadalahAsmaulHusnasiswi kelasIIIPA/2.Iamenggengampecahankaca danmengejarteman-temannya,sepertihendak membunuhmereka.Beruntungkorbanbisa diamankansejumlahdewangurudanempat orangSatpolPPyangbertugasdilokasi. Akibatkejadianitu,tanganAsmaulHusna berdarah-darah, hingga ia pun dijemput keluarganyauntuklangsungdibawakerumah sakit.Kejadiankesurupankaliinibukansaja menggangguProsesBelajarMengajar(PBM) disekolah,bahkan telahmerusakfasilitasdan

mengancamnyawapelajarlainya.Paraguru sepertinyasudahsangatkewalahanmenangani insidenyangacapkaliterjadi.Sehinggaproses belajarmengajarkemarinterpaksadihentikan danseluruhpelajardiizinkanpulang. HumasSMAN1JulokAbdulMuthaleb, S.Pd kepada Metro Aceh membenarkan kejadiankesurupandisekolahnya,menurutnya kejadiankesurupankaliinilebihparahdari kejadiansebelumnya. “Kejadiankaliinilebihgawat,karenamereka siswiyangmengalamikesurupansudahtahu mengamuk.Kalauduluhanyasekedarmeronta danmenjerit-jeritsaja,tapikaliinisudahmain lempar-lemparbatukearahgedungsekolah. Dalamkejadianini,satukacajendelaruangan dansatulembarkacamejadiruangtatausaha pecah,“ungkapAbdulMuthalleb. Ia jug amengakui, meski kali ini yang

kesurupanhanyaenamsiswi,namunsuasana sekolahsangathisterisdankacau,karenamereka semuanyamengamuk. “Kita dari dewan guru sudah sangat kewalahanmenanganikejadiankesurupandi sekolah.Bukansajasakitseluruhbadansampai tigahari,malahmerekasekarangsudahmulai mengamukdenganmengejarsiswa/Ilainnya denganbatudanpecahankaca.Nyawakami dansiswilainnyapunturutmerasaterancam,” sebutHumasSMANJulok. Katanya,untukmenangganiperistiwademi peristiwa kesurupanyangterjadidiSMAN1 Julok,pihaksekolahtelahmencobamenanggani denganmemanggilorangpintaraliasdukundari sejumahdaerah.Namunhalitusia-siabelaka. “Bahkanadadukunyangtumbangditempat, saatmelakukanritualpenyembuhankesurupan dilokasi.Kamiparadewangurudankepala

sekolahsudahsangatbingunguntukmencari orangpintar,tapitakadahasilyangmujarap,” paparAbdul. KepalaDinasPendidikanAcehTimur,H. Agussalim, SH. MH melalui Dikmen M. YakopsaatdikonfirmasiMetroAcehmelalui Hendphoneseluler,dirinyamengakuadanya kejadianmengamuknyasiswiyangkesurupan diSMAN1Julokkemarin,bahkankatanya untukmengatasikesurupandisekolahitutelah diperintahkanpihaksekolahuntukmencariorangpintaryanglebihmantap. “Pihak kita melalui kepala sekolah terus melakukanupayapenyembuhankejadian kesurupandiSMAN1Julok,bahkandalam beberapabulanyanglalukejadianitusudah mulaimenurun,namunkitaengaktahukarena itusemuapengaruhalamgaib,“ucapMYakop singkat.(jpnn)

15 Prajurit TNI Terancam Dipecat adayangtelahmelanggarhingga3kali akankitapecat,”tegasnya. Katapriaberpangkattigabungaemas ini,setiapanggotayangmelakukan kesalahan pada umumnya akan diberikan sanksi disiplin apabila kesalahandalammasalahdisiplin. Sedangkalaunantinyamenyangkut pidanaakandiberikansanksisesuai yangdiaturdalampidana.“Kitaakan segeralakukanpenertibankepada seluruhpersonilyangtelahmenyalah,” katanya. Disinggungmarakanyajudiyang dibekingioknumaparat,priayang akrab disapa Satriya mengatakan, upayapemberitahuankepadaoknumnyatelahdilakukan.“Kitaterusawasi anggotakitayangterlibat,”katanyalagi. Sebelumnya,organisasikeagamaan Front Pembela Islam (FPI) Sumut denganmengerahkanseratusanmassa kesejumlahlokasiperjudiandibanyak tempatdiBelawan. Informasiyangdihimpun,para

bandar berkantong tebal dengan mudahnyamembayaroknumpetugas sebagai pengawal setia untuk melanjutkanbisnisjudinyakembali mencarilapakbaru. Seperti yang dilakoni, AP yang disebut-sebutmelibatkanbeberapa rekannyaberinisial,AdanJ.Walau seluruhlokasiperjudiandiBelawan telahtutupakibatdiberangusmassa FPI,namun,APdenganberaninya menentanghukumkembalimembuat ‘lasvegas’barudikawasanKebun BunderLingk.3Kel.RengasPulau, MedanMarelan. Buntutnya,akibatperbuatanwarga keturunan Thionghua ini menyebabkanseoranganggotaZipur KodamI/BB,KopkaTNILSebayang bersimbahdarahdigimbalioknum petugas marinir yang disinyalir pengawaskeamanandilokasijudi samkwantersebut. Tidakhanyasampaidisitu,akibat keberingasanoknumpriaberambut cepakini,tentarasamatentaranyaris terlibatbentrokan.Daripantauandi

lokasipadamalamkejadianitu,rekanrekan Kopka L Sibayang yang mendapatkabarkorbandigimbalisaat mencari temannya berinisial Kt di lokasiperjudianitu,nyarismelakukan penyeranganbalik. Belasanoknummariniritupuntak tinggaldiam,mengetahuiyangmereka pukuladalahanggotaTNI,mereka dengancepatmenginformasikannya keteman-temannya.Spontansuasana mencekamyangmembuatwarga setempatketakutan. Namunakhirnyaberhasildiredakan setelah petugas intel dari kedua kesatuan militer ini turun ke TKP. Sekitarpukul21.00wib,satuunitmobil patrolibertuliskanPomal(PolisiMiliter AngkatanLaut)yangdidalamnya terdapat sejumlah personil militer bersenjatalengkaptibadilokasiguna melakukanpengamanan. DarilokasibisnisjudiSamkwanitu, petugas Pomal Belawan mengamankanbeberapaoknumpetugas. TakhanyaituPomaldibantulaskar FrontPembelaIslam(FPI)Sumutjuga

turutmengamankan,meja,kursidan peralatanjudisamkwanlainnyauntuk disitasebagaibarangbukti. SebelumpetugasPomalBelawan meninggalkanlokasi,seorangperwira TNIALberpakaianpremanyang melakukan penyelidikan dan mengamankanbarangbuktisempat berjabattangandengandenganKetua DPDFPISumut,HDharmaBakti Gintingsembarimengatakanpihak TNIakanmengusuttuntaskasusbisnis judiitu. Latarbelakangaksipenyerangan terhadapseoranganggotaYonZipur KodamI/BB,KopkaTNILSibayang yang dilakukan oknum petugas marinir, sehingga nyaris memicu terjadinyabentrokan,Kamismalam (13/5) sekitar pukul 20.00 wib, di kawasan Kebun Bunder Lk 3 Kel RengasPulauKecMedanMarelan, mulaiterjawab. DanLantamalI,LaksamanaPertamaTNISyarifHuseinmelaluiAsisten Operasi(Asop),KolonelTNISatriya mengatakan, terjadinya peristiwa

tersebutdidugadisebabkanpersoalan bisnisjudisamkwan(dadu)illegal milikseorangpriaTionghoa,AP. “Pemukulanituhanyaimbasnya saja,tapiyangmenjadipemicunya adalah soal bisnis judi dadu yang dibekingi oknum petugas,” kata, KolonelTNISatriyaketikadihubungi wartawanviaselularnya. Menurutperwiramenengahyang pernah mengenyam pendidikan kerohanian(pesantren)diPulauJawa ini,terkaitpersoalanbisnisjudidirinya akanmenyikapidenganseriuskasus tersebut,apalagihinggamelibatkan oknum-oknum prajurit sebagai pembekingnya. ”Dalam sumpah prajurit sudah disebutkandengantegas,jadikalauada oknum prajurit yang melanggar sumpahyangtelahdiucapkannya makasangsinyajelastidakmain-main, dan soal bisnis judi yang menjadi pemicunyaakankitaselidikansampai sejauh mana keterlibatan oknum prajurit kita dan siapa dibelakangannya,”terangnya.(tim/dna)


Berinternet di Warnet, Mio lewong dahal ramai kali orang di depan warnet itu. Anehnya saat kutanya apakah mereka melihat mio biruku, semuanya tak ada yang tahu,” bilang pria yang mengaku kuliah di Fakultas Ekonomi UMSU itu. Atas pengaduannya itu, Sukron pun harus apes untuk yang kedua kalinya. Kenapa tidak, dirinya salah melapor ke Polsek Medan Kota.“PetugasbilangkalauTKPnya wilayah Polsek MedanArea, jadi kami disarankan ke sana,” terangnya.(syahrul)

Debt Collector Gelapkan Duit Perusahaan LUBUKPAKAM Indra Silaban (23) pria yang bekerja sebagai debt colecctor di PT Wom Finance Lubukpakam ini, kini tengah di buron Polisi. Sebabnya, dengan modus melakukan manipulasi data konsumen pembeli sepeda motor, Indra yang tinggal di Komplek Perumahan BSP Lubukpakam itu diketahui telah

menggelapkan duit perusahaan finance tersebut sebesar Rp 22.968 ribu. Saat dimintai pertanggungjawaban oleh pihak perusahaan tempatnya bekerja, Indra malah menghilang. Dasar itu pihak PT Wom Finance, Sabtu (15/5) terpaksa melaporkannya ke SPK (Sentra Pelayanan Kepolisian) Polres Deliserdang. (pasta)

Tersiram Air Panas, Bocah 2 Tahun Melepuh MEDAN Nasib naas dialami bocah perempuan yang masih berusia 2 tahun ini, Chelsi olivia. Mulai dari perut hingga kakinya melepuh terkena tumpahan air panas dari kuali, Jumat (14/5). Warga Belawan itu segera dilarikan Jhonri Simanjuntak (35), ayahnya ke RSU Pirngadi Medan. Di ruang VIII RSUPM, Jhonri menceritakan, peristiwa itu terjadi pagi, sekira pukul 06.00 WIB. Sang istri sedang memasak air untuk makanan ternak mereka. Setelah mendidih, air dituang ke kuali. Pekerjaan itu ditinggal sebentar oleh istri Jhonri, karena

mau beres-beres rumah. Tak dinyana, Chelsi lari-lari masuk ke dapur. Mungkin terpeleset, Chelsi jatuh dan menimpa kuali. Tak urung lagi, isi kuali tumpah dan mengenai tubuh bocah cilik itu. ‘’Saya saat itu mau melaut. Tiba-tiba dapat telepon, anak saya kena siram air panas. Saya langsung pulang ke rumah, begitu dapat telepon dari istri,’’bilang bapak anak dua itu, berharap putrinya bisa diselamatkan. Amatan POSMETRO, separuh tubuh bocah malang itu melepuh, darah juga keluar dari luka bakar itu. Meski sudah diperban, darah tetap merembes keluar. (dedi)

Mandi-mandi di Sungai, Cewek ABG Hanyut HAMPARAN PERAK Upaya pencarian tenggelamnya siswi SMP, Khairunisa, warga Dusun VI Pulo Agas, Hamparan Perak telah berakhir, Sabtu siang (15/ 5). Jenazah cewek berusia 15 tahun itu ditemukan tak lagi bernyawa. Tubuhnya gembung setelah seharian hanyut. Tenggelamnya, remaja yang akrab disapa Nisa ini sempat menghebohkan warga sekampungnya. Pasalnya, sampai larut malam (14/ 5) tubuh Nisa tak kunjung ditemukan usai mandi-mandi dengan teman-

nya. Bahkan, tenggelamnya Nisa pun sampai ke Polsek Hamparan Perak. Atas penemuan jenajah putrinya itu, kedua orang tua Nisa tampak histeris. Karena, saat ditemukan dalam kondisi tubuh menggembung tak bernyawa. “Korban ditemukan sekira 200 meter dari lokasi tenggelam. Keluarga menolak untuk dilakukan visum karena murni hanyut di sungai,”pungkas Kapolsekta Hamparan Perak, AKP Azuar SH. (fachril)

Cewek Galang Diculik, Tebusan Rp8,5 Juta LUBUKPAKAM Maslia (50), warga Dusun V, Desa Pisang Pala, Kecamatan Galang ini kini tengah risau. Pasalnya, putri ketiganya SriAstuti (26) sudah 3 hari tak pulang ke rumah mereka. Bahkan putrinya itu mengabarkan via sms kalau dirinya jadi korban hipnotis yang dilakukan seorang pria bernama Iwan dan istrinya Ernawati. penculik Sri minta tebusan yang ditransfersebanyak Rp8,5 juta ke rekening nomor 10860100093.505 Bank BRI atas nama Ernawati. Mendapat ancaman tersebut, kerisauan hati Maslia akhirnya berubah menjadi kalut. Jelas saja sebab ibu empat anak ini takut jika putri kesayangannya itu jadi korban

kekerasan para pelaku yang mengaku telah menculik Sri. Karena tak ingin kehilangan putrinya, Maslia dan keluarganya lantas coba bernegosiasi dengan para penculik. Dalam negosiasi melalui nomor HP 081264523716 milik para pelaku, Maslia memohon agar putrinya tidak disakiti dan mengaku hanya menyanggupi tebusan Rp4,5 juta. Anehnya, penculik setuju dan minta uang segera ditransfer. Sialnya, setelah uang ditransfer, pelaku ingkar janji. SriAstuti belum juga dikembalikan. Bahkan pelaku minta uang tambahan sebesar Rp5 juta, berikut pulsa Rp100 ribu. Tak mau percaya lagi, Maslia pun melapor ke Polres Deliserdang. (pasta)

TOGEL MARAK DI ASAHAN KISARAN Penyakit masyarakat khususnya judi tampaknya tumbuh subur di Kabupatan Asahan. Pihak kepolisian seakan menjadi ‘bola’ bagi oknum-oknum yang melanggar hukum tersebut. Terbukti, walau pun sudah banyak pelaku perjudian yang ditangkap, tetap saja aksi perjudian terus berkembang. Berdasarkan data dari pihak kepolisian, selama 5 bulan terakhir, ada 129 tersangka dari 107 kasus judi di Asahan yang ditangani pihak kepolisian Mapolres Asahan. Kapolres Asahan, AKBP Mashudi, melalui Kasat Reskrim AKP Sony M Nugroho, Kamis (13/5) mengatakan, untuk memerangi judi, para personil polisi dikerahkan untuk melakukan razia rutin dan mendirikan pos penjagaan di bebe-

rapa tempat yang dianggap rawan tindak kejahatan, dan judi. Menurutnya, 48 kasus judi berhasil ditangkap oleh unit Polres sedangkan yang ditangkap oleh Polsek sejajaran Polres Asahan sebanyak 59 kasus judi. Berdasarkan wilayah hukumnya, ada 49 kasus di KabupatenAsahan, dan 58 kasus di Kabupaten Batu Bara. Bentuk judi yang sering ditemukan, beber Sony, adalah toto gelap (Togel). “Kami sangat mengharapkan bantuan masyarakat dalam memberantas judi di Asahan. Ini dikarenakan karena pelaku judi selalu berpindah-pindah menghindari petugas. Bila masyarakat menemui atau menjumpai kasus judi, jangan merasa sungkan untuk melapor ke pihak kepolisian,” ucapnya. (smg)

MINGGU, 16 MEI 2010

HALAMAN 3

Dukun Bertindak, Maling Kereta Keok DELI TUA Berbagai cara dilakukan Febri Harianja (20), warga Jalan Catur, Pasar Merah Barat, Medan Kota, untuk menemukan lagi Shogun 125 BK 6313 UQ miliknya yang dilarikan Fajar, temannya sendiri. Upaya menggunakan paranormal alias dukun ternyata memberi hasil. Sepeda motor kembali ditemukan, meski kondisinya sudah ‘dicincang’. Pencurian itu terjadi, Senin (10/5). Febri pergi bersama temannya Ari ke Jalan Santun. Setibanya di sana, mereka bertemu dengan Fajar. Pemuda itu minta diantar pulang. Tak enak menolak permintaan teman, Febri minta Ari mengantar Fajar. Tiba di Jalan AH Nasution, tepatnya di samping SPBU, Fajar meminta Ari agar menunggunya sebentar. Beralasan ada yang mau diambil, Fajar pergi menggunakan sepeda motor. Tunggu punya tunggu, Fajar tak kunjung menampakkan batang hidung. Alhasil, Ari pun kembali dengan naik angkot dan menceritakan Fajar telah melarikan sepeda motor Febri. Kabar itu diteruskan pria lajang itu

T. Harianja

PM/REZA

pada orangtuanya. Meski sempat panik, T Harianja, bapak Febri segera melapor ke Polsek Delitua. Tak hanya itu usaha yang dilakukan. Lelaki paro baya itu juga meng-

gunakan tenaga paranormal di Padang Bulan agar kendaraan roda dua tersebut kembali. Menurut si paranormal, sepeda motor berada di Kota Tebing Tinggi. Besoknya, keluarga korban meluncur ke lokasi yang dimaksud. Namun hasilnya nihil. Tak mau putus asa, T Harianja menemui paranormal lain untuk mengungkap pencurian itu. ‘’Paranormal itu minta nomor plat kereta dimasukkan dalam kotak rokok. Dia lalu meminta kami agar menunggu saja di lokasi kejadian hilang kereta. Lalu paranormal itu membakar kertas, katanya biar si pelaku dapat balasan atas perbuatannya,’’kata Harianja pada POSMETRO MEDAN di Polsek Delitua, Sabtu (15/5). Ternyata usaha itu tak sia-sia. Korban bertemu dengan teman pelaku yang lalu menunjukkan tempat sepeda motor Febri disimpan. Sepeda motornya telah habis dipreteli atau dikokang. Sementara Fajar belum diamankan polisi. Pasalnya, pemuda itu mengalami tabrakan. ‘’Kudengar Fajar tabrakan, dan orangtuanya yang menjamin. Mungkin karena itu dia belum ditangkap,’’kata Harianja yang

DIBACOK BELASAN PREMAN, SEMINGGU OPNAME MEDAN Setelah sepekan lamanya menjalani perawatan di RSU Pirngadi Medan, akhirnya korban percobaan pembunuhan oleh sekelompok preman melapor ke Mapoltabes Medan, Jumat (14/5). Adalah Hendrik Brutu (36), warga Jalan Punak Medan, korban pengeroyokan pemuda itu. Kepada wartawan usai membuat pengaduan, Hendrik membeberkan, peristiwa itu terjadi di kawasan Jalan Nibung Raya, simpang Jalan Gatot Subroto Medan, Minggu (9/5) lalu. Memegang surat pengaduan dengan nomot LP : SLTP/ 1258/V/2010/Tabes MS itu Hendrik Brutu menyebutkan, saat kejadian dia baru saja pulang dari salah satu toko grosir membeli susu anaknya. Karena toko tutup, dia pun langsung pulang ke rumah. Dalam perjalanan pulang, setibanya di kawasan Jalan Nibung Raya Simpang Jalan Gatot Subroto Medan, Hendrik dihadang sekelompok preman. Tiga diantaranya dikenalnya bernama Ganda, Empok dan Kicing. Mereka disebut-sebut pengawas salah satu hiburan malam di kawasan Jalan Nibung

Medan. Tanpa banyak tanya dan tidak diketahui permasalahannya, Ganda beserta temantemannya yang diperkirakan mencapai belasan orang itu langsung menghajar dan membacokinya pakai kelewang serta memukulinya pakai benda tumpul seperti besi dan kayu. Akibatnya, korban terkapar di jalan dengan kondisi bersimbah darah. Menganggap korban telah tewas, maka para pelaku langsung pergi. Sedangkan warga sekitar yang melihat peristiwa itu langsung berdatangan dan membawa korban ke RSU Pirngadi Medan untuk mendapatkan pertolongan medis. Dari kejadian itu, korban mengalami luka 11 jahitan dibagian kepala, 6 jahitan dipelipis mata, tangan kanan remuk serta wajah lembam. “Saya sampai sekarang ini tidak tahu permasalahannya kenapa saya dikeroyok dan hendak dibunuh oleh Ganda serta temantemannya itu,” terangnya. Kasat Reskrim Poltabes Medan Kompol Jukiman Situmorang yang dikonfirmasi melalui saluran selular menyatakan, pihaknya masih mengejar beberapa pelaku yang sudah diketahui identitasnya tersebut. (smg)

Asik Makan, Avanza Raib LUBUKPAKAM Aksi pencurian mobil kembali terjadi di seputaran kota Lubukpakam. Jumat pagi (14/5), mobil Avanza BK 1202 JE milik Syarifah Saidah (29), warga Gang Ikhlas, Jalan Sekata, Medan Barat lewong saat diparkir di depan rumah makan Ojolali yang berada di Jalan T Iman Bonjol, Kelurahan Cemara, Lubukpakam.

Saat buat pengaduan ke SPK (Sentra Pelayanan Kepolisian) Polres Deliserdang, ibu rumah tangga itu menuturkan, dia bersama keluarganya sarapan di RM Ojolali. Mobil yang dikreditnya itu diparkir di depan rumah makan. Anehnya, begitu keluar dari rumah makan, mobil tak ada lagi di lokasi. (pasta)

Kepergok Satpam Nyolong di Carefour MEDAN Nyolong HP di Carefour, Mohammad Irawan, warga Jalan Pertiwi, Tembung diboyong ke Polsekta Medan Baru, Sabtu sore (15/5). Berpura-pura mau beli, Irawan masuk ke toko batik. Melihat ada pengunjung toko, Harum Suci Ningsih, karyawati di sana segera memasukkan Hp E-63 miliknya ke

laci, dan melayani calon pembeli. Namun Irawan sempat melihat Hp korban. Melihat korban sibuk melayani calon pembeli, dia pun langsung beraksi membuka laci dan mengambil Hp. Namun aksinya gagal. Petugas satpam melihat ulahnya. Dia lalu dibawa ke kantor polisi. (johan)

PM/REZA

Sepeda motor Febri yang dilarikan Fajar

membawa BPKB untuk bukti kepemilikan sepeda motornya. Kapolsekta Deli Tua AKP B

Marpaung menyatakan, pihaknya masih melakukan penyelidikan atas kasus curanmor tersebut. (reza)

TERSENGAT LISTRIK, BURUH BANGUNAN TEWAS MEDAN Syahrial (44), warga Jalan Bromo Gang Sentosa, tewas setelah jatuh dari lantai 2, bangunan rumah yang sedang dikerjakannya, Jalan Bromo, Medan, Sabtu (15/5) pukul 10.00 WIB. Namun sebelum jatuh, ayah 3 anak itu terlebih dulu tersengat listrik. Warga sekitar terkejut mengetahui Syahrial meninggal dunia. Pasalnya, lelaki itu sempat membeli rokok dan bergurau dengan warga, sebelum memulai kerjanya bertukang di rumah yang dibangun tersebut. “Dia jatuh dari lantai dua dengan

kondisi tubuh kepalanya mengeluarkan darah. Menurut temannya yang sama bekerja, dia tidak mengetahui kalau didekatnya ada aliran listrik dan korban menyenggolnya sehingga mengenai korban,” ucap warga yang tidak mau namanya disebutkan. Syahrial dilarikan ke RS dr Pirngadi untuk dilakukan otopsi. Setelah dilakukan otopsi, jenazah Sayhrial dibawa pulang ke rumah duka di Jalan Bromo Gang Sentosa untuk dikebumikan. Sebelum dikebumikan, jenazah Syahrial terlebih dahulu disholatkan di mesjid dekat kediaman Syahrial. (smg)

MAYAT

Duo Jambret Tebing Beraksi Pegawai Rumah Sakit Terkapar TEBING TINGGI Aksi jambret kian mengganas di Tebing Tinggi. Kemarin (14/5), giliran Mardiana br Situmorang (34), pegawai RS Herna Tebing Tinggi yang menjadi sasaran penjahat itu. Mardiana melaju pulang ke rumahnya setelah jam kantor selesai. Namun melintas di jalan KF Tandean, sepeda motornya dipepet 2 pria pengendara

RX King. Mendadak, tasnya direbut. Kontan wanita yang menetap di komplek BTN Purnawirawan, Kelurahan Bulian, Bajenis Kota Tebing Tinggi ini hilang kendali. Dia pun terjatuh dan mengalami luka di sekujur tubuh. Setelah berobat medis ke rumah sakit, Mardiana melapor ke Polresta Tebing Tinggi. (asnawi)

CMYK

MEDAN Berinternet di Vito Net Jalan Menteng Raya, membuat Sukron (20) warga Jalan Bhakti Medan apes. Soalnya, Mio warna biru BK 1574 AAC miliknya raib setelah satu jam diparkirkan di depan warnet. Lebih kurang satu jam lebih berchatting ria, anak pertama dari dua bersaudara ini pun beranjak pulang ke rumahnya. “Saat kulihat sebelah kanan parkir, sudah tak ada lagi keretaku. Tak nyangka kali ah, pa-


C MYK

KLINIK METAFISIKA Diasuh : Raden Haryo Damar Ahli Metafisika & Raja Susuk

Tanya:

Ketik : POS(spasi)TGP (spasi)Pertanyaan Kirim ke 7669 (maks. 160 karakter) Hotline: 08153120669

Jawab: .(*)

SERING DIREMEHKAN TEMAN TANYA : Saya seorang pengajar di sebuah universitas swasta, mengapa wibawa saya kurang dan serasa sering diremehkan mahasiswa dan teman. Pengirim: Bud, Medan JAWAB : Sebaiknya datang saja ke tempat praktek saya untuk kita pasang mustika atau susuk kewibawaan, dengan khodam ghaib pendamping akan mempengaruhi orangorang di sekitar Anda. Susuk ini tanpa efek samping dan bisa dibawa ibadah.(*)

Jawab: .(*)

MOBIL TOYOTA BARU : Ready stock: Avanza, Inova,

Rush, Yaris, Fortuner, Vios, dll. Dp. hanya 14Jtan angs 4Jtan. Buat apa beli bekas, yg baru juga murah kok. Hub: 0813 7516 2401

TOYOTA 100% BARU

Ready: Avanza, Innova, Rush, Yaris, Vios, Fortuner, dll. Hub: 0813 7597 9007, 061-7746 2006

TOYOTA DP SUPER RINGAN

Ready stock: Avanza, Innova, Rush Dp. 10% saja Hub: 0812 6010 066, 7772 8120

DAIHATSU 100% BARU DP SUPER RINGAN

• Luxio Dp. 6Jtan • Xenia Dp. 10Jtan • Pick Up Dp. 6Jtan • Terios Dp. 15Jtan Data dijemput, terima tukar tambah. Serius !!! Hub: Handry Tigor, 0812 654 2619, 7713 7278 DAIHATSU PAKET MURAH : Xenia Dp. 12Jt ang 3Jtan. Terios Dp. 16Jt ang 4Jtan. Pick Up Dp. 6Jtan ang 2,5Jtan. Tersedia Luxio, Sirion, Gran Max. Hub: Anto Sinaga, 0812 6525 230, 061- 7703 8771

DAIHATSU BARU

Luxio Dp. 5,6Jt angs 4Jt. Xenia Dp. 11Jt-an angs 2,8Jt. Pick Up Dp. 8Jt angs 2Jt. Terios Dp. 20Jtan angs 4Jt. Hub: Yudi 0812 6413 641, 7757 9718

MOBIL BARU...REZEKI BARU..!!!

• Pick Up Dp. 5Jt • Xenia Dp. 10Jt • Terios Dp. 13Jt • Sirion Dp. 14Jt Proses cepat, data dijemput + hadiah Hub: Kalpin, 0852 7014 9000

DAIHATSU PROSESNYA CEPAT!!!!

Pick Up Dp. nego. Xenia Dp. nego !!! Hub: Didi Mulyono, HP. 0813 9691 1148 NEW XENIA 2010 Dp. 12Jtan. New Terios 2010 Dp. 18Jtan. Hubungi: Nitha, 0812 6011 1198, 061-7757 7722

CAPELLA PAKET AWAL TAHUN

• Xenia 1.0 std Dp. 10Jtan angs 3Jtan x 60 bln • New Luxio Dp. 6Jtan angs 4Jtan • New PU Dp. 7Jtan/15Jtan ang x 1,9x 60bln • Terios TS Dp. 20Jtan angs 4Jtan x 48 bln Bisa tukarDAIHATSU tambah, dptkan full discount & READY TERMURAH hadiah. Hub: Sahrul, 0813Terios 9611Dp. 5768, 0816 Xenia Dp. 10Jt angHP. 2Jtan. 13Jt. PU 307 Gran084 Max Dp. 5Jt Luxio Dp. 5Jt. Full discount & cash back. Hub: Nababan, 0813 6237 1768, 0856 5814 3812 Xenia VVT-i Dp. 10Jtan. Gran Max PU Dp. 5Jtan. Terios Dp. 18Jtan. Hubungi : Ari Astra, 7703 3511, 0812 6423 792

GEBYAR DAIHATSU MURAH !!!

