Page 1

I S S UE 2 6 APR I L 1 9

Diesel

Dirt &

DELIVERED FREE TO

60,000

Turf Expo 2019

HOMES MONTHLY

MEET JASON HODGES

Photo credit: Dirt Diesel and Turf Expo

Save the Date 3 RD, 4TH & 5TH M AY 201 9

N E P E A N ’ S

L I F E S T Y L E

M A G A Z I N E


*

MAY 3-5 2019 | PANTHERS PENRITH 123 MULGOA RD SYDNEY | DIESELDIRTANDTURF.COM.AU * Conditions apply. Visit https://go.machines4u.com.au/2019-diesel-dirt-and-turf-megaprize Open to Australian residents 18+ who attend the 2019 National Diesel Dirt & Turf Expo in Penrith NSW. Only (1) entry per person.


Welcome

Issue I

Hi Readers,

N

T

H I

S

FEATURED THIS ISSUE

20

WELCOME TO APRIL ISSUE.

T

his month is a doozy with the first school holidays of the year, Easter celebrations and Anzac Day all on the horizon. But don’t worry, we’ve got you covered for where to be and what to do to make this month a great one. Back for another year, the Diesel, Dirt and Turf Expo is bound to wow with awesome exhibitors and live demonstrations. Last year it exceeded my expectations - so family-friendly and because it’s Panthers, you don’t need to worry about parking. And did I mention it’s FREE?!

15

Local Feature Bovine and Swine Barbeque

18

Inspiring Story Incredible Izzy

20

Food CSIRO Protein Plus

15

Another must-book for your calendar is the annual Relay for Life, which never fails to draw a strong, supportive crowd to raise muchneeded funds for the Cancer Council. Join for the day or camp overnight, and continue the fight against cancer. Finally, we’ve got some of the latest recipes from the CSIRO cookbook to satisfy the tastebuds and improve your health in the cooler months. There’s even a healthy brownie recipe that looks absolutely divine!

18

So - without further ado, grab yourself a cuppa and dive in!

Sam

PO Box 3106, East Blaxland, NSW 2774 Advertising Enquiries Samantha Foley  0431 281 689 samantha@roamingpanthermagazine. com.au  @roamingpanthermagazine  @roamingpanthermagazine  www.roamingpanthermagazine.com.au

>> OUR TEAM Publisher • Kimberley Kennedy kimberley@roamingpanthermagazine.com.au Editorial • editorial@roamingpanthermagazine.com.au Creative Director • Kwang Tran Manager • Samantha Foley samantha@roamingpanthermagazine.com.au Copy Editor • Melinda Leyshon, WriteCopy Journalist • Cassandra Elliott Writers • Manisha Foley Images • iStock photos • Shutterstock

>> REGULAR CONTRIBUTORS

• Maria, Fellowes & Turner Travel Associates • Peita Davies, realestate.com.au Home Loans Penrith • Joseph Grassi, Joseph Grassi & Associates • Kris Caloia & Karl Thornton, Progressive Physiotherapy • Erin Short, Greencross Vets Coreen Avenue • Sherrynne Dalby, Author of Star Parenting • Trish Fehon, Online Influence • Paul Merrick, Merrick Property Group

• Nicole Fahey, Local Edge Marketing • Melissa Browne, Accounting & Taxation Advantage >> WITH THANKS TO OUR CONTRIBUTORS FOR THIS ISSUE • Shirley Gavin, Nepean Inner Designs • Fiona Kane, Informed Health • Kelly Battersby, Face Clinik • Penrith City Council • Penrith Homemaker Centre • Declan Baker

Published by Penzance Publishing Pty Ltd ABN 18615296118. Printed by Fairfax Media 159 Bells Line of Road North Richmond NSW 2754

We recommend material such as dates, times and prices of a changing nature be confirmed with individual advertisers, contributors or persons and industry professionals in regard to advertising and editorial.

All prices and information are correct and to the best of the publisher’s knowledge at the time of print. Roaming Panther Magazine does not accept or assume responsibility for advertising material accepted. Comments and opinions of contributors do not necessarily reflect the opinion or view of the publishers or editor.

Material in Roaming Panther Magazine is copyright © Penzance Publishing and may not be reproduced without the permission of the publisher. All rights reserved. Issue 26, April 2019

All reasonable efforts have been made to trace copyright owners.

CREATING BEAUTIFUL HOMES Family owned with 20 years experience of quality and workmanship.

BLUE SKY SHUTTERS

Plantation Shutters, Roller Blinds, Panel Glides, Vertical Drapes, Dual Shades, Security Doors and Grilles, Fly Screens and Awnings.

Plantation Shutters Blinds Security Doors Awnings

CALL BLUE SKY SHUTTERS today for a free measure and quote on Office 02 4733 6214 or Peter 0414 706 142 Email blueskyshutters@gmail.com

Website www.blueskyshutters.com.au

Facebook Blue Sky Shutters

Issue 26 April 2019

5


What’s On!

Local Shows & Entertainment

BUDDY HOLLY AND THE BEATLES

NEVER ENDING 80S V 90S PARTY

4 MAY, 8PM THE JOAN Buddy Holly and The Beatles shook the world in the 50s and 60s with their massive chart hits - hits that are still timeless and popular 50 years on, with over 400 million record sales between them. thejoan.com.au

6 APRIL, 8PM PANTHERS PENRITH A battle of the decades! The best pop hits of the 80s and 90s served up LIVE. It’s a song-for-song battle and you decide who wins! Will it be ‘I’m Just A Girl’ or ‘Girls Just Wanna Have Fun’? 80’s Prince or 90’s Jamiroquai? Backstreet Boys or Bon Jovi?

penrith.panthers.com.au

SYDNEY BALALAIKA ORCHESTRA: FROM RUSSIA WITH LOVE 7 APRIL, 3PM BLUE MOUNTAINS THEATRE Dressed in stunning Russian costumes, the Sydney Balalaika Orchestra performs on traditional folk instruments including balalaika, bayan, domra and cimbalom. It’s vibrant, soulful and unforgettable. Audiences will be entranced by the beautiful vocals and dazzling music that captures the essence, magic and mystery of Russia with themes of the countryside, trees, rivers, lakes and, of course, love – often unrequited! bluemountainstheatreandhub.com.au

CONSTANT CRAVING 13 APRIL, 2PM AND 7:30PM THE JOAN Constant Craving - Australia’s ONLY tribute to k.d. lang. Celebrating the 25th anniversary of the GRAMMY® award-winning, critically acclaimed album Ingénue, and featuring the hit Constant Craving. The hits, the covers and the duets are performed live by powerhouse vocalist Lisa Crouch and her incredible nine-piece band. Songs include The Air That I Breathe and Crying, Duets range from Dream a little Dream of Me (with Tony Bennett) to Sleep While I Drive (with Melissa Etheridge), and, of course, Leonard Cohen’s haunting Hallelujah. You will be spellbound. thejoan.com.au

BRYAN ADAMS TRIBUTE SHOW

FREE

SEATTLE SOUND

26 APRIL, 9PM PENRITH RSL Craig Woodward and his band of brothers present the ‘Summer of 2019’ tribute show celebrating the music of Bryan Adams, the number one selling rock artist in Canadian music history. Enjoy all the familiar hits, including Run to You, Heaven, Cuts like a Knife, Everything I Do, and Summer of 69’ to name a few, plus songs from his latest (2015) release, ‘Get Up’.

4 MAY, 8:30PM JAMISON HOTEL The ever-popular Seattle Sounds returns to the Jamison Hotel for another huge night of Grunge-era favourites and love song dedications.

penrithrsl.com.au

jamisonhotel.com.au

WE SPECIALISE IN • A N T I W RINKL E • D ERMA L F I L L ER • TEE TH WHI T E NING • F AT D I SSO LV E NT • PL ATEL E T RI C H PL ASMA (P P A)

Registered nurse Kelly has over 10 years experience in general nursing, with her main focus now being anaesthetics and cosmetic injecting.

THE ART OF COSMETIC’S IS NOT TO NOTICE THE ART

ROSS NOBLE: HUMOURNOID

LA TICK ST ETS

12 APRIL, 8PM BLUE MT. THEATRE What happens when pure comedy takes human form? What happens when a creature is created and bred to do stand up? Nobody knows because that isn’t a thing. What is a thing, is Ross Noble doing a show. You can come and see. This is it.

bluemountainstheatreandhub.com.au

ONLIN E BOOK INGS AV A IL A

BLE

PENRITH | GLENMORE PARK | WOOLLAHRA

 041 5 502 0 64

6

roamingpanthermagazine.com.au

 FAC EC LINIK

FACECLINIK.COM.AU


What’s On!

Things To Do SUNDOWN BEATS & EATS

FITNESS 4 AUTISM

ALIVE AFTER FIVE

14 APRIL, 9AM JAMISON PARK An annual event organised by The Luke Priddis Foundation. Join us for a run or walk, and picnic in the park, with free activities and face painting. Thanks to Penrith Rotary, every participant will receive a free sausage sizzle on the day! Exciting new activities are planned for this year and we’re looking forward to lots of fun. To register, contact events@lukepriddisfoundation.com or call 4736 2202.

3 MAY, 5PM TRIANGLE PARK (WEST END OF HIGH ST) Unwind with friends over a craft brew and live music. Enjoying mouth-watering food under the magical twilight in Penrith City Centre’s newest urban space.

lukepriddisfoundation.com

penrithcity.nsw.gov.au

YOGA @ THE MONDO

penrithhomemakercentre.com.au

RESIN SERVING BOARDS WORKSHOP

WEDNESDAY MORNINGS, 7AM – 8AM PENRITH WESTFIELD (OUTSIDE THE FRESH FOOD MARKET, NEAR THE JOAN) Join Jolan from Om Yoga at The Mondo, each Wednesday morning at 7am. EE

FYROGA S SSE CL A

westfield.com.au/penrith

Sundown Beats & Eats

11 APRIL, 6PM PENRITH HOMEMAKER CENTRE Enjoy a fun-filled evening for the whole family with your favourite food trucks (Rolling Schnitzel, G-Dup Burgers and others!), live music, entertainment for kids, and more!

5 MAY, 1PM THE CREATIVE FRINGE Join the Made by Me Workshop and create three amazing boards to keep for yourself or give as a gift. We’ll give you the tools and techniques to turn your creativity into beautiful objects you’ll be proud to show off at your next dinner party! thecreativefringe.com.au

SydBricks

Tickets at sydneybrickshow.com.au

Issue 26 April 2019

7


What’s On!

What's On

Local Art

at Blue Mountains Theatre

MARRIAGE: LOVE + LAW

Sydney Balalaika Orchestra SUN 7 APR | 3PM

A captivating Sunday afternoon concert, capturing the essence, magic & mystery of Russia.

FRE

E

ROY DALGARNO

30 MARCH – 16 JUNE PENRITH REGIONAL GALLERY Marriage: Love + Law is a NSW State Archives exhibition that explores the laws, beliefs and social attitudes that have shaped and reshaped marriage in Australia over three centuries. The exhibition presents a unique and compelling account of the way in which society has regulated, celebrated and interrogated the institution of marriage.

30 MARCH – 16 JUNE PENRITH REGIONAL GALLERY An exhibition that truly celebrates modernism through social realism in Australian art. Roy Dalgarno commemorates the gift to the community of Penrith of prints from a fascinating Australian artist.

penrithregionalgallery.com.au

penrithregionalgallery.com.au

NEW EXHIBIT

FREE

Local Markets

WANDER AROUND YOUR LOCAL MARKET & FIND A HIDDEN GEM

Mànran (Scotland) SAT 13 APR | 8PM

A Celtic-folk-rock sensation, renowned worldwide for their passionate & uplifting live performances. PENRITH REGION

HAWKESBURY REGION

PACEWAY SUNDAY MARKET

RICHMOND GOOD FOOD MARKET

PACEWAY, PENRITH FIRST SUNDAY, 8AM – 1:30PM Trash & Treasure, Growers and Food Vendors can all be found at the Paceway Sunday Markets.

RICHMOND PARK EVERY SATURDAY, 8AM – 1PM Food grown and produced in and around the Hawkesbury region is some of the finest in the country. Find fresh flowers, handmade treasures, arts and crafts, live music, and more.

clubpacewaypenrith.com/penrith-markets

AUSSIE NIGHT MARKETS

School Holiday $7 Kids Flix

16-24 APR | See website for all sessions!

106 Macquarie Road 4723 5050 | Springwood

www.bluemountainstheatre.com

richmondmarket.com.au

PANTHERS PENRITH EVERY WEDNESDAY, 5PM – 9:30PM 30+ international street food vendors, quality arts and crafts stalls, kid’s rides and entertainment, dedicated dessert section, and music till late. FREE PARKING available on site. Fur friends welcome.

BLUE MOUNTAINS REGION

aussienightmarkets.com.au

glenbrookrotarymarkets.com.au

Featured Markets

GLENBROOK ROTARY MARKETS ROSS STREET, GLENBROOK GENERAL MARKET • THIRD SATURDAY Quality jewellery and crafts with plenty to spoil yourself. Delight at the array of flowers and plants.

