Page 1

I S S UE 25 M A R C H 1 9

DELIVERED FREE TO

60,000

Photo credit: Simon Gould, Hilary Nathan Photography

HOMES MONTHLY

Penrith CBD Festival SAT U R DAY 1 6 M A RC H GET READY FOR ACTION AND ADVENTURE

N E P E A N ’ S

L I F E S T Y L E

M A G A Z I N E


• Super Firm • Firm • Medium

• Plush

$698ea

KING KOil 'CONFORMA ESSENCE SUPER FIRM, FIRM, MEDIUM OR PLUSH' QUEEN MATTRESS.

Also available in other sizes and with a matching base.

• Super Firm • Firm • Medium • Plush

s991ea

KING KOil 'CONFORMA DUO SUPER FIRM, FIRM, MEDIUM OR PLUSH' QUEEN MATTRESS.

Also available in other sizes and with a matching base.

$1597ea

KING KOil 'CHIRO SUPERB SUPER FIRM, FIRM, MEDIUM OR PLUSH' QUEEN MATTRESS.

Also available in other sizes and with a matching base.

M M

._,. ._,.

Ends 31/03/19. Harvey Norman® stores are operated by independent franchisees. Accessories shown are not included.

I I


activate • rejuvenate • populate

Lower Mountains AIR CONDITIONING

4735 6411


Welcome

Issue I

Hi Readers,

N

T

H I

S

FEATURED THIS ISSUE

21

WELCOME TO MARCH ISSUE.

M

arch issue is jam-packed with things to do. One event you absolutely cannot miss is the Annual Penrith Festival hosted by the hard-working team at Penrith CBD Corp. The free family event is on 16 March - enjoy stage shows, roving entertainers, market stalls, food trucks, free activities and rides, showbags, and a HUGE street parade. Head to page 18 to read all about it!

As you’ll see as you work your way through this issue, Penrith is home to not only amazing events but also inspirational people and creative communities. Please enjoy and, as always, I look forward to hearing your ideas and feedback on the magazine.

Advertising Enquiries Samantha Foley  0431 281 689 samantha@roamingpanthermagazine. com.au  @roamingpanthermagazine  @roamingpanthermagazine  www.roamingpanthermagazine.com.au

16

Local Story Don’t MS with Rachel

21

Food Easy Keto - Pete Evans

15

Sam

PO Box 3106, East Blaxland, NSW 2774

Community A brewery in Penrith? Yes please!

16

Another must-read feature this month is from my favourite section (the food section, of course!). We’ve included recipes from Pete Evans’ latest cookbook, Easy Keto. And make sure you keep your eyes peeled on our Facebook page for a cookbook giveaway!

>> OUR TEAM Publisher • Kimberley Kennedy kimberley@roamingpanthermagazine.com.au Editorial • editorial@roamingpanthermagazine.com.au Creative Director • Kwang Tran Manager • Samantha Foley samantha@roamingpanthermagazine.com.au Copy Editor • Melinda Leyshon, WriteCopy Writers • Manisha Foley • Brooke Allender Images • iStock photos • Unsplash.com

15

>> REGULAR CONTRIBUTORS • Maria, Fellowes & Turner Travel Associates • Peita Davies, realestate.com.au Home Loans Penrith • Joseph Grassi, Joseph Grassi & Associates • Kris Caloia & Karl Thornton, Progressive Physiotherapy • Erin Short, Greencross Vets Coreen Avenue • Sherrynne Dalby, Author of Star Parenting • Trish Fehon, Online Influence • Paul Merrick, Merrick Property Group • Nicole Fahey, Local Edge Marketing

>> WITH THANKS TO OUR CONTRIBUTORS FOR THIS ISSUE • Penrith Homemaker Centre • Shirley Gavin, Nepean Inner Designs • Fiona Kane, Informed Health • Penrith City Council • thecarousel.com • Conveyancing Simplified • Snooze Penrith • Penrith CBD Corp • Penrith RSL • Declan Baker

Published by Penzance Publishing Pty Ltd ABN 18615296118. Printed by Fairfax Media 159 Bells Line of Road North Richmond NSW 2754

We recommend material such as dates, times and prices of a changing nature be confirmed with individual advertisers, contributors or persons and industry professionals in regard to advertising and editorial.

All prices and information are correct and to the best of the publisher’s knowledge at the time of print. Roaming Panther Magazine does not accept or assume responsibility for advertising material accepted. Comments and opinions of contributors do not necessarily reflect the opinion or view of the publishers or editor.

Material in Roaming Panther Magazine is copyright © Penzance Publishing and may not be reproduced without the permission of the publisher. All rights reserved. Issue 25, March 2019

All reasonable efforts have been made to trace copyright owners.

CREATING BEAUTIFUL HOMES Family owned with 20 years experience of quality and workmanship.

BLUE SKY SHUTTERS

Plantation Shutters, Roller Blinds, Panel Glides, Vertical Drapes, Dual Shades, Security Doors and Grilles, Fly Screens and Awnings.

Plantation Shutters Blinds Security Doors Awnings

CALL BLUE SKY SHUTTERS today for a free measure and quote on Office 02 4733 6214 or Peter 0414 706 142 Email blueskyshutters@gmail.com

Website www.blueskyshutters.com.au

Facebook Blue Sky Shutters

Issue 25 March 2019

5


What’s On!

Local Shows

QUEEN – BOHEMIAN RHAPSODY

BUDDY’S BACK: THE BUDDY HOLLY SHOW 16 MARCH, 8PM BLUE MOUNTAINS THEATRE Enjoy Rock & Roll at its best in one of the most exciting shows to hit our shores! Buddy’s Back is an internationally acclaimed production that mesmerises and excites audiences both visually and musically with its high-energy performance, brilliant costumes and fantastic musicianship. During this dynamic two-hour production, internationally renowned Scot Robin, together with his Crickets, will perform more than 30 Buddy Holly hits. bluemountainstheatreandhub.com.au

THE GOSPEL ACCORDING TO PAUL

8 MARCH, 8PM PANTHERS PENRITH You’ve seen the movie – now see the show. Thomas Crane & Bohemian Rhapsody are back with their ‘Greatest Hits’ tour, bringing Queen’s visual and musical excitement to life.