Xenia Mi STD Dp. 10Jtan angs 3Jtan. Terios TS Dp. 15Jtan angs 4Jtan. Pick Up Dp. 6Jtan angs 2Jtan. Luxio Dp. 6Jtan angs 4 Jtan. Hubungi: Surya, 061-7754 1246, 0811 618 023

PAKET GEBYAR MEI 2010

Xenia Dp. 10Jtan angs 2Jtan. Terios Dp. 20Jtan. Luxio Dp. 6Jtan. G. Max PU Dp. & angsuran paling rendah. Hub: Tengku Andi, 7715 5669, 0812 6581 973

MITSUBISHIDPRINGAN&DISKONKANDAS

Pick Up T120SS, L300, Colt Diesel, Fuso. Hub: Vina Siregar 0812 6036 0000, 06177530154 SUZUKI BARU DP 10% : Carry PU Dp. 5Jtan APV, Splash, Grand Vitara, Swift, SX-4, tambah bonus lain. Hub: Yudi, SE. HP. 0812 6000 5066, 77799059

RENTAL ANTAR JEMPUT

Inova, Avanza, Xenia. Harian/bulanan Telp. 061-6968 9711, 0812 6090 7003

Kucing Hitam Sebagai Simbol Mistis Menurut literature yang dikumpulkan sumber, kepercayaan akan kucing hitam bermula dari sejarah di jaman babylonia kuno tempo dulu. Saat itu kucing hitam dipersembahkan dalam upacara ritual untuk dibakar bersama sesaji lainnya. Mitos ini timbul karena ada seekor kucing hitam yang tidur ditengah-tengah seekor ular dengan pulasnya, padahal saat itu ular merupakan lambang dari kejahatan. Pemahaman ini terus berkembang hingga abad pertengahan. Di Jerman, ada kepercayaan bahwa apabila ada seekor kucing hitam yang lompat ke tempat tidur orang sakit, kematian akan datang pada orang yang sakit itu. Lain lagi dengan kepercayaan orang Normandia, mereka percaya apabila dalam perjalanan Anda melihat seekor kucing hitam yang sedang menyebrang di tengah bulan purnama, mereka percaya bahwa Anda akan terserang suatu epidemik. Di Firlandia, masyarakat di sana percaya bahwa kucing hitamlah yang membawa jiwa manusia ke

201 RENT : Menyewakan mobil Toyota Kijang MIO CW Krista, LGX, Xenia, Avanza, Innova, Mitsubishi double cabin, Fortuner lepas kunci/supir. Hub: 0616644122, 77179898, 77065252

JUAL/BELI MOBIL : Kijang LSX ‘01/02. 1 unit Carry ‘84. Minibus, 2 unit Xenia. 1 unit APV ‘06. Zebra Pick Up 1.3 ‘95. Hub: CV. Bintang Terang (BT) Telp. 061-7786 0954, HP. 0812 604 0889 Toyota Corolla DX thn 81, warna merah, I Vondered, vr, br, ac, mbl siap pakai. Harga 20Jt/ nego. Berminat hub: 0812 6098 3011 Toyota Kijang Pick Up petak thn 86, siap pakai. Harga nego, Jl. Adam Malik No. 56 Medan, HP. 0812 6507 0486

SEPEDA MOTOR SAHABAT MOTOR

Menjual segala macam jenis kendaraan bekas berkualitas (Cash/Credit) ada garansi mesin, service gratis 3x. Hub: Sahabat Motor, Jl. Pancing No. 135, Telp. 061-7655 5700, 0813 7644 4483, kendaraan yang dijual sebagai berikut :

NEW SUPRA FIT X

thn 2007 Dp. 800.000 angs 358.000/ 36bln thn 2008 Dp. 800.000 angs 378.000/ 36bln SUPRA X 125 CAKRAM thn 2005 Dp. 800.000 angs 396.000/ 36bln thn 2006 Dp. 800.000 angs 410.000/ 36bln NEW SUPRA X 125 CAKRAM thn 2007 Dp. 1.200.000 angs 468.000/ 36bln thn 2008 Dp. 1.200.000 angs 488.000/ 36bln thn 2009 Dp. 1.300.000 519.000/ NEW SUPRA X 125 R (NFangs 125 TR) 36bln thn 2007 Dp. 1.200.000 angs 488.000/ 36bln thn 2008 Dp. 1.300.000 angs 529.000/ 36bln thn 2009 Dp. 1.500.000 angs 569.000/ REVO 36bln JARI thn 2007 Dp. 900.000 angs 358.000/ 36bln thn 2008 Dp. 900.000 angs 398.000/ 36bln REVO CW thn 2007 Dp. 900.000 angs 378.000/ 36bln thn 2008 Dp. 900.000 angs 428.000/ 36bln VARIO CWREVO 110 JARI ABSOLUTE thn 2007 angs 488.000/ 458.000/ thn 2009 Dp. Dp. 1.300.000 1.000.000 angs 36bln 36bln thn 2008 Dp. 1.300.000 angs 498.000/ 36bln thn 2009 Dp. 1.500.000 angs 529.000/ JUPITER MX JARI 36bln thn 2007 Dp. 1.200.000 angs 448.000/ 36bln thn 2008 Dp. 1.200.000 angs 478.000/ 36bln thn 2009 Dp. 1.300.000 angs 519.000/ JUPITER MX CW 36bln thn 2007 Dp. 1.200.000 angs 468.000/ 36bln thn 2008 Dp. 1.200.000 angs 498.000/ 36bln thn 2009 Dp. 1.300.000 angs 539.000/ NEW JUPITER Z 36bln thn 2007 Dp. 1.200.000 angs 468.000/ 36bln thn 2008 Dp. 1.200.000 angs 488.000/ 36bln thn 2009 Dp. 1.300.000 angs 519.000/ NEW JUPITER Z CW 36bln thn 2007 Dp. 1.200.000 angs 478.000/ 36bln thn 2008 Dp. 1.200.000 angs 498.000/ 36bln

NEW VEGA R CAKRAM thn 2007 Dp. 800.000 36bln thn 2008 Dp. 900.000 36bln thn 2009 Dp. 1.200.000 36bln

angs

378.000/

angs

408.000/

angs

428.000/

thn 2007 Dp. 1.000.000 angs 448.000/ 36bln thn 2008 Dp. 1.100.000 angs 468.000/ 36bln thn 2009 Dp. 1.200.000 NEW SMASH CAKRAM angs 488.000/ 36bln thn 2007 Dp. 1.000.000 angs 320.000/ 36bln thn 2008 Dp. 1.000.000 angs 338.000/ 36bln thn 2009 Dp. 1.000.000 angs 375.000/ NEW SMASH CW 36bln thn 2007 Dp. 1.000.000 angs 338.000/ 36bln thn 2008 Dp. 1.000.000 angs 366.000/ 36bln thn 2009 Dp. 1.000.000 NEW SHOGUN 125 RR angs 393.000/ 36bln thn 2008 Dp. 1.300.000 angs 439.000/ 36bln thn 2009 Dp. 1.500.000 angs 466.000/ 36bln SPIN 125 JARI thn 2007 Dp. 900.000 angs 338.000/ 36bln thn 2008 Dp. 900.000 angs 357.000/ 36bln thn 2009 SPIN 125Dp. CW900.000 angs 384.000/ 36bln thn 2007 Dp. 1.000.000 angs 357.000/ 36bln thn 2008 Dp. 1.000.000 angs 375.000/ 36bln thn 2009 Dp. 1.000.000 NEW SHOGUN 125 SP angs 393.000/ 36bln thn 2008 Dp. 1.500.000 angs 448.000/ 36bln thn 2009 Dp. 1.500.000 angs 475.000/ 36bln THUNDER 125 KS thn 2007 Dp. 1.200.000 angs 430.000/ 36bln thn 2008 Dp. 1.200.000 angs 448.000/ 36bln Ayo Buruan jangan sampai ketinggalan PROSES CEPAT NMURAH 1JAM OKBARU!! !!! GRATIS ANGSURAN 5BLN + HP QWERTY • Supra X 125 Dp. 900rb • Beat Dp. 1Jt • Blade Dp. 900rb • Mio Dp. 1Jt • Revo Dp. 900rb • New Jupiter Dp. 1,3Jt • Vario Dp. 1Jt • Vega ZR Dp. 1Jt Hubungi : Hafiz, 0812 6501 1970

alam baka. Di China, kehadiran seekor kucing hitam merupakan pertanda bahwa mereka akan terkena penyakit atau akan jatuh miskin. Ceritanya sedikit berubah ditempat lain, di India, jiwa yang bereinkarnasi dapat dibebaskan dengan melempar kucing hitam ke api. Ada satu legenda dari Bengali bahwa ada seorang wanita yang dapat merubah jiwa manusia menjadi seekor kucing hitam, dan setiap kucing hitam yang disakiti akan menyakiti wanita itu juga. Masyarakat Celts percaya bahwa kucing hitam dapat memprediksi masa depan. Druids pada masa Inggris kuno percaya bahwa kucing merupakan jelmaan seseorang yang berbuat jahat di masa lalunya kemudian di hukum menjadi seekor kucing hitam. Nah, salahkan para druids, karena merekalah yang telah menghubunghubungkan kucing hitam dengan Halloween, hantu dan para penyihir. Ada juga kepercayaan lain, yang mengatakan bahwa kucing hitam ini merupakan salah satu penyamaran para penyihir. Walaupun tidak ada

saksi yang pernah menyaksikan ada penyihir yang berubah menjadi seekor kucing hitam atau seekor kucing hitam yang berubah menjadi seorang penyihir, tetapi mereka mengatakan bahwa suatu hari mereka menyakiti seekor kucing hitam dan kucing hitam itu terluka, dan keesokaan harinya mereka menemukan

SUZUKI 100% BARU CUKUP BAYAR : HADIAHLSGTV14”+HP+HELM+JACKET • Smash Dp.1.250.000 angs 480.000 36bln • Spin Dp. 1.200.000 angs 519.000 36bln • Shogun Dp. 1.800.000 angs 562.000 36bln 0812 6566 176, 0812 6386 618, 7628 1045

Suzuki

Spin CW ‘08, warna merah hitam, BK panjang. Harga Rp. 6,6Jt. Hub: 7692 4418

BUTUH UANG BUTUH DANA TUNAI !!!

Min. 25Jt, jaminan BPKB mobil/truk. Proses cepat & aman. Hubungi: Rahmat, 061-7707 0202, 0813 9697 0202

BUTUHDANA: Jaminansertifikattnh,camat,BPKB

mobil, sp. motor, elektronik, laptop & perhiasan. Hub: Akien 0819 6005 252, 7706 5252, 0813 7691 6374 BUTUH DANA CEPAT : Proses mudah, cicilan murah, jaminan BPKB sp. motor, betor, mobil, angkot. Hub: 061-6611 196, 0813 6162 2462, 0812 6494 2510, 061-7695 5474, 0812 6519 6218 (Simpan Iklan ini bila perlu)

BUTUH DANA CEPAT

Jaminan BPKB spd motor, mobil pribadi, KPUM, betor. Hub: KSU Yoga Solafide Jl. Veteran No. 3B Telp. 061-8455 296, 0852 9661 0596 P. Brayan

percayaan yang satu ini diakhiri dengan memberikan mereka permenpermen yang manis untuk mengantisipasi para penyihir itu agar tidak membuat keonaran. Percaya atau tidak, apakah kucing hitam ada hubungannya dengan dunia spiritual itu semua terserah Anda. (misteri.o.l/int)

DANA CASH : 1/2 Milyar, bergaransi. Khusus IBUNDA OUKUP : Usaha kami yang sedang DIJUAL RUMAH : Lokasi Perumahan Taman PIJAT TRADISIONAL ZULIYA SHM, HGB, Sk. camat, Akta Notaris. Bunga rendah, 1 hari cair, aman & terjamin, data dijemput, terima BPKB kenderaan/juga yg masih kredit. Hub: Sinaga, 0812 6303 887, 0878 6997 0868 BUTUH DANA : Jaminan BPKB mobil/truck thn 90 & sp. motor. Hubungi: Samuel 0852 9615 6555, Andi 0812 640 0575

LOWONGAN KERJA ADA LOWONGAN : Wanita (gadis/janda) 1

org jaga anak & 1 org jaga org tua, gaji 650rb + bonus/bln. Hub: Nesia, Jl. Flamboyan Raya No. 21 Tj. Sari. 061-6992 1199, 0812 6463 504

ADA LOWONGAN; INCOME BESAR

Dibutuhkan P/W, usia 17-45thn, min. SMP, SMA sederajat. Dtg lgsg kerja, penghasilan diatas UMR (1,8Jt/bln). Hubungi: Ibu Aditya, HP. 0813 6166 9314. Jl. Wahid Hasyim No. 118 A simp. Barat ± 100m dari Gatsu

berkembang membutuhkan ibu-ibu untuk dipekerjakan sebagai Tenaga Pemijat. Tidak mesti pintar karena akan diajari, disediakan pemondokan. Berminat datang langsung ke Jl. Bunga Mawar/ Sembada 108 (P. Bulan). Selayang II (Medan). Hub: 8215 624, (Ari) 0813 7061 2358, (Mery) 0812 6304 2501, 0811 610 850 (Gina), setiap hari pkl. 08.00-18.00 wib DIBUTUHKAN : Beberapa waiter/waitres, utk dipekerjakan dibagian Sauna, diutamakan jurusan Pariwisata/Keperawatan, gaji sangat memuaskan. Hub: 0813 7582 3634 (Merry) 0813 7061 2358 (Ary) 0812 6304 2501 (Gina) atau datang langsung ke Jl. Bunga Mawar No. 108 Pasar V Padang Bulan Medan

Sari Permai Blok E No. 82, Lt. 105m2, Lb. 106m, (Lt. 2) SHM. Hub: 0812 6352 9224

INTERNET/DICARI SEGERA : 1 org yg

LINTAH SUPER + VACUM IMPORT DIJUAL TANAH : Lebih kurang 1200m2, Bikin Besar, Panjang, Keras A. Vital

mahir tekhnisi komp/internet, siap dipanggil bila diperlukan. 3 org pegawai tetap wnt/lk, diutamakan laki2, ada Shift malam, ramah & jujur. Hub: 0813 7640 6733, S. Budi 67A pelayanan Cafe, diutamakan yang rajin/jujur. Hubungi: 7635 0413, 0819 2029 139

ADA LOKER : Wanita (gadis/janda) dipekerjakan

jaga anak & prwt org tua, gaji 600rb-1,2Jt/bln LOWONGAN KERJA : membutuhkan secu(bersih) + bonus 50rb. Hub: Cahaya, Jl. Ayahanda 44E, 061-7670 0079, 0812 6514 3676 BUTUH : 1 org gadis/janda yg rajin utk bantu beres warung, bisa nginap, boleh di luar kota, gaji 700rb. Hub: 0852 6236 0340 (No SMS)

rity sbyk 75 org/pria, krimkan lamaran lgsg ke IMAGEN SMART SECURINDO. Jl. Purwosari, Komp.Pelangi Asri No.177 krakatau mdn. telp.6616744,6640667 LOWONGAN KERJA : Dibutuhkan pembantu rumah tangga dan baby sitter, wanita, rajin, jujur, dan bersedia nginap. Hub: 0812 6568 0555

BUTUH : Ass. salon wanita, bisa pangkas

& rebonding, daerah Pd. Bulan. Hub: Merpati Salon, HP. 0857 6246 6868

DIBUTUHKAN : 1 Orang ahli membuat roti

canai, laki2 dan martabak 6 orang wanita usia 21-40thn, muslim utk PRT, kesemuanya untuk bekerja di Malaysia, majikan sudah ada. Berminat hubungi: 0813 6158 2355

Telp. 8450 863, 0813 6172 9884

DIBUTUHKAN : Wanita (gadis/janda) utk di

pekerjakan jaga anak & org tua, gaji 600rb s/d 1Jt/bln bersih + bonus 50rb. Hub: Yayasan Kasih Sayang. Telp. 0813 9792 2135, 0617737 7059 DIBUTUHKAN : As. salon mahir semuanya, Gp. Rp. 500.000 + u. makan + komisi pekerjaan. Hub: HP. 0813 6104 9322 & 0813 7057 6936 Salon Modren DIBUTUHKAN SGR : Tk. pangkas mahir, jujur, berpengalaman, u. jaminan Rp. 40.000 + tempat tinggal Samosir (Pangururan) Hub: Tlp. 0626-20716, HP. 0812 6462 6272

HOTEL PENGINAPAN GUEST HOUSE

Simpang Barat, Jl. Wahid Hasyim No. 126A/B. Harga kamar: Senin-Kamis Rp. 100rb, JumatMinggu Rp. 120rb. Fasilitas: AC, TV, Toilet, tmpt tdr king size

TANAH

Khusus refleksi, lulur, capek2, lemah syahwat Jl. Laksana 33-O, HP. 0813 7087 8289

KUSUK CAPEK-CAPEK DAN LULUR Hub: Mbak Endang HP. 0812 6540 0190

PENGOBATANKUSUKLULURTRADISIONAL Bu Rosa, bersedia dipanggil HP. 0813 7700 3459

MBAK NENENG : Terima pijat utk capekcapek, lemah, letih, lesu, keibuan, sabar, pintar mijat. Hub: 0813 6172 7258

Jl. Imam Bonjol No. 160 Binjai, TP. Hubungi: 0812 2105 6612, 0818 0925 9349

Aldo 0812 109 44445 Antar

10x20m=50Jt • 10x25m=60Jt. Hrg nego. Buruan terbatas!!! Lbr jln 5m, 7m, 13m. Lok: 5mnt dr Ktr. Walkot Binjai, Jl. Semi 3 dkt Mesjid Ubudiyah. Hrg sdh termasuk pajak jual beli & balik nama, SHM, PBB awal. Serius. Hubungi: 0816 312 4916, 0813 7629 5205

Aldo 0812 109 44445 Antar

PELANGSING FAT LOSS LOGO KAVLINGMURAHSHMDIBINJAISLTN/ESTATE 1 Bulan Turun 5 - 12 Kg Pasti Tanpa LOWONGAN KERJA : Wanita untuk • Uk. 7x15=25Jt • 14x15m=50Jt • Efek

ELEKTRONIK DIJUAL :

TV LG LCD 32 inch, masih bergaransi 1, 2 unit, bisa nego. Hub: 0852 1658 8779

DIJUAL :

DIBUTUHKAN : Wanita 17 s/d 30thn. TV LCD 32 inchi Samsung, harga 4Jt. Dijual rak sebagai perawat jompo/kakak asuh, honor Rp. 3 buah harga 2Jt. Hubungi: Ami 0878 9193 HONDA PAKET GURU, PNS & KARY. SWASTA 500rb s/d 1,5Jt. Hub: Yayasan Sumatera, 7979 • Revo jari Dp. 500rb ang 489rb 36bln • Blade Dp. 500rb ang 573rb 36bln • Supra X 125 D Dp. 700rb ang 591rb 36bln • Beat jari Dp. 700rb ang 570rb 30bln Hub: Ferry, 0813 7690 8123, 061-7657 4066

luka yang sama ditempat yang sama kucing itu terluka pada seorang wanita. Kepercayaan lain mengatakan bahwa kucing hitam adalah partner para penyihir untuk menyelesaikan their evil deeds. Mereka akan terbang dengan sapu lidi mereka dan mulai membuat keributan tetapi ke-

KOMPUTER SERVICE COMPUTER, LAPTOP

Pemasangan WiFi, LAN, jaringan Internet, dll. Bisa dipanggil. Hub: 0812 6054 4627

SERVICE AC TRISAT : Service cuci AC Rp. 20.000,-

DIJUAL TANAH :

Uk. 10x13m2, Kapl. Jl. Pendidikan masuk Psr. 8 Tembung Medan. Hub: 0813 7506 1156 TP

TERCECER

OBAT KUAT TADALAFIL + SPRAY Spontan Kuat, Keras & Tahan Lama Aldo 0812 109 44445 Antar

WC SUMBAT/RUSAK WC TUMPAT 061-7762 6388

Sedot / Saluran Air K. Mandi, Westafel, Rehab S.Bor. Garansi Hub : 0812 6392 2800

WC TUMPAT SEDOT :

Saluran air, kamar mandi, wastafel.

TERCECER : Sbh BPKB spd. motor BK 3152 Bergaransi. Hubungi: 0812 6082 7816 IY, an. Iswanda Putra Situmorang, Jl. M. Nawi Harahap Blok K No. 21 Medan. Tercecer disekitar Jl. SM. Raja Mdn Tgl. 12 Mei 10, jam 1 siang. Hub: 0813 7186 5588

PENGOBATAN MEISSY MASSAGE

Berpengalaman dari Malaysia, ahli urat dan segala penyakit pria/wanita. Hubungi: 0812 6540 7033, alamat : Jl. AR. Hakim/Bakti Gg. Rahayu 1 No. 11 Sukaramai Mdn JASA MASSAGE : Ramah, penyabar, pintar mijat, bersih. Menerima panggilan kerumah/hotel. Call: 0812 6394 9586, 0852 7546 2133 RUDY MASSAGE : Pijat capek2, khusus Pasutri & wanita dewasa, khusus panggilan ke hotel. Hub: 061-6690 7537

WC TUMPAT/SEDOT

Saluran air, murah bergaransi. Hubungi : 061-7878791, 088261586654 MOBIL SEDOT WC : 061-7773 7996, 0852 7093 3649 sal. air, wastafel, grsi, murah. 0819 3340 8099. Maju Jaya Gatsu 159

SALSA SERVICE WC :

Sedot WC, tumpat, dll 0813 7047 9596

WC TUMPAT : Sedot, sal. air

Murah bergaransi 061-786 2713, 0812 6491 1858

WC TUMPAT: penuh , saluran air, rehab,

survey gratis/bergaransi dan murah, hubungi: Pak Andi telp: 061-8227240

WC EKA JAYA : 0813 9761 2319, 061reperasi AC, bongkar psng AC central, dis76880437. Sedot sumbat, sal. air, ps piva penser, psng baru. Terima servis luar kota. RERE OUKUP + KUSUK SEHAT sanyo, rehab. Gatot Subroto 90. Garansi Hub. 7322 579/HP. 0812 6012 Mengobati masuk angin, badan pegal-pegal, DIBUTUHKAN SEGERA : Beberapa supir Bergaransi. keseleo, mandi rempah-rempah/air panas 868 memiliki SIM B & kernek utk luar kota & Alamat : Jl. Veteran Krakatau No.7 C dekat MARTIN SERVICE SEDOT WC TUMPAT dalam kota, rajin, jujur, tdk merokok & tahan angkat berat, umur max. 40thn. Hub: Toko Subur Baru Keramik, Jl. SM. Raja simpang Marendal DICARI : Investor (tanpa bekerja) profit perhari 8% Rp. 7.280.000 selama 100 hari, modal suka suka. Info www.berlianvalley.com atau SMS “Petunjuk” ke 0878 8405 8076

DICARI : Supir pribadi utk bawa mobil matic,

masuk jam 6 pagi, jujur, rajin tdk merokok, diutamakan yg sdh berpengalaman, umur minimal 30 tahun. Hub: Toko Subur Baru Keramik, Jl. SM. Raja simpang Marendal

DICARI :

Asisten salon yg ramah dan jujur. Hubungi: 0813 6169 6087

DICARI : Agen distributor utk pasarkan kamera, pulpen, remote & audio mp3, memory card. Segera hub: 0852 7092 1945, 061-7764 3892

PLAYSTATION

Maju Bersama, HP: 061-76417925

PIJAT & LULUR MBAK TARI EVOLUTION GAME

• PS2 slim 90006 baru bergaransi • PS2 tebal bergaransi • PS2 Hard Disc 80 & 160 GB bergaransi • Pasang hardisk PS2 slm & tebal grnsi • Service PS1, PS2, PS3, X-Box, PSP, siap ditempat. Jl. AH. Nasution No. 8C Titi Kuning Mdn Telp. 061-7688 9988, 0812 6569 9860

JUAL & BELI : TV, PS1, 2, 3, Handycam, LCD,

Proyektor, Laptop, Keyboard, Kulkas, M. Cuci, Compo, Sound, dll. Hub: Market Electronic Tlp. 8210097, 66900693, Jl. Setia Budi 424B. S.R. Road

RUMAH

Setaluran air kamar mandi, wastafel, bergaransi. Hub: 061-7627 9447, 0812 600 7919

HP. 061-9167 1526 NB: Menerima panggilan ketempat

PIJAT & LULUR ELIWATI

Jl. Selam Gg. Pertama HP. 0878 6935 6207

PIJAT & LULUR MBAK MIKA

Jl. Mandala By Pass, HP. 0812 6446 8869 NB: Menerima panggilan ketempat

PIJAT TRADISIONAL

Hub: Ibu Wahyu HP. 0812 6582 3788

PIJAT MACHO

Ganteng, penyabar, pintar mijat, berpengalaman. Hubungi: 0852 7070 0345, 061-7718 2510

C MYK

Tanya:

ASESORIS kucing hitam sering kali muncul dalam acara yang berkaitan dengan dunia mistis. Seperti menjelang malam Hallowen, simbol kucing hitam dijual dalam bentuk boneka kecil atau gantungan kunci. Binatang bermata menyala waktu malam hari ini selalu dikaitkan dengan dunia sihir atau magic. Mengapa?

HALAMAN 4

MINGGU, 16 MEI 2010

* Isi dari Materi Iklan diluar tanggung jawab Penerbit


Penyerang 29 Anak di China Divonis Mati CHINA Pengadilan lokal di China, Sabtu (15/5), menjatuhkan hukuman mati atas seorang pria yang menyerang dan melukai 29 anak dan tiga guru di satu taman kanakkanak (TK) di China timur pada April lalu. Xu mengaku dalam proses pengadilan itu bahwa alasannya ialah untuk menyalurkan kemarahannya terhadap masyarakat. Pengadilan Menengah Taixing memutuskan Xu Yuan bersalah melakukan pembunuhan secara sengaja setelah pengadilan terbuka selama setengah hari, yang dihadiri oleh 300 orang. Xu mengaku dalam proses pengadilan itu bahwa alasannya ialah untuk menyalurkan kemarahannya terhadap masyarakat. Tidak diketahui apakah Xu akan mengajukan banding atas putusan yang diterimanya atau tidak. Sebanyak 29 anak dan tiga orang dewasa cedera ketika Xu menyerang mereka dengan menggunakan

pisau di Taman KanakKanak Zhongxin, di kota Taixing pada 29 April. Serangkaian serangan terhadap anak sekolah telah mengguncang China dalam beberapa pekan belakangan. Polisi telah diperintahkan untuk meningkatkan pengamanan di lingkungan sekolah dan permukiman di dekatnya.(bd/dc)

sekira 60 penumpang. 32 penumpang bus tersebut berhasil diselamatkan dan kini menjalani perawatan di rumah sakit di wilayah setempat. Sebagian besar dari korban yang dirawat mengalami shock dan menderita luka bakar. Sementara 28 penumpang lainnya dipastikan tewas akibat insiden ini. Peristiwa ini merupakan yang kedua kalinya terjadi di India dalam beberapa hari terakhir. Sebelumnya 15 orang tewas dalam insiden serupa di wilayah Bihar, Kamis 3 Mei.(bd/oz)

BRISTOL Apes. Mungkin kata ini yang paling tepat untuk menggambarkan kesialan Wayne Moore, 37, manajer sebuah restoran di Inggris.

Moore saat itu ingin menikmati kesendirian dengan santai di rumah sambil merokok. Saat dia menyulut rokok, tiba-tiba sebuah ledakan dahsyat menghancurkan rumahnya. “Aku ingat peristiwa mengerikan tersebut. Aku sedang menyalakan rokok, tiba-tiba muncul bola api dari rokokku dan ledakan besar terjadi,” tutur Moore. Moore mengalami luka bakar serius. Tidak hanya Moore, Ibunya, Irene Stoneman, 57, yang saat itu juga sedang berada di rumah juga mengalami nasib yang sama, terbakar. “Aku tiba-tiba sudah di luar rumah dengan luka bakar. Sementara, aku

YAYASAN HARAPAN BUNDA

Jl. Pinang Baris No.113 B (DepanPintu MasukTerminalP.Baris) Hp : 0813 9644 4756 - 0878 6880 4679 - 061 76324400

LOWONGAN KERJA Kami Perusahaan yg bergerak dibidang otomotif (Showroom) membutuhkan beberapa karyawan yang akan ditempatkan sebagai MARKETING EXECUTIF Kualifikasi Sbb: 1.Lulusan minimal SMA/ Sederajat 2.P/W usia min 20 thn 3.Memiliki Sp. Motor/ SIM C 4.Mampu bekerja secara individu & team 5.Jujur & Bertanggungjawab Lamaran diantar langsung ke

PT. ALFA SCORPII

Jl. AR. Hakim No. 134 BCDE Medan Kode Yusuf

LOWONGAN KERJA...!!!