SPRINGWOOD GROWERS’ MARKET BLUE MOUNTAINS THEATRE, SPRINGWOOD SUNDAY 28TH APRIL, 8:30AM Organic veggies, meat and eggs are all available. Come meet the farmers, producers and growers. blackcastleevents.com.au/markets

8

roamingpanthermagazine.com.au


What’s On!

Grounds

YOUR GUIDE TO YOUR FAVOURITE TEAM’S HOME GAMES

AROUND THE

WS Wanderers

Giants

A LEAGUE - SOCCER

AFL - AUSSIE RULES

Round 25

 Saturday 13 April, 7:50pm  Wanderers vs Sydney FC  ANZ Stadium

Round 27

 Saturday 27 April, 7:50pm  Wanderers vs Melbourne Victory  ANZ Stadium

Business NETWORKING EVENTS

CONNECTING

Local Businesses

Round 3

 Saturday 6 April, 4:35pm  Giants vs Richmond  Sydney Showground Stadium

Penrith Panthers NRL - RUGBY LEAGUE

Round 4

 Friday 5 April, 7:55pm  Panthers vs West Tigers  Panthers Stadium

Round 7

 Friday 26 April, 7:55pm  Panthers vs Rabbitohs  Panthers Stadium

PENRITH VALLEY CHAMBER OF COMMERCE

PENRITH CBD CORP - COFFEE CATCH UP

TUESDAY 9 APRIL, 6PM TATTERSALLS HOTEL PENRITH Come along and enjoy a great night while making the most of the fantastic networking opportunities at the Chamber Connect event.

WEDNESDAY 1 MAY, 7:30AM PENRITH RSL, MAZE CAFE Come and have a free coffee, meet some fellow business owners, and learn about what’s coming up in the continuously growing Penrith CBD.

penrithchamber.org.au

penrithcbdcorp.com.au

Journey BEGIN YOUR

AT S T PA U L ' S P R E - K

BOOK A TOUR OR ENROL TODAY

stpauls.nsw.edu.au

p. 02 4777 4888 e. enrol@stpauls.nsw.edu.au

Issue 26 April 2019

9


! N U F Y A D I L O H L O O H C S What’s On!

E H THES T I W N E FU TO SOM N I P M TS! OUT! JU D EVEN E S R L U O T O A SCH TWO FE

PANTHERS EASTER CARNIVAL IT’S BACK! SUNDAY, 21 APRIL

i

EVENT DETAILS  Easter Carnival  Sunday, 21 April 2019  FREE ENTRY  Panthers Penrith, The Backyard 123 Mulgoa Rd, Penrith

FR ENTEE RY

 panthers.penrith.com.au

This family-friendly event is held in The Backyard where carnival-goers can chill out and enjoy the day.

F

rom midday, families will love DJ Tamara! DJ Tam will bring all the hits and even play some musical games with the children. They can

also paint plasters and create their own egg-cellent masterpieces. You’ll also be able to steal a pat from the cutest little animals with the petting zoo, which will be there from 1pm to 5pm. Of course, it wouldn’t be an Easter carnival without a visit from the Easter Bunny! The cheeky Panthers, Penny and Scratch, will also be there from 2pm to 5pm. Combined with the famous Panthers Hot Cross Bun Eating Competition (starting at 2pm) and the

PETER RABBIT (PG)

TUESDAY 16 APRIL, 11AM With ground-breaking visuals, the movie introduces Brooklyn teen Miles Morales and the limitless possibilities of the Spider-Verse.

THURSDAY 18 APRIL, 11AM A charming and adventure-laden adaptation of Beatrix Potter’s classic tale of a rebellious rabbit trying to sneak into a farmer’s vegetable garden.

 All movies start at 11am

PEANUTS (G)

SMALLFOOT (G) + FREE POP-UP PLAYSPACE

 Blue Mountains Theatre

TUESDAY 23 APRIL, 11AM Charlie Brown, the world’s most beloved underdog, embarks on an epic and heroic quest, while his best pal, Snoopy, pursues his arch-nemesis, the Red Baron.

THURSDAY 24 APRIL, 11AM TATTERSALLS HOTEL PENRITH A bright young Yeti finds an elusive human – a ‘smallfoot’ – bringing the simple Yeti community into an uproar.

 Kid’s Flix and Pop-Up Playspace

P

10

i

 All tickets are $7. Kid’s snack packs with fresh popcorn, a treat and drink are available for $5. *

HANDS-ON CRAFTS AND ACTIVITIES

roamingpanthermagazine.com.au

the Blue Mountains Theatre. With tickets just $7 each, it’s an affordable, all-weather activity the whole family can enjoy!

SPIDER-MAN: INTO THE SPIDER-VERSE (PG)

EVENT DETAILS

CE SPA LAY

And of course, don’t miss the Panthers jumping castle, amusement rides and food trucks that are sure to be a huge hit with everyone.

E

BACK BY POPULAR DEMAND

PO

As we fade into the evening, Panthers will have live music to ensure you party your way into the night.

ntertain the whole family these April school holidays with a range of fun and heartwarming children’s films at

KID’S FLIX AND POP-UP PLAYSPACE

E FRPE-UP

classic Easter Egg Hunt at 3pm (perfect for those with keen eyes and super sleuth skills), there will be lots of fun!

104-108 Macquarie Rd, Springwood

 bluemountainstheatreandhub.com.au

*Only available at the Smallfoot movie screening


ENTER NOMINATE VOTE

the 2019 altitude awards ENTER: ALTITUDEAWARDS.COM

The Altitude Awards recognise and honours the excellence, achievement and contribution of businesses, community groups and leaders in our region.

2019

16 Categories sponsored by local businesses Presented by Women with Altitude + The Mens Altitude Network Sharing the stories of everyday people achieving extraordinary things Nominate someone who inspires you Vote for your favourite business Entries close April 22nd

PROUDLY SUPPORTED BY:

womenwithaltitudeaust

wwaltitude

womenwithaltitude

2019 CATEGORIES SOARING MICRO • SOARING SOLO • THROUGH THE WOODS • CLIMB EVERY MOUNTAIN • ON MY WAY • THE CHANGEMAKER • TWO PEAS PARTNERSHIP • BUSINESS EXCELLENCE • YOUNG ENTREPRENEUR • REVOLUTIONARY • EMERGING LEADER, EMPLOYEE OF THE YEAR • STRATEGIC CONNECTOR OF THE YEAR • PURPOSE DRIVEN ENTREPRENEURS • PAY IT FORWARD / UNSUNG HERO • ARTISAN INSPIRED • DIGITAL DYNAMO ONLINE

#WhoMe #YesYou

Special

MONDAY – THURSDAY, 11AM - 4PM

WESTFIELD PENRITH

SHOP R4, LEVEL 1, 585 HIGH STREET, WESTFIELD, NSW 2750 THEBAVARIANS.COM/PENRITH Issue 26 April 2019

11


Spotlight

MÀNRAN

EVENT IN THE

(SCOTLAND)

Spotlight

i

EVENT DETAILS  MÀNRAN (Scotland)

T

 Saturday 13 April, 8pm  General Admission $35, Concession $32  Blue Mountains Theatre and Community Hub 104-108 Macquarie Road, Springwood  bluemountainstheatreandhub.com.au

Coupled with songs performed in both Gaelic and English, it’s easy to understand why Mànran is in such high demand as a live act. With music ranging from the explosive to the poignant and, at all times, enjoying a palpable connection to their audience, Mànran thrives on live performances. So far, this has taken the band across Europe, the USA and Asia, as well as Australia where the band was awarded “International Artist of the Year” at the Australian Celtic Music Awards.

Open Mic Night

CALLING ALL STREET PERFORMERS AND BUSKERS!

Now, with three highly regarded studio albums under their belt and seven years of blowing audiences away with their energetic and passionate live performances, Mànran continues the touring schedule throughout 2019.

Open mic night in Triangle Park! re you a local musician or performer? We want you! Just book your timeslot and take the stage – it’s free and open to all local musicians and entertainers.

If you’re not a performer, then come along and enjoy a free showcase of Penrith’s best talent. Alongside the free entertainment, enjoy a pop-up record shop and glorious food. EVENT DETAILS  Open mic night - Free event  To find out more or book your slot, contact Dimity Mullane at 0429 905 046 or dimity.mullane@penrith.city  Thursday 11 April, 5-8pm 12

roamingpanthermagazine.com.au

he 2011 launch of their debut single, Latha Math, heralded a meteoric rise to the top of the Scottish music world that quickly saw them playing many of the most prestigious festivals in Europe.

Variously tagged as “folk-rock”, “Celtic-rock” and even “grown-up folk-rock”, Mànran’s music defies easy labelling due to the eclectic mix of influences on the band and the alchemy that melds them. With a central ethos built around the band’s traditional Celtic roots, fiery tunes from fiddle, accordion, flute, uillean and Highland bagpipes bind powerfully to a rhythm section awash with elements of funk, jazz and rock to create innovative and uplifting instrumental music.

 02 4723 5050

A

Mànran is one of the hottest acts and best-loved Scottish bands performing on the international music scene today.

FRE ev e e nt

i

 Triangle Park – western end of High Street Parking is available in the nearby Union Road car park.

Mànran features: Gary Innes – accordion and vocals; Ewen Henderson – highland pipes, fiddle and vocals; Craig Irving – acoustic guitar and vocals; Ross Saunders – bass guitar and vocals; Ryan Murphy – uillean pipes and flute; Mark Scobbie – drums.

Mànran is an exceptionally talented bunch of young guys that are taking the music world by storm with their high energy, stomping tunes and phenomenal Gaelic and English songs Celtic Connections


Spotlight

The Everly Brothers & The Rock ‘n’ Roll Legends of the 50s and 60s

T

For the first time in Australia, Rock ‘n’ Roll fans will embrace and celebrate all the classics and No 1 hits of the music legends! Starring the internationally-renowned The Williams Brothers.

he magical sounds of The Everly Brothers will come alive again with one of Australia’s most successful vocal duos, the internationallyrenowned The Williams Brothers. Supported by their own multi-award-winning band, The Shy Guys, this show is a non-stop journey through some of the greatest songs produced in this era. The Williams Brothers are the sons of one of Australia’s leading Rock ‘n’ Roll pioneers, Warren Williams. The boys were born to carry on the tradition of one of the greatest eras in music history. The first half of the show recounts the story and music of brothers Don and Phil Everly, whose songs and harmony were the inspiration to some of music’s most popular vocal groups including the Beatles, Simon and Garfunkel, The Beach Boys, and the Hollies. Come and hear the magical hits and soaring harmonies that made The Everly Brothers one of the world’s biggest recording acts and the legends that they are, with timeless songs such as Bye Bye Love, Wake Up Little Susie, All I Have To Do Is Dream, Bird Dog, Let It Be Me, (Til) I Kissed You, Cathy’s Clown, Crying In The Rain, and When Will I Be Loved.

In the second half of the show, The Williams Brothers present the songs of Rock ‘n’ Roll legends such as Buddy Holly, Chuck Berry, Little Richard, Jerry Lee Lewis and Australia’s Johnny O’Keefe, as well as the songs of The Bee Gees, The Eagles, The Beatles, The Monkees and The Hollies to name a few. The multi award-winning Williams Brothers recapture these songs with harmony that only brothers can produce together. They breathe life back into The Everly Brothers and Rock ‘n’ Roll legends of the 50s & 60s. This show will have audiences dancing in the aisles, and is certainly one not to be missed! EVENT DETAILS  The Everly Brothers & The Rock ‘n’ Roll Legends of the 50s and 60s  Saturday 27 April 2019 8pm

 Standard $59.90, Concession $54.90, Groups 8+ $49.90

i

T

IT'S BACK!

he Sydney Brick Show is a volunteer not-for-profit group of LEGO® enthusiasts who present unique, original and stunning creations for exhibition to the public. At the 2019 show, see: Over 100 exhibits on display, LEGO® City, Star Wars, Trains, Superheroes, Technic, LEGO® Movie and so much more! Enjoy fun activities, building areas, character appearances and LEGO®-themed shops. The Sydney Brick Show is not employed or affiliated with the LEGO® Company or LEGO® Australia.

 Joan Sutherland Performing Arts Centre 597 High Street, Penrith  thejoan.com.au

i

EVENT DETAILS  The Sydney Brick Show

 Saturday 6 April & Sunday 7 April Doors Open 9am-5pm Show times 9am-4pm (entry every 30 mins)  3 yrs and under are free Junior 4-16 yrs $15.05 | Adult $20.15 Family (2 Adults + 2 Juniors) (Admits 4) $64.10  Panthers Penrith Marquee, 123 Mulgoa Rd, Penrith  penrith.panthers.com.au

Issue 26 April 2019

13


ANZAC DAY

Your Conveyancing Simply Made Easy!

