Issuu on Google+

PHD GROUP CANADA INC. 2568 ROYAL WINDSOR DRIVE MISSISSAUGA, ON, L5J 1K7 TOLL FREE 1800-220-5513 www.phdgroup.ca

SINCE 1967


HISTORY In 1967, Anthony Demysh designed the NOSEMOUNT catalytic Cargo Heater, which he patented in Canada and U.S.A )RUWKHÀUVWWLPHDKHDWHUZDVFUHDWHGWRÀWWKHGHPDQGLQJQHHGVRIWKHWUDQVSRUW WUDGH2QO\WKHZRUOG·VÀUVWFDWDO\VWVZHUHFKRVHQIRUWKLVDSSOLFDWLRQWRHQVXUHWRWDO VDIHW\GXUDELOLW\DQGIXHOHFRQRP\ 7KH3+'*URXS&DUJR+HDWHUZLWK\HDUVRIFRQWLQXRXVUHVHDUFKDQGGHYHORSPHQW RIWHFKQRORJ\LVWKHOHDGHULQLWVÀHOG)RUWKHVDPHDPRXQWRIIXHOWKLVH[FHOOHQW catalyst produces 50% more heat and 50% less moisture than any other heater on the market. ,QIDFW3+'*URXS&DUJR+HDWHUVDQVZHULQJDVWKHDEVROXWHWRWKH FULWHULRQRILGHDOFRPEXVWLRQFRXSOHGZLWKWKHDWWDLQHGSHUIHFWLRQ RIWKLVWHFKQLTXHDWWUDFWHGLQWHUHVWDQGGHYRWLRQRIPDQ\ LQWHUQDWLRQDOWHFKQLFLDQVDQGODERUDWRULHV

SINCE 1967


ABOUT 2XUJRDOLVWRVXSSO\DKLJKTXDOLW\FDUJRKHDWHUZLWKVXSHULRUSHUIRUPDQFHWRWKH1RUWK $PHULFDQ0DUNHW3+'*URXS&DWDO\WLF&DUJR+HDWHULVEXLOWWRWKHKLJKHVWPDQXIDFWXULQJ VWDQGDUGVLWLVHFRQRPLFDOVDIHOLJKWZHLJKWQRLVHIUHHDQGHQYLURQPHQWDOO\IULHQGO\,Q UHFHQW\HDUVZHKDYHPDGHPDQ\LQQRYDWLYHOHDSVIRUZDUGWRPDNHRXU&DUJR+HDWHU superior to any other cargo heater on the market.

P.H.D. Group Canada Inc.LVSURXGWRRIIHUWKUHHGLIIHUHQWORDGKHDWHUVWRPHHW

\RXUVSHFLÃ&#x20AC;FLQGLYLGXDOUHTXLUHPHQWV+LJKSHUIRUPDQFH6WDLQOHVVVWHHO&DWDOLW\F&DUJR +HDWHUV1HZ7HFKQRORJ\KDVEHHQDGYDQFLQJDWDQXQSUHFHGHQWHGUDWHWRDFKLHYH JURZWKDQGFRPSHWLWLYHDGYDQWDJHZLWK0,&52&20387(5&21752/ <RXFDQUHDOL]HXSWRVDYLQJVE\SXUFKDVLQJDQGRSHUDWLQJD3+'*URXS,QF 7KHUPRUHDFWRURYHUDQ\FRPSHWLWLYHPHFKDQLFDOV\VWHP

WHAT WE OFFER

Explosion Proof Economical Pollution Free 5 Year Warranty

Powerful Electronic Control Light Weight Dependable

PHD GROUP CANADA INC. / TOLL FREE 1800-220-5513 / www.phdgroup.ca


CAPITAL COSTS P.H.D. Heater............................ $6,000 Mechanical............................ $13,000

(Approximate costs in Canadian dollars)

FUEL CONSUMPTION P.H.D. Heater.................... 0.4 litres per hour Mechanical....................1.32 litres per hour 3+'HYHORSPHQW7KHUPRUHDFWRUVXVHOHVVWKDQRIWKHIXHORIGLHVHOKHDWHUVIRU HTXDORXWSXW HIÃ&#x20AC;FLHQF\ $GGLWLRQDOO\WKHFRVWRISURSDQHLVFXUUHQWO\XSWR ORZHUWKDQWKHFRVWRIGLHVHOIXHO 7KHUHIRUHWKHRSHUDWLQJFRVWRIWKH3+'HYHORSPHQW7KHUPRUHDFWRUVLVXSWR WLPHV/(66WKDQDPHFKDQLFDOV\VWHPWKLVGRHVQRWHYHQWDNHPDLQWHQDQFHIDFWRUV and warranty into consideration.