Kami perusahaan yang bergerak di bidang otomotif sedang membutuhkan: “ MARKETING “ Dengan kualifikasi berikut: 1. Pria/ wanita usia max. 30 tahun 2. Pendidikan min tamatan SMA 3. Berorientasi pada terget 4. Dapat bekerja secara individu dan team work 5. Memiliki sepeda motor dan SIM C 6. Bertanggungjawab dan Loyalitas Lamaran diantar langsung ke: PT A SCORPII PT.. ALF ALFA Jl. Besar Delitua KM 11 No. 40 (depan Sekolah Singosari) NB: Diutamakan berdomisili di Medan Amplas, Patumbak, Delitua, Namorambe, Medan Johor, Medan Maimun dan Area Sekitarnya

KAVLING MURAH KHUSUS MUSLIM 17,50X8 M Rp. 12.500.000 Lokasi: gg. Starban Desa Telagasari Kec. Sunggal Tanah tinggi, rata, bebas banjir. Surat Dasar SHM/ SK Bupati, 8 km dari simpang Diski (Jl. Medan - Binjai) Aspal, 200 belum aspal Hub: H. Salimik 081 2601 8160 Jl. Binjai Km. 15,4 No.7 AB Diski Bawa pembeli komisi Rp. 500.000

PELUANG KERJA

Ukuran 1x40

100 % Bukan Sales

Perusahaan Swasta, butuh P/ W (1735 thn) untuk diposisikan di kantor cabang baru di Medan, Penghasilan Rp. 1.500.000/ bulan, bisa pilih jam kerja. Hub: Ibu Tia Ada Shift Kerja Hp: 0813 7009 8750 Alamat Kantor: Jl. Wahid Hasyim No. 118 A ± 100 m dari simp. Barat Gatot Subroto Medan NB: bawa guntingan iklan ini langsung diterima

menyelamatkan diri mereka dengan merangkak keluar dari reruntuhan puing-puing rumah mereka.

Rp.25.000/terbit Rp.625.000/bulan

Ukuran 2x40

Rp.50.000/terbit Rp.1.000.000/bulan

REZEKI ELEKTRONIK BUTUH Jaminan BPKB/ Spd. Motor REZEKI ELECTRONIC DANA Hub: ASIONG Jl. Serdang No.441-E Depan Pasar Aksara/ 9777 1688 CEPAT Spg Macan Yaohan Telp.08134149159 Jl. Prof. HM. Yamin/Serdang No.441-E (dpn Aksara Plaza) samping Macan Yaohan, Telp : 061-4149159

Rp.200.000,Rp.150.000,Rp.250.000,Rp.450.000,Rp.535.000,Rp.750.000,Rp. 65.000,Rp. 65.000,Rp.400.000,Rp.200.000,Rp.120.000,Rp.850.000,-

DVD Speaker active TV 9’ (b/w) TV 14’ TV 17’ TV 21’ Blender . Dispenser Parabola Digital receiver Magic com Mesin cuci 2 tbg

Bebas ADM

PROSES CEPAT - BUNGA 1 %

Hubungi: 061-91013535 “ BAMBANG AL-AZIZ” KONSULTAN SPIRITUAL

= TERBUKA SEMUA AGAMA & GOLONGAN = 1). Pengisian “Susuk Samber Lilen” Semar mesem tk 10 = jenis susuk pamungkas tingkat tinggi yang mengandung power daya pikat berlipat ganda atau di isi sesuai kebutuhkan anda (Super Dahsyat !) dijamin aman lahir & bathin mahar = khusus 2). “ BEDAK Aura Ratu Cennera” = Dapat merubah Anda menjadi wanita yang cantik mempesona siang & malam, kulit wajah jadi putih dan mulus, awet muda & mengandung daya pikat luar biasa hebat ! (Cobalah & buktikan) Mahar Rp. 250.000 3.) “ Buka Aura & Aji Pengasihan Tembus” = Kekuatannya mampu membebaskan diri dari emosi negatif dan kesialan hidup sehingga anda akan tampil percaya diri, aura bersinar disenangi dalam pergaulan & cinta banyak relasi, mampu menarik simpati, sukses dalam karir, membawa ketenangan hati & mendatangkan rejeki besar.... (Demi sesama: Mhr Rp. 91.000) Yakinlah !! Alamat Praktek: HB: Bambang Al- Aziz: 061.773.773.70 , Hp: 0813 7084 7253, Jln. Medan - Tg. Morawa km. 12,5 Gg. Suka Mulia No.76 Dekat Pesantren Al- Muklisin (Hari Besar/ Minggu Tutup)

PARANORMAL ABAH RAHMAN

“PELUANG KERJA”

Melayani sampai tuntas : Problem rumah tangga, cinta, karir, jodoh. Dll. Dtg langsung atau jarak jauh hasil sama. 1. MINYAK PEMIKAT SUKMA : Sebotol minyak yang sudah dititiskan doa doa pengasih tingkat tinggi. Reaksi ilmu ini benar luar biasa, orang lain seketika dapat mabuk kepayang terus terbayang bayang wajah sipemakai aroma. Apa pun keinginan si pemakai aroma dengan mudahnya dituruti oleh orang lain. Aman dipakai untuk siapa saja. Sangat cocok dipakai oleh petualang cinta. Mahar : 300.000,2. CINCIN PINTU REZEKI : Lewat media batu cincin yang sudah diisi kekuatan supranatural khusus akan membantu Anda agar selalu berwibawa, disegani orang, selalu hoki dan menarik rasa cinta bagi lawan jenis atau pun sejenis. Mahar : Rp. 300.000,3. KERIS KECIL MAGNET PELARISAN : Miliki segera benda pamungkas ini. Sangat ampuh digunakan untuk berdagang maupun berbisnis. Secara otomatis menarik rezeki dari arah mana saja. Mahar : Rp. 300.000,-

Terbuka Untuk Semua Kalangan

Butuh cepat P/W usia 17 - 42 Thn untk kerja di kantor min: SMP, SMU sederajat (100% bukan sales), ( 2.5Jt/ bln) Bisa pilih jam kerja. utk info: Hub: IBU ADITYA Hp : 0813 6166 9314

Atau datang langsung ke Jl. K.H.Wahid Hasyim No 118A. simpang Barat , Gatot Subroto, Medan DIBUTUHKAN SEGERA: 1.PEGAWAI WARUNG MAKAN: Perempuan, Muslim, Menginap, Rajin, Jujur, Bnr2 Niat Mau Bekerja 2.PRT: PEREMPUAN, MUSLIM, MENGINAP, Asuh Anak dan Kerja Rumah Tangga, Rajin, Jujur. Hub: 061-91011455

“Kami beruntung masih hidup. Kondisi kami kini sudah mulai membaik,” kata Moore.(bd/kcm)

SEOUL Pihak Departemen Arkeologi Korea Selatan menemukan mumi berkelamin wanita yang diperkirakan berusia sekitar 500 tahun di sebuah kawasan di Korea Selatan. Mumi wanita yang diduga berasal dari kalangan sosial ekonomi atas ini diyakini adalah istri salah seorang pejabat pemerintah tingkat tinggi semasa Dinasti Joseon. Mumi wanita tersebut ditemukan bersama peti jenazahnya yang terbuat dari kayu terbaik serta tas dan pakaian kehormatan bagi wanita bangsawan.(bd/kcm)

Loker, Elektronik, dll LOWONGAN KERJA

segera mencari ibu, yang juga tertimpa reruntuhan rumah,” kata Moore. Moore dan Irena, Ibunya berusaha

Mumi W anita Ini Berusia 500 T ahun Wanita Tahun

Iklan INFO

Dibutuhkan tenaga wanita tamatan SD, SLTP, SLTA, SPK, AKPER untuk menjadi : • Babby Sitter • Perawat Jompo/Pribadi • Kakak Asuh Honor Rp.650.000,- s/d 1.250.000,Hubungi :

HALAMAN 5

Menyalakan Rokok, Rumah yang Meledak

Bus Sentuh Kabel Tegangan Tinggi, 28 Tewas

NEW DELHI Sebuah bus yang ditumpangi oleh rombongan undangan pesta pernikahan, hangus terbakar setelah tidak sengaja menyentuh kabel tegangan tinggi. Insiden yang terjadi di India ini menewaskan 28 penumpang bus nahas itu. Seperti dilansir Associated Press, Jumat (14/5), kejadian ini disebabkan oleh sebuah kabel bertegangan tinggi dibiarkan terurai di atas jalanan distrik Mandla, di wilayah Madhya Pradesh. Menurut pihak kepolisian, bus tersebut membawa

MINGGU, 16 MEI 2010

Power Buy TV LG 21’ Ultra Slim Hadiah TV Samsung 21’ Langsung TV Advance 21’ Jam Digital TV Fuji 21’ Kulkas 1 Pintu Samsung M. Cuci 2 Tabung AC 1 PK

Rp. 98.000,- x 12 Rp. 98.000,- x 12 Rp. 75.000,- x 12 Rp. 75.000,- x 12 Rp.140.000,- x 12 Rp.110.000,- x 12 Rp.195.000,- x 12

NUSANTARA JAYA ELECTRONIC Jl. K.L. Yos Sudarso No.47 GH Glugur Kota 6613329

Lokasi Dipinggir jalan besar/ jalan utama Dusun 3 Desa Banda Labuhan Kec. Tj. Morawa ukuran sesuai keinginan, harga maximum Rp. 100 rb/ meter. Daerah Bebas banjir, surat SK Camat. Peminat Hubungi: H. Mijaharuddin, 081361211185, Moh. Azman 061-76311007

BUTUH DANA CEPAT Hubungi

Ryan Sinar Mas Multifinance

BERGARANSI

Bawa Iklan Ini Akan Mendapat Hadiah Menarik

Dengan Jaminan BPKB sepeda motor kami memberikan pinjaman mulai dari Rp.2 juta - Rp.10 juta. Gratis 1x angsuran, Gratis Biaya Administrasi, Proses Cepat dan Angsuran Murah Kantor : Jl. Veteran Psr VII No.50 Marelan 061-6841632,

HP: 0813 7048 6343

klik www.abahrahman.com

PESANGGRAHAN TITIK BA

PERMATA GRIYA

SUMBER ILMU HIKMAH THAREKAT DAN TASAWUF

Tanpa Mahar Dengan niat tulus membantu anda dalam hal perekonomian/ rezeki, pelaris usaha, asmara, problem rumah tangga, dan semua masalah yg anda hadapi dalam kehidupan. Banyak orang yg telah tertolong, simpan iklan ini suatu saat anda perlu. iklan tidak iklan praktek tetap buka setiap hari jam 08.00 - 22.00

KI P. SUJIWO 0813 7097 3005

Jl. Klambir V ± 500 meter lewat kantor PTPN 2 Gg. Ridho samping lapangan bola

Praktek : Jln. Laksana Gg. Kadi No. 25, (Belakang Indomaret) Medan. HP : 0813 7630 6023. (SMS tidak dilayani) Bank : Mandiri A/C 106-00-0509115-5 A/n Abdurrahman. Terdaftar di Kejaksaan Tinggi Sumut No: B-45/DSP.5/01/2010

MASSAGE & SPA

Komp, Ruko Griya Riatur Blok A No. 48

Telp. 061-8444287

MASSAGE, LULUR & FACIAL Dengan Therapis Yang Muda & Baru Serta Berpengalaman,

Tersedia Paket :

Harga Treatment Ekonomis

Fasilitas : AC, Air Panas, Minuman Kesehatan, Aman & Nyaman

PROMOSIKAN PRODUK , USAHA DAN JASA ANDA HANYA DI POSMETRO MEDAN Kunjungi Perwakilan Dibawah Ini 76410406

Promosikan Produk, Usaha Dan Jasa Anda Hanya di

Harian POSMETRO MEDAN

Telp. 061-7881661, Fax: 061-7875616


Flashter Band

Wak Ingin Uedup di Sanggung Musik MEDAN Menjadi rock star dan digandrungi banyak orang, tentunya menjadi impian pelaku musik. Hal itu pula yang tengah dipersiapkan sekelompok pemuda yang tergabung dalam Flashter Band. Pengalaman menjajal panggung-panggung musik menjadikan Budi (vocal), Agoes (gitar & backing vocal), Fujie (bass & backing vocal) dan Novrie (drum, percussion & looping) yakin mampu menembus pasar nasional. Band yang mereka bentuk tahun 2006 dengan pilihan warna musik rock alternative dan sedikit sentuhan modern rock membuat lagu-lagu yang mereka hasilnya terdengar easy listening. Inspirasi menciptakan musik dan lagu, anak-anak Flashter terpengaruh dengan band-band seperti, Hoobastank, Incubus, Foo Fighter, Z’arc Enciel, Luna Sea dan X-Japan. Sedangkan musik Indonesia seperti Rif, Andra and The Backbone, J-Roks, Samson, Naff dan musik hits. Tiga lagu yang rampung sebut Budi, sudah melewati proses recording di Citra Studio Recording. Diantaranya lagu berjudul Masih Mencintaimu, Hanya Teman Saja (HTS) dan Cinta Palsu.

Mendatang personil Flashter tengah sibuk mempersiapkan jadwal manggung di piala dunia nanti. Malah saat ini mereka sedang focus di acara A Mild Wanted. “Saat ini kita lagi fokus acara A Mild Wanted. Soalnya, dari 18 finalis A Mild Wanted, Flashter menjadi salah satu finalis. Doa kita ya supaya masuk babak final,” harap Budi. Budi yang merupakan eks basis Band Pipet ini mengaku, tak semudah membalikkan telapak tangan untuk menjaga band tetap eksis. Terlebih persoalan yang biasa dihadapi group band adalah solidaritas personilnya untuk tetap eksis. Jika eksistensi tersebut sudah terjaga, tangga untuk menuju kesuksesan akan semakin mudah diraih. Flashter sendiri terang Budi telah mengalami pergantian personil. Posisi Fujie yang menggawangi bass & backing vocal sebelumnya dikendalikan Arie. Alasan keluarnya Arie menurut mereka menjadi sesuatu yang tak dapat dicegah. Rutinitas kerja untuk memenuhi kebutuhan ekonomi menjadi alasan Arie. Keluarnya Arie, sempat membuat Flashter vakum selama enam bulan di pertengahan 2009. (ali amrizal)

HALAMAN 6

MHGAN SANASee

Begitulah kata kebanyakan orang yang bakal kita dengar belakang hari ini. Tentunya kita tau benar penyebabnya dikarenakan menipisnya lapisan ozon. Lantas apa yang seharusnya kita lakukan? Yuks!! Kita simak apa kata rekan-rekan Metro.

Djunot Amri : GO GREEN...tanam pohon sebanyak2nya!!! betol ga?!!

Dweek Mardova Nasution : Kesadaran masing aja ya.. satu lagi.. kesadaran pemimpin nyaa..pemimpin yg seharusnya memberikan arahan seperti ini.. satu lagi.. kesadaran manusia amat sangat diperhitungkan, seperti mematikan lampu yg tidak di pakai.. tidak melakukan penebangan liar demi keuntungan sendiri.. menurut aku itu aja sih.. kesadaraan... manusianya yang harus lebih ditanam.. sama kaya pemimpin nya..

CMYK

MINGGU, 16 MEI 2010

Budenk Milano- Budiman : Klo batik bs diwajibkan setiap hari jumat di kantor-kantor hanya utk menghargai warisan budaya. Kenapa untuk masa depan Bumi ga diwajibkan aja naik sepeda ke kantor setiap hari apa gitu.. Bagi yg naek kendaraan bermotor dikenain SP atau Surat Peringatan dari kantornya masing-masing.

Mahjijah Ozy : Gundulin terus hutan yang ada. Bangun rumah kaca banyak-banyak. Buka peternakan seluas luasnya. Hehehhehee… Kalo makin panas kita pasang ac di setiap ruangan biar sueejuukkk.

Nanda Kc Smith : Ya penanaman sejuta pohon lah sama penghematan pengunaan barng elektoric kali yaa..

CHUSHN Oleh : Sunny, Penikmat Sastra, Kuliah dan Bekerja di Pekanbaru

SATU WAKTU TIGA HATI

aku sedikit menjauh dari Jumi. Berusaha agar ia tidak mendengar semua perbincanganku dengan Gugun. “Jum! Tunggu sebentar, yach! Dari kakak!” kataku pada Jumi sambil meninggalkannya. Tentunya ia percaya dengan kebohonganku. “Halo Gun!” sedikit ketakutan, aku mengecilkan suara. “Fika! Tugas Metode Penelitian sudah siap? Aku kurang paham. Tolong ajarkan, Fik!” “A..a…ku?” tanyaku gugup ‘Ia! Please!” jawabnya dengan penuh harap “T…ta…ta…pi, aku rasa Gugun lebih paham dari aku!” “Please, Fik! Aku nggak paham Metode Penelitian!” “Ok, di pustaka wilayah, besok, jam 1!” sambungku tanpa ada keraguan. “Ok, my friend!” Esok hari. Dia sudah menungguku. Dari balik kaca bening, jelas aku melihatnya mengutak-atik sebuah laptop. Rasa bersalah itu

mulai bergejolak kembali. Apakah aku sesuai dengan apa yang dikatakan orang-orang? Aku yang menepuk air. Sayangnya, yang basah bukan mukaku, tapi muka Jumi. Apa yang harus aku dahulukan? Perasaan aku sendiri atau perasaan sang teman. Langkah ini begitu berat. Semakin berat ketika aku semakin berada dekat dengannya. “Tukang jaga pintu, yach?” Sentak aku terkejut mendengarnya. Berarti dari tadi ia sudah melihat aku yang mematung di pintu masuk pustaka wilayah. Wajahku memerah. Dadaku berdebar.

Keringat dingin mengucur dari seluruh tubuhku. Harapanku dia tidak ingin tahu apa yang aku rasakan saat ini. “Melamun! Mikir apa?” “kg…kg…nggak. Nggak mikir apa-apa. Benar, aku nggak mikir apa-apa!” aku meyakinkan Gugun. Berusaha mengembalikan konsentrasi pada pelajaran yang akan kami bahas. Keringatku masih bercucuran. Bahkan keluar lebih banyak. Penyejuk ruangan tak mampu menahan keringatku. Sekuat tenaga aku berusaha fokus. Fokus Fika! Fokus! Jeritku dalam hati. Dan untuk pertama kalinya pandangan kami

melihatnya. “Sebagai laki-laki, ketika ada seorang wanita yang mengungkapkan perasaannya pada ku, bukan main rasa senang yang aku rasakan. Nggak terlalu muluk, Fik. Tapi sayang, perasaanku tidak bisa berkata ya, untuk itu.” “Untuk itu apa?” aku purapura tidak mengerti dengan apa yang dikatakan Gugun. Jauh di dalam hatiku bertabur rasa senang karena aku telah mendapatkan jawaban Gugun yang paling dinantikan Jumi. “Sudah sejauh mana Fika tau tentang cerita ini?” aku melihat ke arah Gugun. Rupanya dia tahu apa yang ada di pikiranku saat ini. Kali ini cara berbohong apa lagi yang harus aku lakukan. “a…a…ku…” penyakit

UmarBaki

LOWONGAN KERJA LANGSUNG DI PENANG - MALAYSIA DIPERLUKAN SEGERA : I. Operator Produksi pada Perusahaan Elektronik Terkemuka di Penang "SUMITOMO METAL (SMI) ELECTRONICS DEVICES (M) SDN.BHD (SMIED)" II. Sewing Workers (Penjahit) pada Perusahaan Garment Terkemuka di Penang "PEN APPAREL SDN.BHD." Dengan persyaratan sebagai berikut : • Wanita, imur : 18 s/d 30 tahun • Mendapat Izin Orang Tua / Keluarga • Lulus Test Awal dan Test Kesehatan • Bersedia Kontrak Kerja minimal 2 tahun FASILITAS • Pendapatan dengan gaji pokok, insentif, lembur, tunjangan shift, dan lain-lain yang sangat menarik • Asrama & perlengkapannya, Transportasi, dan Asuransi • Diberangkatkan dengan Pesawat Terbang Pendaftaran & Seleksi dilakukan setiap hari dengan membawa : Copy KTP, Pasphoto 3 x 4 = 2 lembar, Copy Ijazah, Copy KTP Orang Tua / yang memberi Izin, Copy Kartu Rumah Tangga ( Tidak dipungut biaya pendaftaran) Untuk Pendaftaran Datang Langsung Ke : PT. AL WIHDAH JAYA SENTOSA Jl. Setia Budi No. 74-C Tanjung Rejo ( Sebelah Showroom Yamaha, dekat simpang Jl. Sei Serayu ) Medan - 20122 Telp : 061 - 8215444 ( Hunting )

gugupku sering muncul jika situasinya seperti ini. “Satu hal yang ingin ku katakana Jumi wanita yang hebat” sambungnya tanpa menunggu jawabanku. Gugun membalikkan halaman bukunya. Aku tatap wajahnya. Berpikir kalau ia akan menerima Jumi. Jumi memang wanita yang hebat, tidak seperti diriku yang terlena oleh kekuranganku sendiri. Lalu, Gugun kembali menatapku dalam. Tatapan yang ingin menemukan sesuatu dalam diriku. Menarik semua perhatianku dengan kata-kata yang membelaiku hingga lelap dalam mimpi indah. “Aku berada di sisi Jumi, tapi aku ingin fika yang berada di sisiku.”

Hunian di Taman Bunga

EXTRA

Residence

Rp.

100 Jt-an

ng Juga Pesan Sekara an...! habis Sebelum Ke Kantor Proyek :

061 - 6996 3691

81396894099

ISTANA PROPERTY Jl.Jendral. Gatot Subroto No. 88 Binjai Telp . 061- 8821984 Hotline : - 0813 9668 7998 - 0878 9187 4944 - 0813 7533 5853 - 0812 6395 2106

CMYK

Sisa-sisa hujan belum juga reda. Aku mengulurkan tangan melewati cucuran atap. Membiarkan rintik-rintik hujan berebut singgah di telapak tangan. Hiruk pikuk asap dari secangkir capucino tersaji di atas meja lesehan. Aku memalingkan pandangan. Lalu menatap Jumi. “Aku mengatakannya karena aku tidak mampu lagi untuk menahannya. Semakin sakit jika harus terus dipendam. Terlalu cepat, Fik?” suara Jumi bergetar. Persis seperti getargetar cinta yang saat ini memenuhi seluruh nadinya. Jumi menatapku, mengharapkan jawaban. Jawaban dari akhir ceritanya di lesehan ini. Seteguk capucino menghangatkan tenggorokanku. Aku menggelengkan kepala tanpa mengeluarkan sepatah kata pun dari mulutku. Berharap Jumi puas dengan jawabanku. Ia sedikit terhibur. Lama-lama lesehan ini ramai dikunjungi orang. Dua jam sudah kami di sini. Tiba-tiba ponselku bergetar. Aku lihat di layarnya. Tertera nama Gugun. Tanganku sedikit gemetar. Sebentar aku melihat Jumi. Gejolak rasa bersalah menguliti tubuhku. Lebih-lebih ketika Jumi mengutarakan seluruh perasaannya tentang Gugun kepadaku. Gugun masih terus memanggil. Sedikit gugup,

berpapasan. Bertemu pada satu titik yang sangat aku harapkan. “Gun! Lagi ada masalah yach?” “Nggak! Kelihatannya aku ada masalah?” Aku menganggukkan kepala. “Jangan bohong!” jawabku Aku tahu ini salah. Pesan yang dipercayakan Jumi, telah aku salah gunakan untuk kepentingan diriku sendiri. Gugun mengembalikan pandangan pada sebuah buku yang berada di tangannya. “Fik!” Aku mendengar ia memanggilku. Mencoba berfikir positif, dia akan bertanya tentang pelajaran. Tidak lebih dari itu. Gugun melanjutkan perkataannya yang jauh dari apa yang aku harapkan, Aku terpaksa menegakkan wajah untuk


SementaraItu

Hasil Pilkada Tapsel akan Dikirim ke Gubsu

TAPSEL Hasil pleno penghitungan suara pemilukada Kabupaten Tapanuli Selatan oleh KPU Tapsel yang menetapkan pasangan nomor 4 SARASI sebagai peraih suara terbanyak akan dilaporkan ke Gubernur Sumatera Utara pada Kamis (20/5) mendatang oleh Bupati Tapsel untuk di-SK kan dan ditetapkan. Hasil pleno itu tertuang dalam berita acara nomor 32/KPUKAB/002-434707/V/2010 tertanggal 14 Mei tentang rekapitulasi hasil penghitungan suara pemilukada Tapsel dan keputusan KPU Tapsel nomor 20 tahun 2010. Sedangkan laporan pleno penghitungan suara sudah disampaikan KPU Tapsel secara resmi kepada KPU Sumut, Jumat (14/5) malam. ”Laporan sudah disampaikan kepada KPU Sumut. Sedangkan ke Gubsu mekanismenya kita sampaikan dulu ke DPRD Tapsel tanggal 20 Mei mendatang untuk kemudian DPRD Tapsel merekemondesikannya kepada Bupati Tapsel. Kemudian Bupati Tapsel akan menyampaikannya kepada Gubsu untuk di-SK kan,” terang Akhiril Pane MPd, salah seorang anggota KPU Tapsel Divisi Tekhnis kepada METRO (grup koran ini), Sabtu (15/5). Sesuai jadwal yang sudah dibuat KPU Tapsel, diperkirakan pelantikan digelar 12Agustus mendatang atau 3 bulan ke depan. ”Sesuai jadwal, pelantikan akan di laksanakan pada tanggal 12 Agustus mendatang atau 3 bulan lagi,” pungkasnya.