DAWN SERVICES

Lest We Forget PENRITH RSL SUB BRANCH THURSDAY, 25TH APRIL - ASSEMBLY AT 4:30AM The annual ANZAC Day Dawn Service will assemble at 04.30hrs and a silent march will commence from Castlereagh Street, outside of Penrith RSL Club, to Memory Park. The Service will commence once all are assembled in the park. Breakfast will be provided by Penrith RSL Club following the service, with a gold coin donation to enter.  subbranch.penrithrsl.com.au

Specialists in all property transactions throughout NSW We pride ourselves on treating each transaction as if it were our own, making it a stress-free and simple process that is tailored specifically to each individual clients circumstances.

ST MARYS RSL SUB BRANCH THURSDAY 25TH APRIL - COMMENCES AT 5AM

CONTACT US FOR AN OBLIGATION

Two large screens with live streaming of the Dawn Service will also be available. All in attendance are invited back to St Marys RSL Club for breakfast (for a small fee).  vvaastmarys.com.au

FREE QUOTE

Shop 1, 1216 Mulgoa Road, Mulgoa NSW 2745 Ph: 02 4704 3100 | Fax: 02 4704 3101

www.conveyancingsimplif ied.com.au

6.30am – 8.30am

James Van Cooper

9am – 11am

Anzac Day Dawn Service

Aussie Dolls

4.30pm – 7.30pm

Two Fire: Cold Chisel & Jimmy Barnes Show

- T h u r s d a y, 2 5 t h A p ri l 2 0 1 9 - A s s e m b l y at 4 :3 0 a m - P e n r i t h C i t y M e mo ry Pa rk -

el whe ring rol. nt stee ium uise co Premith cr w

16”

h

yw

Allo

eels

y® rPla e Ca ies. Appl pabilit ca

1.6

e.

gin

i en

GD

DRAW: FRIDAY 25TH MAY 2019 8:00PM

14

roamingpanthermagazine.com.au


Local Feature

Take Your Tastebuds on a

Smoke-filled Adventure Written by Penrith City Council

Bovine and Swine brings low and slow barbeque meats to Penrith.

I

t’s a well-known fact that slow-cooked meat just tastes better, and the Texans have been pioneering (and perfecting) this method of cooking for quite some time. Penrith local Wes Griffiths travelled back and forth learning from some of the best restaurants in Texas, and soon decided to open up his own barbeque restaurant.

All the meat is smoked for a good 10-12 hours and available to purchase for $9 per 100 grams or in a brioche bun sandwich for $15. On offer is Beef Brisket, Chopped Pork with Carolina-style sauce, Pork Ribs, Chicken Breast, Turkey Breast and Pork Belly. There’s also homemade sausages made with beef, pork, jalapeno and cheese.

Bovine and Swine Barbeque originally opened in Newtown and quickly gained a loyal following among the trendy inner-west locals but, after a few successful years there, Wes decided it was time to return home and share his delicious meats with Penrith.

And let’s face it, no meat is complete without a side or two (or three), and there’s some great options to choose from here. All sides are $7 each and include Mac’n’Cheese, Pit Beans, House Slaw, House Pickles, and Potato Salad. For those of us who have trouble deciding what to eat, there’s a Meal Plate for One (up to four choices) for $35 and a Meal Plate for Two (up to six choices and two sides) for $60.

So what makes Bovine and Swine Barbeque different from other slow-cooked meat restaurants? Well, while most of us are all enjoying the last few hours of sleep, Wes is up smoking meats from 5am using Australian Ironbark Wood so we can all enjoy that perfect bark, melt in your mouth texture and smokey taste.

SINK YOUR TEETH IN If you decide to indulge (and why not!), just don’t leave your order too late. Bovine and Swine Barbeque is only open until they sell out of their meat. Eat in or takeaway options are available on Wednesdays and Thursdays from 5pm-9pm, and Fridays to Sundays from 12pm-9pm.  Bovine and Swine Barbeque 95 Great Western Highway Emu Plains NSW 2750  02 47 351 547

With eat-in and takeaway options available, there's never been a better time to indulge in some slowcooked goodness!

Wes is up smoking meats from 5am using Australian Ironbark Wood so we can all enjoy that perfect bark, melt in your mouth texture and smokey taste

Issue 26 April 2019

15


Roaming Feature

Diesel Dirt & Turf Expo 2019

D I E S E L , D I RT, T U R F … A N D SO M U C H M O R E ! Written by Cassandra Elliot

You’ve probably heard of the Diesel, Dirt and Turf Expo because it’s Australia’s largest construction event and it runs across three days. But did you know it’s not all about the boys and their toys?

R

oaming spoke with Michael from the DD&T Committee about the upcoming expo. “Kids are encouraged to come! It's the first really

family-friendly trade expo that's been held. It's not a stuffy event, it's all about fun,” he says proudly. “That's why the exhibitors have all sorts of giveaways and things so the kids can really be a part of it all. 16

roamingpanthermagazine.com.au

“A lot of families come down; there's kids in pushers, young ones running around, and kids can climb on a lot of the big machinery and pretend they're actually driving it, which they love. It makes for a great photo! “There are lots of great giveaways from the exhibitors too. They offer an array of little hats, tools, hammers, fluro vests and things, so the kids really get involved. “There's a great demonstration area where you can watch the machines dig really big holes, safely, from behind a fence, and huge loads being lifted and everything. There’s lots of exciting stuff for those who want to see the big machines up close and watch how they work.” Michael explains that the kids can even have a go themselves. “There’s these little big-rigs, which are little scale-model trucks, excavators and cranes that work, so the kids line up for them. They love these because they get to play on them, learn how an excavator or whatever

works, and they operate them themselves. That’s where you’ll find the lines,” he laughs. It’s not all about the kids, though. There’s plenty of entertainment for adults, too. There are live bands, food stalls, and even a licenced bar if you want a drink or two. If you just want to sit in the shade and let the kids play for a while, there are nice shady spots for you to do that, too. And why not, when the whole event is free? As Michael says, “it’s a really good three days out for the whole family!” The Diesel, Dirt and Turf Expo started in 2016 as a way for the earth-moving industry to connect with local businesses. “There were a few other shows that existed beforehand, but none that were so inclusive of getting people interested in the industry. It's really an industry that's making itself available for anyone who's interested in it, wants to know about it, or wants to know what's going on with technology.”


Roaming Feature

The DD&T Committee incorporated family entertainment and made it available to everyone by holding it over a weekend that coincides with school holidays and great weather. It was a success. In its first year, 30,000 people attended the event, and a lot of the same people keep coming back. And for businesses, the expo is just as impressive. In their first year, one business sold over a million dollars’ worth of gear in the first two days. “It's grown again; last year we had over 70,000 people, so it really has a lot of appeal.” Michael says it’s such a success because it’s an industry expo run by businesses and representatives who are in the earth-moving industry. The show initially appealed to those who are diesel mechanics, those who work in construction, and those smaller 'mum and dad' businesses, but the event appeals to so many more now. “There’s just a fascination for seeing how things get built, how really big holes are dug, and how infrastructure is done in a city like Sydney,” he says. For those in the earth-moving industry, there’s nothing like this expo. Whether you’re in the market for some equipment and want to compare machinery side-by-side (and talk to representatives from the big manufacturing companies), you want to learn about the latest developments and technology, or you want to put your digger-operating skills to the test and prove you’re the best in one of the operator challenges, the DD&T Expo is where you need to be. The operator challenges are a highlight of the event, putting machine operators through a number of

challenges involving skill and experience, competing for thousands of dollars in cash and prizes. But don’t worry - if you don’t operate machinery, you can still win! There are huge prizes and giveaways throughout the weekend. Some are even won just by visiting all the exhibitor’s stalls and getting your passport stamped. Who knows, you may even win some muchneeded gear for your truck or a new piece of technology to make work easier! “It's getting bigger every year. There's over 200 exhibitors, and every year we have a close look at what makes it enjoyable for people to attend and we improve on that. For example, having signage on all the roads, and upgrading the toilet and food facilities.” People come from overseas just to attend this event. A lot of exhibitors find the event so successful for their business that they come back and want an even bigger stall next time. A lot of planning goes into this three-day event. With less than a dozen people coordinating the planning of such a big expo, as soon as one event finishes the team begin planning the next one. “It’s a big job,” says Michael, “but it’s such a great team of people. “If you like big machines, if you've got young kids who've got an interest in digging up roads or building railway lines or anything like that, this event’s for you." With free parking, heaps of giveaways, and absolutely no entry cost, the expo is undeniably a great day out for the family. We'll see you there!

  There’s lots of exciting stuff for those who want to see the big machines up close and see how they work i

EVENT DETAILS  D  iesel Dirt & Turf Expo 2019  F  riday 3 May to Sunday 5 May  REE ENTRY  F  enrith Panthers Rugby League Club  P  dieseldirtandturf.com.au

Issue 26 April 2019

17


Inspiring Story

Incredible

Izzy

LIFE IS TOUGH, BUT IZZY IS TOUGHER

B

Written by Manisha Foley

eing tired and lethargic is usually synonymous with being a teenager, especially one beginning her journey in high school. For Izzy Dunn, however, it was a far more serious illness that she or her family could ever imagine taking over their lives. “The day before Mother’s Day last year we went to the local GP,” explains Izzy’s mum Nicole. “To rule out physical symptoms the Doctor suggested a routine blood test. When the haematologist called back to tell me to get my daughter to the hospital straight away, I knew it was something serious.”

“At first, I thought it was Pop and that he wasn’t well,” says Izzy. “I started to freak out and got told that I was just going to the hospital for a check-up. Mum and Dad had an idea of what may have been going on, but we didn’t find out officially until the Monday.” Izzy’s parents had to absorb the fact that their young daughter had Acute Myeloid Leukaemia (AML). Acute Myeloid Leukaemia is a type of cancer that affects the blood and bone marrow. An overproduction of immature white blood cells called myeloblasts crowds the bone marrow, preventing it from making normal blood cells. AML is a rare disease, accounting for 0.8% of all cancers diagnosed.

The Fight of Her Life

Relying on a Stranger

Izzy and her family’s strength and determination to beat this awful disease would come to light when Izzy had to go through months of harrowing treatments that decimated her body.

The next step was a Bone Marrow Transplant. This treatment is demanding both physically and mentally, and is sometimes the only option that offers the prospect of cure or survival. For it to be successful, Izzy had to find a matching donor. Family members are the first that are tested to see if they are a perfect match. Unfortunately, no one in Izzy’s family was. The family then had to go on the World Register to find out if there was someone that would match.

From May through to September, Izzy had 58 rounds of chemotherapy. She lost count of blood transfusions, skin biopsies, lumbar punctures, and monthly bone marrow biopsies. There were also multiple appointments with specialists, and questions about fertility that had Izzy make difficult choices on a future that she hadn’t contemplated yet.

Nicole and her husband found it very difficult to tell Izzy until they had all the answers. They waited until Izzy had undergone a Spinal Tap and Bone Marrow Aspiration before confirming that she had a rare form of cancer.

Izzy was also prone to nosebleeds, with one taking four hours to stop. An added complication was that she was neutropenic, meaning her white blood cells were not helping the body fight infection.

“I would never think that this would happen,” says Izzy. Nicole echoes these thoughts.

“She did not have a strong immune system,” explains Nicole. “The common cold could have killed her.”

“She hadn’t been to see a doctor in two years - she even ran 5km the week before! As a parent, it was hard to not have any control over the situation.”

Izzy and her family hoped that all these treatments would aid in getting rid of the cancer. Sadly, they were told that the chemotherapy was ineffective; news they did not want to hear.

After Izzy’s diagnosis, however, it was Izzy herself who made every single decision moving forward.

“Two matches came back, and one was perfect,” says Nicole. “Because they are anonymous, all we knew was that the donor was a 34 year-old male.” The timing of the procedure is critical and invasive. Two weeks prior to her transplant, Izzy had 21 million stem cells removed. Her blood would then undergo a procedure where the stem cells and plasma were separated, and the blood put back into her body. “They also had to kill all my cells, so none of my DNA could remain. This meant I had extremely strong chemo over four days.” On 20 September 2018, the day of the transplant, a nurse had to fly across the world to retrieve the donor’s cells and

Izzy’s maturity and power at the weakest points... were part of the reason that she’s still here to live and fight another day. 18

roamingpanthermagazine.com.au


Inspiring Community

come back on the same day. The actual procedure itself took 15 minutes, with Izzy asleep the whole time. “It took a while for my body to accept it. There was a war raging on inside of me and I had to be very careful after the transplant because my immune system was at an all-time low. I was allowed outside of the hospital for one hour only!” And all Izzy wanted to do was go home and sleep in her own bed. “We were in the process of renovating the house when she was diagnosed,” says Nicole. “And when we could finally have her back home, we had to speed up the reno’s! Wayne did 90% of the renovations himself to make sure the house was in order before she came home. We couldn’t risk a speck of dust making her ill.” Izzy’s family (including her brother Shawn and his fiancé Jenna) were not the only ones who were banding together to make sure she came home. Their network of friends was also with her every step of the way. “My best friend Jordan was so supportive,” smiles Izzy. “She even took part in the World’s Greatest Shave for me!” “The nurses were also incredible at the hospital,” explains Nicole. “Every single nurse in the cancer ward is special, and every time we went in we hugged and kissed them all. To nurse children through life-threatening diseases is absolutely incredible. “Both our workplaces (NSW Police and NSW Fire & Rescue) showed us so much support along the way too. And I have to give a special mention to Peter Shaw and Melissa Gabriel

from the Bone Marrow Transplant team, as well as Paediatric Oncologist Dr Bhavna Padhye, for their expertise and compassion.” Once Izzy’s weight was stable and she could increase her fluid intake, she was then given the all-clear to finally leave hospital. She had not been at home from May 2018 to October 2018. Now Izzy has check-ups but once a fortnight. But she and her family remain vigilant; Izzy cannot eat takeaway, as there may be a risk of food poisoning which could be fatal. She also has to have all her vaccinations administered and can't return to school just yet. To celebrate Izzy’s cancer survivorship, the Dunn family is getting on board with the Relay For Life. Izzy’s brother has a team (B.U.T.T.S), which they will join.