8-9 MARCH, 7:30PM THE JOAN Full of intelligence and wit, The Gospel According to Paul is a funny, insightful and occasionally poignant portrait of Paul Keating. The man that – as he tells it – single-handedly shaped contemporary Australia. Showcasing his eviscerating wit, rich rhetoric and ego the size of Everest, The Gospel According to Paul distils Keating’s essence into 75 minutes.

penrith.panthers.com.au

thejoan.com.au

ARJ BARKER – WE NEED TO TALK 8 MARCH, 8PM BLUE MOUNTAINS THEATRE Australia’s adopted son of comedy returns to Australia with his brand new show, We Need To Talk. You had better sit down for this… Arj needs to talk to you and what he’s going to say will make you laugh - very, very hard. Age 15+ only. bluemountainstheatreandhub.com.au

LOCAL EDGE MARKETING Penrith’s Original Social Media Management Agency Multi Award Winning Clients

Local Music EURO LATINO 13 MARCH, 11AM BLUE MOUNTAINS THEATRE This spectacular musical journey through some of Europe and South America’s most popular melodies will knock your socks off. It’s a high-energy award-winning showcase of classic tunes from yesterday as well as modern hits. bluemountainstheatreandhub.com.au

ALIVE AFTER FIVE

You manage your business, we’ll manage your social media. Suite 12, 95B Station Street Penrith NSW 2750 info@localedgemarketing.com.au | www.localedgemarketing.com.au

5 APRIL, 5PM – 8.30PM TRIANGLE PARK, PENRITH (WESTERN END OF HIGH ST) Kick-off your weekend in style at Alive After Five! Unwind with friends over a craft brew and live music while enjoying mouth-watering food under the magical twilight in Penrith City Centre’s newest urban space. Choose from local favourites High Street Social, Siam Cuisine Thai Restaurant and Cooks Castle Indian Penrith, plus sweet treats courtesy of Underground Coffee Roasters. Grab your friends and colleagues, and head to the Penrith City Centre for a wonderful evening!

 Penrith City Council 6

roamingpanthermagazine.com.au

DVORAK & FRANCK 23 MARCH, 8PM THE JOAN Penrith Symphony Orchestra presents two of the greatest romantic works for orchestra; the symphony triumphantly interweaves the French and Germanic style. The work showcases soloist and orchestra alike with its unequalled melodic lyricism.

thejoan.com.au


What’s On!

Local Music BAG RAIDERS

NASHVILLE LIVE

MARCH 29, 7PM O’DONOGHUES Bag Raiders are one of the Australia’s best electronic bands. With hits including “Shooting Stars”, “Way Back Home” and “So Demanding”, this one-off O’Donoghues show is set to impress. Wear comfy shoes because you won;t be sittign still! Doors open at 7pm, kicking off with resident DJ TA$K. Tickets available at MOSHTIX.

SIMON AND GARFUNKEL - THE CONCERT

15 MARCH, 7:30PM THE JOAN For the very first time in Australia, the hit musical production celebrating country music, and the stories behind the genre’s biggest hits out of Nashville Tennessee, brings its energy to stages around the country. Audiences will be moved through a mixture of classic solos, amazing duets and fantastic group harmonies as the cast of international performers step up alongside the stellar live band.

9 MARCH, 8PM BLUE MT THEATRE Showcasing over 20 hit songs, ‘Shelley and Robertson’ bring over two decades as one of Australia’s top duos alongside close vocal harmonies and stirring songs from a timeless era.

thejoan.com.au

bluemountainstheatreandhub.com.au

odonoghues.com.au

Things To Do

MUSIC BY THE RIVER

PENRITH WORKING TRUCK SHOW

17 MARCH, 11AM – 4PM TENCH RESERVE, JAMISONTOWN Enjoy a lazy Sunday afternoon with stunning sights and spectacular sounds at Music by the River. Set on the banks of the beautiful Nepean, Music by the River is a free community event and a highlight of autumn in Penrith. Join in this free event, soak up the gorgeous river views and relax to the sounds of talented of local musicians playing original music and famous favourites. Grab a bite or bring a picnic, and sit back and relax on one of the comfy deck chairs while the kids are entertained by the many activities.  Penrith City Council

31 MARCH, 8AM – 4PM MUSEUM OF FIRE A huge day of non-stop entertainment, rides and unique exhibits combine to create this spectacular show. There will be hundreds of vehicles on display, from the huge B Doubles to custom trucks, plastered with chrome detailing and spectacular airbrushing, as well as the outstanding collection of fire engines of the Museum. Enjoy live entertainment, including performances from some of Australia’s great country rock stars. Kids will be kept busy with a huge selection of free rides and activities. pwts.com.au

WE SPECIALISE IN • A N T I W RINKL E • D ERMA L F I L L ER • TEE TH WHI T E NING • F AT D I SSO LV E NT • PL ATEL E T RI C H PL ASMA (P P A)

Registered nurse Kelly has over 10 years experience in general nursing, with her main focus now being anaesthetics and cosmetic injecting.

THE ART OF COSMETIC’S IS NOT TO NOTICE THE ART

GIRLS NIGHT OUT: FIVE FEET APART 20 MARCH HOYTS PENRITH Catch up with the girls and be the first to experience the heartfelt love story, Five Feet Apart at the next HOYTS Girls’ Night Out screening.

hoyts.com.au

SYDNEY INTERNATIONAL ROWING REGATTA 25 – 31 MARCH REGATTA CENTRE Australia’s largest rowing event, comprising the following domestic and international competitions: Australian Open Rowing Championships, Australian Open Schools Rowing Championships, and Kings and Queens Cups Interstate Regatta.

sirr.rowingaustralia.com.au

ONLIN E BOOK INGS AV A IL A

BLE

PENRITH | GLENMORE PARK | WOOLLAHRA

 041 5 502 0 64

 FAC EC LINIK

FACECLINIK.COM.AU Issue 25 March 2019

7


What’s On!