Sementara itu dalam rapat pleno yang dipimpin Ketua KPU Tapsel, Mustar Edi Hutasuhut disaksikan 4 anggota KPU lainnya di kantor KPU Tapsel, Jalan Willem Iskandar, Sadabuan, Padangsidimpuan, Jumat (14/5) dihadiri 5 pasangan saksi calon sedangkan 1 saksi pasangan calon nomor 6 tidak hadir, Plt Bupati Tapsel Akhmad Ibrahim Harahap, Kapolres Tapsel AKBP Subandriya SH MH, Kapolresta AKBP Roni Bahtiar Arif, Kasi Intel Polim SH, Ketua PA Padangsidimpuan Haspan Pulungan, anggota Panwaslukada Tapsel dan lainnya ini di mulai sejak pukul 09.00 WIB menetapkan pasangan nomor 4 SARASI sebagai peraih suara terbanyak dan menjadi bupati dan wakil bupati Tapsel terpilih. Adapun hasil rapat pleno penghitungan suara tersebut dari seluruh suara sah yakni sebanyak 137.772 pasangan nomor 4 SARASI berhasil memperoleh suara sebanyak 61,157 atau sekitar 44,39 persen. Sementara di urutan kedua pasangan nomor 3 ADAB memperoleh 47.602 suara atau sekitar 34,55 persen, kemudian pasangan nomor 5 HORAS di urutan ke 3 meraih 24.710 suara atau sekitar 17,94 persen, selanjutnya pasangan nomor 1 HANDAL di posisi 4 meraih 2.435 suara atau sekitar 1,77 persen, di posisi lima pasangan nomor 2 SAHATA meraih 1.028 suara atau sekitar 0,75 persen dan di urutan terakhir pasangan nomor 6 NAULI BASA meraih 840 suara atau sekitar 0,61 persen. (smg)

KPUD Tebing Tinggi akan Tetapkan Calon Terpilih TEBING TINGGI Hasil rekapitulasi penghitungan suara terhadap lima pasangan calon Walikota dan Wakil Walikota Tebing Tinggi oleh KPUD berakhir, Sabtu (15/ 5) siang di Gedung TC Sosial Jalan RSU Kota Tebing Tinggi telah selesai. Selanjutnya KPUD Tebing Tinggi menunggu waktu tiga hari untuk menetapkan calon terpilih melalui Rapat Plenonya. “Kita akan berikan waktu tiga hari sejak hari ini, ada atau tidak gugatan. Kalau ada kita tunggu ketetapan MK (Mahkamah Konstitusi..red). Bila tidak ada dalam waktu tiga hari ini, maka KPUD melalui Rapat Pleno akan menetapkan Walikota dan Wakil Walikota terpilih,” ucap Ketua KPUD Tebing Tinggi, Hatta Ridho, S.Sos, MSP didampingi anggota Drs. Salmon Ginting, Marwan, S.Ag, Abdul Khoir, S.Ag dan Maswarni kepada POSMETRO-MEDAN usai rekapitulasi penghitungan. Masih menurut Ridho, dari awal pemungutan suara di TPS, hingga rekapitulasi di KPUD saat ini belum ada komplain atau gugatan dari pasangan calon lain. Selanjutnya Ridho menerangkan, setelah ditetapkan pasangan calon yang menang menjadi Walikota dan Wakil Walikota Tebingtinggi sebagaimana jadwal pelantikannya akan berlangsung 30 Agustus 2010 mendatang. Berkaitan dengan jumlah partisifasi pemilih, menurutnya sudah cukup tinggi mencapai 65 persen. Dari jumlah DPT 113.639. Dengan suara tidak sah 1999 surat suara. Tidak memilih (golput) 36.601 orang (32,20%). Berdasarkan hasil rekapitulasi KPUD TebingTinggi, pasangan calon yang unggul nomor 4, yakni HM Syari Chap dan Ir. Hafaz Padillah, MSi memperoleh 28.028 (36,38%) suara, menyusul pasangan

nomor 1. Ir. Umar Zunaidi Hasibuan,MM dan Irham Taufik,MAP dengan perolehan suara 21.773 (28,26%), kemudian pasangan nomor 5. Drs. Syahril Hafzein dan Wan Gunadi,SE memperoleh 17.554 (22,79%) suara. Pasangan nomor 3. Amril Harahap dan Irwady memperoleh 6.853 (8,90%) suara, kemudian pasangan nomor 2. Adi Harianto dan Sarabintang Saragih hanya memperoleh 1.631 (2,12%) suara. Hadir dalam rapat terbuka tersebut, Kapolresta Tebing Tinggi, AKBP Robert Harianto Watratan SH SSos, Ketua Panwaslu Kota Tebing Tinggi, Supriadi dan sejumlah saksi dari pasangan calon. Secara terpisah Ketua Tim kampanye pemenangan HM Syafri Chap dan Hafaz Padillah mengucapkan terimakasih kepada masyarakat pemilih. “Tanpa dukungan masyarakat, kami tidak dapat mengantarkan Bapak Syafri Chap dan Hafaz menjadi Walikota dan Wakil Walikota Tebingtinggi,” ucap Azwar Siban alias Oban. Didampingi Wakil Sekretaris Partai Golkar Ir. Yunan Napitupulu, Oban berpendapat, kemenangan pasangan calon nomor urut 4 ini seperti tidak disangka. Ketika ditanya strategi yang digunakan, Oban menjelaskan pertama sekali adalah faktor strategi. “Juga adanya campur tangan Tuhan. Itulah takdirNya,” ujarnya. Demikian halnya juga disampaikan oleh Edi Azhar dan Siswa Ginting di sekretariat tim Sobat Hafal Jalan Ahmat Yani. Mereka mengucapkan terimakasih atas simpati masyarakat dengan demikian diharapkan perubahan bisa direalisasikan. Pasangan calon yang kami dukung ini unggul di lima kecamatan di Kota Tebing Tinggi dan angka kemenangannya lebih besar dari jumlah golput. (Asnawi)

Menyajikan Fakta, Peristiwa & Fenomena Penerbit : PT. Posmetro Medan Pers (Harian Posmetro Medan) Chairman Komisaris Utama Komisaris Direktur Utama Direktur

: : : : :

H Rida K Liamsi MBA Marganas Nainggolan Ari Purnama Janopa Sihotang Syaiful Ishak

MINGGU, 16 MEI 2010

HALAMAN 7

Rekapitulasi Suara di KPUD Binjai Nyaris Ricuh

Dhani – Meutya Gugat ke MK BINJAI Dihadiri sejumlah saksi dan beberapa pasangan calon Walikota dan Wakil Walikota Binjai, tahapan rekapitulasi tingkat KPU/rapat pleno terbuka rekapitulasi perhitungan suara Pemilukada 2010 secara resmi dibuka Kapolresta Binjai AKBP Dra Rina Sari Ginting, Sabtu (15/5). Ketua KPUD Kota Binjai, Agus Susanto,SH,MH menyampaikan rasa terimakasihnya kepada sejumlah pasangan calon Kepala Daerah dan Wakil Kepala Daerah Kota Binjai yang telah mengikuti proses demokrasi dalam Pilkada Kota Binjai membacakan hasil rekapitulasi penghitungan suara di tingkat KPU. Pembacaan perhitungan hasil rekapitulasi suara di Kecamatan Binjai Kota, tanpa adanya keberatan sejumlah saksi-saksi. Saat akan melanjutkan pembacaan rekap suara Kecamatan Binjai Barat, mengalami protes dan keberatan dari para saksi pasangan nomor urut 5 yang menginginkan pihak KPUD Kota Binjai menghitung ulang isi kotak suara dari masing-masing TPS setelah terjadi kesalahan mengenai suara sah yang dinyatakan tidak sah. Hingga dinilai merugikan suara salah satu pasangan. “Kami memohon agar kiranya KPU melakukan penghitungan ulang suara di masing-masing TPS yang ada di Kecamatan Binjai Barat. Dimana pada TPS 6 saat suara dihitung di PPK ternyata ada kesalahan mengenai surat suara yang sah tapi dinyatakan tidak sah. Atas dasar itu kami mohon agar seluruh suara yang ada dihitung ulang, baru penghitungan suara di Kecamatan lainnya bari dapat dilanjutkan,” ujarArfat, saksi nomor 5 kepada pihak KPU, disambut teriakan para pendukung Dhani – Meutya yang berada di luar pagar. Menanggapi keberatan saksi,

Ketua KPUD Binjai, Agus Susanto,SH,MH, menolak dengan tegas, karena melanggar ketentuan UU yang telah mengaturnya. “Maaf penghitungan suara sebelumnya telah dilakukan di PPK. Kita juga telah melakukan koreksi terhadap hal yang, jadi tidak mungkin menghitung ulang kembali. Namun kita juga memberikan formulir keberatan saksi untuk dapat mengajukannya ke Mahkamah Konstitusi,” ujar Agus. Keberatan dengan keterangan pihak KPU, gelombang massa pendukung pasangan Dhani – Meutya yang berada di luar pagar kantor KPUD Binjai, Jalan Gatot Subroto, Kelurahan Limau Mungkur, Kecamatan Binjai Barat langsung berteriak histeris dengan menuding KPU mandul hingga semakin memanaskan suasana rekapitulasi yang dijaga ketat petugas Kepolisian Mapolresta Binjai. Keberatan Debat pun terjadi di arena penghitungan suara, setelah calon Walikota H Dhani Setiawan Isma,S.Sos angkat bicara memberikan pandangan kepada KPU Binjai atas keberatan saksi mengenai kesalahan suara di PPK Binjai Barat. “Atas dasar keberatan saksi itulah kita mengharapkan KPU mau melakukan pengitungan ulang suara di Kecamatan Binjai Barat. Dan kita tak ingin satu pihak pun yang dirugikan” tandasnya. Hal senada juga diungkapkan Hj Meutya Hafid tentang keberatan saksi mengenai surat suara sah,

Meutya Hafid memperlihatkan bukti kertas jadwal rekapitulasi suara dari KPU.

namun dinyatakan tidak sah. Ia menilai KPUD Binjai gagal dalam mensosialisasikan penerangan mengenai aturan Pilkada kepada Ketua KPPS. “Kita bukan mengeneralisasikan sesuatu hal, namun terkait masalah keberatan saksi mengenai aturan masalah surat suara sah dinyatakan tidak sah, kita menilai KPU gagal mensosialisasikan penerangan kepada KPPS,” ungkap Meutya dan Dhani yang kembali membuat suasana menjadi riuh. Ketua Panwaslu Kota Binjai, Johanes Surbakti yang diminta KPU Binjai menerangkan persoalan yang ada di hadapan saksi dan sejumlah undangan mengatakan pihaknya tidak ada menerima laporan keberatan saksi dari masingmasing TPS dan lain-lain. Mendapat kecaman dari H Dhani Setiawan Isma,S.Sos yang menilai Panwaslu tak layak berbicara dan mengada-ada terkait ucapan Panwaslu mengenai masingmasing 8 orang saksi melakukan

penandatanganan hanya saksi nomor 5 yang tidak melakukan tanda tangan. “Anda jangan mengada-ada mengenai apa yang saudara katakan tadi hanya saksi nomor lima yang tidak mau menandatangani dari kedelapan saksi yang ada. Untuk itu anda tak layak berbicara di depan karena tidak fair sebagai Panwas,” ketus Dhani. Amatan POSMETRO MEDAN pada rekapitulasi suara Pemilu Kada 2010 dan nyaris menjurus ricuh masih dalam kendali, hingga akhirnya penghitungan suara kembali dilanjutkan. Namun saksisaksi yang menyatakan keberatan menuliskan keberatannya melalui formulir yang nantinya akan diajukan ke Mahkamah Konstitusi. Ketua KPUD Binjai, Agus Susanto,SH,MH ketika ditemui mengatakan menerima gugatan pihak saksi pasangan nomor urut 5 untuk selanjutnya dilayangkan ke MK. Sedangkan rapat pleno reka-

pitulasi perhitungan suara akhirnya diskors dari mulai pukul 13.00 Wib hingga pukul 15.00 Wib. Total jumlah suara keseluruhan masing-masing pasangan calon Walikota dan Wakil Walikota Binjai : Pasangan nomor 1 : IrAyub Syaiful – DrsAdi Wijaya (10320 suara), pasangan nomor 2 : Eddy Aswari,ST,MM –Ahmad Murlan,BA (2106 suara), pasangan nomor 3 : Drs H Abdul Gani Sitepu – H Ajie Karim (15261 suara), pasangan nomor 4 : Ir Nazri Kamal – Lasiono,SPd (5455 suara), pasangan nomor 5 : H Dhani Setiawan Isma,S.Sos – Hj Meutya Hafid (22087 suara), pasangan nomor 6 : Prof SyamsulArifin,SH,MH –Abdi Nusa,SH (6473 suara), pasangan nomor 7 : H Zefri Januar Pibadi – Drs Baskami Ginting (22213 suara), pasangan nomor 8 : H Muhammad Idaham,SH,Msi – Timbas,Amd (25786 suara) dan pasangan nomor 9 : H Helman,SH,MAP – Muhammad Rasiydin,SHI (2125 suara). (aswin)

Soal Pembangunan PLTA Asahan III

PLN Lebih Siap Dibanding Swasta ASAHAN Acara selamatan dimulainya proyek Asahan III dimaksudkan untuk membantah anggapan dari bahwa PLN kalah siap dibanding swasta untuk mewujudkan proyek tersebut. Demikian pernyataan yang disampaikan Direktur Utama PT PLN (Persero) Dahlan Iskan, menjawab sejumlah pertanyaan di media massa terkait acara selamatan rencana pembangunan PLTA Asahan III yang diselenggarakan, Jumat (14/5), di Desa Tangga, Kecamatan Aek Sonsongan, Kabupaten Asahan. Menurut Dahlan, pihaknya menyadari posisi Gubsu Syamsul Arifin yang sangat sulit karena karena dimasa lalu sudah terlanjur memberi izin lokasi kepada pihak tertentu. “PLN ingin mewujudkan kepada Gubernur bahwa PLN benar-benar siap dibanding siapapun untuk merealisasikan Asahan III,” katanya. Dahlan mengungkapkan, pihaknya menyadari bahwa selamatan tersebut kurang berkenan di hati Gubsu, tetapi tidak ada maksud sedikitpun untuk mengabaikan kekuasaan Gubsu. Kalau acara selamatan tersebut dinilai kurang tepat, Dahlan siap meminta maaf kepada Gubsu, tapi Dahlan berharap dengan kekuasaan yang ada di Gubsu, beliau bisa menggunakannya secara arif dan bijaksana serta sebesar-besarnya untuk kemanfaatan rakyat banyak PLN juga minta maaf kalau terkesan ngotot karena PLN sudah menghabiskan dana negara lebih dari Rp 100 miliar untuk membiayai

Pemimpin Umum/Pemimpin Perusahaan: Janopa Sihotang Wakil Pemimpin Umum : H Affan Bey Hutasuhut Pemimpin Redaksi : Maranatha Tobing Ombudsman: Vincent Wijaya Dewan Redaksi: Marganas Nainggolan (Ketua), Janopa Sihotang, H Affan Bey Hutasuhut, Maranatha Tobing, Ahmad Faisal Matondang, Alvin Nasution Wakil Pemimpin Redaksi: Ahmad Faisal Matondang, Alvin Nasution Redaktur Pelaksana : Jhonson Sibarani Assisten Redaktur Pelaksana : Budi Hariadi

Dirut PT PLN Dahlan Iskan, menerima ulos dari tokoh masyarakat pada selamatan rencana pembangunan PLTA Asahan III di Desa Tangga, Kecamatan Aek Sonsongan, Asahan.

persiapan selama ini, seperti, study kelayakan, disain dan mengurus Amdal. Bahkan Amdal tersebut sudah berhasil diselesaikan PLN sejak beberapa tahun lalu. “Kami harus maksimal memperjuangkan proyek ini, kalau tidak akan dianggap melakukan pemborosan uang negara. Kami berharap dukungan sepenuhnya dari Gubsu dan seluruh masyarakat Sumut agar PLN dapat segera membangun proyek ini,” kata Dahlan. Pada acara selamatan itu, sebanyak delapan tokoh masyarakat perwakilan dari 13 Desa dan 2 Dusun di Kabupaten dan Tobasa dan Asahan, sebagai lokasi pembangunan PLTA Asahan III menyatakan mendukung PT PLN (Persero) sebagai pelaksana pembangunan proyek tersebut. “Kami berharap kehadiran PLTA ini akan bisa

Koordinator Liputan : Solideo Sembiring Redaktur : Mangampu Sormin, Johasman Tarigan, Hiras Budiman Situmeang, Maria Surbakti Reporter: Johan H Panjaitan, Nanang,Darwis Sinulingga, Pasta Tarigan, Elfitra Sihombing, Mula NH Tinambunan, Kali A Harahap, Jafar Siddik, Reza Wibowo, Ali Amrizal, Rusdi Nasution, Syahrul R Sihotang, Sahala Simatupang, Aswin, M. Zulfadli Siregar Sekretariat Redaksi: Sekretaris Redaksi: Nurleni Dept Perwajahan, Pracetak & Artistik : Kadept. Perwajahan, Artistik : Simon Sinaga Ka.Bag: Dedy Syahputra

membantu meningkatkan kehidupan masyarakat sekitar,” kata Wilem Panjaitan, tokoh masyarakat dari Desa Tangga, Kabupaten Asahan. dalam kegiatan tersebut, Direktur Utama PT PLN (Persero) Dahlan Iskan didampingi sejumlah direksi dan pejabat PLN, Dir Perencanaan Ir Nasri Sebayang, Dir Op Indonesia Barat Ir Harry Jaya Pahlawan, Dir Op Jawa-Bali Ir Ngurah Adnyana, Dir Op Indonesia Timur Ir Vikner Sinaga, Dir Energi Primer Ir Nur Pamuji, Dir Bisnis&Manajemen Risiko Ir Murtaqi Syamsudin, Sekretaris Perusahaan Ida Bagus Mardawa, GM PLN Pikitring SUAR Ir Bintatar Hutabarat, GM PLN Wilayah Sumut Ir Denny Pranoto, GM Pembangkitan Sumbagut Ir Ikuten Sinulingga dan GM PLN Sumatera I Ir Chaeruddin Matondang. Para jajaran Direksi PLN, Jhon

Kord Pracetak/Perwajahan : Ferry Sumarlen Kord. Mounting : Syafrizal Art/Graphis: Boniq Suhendar Tekhnisi, Maintenance dan IT: Joel E Simanjuntak Penjab Online : Rudi Eka S Simanjuntak Departemen Umum/Adm/Keuangan: Manager Umum/Sdm/Keuangan: Rudyanton M Sidabutar Kadept. Umum/Adm/Keu : Eva D Sitorus Kabag. Adm/Piutang : Nancy Paulina Departemen Sirkulasi/Pemasaran: Manager Pemasaran : Feri Agustika Kadept. Pemasaran: Advert B. Malau Kabag Pengembangan : Novi Syahputra

Hugo Silalahi juga turut hadir dalam kegiatan tersebut mewakili Ketua DPRD Sumut, bersama Ketua DPRD Kabupaten Asahan Benteng Panjaitan serta sejumlah tokoh masyarakat dan tokoh agama dari kedua kabupaten. Terhadap dukungan yang disampaikan warga setempat, Jhon Hugo menyatakan, sangat mendukung. “Kalau warga sudah mendukung, wakil rakyat juga akan mendukung,” katanya. Ditambahkan Jhon Hugo, empat bulan yang lalu, saat pihaknya melakukan Rapat Kerja Komisi IV sudah memasukkan rencana pembangunan PLTA Asahan III sebagai rekomendasi kepada Gubernur Sumatera Utara, agar menyerahkan izin prinsip kepada PLN. “Namun hingga saat ini hasil rekomendasi tersebut belum mendapat tanggapan. Kita minta Gubsu segera merealisasikannya, karena pembangunan tersebut

Kord. Pengembangan : Indra S Lingga Kord. Ekspedisi : Oryza Pasaribu Kord. Distribusi : M Taufik Kabag. Adm/Piutang : Imelda Simbolon Departemen Iklan: Manager Iklan/EO : Losber Sihotang Ka.Bagian Iklan: Sri Kurniasih Kord. Adm/Piutang : Henny Siregar Kord. Pengembangan : Parsaoran Purba Kord. Design : Arif Budiman Penasehat Hukum : A Hakim Siagian M.Hum Tarif Iklan : Halaman 1 (Utama) Full Color Rp. 26.000 mm kolom, Hitam/Putih (B/W) Rp. 20.000/mm kolom, Halaman 8, 9 & 16, Full Color Rp. 15.000 mm kolom,

terkait akan kondisi krisis listrik yang mengancam warga Sumut pada tahun-tahun mendatang,” katanya. Terkait rencana pembangunan PLTAAsahan III tersebut, Direktur Perencanaan dan Teknologi PLN, Nasri Sebayang, mengatakan, pengoperasian pembangkit listrik tersebut akan dapat menghemat subsidi dalam bentuk pembelian BBM sebesar Rp 2,5 triliun per tahun. “Dengan daya terpasang 2 x 87 MW, jika menggunakan BBM maka dibutuhkan 450 ribu kiloliter per tahun. Jadi pengoperasian pembangkit dengan tenaga air ini bisa hemat Rp 2,5 triliun setiap tahunnya,” katanya. Rencananya, seluruh persiapan pembangunan termasuk pembebasan lahan, akan dilaksanakan pada bulan Mei. Selain itu, pada bulan Juni, kata Nasri, pihaknya ini akan membuka tender pengadaan dan kontruksi (Engineering, Procurement and Contruction/EPC). “Walau proyek ini didanai Jepang, namun lelang internasional ini bisa diikuti oleh negara manapun yang memenuhi persyaratan,” kata dia. Nasri menargetkan PLTA unit 1 akan mulai beroperasi pada tahun 2013, diikuti dengan unit berikutnya pada 2014. Ia berharap kehadiran PLTAini bisa memperkuat pasokan listrik di wilayah Sumatera Utara. “Saat ini kondisi listrik di sana sudah membaik. Semoga dengan adanya proyek ini akan semakin lebih baik,” harapnya. Pada kesempatan itu, PLN juga menyerahkan bantuan melalui CSR kepada 8 balai desa dan sejumlah rumah ibadah. (Maria Surbakti)

Hitam/Putih (B/W) Rp. 10.000/mm, Ucapan Duka Rp. 8.000 mm kolom, Halaman Dalam (B/W) : B/W Rp. 8.000 mm kolom, B/W duka Rp. 5.000 mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp. 2.000 (dalam kota). Rekening a/n : PT. Posmetro Medan Pers, Bank Mandiri Cab. Tiara Medan Ac: 105-0003103441. Rekening a/n: Marganas Nainggolan Alamat Redaksi/Iklan/ Pemasaran: Jl.SM RAJA KM 8,5 No.134 Medan-Amplas, Telp (061) 7881661 Fax (061) 7881733.e-mail: pos_metro_medan@yahoo.com Perwakilan Jakarta: Jalan Raya Kebayoran Lama17 Jakarta Selatan, Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl.SM RAJA KM 8,5 No.134 Medan-Amplas Telp (061) 7881661 Fax (061) 7881733

PENGUMUMAN : Setiap menjalankan tugas peliputan, Wartawan POSMETRO MEDAN dilengkapi Surat Tugas atau Kartu Pers POSMETRO. Jika ada yang mencurigakan, silahkan hubungi call centre kami di 0812-6309088. Terima kasih


MINGGU 16 MEI 2010

CMYK

Halo Cewek 081362189147 : Herman 30 thn butuh teman curhat. 081328265774 : Aq lajang 28 thn mencari cewk yg lembut dan penyayang no miscol trims posmetro jaya terus 081361199781 : Pria singel 27thn sederhana. Cr cwek singel 24-25 thn 081360500663 : Adyth, mnkh, 39th, tmpan dn romantis, khusus utk wnta gndt dn cntk, umr 40th keatas, pngrtian. Sms ato telf. 081361438370 : Lelaki,Cari wanita 085275391754 : Saya cowok sigele umur 23thn agamaku islam” tingal di medan!!” mau cari pacar.” apa adanya sms. Cool” psti di, bls” 08566061131 : Hai gua cow chines 38thn,cr kenalan cew seumur 30an.call or sms trims pm 081376854704 : Aslkm... Saya cowk 25 thn,mndr/krj. Mo cr pndmg hdp yg pengertian-srius call or zms thanks POSMETRO 081265858701 : Hi.. Aq Cowok Single 30 tahun, cari ce manis medan. Status tdk masalah. Hub.. Or sms. Ok 081361195310 : Hay,sy s0rang Cw0,brasal dri Aceh,,umur 24,pngen knal ma S0rang Cwe Medan buat jdiin Pacar. 081265532425 : Aku cwok pengen kenal ama cewek,janda.tlp aja atau sms pasti di BLS 085270875951 : Cowk Kristen,25thn mo cr janda kristen, 25thn, cntk, baek, jjr, wiraswasta n humoris. Anda berminat? SMS

anda akn sy bls dgn ht yg tulus ok. 081370602398 : W cew chines cr cow untk pendamping hdp yg baik,jujur,terima w apa adany gt thank pm 081397390849 : Pria, 27 th, Babyface, Peg.Bank, mencari wanita yg bs diajak curhat n enjoy, sms or call. 081263920302 : Pria singel cari temen cewek dewasa janda akan dijadikan temen sejati. 085262669459 : Cow chinese baek2,Umur 28 thn,single.mau knl dgn cew single chinese yg baek2,jujur,dan punya usaha.sms/ telp. tdk trima miscall2/iseng2. Thanks, 127376256690870 : Pria duda personalia perk.swasta mau cari wanita gadis (janda) utk dijadikan pendamping hidup. 081390306555 : Cwok muslim 27 thn krja sbgai salesman cari tmen cwek yg baek n tdk sombong, yg mnat knal aku please call or sms. 165537323706783 : Hai w laki CHENES,Pengen kenalan sama cew chenes yg baek dn bs trm w ap ada ny..klau bs umr 25thn keatas okk 081397892166 : Pria 40thn, cw gds janda muda yg mo curhat call sms kn no ini pasti dibls. Thnk PM 081361095047 : Saya cow islam krja tukang beca cari jodoh pegawai negri 085296618111 : Pria singel 27th dambakan mbak2 yg tajir dan yg punya mobil,cantik n manis 085270988987 : Pria 26 tahun ingin berkenalan dengan wanita.

Halo Cowok 081362799086 : Cwe singel,23 thun.rina lestari ,mencari cinta sejati,dari kalangan AKABRI,PM,BRIMOB,krn sy suka.. Smz atu mscol sy y? Psti d layani. Thaks 081264752125 : Wanita Single Parent, 27 thn mslm 081397181539 : Wanita single,20thn imut n caem. Hum0ris...mncri pria single 2025thn,yg bncit tp gk gndut.. 081265448110 : Nm ag Randy, ag mau cr tmn curhat klau bs jaddin pcr. SMS or tlpn aja, pastinya diblas. Thank PM 081362275898 : Wanita singel, kristen, 28 thn, putih, menarik. Cari pendamping hidup, lajang, umur 32thn-40 thn, pengusaha,, AKPOL, mapan. Khusus yg serius. 081263393315 : Mejuahjuah,cewek KARO,janda anak 2,26thn.cari teman

curhat.NO SMS -MC. 083197844546 : Aku seorg gdis 35 thn aku tlh ternoda dri umr 24 thn. Aku dinodai sma org yg udh punya istri. Stlh dia dptkan dia mninglkan aku. 085275178446 : Dina 21 cew manis - putih , mau knalan dgn cowok 40 s/d 25 thn , khusus cowok yg baik2 aj ya . Klo ccok akn dijadikn pacar . 176746700566003 : Janda Cntk,27thn,Haus Belaian Pria.Sms Pasti D Bls..!? 145139414126882 : W ce chns 23th single. cr cowok chines baek2 umr 25 ke atas. Bt yg srius z ya. 085275217131 : Gadis 36thn kristen,cr pasangan hidup pria Kristen LAJANG usia 37-42thn karyawan atau PNS.Yang serius call atau sms 081375237210 : Nm sy Nadia, sy cri tmn buat curhat. . . .

Halo Teman 085760867855 : Q Lidya,kristen,mau bertmn dgn cow baik n seiman,GBU 081263281373 : Hai pengen nambah tmn nie???? sy gerry 21thncr tmn d atas usiaku.thanks yaa 081265463730 : Hai tmn2,aq Ryan (20) jomblo,mau cr tmn cew yg jmblo jg,yg mau jd tmn qu silahkan coll or sms,pst dibls. 081375566246: Namaku Russel, cowok berusia 19 thn, 175, 65, muslim, tinggal di Medan. W cari tmn pria usia 25-50 thn, krj n gk pelit. 081362101923 : Q cew 26th,mslim.pngen cr tmen yg bs djdikn sohib.cew N cow yg

KD Dukung Yuni-Raffi Kristina Iri

Hubungan asmara Yuni Shara dan Raffi Ahmad bikin iri banyak orang. Termasuk sahabat Yuni, pedangdut Kristina. Ia mengacungi jempol Yuni dan Raffi yang jauh beda usia. “(Hubungan) itu nggak menyangkut usia. Kalau cocok, jodoh di tangan Tuhan. Yang penting mba Yuni happy, nyaman,” ujar Kristina ditemui di Gedung Iskandarsyah, Blok M, Jakarta Selatan, Sabtu (15/5). Menurut janda Al Amin itu kenyamanan adalah hal yang paling terpenting dalam sebuah hubungan. Saling pengertian juga dibutuhkan agar keduanya merasa nyaman bersama. Seorang pacar yang baik di mata Kristina haruslah bisa memahami perasaan pasangannya tanpa diminta. Hal tersebut bisa dilihat Kristina dari hubungan asmara YuniRaffi yang berbeda usia 15 tahun tersebut. “Kalau lihat keharmonisan mereka, aku iri. Padahal Raffi itu beda jauh umurnya sama mba Yuni. Berarti kan mba Yuni luar biasa. Itu karena cinta. Berusaha mengimbangi,” jelas Kristina yang mengaku masih asyik menjomblo itu. (bd/dc)

JAKARTA Penyanyi Krisdayanti muncul sebagai cameo dalam video klip duet Yuni Shara dan Raffi Ahmad. Perempuan yang biasa disapa KD itu mendukung duet tersebut kalahkan Anang-Syahrini. “Lanjutkan terus!,” dukung KD ditemui di Beyond Cafe, Bar and Resto di Blok M, Jakarta Selatan, Sabtu (15/5). KD mengaku kaget ketika mendengar hasil kerja kakak tercintanya itu. Lagu yang dibawakan Yuni dan Raffi dirasa sangat serasi. Janda dua anak itu senang melihat hubungan asmara Yuni dan Raffi berlanjut ke urusan pekerjaan. Yuni dinilai KD sangat serasi dengan Raffi. Tidak hanya dalam percintaan tetapi juga karir. “Ini kerja yang harus disupport. Apapun duetnya saya selalu mensupport, apalagi ini sepasang kekasih,” tutur KD.

baik,humoris abizz,smart,N gak sombong,yuk sohiban !! 115172668226772 : H1 cow to cew aq mo cr tmn yg g matre buat crht q tngg y) 085262692128 : Priya merit cari teman untuk curhat 081361020287 : Teman2 semuanya.. kalau ada gambar/ logo atau cerita yg menarik maupun lucu kirim kemari yach.. paulina tunggu lho !! thx ya pm sukses slalu. 081376144929 : Wa Cowok 20 (jawa-india muslim) cari teman cow diatas 30 thn ke atas. 085761205116 : Aku cow 28thn cr tmn cow 40thn klu bs cow karo, tmn curhat. Ditunggu sms or telp

CAPRICORN (22 Desember-18 Januari) Sesekali waktu kamu juga butuh waktu untuk diri sendiri dan ngga diganggu siapa-siapa termasuk orang yang sangat dekat denganmu. Kesehatan: Jangan memforsir diri kalau sudah caapek. Keuangan: Semakin baik dalam mengelola keuangan. Asmara: Harus tau juga kekurangan si dia apa. AQUARIUS (18 Januari-18 Februari) Kamu bisa membuat suasana semakin semarak. Ternyata banyak orang yang terhidur dengan kehadiranmu. Kesehatan: Perbanyak makan buah-buahan. Keuangan: Ngga banyak perubahan. Asmara: Yang nampak terlihat jelas belum tentu benar.