SHOW YOUR SUPPORT

“We are going to do the walk and kick cancer’s butt!” says Nicole. For the better part of last year, the Dunn family lived their lives around numbers; blood count, red cells, white cells, and the like. And they became fluent in a language few could imagine needing to learn; the language of cancer. Due to their strength, and one extremely tenacious 12-year-old, they beat the odds and fought this disease with every bit of ammo they had. Izzy’s maturity and power at the weakest points in her young life were part of the reason that she’s still here to live and fight another day.

Relay For Life brings together communities to celebrate survivors, remember loved ones lost, and fight back against cancer. Want to support the Dunn family and incredible Izzy? Then head to the Relay for Life Penrith Page to make a donation!  Relay for Life - Penrith 2019  cancercouncil.com.au/event/relay-for-life-penrith/  Saturday 4 May - Sunday 5 May  Ransley Street, Penrith

FEEL AT HOME HOME AT QUEST QUEST ‘INSERT PENRITHLOCATION’ At Quest, we’ve built a network of apartment Quest Penrith brings a new standard of accommodation to Penrith hotels to provide business travellers with spacious and for the short and long stay traveller. Located in the regional hub comfortable accommodation, that’s conveniently located of Penrith, Quest Penrith is situated on Lord Sheffield Circuit, wherever you need to be. strategically positioned within close proximity of the Penrith Train Station‘location’ and just aoffers shortxx stroll Westfistudios, eld Penrith. Quest selffrom contained one, two and three bedroom apartments for whenever business takes you to Quest Penrith offers a variety of different apartment style room ‘insert location’. types, to cater to whatever your accommodation needs might be. Complimentary WiFi On-site Property Manager Separate living and dining areas Complimentary High Speed WiFi Fully equipped kitchens Gymnasium On-site car parking Businessgym lounge On-site and sauna Conference facilities Laundry facilities

Visit questpenrith.com.au Visit questlocation.com.au or call call 01 022345 91366789 1100

Issue 26 April 2019

19


Food

C SIRO

Sweet Potato & Haloumi Fritters

PROTEIN

Plus

An evidence-based strategy for achieving weight loss or for general weight management, and for those wanting to improve their lifestyle for healthy ageing.

Serves 4

PREP TIME: 15 MINS COOK TIME: 25 MINS

INGREDIENTS 9 1.2kg orange sweet potato, peeled and coarsely grated 9 320g haloumi, coarsely grated 9 2 teaspoons ground cumin 9 Light olive oil spray, for cooking 9 2 cloves garlic, crushed 9 4 spring onions, white part thinly sliced into rounds, green part thinly sliced diagonally 9 120g baby spinach leaves Avocado Dressing 9 ½ (80g) medium-sized avocado 9 ¹⁄³ cup (80ml) white wine vinegar or apple cider vinegar 9 ½ teaspoon Dijon mustard. METHOD 1 To make the avocado dressing, blend all the ingredients in a jug with a hand-held blender until smooth. Season with black pepper and set aside. 2 Heat a large non-stick frying pan over low–medium

heat. Combine the sweet potato, haloumi and cumin in a bowl and season with freshly ground

CSIRO PROTEIN PLUS NUTRITION AND EXERCISE PLAN  Dr Jane Bowen, Grant Brinkworth, Genevieve James-Martin  RRP $34.99 (Paperback)  publish.csiro.au

Over the past three decades, the CSIRO has conducted extensive research to understand diet and lifestyle strategies that optimise weight management, health, and wellbeing for everyday Australians. Based on this research, scientists have found that a daily protein intake higher than the current recommendations can benefit many people - namely, people who are trying to lose weight, those who need to gain muscle mass, older people who want to stay physically strong and active as they age, and those following a strictly plant-based diet.

20

roamingpanthermagazine.com.au

black pepper. Lightly spray the pan with olive oil and drop in firmly-packed ½ cup measures of the sweet potato mixture, pressing down to form 8cm circles. Depending on the size of your pan, you will probably need to do this in two batches of four. Cook for 5 minutes each side or until golden and cooked through. Remove and cover to keep warm. 3 Lightly spray the pan with a little more oil and

increase the heat to high. Add the garlic, white part of the spring onion, spinach and ¼ cup (60ml) water. Cook, tossing constantly, for 2 minutes or until the spinach has just wilted. Remove the pan from the heat and season with black pepper. 4 Serve two sweet potato fritters per person,

layered with the spinach mixture. Spoon over the dressing and sprinkle with the green spring onion.

TIP

If you want to reduce the salt content of the haloumi, place the block in a bowl of water for 30 minutes to steep. Drain before use.


Food

Cheesy Breakfast Beans Serves 4

PREP TIME: 15 MINS COOK TIME: 25 MINS

INGREDIENTS 9 1 tablespoon olive oil 9 1 onion, finely chopped 9 2 teaspoons sweet paprika 9 1 x 400g tin crushed tomatoes 9 600g drained and rinsed tinned red kidney beans 9 160g tasty cheese, coarsely grated 9 ½ teaspoon dried mixed herbs 9 4 x 40g slices multigrain bread, toasted, halved.

METHOD 1

Heat the olive oil in a large saucepan over medium heat. Add the onion and paprika and cook, stirring occasionally, for 5 minutes or until softened and light golden.

bubbling. Season with freshly-ground black pepper. 5 Serve the beans hot with toast for dipping.

2 Reduce the heat to low. Add the tomatoes and

kidney beans and cook, stirring occasionally, for 15 minutes or until the mixture has reduced and thickened slightly. 3 Preheat the oven grill to high. 4 Transfer the bean mixture to a 1 litre flameproof

baking dish. Sprinkle over the cheese and then the mixed herbs. Cook under the grill for 2–3 minutes or until the cheese is melted and

TIP

Because you will be draining off quite a bit of liquid, you will need to buy three 400g tins of beans to have the required quantity for this recipe. Store the leftover beans in an airtight container in the fridge for up to three days, or freeze in an airtight container for up to three months.

Issue 26 April 2019

21


Food

Chicken Soba Noodles Serves 4

PREP TIME: 15 MINS COOK TIME: 10 MINS

INGREDIENTS 9 3 teaspoons sunflower oil 9 1 teaspoon sesame oil 9 400g lean chicken breast fillet, thinly sliced crossways 9 1 red onion, cut into wedges 9 1 bunch Chinese broccoli, trimmed, stems thinly sliced and leaves torn 9 2 tablespoons salt-reduced hoisin sauce 9 1 tablespoon salt-reduced soy sauce 9 2 teaspoons finely grated ginger 9 1 x 180g packet shelf-fresh soba noodles 9 1 bunch broccolini, trimmed, stalks halved lengthways, then halved crossways 9 ½ cup small coriander sprigs.

METHOD 1

Heat the sunflower and sesame oils in a large wok over high heat. Add the chicken and stir-fry for 3-4 minutes. Add the onion and cook for 1 minute.

2 Add the Chinese broccoli, hoisin,

soy sauce, ginger and 2 tablespoons water. Stir-fry for 2 minutes or until the chicken is cooked and the vegetables are just tender. 3 Meanwhile, bring a large saucepan

of water to the boil over high heat. Add the noodles and broccolini and cook for 1-2 minutes or until the noodles are heated through and separate easily, and the broccoli is just tender. Drain well, then divide among serving bowls. 4 Spoon the chicken mixture over the

noodles, top with coriander, and serve.

Double-Choc Raspberry Brownie Serves 8

PREP TIME: 20 MINS COOK TIME: 35 MINS

INGREDIENTS 9 ¼ cup (45g) light margarine, melted 9 ½ cup (50g) cocoa powder 9 ¼ cup (50g) unsweetened apple puree 9 2 tablespoons pure maple syrup 9 2 teaspoons vanilla 9 4 large eggs 9 1 cup (120g) almond meal 9 100g dark chocolate (70% cocoa solids), broken into pieces 9 125g raspberries. METHOD 1

Preheat the oven to 160°C (140°C fan-forced). Line the base and sides of a 20cm square cake tin with baking paper.

2 Place the melted margarine, cocoa powder,

apple puree, maple syrup, vanilla and eggs

22

roamingpanthermagazine.com.au

in a large bowl. Using a hand-held electric mixer, beat on high speed until smooth and well combined. Stir in the almond meal. 3 Pour the almond mixture into the prepared

tin and smooth the surface. Gently press the chocolate and raspberries into the batter until partially submerged. Bake for 30-35 minutes or until the brownie is set around the edges and just set in the centre. Cool completely in the tin. Cut into eight even pieces and serve.

TIP

You can swap the fresh raspberries for ¾ cup (95g) frozen raspberries, if desired. The cooled brownies can be stored in an airtight container at room temperature for up to three days, in the fridge for up to a week, or in the freezer up to three months. Thaw overnight in the fridge.


Home Living

Style Your Kitchen HOW TO

As the heart of any home, the kitchen brings the whole house together unlike any other space.

I

t’s where all the action happens, so take the time to make your kitchen a functional, fun and beautiful place to be. Every kitchen needs bar stools that are equally stylish and comfortable, as well as playful pops of colour for a loved and lived-in look. Decorate with a pendant light, natural greenery, fresh produce, vases, kitchen towels, artwork or wall hangings.

Pop Star Modernise the look! Bright colours bring a fun energy to your space. Use your favourite pops of colour in pendant lights, artwork, hardware, tea towels and appliances.

Toowoon Bay renovation Images courtesy of Kara & Kyal Demmrich

Style Up Your Kitchen ALL ITEMS AVAILABLE AT PENRITH HOMEMAKER CENTRE

It’s Only Natural

Luxe barstool in ink velvet $199 each, Early Settler

Fresh flowers and foliage bring your room to life. Use vases of varying heights and mix up your greenery with natives like silver dollar or parvi eucalyptus.

Statement Piece A splash of bold colour adds personality. Taubman’s Midnight Hour (shown) makes an elegant statement and anchors the space.

Cherry Picking

Harper banana leaf placemat $19.95, Provincial Home Living Home Republic tangier wall hangings from $65.99, Adairs

Wire basket $16.95, Provincial Home Living

Oranges, lemons, apples – display the fruits you use most often. For maximum visual impact, fill a bowl with one variety of eye-catching fruits.

POP IN STORE FOR ALL THE INSPIRATION YOU NEED

Phoenix vivid slimline basin mixer in matte black $291.50, Harvey Norman Tropical leaf large vase in green $19, Domayne

Visit Penrith Homemaker Centre for all your kitchen style needs.  Cnr Mulgoa Rd and Wolseley St, Jamisontown 2749  penrithhomemakercentre.com.au

24

roamingpanthermagazine.com.au

Taubmans Endure 2L interior in Midnight Hour $62.50, Bunnings


FIND YOUR

Local

Y OUR LOCA L BUSIN E SS D I RE C T O RY

Want To Advertise Your Business?

Reach 60,000 homes in Penrith and the Blue Mountains. Book your space today! For more information Contact Sam on  0431 281 689 or  samantha@roamingpanthermagazine.com.au

Painter

Local Directory

Concreter S&L CONCRETE Locally owned and operated, with excellent workmanship at affordable prices.  Penrith, Blue Mountains and the greater area  0411 704 302  slconcrete5@bigpond.com  slconcretensw SLCONCRETE.COM.AU

Accountant

Conveyancer

URBAN PAINTING & DECORATING

A&TA ACCOUNTING & TAXATION ADVANTAGE

CONVEYANCING SIMPLIFIED

Master Painters servicing Sydney and its surrounding areas.

A team of accountants dedicated to simplify your life by helping you understand and make sense of your numbers.

Your Conveyancing simply made easy! Specialists in all property transactions throughout NSW.