Things To Do

Local Markets MELANOMA MARCH 17 MARCH, 8 – 11AM REGATTA PARK, RIVER ROAD RESERVE SIDE March for a cure for Melanoma at Emu Plains. Melanoma March is in its eighth year in 2019, and is now the Melanoma Institute Australia’s major annual fundraising campaign to support melanoma research. The Melanoma March is a special event which brings together the whole community to raise awareness and funds for melanoma research. It’s an opportunity to inspire others, remember loved ones, and support your local March to find a cure for Melanoma. westernsydney.melanomamarch.org.au

2019 POLO INTL – AUS V ENG

WANDER AROUND YOUR LOCAL MARKET & FIND A HIDDEN GEM

INTERNATIONAL ASSAULT

6 APRIL WINDSOR POLO CLUB, RICHMOND The Polo International is the most prestigious event on the Australian polo calendar, attracting teams and players from all over the world. Don’t miss seeing the sport of polo at its highest level.

11 MARCH, 7:30PM PANTHERS PENRITH World Series Wrestling returns, featuring all of your favourite World Series Wrestling stars including current World Champion Robbie Eagles, and World Tag Team Champions Marty Scurll and Brody King.

polointernational.com.au

penrith.panthers.com.au

PENRITH REGION AUSSIE NIGHT MARKETS WEDNESDAY NIGHTS An international food market on the doorstep of Panthers Penrith. Bring your family and friends, and give your taste buds an experience you won’t forget. aussienightmarkets.com.au

HAWKESBURY REGION

Local Art

Local Fitness

WINDSOR MALL SUNDAY MARKETS EVERY SUNDAY Located in the George St Mall. Find quality handmade homewares, arts, crafts, fashion and fresh produce, while local bands and buskers offer great entertainment. hawkesburyaustralia.com.au

BLUE MOUNTAINS REGION

Eliza Gosse - Ancher on River Road, 2018, gouache on paper.

ST MARYS DUTCH FESTIVAL

THE IDEAL HOME

YOGA @ THE MONDO

29-31 MARCH, 10AM – 4PM REMBRANDT DUTCH CLUB Eat, drink, and enjoy the entertainment in traditional Dutch style! Each year the Rembrandt Dutch Club celebrates over three days with the free Dutch Festival. The aim of the club is to keep the Dutch traditions going within the Australian community - not only to please the older generation, but also teach the younger ones about the food, drink and party habits, as well as how much fun can be had!

UNTIL 24 MARCH PENRITH REGIONAL GALLERY This incredible exhibition seeks to explore Australian experiences of home across the past 100 years. It will have you remember the past and think about the future.

WEDNESDAY MORNINGS, 7-8AM THE MONDO, PENRITH PLAZA Enjoy free yoga classes at the Mondo, located between Westfield, the Library, and The Joan.

rembrandtdutchclub.com

penrithregionalgallery.com.au

westfield.com.au/penrith

GLENBROOK ROTARY MARKETS FARMERS MARKET • FIRST SATURDAY Stock up on organic fruit and veggies, sourdough bread, home-baked cakes and biscuits, pickles, jams and honey and lots of other goodies. GENERAL MARKET • THIRD SATURDAY Quality jewellery and crafts with plenty to spoil yourself. Gardeners can delight at the array of flowers and plants. glenbrookrotarymarkets.com.au

I WANT TO KNOW WHAT LOVE IS Joyous. Sexy. Heartbreaking. Take a dizzying ride through love’s collision course.

Saturday 6 April 7.30pm Standard $45 | Concession $40 | Under 30s $30 thejoan.com.au | 4723 7600 Joan Sutherland Performing Arts Centre 597 High Street Penrith 8

roamingpanthermagazine.com.au


What’s On!

Business NETWORKING EVENTS

Local Businesses

WOMEN WITH ALTITUDE 14 MARCH, 9AM – 11AM SPRINGWOOD UNITING CARE FUNCTION ROOM This is a two-hour workshop hosted by Anne Barratt of Empowering Health. Learn practical exercises to identify and clear personal blocks to your business or career success. womenwithaltitude.com.au

PENRITH CBD CORP - COFFEE CATCH UP FIRST WEDNESDAY, 7.30AM – 8.30AM PENRITH RSL Come and have a free coffee, meet some fellow business owners, and learn about what’s coming up in the continuously growing Penrith CBD. penrithcbdcorp.com.au

PENRITH VALLEY CHAMBER OF COMMERCE 12 MARCH, 6PM PENRITH PACEWAY Come along and enjoy a great night while making the most of the fantastic networking opportunities at the Chamber Connect event at Penrith Paceway. penrithchamber.org.au

Grounds AROUND THE

CONNECTING

YOUR GUIDE TO WHAT’S HAPPENING IN SPORT THIS MONTH.

Penrith Panthers Round 1

 Sunday 17 March, 4:05pm  Panthers v Eels  Panthers Stadium

WS Wanderers Round 23

| NRL - RUGBY LEAGUE

| A LEAGUE - SOCCER

 Saturday 30 March, 7:50pm  Wanderers v Melbourne City FC  ANZ Stadium

Giants

| AFL - AUSSIE RULES

Round 1

 Sunday 24 March, 3:20pm  Giants v Essendon  Sydney Showground Stadium

Round 2

 Saturday 6 April, 4:35pm  Giants v Richmond  Sydney Showground Stadium

Your Conveyancing Simply Made Easy!

Specialists in all property transactions throughout NSW We pride ourselves on treating each transaction as if it were our own, making it a stress-free and simple process that is tailored specifically to each individual clients circumstances.

CONTACT US FOR AN OBLIGATION

Shop 1, 1216 Mulgoa Road, Mulgoa NSW 2745 Ph: 02 4704 3100 | Fax: 02 4704 3101

FREE QUOTE

www.conveyancingsimplif ied.com.au Issue 25 March 2019

9


Spotlight

Christine Anu IN CONVERSATION & SONG

EVENT IN THE SPOTLIGHT EVENT DETAILS

A journey of music and stories Australia’s most iconic female Indigenous entertainer returns to the Joan with her highly acclaimed and intimate show.

i

 Christine Anu: In Conversation and Song  16 March, 7.30pm - One night only  Standard $60 | Concession $55 Under 30s $30  Joan Sutherland Performing Arts Centre 597 High Street, Penrith  02 4723 7600  thejoan.com.au

Christine, accompanied by her exceptionally talented band, will perform popular songs including Sunshine on a Rainy Day and the unofficial national anthem My Island Home – a song selected by the National Film and Sound Archives to be inducted into the Sounds of Australia Registry alongside Midnight Oil and The Wiggles. On this very special occasion Christine will also share personal anecdotes on life, her advocacy work for diversity and inclusion, and the importance of Aboriginal and Torres Strait Islander language in Australian culture. A multi award-winning recording artist, Christine has made acclaimed appearances in major films and stage productions including Baz Luhrmann’s Moulin Rouge and The Matrix Reloaded. A stage powerhouse and performer, she has also starred in widely acclaimed stage productions including Hairspray: The Arena Spectacular, The Sapphires, Rent, and Parramatta Girls.

one night only!