Prihatin Musik Keroncong Diakui Malaysia JAKARTA Kaburnya Arumi Bachsin masih menjadi teka-teki. Ibunda Arumi, Maria Lilian Pesch, menuding putrinya kabur karena pengaruh dari Miller. Aktor asal Malaysia ini telah lama memendam cinta untuk Arumi. “Setiap perbuatan melawan hukum (Miller bawa kabur Arumi), pasti ada tindakan hukumnya,” tutur kuasa hukum keluarga Arumi, Minola Sebayang, dalam jumpa pers di Restoran Bumbu Desa, Cikini, Jakarta Pusat, Sabtu (15/5). Masih kata Minola, karena Arumi masih di bawah umur, usianya masih 16 tahun, yang berhak penuh atas Arumi adalah orangtuanya. Bukan orang lain. Dalam jumpa pers ini ikut serta adik Arumi, Alila Bachsin. Kata Alila, keluarga mencurigai Miller karena ada bukti SMS. “Dia (Miller) pernah bilang ke orangtua melalui SMS dan buktinya itu

PISCES (18 Februari-20 Maret)

masih ada. Katanya, ‘Biar tahu rasa mama kamu. Karena sudah satu tahun aku menunjukkan rasa suka dan cinta aku ke kamu. Dan

sekarang giliran kamu yang melakukan action’,” beber Alila. “Arumi bukan orang yang ngebet. Kalau ada yang membuktikan cinta kepada Arumi, kalau ternyata ada orang lain yang sayang sama Arumi, mungkin Arumi luluh juga. Toh selama ini, mama sangat welcome dan

TAURUS (20 April-20 Mei)

Hati-hati dengan kelalaian yang kamu miliki, karena banyak hal kecil yang perlu kamu perhatikan hari ini. Kesehatan: Kalau perlu minum vitamin tambahan. Keuangan: Walaupun merasa sedikit mengeluarkan, tapi kalau sering jadi akan bertumpuk banyak kan? Asmara: Tiba-tiba kangen sama dia. ARIES (21 Maret-19 April)

Cobalah untuk berpikir bukan hanya dari sudut pandangmu saja. Kamu harus bisa menghargai berbagai pendapat orang lain. Kesehatan: Batuk-batuk kecil yang cukup mengganggu. Keuangan: Perlu perencanaan lebih dalam. Asmara: Hargai dan hormati si dia donk!

Mengubah kebiasaan buruk memang ngga gampang. Yang namanya kebiasaan pastinya sudah menjadi bagian sehari-hari. Kesehatan: Perbanyak minum air putih. Keuangan: Sebisa mungkin biasakanlah belanja secukupnya. Asmara: Kebersamaan memang diperlukan untuk menumbuhkan rasa sayang.

Kesadaran akan pengalaman masa lalu bisa menjadi suatu pelajaran berharga bagi kemajuan di masa datang. Kesehatan: Kebanyakan tidur juga ngga baik. Keuangan: Perlu bimbingan dari yang mahir untuk memberitahukan investasi terbaik. Asmara: Belajarlah saling memahami pribadi masing-masing.

GEMINI (21 Mei-21 Juni)

enggak pernah melarang Arumi bergaul dengan siapapun,” lanjut Alila. Adik Arumi yang masih berumur 14 tahun ini berpesan kepada orang yang diduga membawa kabur Arumi atau memberikan hasutan kepada Arumi untuk kabur dari rumah. “Siapapun temannya, Arumi masih di bawah umur dan wajar kalau dilarang pacaran. Tapi kalau mau sama Arumi datang ke rumah. Jangan jadi banci kalau ngaku laki-laki,” tegasnya. Ibunda Arumi, Maria Lilian Pesch, pernah menyatakan, Arumi berubah sejak kenal Miller. Mereka main sinetron yang sama, Dia Bukan Anakku. Masih kata Maria, dalam pelariannya Arumi justru menghubungi Miller, bukan keluarganya. Maria juga mengaku, Miller pernah meneleponnya untuk meminta izin memacari Arumi. “Waktu itu, Miller pernah menelepon saya dan bilang, ‘Tante, saya pacaran sama Arumi ya.’ Memang, kurang ajar tuh anak. Enggak sopan,” ketus Maria, yang dihubungi, Jumat, 14 Mei. (bd/oz)

CANCER (22 Juni-22 Juli) Kamu akan bertemu dengan pihak keluarga yang membutuhkan bantuan. Kamu memang bisa memberikannya, tapi jangan semudah itu juga. Kesehatan: Kebanyakan makan yang berminyak ngga baik lho. Keuangan: Akan ada pemasukan tambahan. Asmara: Ia sangat mengerti dirimu. LEO (23 Juli-22 Agustus) Hari ini adalah hari yang tepat untuk mengusir kebosanan yang sudah kamu rasakan sepanjang seminggu sebelumnya. Kesehatan: Ngga kekurangan. Keuangan: Semua bisa diatur. Asmara: Cobalah bicara dari hati ke hati.

JAKARTA Siapa sangka bahwa presenter Ratna Listi terjun ke dunia hiburan dari musik keroncong. Ratna pun prihati melihat musik budaya Indonesia diakui negara Malaysia. “Tahun 1989 aku pernah menjuarai ajang festival televisi dan radio untuk lagu kerocong se-Jawa Timur,” kisah Ratna ditemui di Hotel Grand Mahakam, Blok M, Jakarta Selatan, Sabtu (15/5). Hingga kini Ratna tidak pernah meninggalkan musik keroncong. Sayangnya, jarang ada produser yang mau memproduksi albumnya. Ratna pun mau tak mau berusaha sendiri untuk terus mengibarkan musik keroncong. Negara Malaysia mulai mengembangkan keroncong dan mengakui musik tersebut sebagai warisan budayanya. Presenter ‘Bedah Rumah’ itu pun prihatin mendengarnya. (bd/dc)

CMYK

JAKARTA Pernah pacaran dengan Gary Iskak hingga hamil dan tak dinikahi membuat Ima Risma kapok. Dia tak ingin lagi pacaran dan tidur dengan sembarang pria yang belum jelas latar belakangnya. Risma berpesan kepada semua perempuan agar hati-hati dalam berpacaran. “Kalau mau nikah, harus resmi dan jangan mau dijanjikan sama pria bermulut manis. Jangan mentang-mentang cinta, kebablasan. Harus cari bibit, bebet, bobot dan harus hati-hati memilih pasangan hidup,” saran Risma. Ditemui di Hotel Atlet Century, Jakarta, Jumat (14/ 5) malam, usai konsultasi dengan Habib Abdurrahman Assegaf, Risma juga bertutur tentang kriteria pria idaman yang kelak bakal dijadikan suami. “Dia harus baik dan sayang sama aku dan anak aku. Seiman, bertanggungjawab. Apapun profesinya. Aku belum tahu kapan (cari suami). Kalau memang sudah ditakdirkan Allah, aku terima,” ujarnya. Saat ini, dua kasus Risma dengan Gary belum usai. Gugatan perdata Risma di Pengadilan Negeri Tangerang untuk meminta Gary mengakui anaknya, masih berjalan. Kasus pidana di Polda Metro Jaya pun masih diproses polisi. Menghadapi dua perkara hukum, Risma berharap masalah bisa cepat selesai. Sebab, tersangkut kasus hukum membuat gerak Risma dalam mencari nafkah bagi putrinya jadi terhambat. “Masalah ini mengganggu pekerjaan aku. Kemarin itu ada tawaran iklan untuk di billboard, tapi karena aku lagi menjalani persidangan, jadinya batal,” tuturnya. (bd/oz)

VIRGO (22 Agustus-22 September) Perjumpaan hari ini dengan salah seorang teman membuat kamu semakin terbuka akan suatu hal. Kamu juga bisa memberikan masukan baginya. Kesehatan: Cukup fit. Keuangan: Bisa disiasati dengan baik. Asmara: Kesabaran akan membuahkan hasil. LIBRA (23 September-23 Oktober) Kamu sering banget mengajak seseorang yang kamu anggap dekat untuk menghabiskan waktu bersama. Tapi, pandai-pandailah menempatkan diri. Kesehatan: Lagi semangat. Keuangan: Tetap sama. Asmara: Kalau udah ngga ada rasa, mau diteruskan?

SCORPIO (24 Oktober-21 November) Hari ini kamu merasa agak bimbang karena terbentur sama dua pilihan kegiatan yang sama-sama ngga ingin kamu lakukan. Kesehatan: Tidur jangan kemalaman donk. Keuangan: Perlu siasat lagi untuk bisa berhemat. Asmara: Kangen terus padanya. SAGITARIUS (23 November-21 Desember) Semangat berlebihan juga ngga baik lho…Gara-gara itu kamu jadi cepat capek sebelum bertanding. Saat tiba waktunya kamu udah kelelahan duluan. Kesehatan: Jangan diforsir. Keuangan: Kalau sudah ditabung, pasti lebih aman. Asmara: Terkena malarindu.


10

sambungan panggung hukum

Klik

MINGGU, 16 MEI 2010

www.posmetro-medan.com http://epaper.posmetro-medan.com

Minah... oh Minah...

Sudah Mahal Malah Dicampur Solar MEDAN Dampak dari konversi minyak tanah (minah) ke gas, harga minah mahal. Meski mahal, masyarakat tetap sulit menikmati Bahan Bakar Minyak (BBM) milik Pertamina ini. Persoalan masyarakat pun kian bertambah, dengan ditemukannya minah bercampur solar maupun bensin.

CMYK

HALAMAN

Aparat Harus Bertindak Beredarnya minah diduga bercampur solar, air maupun zat lain sangat disesalkan. Karena, itu merupakan penipuan dan merugikan masyarakat yang mempergunakan minah. “Kita menyesalkan jika minah itu memang betul bercampur dengan zat lain. Kita akan menelusuri semua informasi ini,” ungkap Kabag Humas Pemko Medan, Hanas Hasibuan kepada POSMETRO, kemarin (14/5). PM/DOK Hanas Hasibuan Menurut Hanas, jika memang ada masyarakat menemukan minah sudah bercampur jangan tinggal diam saja. Masyarakat bisa melaporkannya kepada

>> Baca di Hal 10

Pengawasan Tak Ketat Program yang dibuat pemerintah mengalihkan minyak tanah (minah) ke gas untuk mengurangi subsidi malah dimanfaatkan segelintir orang untuk mencari keuntungan banyak. Semuanya itu tidak terlepas dari pengawasan Pertamina yang kurang ketat memantau dilapangan. Ironisnya lagi, meski sudah tidak disubsidi lagi malah minah langka dan dicampur dengan air mauun soPM/DOK lar. Sabar Syamsuria Sitepu Wakil Ketua DPRD Medan Sabar Syamsuria Sitepu begitu dikonfirmasi seputar minah yang sudah langka dilapangan mengatakan, semuanya itu

>> Baca di Hal 10

PM/INT

Warga yang hingga malam mengantri untuk mendapatkan minyak tanah.

Berbagai macam aneka warna minah, pasca konversi gas. Ada berwarna jingga/ ungu, ada juga warnanya hampir sama dengan bensin/premium, namun ada juga yang kuning kehitam-hitaman. Disparitas (perbedaan) harga yang begitu mencolok, antara solar, premium atau bensin. Bensin dan solar harga per liternya Rp4500, sementara minah setelah subsidi ditarik, harganya mencapai Rp7 ribu hingga

Rp8 ribu per liter. Hal inilah yang mengakibatkan terjadinya pengoplosan tersebut. ‘’Untungnya lumayan jika minah dicampur solar karena harga solar lebih murah dari minyak tanah. Kalau dicampur tentu modalnya lebih murah, namun untungnya lumayan,” ujar A Br Berutu, warga Sunggal, Medan. Pengalaman yang sama juga disampaikan

sejumlah ibu rumah tangga di Kota Binjai. Sebagian besar masyarakat membeli minyak oplosan karena harganya lebih murah dan terjangkau. Jumini, warga Binjai mengatakan karena sulit mendapatkan minyak tanah bersubsidi di pangkalan dan non subsidi terlalu mahal, sebagian masyarakat mengoplos sendiri minyak tanah dengan menggabungkan minyak solar atau premium. “Pokoknya mana yang

paling murah itu yang dikejar masyarakat.” Parahnya lagi, bukan warga saja yang mengeluh kualitas minyak tanah non subsidi yang diduga bercampur solar ini. Pemilik pangkalan juga mengeluhkan adanya dugaan minyak tanah bercampur solar tersebut. Tak mau disebut sebagai biang yang mengoplos minah itu, pangkalan

>> Baca di Hal 10

Mau Asli, Warnanya Ungu Sejak tahap I di 5 kabupaten/kota, Medan , Deliserdang, Binjai, Langkat, Sergei terhitung 1 januari, alokasi minah subsidi tidak disalurkan lagi. Minah yang saat ini dijual adalah minah keekonomian dengan tambahan marker dyes jadi warna ungu/ jingga. Harganya bervariasi. Setiap tanggal 1 dan 15 mengalami perubahan harga sekitar Rp7 ribu

hingga Rp7500 per liter. Demikian dijelaskan Humas Pertamina Sumbagut, Fitri Erika

pada POSMETRO MEDAN. Menurutnya, fenomena saat ini ada rembesan minah subsidi berasal dari perbatasan aceh atau perbatasan 5 daerah tersebut. Hal ini menimbulkan daerah yang belum terkonversi mengalami kekurangan. ‘’Sehingga kami secara terus menerus berkoordinasi dengan Hiswanamigas untuk memantau

>> Baca di Hal 10

Minah yang berwarna ungu.

PM/INT


Sudah Mahal Masih Dicampur Solar meyakini ada oknum aparat yang terlibat mengoplos minah dan solar tersebut. Saat ini, banyak pengecer yang langsung menjual minah ke masyarakat atau kios-kios. Tapi minah yang dijual kualitasnya tidak bagus. Sebab, sumbu kompor keras dan api berwarna merah serta asapnya hitam. Sementara, di Kelurahan Kwala Bekala Medan Johor, beberapa waktu lalu, warga di sana melapor pada koran ini, masih banyak warga di sana yang belum menerima kompor gas. Bahkan, kondisi ini semakin diperparah dengan beredarnya minyak tanah yang bercampur solar. Harga minah sesuai HET, Rp7 ribu per liter. Tapi warna minah itu hitam dan api kompor susah menyala. Seperti yang diungkapkan Br Bangun pada POSMETRO MEDAN. ‘’Kompor gas tak dapat, minah murni pun sulit didapat, walau harganya

mahal,’’kata ibu anak 4 itu. Namun sejumlah warga lainnya, lebih senang menggunakan gas ketimbang minah. Pasalnya, penggunaan gas lebih mudah dan irit. Seperti yang diungkapkan Ali (40), warga Jalan Letda Sujono. Dia mengaku heran melihat peredaran minah sekarang ini. Soalnya, meski masyarakat mulai banyak menggunakan gas, tapi minah masih saja susah dicari. Ditambah lagi, harga mahal dan dicampur solar. “Udah susah dan harganya mahal malah dicampur solar pulak. Kadarnya lebih banyak solar dari minah. Itu sangat kentara kalau dilihat,” bebernya. Senada juga diungkapkan Erni (47) pedagang goreng di kawasan Sisingamangaraja. “Aku tak mau beli minah sekarang ini. Soalnya, minah sekarang ini tak murni dan malah dicampur solar dan air. Daripada membahayakan diri, mendingan pakai gas aja,”katanya. (maria/ali)

HALAMAN 10

MINGGU, 16 MEI 2010

10 Penjahat Terbesar Sepanjang Sejarah Berikut ini 10 penjahat terbesar sepanjang sejarah dan satu diantaranya berasal dari Indonesia. Artikel ini murni bukan pendapat saya, dan saya disini hanya bermaksud untuk sharing saja. Tidak ada niat apapun dibaliknya.

Mau Asli, Warnanya Ungu agen minah/LPG 3 kg agar menyalurkan sesuai dengan wilayahnya,’’terang Asisten Manager External Relation Pertamina Regional I Sumbagut itu Menyahuti soal fenomena lain, soal adanya informasi campuran solar. Menurut Erika, hal itu tidak disarankan. Sebab, mengingat sifat solar sangat berbeda dengan minah, tentunya akan menimbulkan efek lain. Penarikan Kuota Minyak Tanah Bertahap Seiring dengan telah terdistribusinya paket perdana LPG 3 kg dan meningkatnya penggunaan LPG 3 kg oleh masyarakat, telah dilakukan pengurangan kuota minyak tanah bersubsidi secara bertahap sebesar 10% pada bulan Januari-Maret kemarin di wilayah terkonversi, khususnya yang termasuk tahap II (Tebing Tinggi, Tanjung Balai, P. Siantar, Asahan, Batubara, Labuhan Batu, Karo, dan Simalungun). Sedangkan pada bulan April-Juni ini akan dilakukan pengurangan sebesar 50%. Penarikan minyak tanah yang dilakukan secara bertahap ini, untuk memberikan kesempatan bagi masyarakat agar beradaptasi menggunakan LPG. Tentunya rencana penarikan ini dapat berubah, dengan memperhatikan situasi yang berkembang di masyarakat. Sedangkan untuk wilayah yang termasuk tahap I (Medan, Binjai, Langkat, Deli Serdang, dan Serdang Bedagai), minyak tanah bersubsidi sudah tidak disalurkan per 1 Januari.

Stok BBM dan LPG SumutAman Menghadapi pemilihan kepala daerah (bupati/walikota) di Sumatera pada 12 Mei lalu, Pertamina Pemasaran Region I Sumbagut telah menyusun strategi dan antisipasi dalam rangka memberikan kenyamanan kepada masyarakat dari sisi suplai BBM. Kesiapan ini dilakukan dengan tujuan agar kebutuhan BBM untuk masyarakat selaku konsumen selama pilkada serentak di Sumut dan akhir pekan ini senantiasa terpenuhi dengan lancar dan dalam jumlah yang cukup, sehingga stabilitas stok dan harga tetap dapat dipertahankan. Stok BBM di 5 lokasi, yaitu Instalasi Medan Group, Depot Siantar, Depot Kisaran, Depot Sibolga dan Depot Gunung Sitoli dalam jumlah yang cukup. Saat ini (10 Mei) jumlah Premium sebanyak 21.330 kiloliter (KL), Minyak Tanah 18.070 KL, dan Solar 22.720 KL. Sementara Stock LPG di Depot LPG dan SPPBE di Sumut, sebanyak 2.420 MT atau 2.420.000 kg, dan tanggal 11 Mei dijadwalkan masuk kapal Asean Gas di Depot Pangkalan Susu, mengangkut 1.300 MT. Dari data tersebut dapat disimpulkan bahwa ketersediaan stock untuk BBM dan LPG untuk wilayah Sumatera Utara dalam jumlah yang mencukupi. Pasokan secara kontinyu akan terus ditambah, yang berasal dari Kilang Refinery Unit II Dumai (Riau) dan impor via Instalasi Tanjung Uban (Kepulauan Riau). (Maria Surbakti)

Pengawasan Tak Ketat ulah manusia yang ingin meraih untung banyak. Alhasil, segala cara pun dilakukan. Baik mencampuri dengan air, solar maupun lainnya “Berat ngurus manusia permanusia. Karena, bukan satu rang saja yang melakukan, tapi banyak. Semuanya itu, untuk meraih untung besar. Karena, harga minah tidak bersubsidi sangat mahal dan mencapai Rp 8000,” tuturnya. Lebih lanjut, Sabar bilang, pengawasan pihak Pertamina di lapangan tidak cukup untuk mengungkap permainan di lapangan. Tapi Pertamina harus kordinasi dengan aparat. Jika tidak, para pelaku yang menjual minah ke pabrik maupun mencampur alias mengoplos akan terus berkeliaran di alam bebas. “Kita minta Pertamina kordinasi dengan aparat untuk membantu kerja di lapangan. Kalau tidak, minah yang tidak bersubsidi terus dimanfaatkan oknum tidak bertanggungjawab,” pintanya. Politisi Golkar itu mengaku sangat menyesalkan kenapa pemerintah secara drastis menghapuskan minah bersubsidi. Seharusnya, pemerintah bertahap untuk mengalihkan minah ke gas. Soalnya, sebagian masyarakat masih memerlukan dan terbiasa memakai minah. “Kita binggung juga lihatnya

kenapa minah bersubsidi langsung dihapuskan. Seharusnya, pemerintah membuat pengalihan secara bertahap. Begitu semuanya sudah tidak ada masalah dan dirasa mantap, baru minah bersubsidi ditarik dari peredaran,” terangnya wakil rakyat yang juga pengusaha ini. (ali amrizal)

Aparat Harus ...

pihak polisi maupun DPRD Medan. Jadi, masyarakat jangan takut. “Masyarakat harus menunjukkan sampelnya dan uji kadar minah. Jika hal itu terjadi, aparat polisi bisa melakukan penindakan dan menangkap pelakunya. Kita tidak ingin masyarakat mempergunakan minah dirugikan,” himbaunya. Masih kata Hanas lagi. Untuk mengantisiasi kelangkaan minah, pihaknya minta supaya Pertamina terus memantau dan kordinasi dengan pihak pangkalan. Pasalnya, jika minah langka masyarakat jadi binggung mencarinya. Karena minah masih dibutuhkan masyarakat golongan bawah, meski konversi gas sudah diberlakukan di Medan. “Walau minah bersubsidi dihapuskan, Pertamina jangan santai saja dan tidak begitu peduli. Pertamina harus tetap kordinasi supaya minah non subsidi bisa didapat masyarakat yang membutuhkannya,” tegasnya. (ali amrizal)

Al Capone

Jeffrey Dahmer

Ted Bundy

Bonnie & Clyde

Theoadore Kaczynski FOTO-FOTO : PM/INT

1. Al Capone Alphonse Gabriel “Al” Capone (17 Januari 1899 - 25 Januari 1947) adalah seorang gangster Amerika yang memimpin sebuah sindikat kejahatan yang didedikasikan untuk penyelundupan dan pembuatan minuman keras dan aktifitas ilegal lainnya selama Era Prohibition tahun 1920-an dan 1930-an. Lahir di Brooklyn untuk Southwestern imigran Italia Gabriele dan Teresina Capone, Capone memulai karirnya di Brooklyn sebelum pindah ke Chicago dan menjadi bos organisasi kriminal yang dikenal sebagai Chicago Outfit- meskipun dikartu namanya dikenal sebagai agen furnitur bekas . Meskipun ia tidak pernah berhasil dihukum karena tuduhan pemerasan, karier kriminal Capone berakhir pada 1931, ketika ia didakwa dan dihukum oleh pemerintah federal karena penggelapan pajak penghasilan.

2. Jeffrey Dahmer Jeffrey Lionel Dahmer (21 Mei 1960 - 28 November 1994) adalah seorang pembunuh berantai dan pemerkosa dari Amerika. Dahmer membunuh 17 pria dan anak laki-laki - yang kebanyakan berasal dari keturunan Afrika dan Asia - antara tahun 1978 dan 1991. pembunuhannya sangat mengerikan, yang melibatkan perkosaan, penyiksaan, pemotongan, necrophilia dan kanibalisme. pada 28 nivember, 1994, ia dipukuli sampai mati oleh seorang narapidana Lembaga Pemasyarakatan Columbia dengan sebuah batang besi pada saat pengerjaan tempat fitnes di penjara.

3. Ted Bundy Theodore Robert “Ted” Bundy, lahir Theodore Robert Cowell (November 24, 1946 - 24 Januari 1989), adalah seorang pembunuh berantai Amerika yang aktif antara tahun 1973 dan 1978. Dia dua kali melarikan diri dari penjara lokal sebelum penangkapannya terakhir pada akhir bulan Februari 1978. Setelah lebih dari satu dekade selalu menyangkal tindak kejahatannya, akhirnya ia mengaku lebih dari 30 pembunuhan, meskipun sebenarnya total korban masih belum diketahui. Perkiraan berkisar antara 26 hingga lebih

James McVeigh

dari 100, perkiraan yang umum 35. Biasanya, Bundy akan memukul korbannya dgn gada, kemudian mencekik mereka sampai mati. Dia juga terlibat dalam pemerkosaan dan necrophilia. Bundy dieksekusi karena pembunuhannya yg terakhir oleh negara bagian Florida pada tahun 1989.

4. Bonnie & Clyde Bonnie Parker (1 Oktober 1910 - 23 Mei 1934) dan Clyde Barrow (24 Maret 1909 23 Mei 1934) yang dikenal penjahat, perampok, dan geng penjahat,yang melalang buana di Amerika Serikat Tengah pada masa depresi. Hal ini membuat mereka mereka dikenal secara nasional. Mereka menarik perhatian pers Amerika dan para pembaca yang membuatnya dikenal sebagai “era musuh publik “ antara 1931 dan 1934. Meskipun saat ini dikenal atas lusinan perampokan bank, Barrow sebenarnya lebih suka merampok toko-toko kecil atau pompa bensin di pedesaan . Geng ini diyakini telah menewaskan sedikitnya sembilan polisi dan melakukan pembunuhan beberapa warga sipil. Mereka akhirnya disergap dan dibunuh di Louisiana oleh petugas hukum

5. Theodore Kaczynski a.k.a Unabomber The Unabomber menjadi salah satu sasaran FBI yang menghabiskan biaya penyelidikan paling besar. Sebelum identitas Kaczynski dikenal, FBI menggunakan pegangan “UNABOM” ( “University and Airline Bomber”) untuk merujuk kepada kasus, yang menyebabkan media yang memanggilnya Unabomber. Meskipun telah ada upaya dari FBI utk membuka kedoknya, ia tidak langsung dgn mudah diketahui identitasnya. Malah, saudaranyalah, Ted yang mengenali gaya penulisan dan sidik jari yg diperoleh dari FBI. Untuk menghindari hukuman mati, pengacara Kaczynski masuk ke dalam permohonan persetujuan, di mana ia mengaku bersalah dan dijatuhi hukuman penjara seumur hidup tanpa kemungkinan pembebasan bersyarat. Theodore

Paul Bernardo & Karla Homolka

Kaczynski telah ditetapkan sebagai “teroris dalam negeri” oleh FBI.

6. James McVeigh James Timothy McVeigh (April 23, 1968 - 11 Juni 2001) adalah seorang veteran Angkatan Darat Amerika Serikat dan penjaga keamanan yang dihukum karena mengebom Gedung Alfred P. Murrahdi di Oklahoma City pada 19 April 1995, pada perayaan ulang tahun kedua Pengepungan Waco , dia melakukannya sebagai balas dendam untuk mengilhami revolusi melawan apa yang dianggap sebagai tirani pemerintah federal. Pengeboman menewaskan 168 orang dan merupakan tindakan terorisme yang mematikan di Amerika Serikat sebelum September 11, 2001 serangan. Dia dinyatakan bersalah atas 11 penyerangan federal, dijatuhi hukuman mati dan dieksekusi pada 11 Juni 2001

7. Paul Bernardo & Karla Homolka Karla Homolka dan Paul Bernardo adalah sepasang kekasih yang bersenang-senang dengan cara menyiksa dan membunuh gadis-gadis muda, termasuk adik perempuan karla yg berumur 15 tahun pada malam Natal. Sekarang Homolka bebas setelah menjalani hukuman pendek selama 12 tahun penjara.

8. Suharto Pada tanggal 29 Mei 2000, Soeharto ditempatkan di bawah tahanan rumah ketika pemerintah Indonesia mulai menyelidiki korupsi selama rezimnya. Pada bulan Juli 2000, diumumkan bahwa ia akan dituduh menggelapkan US $ 571 juta dari sumbangan pemerintah ke salah satu dari sejumlah yayasan di bawah kendalinya yang kemudian digunakan uangnya untuk membiayai investasi keluarga. Tetapi pada bulan September dokter yang ditunjuk pengadilan mengumumkan bahwa ia tidak bisa diadili karena kondisi kesehatan yang menurun. Jaksa penuntut umum mencoba lagi pada tahun 2002 tapi kemudian dokter mengindikasikan ada penyakit pada otaknya. Tanggal 26 Maret 2008, sebuah

Suharto

John Gotti

pengadilan sipil hakim membebaskan Soeharto dari korupsi namun memerintahkan yayasan amal, Supersemar, untuk membayar US $ 110 juta

9. John Gotti John Joseph Gotti, Jr, juga dikenal sebagai Johnny Boy, adalah bos dari keluarga kejahatan Gambino . John Gotti adalah bos penjahat paling kuat pada zamannya. Ia menjadi dikenal luas karena kepribadian yang blak-blakan dengan gaya flamboyan yang pada akhirnya menyebabkan kejatuhannya. Pada tahun 1992, Gotti didakwa pemerasan, 13 pembunuhan, obstruksi keadilan, konspirasi untuk melakukan pembunuhan, perjudian ilegal, pemerasan, penggelapan pajak, dan dijatuhi hukuman penjara seumur hidup di mana ia meninggal 10 tahun kemudian karena kanker.