 Covering the greater Sydney region  0408 012 582  richard@urbanpainting.com.au  urbanpaintingdecorating

 37 Ross St, Glenbrook 2773  1300 692 228  info@byata.com.au  @acctaxadv

 1/1216 Mulgoa Rd, Mulgoa 2745  02 4704 3100  info@conveyancingsimplified.com.au  @conveyancingsimplified

URBANPAINTING.COM.AU

BYATA.COM.AU

CONVEYANCINGSIMPLIFIED.COM.AU

Helping you make better choices in the Blue Mountains, Penrith and Glenmore Park

Home loans | Financial planning | Risk and General insurance | Car loans | Business lending

talk to us today p 4739 9749 Blaxland p 4721 1733 Penrith p 4737 2417 Glenmore Park w MortgageChoice.com.au/rob.lees Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Pty Limited ACN 158 645 624. AFSL 422854.

Issue 26 April 2019

25


Local Story

Shannon rith n e P g n i t Boyd Pain ONE WALL AT A TIME Written by Cassandra Elliot

Since painting the inside wall of a local burger shop a few years ago, Shannon Boyd’s art has exploded throughout Penrith.

H

is murals are featured all around Western Sydney, from local schools and PCYCs to cafés and bars. His work is on roller doors along High Street. And he’s been commissioned to do work as far as Maitland, Newcastle and Melbourne. “I went down to Melbourne for a holiday last year and did some artwork in the laneways down there, which was really cool. I got permission from a little café down there opposite the alleyway, and that artwork was pretty fun. “I did a mural on the Bondi Beach Graffiti Wall, which was huge. That was in 2017. That’s definitely a highlight for me,” he smiles. “PCYC Penrith has been really cool, too. I got to paint several people for the refurbishment in 2017. I painted Mick Fanning, Jess Fox and Nathan Cleary on the back of the PCYC. I love doing work in my local area. No-one else is really doing what I’m doing in Penrith, which is great for me.” SB Illustrations is Shannon’s Instagram handle, and he’s felt the support from the local community through his social pages. “Nathan Cleary has been really supportive. He took a photo with his mural and shared it on his social, and used it for an interview when he re-signed with Penrith. Jessica Fox too - she came down and took photos with me, and we keep in touch. Mick Fanning as well - he was born in Penrith. He reached out through his social, acknowledging the work, which has been really rewarding.” Portraits are Shannon’s specialty and he’s done quite a few of them around town.

When people are mentioning me and my work, that's really rewarding

“A lot of clients have their own ideas and suggestions of who they want to feature, like High Street Music. They wanted to do The Beatles and I kind of suggested that we keep it local - not just Penrith, but Australian music. So we ended up painting Michael Hutchence from INXS, Kylie Minogue and Angus Young. Just sitting down at High Street Depot and seeing people walking along and stopping to get photos with them, that's awesome. “In two short years I’ve ticked off a lot of goals that I’d set myself for five years, but I guess one day I’d really like to do some big artwork, like some silos or some big buildings and the wall-to-wall festivals. I’d love to get them started.” Shannon wants to convince Penrith Council to hold wall-to-wall festivals every five or so years. The idea is to bring local businesses with blank walls together with local artists who’d like to brighten up the area. He says the competitions will be great exposure for artists and brighten up the community at the same time. “I’m just so thankful to be getting paid to do what I love, especially in my local area. When I walk around Penrith, I just think about what could be. There's so much room for it. But when people are mentioning me and my work, that's really rewarding too.”

check shannon out Connect with Shannon via Instagram at  SB Illustrations.

AUSTRALIA’S LARGEST CONSTRUCTION EXPO IS BACK IN 2019! PANTHERS PENRITH 123 MULGOA RD SYDNEY | DIESELDIRTANDTURF.COM.AU

3-5 MAY 2019

®


Travel

Special Events or Festivals TRAVELLING FOR

A GREAT WAY TO PLAN YOUR TRIP!

Famous illuminated ice sculptures and structure at the annual Harbin Ice & Snow World Festival

No matter what your interests, there is an event or festival to commemorate it.

A

ttending a festival, event or special anniversary when travelling is the perfect way to immerse yourself in the culture and customs of a destination or to remember a significant piece of history. Here are just a few ideas.

London, Notting Hill Carnival

Melbourne Cup Carnival

Melbourne Cup Carnival Singapore, Chinese New Year

New York, New Years Eve

Bhutan, Tshechu Festival

Mongolia, Naadam Festival

Local Experts

LONDON has historically been at the epicentre of English life. Today London is one of the most diverse, exciting and creative cities in the world. There are many annual events including the Notting Hill festival, the pageantry of the Trooping of the Colour, or the amazing Chelsea Flower Show. From battlefield tours to a West End show, and from a football game to centre court at Wimbledon, London really does have it all.

Lynette, Kerrie, Jenny & Nicole Travel Experts Maria, Fellowes & Turner Travel Associates Penrith

MELBOURNE has a flavour to tempt every tastebud. Melbourne has more restaurants and cafes per capita than any other city, with an assortment of cuisines and absolutely no end of stylish bars. Maybe enjoy the cricket on Boxing Day, centre court at the Australian Open, or a day at Flemington for the Melbourne Cup. SINGAPORE is modern and pulsating with life 24/7. The city is safe and clean, and offers an endless list of things to do across culture, dining, night life and the outdoors. Chinese New Year is a magical time, with parades and events all over the city! Or perhaps action is more your style, in which case enjoy the Formula One Grand Prix for a great experience.

Local travel experts with world wide experience.

NEW YORK is the place to discover hidden bars, local restaurants, the changing art scene, amazing Broadway shows, museums, the Statue of Liberty, and so much more. Perhaps join the crowds to party all night in Times Square on New Years Eve, waiting for the famous ball to drop at midnight, or attend one of the many film or art festivals throughout the year. The city that never sleeps awaits you.

We offer the widest range of travel options available and specialise in creating unique and experiential holidays with a difference.

BHUTAN is a truly magical destination that has only opened up to tourism in more recent times with amazing scenery and welcoming locals. A visit to a Tshechu (festival) is an experience you will never, ever forget. MONGOLIA hosts the annual Naadam Festival, a sophisticated and eloquent expression of nomadic culture. It is an honoured celebration of national independence and an outstanding combination of arts and sports.

Be inspired by Kerrie, Lynette & their team, who with their years of travel experience, can help you discover the hidden gems in your next destination without Localvalue-filled travel experts with stress by delivering tailored, itineraries to world wide experience. exceed your expectations.

Maria, F premium well-tra

We offer unique a

Whether Be inspir experien without expectat

That’s w

Maria, Fellowes & Turner Travel Associates is Flight Centre Travel Group’s

premium travel brand, bringing together the most knowledgeable & That’s where our experience counts. well-travelled consultants across Australia.

We offer the widest range of travel options available and specialise in creating unique and experiential holidays with a difference. Whether it’s an indulgent weekend escape or an overseas trip-of-a-lifetime. Be inspired by Kerrie, Lynette & their team, who with their years of travel experience, can help you discover the hidden gems in your next destination without stress by delivering tailored, value-filled itineraries to exceed your expectations.

HARBIN in China hosts the annual ice festival, the world’s largest. With ice sculptures, an art expo, ice lantern art fair, ice and snow amusement park, ice bar and restaurant, and much more, this is a truly unique experience.

That’s where our experience counts.

Freecall or emai 14 Macq travel-as

Harbin, Ice Festival

Flight Centre Travel Group Limited (ABN 25 003 377 188) trading as Travel Associates. ATAS No. Accreditation A10412. Flight Centre Travel Group Limited 25 003Accreditation 377 188) trading as Travel Associates. ATAS Accreditation No Flight Centre Travel Group Limited (ABN 25 003 377(ABN 188) trading as Travel Associates. ATASTAJD160906 Accreditation No. A10412. TAJD1 Flight Centre Travel Group Limited (ABN 25 003 377 188) trading as Travel Associates. ATAS No. A10412. TAJD160906

stop dreaming and start planning To arrange a travel package to a festival or event of your dreams, make an appointment to come and see us! Give us a call at Maria, Fellowes & Turner Travel Associates Penrith on 1800 040 744.

Freecall 1800 040 744 or email Freecall 1800 040 744 or email penrith@travel-associates.com.au penrith@travelassociates.com 14 Macquarie Avenue, Penrith NSW 2750 travel-associates.com.au/mariafellowes 14 Macquarie Avenue, Penrith NSW 2750 travelassociates.com/mariafellowes

Flight Centre Travel Group Limited (ABN 25 003 377 188) trading as Travel Associates. ATAS Accreditation No. A10412. TAJD160906

Issue 26 April 2019

27


Wellbeing

Physio N I A Hip P FOR

Hip pain is another one of the common issues that we see in the practice.

The hip has a job to do, and that’s to keep you mobile

Local Experts Kris Caloia & Karl Thornton

Physiotherapy Experts Progressive Sports & Spinal Physiotherapy

W

e bet that you probably know a relative or family friend who suffers with hip pain or may have even had a hip replacement, are we right? This particular pain can be caused by a wide variety of conditions, and can also be what is termed as ‘referral pain’ if another part of the body has an injury or condition. When you think about it, your hip is a very large and crucial ball and socket joint with cartilage that sits in between. Surrounding the hip are powerful muscles that help to move you forward when you walk. The muscles surrounding the hip play a huge role in controlling the knee and ankle movement, too. So, to put it simply, the hip is a very important part of our bodies that must function well to get the most out of life.

Unfortunately, there are many conditions and injuries out there that our hips can develop which can result in pain, including: • Osteoarthritis and Rheumatoid Arthritis • Pinched nerves, and • Conditions from other areas, such as • Hip fractures your back and gynaecological issues. • Bursitis • Tendinitis With or without pain, the hip has a job to do and that’s to keep you mobile. Ignoring hip pain over a long period of time can only make matters worse. Minor problems can often result in long-term injury and really take away that everyday quality of life.

POWER TO

KEEP MOVING

• A lack of strength or control in your hip joint can often injure the surrounding soft tissue. • If your hip is injured, this can then cause strain on your knee and ankle. If you or someone you know suffers with hip pain, did you know that an early assessment of your pain and treatment can help you delay or avoid invasive procedures like injections or even potential surgery? When you come to our practice, your physiotherapist will get to know your history, take you through a thorough assessment process, and answer all of your questions. Once we have an accurate picture of your condition, we: • Talk to you about the best treatment options • Create a personalised rehabilitation program • Suggest exercises for you to do at home, and • Give you strategies to manage and minimise your pain. Our qualified physiotherapists successfully treat a whole range of hip injuries and chronic conditions: • Gentle hands-on physiotherapy is often the best starting point to ease hip pain • Hydrotherapy is an effective way to strengthen and support your hips, and • Often small lifestyle changes can protect your hips. suffering from hip pain?

4/29 York Road, Jamisontown | (02) 4721 7798 www&rorssi+raoma* | ind *s on soia" 28

roamingpanthermagazine.com.au

If you’re suffering with hip pain, or know someone who is, contact Progressive Sports and Spinal Physiotherapy today on 47217798 or email info@progressiverehab.com.au.


Beauty

Wellbeing

Ageless Society

Written by Kelly Battersby, Face Clinik

I

t’s more and more common today to seek that youthful glow. And why shouldn’t we? We’re all living longer, taking care of our mind, bodies and soul, so why shouldn’t we slow down some of the visible signs of aging?

One of the options we have to do this is via injectables. Anti-wrinkle injectables reduce fine lines caused from muscle movement. Dermal fillers are another form of injectable – they’re thick and gel-like to create volume and shape in the face.

Healthy Snack Ideas With the school holidays and Easter happening this month, this usually means chocolate - and a lot of it!

Snack Ideas

Injectables are often misunderstood. So let’s talk about some of the common misconceptions surrounding this treatment. YOU’RE NOT TRYING TO LOOK 21 AGAIN, OR BE MUMMIFIED

HERE ARE SOME OF MY FAVOURITE GO-TO SNACK AND EASTER FUN IDEAS

You’re not trying to reverse the clock – it’s about looking refreshed and rested. When you use a good cosmetic injector, no one will be able to notice. When treating new clients, I often hear, “Oh I don’t want to look fake” or “I still want expression or movement”.

Fresh Fruit

Injectables have come a long way since Nicole Kidman’s face scared everyone off when she had no expression! We want movement and, above all else, smoothness, youthfulness and improved skin tone – all of which can be achieved.

Nuts & Seeds

IT’S NOT PAINFUL Believe it or not, injectables don’t hurt. There’s a huge stigma with needles in general, and most of us automatically recall that horrible experience we had back in Year 7. In all honesty, the process is so quick that you’ll be shocked at how painless it really is!

So there you have it – three of the most common misconceptions about injectables. They’re not for everyone but, with their popularity skyrocketing, they’re becoming more and more favoured as part of an overall beauty regime. make a booking Face Clinik is located in the local areas of Penrith and Glenmore Park. To book a consultation with Kelly, please call 0415 502 064 or visit faceclinik.com.au.

(any way)

Yoghurt: Full-Fat & Plain

Rice Paper Rolls or Sushi Rolls

Wraps

Frittata

Rice Crackers/Vegies

Protein Balls

Vegies such as cucumber and carrot cut up with dip such as mashed avocado, tzatziki or hummus, or with cheese or nut butters

C

Eggs

Meatballs

Cut up into small servings (peanut butter, ham, cheese, chicken, etc)

It’s safe to say you can get lip fillers without looking like a duck.