An inspiration of talent, Christine Anu: In Conversation and Song is a show not to be missed.

Ronn Moss An Evening of Songs and Stories There’s more to the story of Ronn Moss, the man behind Ridge Forrester for 25 years, who will be in town this March.

R

onn Moss is more than an actor - he’s also an accomplished musician and singer/songwriter. In 1976 Ronn joined Peter Beckett to form the band Player, remaining with the group throughout their biggest moments including the creation of the 1978 smash hit, Baby Come Back. Ronn released his solo debut in 2002. I’m Your Man received a dedicated Australian release, and he followed this up with a second solo effort, Uncovered, in 2006 and then My Baby’s Back in 2018. Whether he’s feuding with brother Thorne, marrying Brooke, making up with brother Thorne, re-marrying Brooke, or writing smooth, blue-eyed soul, Ronn Moss can do it all.

i

EVENT DETAILS  Ronn Moss An Evening of Songs and Stories

 $50 Standard | $150 VIP Experience (visit online for details)

 15 March, 8pm

 55 Sherbrooke St, Rooty Hill  rootyhillrsl.com.au

AUSTRALIA’S LARGEST CONSTRUCTION EXPO IS BACK IN 2019! PANTHERS PENRITH 123 MULGOA RD SYDNEY | DIESELDIRTANDTURF.COM.AU

3-5 MAY 2019

®


Spotlight

John Williamson The Butcherbird Tour Back on the road, this Aussie icon is sharing the big hits alongside his latest musical creations.

H

aving created some of Australia’s most recognised unofficial anthems, John is firmly cemented in the nation’s musical culture. His tributes to legends and unsung heroes, and tender ballads, have captured the spirit of the nation in song unlike any other. Australian icon John Williamson is back on the road with The Butcherbird Tour, which he is taking across Australia over the next 12 months from coast to coast. Along the way he's sharing the big hits and his latest musical creations. The new tour comes off the back of his new album by the same name, Butcherbird, released in August 2018. The new album and tour continues to see

John celebrate and pen the stories into song that he continues to be passionate about; the country, the people, and the fight for what is right. Butcherbird combines humour, romance, travelling songs and campfire stories. There's no doubt as to why it resonates with Aussies and continues to showcase his ability to capture the land, its characters and the Australian spirit in song. You can call him what you want; Mallee Boy, True Blue or just plain Fair Dinkum. But there is no denying that, after more than forty years in the music industry, John Williamson is truly an Australian icon.

EVENT DETAILS  John Williamson – The Butcherbird Tour

i

 22 March – 8pm  Adult $56 | Child (under 14yrs) $33  123 Mulgoa Road, Penrith  penrith.panthers.com.au

the meatballl

GET THEM AT BAVARIAN PENRITH THEBAVARIANS.COM

Issue 25 March 2019

11


Community

Caring For Our Males

Written by Manisha Foley

Local fleet sales manager Sean Hogan is taking a brave step in speaking out about men’s struggle with mental health and depression.

Monday for dinner and a chat. It’s a place where they can be open and talk. They are stronger because they are together,” says Sean.

A

“Silence is a big factor," explains Sean. "I’m a big believer in letting men know it’s okay and there's lots of help out there. Quite often there are children who may have concerns over things that adults find trivial, such as ‘not enough Facebook likes or something on social media’ and they get dismissed because they aren’t adult problems, but we have to listen to our children because one conversation may save a life.”

father of three teenage children, Sean knows the significance of being honest and open with his family.

“I was lucky growing up, never having lost a close friend. But it was quite the opposite for my son. At 14 he lost one of his close friends in a tragic car accident. He was like a son to me and I could see the pain in my child’s eyes when that happened. A year later, he lost a mate from his local AFL club to suicide. To see Ty go through this again, all I wanted to do was make the pain go away.” Prior to this, Sean was watching the Man Up series and saw Tom Harkin, who ran programs in schools about challenging masculinity. Sean found the importance in the message that Tom and his Tomorrow Man programs were presenting – they were reinventing masculinity for boys and men Australia-wide. “We are taught that it's important for men to be stoic and heroic, but the most masculine thing a man can do is be vulnerable. We need to show men that it's okay to cry, to be upset and, most importantly, to be there for your mates. “My sons are really good young men and we have a tradition of their friends coming around every second

12

roamingpanthermagazine.com.au

Mental health among men has risen exponentially, being the number one killer amongst men. The statistics are terrifying, with six men taking their own lives every day.

Sean also recognises the importance of the support his local AFL team provides. He approached Gotcha4Life and local footy clubs to talk about how they could positively impact men’s health. Together they held fundraisers and a sportsman’s lunch in which all funds were donated to the local area for the supply of programs that would inspire local boys and men to be the best they could be. “We also work closely with Penrith RAMS and have a Gotcha4Life round. After the games the participants have an open conversation about mental health. After lunch we also have a ‘blokes night’ that generates discussion on what it’s like to be a man battling depression and suicide.” These fundraising events and lunches have raised a staggering $92,000 to date. And the funds are all used in local communities to spread awareness. As Sean says,

“It’s about connecting communities together and sharing our stories.” His tireless work has been recognised by Penrith City Council, which bestows the Australia Day Awards honours to outstanding locals in recognition of their contribution to the city. Sean received a Local Appreciation Award for his commitment to the cause. “It’s important for me and the organisations I work with to spread this message; it’s okay not to be okay.” Sean Hogan is rewriting the rules on what it is to be an ‘Aussie Man’ and creating a positive impact that will provide boys and men with the strength and emotional intelligence to continue healthy conversations that will save lives.

...the most masculine thing a man can do is be vulnerable ABOUT GOTCHA4LIFE Gotcha4life Foundation has been established with the fundamental aim of helping save the lives of males throughout Australia, taking action and positively impacting on men’s mental health.  gotcha4life.org


Community

All Stars, All Abilities Written by Brooke Allender

through activities that develop an exciting cheer routine.