10. O. J. Simpson Kasus O. J. Simpson adalah kasus pembunuhan yang melibatkan aktor sekaligus mantan pesepak bola Amerika O. J. Simpson. Ia diadili karena didakwa membunuh mantan istri Nicole Brown Simpson dan Ronald Goldman (pacar mantan istrinya) pada 1994. Kasus pidana ini mendapat sorotan luas dari media massa dan publik Amerika Serikat karena O.J. Simpson adalah mantan bintang sepak bola Amerika berkulit hitam. Setelah melalui pengadilan berkepanjangan, Simpson dinyatakan tak bersalah dan dibebaskan pada 3 Oktober 1995. Di kemudian hari, Simpson dituntut di pengadilan sipil oleh keluarga Brown dan Goldman. Pada 5 Februari 1997, juri dengan suara bulat menunjukkan bukti-bukti dalam jumlah besar yang mendukung tanggung jawab Simpson sebagai penyebab kematian akibat kelalaian atas Goldman dan pemukulan atas Brown. Juri memutuskan, Simpson diwajibkan membayar ganti rugi sebesar AS$33,5 juta untuk kematian Ronald Goldman dan pemukulan terhadap Nicole Brown. Atas keputusan tersebut Simpson naik banding. Pengadilan banding Los Angeles menguatkan vonis pengadilan sipil terhadap Simpson. sumber : http://numb3rblog.blogspot.com

O. J. Simpson FOTO-FOTO : PM/INT


MEDAN Sungguh tragis nasib gedung-gedung bersejarah di kota Medan. Seiring tahun, keberadaan gedung bersejarah hancur. Kini, hanya tinggal beberapa saja gedung bersejarah di kota Medan. Salah satunya gedung Graha XL di Jalan Diponegoro yang masih berdiri utuh.

HALAMAN 11

MINGGU, 16 MEI 2010

Rumah Peristirahatan Keluarga Sultan Menurut keterangan Humas Badan Warisan Sumatra (BWS) Hairul kepada POSMETRO MEDAN, gedung yang kini menjadi kantor perusahaan telekomunikasi (XL) dibangun pada tahun 1920 oleh Sultan Langkat. Gedung dulunya menjadi rumah peristirahatan keluarga Sultan. Ketika Deli Masschappij didirikan sebagai perusahaan perkebunan terbesar di kota Medan, sebagian besar bangunan di Jalan Diponegoro dipergunakan sebagai tempat tinggal para pejabat Deli Masschappij. Nah, sekitar tahun 1980-an, William Chandra membeli gedung tersebut dari keluarga Sultan dan membangun kembali untuk digunakan sebagai tempat usaha tanpa merubah bentuk aslinya. “Meski melakukan pembangunan beberapa kali, keluarga Sultan dan William Chandra selaku pemilik gedung sekarang, tidak melakukan perubahan,” ujarnya. Akhirnya, di tahun 2000 gedung yang sudah ditinggalkan sejak 20 tahun lalu itu dimanfaatkan PT XL Axiata (sebelumnya, PT Exelcomindo Pratama) sebagai kantor. Untuk kepentingan komersial sebagian bangunan direnovasi tanpa mengurangi keasliannya. Seperti warna dan bentuk jendela. Selebihnya, sama sekali tidak dirubah. Baik itu lantai papan di lantai 2 dan ubin kuning di lantai dasarnya. Juga kamar kecil dan ruang-ruang yang tersedia di keseluruhan gedung. “Tahun 2001, gedung Graha XL menerima anugerah pelestarian. Semuanya itu diraih, lantaran Graha XL tetap mempertahankan keaslian gedung tersebut,” tukasnya. Ir Kuncoro T Prihatn selaku FM Manager West Region PT XL Axiata menuturkan gedung berlantai dua arah barat ini memiliki luas 2300 meter. Di lantai

pertama dulunya menyatu yang dijadikan lobi hotel dan 3 ruangan sebelum mereka menempatinya. Lantas, pihaknya membuat ruangan serta menambah 1 kamar mandi. Mengenai keramik lantai, lantaran tidak diperbolehkan menggantikannya, pihaknya menutupnya dengan keramik baru yang ditambal dengan kayu kasao berukuran 5x7. Di lantai dua terdapat empat kamar dan satu kamar mandi utama. Tangga menuju lantai

dua masih tetap kayu dan lantainya juga kayu. “Kita masih tetap memakai cat seperti dulunya. Sedangkan keramik ruangan depan kita tambal tanpa membongkar keramik yang lama. Tidak ada satupun bangunan dihancurkan,” terangnya. Kuncoro bilang, sebelum mereka menempati gedung ini dindingnya masih tahan dan awet lantaran tidak dipasang AC. Begitu dipasang AC, dindingnya menjadi lembab dan terkelu-

pas. Namun, pihaknya tetap memplester dinding itu kembali agar tidak merembet dan tidak kelihatan jelek karena pengaruh AC. Lebih lanjut, arah selatan di samping gedung utama tepat berada di pos satpam, terdapat lima ruangan dan lima kamar mandi serta satu dapur umum. Kini, hanya tiga kamar mandi saja yang berfungsi dan dua direnovasi serta ditambahi musholla.

Sedangkan arah timur bagian belakang, terdapat enam kamar. Kini, malah dijadikan gudang dan ruang rapat. “Kita tetap melakukan perawatan tiap tahunnya. Kita buat anti rayap supaya tidak keropos dimakan rayap. Kita juga tiga kali melakukan perubahan tanpa bongkar bangunan aslinya. Kita hanya menambah ruangan yang diperlukan di kantor ini,” terang Kuncoro mengakhiri.(ali amrizal)

Tujuan W isata Wisata RAGAM WISATA SUMATERA UTARA

Berpeluang Mengejar Bali Sumatera Utara memiliki berbagai tempat pariwisata yang patut dikunjungi para wisatawan yang berkunjung ke daerah Sumatera Utara, dan banyak hal yang dapat dinikmati oleh para wisatawan lokal maupun wisatawan yang berasal dari Luar Negeri. Oleh karena itu kita harus yakin bahwa Sumatera Utara dapat menyamai Bali dan dapat diandalkan ke pentas internasional, karena lokasi Sumatera Utara berdekatan dengan tiga negara, yakni Singapura, Thailand, dan Malaysia.

Ketertinggalan yang dirasakan selama ini terkait dengan minimnya sarana, prasarana pendukung dan sumber daya manusianya. Dapat kita lihat bahwa di Bandara Polonia Medan, Pelabuhan Belawan yang merupakan Gerbang pintu masuknya para turis asing, tak tertutup kemungkinan minta para wisatawan yang ingin berkunjung ke Sumatera Utara begitu besar, akan tetapi, strategi promosinya terkesan masih

kurang, sehingga kadang kadang sering membuat wisatawan kehilangan gairah untuk datang ke sumatera utara. Keterkenalan Danau Toba yang terletak yang merupakan danau terbesar yang ada di Indonesia, mungkin telah sampai kabarnya ke seluruh pelosok Nusantara, atau mungkin bahkan sampai di Mancanegara. Namun di Sumatera Utara bukan cuma Danau Toba saja tempat

Gundaling

Taman Bukit Lawang yang menjadi lokasi penangkaran orang utan

menarik yang pantas anda kunjungi. Belum lagi objek wisata seperti Berastagi, Danau Lau Kawar di kaki Gunung Sinabung kabupaten Karo. Malah ada pula objek wisata alam Bukit Lawang di Kabupaten Langkat. Objek wisata Bukit Lawang, merupakan tempat tujuan wisata yang berada di Kabupaten Langkat, Provinsi Sumatra Utara yang terletak 68 km sebelah barat laut Kota Binjai dan sekitar 80 km di sebelah barat laut kota Medan. Bukit Lawang termasuk dalam lingkup Taman Nasional Gunung Leuser yang merupakan daerah konservasi terhadap mawas orang utan. Wisatawan dapat pula mengunjungi Bukit Gundaling yang tepat berada di pinggiran Kota Berastagi Kabupaten Karo, dimana Gundaling itu sendiri merupakan salah satu daerah objek wisata di Brastagi, Kabupaten Karo, sekitar 50 km dari Medan, Sumatera Utara. Gundaling adalah daerah ketinggian yang menyajikan panorama indah kota Brastagi dan sekitarnya.

Berastagi Di dalam daerah wisata Gundaling, banyak terdapat penginapanpenginapan dari tingkat bungalow sampai dengan hotel berbintang. Objek wisata lain yang tidak kalah menarik dan masih berada di Sumatera Utara adalah Sibolangit. Di daerah ini terdapat kawasan wisata di Tanah Karo Simalem, Sumatera Utara. Kawasan ini masih termasuk ke dalam wilayah Kabupaten Deli Serdang, berbatasan dengan wilayah Kabupaten Karo. Daerah ini dapat

ditemui saat perjalanan dari Medan menuju Brastagi, tepatnya sebelum daerah Bandar Baru. Sibolangit juga merupakan kawasan perkemahan Pramuka yang populer. Sibolangit pernah menjadi tuan rumah penyelenggaraan Jambore Nasional Gerakan Pramuka Indonesia Tahun 1977. Jambore tersebut dilaksanakan pada tanggal 1-20 Juli 1977. Di kawasan ini pernah jatuh sebuah pesawat Garuda Indonesia nomor pen-

Danau T oba Toba

erbangan 152, tepatnya pada tanggal 26 September 1997 di desa Buah Nabar yang rencananya akan mendarat di bandara Polonia, Medan. Toleransi antar umat beragama di provinsi Sumatera Utara memang sangat kuat, dan hal tersebut tercermin dari salah satu objek wisata Taman Iman yang ada di Kabupaten Dairi dan tepat berada di Sitinjo, Kabupaten Dairi, Provinsi Sumatera Utara, Indonesia. Taman Wisata Iman (TWI) merupakan tempat wisata religius. TWI bukan hanya mewakili salah satu agama saja yang diakui di Indonesia melainkan semua agama. Mewakili yang dimaksud adalah bahwa dalam TWI terdapat berbagai bangunanbangunan yang duanggap bersejarah bagi pemeluk agama masingmasing. Mulai dari tempat peribadatan hingga miniatur bangunan yang dianggap bersejarah dan mengenangkan peristiwa-peristiwa penting bagi pemeluknya. Lokasi yang disebutkan di atas merupakan beberapa diantara banyak lokasi wisata lainnya di Sumatera Utara. Lantas apakah sajian wisata di Sumatera Utara bisa mengimbangi Bali, yang dipandang sebagai surga wisatawan? Sebaikanya pertanyaan itu kita serahkan kepada pemerintah terkait dan masyarakat itu sendiri. (budi/in)


Kipas AC Tidak Jalan Jika Anda menginginkan kendaraan awet, maka jawabannya adalah rajin merawat. Kondisi alam yang semakin pasan, tentunya membuat Anda dan keluarga tidak nyaman jika dalam kondisi AC rusak. Karenanya perhatikan selalu kondisinya. Jangan-jangan kipas AC mobil Anda tidak bergerak. Point yang harus diperhatikan adalah perhatikan kondisi air radiator. Jangan biarkan juga

sampai terjadi panas berlebih, akibat kipas tak bergerak. Sebab hal itu dapat mengakibatkan metal di mesin berubah bentuk dan menimbulkan kebocoran. Bahkan bila panasnya menembus batas merah, maka mesin bisa rusak total. Sebaiknya segera ganti/perbaiki kipas AC Anda, agar pendinginan mesin bisa tetap optimal saat AC dihidupkan dan nikmati berkendaraan nyaman bersama keluarga. (bud/in)

MINGGU, 16 MEI 2010

HALAMAN 12

Cara Toyota Pangkas Harga Mobil Hidrogen Anda Mau Pasang Iklan Hubungi : 08126456433

Pabrik Toyota di Thailand Tutup Dua Minggu BANGKOK Toyota Motor Thailand akan menghentikan produksinya selama dua minggu di salah satu pabriknya di Thailand pada akhir bulan ini. Tujuannya adalah memperbaiki jaringan produksi dan pasokan produk Toyota di negara itu. Demikian dijelaskan juru bicara perusahaan itu, seperti yang dikutip harian Bangkok Post hari ini. Ditambahkan, penutupan tidak akan diikuti dengan pemutusan hubungan kerja (PHK). Juga tidak dijelaskan kaitannya dengan situasi politik di negara itu yang kian mencekam antara kubu pemerintah dan pengikut setia Thaksin Shinawatra, yaitu “Kaus Merah”, yang bentrok di

pusat kota Bangkok. Hanya dijelaskan, pabrik itu mempekerjakan 950 karyawan dengan total produksi per tahun 50.000 unit. Selanjutnya, Toyota akan memindahkan produksinya keThaiAutoWorks dekat Bangkok yang merakit SUV Fortuner dan pikap Hilux– yang berada di Samrong, Provinsi Samrong Prakan di luar Bangkok . Pabrik yang disebutkan terakhir mulai beroperasi pada 1988 dan memproduksi 60.000 unit kendaraan per tahun untuk tujuan ekspor ke Eropa dan Asia Pasifik. Di Thailand, Toyota mempunyai empat pabrik yang dijadikan menjadi pusat produksi regional dan ekspor.(bd/zbj/kcm)

Toyota Motor Corp mengumumkan telah berhasil memangkas biaya pembuatan mobil berbahan bakar hidrogen hingga sekitar 90 persen sejak pertengahan dekade 2000-an. Dengan pencapaian itu, Toyota berharap bisa menjual mobil hidrogen pertamanya dengan harga sekitar US$ 50 ribu (Rp 450 juta) di pasar retail. Toyota menargetkan mobil hidrogen pertamanya masuk pasar pada 2015. Model pertama Toyota berbahan bakar hidrogen itu nantinya berupa sedan dengan kemampuan jelajah setara mobil berbahan bakar bensin. Hal itu diungkapkan petinggi Toyota, Yoshihiko Matsuda seperti dirilis dalam laman Toyota, Rabu 12 Mei 2010. Saat ini teknologi hidrogen Toyota dikembangkan menggunakan SUV Toyota Highlander. Menurut Managing Director for Advanced Autos itu, masih ada kendala besar yang harus dicari jalan keluarnya. Meskipun sudah berhasil menurunkan biaya pembuatan mobil berbahan

Dijual

Mitsubishi Lancer SL ‘82 Warna Hitam - Pajak Panjang, Velg 16”, Ban baru, Full Sound - Jok Kulit, Siap Pakai Hub: 0812 6000 7200 - 77499791

1 unit bus Lux ‘06 Karoseri asli Trisakti, ACfull dingin, sound system full, subwofer, TV, komponen, lengkap, pakai infetor, ban 90% baru, sekali lihat pasti jadi (B.U) harga nego. Hub: 081396925102, 081260776226

Suzuki Carry Futura 1.3 Alexander Custom’ 92

BK asli Medan, dalam2 baru, kulit, mesin sehat, warna biru Rp. 31 Jt/ nego Hub: 08126578790/ 77788647

Dijual

Telp. 414 77 46 - 0812 6485 4159

bakar hidrogen dari US$ 1 juta, namun pencapaian sekarang ini masih separuh jalan dari target yang ditentukan. Alasannya jelas, Toyota tidak ingin memberikan subisidi harga untuk mobil hidrogen yang dijual. Ini yang membedakan dengan pabrikan lain yang memberikan subsidi agar mobilnya bisa di jual dengan harga terjangkau. Toyota berhasil memangkas biaya produksi mobil berteknologi fuel cell ini dengan mengurangi penggunaan plati-

num, logam mulia yang harganya lebih mahal dari emas, menjadi sepertiga dari sebelumnya. Toyota juga berhasil menemukan cara yang lebih murah untuk memproduksi lapisan tipis film yang di digunakan dalam fuel-cells, tempat reaksi hidrogen dan oksigen yang menghasilkan listrik. Pengurangan harga juga terjadi tangki bahan bakar hidrogen yang menggunakan serat karbon yang ringan tapi lebih kuat dari baja. (bd/vi)

rbit 00,- / Te p. 15.0 ,- / Bulan R Iklan Foto Rp. 400.000 Hubungi: Mobil & Rumah 0812 6478 3718 0813 7529 3827 0812 6404 8640 POSMETRO MEDAN

Isuzu Panther PU ‘03/‘05 Warna Hitam MITRA JAYA MOBIL Jl. Gatot Subroto No. 399 Medan Telp. 414 77 46 - 0812 6485 4159

Kijang Kapsul LGX ‘01 Warna Biru MITRA JAYA MOBIL: Jl. Gatot Subroto No. 399 Medan Telp. 414 77 46 - 0812 6485 4159

Dijual Kijang Krista Diesel ‘01 Warna Biru Mika MITRA JAYA MOBIL: Jl. Gatot Subroto No. 399 Medan Telp. 414 77 46 - 0812 6485 4159

Dijual Mitsubishi Kuda GLS Diesel ‘00 WarnaMerah hati MITRA JAYA MOBIL: Jl. Gatot Subroto No. 399 Medan Telp. 414 77 46 - 0812 6485 4159

Daihatsu Espass Minibus 1.3 CC ‘03 Warna Silver MITRA JAYA MOBIL: Jl. Gatot Subroto No. 399 Medan Telp. 414 77 46 - 0812 6485 4159

Daihatsu Rocky 4x4 ‘95 Warna Hitam MITRA JAYA MOBIL: Jl. Gatot Subroto No. 399 Medan Telp. 414 77 46 - 0812 6485 4159

DIFA Mobil

il Jual Beli Mob Baru - Bekas Cash - Kredit

Jl. Tritura No.50 A Medan Telp. 061-77698741 - 0812 637 8815

KARYA MOBIL Jual - Beli Mobil Cash - Kredit

Suzuki APV type X ‘04 2004 akhir, warna coklat metalik, ban 4 baru, jok alas dasar sudah balut imbitek, BK asli Medan, Harga Rp. 93 Jt/ Nego, Hub: 0812 6007 8666

Jl. Tritura No.71 F Medan Telp. 061-785 39 62

Suzuki Katana ‘98

Jl. Karya Bakti No. 15 Medan Johor Telp. 0811 637 306 - 061 768 50121 Dijual

Dijual

Kijang Innova G ‘05 Vitara ‘93 4WD Warna Merah Ferari, ban baru, VR, PW, Full Jok Kulit, VCD, AC, BK pilihan, Pjk baru perPanjang, mobil siap pakai 081361491323

Bensin, Warna Hitam

Hubungi: PARDA MOBIL 061-785 39 62

TAFT GT’93

Warna Biru, 4x4 , siap pakai

Hubungi: PARDA MOBIL 061-785 39 62

Toyota Kijang Commando Long ‘91

Warna Abu2 Hub: KARYA MOBIL Hp: 0811 637 306, 061-7685 0121

Dijual

Toyota Kapsul LGX Bensin ‘01

Warna Silver Metalik

Hubungi: PARDA MOBIL 061-785 39 62

Kijang Kapsul LX Bensin ‘97

Warna Hijau Metalik

Hubungi: PARDA MOBIL 061-785 39 62

Honda Grand Civic ‘89

Warna hitam Hub: KARYA MOBIL Hp: 0811 637 306, 061-7685 0121

Warna Abu2 Hub: KARYA MOBIL Hp: 0811 637 306, 061-7685 0121

Jl. Ngumban Surbakti No.14 Pasar VIII Medan Telp. 0813 9691 9855

Dijual Suzuki Baleno ‘97 Warna Hijau Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Dijual Totoya Kijang Grand Extra ‘93 Warna Abu2 Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Hyundai Matrik ‘02

Hyundai Trajet ‘01

Warna hitam, BK Medan, AC, Tape, VCD,

km 55 rb, TV Slidding Hub: DIFA MOBIL, 061-77698741-08126378815

Dijual

Kijang Rover ‘93

Warna Abu2 Hub: KARYA MOBIL Hp: 0811 637 306, 061-7685 0121

Dijual Toyota Twin Cam ‘89/’90 Warna Putih Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Jl. Tritura No.82 Medan Hub: 0811 6099 03 - (061)7715 2989

Jimny 4x4 ‘86

Warna Hitam, Ban 30 Radial

Hub: DIFA MOBIL, 061-77698741-08126378815

Toyota Kijang Super ‘92 AC, Tape, VR, warna abu2 metalik. Harga Rp. 36 Jt/ Nego Hub : Sempabu Mobil, Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

Panther LDX ‘91 Warna Abu-abu metalik, VR, AC double blower, harga Rp.39 Jt/nego Hub : Sempabu Mobil, Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

Toyota Kijang Innova Bensin type E ‘05 Warna Coklat Metalik Hub: Ganori Mobil Hp: 0811 6099 03 (061)7715 2989

Daihatsu Xenia ‘04 Type Li, biru metalik Hub: Ganori Mobil Hp: 0811 6099 03 (061)7715 2989

Jual - Beli Mobil Cash - Credit

JL. TRITURA SIMPANG STM UJUNG NO.18 MEDAN

Telepon : 0813 9764 0122 , 061-77 182 814 Dijual

Hartop Pick Up ‘80 Mesin 2F Timbul, ada 3 unit,Dilelang 80 Jt/ nego Hub : Sempabu Mobil, Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

Taft Badak Minibus ‘82 Warna Merah, Pajak Hidup, Harga 26,5 Jt/ Nego Hub : Sempabu Mobil Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

KIA Picanto ‘05 Warna Orange Hub: Ganori Mobil Hp: 0811 6099 03 (061)7715 2989

Daihatsu Xenia type Xi VVTi Delux ‘06 Warna Biru Metalik Hub: Ganori Mobil Hp: 0811 6099 03 (061)7715 2989

Warna Hitam Metalik Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp.081397640122, 77182814

Warna Hitam , Solar Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp.081397640122, 77182814

Panther Touring / HiGrade ‘05/’95

Toyota Kijang LGX 1.8 ‘03/99

Warna Biru Met/ Abu2 Met

Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp081397640122, 77182814

Dijual/ Disewakan: Rumah type 42 di Villa Flamboyan Setia Budi (teralis sudah ada) Hub: 0812 7718 4063

Kijang Pick Up ‘90 Warna Biru, pajak hidup, siap pakai harga 38 Juta/ nego Hub : Sempabu Mobil, Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

Kijang Pick Up Kapsul ‘97 Warna Hitam, VR, BK Medan, Siap Pakai, Harga 55 Jt/ Nego Hub : Sempabu Mobil, Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

Daihatsu Zebra Minibus ‘94 Warna Hitam, 5 speed , rem depan cakram, siap pakai Hub : Sempabu Mobil, Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

Toyota Kijang Pick Up ‘85 Warna Abu2, Surat2 Hidup, Harga 16,5 Jt/ nego Hub : Sempabu Mobil, Telp. 0813 9691 9855 Jl. Ngumban Surbakti No.14 Psr 8 Medan

Toyota Kijang LGX ‘97 Warna Hijau Botol Metalik Hub: Ganori Mobil Hp: 0811 6099 03 (061)7715 2989

Suzuki Swift type ST ‘08 Warna Biru Metalik Hub: Ganori Mobil Hp: 0811 6099 03 (061)7715 2989

Honda Accord Mestro ‘91 Original, Medan Asli, Warna Abu2 Metalik Hub: Ganori Mobil Hp: 0811 6099 03 - (061)7715 2989

Misubisi Lancer Evo 3 ‘95 Warna Abu2 Metalik Hub: Ganori Mobil Hp: 0811 6099 03 (061)7715 2989

Warna Hitam Hubungi : CV. Suka Mobil 061-68784998, 08116203698

Warna Biru Muda/ Biru Metalik Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp.081397640122, 77182814

Suzuku Carry GRV 1.3 ‘97

Warna Hitam Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp.081397640122, 77182814

Warna Hijau Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp.081397640122, 77182814

Dijual

Dijual Dijual

Toyota Kijang Krista 2.5 Solar ‘00

Hyundai Atoz 1.0 GLS ‘01

Warna Hijau Metalik Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp.081397640122, 77182814

Warna Biru Hub : BM MOTOR: Jl. Tritura No.18 Medan Telp.081397640122, 77182814

Honda City IDSI ‘04

Warna Hitam metalik, Manual Hubungi : CV. Suka Mobil 061-68784998, 08116203698 Dijual

Daihatsu Taft Independent ‘96

Kijang LSX Diesel ‘97

Warna Hijau Hubungi : CV. SUKA MOBIL 061-68784998, 08116203698

Warna Hijau Hubungi : CV. SUKA MOBIL 061-68784998, 08116203698

Dijual

Dijual

Chevrolet Blazer 2.2 Montera ‘05

Dijual

Dijual

Dijual

Dijual

Mitsubishi L300 ‘92 Pick Up/ Bensin Kondisi Siap Cat/ Jok baru/ BK Panjang, kondisi Jalan, Harga 40 Jt/ nego, Hubungi: Jimmy 0811632813 - 77863990

Toyota Avanza type G ‘07

Kijang Innova G 2.5 ’07

Nissan Xtrail XT A/T 2.5 ‘03

Dijual

Mitsubishi L300 ‘92 Minibus/ Bensin Kondisi Siap Cat/ Jok baru/ BK Panjang, kondisi Jalan, Harga 40 Jt/ nego Hubungi: Jimmy 0811632813 - 77863990

ZEBRA 1.0 ‘88 (MURAH) BK Mdn, Hidup, Siap Jln. Harga 12 Jt/ Nego Habis, Hub: Indra 0812 6409 9909

BM MOTOR

MOBIL

• Jual & Beli Mobil • Cash & Kredit • Baru & bekas

Dijual Espass ‘03 Warna Merah Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Dijual

Mobil Zebra ‘93 Kondisi siap cat/ jok baru/ BK panjang, kondisi jalan Harga 21 Juta Nego hubungi: Jimmy 0811632813, 77863990

Warna Biru, BK Asli Medan 1 nama, AC Double Blower, Tape, km 105 rb

Hub: DIFA MOBIL, 061-77698741-08126378815

Dijual

SEMPABUMobil GANORI Jual - Beli Mobil Cash- Kredit

Zebra Pick Up ‘93 Kondisi Siap Cat / Jok Baru, BK Panjang, Kondisi Jalan, Harga 23 Jt / Nego Hub: Jimmy, 0811 632 813 , 77863990

Toyota Kijang Super G 1.8 Long ‘96

Warna Silver, BK Medan, Jok Kulit, AC, Tape, Alarm, mulus.

Hub: DIFA MOBIL, 061-77698741-08126378815

Dijual

Dijual

Toyota Corolla SE Saloon Warna MErah Maron, AC, TP, VR 15”, BK Medan Asli Hub: 0852 6270 5678

Hyundai Verna ‘02

Warna Biru , Jok Kulit baru, AC, P. Windows, Tape, Power, Alarm, BK Asli Medan Hub: DIFA MOBIL, 061-77698741-08126378815

Timor DOHC ‘97 Warna Hijau

Dijual

Daihatsu Espass ZLI ‘05 Warna Biru

Hubungi : CV. SUKA MOBIL 061-68784998, 08116203698

Hubungi : CV. SUKA MOBIL 061-68784998, 08116203698

Dijual

Dijual

Escudo semi Nomade ‘96/’97 Toyota Soluna SLI ‘00 Warna Biru

Hubungi : CV. SUKA MOBIL 061-68784998, 08116203698

Warna Hijau tua, Accesories Lkp, Full Sound, 2 Power Venom & Kenwood, Subwofer 2 Kenwood, Amply, TV, remote, alarm, peredam, AC, VR, 1 nama BPKB, BK 3 angka, pjk pjg, audio sgt mewah, Harga 100 Jt/ nego (bagi yg Hoby) Hub: 081361777122, 087868832142


MINGGU 4 April 2010

POSMETRO MEDAN

RADEN HARYO DAMAR

PUSAT PENGOBATAN & SPESIALIS ALAT VITAL M. YANA PERMANA SIDIK & HM. YUSUF ASLI PEWARIS TUNGGAL & TERBESAR BANTEN

& GUS YUSS

BPOM RI PO. 07.05.01163751.B166/DSP.5.08.2009

TERAPI ALAT VITAL SUPER SPEKTAKULER

Semua Program Hasil Resensi Ilmu Ghaib & Rujukan Kitab Kuning, Tidak Menyimpang dari Kitabullah, Assunnah, Ijmak,Kiyas, Bebas Agama, Arts Magic & Religi, Aman & Permanen. * PELET KAMASUTRA + MIMPI TEMBUS (Hajar Do’i Biar Klimpungan) Pancarkan Daya Pekasih Bikin Do’i Tunduk Takluk Bisa Difungsikan untuk pelaris/memikat relasi/hubungan dengan atasan/merupakan senjata yang menggiriskan untuk menaklukkan lawan jenis yang angkuh (BONUS BUKA AURA). * SUSUK & MUSTIKA (KEMILAU) “SUPER STAR” & “SANG DIVA” & CHARGER Kajian dari Khazanah ilmu susuk terbaik dari yang baik & sudah diuji bertahun ( di Medan & Surabaya) Terbukti bikin cantik & bagus rupa (tak perlu operasi plastik) Aura Kemilau (silahkan poto aura) Pesona diri & Suara Karisma & bertaburan bintang, suksek bisnis,karir,jodoh,sial hilang & manfaat lain yang tak tertulis. Bahkan bisa pengaruhi wajah hingga mirip idolamu. Lihat RHD Mirip siapa? (+ Mantra Gendam + air aura keramat) Saksikan * MUSTIKA MACAN LANGIT (+ Body Guard Goib) Iklan Deli TV Tak cuma sensasi tapi sudah diuji ribuan orang dalam & Luar negeri Tiap hari Senin jam 08.00 s/d Transfer Energi Ilahiah & Sufistik/Metafisika, Theormodinamika. 09.00 pagi Fungsi : Kebal Sajam/Tembak/Kepruk/Anti Silet/Cukur (tes pakai silet Goal Tajam) Diwajibkan mengasah parang dari per - mobil Setajam - tajamnya untuk dites. Bacok,Sayat,Gorok,Tusuk,Bahkan Bisa tes sendiri sepuasnya. Anti Api (tes) Tes Kepruk,bela diri Ghaib. Keselamatan jiwa raga, Pukulan Sakti, menghalau musuh dll. Sudah dibuktikan oleh para Kyai & Ribuan Banser NU (dalam gemblengan masal) + Terbaik & Telah teruji Dilaga. * Susuk / Mustika Junjung Derajat : Pegangan khusus untuk anda yang sudah menemukan jati diri (Boss, kontraktor, pejabat) Melayani: Goyang Lidah/Mus Kyai Kanjeng (Pelaris Bisnis Dasyat) Pengobatan Medis / Non Medis/ Pemindahan Penyakit ke Telur/Ayam / Kambing. Siap Diundang Ceramah Agama (Nada & Dakwah) & Gembleng Masal.