Falafel Balls

Cheese Pieces

Best to add flavour yourself with fruit or some cinnamon

YOU WON’T LOOK LIKE A DUCK

In recent years lips have been extreme, which has led to people correlating bad injecting with lip fillers. Dermal fillers were not designed to be over-injected but, unfortunately, they have been. Our philosophy, which I’m sure is shared by other clinics, is a more natural approach that’s about enhancing, and not deforming, lips.

Written by Fiona Kane, Informed Health

With a mix of egg and grated vegies either cut up into small squares or made in muffin trays With ingredients such as coconut butter or oil, nut butters, cacao, ground nuts/ seeds and dried fruit.

hildren often enjoy being involved in preparing these dishes, making funny shapes with fruit pieces or fruit skewers. Cookie cutters are useful for creating fun shapes out of melon pieces.

The protein balls and fruit can be fun at Easter. Remember that Easter activities such as the egg hunt can be done with a mixture of eggs and other small toys or bubble blowing kits etc; it doesn’t need to be all about treats. Other great Easter activities include art and crafts, painting actual eggs, and egg and spoon races. It's best if Easter isn't only about chocolate! Keep packaged foods to a minimum. When you do use them, choose the ones with the lowest sugar and ingredients you recognise as food. Don’t believe the claims on the front of the packaging and always look at the ingredients. Remember that one teaspoon of sugar is 4g, so when you read a label and it says it has 24g of sugar that means it has six teaspoons of added sugar! The World Health Organisation recommends that, to maintain good health and healthy teeth, it's important to keep added sugar between three and four teaspoons depending on your child’s age. It's zero for infants and very small children, and six for adults. Of course, it's OK to have treats - just be aware of how much sugar and junk food your children eat, keeping it to a minimum. FIND OUT MORE Contact Fiona Kane, Nutritional Medicine Practitioner, Holistic Counsellor and Life Coach at the Informed Health Nutritional Wellbeing Centre.  informedhealth.com.au Issue 26 April 2019

29


Lifestyle Hacks

Lifestyle Hack

SHARE Y LIFESTYL OUR E HACKS

SCORE YOURSELF A “FREEBIE” OR A “HOT DEAL” It sometime pays to sign up as a member or the mailing list when asked when finalising your purchase.

A

s my 39th birthday swiftly approaches, my emails are now being bombarded with vouchers for free donuts, ice creams and meals; and I’m not complaining! About two years ago, I started signing up for company mailers and free store cards, making sure I enter my dates of birth on their online store. Then about one month prior to my birthday each year, I start receiving freebies. Some have a minimum purchase (buy one meal get the birthday meal free), but most are straight out free things. Not all of them will appeal, but I always find a few things each year that I want to take advantage of. One mistake I did make was to use my personal email. Instead I would suggest setting up an email solely for this and only checking it one month prior to your birthday because, as you can imagine, you get marketing emails throughout the year, too.

Get more lifesty Facebook: le hacks, follow m e on: My So-Cal led Li Instagram : @mysclife festyle style

-Luisa Patisso Written By Maria d Lifestyle from My So-Calle

Do you have a Lifestyle H ack that helps you o ut with life? Email us yo ur tips and tr icks and you could b e featured in our next issue of Roam ing: editorial@ro amingmagaz ine.com.au

HO DEA T LS

My Hit List for Special Offers

*

Boost Juice

Free Boost Juice for Vibe club members

Cotton On

Cold Rock

1 free ice cream on birthday and a $10 off Birthday Cake Voucher

$10 Birthday pressie voucher to use in-store or online

Forever New

Hungry Jacks

A free Whopper burger on your birthday

15% off full price items for the month of your birthday via email

Krispy Kreme

Free 4-Pack of Original Glazed Doughnuts

Jeanswest

$10 birthday voucher with no minimum spend - full priced items only

RASHAYS

$10 Gift Voucher on your Birthday to spend at any RASHAYS Casual Dining Restaurant

Katies

$20 birthday voucher $50 min spend

Myer

$10 voucher for silver members, $20 voucher for gold members

San Churro

Free churros for two

Best & Less

15% off code to use in-store or online

Spotlight

$10 off on birthday

Witchery

$10 Gift Voucher for standard members

The Body Shop $10 Voucher for your birthday

Woolworths Rewards

5 x points on every shop for 1 week Now 5 x points on your first shop only.

Bonds

*Terms & conditions apply. Please check all offers still apply at time of print.

$10 eGift Card to use in-store or online

Specialising in the Sale of Quality Residential and Acreage Properties

14 YEARS O F LO CAL REAL ES E X P E R TAT E IE N C E

Established by Paul Merrick, one of the leading and most trusted agents in the Nepean Valley and Lower Mountains for over a decade, the company has been founded with a vision to give clients the value and service that they rightfully deserve, delivered with honesty, professionalism and integrity. With access to exceptional marketing material, a vast network of clients and contacts and intimate local knowledge that comes from living in this community for over 40 years, we are here to help and offer a completely refreshing approach to ensure your next big move in life is a great one! Experienced Local Boutique Agency

Customised Sales Campaigns Designed To Suit You And Property

Innovative Video & Social Media Marketing Paul Merrick

Office. 02 4760 0812 Mobile. 0404 599 146 Email. merrick@merrickpropertygroup.com.au Address. PO Box 1825 Penrith BC, PENRITH NSW 2751

30

roamingpanthermagazine.com.au

!

merrickpropertygroup.com.au


Legal

Borrow T Super Fund THROUGH YOUR

This article is for general information only and is not intended as legal advice. If you need specific help, contact your solicitor.

BUT KNOW THE RISKS Yes, you can borrow money through your Super Fund.

Local Expert

Joseph Grassi Legal Expert Joseph Grassi + Associates

his is called a limited recourse borrowing arrangement which allows the trustee of a Small to Medium Superannuation Fund (SMSF) to borrow for investment so long as it satisfies the following criteria:

For example, if an SMSF trustee acquired 100 shares in a company it would not be permitted to sell those shares then use the proceeds to buy shares in a different company under the same borrowing arrangement.

• The funds must be used to buy a single asset; • The asset must be held on trust for the SMSF; • The trustee must have legal ownership of the asset after making one or more payments; • The rights of the lender, or any other person, against the trustee over a default on the borrowing must be limited to that asset; • The asset must not be subject to any charge other than that provided over the borrowing; and • The asset must not be replaced with another asset, except in specific circumstances.

In this case, the trustee would have to use the proceeds to end the loan then set up a new arrangement to acquire the new shares in the different company.

This arrangement is permitted under section 67A of the Superannuation Industry (Supervision) Act 1993.

You should seek professional help if you are considering this kind of arrangement.

The Federal Government has confirmed that a superannuation trustee who enters into a limited recourse borrowing arrangement to buy an asset is to be treated as the owner of the asset for income tax purposes. Before setting up a limited recourse borrowing arrangement, an SMSF trustee should review and understand the risks involved.

The rules states that the asset must be held on trust so that the trustee of the SMSF acquires a beneficial interest in it. This means that the trustee will not be permitted to hold the legal title of the asset and that a separate trust will need to be set up to hold the asset until repayment is made. However, the SMSF will be entitled to all the income, such as rent, generated by the asset. Once the loan has been repaid the legal title of the asset can be transferred to the SMSF. When an asset has been acquired under this arrangement the trustee will generally not be permitted to replace it with another asset, except in certain limited circumstances.

We’ll help you get into your first home Speak to me about getting your conditional approval

Peita Davies Local home loan specialist 0452 214 202 @peita.davies.realestatehls Peita.davies@realestatehls.com.au 1B Castlereagh St, Penrith NSW 2750 Peita Davies is a credit representative (399445) of BLSSA Pty Ltd ACN 117 651 760 (Australian Credit Licence 391237)

LAM0031 - Peita Davies_Press Ad (255x156mm).indd 1

2/3/19 2:36 pm Issue 26 April 2019 31


Digital

Sorry

I Don't Speak

Jargon

Have you ever sat through a meeting and been confused by certain acronyms or phrases?

W

hat you’re probably hearing is jargon, or industry-specific language. Here’s what some of it means.

DOMAIN NAME: The name of your website, usually the same as your business name. It’s very important to have full control and ownership of your domain name. URL: The unique address of a web page, for example: https://onlineinfluence.com.au/penrith-web-designer/. WEB HOSTING: A service that allows your website to be viewed. Websites are hosted, or stored, on special computers called servers. CLOUD WEB HOSTING: When your website is hosted and information stored across several remote servers, this cluster of servers is “the cloud”.

Local Expert Trish Fehon Digital Expert Online Influence

SSL CERTIFICATE: A Secure Socket Layer certificate ensures website traffic between your web server and the user's browser is secure and cannot be read. SERVER EMAIL: Email that is hosted on your own website server. HOSTED EMAIL: Email hosted separately to your website through a service like GSuite or Office 365.

BROWSER: Software application for accessing information on the web. Popular browsers are Chrome, Firefox, Safari, and Internet Explorer. APPS: Short for software applications. SEM: Or Search Engine Marketing. Paid marketing through various providers, including Google and Bing. SEO: Search Engine Optimisation improves your chance of ranking well in search engines including Google, Bing and Yahoo. EDM: EDM is Electronic Direct Mail. More than email communication, it uses multiple forms of communication to relay and reinforce a campaign message. CONTENT MARKETING: The creation and sharing of online material (videos, blogs, social media posts) that does not explicitly promote your brand, but stimulates interest in your product or services. BLOGGING: Blog is short for “web-log”, and blogging is like a regular column. For businesses, blogging can boost your online visibility and build relationships with your ideal audience. WE SPEAK YOUR LANGUAGE At Online Influence, we don’t just know what all this jargon means, we can apply it to your business to achieve extraordinary results. Contact us on 02 4724 9555 today to find out how.

Social Media

A Social Business FOR YOUR

CONSISTENCY IS KEY

Written by Nicole Fahey from Local Edge Marketing

When it comes to maintaining a strong presence on social media for your small business, consistency is key. get social media on your side Nicole, owner of Local Edge Marketing in Penrith, is a social media management expert. She has helped many local businesses build their brand online and become top of mind thanks to a strong social media presence. Need help with your socials?  0415 246 565  info@localedgemarketing.com.au  localedgemarketing.com.au

32

roamingpanthermagazine.com.au

nd we mean it in all aspects of the word. From a consistent brand voice, through to consistent content and delivery, and your overall aesthetics. This ensures your business is portrayed cohesively across social, making it easier for customers to recognise, connect and engage with your business.

and feel. For example, if you’re using branded social media tiles regularly in your content, ensure they are ‘on brand’ and not forever changing. Ensure you’re using your logo correctly, you’re applying the same filter to images (if any) and even maintain a fairly consistent length of copy in your posts. It all matters.

CONSISTENCY OF BRAND VOICE Your brand voice and tone on social media is essentially the element of personality and emotion that is embedded into all of your content efforts, copy specifically. Of course, every business and brand has a completely different brand voice. For instance, important factors that should also influence your brand voice are your industry and the audience that you’re talking to. Finding your brand voice and keeping it consistent is often a challenge for small business owners.

CONSISTENCY OF CONTENT & DELIVERY Although many would like to not believe it, social media is a long-term game. It’s not a quick fix, it’s all about consistency over time. If you’re not consistent on social, you’re less likely to build trust and credibility with your local audience. Just like any relationship in the real world, it takes time to build a connection with others and for others to trust you. Brands with a strong and profitable social media presence are consistent with not only the content they produce; they are also consistent with its delivery by following a well-planned, strategic schedule.

CONSISTENCY OF AESTHETICS When we mean aesthetics, we mean the look of your brand on social. This drills down to following your style guide and ensuring that you’re using consistent colours, fonts and following protocol for your brand’s overall look

If you’re not consistent on social, you’re less likely to build trust and credibility with your local audience


Pets

Local Vet

Your Pet Rabbit

Dr Erin Short

PROTECT

VETERINARIAN Greencross Vets Coreen Avenue

Myxomatosis is another fatal virus that affects rabbits. It is transmitted in similar ways to calicivirus. It causes fever, swelling of the ears, eyes and genitals and severe conjunctivitis. There is no vaccination available within Australia against myxomatosis. There is no treatment or cure for calicivirus or myxomatosis.

Calicivirus is being released to control wild rabbit populations

C

alicivirus is also known as Rabbit Haemorrhagic Disease Virus (RHDV). It causes internal haemorrhage and death in rabbits. This virus affects wild and pet rabbits, but it will not affect native animals, other pets or humans. Calicivirus is spread by direct contact with infected rabbits, predator faeces and insects like flies, mosquitoes and fleas.

Due to the presence of myxomatosis, we also recommend protecting rabbits from exposure to flying insects. Outdoor rabbits require insect proof enclosures. Ensure pet rabbits have no direct or indirect contact with wild rabbits. Do not cut grass and feed it to pet rabbits if there is a chance wild rabbits have contaminated it.