We take 15 minutes with Emma Twoumey, Tumble Director and Coach at Liberty Allstars.

The favourites are definitely the ribbons and trampolines! At the end of every class, we’ll spend some time using them as a treat for their hard work.

B

HOW MUCH HAVE YOU SEEN THESE KIDS TRANSFORM?

reaking barriers and building fortitude. Meet Penrith’s first competitive cheer squad for special needs kids of all ages, Iron Heart.

When we first started, the kids were unsure of our volunteers and didn’t like being touched. Since then, they have shown physical and psychological improvements, and now share a special bond with their trainers. Not to mention the absolute beam of pride they have when they put their uniforms on!

LIBERTY ALLSTARS WAS FOUNDED IN 2015 WITH HUGE SUCCESS – WHAT DROVE YOU TO START IRON HEART? We started Iron Heart in 2017. We felt there were a lack of physical opportunities for special needs kids, including the chance to experience the real deal, competitive classes that all our students do. They practice weekly, have uniforms, and compete four times a year. WHAT ACTIVITIES DO THEY TAKE PART IN – IS THERE A FAVOURITE?

AND WHAT ABOUT YOUR VOLUNTEERS, HOW HAS IT TRANSFORMED THEM? We have a brilliant group of girls who are committed, hardworking athletes and volunteer their time to work with our Iron Heart kids.

During practices we work on fine and gross motor skills, self-esteem, and team interactions. This is all done

Free entry & parking

We have parents thanking us constantly – one mother said she can now confidently go grocery shopping knowing that her child has the tools to manage potential overwhelm.

It's enhanced their own physical abilities. They watch as these incredible young athletes perform without letting their disabilities get the better of them, so they harness this courage and determination in their own practice. WHERE DO YOU HOPE TO TAKE IRON HEART IN THE FUTURE? We’re always thinking of new routines and competitions for our Iron Heart kids to take part in. We want to build camaraderie between the kids and their fellow athletes. We want them to feel empowered and valued as team players. And we want to spread the word so that parents of kids with disabilities know that there’s opportunity and support out there. FIND OUT MORE For more information, follow Iron Hearts on Facebook  Liberty Allstars Iron Heart

Over 200 exhibitors

®

MAY 3-5 2019

Friday 3rd, Saturday 4th, Sunday 5th May 2019

AUSTRALIA’S LARGEST CONSTRUCTION EQUIPMENT EXPO

GOLD SPONSOR:

GOLD MEDIA SPONSOR:

PANTHERS PENRITH 123 MULGOA ROAD SYDNEY | DIESELDIRTANDTURF.COM.AU “Diesel Dirt & Turf, DD&T and Diesel Dirt & Turf Expo ® are trademarks owned by Diesel Dirt & Turf Expo Pty Ltd. © 2019 Diesel Dirt & Turf Expo Pty Ltd. All Rights Reserved. Any unauthorised use of the trademark is expressly prohibited.”

DDT19_HP_horizontal_ad.indd 1

15/2/19 12:32 pm

Issue 25 March 2019

13


Local Business

ROAMING WITH

Local Business We spoke with Snooze Franchise Partners Kathy and Ivan about all things beds, bedding and business in Penrith. 1 WHEN DID YOU FIRST OPEN THE DOORS

TO SNOOZE PENRITH AND WHERE ARE YOU LOCATED? Snooze Penrith opened over 20 years ago, and we had the incredible opportunity to take over as Franchise Partners in August 2017. You'll find us in the Penrith HomeMaker Centre, which has plenty of parking and is readily accessible. We loved the area and saw it as a great chance to bring our passion for retail to the community. 2 WHAT MADE YOU MAKE THE MOVE TO

PENRITH AND OPEN SNOOZE PENRITH? Ivan and I have been in the retail industry for over 20 years. We arrived in Australia from Ireland three years ago and were fortunate to join the Snooze family as Store Managers in Sydney. With the luck of the Irish behind us, we had the amazing opportunity to acquire our own store. We both manage the store on a day-to-day basis and have a wonderful, dynamic team supporting us. 3 WHAT SERVICES AND PRODUCTS DO

YOU OFFER? We offer mattresses, bed frames, bedroom furniture and kid’s beds as well as linen, pillows and quilts – everything you need to make your bedroom your own.

We’re also proud to offer a great range of Australian mattresses such as Sealy, Madison and Slumberland. 4 WHAT WOULD YOU SAY YOUR POINT OF

DIFFERENCE WOULD BE? The perfect bedroom beings with your dream bed. So at Snooze we have a secret weapon called the 'Snooze Profiler®', which helps us work with each customer to select the perfect mattress based on their own individual uniqueness. With a huge selection of bedroom furniture to choose from, your dream bed isn’t far away. Using the sleep profiler is simple and easy. 1. Start your profile by answering a few simple questions. 2. Lay back on the Snooze Profiler®, as it simulates different mattress comfort options. 3. Receive your sleep profile – you can then start shopping for the perfect bed! 5 BEING A LOCAL BUSINESS OWNER, YOU

WOULD KNOW THE IMPORTANCE OF COMMUNITY INVOLVEMENT - HOW DO YOU GIVE BACK TO THE COMMUNITY? Several staff members are involved in local networking groups and work with other local businesses - it’s wonderful to spend time with like-minded people in the community.

We’ve also worked with some local charities and donated products to help them with fundraising activities. And as we’re huge fans of the Panthers, we decide to jump on board as a sponsor which is really exciting for us. 6 ARE THERE ANY ACHIEVEMENTS YOU ARE

PARTICULARLY PROUD OF SINCE OPENING? We’ve won numerous awards in our short time with Snooze, and were recently awarded Snooze Team of the Year and Retailer Excellence, and one of our main suppliers, Sealy, recognised us for the highest dollar and percentage increase within the year we’ve been trading. The Snooze Team of the Year was recognition of not only our business operations but also our focus on our customers and community, which we’re passionate about. We wouldn’t be as successful if it wasn’t for the support of our customers. 7 WHAT ADVICE WOULD YOU GIVE TO SOMEONE

WANTING TO OPEN THEIR OWN BUSINESS? Although starting a new business can come with high risk, it also comes with high reward. If you have a clear plan, set objectives and a great team to help execute that plan and those objectives, along with great products and services, you have the recipe for a successful business.