Langsung besar dan panjang di tempat (Dalam tempo wkt 20 menit). Dijamin No Suntik silikon, terapi asli tradisional bebas pantangan usia, ras & agama. Hasil permanen seumur hidup dijamin tanpa efek samping & bergaransi pengobatan cukup 1 x keahliannya luar biasa sudah teruji & terbukti secara spritual & faktual!!

ANDA PUNYA MASALAH SEKITAR ALAT VITAL DISINI JAWABANNYA Tambah Besar 3, 4, 4.5 s/d 5.5 • Panjang 15, 16, 17 s/d 20 • Keras, kuat, tahan lama • Loyo & kurang gairah sex • Ejakulasi dini/ lemah syahwat • Impotensi, mani encer • Tidak punya keturunan • Spilis, diabetes • Kencing Nanah Pastikan niat anda diterapinya aman tanpa efek samping

Juga melayani : Pil/Wil perselingkuhan asmara suami/istri, pacar hianat, lesbi, pasang susuk janur kuning ratu pengantin (1116). Susuk Ki Arjuna Si Raja membangkitkan (7 unsur dlm tubuh) Jodoh, tender, peloby/ pekerja malam, dll.

“ Buka tiap hari jam 08.00 s/d 21.00 WIB ” Alamat : Jl. T. Amir Hamzah No. 30 Binjai ± 100 m Tugu Pahlawan. Hubungi Hp : 0813 6170 0088/0812 6077 2009

KLINIK METAFISIKA Jl. Medan Tjg. Morawa KM 11,5, Depan Hotel Halay INN Medan HP. 0815 3120 669, 061- 7760 8103

AHLI PIJA PIJATT URA URATT TRADISIONAL BU TIWI

TERAPI KEJANTANAN ALAT VITAL PRIA & WANITA PALING SPEKTAKULER DARI PELABUHAN RATU PANTAI SELATAN DITANGANI LANGSUNG : BPK. UMAR & UST.A.AZIS

Cara efefktif paling jitu menurut faal dan jalur anatomi tubuh. Menyembuhkan : masuk angin, capek2, pegal2,ngilu2, lesu tak bergairah, sakit. kepala, sinusitis,batuk panjang, flu menahun radang teggorokan, darah mengental, cairan mengental - Angin duduk : penyempitan pembuluh jantung, sesak nafas, sulit tidur, darah kental, beku cairan mengental, pengerasan otak (sumsum tlg belakang) nyeri punggung, nyeri tulang. - Darah tinggi/rendah, kolestrol, pengapuran, stress, stroke, (trigliserida) sakit bahu, sakit pundak, kebas2, leher kaku, tangan sulit diangkat, tapak kaki pedas (berat) jari2 kaku, tulang selangka sakit, lemas. - Asam urat, reumatik, encok, diabetes,(gula) nyeri sendi, bengkak2, tulang pinggul Sakit Angin duduk, bersila, jongkok, sakit untuk berdiri nyeri lutut, berjalan tak tahan, paha sakit - Gangguan ginjal: Pinggang rasa mau patah bangun tidur (urat saraf terjepit) terkilir, otot 2 kaku, kuping berdengung. - Turun perut, maag lambung, sulit BAB, Ambeien perut kembung, kepala pusing , hernia, sering buang air kecil. Dilengkapi minyak rempah beramuan asli karo dll. Untuk pria/ wanita, lansia, anak2, dewasa. KHUSUS KEJANTANAN PRIA : impoten, sulit ereksi, cepat loyo, lemah syahwat (ED), gampang ereksi mati tiba2, keras tidak sempurna, pegal ngilu dan berdenyut di alat vital, gairah sex menurun, porstat, buang air kecil tersendat2 (tidak lancar) ingin kokoh, kuat, keras, besar alami (tidak kendor) dijamin Berhasil tidak kecewa, untuk kebahagiaan suami istri, dilengkapi minyak rempah beramuan asli karo KHUSUS WANITA : monopouse, firigit (tidak gairah) miss V becek, organ sex longgar, berlendir, keputihan, bau tdk sedap, ingin berdenyut, berpasir, cengkram, hancurkan lemak alami, totok dan buka aura agar cantik alami, berseri, awet muda, dilengkapi lulur rempah tradisional dan penguapan asap rempah untuk missV. Jl. Bayangkara no.390 Medan dkt SPN Sampali

HP:

Harga net Rp. 180.000,-

Dunia mengakui oil pembesar yang paling hebat adalah dari AFRIKA SELATAN yaitu BLACK MAMBA OIL. Kami tidak menjual obat kuat/ alat pembesar produk lain, karena kami hanya menjual produk BLACK MAMBA terlaris dan terbaik tanpa efek samping. Hampir semua alat vital orang NEGRO, panjang, besar, kuat, keras dan tahan lama. Siap dibuktikan! Anda korban/ kecewa obat pembesar produk lain? Buktikan kehebatan BLACK MAMBA. Dijamin tidak kecewa untuk yang kedua kalinya dan istri anda akan kagum yang luar biasa karena besarnya. On-line: 08.00-20.00 WIB

ANTAR ,TAMBAH BIAYA TRANSPORT

African’s Oil & Capsules

HUB:

Melayani Berbagai Macam Keluhan Antara Lain: * Khusus Pria, Tambah Ukuran - Panjang 13-16-19-22cm diameter : 3,5,4-4,5,5-5,5-6cm - Kuat dan Tahan Lama - Ejakulasi dini, sphilis/rajasinga mani encer - Lemah Syahwat, diabetes Impoten, dll

Alamat: Jl. SM. Raja Sp. Limun, Jl. Selamat lurus No.2 S 061-68787695, 0812 6379 9049, 0812 7863 6428

Hanya ada Satu - satunya Black Mamba yang ada di Medan

Rek. Mandiri : 1050009956669

* Khusus Wanita - Memperbesar Payudara - Terapi Perawan/virgin - Kista, Lemah Kandungan - Kanker Payudara - Ingin Mempunyai keturunan Dll

Buka setiap hari

* Ingin Cepat dapat jodoh, pengasihandisegani jam 08.00-21.00 atasan, menyatukan dan memisahkan PIL/WIL Mahar Rp.500.000 puter giling, juga melayani pasang susuk dll bergaransi, alami tanpa efek samping, langsung reaksi ditempat, hasil Izin : B-70/DSP.5/II/2007 permanen untuk seumur hidup.

Alamat Praktek : Jl. SM. Raja Depan Taman Makam Pahlawan No.130 B Medan Samping Showroom Toyota Auto 2000 Belakang Tambal Ban

HP. 0813 8042 6253

081263515003

Mengatasi keluhan pria dengan BLACK MAMBA OIL langsung terbukti seketika besar, panjang , kuat, keras, kencang dan tahan lama. 100% paten, permanent dapat dibuktikan langsung di tempat. Cukup 1 botol untuk selamanya.

URAT SYAHWAT 1. Impoten, L. Syahwat (gula), kurang gairah/ keras, tambah besar & panjang 2-3-5 cm, ejakulasi dini, mani encer, telor turun, mandul, terbukti di tempat, permanen, aman, tanpa efek samping mahar 100 ribu 2. Urat terjepit, otot persendian kaku, mati rasa, angin duduk, mahar 50 rb 3. Pagar badan, pelet, penglaris mahar 50 rb 4. Pengobatan ghaib (ruqyah),membuang hasad dengki manusia, ilmu2 hitam, dll 100 rb 5. Buka aura, kewibawaan, penunduk, awet muda,murah jodoh/kerja, buang sial, dgn mandi minyak panas, air raksa, samber lilin mahar 200 rb 6. “Ramuan” keperawanan agar rapat, legit, wangi, kesat, keputihan, 300 rb 7. Mengobati jerawat batu mahar 200 rb 8. Patah tulang, terkena guna, santet, narkoba, stress, siplis (raja singa), medis/non medis, lainnya. 9. Memisahkan WIL/PIL 10. Buka pintu ghaib, pandangan ghaib, silat ghaib, komunikasi dengan seluruh ghaib.

PA’ YONG SIKUMBANG

Jl. Pertahanan / Patumbak Taman Jasmin Mas No. A 4 Amplas, Hp: 0812 604 1050 Flexy 061-7769 8634 Izin. Kejatisu : B-23/ DSP 5/ 001/2008 1. Kerahasiaan anda saya jamin aman & siap memberikan yang terbaik untuk anda. Anda punya masalah dan keinginan telepon saja saya untuk konsultasi seperti : Ruwatan dan melihat, mendeteksi apa yang terjadi pada diri & kehidupan anda sehingga sial, kurang beruntung, Sulit jodoh, terkuncilkan dll. Bonus : Minyak pelet pemikat & pengasih yang sangat cepat bereaksi memikat & menundukkan yang dituju baik lawan jenis & siapa saja + buka aura. Pelarisan dagangan besar dan kecil. Membekap istri simpanan agar semua keinginan dituruti suami disayang & dimanja. Pengisisan kosmetik, penyatuan pasangan & pemisahan, pelet vagina, matikan pistol suami. Menundukan bos/atasan agar sayang & tidak pelit & percaya cocok untuk pembantu, pegawai dll. Melihat masa depan. Jual beli rumah, mobil, dll. Pertahankan jabatan, menghadapin ujian. Pacar hianat, kasar dll. Pengobatan medis & non medis. Gurah hidung dll. Semuanya bergaransi dan siap dibuktikan kekuatannya. 2. Susuk cahaya aura 7 Pancar.Tampil cantik dan tampan bersinar ditempat yang terang berkilau ditempat yang gelap menambah daya pikat & pesona terhadap lawan jenis dan siapa saja yang memandang & awet muda. Aman dunia akhirat. Kekuatannya dapat mempengaruhi yang dituju (dapat dites kekuatannya). Cocok untuk istri simpanan, anak malam (psk), penyanyi, marketing, model,peragawati,artis,pelamar pekerjaan (interview). Pimpinan sidang apa saja sekaligus benteng diri tidak ada pantangan, tidak mempersulit kematian. 3. Bait 1 Malam (Pengisian habis-habisan) menjadi paranormal/ guru dan thabib cara mengajar teori langsung praktek 4. Tenaga dalam inti cakra hikmah sejati : benteng diri dari gangguan ghaib dan nyata. Bisa mengobati diri sendiri dan orang lain. Mempunyai pukulan penderas (dites), meraga sukma (dites). Keselamatan, pelet & pengasih, pengawal gaib. Kebal hikmah (dites). Sedot pusaka/harta karun. Cara menangani orang ke masukan. Menjatuhkan tanpa menyentuh (dites). Mendeteksi dan banyak lagi. Ilmu Hikmah diperoleh dari ustad Azis Hidayatullah sang Pemburu Hantu

HUB: RADEN SUROPATI 0813.6100.2240 JLN. PANCING LEWAT PAJAK SORE,MEDAN PRAKTEK MENETAP

PENGOBATAN

TERAPI KEJANTANAN ALAT VITAL

TRADISIONAL OMPUNG TANGGO SIALLAGAN SPESIALIS PENYAKIT KULIT DAN GATAL - GATAL

HJ. MAK. EROT Ditangani Langsung oleh A. SAHRUDIN

Dapat mengobati segala jenis penyakit kulit dan gatal - gatal, berat ringan, lama dan baru. sudah bosan berobat kemana - mana, “ dan sudah pernah sembuh tetapi kambuh lagi”. Kami dapat mengobati sampai tuntas dengan Ramuan Tradisional. Termasuk Kutu Air, Panu, Kurap gajah, Eksim, Pitiligo,jerawat termasuk Keputihan bagi wanita dan Penyakit kulit lainnya.

Izin No : B-204/DSP.5/08/2007 Mengobati khusus alat vital komplit bagi pria dan wanita asli alami, paten seumur hidup, bebas usia dan agama. Khusus Pria : Khusus Wanita : - Panjang, besar, perkasa. - Ingin punya keturunan - Kuat, keras, tahan lama. - Payudara jadi montok dan indah AR M AH - Lemah Syahwat .600.000,- - Ingin cepat dapat jodoh Rp - Mani Encer - Buka Aura, pengasihan - Impoten, Kencing batu, dll - penglaris, pasang susuk, dll Bentuk ukuran: Panjang: 14 cm, 16 cm, 17 cm, 20 cm Buka tiap hari: Jam 08.00 s/d 21.00 WIB Diameter: 3 cm, 3,5 cm, 4 cm

NYATA AMPUHNYA, NYATA SEMBUHNYA Dijamin Halal dan Mujarab, setelah sembuh tidak akan kambuh lagi. BUKAN JANJI TAPI BUKTI Izin Dinkes No: 448/2611/III/2008 Izin Kejaksaan No: B-50/DSP.5/03/2008 Alamat Rumah/Praktek : Jl. Putri Hijau No.46 H Medan (SampingKantorLurahKesawan)BukaPraktekJam04.00 Sore s/d 09.00 Malam Setiap Hari. HP. 0812 6367 676

Alamat Praktek: Jl. SM. Raja Gg. Purnama No.1 (depan bengkel MICKRO SEHAT) ± 50 M dari Makam Pahlawan arah Simpang Limun. HP : 0813 9752 5049

POSMETRO MEDAN KORAN NOMOR 1 TERBESAR JUMLAH PEMBACANYA DI MEDAN Hasil Survey LP3ES & SPS Pusat Tahun 2009 PONDOK NUR AGUNG AKTE NOTARIS NO.07/NA/2009

Insya ALLAH dapat membantu anda yang sudah kemana-mana tetapi belum berhasil dan merasa puas ??? I. PENGOBATAN MEDIS & NON MEDIS II. Buka Aura, Pelaris Usaha, Karier, Kewibawaan, Ritual Tarik Rezeki, Semar Mesem, Kekebalan, Pasang Susuk, Pesugihan, Jin Pendamping, Istri Cantik, Suami Kaya, Gendam dll. III. PROGRAM SERTIFIKASI PENGHUSADA (SPH) : Insya ALLAH Anda akan memiliki kesehatan tubuh, Kelancaran Usaha, Terbuka Aura Positif, Terawangan, Batin dapat memanggil Kodam Jin & Berkomunikasi, Memiliki Berbagai Macam Kesaktian, Dapat Melakukan Pengobatan Medis & Non Medis, Menguasai berbagai Macam Ilmu Supranatural, Merasakan Kedekatan Diri Kepada Sang Pencipta dan Ketenangan Batin (Berijazah Sertifikat) IV. Program Master Penghusada (MPH) : Anda akan menguasai berbagai ilmu supranatural & kesaktian, Batin dapat Menembus Alam Siluman, Ruhania, Malakut, Kembaran Diri Serta Berkomunikasi, Menguasai Seluruh Program I s/ d III sert dapat menurunkannya secara Profesional kepada orang lain, Merasukan Kedekatan diri kepada Sang Pencipta (Berijazah Sertifikat) HUB : PAK RANDI (TOKOH SPRITUALIS YANG BERPENGALAMAN_ Telah Menerima Piagam & Piala Penghargaan CITRA PENGOBATAN ALTERNATIF Serta SPRITUALIS INDONESIA AWARD 2007 Alamat : Perumahan CENDANA ASRI BLOKAC/06 Kampung Undian (Masuk dari simpang timbangan kayu besar, jl.Limau Manis Tg. Morawa )

77789233, 081361188416, 081388110705 (No SMS)

7 HARI MENUNTASKAN

IMPOTENSI & EJAKULASI DINI CUKUP 1 X PENGOBATAN A SELAMANYA UNTUK SELAMANY

Tanpa mantra, urut , suntik, vakum, obat oles & efek samping

BIRVA TRADISIONAL

Solusi yang tepat menuntaskan masalah seksual Pria & wanita baik diusia tua dan muda MENUNTASKAN MASALAH SEKSUAL WANITA SEPERTI KEPUTIHAN, PEKTAI, GURAH VAGINA, SUBUR KANDUNGAN KAMI MEMBERI BUKTI UNTUK ANDA Hub : Jl. Krakatau Simp. Jl. Sido Rukun No.3A Medan,

HP: 0813 6169 1789.

Buka Setiap hari : 08.00 s/d .19 00 WIB Hari libur Tetap Buka: 08.00 s/d 15.00 WIB. Izin Dinkes: 06/YANKES/BATRA/III/445/2003.

KI AGENG TAPAK JALAK

( Bukan Memberi Janji Tapi Memberi bukti ) Insya ALLAH dapat membatu anda dalam hal

A. PENGOBATAN MEDIS DAN NON MEDIS : Kebas2, Asam Urat, Struk, Darah Tinggi, Diabetes, Liver, Batu Ginjal, Asma, TBC, Kanker, Kelenjar Getah Bening, Ejakulasi Dini, Ingin Punya Keturunan, Stress, Gila, Kena Narkoba, Anak Bandel, Terkena Racun, Kena Guna2, Santet, Teluh dsb ( Mahar Ikhlas) B. Tasbih Alkaromah, Batu Merah Delima, Alqur'an Stambul, Rompi RijalulGoib, Sabuk Kekuatan, Keris Semar Mesem, Tali Pinggang Karomah, Buka Aura, Pelarisan Usaha, Susuk Kantil, Susuk Rembulan, Sususk Samber Lilin, Masalah Asmara, Tender, Jabatan, Pagar Goib, Kekebalan, Kapsul Kecantikan, Terawangan, Rogo Sukmo, Siref, Sedulur Papat dll Problem. Alamat : PERUMAHAN GRIYA MORA INDAH BLOK C / 105 Tj. MORAWA

TELP : ( 061 ) 69627396, 0813 6116 4240 (NO SMS) Praktek : Jam 13.00 - 21.00 WIB NB : Iklan Tidak Naik Tetap Buka RIBUAN ORANG TELAH TERBUKTI

PUSANGGRAHAN KUMALA TUNGGAL Konsultasi Supranatural & Pengobatan Alternatif Ditangani Langsung Oleh Paranormal Dari Pati Radhien Mas Ahmadi Suwinoto Broto Izin Kezati Nomor : 13/71 DSP.5/05/2007 Website.www.radhienmasahmadi.com Email : radhienmasahmadi sb@yahoo.co.id

1. PEMASANGAN SUSUK PANCA WARNA + BEDAH AURA Mengoptimalkan pancaran aura tubuh, pengasih, pemanis, pemikat, penglaris, awet muda, kerezekian, kewibawaan, kharisma, pesona diri, daya tarik luar dalam baik tatapan mata, suara, kinerja, dan penampilan fisik yang sempurna juga berfungsi untuk pagar badan. 2. RUWATAN AGUNG KUMALA TUNGGAL Adalah ritual turun temurun dari leluhur yang berfungsi untuk membersihkan hawa-hawa negative, sial, sengkolo, sulit jodoh, sulit punya keturunan, karier dan usaha yang macet, serta sakit yang tak kunjung sembuh. Ruwatan ini merupakan warisan leluhur yang tidak di titis restukan pada banyak praktisi spiritual, syukur pada illahi, kamilah pewaris ilmu ruwatan agung kumala tunggal. 3. HAIKAL KUMALA TUNGGAL Penglarisan dan penderas rezeki, juga pagar usaha, menarik rezeki dan segala penjuru, azimat yang sangat ampuh cocok untuk semua jenis perniagaan, dirumah, dipasar, sales dan dimanapun anda berdagang. 4. MUSTIKA JAMRUD KAROMAH Memiliki energi pengasih tingkat tinggi, kewibawaan, kharisma, benteng diri, penunjang karier, hoky dalam berbisnis, relasi kerja, pengaruhi lawan bicara bahkan urusan asrama. 5. AZIMAT KERAMAT LULANG KEBO LAWU + MINYAK KEMBANG LAWU Dikeramatkan ratusan tahun, memiliki kekuatan magis yang luar biasa dan energi metafisika tingkat tinggi, asli dari alam ghoib gunung lawu, sangat ampuh untuk meningkatkan hoky, merontokan sial diri, menunjang karier, keharmonisan dalam asmara, memunculkan pesona aura, menundukan dalam negoisasi, membuka peluang bisnis besar, kharisma, sangat cocok untuk pebisnis, eksekutif, pejabat, bos, pimpinan dan lain sebagainya. 6. PENGOBATAN PENYAKIT MEDIS NON MEDIS Dengan metode kebathinan, terapi telur, terapi pijat, terapi tenaga dalam, pemindahan penyakit ke kambing khusus penyakit dalam, ramuan-ramuan tradisional dan herbal.

Alamat praktek Jl. Medan - Tg. Morawa Km. 13,5 Gg. Lokasi Komplek Perumahan 75 0399 Tamora Indah II Blok B No. 38. HP HP.. 0813 75 7575 0399.


Yakin Inggris ke Final Saat baru mulai menangani timnas Inggris, Fabio Capello menemukan sekumpulan pemain yang tampak lesu. Waktu bergulir, Capello pun kini yakin Tiga Singa sudah oke lagi dan mampu ke final Piala Dunia 2010. Capello mulai menjadi manajer Inggris sedari tahun 2008 lalu menggantikan Steve McClaren. Saking percayanya Capello dengan kemampuan Inggris saat ini, dia pun berani mencanangkan bidikan tinggi di Afrika Selatan musim panas ini. (int)

Skuad Belanda Dirampingkan Pelatih tim nasional Bert van Marwijk Jumat merampingkan tim sementaranya ke Piala Dunia 2010 Afrika Selatan dari 30 menjadi 27 pemain dengan dikeluarkannya Otman Bakkal (PSV Eindhoven), Wout Brama (FC Twente) serta David Mendes da Silva (AZ Alkmaar). Tim ini akan ambil bagian dalam suatu kamp pelatihan di Austria pekan depan kendati Wesley Sneijder, Mark van Bommel dan Arjen Robben, yang akan terlibat dalam pertandingan final Liga Champions pada 22 Mei mendatang antara Bayern Munich melawan Inter Milan, bergabung dengan tim mereka belakangan. (int)

Capello Jelaskan Pencopotan Terry Manajer Fabio Capello akhirnya buka suara mengenai pemecatan John Terry sebagai kapten tim nasional Inggris setelah kasus perselingkuhannya dengan teman dekat Wayne Bridge terbongkar. “Saya tak punya pilihan lain. Dia tahu, bagi saya nilai-nilai adalah segalanya. Saat itu, saya berada di Italia dan mendapat telepon tentang apa yang terjadi. Semua disampaikan kepada saya,” kata Capello. (int)

Rooney Punya Senyum Terburuk Piala Dunia 2010 belum juga dimulai, namun Wayne Rooney sudah mendapatkan kabar buruk. Menurut survei striker tim nasional Inggris tersebut memiliki senyuman terburuk. Sebagaimana yang dilansir SunSport, dari survei yang dilakukan National Smile Month, Rooney berada di peringkat teratas sebagai pemain dengan senyum terburuk yang akan berlaga di Piala Dunia 2010. Senyum pemain Manchester United ini bahkan lebih buruk daripada senyuman striker AC Milan Ronaldinho. (int)

Korut Didukung 1.000 Fans Cina Tak banyak warga Korea Utara yang mampu mendukung secara langsung negaranya di Afrika Selatan, sehingga akhirnya fans dari Cina yang diundang untuk mendukung kiprah tim kuda hitam itu. Menurut kantor berita Xinhua, kantor Komite Olahraga Korea Utara di Beijing membagikan

1.000 tiket bagi penduduk RRC yang bersedia mendukung Korea Utara. Fans Cina itu akan menyaksikan laga antara negeri tetangganya itu dengan Brasil dan Portugal. (int)

Dendam Evra pada Inggris

Francesco Totti akan dimainkan melawan Chievo

Usai gagal meraih gelar Liga Inggris, Patrice Evra menginginkan trofi Piala Dunia 2010 sebagai obat kekecewaannya. Bek sayap timnas Prancis ini mau Inggris menjadi lawannya di final nanti. Evra yang memperkuat Manchester United sepertinya sangat kecewa dengan kegagalan klubnya mempertahankan gelar juara. Praktis dengan kegagalan ini, Setan Merah tidak mengantongi satu pun gelar bergengsi kendati telah menjuarai Piala Carling. (int)

PM/JPNN

Becks ‘Jimat’ Inggris Ada baiknya Fabio Capello membawa David Beckham ke Afrika Selatan nanti meskipun ia tak bisa bermain. Sebab Beckham diyakini bisa membawa keberuntungan untuk The Three Lions jadi juara Piala Dunia. Status Becks nantinya jika jadi diterbangkan bersama Steven Gerrard dkk, jalan Inggris menuju trofi Piala Dunia keduanya akan semakin mudah karena faktor keberadaan Becks di skuad Tiga Singa. “Beckham bisa jadi perwakilan yang baik untuk negaranya (Inggris). Aku rasa kalau Beckham ada di Afrika Selatan, Inggris punya kesempatan untuk jadi juara Piala Dunia,” cetus legenda Liverpool, Ian Rush. (int)

Korea Utara yang Misterius Timnas Korea Utara tampaknya pantas jika diberi label sebagai tim yang misterius di Piala Dunia 2010. Sebab, tim yang dijuluki Chollima ini jarang sekali tampil di depan pers. Korut akhirnya muncul di depan publik dengan mengadakan konferensi pers kecil di daerah terpencil di Swiss untuk mempersiapkan laga ujicoba versus Paraguay akhir pekan ini. Namun, konferensi pers tersebut tidak berjalan seperti yang diperkirakan. Pelatih Korut, Kim Jong-Hun tidak bicara banyak dalam wawancara yang berlangsung sekitar 12 menit itu. (int)

Ian Rush Puji Anak-anak Indonesia Timnas Indonesia boleh saja kering prestasi selama dua dekade terakhir. Namun hal itu tak mengurangi minat legenda Liverpool, Ian Rush, untuk memuji kualitas para pesepakbola cilik Tanah Air ini. Rush sedang dalam kunjungan ke Jakarta dari 14 hingga 17 Mei ini memang menyempatkan dirinya untuk jadi memberikan coaching clinic kepada klub sepakbola anak-anak binaan Kedubes Inggris yang dilaksanakan di lapangan GOR Sumantri Brojonegoro, Sabtu (15/5) pagi WIB. (int)

PSMS kini berlaga di Divisi Utama Liga Indonesia karena tergusur dari Liga Super. Sesuai janjinya, Ketua Umum PSMS Medan Drs H Dzulmi Eldin MSi akan mengangkat kembali prestasi klub berjuluk ‘Ayam Kinantan’ itu. Mari dukung dengan mengirimkan pesan ke nomor

081396006871 087748467527 : PSMS ayo bekerja keras latihan n bertanding.. 081263756821 : Mejuah-juah PSMS, kamu pasti bisa kalahkan dan rap-rap lawanmu. 081990615892 : Belilah pelatih luar negeri agar bisa ke ISL kembali. Trims 085658534805 : Sekarang mungkin pemain kurang maksimal aja latihannya. Ayo main pemain PSMS, udah terlalu banyak yang meremehkan kemampuan kalian. 081397900760 : PSMS tunjukkanlah keberanianmu. Jadikanlah klubmu

HALAMAN 14

MINGGU, 16 MEI 2010

seperti julukanmu. Ayam Kinantan yang slalu bs mengalahkan lawannya. 081265471944 : Selamat untuk PSMS lepas dari degradasi. Dari D Ginting, Biru-biru 087869004833 : Kalah lagi, kapan sih menangnya. Bilangnya mau masuk ISL tahun depan, di Divisi Utamapun hancur-hancuran. 085296923668 : Ayo PSMS kapan mau ikut Piala Dunia antar Klub. By KAMPAK Ringgo. 081316088833 : Benahi manajemen PSMS dan orbitkan pemain lokal.