Calicivirus has been released in our region as part of a plan to control wild rabbit populations. Wild rabbits are declared a pest animal in NSW due to the agricultural and environmental damage they cause.

If a pet rabbit is infected, it is advised to quarantine them from other rabbits. Cleaning and disinfecting cages and equipment is very important.

We recommend ensuring all pet rabbits are vaccinated against this disease. The vaccination will protect against the released virus. Young and unvaccinated rabbits should be vaccinated as soon as possible. Rabbits less than 12 weeks will require a booster in one month, and adult rabbits will require a booster each six months.

Rabbits can also be kept indoors; they are quite clean animals and can be trained to use litter trays. It is important to rabbit-proof your house, as rabbits love to chew. Removing access to phone and power cords is vital.

HAVE CONCERNS? If you have any questions or concerns about your pet rabbit, please call Greencross Vets Coreen Avenue on 4731 3055.

EXPERIENCE & RELIABILITY Personal Legal Services • Property and Conveyancing • Wills, Probate & Administration • Estate Planning

• Asset Protection Planning & Implementation • Notarial Services

Commercial Legal Services • Planning & Environment Law • Commercial Advice • Corporate Law & Governance • Business Law • Employment & Industrial Law

• Retail, Commercial & Industrial Leasing • OH&S Law • Debt Recovery, Bankruptcy & Insolvency Law

• Intellectual Property

Solicitor Director: Joseph M Grassi Dip Law (SAB) LLM Accredited Specialist Property Law Notary Public Solicitor: Grant Wiblin LLB, BSocSc, GDipLegalPrac Licensed Conveyancer: Wendy Harvey | Office Manager: Lois Grassi | Administration: Emily Beal

 Suite 1, 86 Henry Street, Penrith 2750  info@grassiassociates.com.au

 4702 5905

www.grassiassociates.com.au Issue 26 April 2019

33


Lending First home buyer checklist

2019

Local Expert

COULD BE YOUR YEAR TO

Peita Davies

Own Your First Home With the property market conditions slowing and house prices in Sydney cooling off, this could be the perfect time to buy your first home and get yourself into the market. ARE YOU ELIGIBLE FOR THE FIRST HOME OWNER’S GRANT? In NSW, from July 2018, the grant currently gives eligible first home buyers $10,000 to purchase a new home of up to $600,000 or to build a new home up to $750,000. Established and existing properties are not eligible and must be the first sale of the property as residential premises. The best way to find out whether you’re eligible is through a discussion with your mortgage broker, who can help you fill out and lodge your application.

Home Loan Specialist realestate.com.au Home Loans Penrith

1

RESEARCH THE MARKET

Research the property market and your local suburbs. Write a shortlist of must-haves – from location to the number of bedrooms and the type of property. 2 FIND OUT HOW MUCH YOU CAN BORROW

Now that you have a clear picture of the market, it’s time to find out how much you can afford to borrow. Speak to our team about your borrowing capacity to understand the maximum purchase price you can afford when house hunting! 3 CALCULATE YOUR REPAYMENTS

ARE YOU EXEMPT FROM STAMP DUTY? From 1 July 2017, the NSW government has abolished stamp duty for first home owners purchasing a property valued at up to $650,000. For homes valued between $650,001 and $850,000, a concessional rate of stamp duty applies. WHAT IF YOU ARE BUYING VACANT LAND? For vacant land to build your home, first home buyers pay no stamp duty if the value of the property is $350,000 or less. Vacant land valued between $350,001 and $450,000 attracts a concessional rate. All information contained in this article is current as of [01/03/2019] and is intended to be of a general nature only. It has been prepared without taking into account any person’s objectives, financial situation or needs. Before acting on this information, REA recommends that you consider whether it is appropriate for your circumstances. REA recommends that you seek independent legal, financial, and taxation advice before acting on any information in this article. For more information on the first home buyers grant in NSW, see https://www.revenue.nsw.gov.au/grants-schemes/ previous-schemes/first-home-owner-grant

Part of deciding how much to borrow is factoring in repayments. It’s important to understand your budget for repayments and other expenses, such as groceries, bills, and long-term savings goals. 4 FACTOR IN OTHER UPFRONT COSTS

Plenty of first home buyers make the mistake of focusing solely on their deposit and don’t factor in other upfront costs involved in buying a home, such as: • Stamp duty • Other government fees and changes • Legal/conveyancing fees • Pest and building inspections • Lenders mortgage insurance • Money for any essential repairs, and • Moving costs. If you’re a first home buyer and not sure where to start, speak to our team today and get our expert guidance to help you get into the property market.

Online Influence Penrith can help you with all your online marketing needs Website Design and Development Google Advertising Facebook Advertising Email Marketing campaigns Search Engine Optimisation (SEO) E-commerce (Shopping carts)

Online Influence is a Google Partner, a Facebook Ad agency and a boutique Web development company that specialises in helping you get leads and sales from your website.

www.Onlineinfluence.com.au

0247 249 555 Level 1, 331 High Street, Penrith NSW 2750 Specialized in:

Search ads

34

roamingpanthermagazine.com.au


Property

O

ften their chosen agent has stopped communicating with them, or they simply keep asking them to drop the price as the only solution to getting their property sold.

WHY HASN’T MY

Property Sold?

BEFORE YOU DROP TENS OF THOUSANDS OF DOLLARS FROM YOUR PRICE, CONSIDER THESE QUESTIONS. 1 IS IT OUR HOUSE OR IS IT OUR PRICE?

There are a number of frustrated sellers whose properties have been on the market for a while now but remain unsold.

This is a good question for your agent to ask buyers who inspect but decide not to buy your property. If the house is not suitable, then it’s the house. If they love your house but are seeing better value in other properties, then it’s the price. A very simple but effective question. 2 HAS MY AGENT MARKETED OUR

PROPERTY PROPERLY?

Local Expert Paul Merrick Property Expert Merrick Property Group

Have they shot a professional video and posted it on social media? Have they advertised your property on all major websites and used the best subscriptions on those sites so you feature towards the top of the search? Have they given you high quality photography and a floor plan? Have they contacted their database? 3 IS THE PRESENTATION OF OUR

PROPERTY UP TO SCRATCH? To work this out you either need to go and look through some other properties you’re competing with,

or have a very honest conversation with your agent. If your property is vacant you should give serious consideration to investing in staging the property. This way prospective buyers feel a more emotional connection to your property. 4

AM I BEING REALISTIC WITH MY SELLING PRICE?

Take a fresh look at the other properties you’re competing with. With the help of your agent, look very closely at what’s selling around you. If your expectations are out of line with what the buyers are paying, you may be in for a very long and disappointing ride. The key to success in this market is a realistic price, perfect presentation, no short cuts in the marketing, and sometimes just a good dose of patience and persistence. If you’re struggling and want some advice, free of obligation, I’ll always welcome your call for a confidential chat. NEED SOME DIRECTION? Feel free to call me directly on 0404 599 146. I’ll happily offer confidential real estate advice without obligation.

Same Great Team, Same Great Service We’ve changed our name! Coreen Avenue Vets have changed names to Greencross Vets Coreen Avenue

But we’re still the place where every pet has the opportunity to be loved, cared for and recognised as a priority. Every pet entering the practice becomes an integral part of our family unit.

Unit 2 & 3/117 Coreen Ave Penrith, NSW, 2750

 02 4731 3055

 www.greencrossvet.com.au Issue 26 April 2019

35


Finance

Marie Kondo Your Finances?

IS IT TIME TO

Local Expert Melissa Browne Money & Business Strategy Expert Accounting & Taxation Advantage

If you’re one of the many people who have become obsessed with folding your t-shirts so they stand up, asking items if they spark joy or are trying to whittle your book collection down to thirty, then chances are you’ve been caught up in the Marie Kondo movement.

A

ll new to you? Let me give you a quick debrief. Marie Kondo is a Japanese organising consultant and author. Her best-selling books include The Life Changing Magic of Tidying and she now has a series on Netfix where she teaches others how to declutter, minimise and spark joy in their own homes using her KonMari Method. Now, I love a good declutter as much as the next person. The problem arises when we declutter and minimise without questioning what brought the clutter into our homes and lives in the first place.

LOCAL EDGE MARKETING Penrith’s Original Social Media Management Agency Multi Award Winning Clients

That’s because, what we don’t need is an annual Marie Kondo-style purge of the items we’ve purchased during the year that we’re now either giving away or disposing of. That’s not good for our wallets or the environment. Instead, I believe now is the perfect time to address why we’re caught up in a cycle of financial binging and purging. This process begins with a 30-day Detox. A 30-day detox simply means not buying anything non-essential for 30 days. The purpose of the financial detox is to figure out why you spend. During those moments when you’re tempted to spend, asking yourself why it is that you’re spending. Is it because you’re stressed, sad, bored, lonely, excited or celebratory and where, instead of via your bank account, you can you get a dopamine hit? Of course, not all of us are spenders. Some of us are hoarders and during the 30 days it’s time to ask yourself, how much is enough? What bank account balance will make you feel safe, how can you spend without guilt and how can you enjoy today and not simply worry about tomorrow? During the 30 days it’s the opportunity to challenge your money mindset. To ask what sparks joy in your life (not just your home) and what life do you want to design? To place financial goals around making that life come true. To consider setting up multiple bank accounts and automate your wage to them and live to your everyday account so you can spend without guilt. It’s asking where the clutter is in your finances – where the multiple super accounts are, the mortgage you’ve been meaning to get a better rate on, the multiple credit cards, the personal loan, the after pay account that always has a balance, or the many other areas of your finance that could do with some purging and cleaning up. And then doing something about it. In short, it’s becoming a conscious consumer, one that doesn’t financially binge and purge and one who is excited about creating joy not just in their homes, but in all their life. Yes, that means your finances – the one place we often avoid when we think joy, wellness and stress-free because often it makes us feel anything but.

You manage your business, we’ll manage your social media. Suite 12, 95B Station Street Penrith NSW 2750 info@localedgemarketing.com.au | www.localedgemarketing.com.au

36

roamingpanthermagazine.com.au

MELISSA BROWNE Melissa Browne is CEO of accounting firm A&TA and financial planning firm The Money Barre. Her latest book, Unf*ck your Finances, is instore now at all good bookstores.


Business Profile

ROAMING WITH

Local Business Merrick Property Group

We spoke with Paul Merrick of Merrick Property Group to get the inside information on this amazing local business. 1 WHEN DID YOU FIRST START YOUR CAREER

IN REAL ESTATE, AND WHY DID YOU CHOOSE THE PROPERTY INDUSTRY? I started my career in real estate around 14 years ago. I always had an interest in it from a young age, but initially went down a different career path before finally working up the courage to do what I really wanted to do! 2 WHEN DID YOU FIRST OPEN MERRICK

PROPERTY GROUP AND WHERE ARE YOU LOCATED? Merrick Property Group was founded in 2014. Until recently, we were in the CBD of Penrith but we’ve just made a big move to larger, more modern premises at 2/84-90 Old Bathurst Road in Emu Heights. 3 TELL US MORE ABOUT YOUR TEAM

We’re fortunate to have a very tight-knit team. Apart from myself we have Tori Walker, who is our super-organised Admin and Sales Support Guru. Tori is also a professional property stylist, which makes her an enormous help to our clients. We have a dynamic Open Home Support Team that ensures our open pointers, flags and signs are put out and picked up, as well as helping take names of those coming through our open homes. For our market-leading videos we use Rocknbob Media House, and for photography we use Jeff Brislane of Tempest Light Photography.

4 WHAT WOULD YOU SAY YOUR POINT OF

DIFFERENCE WOULD BE? The biggest point of difference with our agency is that you’ll feel like part of the family, rather than just another listing or number. Our detailed approach to helping you have your home prepared to the highest standards, along with our world-class marketing, ensures that not only does your home stand out from the crowd, but also that buyers are given first-class and detailed information to help them navigate the buying process with confidence.

7 WHAT ADVICE WOULD YOU GIVE TO SOMEONE

WANTING TO OPEN THEIR OWN BUSINESS? Get good advice early. Surround yourself with people who have already walked the path you’re planning on taking. Be true to yourself and be prepared to lead, not just follow. Work “on” your business, not just “in” your business, so you continue to evolve. And be prepared to work harder and care more for your clients than anyone else will.

5 BEING A LOCAL BUSINESS OWNER, YOU

WOULD KNOW THE IMPORTANCE OF COMMUNITY INVOLVEMENT. HOW DO YOU GIVE BACK TO THE COMMUNITY? Since opening Merrick Property Group we’ve supported a number of charities that are important to us and the greater community. We’ve had sponsorship involvement at a few local sports clubs as well. This year we’ll be turning our focus to more Autism-related organisations. I’ve also recently been appointed to the Board of Nordoff Robbins Music Therapy Australia, which is a great honour. Nordoff-Robbins Music Therapy is an inspirational, not-for-profit organisation that provides clinical music therapy and community music programs. 6 ARE THERE ANY ACHIEVEMENTS YOU ARE

PARTICULARLY PROUD OF SINCE OPENING? The move into our new office, our new website, developing a dynamic, tight-knit team, and all the nice reviews and referrals we receive from our very loyal clients all make for lots of proud moments. Ultimately, what we do helps people move onto the next stage of their lives, and that’s what is so great about what we get to do every day.