COLD WEATHER ACTIVATION P.H.D. Heater7HVWUHVXOWVSURYHHIÃ&#x20AC;FLHQWVWDUWLQJ and operation down to -60F 0HFKDQLFDO'LIÃ&#x20AC;FXOWLIQRWLPSRVVLEOHWRVWDUW at -60F

SINCE 1967


COMPARISON MAINTENANCE P.H.D. Heater2XUXQLWKDVQRPRYLQJSDUWV 0HFKDQLFDO5HTXLUHVSHULRGLFRLOFKDQJHVLQFOXGLQJUHSODFHPHQW RIRLOÀOWHUIXHOÀOWHUDQGDLUÀOWHU :HUHFRPPHQGDQDQQXDOLQVSHFWLRQRIRXUV\VWHPZKLFK  WDNHVDSSUR[LPDWHO\PLQXWHVDQGLVGRQHIUHHRI   FKDUJHDWRXUIDFLOLW\RUZHFDQWUDLQ    PDLQWHQDQFHSHUVRQQHOLQ\RXUIDFLOLW\ ,QVXEVHTXHQW\HDUVDGLHVHO HQJLQHZLOOUHTXLUHPDMRUPHFKDQLFDO VHUYLFLQJ7KLVFDQEHH[SHQVLYHLQWHUPV RIGRZQWLPHDQGWKHFRVWRISDUWVDQG PHFKDQLFVODERXU

SAFETY P.H.D. Heater2XUKHDWHUVDUHFHUWLÀHGH[SORVLRQSURRIDQG DSSURYHGIRURSHUDWLRQLQ&ODVV 'LYLVLRQ *URXS'+D]DUGRXVDUHDV Mechanical......... Diesel heaters can not come close. Our Thermoreactor units initiate the catalytic process PASSIVELY XVLQJPLFURHOHFWURQLFLPSXOVHVUDWKHUWKDQDQRSHQÁDPHRUVSDUN ,QFRQMXQFWLRQZLWKWKLVSDVVLYHVWDUWIHDWXUHRXU7+(5025($&7256 FDWDO\VWR[LGL]HVJDVHVEHORZWKHLUDXWRLJQLWLRQSRLQW There is NO DANGER OF IGNITION.

WARRANTY P.H.D. HeaterQRFRVW\HDUSDUWVDQGODERXUXQGHUQRUPDOXVH 0HFKDQLFDOSDUWLDOZDUUDQWLHVUDQJLQJIURPPRQWKVWR\HDUV

PHD GROUP CANADA INC. / TOLL FREE 1800-220-5513 / www.phdgroup.ca


COMPARISON DEPENDABLE P.H.D. Heater0DQXIDFWXUHGWR&DQDGLDQDQG86$Military Standards Each one is hand PDGHDQGLQVSHFWHGE\WZRSURIHVVLRQDOVZLWKWRWDOH[SHULHQFHRIRYHU 35 years. It will start, no matter what the outside conditions; our unit has no PRYLQJSDUWV 0HFKDQLFDO5HTXLUHVSHULRGLFRLOFKDQJHVLQFOXGLQJUHSODFHPHQWRIRLOÃ&#x20AC;OWHUIXHOÃ&#x20AC;OWHU DQGDLUÃ&#x20AC;OWHUDQGRFFDVLRQDOPDMRUPHFKDQLFDOVHUYLFLQJ(QJLQHZLOOQRW WXUQRYHULQFROGFRQGLWLRQVOHDYLQJ\RXZLWKRXWKHDW)ULFWLRQEHWZHHQ PRYLQJSDUWVZLOOHYHQWXDOO\FDXVHWKHHQJLQHWRVHL]H