KONSULTASI SEKS METRO Diasuh : AA’ Ks. Gunawan (Pakar Pengobatan Alat Vital Pria) Ketik : POS(spasi)TGP(pertanyaan) Kirim ke 7669 (maks. 160 karakter) Hotline : 081534431998 (no sms)

Alat Vital tak Keras

Siena

vs

Chievo

vs

AS Roma

Totti dan Pizarro Siap Tampil ROMA Striker Roma Francesco Totti dan gelandang David Pizarro dikabarkan sudah berlatih secara penuh dan siap tampil lawan Chievo di laga pamungkas Serie A Itali, malam ini (16/5). Dilansir Il Corriere dello Sport, Totti dan Pizarro sudah berlatih dengan sangat bagus dalam sesi latihan sejak pagi hari. Kehadiran

mereka di dalam skuad Claudio Ranieri sangat dibutuhkan. Roma masih memiliki peluang untuk meraih scudetto jika mampu mengalahkan tuan rumah Chievo, sembari berharap Inter akan kalah saat lawan Siena. Saat ini, posisi Roma hanya terpisahkan dua angka dari Inter. Selain Totti dan Pizarro, striker Mirko Vucinic juga kemungkinan

akan tampil setelah pulih dari cedera ringan awal pekan ini. Meski mendapat kabar bagus, Ranieri juga terpaksa tak bisa menurunkan John Arne Riise karena sedang menjalani hukuman larangan bertanding. Marco Casetti akan menggantikan dengan mengisi pos bek di kiri, sementara Marco Motta di kanan. Julio Baptista juga tidak nongol di sesi latihan. (int)

Zanetti akan melampiaskan sakit hatinya membawa Inter juara Liga Italia.

Inter Milan

Pelampiasan Sakit Hati MILAN Mungkin hati Javier Zanetti dan Esteban Cambiasso kini tengah terluka akibat tak dipanggil ke skuad bayangan Argentina di Piala Dunia. Laga Inter Milan saat menjamu Siena bisa jadi arena pelampiasan yang tepat bagi keduanya. Keputusan mengejutkan dibuat oleh Maradona saat tak mengikutsertakan Zanetti dan Cambiasso yang terhitung pemain senior ke tim awal Abiceleste, yang akan dibawa ke Afrika Selatan. Kritikan terhadap Maradona pun berdatangan termasuk dari bos besar Zanetti dan Cambiasso di Inter Massimo Moratti. Namun Maradona bergeming dan tetap pada keputusannya.Baik Zanetti dan Cambiasso tak boleh terlalu lama terlarut dalam kekecewaan. Sebab keduanya telah ditunggu partai krusial di Artemio Franchi melawan tuan rumah Siena, Minggu (16/5) malam WIB. Krusial karena kemenangan atas Siena berarti perayaan scudetto ke18 sepanjang 102 tahun sejarah Nerazzurri. Dan hasil apapun dari laga Chievo Verona lawan AS Roma tak akan berpengaruh. Namun demikian bila Inter sedikit saja lengah, bisa saja Roma malah menyalip tim besutan Jose Mourinho itu di pekan terakhir. Tentu hal itu tak diinginkan oleh Inter dan juga para pendukungnya. Maka Moratti meminta seluruh pemain Biru Hitam khususnya Zanetti dan Cambiasso berkonsentrasi penuh untuk pertandingan melawan Siena itu. “Dalam pandanganku, titel Scudetto sama pentingnya dengan Piala Eropa (Liga Champions), di mana saat ini aku sangat fokus untuk laga kontra Siena,” ucap Moratti di Football Italia. “Jika kami memenangi Scudetto hari Minggu nanti, saya ingin Javier Zanetti mencetak gol penentu,” tukasnya. Sementara itu, ada kontroversi menjelang laga ini. Massimo Mezzaroma sempat dikabarkan akan membiarkan timnya dibantai Inter, agar Nerazzurri bisa meraih

gelar. Mezzarroma bereaksi keras, dan mengatakan; “Kami tahu seluruh dunia menyaksikan laga ini, dan kami akan bermain serius.” Anehnya, Siena berlatih terlalu santai untuk laga ini. Alberto Malesani akan menurunkan skuad terbaiknya dalam laga ini, tapi akan ada sejumlah perubahan. Defender Marco Malago menjadi starter, dan Claudio Terzi diistirahatkan. Simone Vergassola dan Albin Ekdal kembali ke tim inti. Mate Jajalo mendukung Emanuele Calaio di lini depan. Jose Mourinho juga akan menurunkan skuad terbaiknya, dengan Marco Materazzi dan Walter Samuel menjadi starter di lini belaknag. Dejan Stankovic duduk di bangku cadangan, sebagai

Prakiraan Pemain : Sienna (4-4-2) 31 Pegolo, 3 Del Grosso, 9 Malago, 13. Rossettini, 21 A. Rossi, 2 Genevier, 8 Vergassola, 10 Codrea, 23 Jarolim, 7 Reginaldo, 9 Paolucci Pelatih : Alberto Malesani Inter (4-3-1-2) 12 Julio Cesar, 13 Maicon, 25 Samuel, 6 Lucio, 26 Chivu, 4 Zanetti, 19 Cambiasso, 14 Vieira, 5 Stankovic, 9 Eto’o, 22 Milito Pelatih : Jose Mourinho

Benitez Gantikan Mourinho PM/JPNN

INTER Milan telah menghubungi Rafa Benitez setelah akhirnya menerima kenyataan kalau mereka akan kehilangan pelatih mereka sekarang, Jose Mourinho. Klub finalis Liga Champions itu mulai bersiap karena usaha Real Madrid untuk mendapatkan Mourinho makin gencar dan berharap kompensasi yang mereka dapatkan bisa mereka gunakan untuk menggaet Benitez yang situasinya tidak menentu di Liverpool. Benitez, yang juga diincar Juventus, berencana untuk menga-

PM/JPNN

pengganti Wesley Sneijder. Bagi Inter, giornata ke-38, akan menjadi momen penentuan scudetto kelima mereka dalam lima musim terakhir. Selain itu, bila berhasil mengalahkan Siena, akan ada dua trofi menghiasi lemari mereka. Namun, itu bukan yang terakhir. Inter masih berpeluang menyabet satu piala lagi, yaitu Liga Champions. (int)

dakan pembicaraan lebih lanjut tentang masa depannya di Anfield tengah spekulasi yang mengatakan akan terjadi pemutusan kerja sama di antara mereka seiring musim terburuk Liverpool sejak tahun 1999. Inter sebelumnya menepis semua berita yang mengabarkan mereka telah mendekati Benitez atau siapa pun yang lainnya. Tapi sekarang SunSport mengatakan ada pembicaraan antara Inter dan pelatih Spanyol itu.Mourinho juga sudah nampak begitu tertarik untuk melatih Real. (int)

PM/JPNN

Mourinho-Lampard Paket Madrid MADRID Kombinasi dari tradisi, kejayaan, kemakmuran dan taburan bintang lapangan hijau membuat Real Madrid begitu glamor. Itu pula yang diyakini membius Jose Mourinho. Dan Inter Milan sulit mempertahankannya. Pelatih asal Portugal itu sepertinya akan menggantikan Manuel Pellegrini setelah Inter bertarung dengan Bayern Muenchen di final Liga Champions pekan depan di Estadio Santiago Bernabeu, markas Real Madrid. Mourinho ingin melengkapi perjalanan kariernya yang gilang gemilang di Spanyol, setelah sukses di Inggris dan Italia. Mantan manajer Chelsea ini kemudian membidik Frank Lampard jika jadi menangani klub elite dari ibukota Spanyol tersebut. Mourinho ingin gelandang berusia 31 tahun itu sebagai poros Los Blancos untuk mengakhiri cerita buruk di Liga Champions, yang di enam musim terakhir tidak pernah bisa lolos lebih dari babak

SOSOK

Walter Gargano

Adu Teknik Oke, Main Keras juga Ayo!

Tanya : Ass AA Gunawan, saya pria 27 tahun dan telah menikah 2 tahun lalu. Entah kenapa, kini mendapatkan alat vital saya tak begitu keras. Mengapa bisa begitu pak AA ? Dan apa bisa disembuhkan? Mohon dijawab. 081395655*** Jawab : Boleh dibilang, usia Anda relatif muda untuk mengeluhkan hal itu. Tapi jangan khawatir, apa yang Anda keluhkan bukan menjadi masalah besar lagi. Banyak yang bisa Anda lakukan untuk mengembalikan keperkasaan seperti 2 tahun silam. Contohnya; giat berolahraga, tak mengkonsumsi alkohol dan lain sebagainya. Anda juga bisa melakukan terapi dengan ramuan tradisional. Silahkan datang untuk membuktikannya. (*) PM/INT

WALTER Gargano memimpikan Uruguay sampai ke final Piala Dunia 2010. Si pemain tengah pun siap mengeluarkan seluruh kemampuan tekniknya, plus tampil ngotot dan bahkan keras, untuk mewujudkannya. Uruguay dikenal punya tipe permainan intens dan keras. Demi merebut bola, tiap senti lapangan bisa dilahap. Kerja keras itu pun acap dibumbui tekel-tekel yang juga keras. Dengan gaya permainan La Celeste tersebut, para gelandang yang beroperasi di lini tengah yang krusial pun tak jarang lebih mengandalkan tenaga dan stamina. Namun, sedikit beda dengan Gargano.“Memang benar kalau aku

PM/JPNN

mungkin adalah pemain yang lebih mengandalkan teknik dibandingkan dengan tipe klasik gelandang tengah Uruguay. Aku suka membaca permainan dan membantu rekanrekanku mendapat bola dan membuka celah,” terang Gargano kepada situs FIFA. Meski begitu, pemain berusia 25 tahun yang membela klub Napoli tersebut bukannya tak bisa bermain ngotot. Gargano siap melakukannya demi mewujudkan impiannya membawa Uruguay ke final. “Jangan khawatir, jika aku harus main keras, aku takkan sungkan,” tegas dia. (int)

16 besar. Permintaan Mourinho didukung penampilan ciamik dan konsisten dari Lampard. Dua faktor yang membuat Sporting Director Madrid Jorge Valdano dan Presiden Florentino Perez mengangguk. Memboyong Lampard akan sangat sulit. Lampard bahagia di Stamford Bridge, dan di era Carlo Ancelotti, ia membuktikannya dengan koleksi 27 gol musim ini. Tapi di situlah tantangannya. Madrid punya trek rekor yang sulit dibendung jika sudah punya keinginan. Medio tahun lalu masih segar buktinya uang berbicara saat Madrid sukses memboyong sekaligus Cristiano Ronaldo dan Kaka. Liverpool juga tidak banyak berkutik ketika harus merelakan Xabi Alonso. Mourinho diharuskan mengeluarkan kata-kata manis jika ingin menyertakan Lampard dalam kepindahan dirinya ke Spanyol. Apalagi Lampard merasa risih karena harus membalas budi Roman Abramovich. (int)


Jaga Rekor

Namun tidak demikian dengan Valladolid yang menjadi lawannya di Stadion Nou Camp dinihari nanti (17/5), kemenangan tidak membuatnya otomatis selamat dari degradasi. Pasalnya, Racing Santander dan Tenerife — dua tim di bawahnya yang sama-sama mengoleksi 36 angka — berpotensi melemparnya dari peringkat 16. Javier Clemente mengatakan tidak ada yang tidak mungkin di sepakbola. Clemente relatif sukses mengeluarkan Valladolid dari degradasi, setelah hanya kalah sekali dari enam laga terakhir. Tapi kali ini Clemente harus bermain tanpa Alvaro Rubio, Sisi, Nivaldo, Carlos Lazaro danAsier Del Horno, yang mengalami cedera. Kabar baiknya adalah Alberto Marcos telah kembali. Sedangkan Borja Fernandez terkena hukuman. Melihat lawan yang dihadapi, di atas kertas Barcelona bakal merebut tiga angka. Dan secara otomatis memenangkan gelar ke-20 sepanjang sejarah klub Catalan tersebut. Plus, mengubur ambisi Real untuk kembali mengangkat trofi Liga Primera yang terakhir kali direbut pada era Fabio Capello musim 2006/2007. Meski tinggal selangkah, perjuangan El Barca—julukan

Barcelona—diprediksi tidak mudah. Sebab, Valladolid juga bakal all out demi menghindari jeratan degradasi. “Ini adalah perjalanan liga yang paling menantang, sejauh yang saya ingat. Paling menguras energi dan pikiran,” ucap Carles Puyol, kapten Barca, seperti dikutip AFP. Setelah kemenangan atas Sevilla pekan lalu, kubu Barcelona memang sudah yakin benar bakal merebut gelar. Nah, itulah yang diwaspadai pelatih Josep Guardiola. Dia mengingatkan bahwa performa Valladolid semakin membaik sejak ditangani mantan pelatih timnas Spanyol, Javier Clemente. Ya, Clemente mengambil alih kepemimpinan Valladolid dari Onesimo Sanchez pada 6 April lalu. Sejak itu, klub berjuluk Pucela tersebut langsung tancap gas dan merebut sejumlah hasil mengesankan. Salah satunya adalah mengalahkan klub papan atas Sevilla 2-1 pada pekan ke-32 (13/ 4). Dalam tujuh laga bersama Clemente, mereka hanya sekali kalah dari, yakni Atletico Madrid. Faktor bahwa Clemente pernah memoles Guardiola di timnas Spanyol juga menjadi poin perhatian pelatih 39 tahun tersebut. (jpnn/int)

Banding Ditolak, Xavi Absen karena telah mengoleksi lima kartu kuning. Barca rupanya punya perhitungan lain terhadap keputusan yang dikeluarkan Komite Kompetisi La Liga. Azulgrana mengajukan banding dan pada akhirnya klub raksasa Katalan itu memasukkan proposal ke Komite Disiplin untuk Olahraga Spanyol (CEDD). Barcelona meminta suspensi itu ditunda hingga musim depan sehingga Xavi bisa berlaga lawan Valladolid di Nou Camp. Tetapi, proposal banding itu ditolak Jumat (14/5) kemarin.Artinya pelatih Pep Guardiola harus memikirkan taktik dan strategi baru tanpa Xavi di dalamnya menghadapi tim asuhan Javier Clemente yang sedang

Tertarik ke Barca... “Barca? Pada saat ini, Madrid adalah rumah saya dan klub saya adalah Real Madrid. Tetapi saya tidak akan mengatakan tidak pernah. Saya tidak tahu apa yang akan terjadi di masa depan, Anda tidak akan pernah tahu. Walaupun saya ingin pensiun di Madrid,” kata Ronaldo. (int)

berjuang menghindari degradasi. Tanpa Xavi, Barcelona akan kehilangan pijakan di sektor tengah. Guardiola pantas waswas terutama lantaran Andres Iniesta belum fit benar akibat cedera. (int)

Ingin Bunuh Diri nyawanya sendiri. Dan pacar pesepak bola Paris St Germain, Claude Makelele, itu ditemukan pingsan. Noemie yang menjadi model Marks & Spencer ditemukan tergeletak tak sadarkan diri di rumahnya di La Celle-Saint-Cloud, dekat Paris. Seorang pria yang sedang berjalan-jalan dengan anjingnya menemukan tubuh wanita 30 tahun itu pada Minggu lalu. Pria tersebut langsung menelepon panggilan darurat. “Perempuan muda berumur 30 tahun ditemukan tak sadarkan diri di La Celle-Saint-Cloud, Minggu sore. Dia dilarikan ke rumah sakit untuk perawatan atas dampak dari overdosis. Dia kini pulih dengan baik,” sebut pernyataan kepolisian Paris. (int)

HALAMAN 15

MINGGU, 16 MEI 2010

Korea Selatan Juara Piala Uber Pasangan Markis Kido/ Hendra Setiawan menjadi andalan saat meladeni ganda Cina, Cai Yu/Fu Haifeng. PM/JPNN

Indonesia vs China

Selatan. Artinya, Korea Selatan pun jadi juara Piala Uber untuk kali pertama dalam sejarah dengan menundukkan si juara 11 kali, China, yang juga jawara enam edisi beruntun. Dua kemenangan Korea Selatan sebelumnya diraih Lee Hyo Jung/Kim Min Jung atas Ma Jin/Wang Xialoi dengan skor 18-21, 21-12 dan 21-15. Dan Bae Seung Hee yang menundukkan pemain nomor satu dunia Wang Yihan lewat permainanan dua set langsung, 23-21 dan 21-11. Sedangkan China meraih satu kemenangan lewat perjuangan Wang Xin yang menang 21-14, 16-21 dan 21-7 atas Sung Ji Hyun. (int)

Maksimalkan Dua Ganda KUALA LUMPUR Secara teknis Indonesia menjadi underdog dari China pada pertandingan final Piala Thomas hari ini (16/5). Skuad Merah Putih tetap punya kans antara lain dengan memaksimalkan dua ganda. Dari formasi yang terbiasa, hampir dipastikan Taufik Hidayat dan pasangan Markis Kido/ Hendra Setiawan menjadi dua penampil pertama tim Indonesia. Calon lawan mereka adalah Lin Dan dan Cai Yu/Fu Haifeng. Di partai ketiga atau tunggal kedua, Indonesia masih menunggu perkembangan kondisi Sony Dwi Kuncoro. Jika dinilai tidak siap, maka Simon Santoso kembali memainkan peran itu, dan Dynosius Hayom Rumbaka menjadi tunggal ketiga. Mengenai ganda kedua, manajer tim Yacob Rusdianto

mengatakan timnya masih mempelajari dan mengevaluasi, siapa di antara Nova Widianto, AlventYulianto, dan Muhammad Ahsan yang akan dipasangkan. Dari keterangan Yacob, Nova punya kans besar untuk diturunkan. Salah satu alasannya adalah, dia sangat jarang bermain di nomor ganda putra karena lebih spesialis ganda campuran. “Untuk ganda kedua, mungkin kita bisa pasang kayak kemarin (Nova/Alvent—Red). Sulit dibaca lawan. Orang susah cari video Nova kalau main ganda putra. Mungkin baru pertandingan semalam China mempelajari dia,” ujar Yacob di BCS Sport Center, Kuala Lumpur, Sabtu (15/5). Seperti diketahui, Nova/Alvent menjadi penentu kemenangan Indonesia atas Jepang di babak semifinal kemarin, dengan skor 31. Itu adalah kali pertama mereka ditandemkan di ajang internasional. Sementara ganda putra pertama Markis Kido/Hendra Setiawan diharapkan memberi poin untuk Indonesia. Dari empat pertandingan mereka belum kehilangan set. Peringkat mereka juga lebih baik daripada Cai Yun/

Fu Haifeng. Dari rekor pertemuan, kedudukan mereka berimbang: sama-sama menang empat kali. Bagaimana dari nomor tunggal? Taufik jelas tetap diharapkan bisa memberi perlawanan terbaiknya melawan Lin Dan, walaupun sejak 2007 tak pernah bisa mengalahkan pemain kidal peringkat dua dunia itu. “Saya yakin Taufik bisa. Waktu melawan India dia diragukan, tapi saat melawan Jepang, dia main hampir sempurna,” tegas Yacob. Saat disinggung soal rekor pertemuan terakhir Taufik dengan Lin Dan, ia memberi ilustrasi yang menekankan bahwa apapun bisa terjadi. Ia mencontohkan kekalahan Simon dari pemain Jepang Sho Sasaki di semifinal kemarin. “Sebelum kemarin, Simon itu selalu menang dari empat kali pertemuan dengan Sasaki. Itu artinya, dalam pertandingan semua bisa berubah. Yang biasa menang bisa kalah, begitu juga sebaliknya. Yang penting kita usaha dengan maksimal.” Pertandingan final Indonesia kontra China akan digelar di Putra Stadium, Bukit Jalil, sekira pukul 13.00 WIB. (int)

30 SSB Bersaing di Turnamen Super Seri Festival

PM/SORMIN

Dzulmi Eldin didampingi istri foto bersama dengan Hendra DS serta tim SSB Generasi Kosek dan SSB Disporasu.

MEDAN Sebanyak 30 tim sekolah sepak bola (SSB) Kota Medan bersaing pada turnamen sepak bola U-12 bertajuk Super Seri Festival (SSF) yang berlangsung di Lapangan sepak bola Patriot Jalan Air Bersih Medan, Sabtu (15/5). Turnamen yang dibuka langsung Ketua

TIM Uber Korea Selatan menjadi kampiun Piala Uber dengan meruntuhkan tim tangguh China. Kemenangan 21-19, 14-21 dan 19-21 yang ditorehkan Lee Kyung Won/Ha Jung Eun atas Du Jing/Yu Yang membuat Korea Selatan menang 3-1. Berlaga di Putra Stadium, Kuala Lumpur, Sabtu (15/5) sore WIB, pertarungan antara Du/Yu yang ganda putri terbaik nomor dunia dunia kontra Lee/Ha yang peringkat 11 dunia, berjalan sengit terutama di set ketiga. Selama satu jam dan 18 menit, pertarungan akhirnya tuntas dengan kemenangan untuk pasangan Korea

Umum PSMS Medan Drs Dzulmi Eldin, dihadiri Camat Medan Kota Drs Mansyur Usman, Lurah Sudirejo I Ubudiyah SH, Manejer PSMS Drs Hendra Ds, Bendahara Pengcab PSSI MedanAsrul Sany didampingi bidang organisasi H Sofyanto SE dan undangan lainnya.

Drs Dzulmi Eldin, yang juga calon Wakil Walikota Medan periode 2010-2015 dalam sambutannya mengatakan sangat bangga melihat pesepakbola usia muda Kota Medan ikut meramaikan kejuaraan SSF U-12 tersebut. Pasalnya, di usia 12 anak-anak dapat berlatih dan meningkatkan kemampuannya, sehingga kelak menjadi pemain handal dan terpilih membela klub kebanggaan kota Medan, yakni PSMS Medan. “Tingkatkan kemampuan dan tunjukkan sportivitas dalam pertandingan,” ujar Eldin. Ketua Pengcab PSSI Medan, Drs H Darwin Syamsul yang diwakili BendaharaAsrul Sany Batubara mengatakan sangat mendukung kegiatan Super Seri Festival (SSF) tersebut. Pasalnya, sejak usia dini harus dibina pemain sepak bola menuju pemain nasional nantinya. Lebih lanjut, Asrul berharap para pemain SSF U 12 yang tampil dalam pertandingan untuk menjaga sportivitasnya dan menjunjung tinggi moral olahraga.

Sementara Ketua Panitia, Heri Dodi Saptono menyebutkan ke-30 SSB yang bertarung sudah diseleksi ketat. Hal ini dilakukan untuk tidak merugikan tim sendiri dan tim lain. Ke-30 SSB yakni SSB Portis, SSB Generasi Kosek A, SSB Generasi Kosek B, SSB Bumi Serdang Damai (BSD), SSB Tunas Remaja, SSB PTP I Wilayah A, SSB PTP I Wilayah B, SSB Surya Putra Marendal A, SSB Surya Putra Marendal B, SSB Sejati Pratama, SSB Surya Putra Marendal A, SSB Surya Putra Marendal B, SSB Generasi Medan B, SSB Kenari Utama, SSB Medan Utara lion, SSB Medan Utara tiger, SSB Kompas, SSB Sinar Sakti Medan, SSB Gumarang, SSB Medan Soccer, SSB kurnia, SSB Patriot putih, SSB Patriot orange, SSB Patriot Muda, SSB Tasbi, SSB Hendra, SSB albatros, SSB dispora, dan SSB Mayang putra. Pada laga kemarin (15/5), Generasi Kosek kalah 0-1 atas Disporasu, Patriot Putih menang 2-0 atas M. Utara Lion. (sormin)

Tim Uber Korea kelyar sebagai juara setelah menundukkan tim tangguh Cina. PM/JPNN

MENANTI KEAJAIBAN Dinihari (17/5) nanti, Madrid akan melakoni laga pamungkas melawan Malaga. Tertinggal satu poin dari pemuncak klasemen Barcelona, skuad besutan Manuel Pellegrini harus memetik kemenangan demi peluang mengangkat trofi di akhir laga. Namun dengan catatan, Real Valladolid mampu menumbangkan atau minimal mengimbangi Barca di Camp Nou, pada saat yang bersamaan.Tentunya ini tak semudah membalikkan telapak tangan. Setelah meraih tiga gelar juara Premier League berturut-turut bersama Manchester United, pemain yang dijuluki CR9 kini dihadapkan kenyataan pahit jika trofi La Liga pertama gagal direngkuhnya. “Saya menikmati tahun pertama di Madrid. Tapi, mungkin tidak akan cukup tanpa memenangkan trofi,” aku Ronaldo, seperti dilansir Reuters, Sabtu (15/5). “Tersingkir dari Liga Champions adalah momen terburuk. Tapi, Anda pasti akan terpeleset saat tim kedatangan banyak pemain baru dan seorang pelatih baru. Maka, kami harus tetap berjuang,” kilah pencetak 26 gol bagi Los Blancos sepanjang

musim ini.

Lebih penting Sementara kiper Real Madrid, Iker Casillas, mengatakan, lebih penting bagi timnya memikirkan bagaimana mengalahkan Malaga ketimbang memusingkan hasil pertandingan Barcelona melawan Valladolid dalam pertandingan terakhir Divisi Primera. Madrid saat ini berada di posisi kedua dengan nilai 95 atau cuma kalah satu angka dari Barcelona. Kemenangan atas Malaga akan siasia bila pada pertandingan lain Barcelona mampu menggulung Valladolid. Casillas mengatakan, situasi itu tak membuat Madrid kehilangan motivasi untuk meraih kemenangan di partai terakhir. Menurut dia, apa pun hasil akhirnya, menang atas Malaga jelas lebih baik ketimbang seri atau kalah. “Segalanya bisa terjadi, dari yang terburuk sampai yang terbaik. Namun, kami tak bisa melupakan bahwa kami memiliki pertandingan dan pertama-tama, kami harus memastikan bahwa kami memenangi laga kami sendiri,” tegas Casillas. (int)


MINGGU 16 MEI 2010

Malaga vs R. Madrid

MENANTI KEAJAIBAN Cristiano Ronaldo menunggu keajaiban agar bisa juara Liga Spanyol.

MADRID Cristiano Ronaldo terancam mengakhiri musim 2009/ 2010 bersama Real Madrid tanpa merengkuh satu pun gelar juara. Hanya sebuah keajaiban yang diharapkan punggawa Timnas Portugal di penghujung La Liga ini.

Barcelona

vs

JAGA REKOR

Ingin Bunuh Diri

Diduga sengaja menenggak alkohol dan obat-obatan terlarang, membuat model Noemie Lenoir bermaksud menghilangkan Baca Halaman 15

Baca Halaman 15

Banding Ditolak, Xavi Absen

Prediksi Lae Togar Chievo Sampdoria Siena Cagliari Atalanta Malaga R.Santander Osasuna Barcelona Valencia

BARCELONA membutuhkan kemenangan demi mengamankan trofi La Liga Primera. Sayang melawan Real Valladolid, sang juara bertahan harus turun tanpa playmaker andalan Xavi Hernandez karena banding yang diajukan ditolak. Gelandang berusia 30 tahun itu menerima kartu kuning ketika Barcelona menundukkan Sevilla 32 akhir pekan lalu. Serta merta Xavi terjerat hukuman otomatis suspensi satu pertandingan

Tertarik ke Barca Ronaldo Dicemooh

Baca Halaman 15

Noemie Lenoir

Lionel Messi akan berjuang habis-habisan untuk bisa menjaga rekor menang di kandang dan menjuarai Liga Spanyol.

BARCELONA Satu kemenangan lagi, Barca menjadi juara kali kedua berturut-turut, dan tetap menjaga rekor menjadi satu-satunya tim tak terkalahkan di kandang.

Baca Halaman 15

BINTANG Real Madrid, Cristiano Ronaldo, dicemooh oleh fans Real Madrid minggu ini ketika sedang menonton turnamen tenis. Berita Sport yang dikutip TribalFootball mengatakan Ronaldo dicemooh oleh para penonton pada hari Rabu ketika dia ikut menonton pertandingan antara Rafael Nadal dengan Oleksandr Dolgopolov di turnamen tenis Madrid Terbuka. Nampaknya Ronaldo telah membuat marah beberapa fans dengan menolak menepis kemungkinan dia akan pindah ke Barcelona.

Valladolid

Xavi Hernandez

22 Abidal

PELATIH: Josep Guardiola

3

CADANGAN 1 13 Pinto 4 Marquez 28 Dos Santos 15 Keita 19 Maxwell

FORMASI

4-3-3

16

14

Busquets

Henry

Pique

Valdes

5

8

9

Iniesta

Ibrahimovic

Puyol

2 Dani Alves

16

7 20 22 Costa

Cannobio

18 23 Marquitos

11

10

Bojan

Messi

PELATIH: Javier Celemente

P. Lopez

Aleman

Rubio

10 Borja

0 ½ 0 0 0 0 0 0 2 1

AS Roma Napoli Inter Milan Bologna Palermo R. Madrid Sporting Gijon Xerez Valladolid Tenerife

TVONE Senin (17/05), pukul 00:00 wib : Barcelona vs

VALLADOLID

Nou Camp Stadion

: : : : : : : : : :

Siaran Langsung

Baca Halaman 15

BARCELONA

½ 0 1 0 ½ ½ 0 0 0 0

CADANGAN

17

1 1

Prieto

Villar

4

Fabricio 13 Barragan 2 Vegas 8

Nivaldo

3 Marcos

Pele 6 Sesma 19 Bueno 11

FORMASI

4-3-2-1

TELKOMVISION Minggu (16/05), pukul 20:00 wib : Cagilari vs Minggu (16/05), pukul 20:00 wib : Catania vs

Valladolid

Bologna Genoa

VISION 1 Minggu (16/05), pukul 20:00 wib : Chievo vs AS Roma Minggu (16/05), pukul 20:00 wib : Siena vs Inter Milan

CMY K

C MY K

posmetro medan  

edisi 16 mei