WE’LL CARE FOR YOU LIKE FAMILY!  Merrick Property Group  2/84-90 Old Bathurst Road Emu Heights (Next door to Zokoko)  0247 600 812 / 0404 599 146  merrickpropertygroup.com.au  MerrickProperty

If we were to sell our home in the future, there is no question Paul is the man for the job Testimonial: Alex P and Kate H Issue 26 April 2019

37


Interiors

Kitchens

The Heart of Any Home

Your Kitchen Checklist

Written by Shirley Gavin, Nepean Inner Designs

Good kitchen design is essential for maximum comfort and injury prevention. If you’re thinking of modifying your kitchen, it’s important to plan a functional layout.

between these work areas while allowing ample space to circulate around the oven door and dishwasher.

Ensure everything has a place. A few examples to make life easier:

 Determine which storage areas you can double up on – for example, cups with tea and coffee

T

• Hide the rubbish bin in the island bench • Introduce a butler’s pantry to house your appliances • Mount the microwave above the bench, and • Ensure your dishwasher is close to your sink.

 Have cooking utensils and condiments in close proximity to the cooking centre

he style of kitchens has changed dramatically over the years, and what we do in them even more so. We’ve now opted for open plan living, with the kitchen no longer hidden away. It’s become the magnetic, central gathering space of a home.

The basics of layout and function. The ‘Kitchen Work Triangle’ is a concept used to determine efficient layouts. It represents the main stations – the fridge, stove/oven, and sink. The idea is that these elements are in comfortable proximity to one another, creating an efficient space. Preparation space is crucial. Worktops and island benches should be generous in their surface area. Avoid long distances

Storage is something that’s often forgotten. Include ample amounts of storage for your food, crockery and appliances. TIP: Drawers are better for storage space than cupboards!

A functional and aesthetic kitchen can add value and make your house a home. It’s one of the busiest areas in the home, so choose the most durable materials you can afford. 2019 trends are darker and moodier colour palettes, and natural finishes like timbers and stones. But aesthetics aside, great kitchen design lies strongly in functionality. Nailing both elements? Bellissimo! So, do your research and ask lots of questions. It will save you time and money in the long run.

 Work out your daily kitchen tasks to make your layout as efficient as possible  List your most cooked meals to determine the appliances that best suit your daily needs

 Store everyday crockery and cutlery within arm’s reach of the dishwasher for efficient clean up.

FOR MORE INSPIRATION follow me on facebook at  facebook.com/NepeanInnerDesigns

ONE

MINUTE WALK FROM

NEPEAN HOSPITAL Greater Western Hwy

Visit our Pharmacy for Friendly

Services & Expert Advice • Prescriptions Filled

• Workers Compensation

• Surgical Supplies

• Specialty Vitamins & Herbal Supplements

• MedsChecks

• Home-aids

• Injury Supportwear

• Baby & Mum Care

• Hires - Wheelchairs, Crutches & Breast Pumps

• Wide Range of Gifts

• National Diabetes Service • Webster Packing

 specialistclinicpharmacykingswood

 4737 3456 38

roamingpanthermagazine.com.au

ST ET ERS

ST

Within the Specialist Clinic

S TA F

• Newspapers, Milk, Drinks, Chips & Lollies

BY

SOM

ST

DER

PA R

Professional Service

Penrith

KER

Local & Convenient

Kingswood Station

Nepean Hospital

FORD

ST

M4 Motorway

• Photocopying, Faxing, and Laminating

 pharmacy@specialistclinicpharmacy.com

 Suite 3, 64 - 68 Derby St, Kingswood

Trading Hours Monday - Friday Saturday Sunday Public Holidays

7.30am - 7.30pm 8.00am - 5.00pm CLOSED 9.00am - 1.00pm


The Highest Standard in Concreting Services in Penrith & Blue Mountains LOCALLY RUN, FAMILY BUSINESS, WITH EXCELLENT WORKMANSHIP AT AFFORDABLE PRICES S E R V I C E S TA I L O R E D T O S U I T Y O U S L A B S | D R I V E W AY S | C O M M E R C I A L & I N D U S T R I A L | O S D TA N K | C U S T O M D E S I G N | G E O S T O N E

D O N ’ TT ! E FORG

E E R F

LD L OF O A V O REM WAY DRIVE n this ad at time *Whe

o m e n ti n yo u ta c t of c o n

CALL US N OW!

0411 704 302

 SLCONCRETE5@BIGPOND.COM

 FA C E B O O K . C O M / S L C O N C R E T E N S W

W W W. S L C O N C R E T E . C O M . A U


Find your

at Snooze

Clovelly Bay QS Bed Frame

$999 Regular price

BONUS FREE LOCAL DELIVERY Only available at Snooze Penrith. Offer ends 30th April 2019. Local delivery applies to an address up to a 35km radius from Snooze Penrith. Excludes next day & express delivery. New orders only. Minimum spend $999.

Snooze Penrith, Shop 22 Penrith Homemaker Centre, Lot 2 Pattys Place, Jamisontown | 4733 7911 snooze.com.au

IT’S AMAZING WHAT A LITTLE SNOOZE CAN DO Pictures are for illustrative purposes only – bed frame, bedding and linen or accessories are not included in the mattress price – colours may vary. © Snooze 2019. W228223


Easter Colouring-In Puzzles

BRING SOME COLOUR TO EASTER PUSH THE HOT CROSS BUNS AND EASTER EGGS ASIDE IT’S TIME TO COLOUR!

Happy Easter!

Issue 26 April 2019

41


Horoscopes

Horoscopes By Sherrynne Dalby

Aries

(21 MAR – 20 APR)

Taurus (20 APR – 21 MAY) Time to take control of your financial situation. There should be a little extra to go around this month and this could be due to career improvement. This will apply more so to April birthdays at this stage. Friends and associates can be a source of support and even inspiration, so you know where to go if you are looking for new ideas but choose your friends wisely. Relationships can have your attention around the 20th and birthdays around this date will find it a focus over the next 12 months. Be wary of overspending or committing to anything.

Cancer (21 JUN – 23 JUL)

Ruling Planet: Mars Sign:

The confusion that plagued the end of March should be sorted and untangled as this month unfolds, although it may take a few attempts before all becomes clear. May birthdays should feel an extra boost of energy early April. This can be perfect for getting into a better fitness regime or stepping up the current one. There is also activity around career issues at the moment. Early June birthdays will feel this early in the month, with mid-June birthdays feeling the pinch closer to the mid-month full moon. Opportunities abound but you need to be able to distinguish fact from fiction.

Leo (23 JUL – 23 AUG) Playtime continues for Leo but be cautious of overindulging your passions mid-month. Too much play can be a bad thing, so try to keep a balance. Keep yourself balanced and keep your bank account balanced. Early April provides the opportunity for some to improve their education. This will require commitment and effort but will pay off in the long run. For others, it can indicate an overseas trip, or at least the planning of one. Early August birthdays will be particularly affected. July birthdays can experience career shakeups. Sometimes you need a prod to get moving in the right direction.

The Ram

Gemstones:

Diamond

Colours:

Red, Scarlet, Carmine

Day:

Tuesday

Number:

Nine

This is your annual time for renewal - Happy Solar return Aries! The saying ‘Many Happy Returns’ is a reference to the sun returning each year to the same area in the sky that it was at the time of birth. For Aries this year, that is from 21 March until 20 April, it covers all those born under the sign of the Ram. The coming month will give you a snapshot of the year ahead. Pay attention to what is going on around your birthday for clues. There are two full moons in Aries in 2019, a rare occurrence. This means birthdays at both the very beginning and very end of the signs will find the next twelve months have a relationship focus. Mid-April in particular can experience some shakeups, ultimately positive. Early April birthdays need to focus on self improvement. Birthdays around the 10th - this is a time to learn ways to better handle pressure. It’s time to look at how much responsibility you need to take for your own predicament. Nobody has control over external events, but we can master self-control and our responses to external stimuli.

Capricorn (22 DEC – 20 JAN) You had some ideas for home improvement, making it more appealing and home like. You have it in you to transform those ideas into something concrete, so believe in yourself. Siblings are playing a big role in your life now. It doesn’t have to be a physical presence; perhaps you are just thinking of them or reminiscing. Maybe you need to call. Look forward to a change of circumstances from mid-month, easing pressure and providing opportunity to relax and let off steam. Birthdays around the 22nd will find trying something new will be more successful than sticking with the tried and true.

42

It may be that your plans require some realignment. There can be issues around home and family that you may not have factored in. This can be that you may not have been aware of them initially or that they slipped your mind. This doesn’t need to have a negative outcome; in fact, it can be quite positive when you get it all together. Preparation with attention to detail is needed. This can also apply to career issues, as new opportunities arise, especially early July birthdays. This can mean a new direction and / or greater responsibility.

Gemini (21 MAY – 21 JUN)

roamingpanthermagazine.com.au

Virgo (23 AUG – 23 SEP) Communication problems should be sorting themselves out now, if not just give it a little extra time. All will be good by the end of the month. Relationships continue to garner your attention and you can be feeling quite romantic, perfect for planning a weekend getaway. Mid-month can be a time for getting serious. This encompasses numerous but interconnected areas of life; relationships, home and family, and career and finances. It can be a good time for planning but don’t rush into anything. Make sure you dot the i’s and cross the t’s before making decisions or committing to anything.

Scorpio (23 OCT – 22 NOV) Your creative juices should be overflowing at the moment and if you allow your imagination free reign you will not be the only one surprised by what you are able to achieve. Work opportunities are more prominent around the 5th. It is possible to find that new job or promotion you have been looking for at this time. October Scorpios will be feeling the early tug of Uranus as it begins its seven year disruptive journey through your house of relationships. It is time to reassess your approach to others and to shed relationships that have run their course.

Aquarius (20 JAN – 19 FEB) There may some financial anomalies that require your attention. The basis of it can be as simple as communication errors or even a computer error. Whatever the basis, there appears to be some confusion. Once this problem is sorted, there should be a little extra, something you had forgotten about. January-born Aquarians can be thinking about pulling up stakes and making a move. You can be feeling quite restless at the moment but it might be prudent to take your time. Weigh up your options and make a plan before you take any action. Maybe settle for a holiday for now.

Libra (23 SEP – 23 OCT) Relationships again continue to dominate thought and action throughout the coming month. New lines of communication open around mid-month which can be positive for relationships and may be a good time to share your feelings. There can be an almost karmic feeling around career matters throughout April. Remind yourself when in doubt that you are your own master or mistress. Even when you feel you have no control, you still have choices. You may have been experiencing selfdoubt of late. This is passing and when your mind is turned around it can help you unlock greater potential.

Sagittarius (22 NOV – 22 DEC) Your biggest problem throughout April is one you are probably familiar with. That is the tendency to overindulge or go overboard with something. Quite often this can mean spending. You have been learning the hard way that not managing your finances has consequences. While it is important that you indulge yourself every now and then, it is best that you save for it ahead of time rather than get caught paying off more than you planned after the event. You are faced with temptation this month; you can succumb but remember to use temperance at the same time.

Pisces (19 FEB – 21 MAR) You have been feeling better about yourself for the last few weeks. Building on this, you have the opportunity now to actually make some changes that you may have been dreaming of for some time, particularly when it comes to yourself. This is, generally speaking, a good time for you - things should be going in your favour. Finances appear to be improving, especially if you have been putting new plans into action, either for creating or improving cash flow. Mid-month should see your plans begin to bear fruit, so be prepared to act when the time is right.


36 B A R B E R ARTIST IMPRESSION

NEW 1, 2 & 3 BEDROOM APARTMENTS IN PENRITH CALL TO VIEW OUR ON-SITE DISPLAY SUITE AT 36 BARBER AVENUE 02 8806 3413 0407 239 536 www.36barber.com


Easter Eats Festival Outdoor Family Event Fri 12 April – Sun 14 April Penrith Homemaker Centre Join us for a weekend of food, film, live music and fun for the whole family Food Trucks / Live Music / Jumping Castles / Face Painting / Entertainment

Sundown Cinema Fri 12 April 5pm – 9pm

See the movie HOP (Movie starts at 7pm) + DJs + Roaming entertainers

Family Fun Days Get your FREE popcorn

Sat 13 & Sun 14 April 11am – 3pm Join us for a fun-filled Easter weekend + Live music + Rides

PLUS The Easte r Bunny!

Find out more at penrithhomemakercentre.com.au

Late night shopping every Thursday until 9pm Cnr. Mulgoa Rd & Wolsely St, Jamisontown penrithhomemakercentre.com.au   

Profile for Penzance Publishing

Roaming Magazine April 2019 Issue  

Nepean's Lifestyle Magazine

Roaming Magazine April 2019 Issue  

Nepean's Lifestyle Magazine

Advertisement