ENVIRONMENTAL IMPLICATIONS P.H.D. Heater2SHUDWHVYLUWXDOO\SROOXWLRQIUHH SSP DQGFRPSOHWHO\QRLVHIUHH 0HFKDQLFDO1RLV\HQJLQHH[KDXVWIXPHVSROOXWHWKHDLUDQGQRW FHUWLÃ&#x20AC;HGWREHH[SORVLRQSURRI $QHQYLURQPHQWDOEHQHÃ&#x20AC;WDQ\JDVHVRURGRUVSUHVHQWLQDWUDLOHU ZLOOEHFRQVXPHGDQGFRQYHUWHGWRHQHUJ\E\WKH3+' 7KHUPRUHDFWRU,QHVVHQFHWKH3+'7KHUPRUHDFWRUSXULÃ&#x20AC;HVWKH air in the trailer while maintaining the cargo at a predetermined WHPSHUDWXUH)XUWKHUPRUHE\RSHUDWLQJFRPSOHWHO\QRLVHIUHH RXU7KHUPRUHDFWRUZLOODOORZ\RXUGULYHUWRVOHHSVRXQGO\ SUHYHQWLQJDFFLGHQWVRQORQJHUKDXOV+HDOWKH[SHUWVEHOLHYH WKDWÃ&#x20AC;QHGLHVHOSDUWLFXODWHVIURPGLHVHOHQJLQHVFDUULHGGHHS LQWRWKHOXQJVFRXOGEHRQHRIWKHPRVWGDQJHURXV SDUWLFXODWHPDWWHU 30 WRKHDOWK

SINCE 1967


STANDARD FEATURES 23-NTR MEPCA and 30-NRT MEPCA The 23-NTR MEPCA and 30-NRT MEPCA units $QH[FKDQJHSURJUDPLVDYDLODEOHDIWHUWKLV DUHH[WUHPHO\VLPSOHWRRSHUDWHDQGPDLQWDLQ SHULRG$OOUHSDLUDQGVHUYLFHQHHGVZLOOEH 8QGHUQRUPDORSHUDWLRQVWKH\DUHYLUWXDOO\ PHWDWRXUIDFWRU\VHUYLFHXSRQQRWLÀFDWLRQ PDLQWHQDQFHIUHHDQGDUHJXDUDQWHHGIRU 5 years. ‡$W%78KJHQHUDWLQJXSWRž) ž&

‡'HVLJQHGDQGDSSURYHGIRUXVHLQWUDQVSRUWDWLRQRIGDQJHURXVJRRGV ‡ 0DQXIDFWXUHGWR0LOLWDU\6WDQGDUGVRI&DQDGDDQGWKH86$

‡6ROLGVWDWH0LFUR(OHFWURQLF3DVVLYH&DWDO\VW$FWLYDWRU  0(3&$IRUUHOLDEOHVWDUWV

‡3RZHUIXORXWSXWIRUORQJWKLQZDOOHGWUDLOHUV‡3ROOXWLRQRGRUDQG QRLVHIUHHE\GHVLJQ

✝ ‡$XWRPDWLF(OHFWURQLF6\VWHP6XUYHLOODQFHFRPSXWHUFRQWUROPRGXOH HQVXUHVSURSHUDFWLYDWLRQDQGRSHUDWLRQZLWKDXWRPDWLFVKXWGRZQ LQFDVHRIPDOIXQFWLRQ

✝ ‡2%'VFDQQLQJV\VWHP ✝ ‡1RPHFRYLWWHVPHOOLQVLGHWKHWUDLOHUWKDQNVWR60(//&87 ✝ ‡6RODUSDQHOWRVXSSRUWDQGVDYHEDWWHU\OLIH ‡/SURSDQHXQGHUPRXQWHGWDQNLQFOXGHG ‡$GMXVWDEOHWKHUPRVWDWLFWHPSHUDWXUHFRQWURO ‡6WDLQOHVVVWHHOQRVHPRXQWWUDLOHUWKHUPRPHWHUZLWKIWFDSLOODU\ ‡9LEUDWLRQUHVLVWDQWZLWK12029,1*3$576 ‡(OHFWURQLFIDQDVVHPEO\IRUKRWDLUFLUFXODWLRQ ‡,QVWDOODWLRQLQFOXGHG ‡5DWHGWRNHHS\RXUWUDLOHUDWž)IRUKRXUVZLWKDQRXWVLGH WHPSHUDWXUHDWž) VRPHFXVWRPHUVERDVWVXSWRKRXUVXQGHU QRUPDOXVH

‡'LPHQVLRQVµ[µ[µZHLJKLQJWRWDOOEV KHDWHUDQGIXOOWDQN

✝ 1HZGHVLJQIHDWXUHVIRU

PHD GROUP CANADA INC. / TOLL FREE 1800-220-5513 / www.phdgroup.ca


SINCE 1967

PHD GROUP CANADA INC. TOLL FREE 1800-220-5513 www.phdgroup.ca


phd_cargo_heaters_2012