GET A BETTER NIGHT'S SLEEP WITH SNOOZE  Snooze Penrith  Shop 22 Penrith Homemaker Centre, 2 Pattys Pl, Jamisontown  02 4733 7911  snooze.com.au

14

roamingpanthermagazine.com.au


Community

Penrith's New Brewery with a Difference CATCH UP & CHILL OUT Written by Penrith City Council

The humble home brew has come home to roost with microbrewery Rusty Penny opening their doors in Penrith.

Y

ou could say the idea for Rusty Penny Brewing Co has been ‘brewing’ away for some time (sorry we couldn’t resist). Local mates Matt and Mark, owners of local home brew supplies shop All Things Homebrew, have nurtured the dream of opening their own microbrewery since 2007. After 13 years of ‘practice’, the boys took the leap. They opened the doors to Rusty Penny in December

and Penrith couldn’t be more excited to welcome a new microbrewery to the region. For those of you who like to get technical; Matt and Mark brew their beers in a 200-litre system. This is smaller than most breweries but gives them an opportunity to experiment and strive for the ultimate brew. It also gives tasters a wider sampling range – up to 12 different beers can be enjoyed at any given time! Some of the brews on tap include the Australian Pale Ale, Stout, American Pale Ale, Pils and Session Ale. Overwhelmed already? Don’t worry. Just know that there’s a beer to suit absolutely everyone’s taste and you’re guaranteed to get a top notch drink every time you visit!

With capacity to seat up to 30 people, Rusty Penny is suitable for both individual and group tastings, meaning it’s the perfect location to catch up and chill out. Tasting paddles are available for $7 and include five samples. Alternatively, you can jump right in with a sample glass starting at $6.

COME GRAB A BREW Rusty Penny is open Thursday through to Sunday, so make a date with your mates and enjoy one of life’s simplest pleasures.  Unit 5/4 Dean Place, Penrith  02 4706 9061

Issue 25 March 2019

15


Inspiring Local Mum

Don’t MS with Rachel Written by Manisha Foley

HOW ONE WOMAN’S BATTLE WITH MULTIPLE SCLEROSIS IS MOTIVATING WARRIORS ACROSS THE WORLD

I

t was during a casual hangout with her girlfriends on Sunday 26 November in 2017 that Rachel Schein, an energetic 29-year-old from Emu Heights, began to feel pins and needles in the outer parts of her hands and feet. What she didn’t expect was to be diagnosed with Multiple Sclerosis a week later. “After the initial pins and needles, the feeling was getting frequent day by day. Over the next week the tingling and numbness intensified, until I couldn’t feel anything from my hips down,” explains Rachel. "I made many a trip to the doctors and Emergency – deep down I knew something was wrong and I wanted answers straight away.” Rachel’s insistence paid off. On 5 December she was admitted to Westmead Hospital where she remained for nine days. She underwent countless tests until the neurologists diagnosed her with Relapsing, Remitting Multiple Sclerosis. “It was a pretty intense couple of days,” recalls Rachel. “Because there isn’t one specific test for MS, it’s more of a matter of putting as many ticks in the column as you can and then ruling everything else out.” As a condition of the central nervous system, MS varies greatly with every individual. It interferes with nerve

Funds will go towards services like MS Connect, which Rachel used to help her during some incredibly tough moments. 16

roamingpanthermagazine.com.au

impulses within the brain, spinal cord and optic nerves, with symptoms ranging from mild to severe. Rachel is lucky to have been diagnosed with the first category, which means she can have total recovery after flares or relapses. The journey has, though, affected her mobility. “After being diagnosed I was in a wheelchair in hospital; the bottom half of my body was numb. Once I could walk again, I had to take it easy and struggled to walk upstairs,” she explains. While her medication helps with mobility, fatigue is Rachel's biggest struggle. “I can’t be out and about in very hot situations and have to really plan out my day in case I get tired. Also, the medication supresses my immune system, meaning I need to be cautious of germs! And with my little girl starting day care, it’s only natural that she’ll catch whatever is going around. The slightest exposure to a cold means I’ll get sick straight away. So instead of getting sick a couple of times a year, I can get sick once a month.” Her beautiful daughter Isabella was only five months old when Rachel was diagnosed. And for Rachel, as tough as it was to accept her MS, it was tougher to be away from her daughter and husband for so long. Rachel was in her element being a first-time mum and, naturally, felt cheated from experiencing the unbridled joy of


Inspiring Local Mum

Isabella’s newborn months as her health overshadowed the quality time they spent together.

Rachel's blog has created bonds between friends (her ‘MS Warriors’, as she fondly calls them) who face the same challenges – even from the other side of the world.

“I don’t think I would have gotten through that time without the support of my husband Damien, my in-laws and my own family – they have been absolutely amazing. Isabella was my number one motivation for fighting this fight and giving her the best possible mum to take care of her.”

It most definitely resonated with Rachel’s mother, who told her that she was participating in this year’s MS Walk + Fun Run in honour of her. She was so touched by her mum’s kindness that she used the opportunity to do her part in raising much-needed funds for MS Support Services.

The strong support network that surrounds Rachel, Damien and Isabella is what motivated Rachel to document her journey. She initially began an Instagram page which showed what life was like living with MS. She received such a positive response from her honesty that she began mapping her journey via a blog.

“The response has been amazing! Little did I know how many people wanted to get on board and support me and the cause. Not only are people donating, but I’ve also been contacted by so many family members and friends wanting to join me on the walk.”

“I wanted to start this blog for a few reasons. Firstly, for people to be able to talk about disability comfortably and not feel that they had to tiptoe around the subject. Secondly, it was a way to keep family and friends informed of my journey. Thirdly – it’s a way for me to vent! I’m an open book so for me I feel like it’s a bit of therapy and it helps my mental state. “My blog is also a good way to keep my MS journey documented, for me and my doctors, and I hope to be able to share it with my daughter one day when she’s old enough. Lastly, it’s a way to help others. Whether by helping people going through something similar or helping people better understand what MS is while also creating more awareness of the condition.”

Rachel’s team, Don’t MS with Rachel, currently has over 40 people who have raised over $2,000 so far. These funds will go towards services like MS Connect, which Rachel has used to help her during some incredibly tough moments. “I consider myself lucky because I was diagnosed and treated so quickly – within a week. So many people go for months, if not years, without a diagnosis.” Even though there is no cure for MS, Rachel and her beautiful family are fighting the good fight to raise awareness. So jump on board and support Rachel and her fellow MS Warriors in creating a better future for people living with the condition.

DONATE TO RACHEL’S TEAM FOR THE MS WALK + FUN RUN If you would like to donate head to:  www.mswalk.org.au and search DON’T MS WITH RACHEL. Join in the MS Walk + Fun Run yourself!  Metcalfe Park, Pyrmont, Sydney NSW 2000  Sunday 7 April 2019 Run – 8:30am Walk – 10:00am

For All Your Beauty Needs

Insignia Hair & Day Spa is an award winning hairdresser located in Penrith. We also have a full Day Spa with Beauty Salon, Massage Therapist and Nail Parlour all in the heart of Penrith. Insignia Hair & Day Spa is your Hairdresser in Penrith we specialise in creative cutting and colouring for men, women and children, colour correction, total restyles and makeovers to make you look and feel amazing. HAIR

BEAUTY

 (02) 4722 3503

DAY SPA

 14/69 York Rd, Penrith NSW 2750

ins ig n i a h a i r a n dd a ysp a .c om .a u Issue 25 March 2019

17


Roaming Feature 201 THE 9 ME AC A DV T I O N & ENT URE

Penrith CBD Festival SAT U R DAY 1 6 M A RC H Written by Manisha Foley

Ready for action and adventure? The Penrith CBD Corporation, along with main sponsor Penrith City Council, will be bringing all of that and more to the CBD via its annual Festival.

“P

enrith City Council has supported the Penrith CBD Festival for many years, recognising the role large community festivals like the CBD Festival play in showcasing Penrith and engendering community pride in our City,” says Cr Ross Fowler OAM, Mayor of Penrith. 18

roamingpanthermagazine.com.au

With the opportunities and experiences on the rise within Penrith, it’s the perfect time to showcase our diversity and encourage people to discover Penrith and the CBD. “What’s really great to see is all the local businesses engaging with each other to support the Festival and getting on board with such a great community event,” explains Gai Hawthorn, CEO of Penrith CBD Corporation. Cr Fowler agrees. “Council is aware that a healthy CBD means a vibrant and healthy local economy. For this reason, Council has recently undertaken significant improvement works on High Street to enhance streetscape design, incorporate environmental and social sustainability, develop neighbourhood character, and increase usability and safety in the street. This important, city-shaping project

will have major ongoing benefits for residents, workers, visitors and local businesses, providing an atmosphere that brings shoppers back to this 'traditional' main street of Penrith.” An event of this magnitude takes a village to put together – not to mention the many great sponsors who have also jumped on board. “We have the talented crew from Mr Watkins creating beautiful cocktails and food. High St Depot will be whipping up award-winning coffee and mouth-watering breakfasts. And At Print is designing all the eye-catching creative for our big day. Festival goers will be able to roam the streets which will be full of market stalls and entertainment, and also support small business at the same time.”


Roaming Feature

Brighter, an initiative of the Australian Petroleum Production & Exploration Association, approached Penrith CBD Corporation to find out how it could contribute and engage with the local community. “Natural gas is embedded in our everyday lives, even in ways we may not think about. Take the humble gas BBQ, for example – it’s core to the Australian way of life, and it brings family and friends together,” explains Sarah Browne, Director of Communications for Brighter. “By supporting the Penrith CBD Festival, we are supporting an event which brings people and local businesses together, just like the gas BBQ on a summer’s day.” Of course, the humble BBQ will be one of the features on the day, with Brighter and local Rotary clubs participating in a BBQ Challenge. And if that doesn’t have your mouth watering, Festival goers will also have the chance to work out and cool down at the same time with the ‘Bike n Blend’ - harnessing your pedal power to mix your very own smoothie! These bikes will be part of the festival’s ‘Action & Adventure’ space, which will be brimming with various activations by BCF Penrith, Bunnings, Panthers, Nepean Motor Group, and PCYC Penrith. Astina Group will be taking ownership of the ‘Experience Penrith’ space, highlighting the incredible lifestyle experiences offered within the CBD. “We think it’s extremely important for local community to support local business. It’s one of our core values and something we strive to achieve,” says William Schrumpf, General Manager of Astina Group. “Astina Group supports and manages all facets of business, from café’s, apartment living or investing in property, so it was a no-brainer to support such a great event.” Another business who knows how important it is to engage locally is Katrina Couchman from WOTSO Workspace Penrith, also a Festival sponsor. “The Festival is important to myself and to WOTSO, as we offer a lot of services to the community that people are unaware of. Co-working is the way of

the future and it’s a great way to show the people of Penrith that we’re very much moving with the times and fulfilling their needs,” says Katrina. The kids aren’t forgotten, either, with fantastic entertainment organised from the main stage (proudly sponsored by Westfield Penrith). PAWS will be performing the Wizard of Oz as the pantomime (which portrays the ultimate adventure in our books!), and there will be special guest appearances by Paw Patrol and Trolls. Free face painting and plaster painting, plus the adorable animals in the kindy farm, will also be available. And if that isn’t enough, we have Bubbly coming to wow the crowds with monster bubbles and an interactive activity for kids. Little hands will also be kept busy courtesy of Bricks 4 Kidz and their LEGO display. The iconic Street Parade will be making an appearance again, with the support of Lower Mountains Air Conditioning, with the team sponsoring one of the favourite parts of the day.

Although the Penrith CBD Festival is only for one day, the benefits to the CBD and the city of Penrith reach far and wide... it boosts the local economy and fosters a genuine sense of pride in our community

“Nothing brings people together like festivals do. They play a pivotal role in community-building; bringing people from every religious, economic and social background together,” explains Anthea and Andrew, the duo behind the 30-year-old business. “As a family business, with three children of our own, we also enjoy supporting the festival knowing that our sponsorship funds go towards a day for Penrith to enjoy with their own families!” Although the Penrith CBD Festival is only for one day (although what a jam-packed day it is), the benefits to the CBD and the city of Penrith reach far and wide. By bringing in a crowd of over 20,000 to the streets, it boosts the local economy and fosters a genuine sense of pride in our community. Importantly, it helps forge those essential bonds with local businesses and organisations – it’s their sponsorship and involvement that helps strengthen relationships. And it’s these very connections that are the glue that hold our amazing community together.

i

EVENT DETAILS A day filled with live stage shows, roving entertainers, market stalls, food trucks, characters, free activities and rides, showbags, and a HUGE street parade.  Penrith CBD Festival 2019  Saturday, 16 March 2019 9AM - 4PM  FREE EVENT  Penrith CBD  @penrithcbdcorporation

Photo Credit: Hilary Nathan Photography | 2019 Penrith CBD Festival Sponsors

Issue 25 March 2019

19


Local Business

ROAMING WITH

Local Business Meet local Conveyancer Rebeccah Barker – she knows her stuff. And she’s awesome at making property transactions completely and utterly painless.

1 WHEN DID YOU FIRST OPEN CONVEYANCING

SIMPLIFIED AND WHERE ARE YOU LOCATED? I opened the firm in late 2017, and the office is in the Mulgoa Village Shopping Centre on Mulgoa Road. 2 TELL US ABOUT THE SERVICES YOUR

BUSINESS OFFERS. I specialise in a range of Conveyancing services including residential, off-the plan, strata, community, commercial and rural transactions throughout NSW. I can also act on family transfers, deceased estate transfers, and retirement villages. 3 TELL US MORE ABOUT YOUR INDUSTRY

EXPERIENCE. I commenced studies straight after completing my HSC in 2008. Since then I’ve had experience in a boutique local conveyancing firm and a solicitor’s office where I gained extensive knowledge and experience in many areas of Conveyancing, while also beginning to establish a name for myself in the industry. During this time I also completed my Advanced Diploma of Conveyancing with distinctions, was a finalist for the Australian Institute of Conveyancers

CEO Award, and was granted my Conveyancing Licence – being the youngest Licenced Conveyancer in NSW at the time. It became clear early on that I had a strong passion for the Conveyancing/property industry, and it’s a passion that continues to grow every day. 4 WHAT WOULD YOU SAY YOUR POINT OF

DIFFERENCE WOULD BE? I pride myself on offering a personalised service that is tailored specifically to each individual client’s needs, using the latest technology and systems. I will guide you through each step of your property transfer journey and minimise the stress and risks involved along the way. When you use my firm, you deal with me directly throughout your entire matter. This means your questions are answered first time, every time. 5 WHAT WOULD BE THE MOST REWARDING

ASPECT OF WHAT YOU DO? By far, the most rewarding part of my job is helping clients reach their goals of buying a new property, whether it be their first home, their dream home, or an investment property. I strive to treat each matter as if it is my own, so the excitement my clients have when

I advise that their matter has settled really makes my day and I feel so lucky to call this my job. 6 WHAT ADVICE WOULD YOU GIVE TO SOMEONE

WANTING TO OPEN THEIR OWN BUSINESS? There is never a perfect time! I put off opening my own business for so many years, constantly thinking that it was never the right time and eventually this perfect time would suddenly appear. In the end, I opened my business in the middle of planning a destination wedding and, let me tell you, it wasn’t easy but worth it! I am so proud of this little business I have built in such a short time, and I look forward to what the next few years will bring.

Testimonial

Lester & Michelle - Cranebrook

CONVEYANCING SIMPLY MADE EASY! Specialists in all property transactions throughout NSW  Conveyancing Simplified  Shop 1, 1216 Mulgoa Road, Mulgoa  02 4704 3100  conveyancingsimplified.com.au

20

roamingpanthermagazine.com.au

|

“I can't thank Rebeccah enough for all of her support, guidance and hard work during our purchase and sale process. Rebeccah is exceptionally knowledgeable; she communicated with us every step of the way and her customer service is exceptional. She really is the best and I recommend her services to everyone I know.”


Food

Easy

KE O KET TO

A style of eating that is low in carbs and rich in healthy fats.

EASY KETO: PETE EVANS  Pete Evans

 RRP $24.99 (Paperback) | $9.99 (Ebook)  panmacmillan.com.au The ketogenic diet is a powerful way to transform your health, lose weight and find relief from common health problems. In this practical, one-stop guide, Pete Evans gives you the essential information you'll need to transition to this way of eating, including: • The benefits of a keto diet • Guidelines on carbohydrates found in common foods • Eating, shopping and pantry tips • More than 70 simple and delicious recipes As always, Pete's recipes are quick, easy to make, and full of bright, fresh flavours.

Pork Chops WITH RATATOUILLE

Serves 4 INGREDIENTS 9 4 x 200g pork cutlets 9 2 tablespoons melted coconut oil or good-quality animal fat* 9 1 handful of basil leaves Ratatouille 9 300ml coconut oil or good quality animal fat* 9 1 large eggplant, cut into 2cm pieces

9 2 zucchini, cut into 2cm pieces 9 1 red onion, diced 9 1 red capsicum, cut into 2cm pieces 9 5 tomatoes, chopped 9 2 garlic cloves, chopped 9 2 tablespoons apple cider vinegar 9 3 tablespoons olive oil 9 Sea salt and freshly ground black pepper.

METHOD 1 To make the ratatouille, heat the coconut oil or fat in

a large heavy-based frying pan over medium – high heat until it starts to smoke. Add the eggplant and fry until golden, about 4 – 5 minutes. Remove the eggplant with a slotted spoon and drain on paper towel. Repeat with the zucchini. Reserve the leftover oil. Heat 2 tablespoons of the reserved oil in a large saucepan over medium heat. Add the onion and cook, stirring occasionally, for 5 minutes, or until softened. Stir in the capsicum, tomato, garlic and 3 tablespoons of water and cook, stirring now and then, for 8 minutes or until softened. Stir in the fried eggplant and zucchini and gently simmer for 15 minutes, or until the tomato has broken down into a rich sauce. Stir in the vinegar and olive oil and season with salt and pepper.

2 Coat the pork cutlets with the coconut oil or fat and

season with salt and pepper.

3 Heat a large heavy-based frying pan over medium –

high heat, add the pork and cook, turning occasionally, for 6–8 minutes or until browned and just cooked through. Allow to rest for 5 minutes.

NUTRITIONAL INFORMATION PER SERVE

4 To serve, divide the ratatouille among serving plates,

place a pork cutlet on top and scatter over the basil.

Total carbs: 4g | Net carbs: 3g | Fat: 41g | Protein: 27g Fat: 75% | Protein: 22% | Carbs: 3% PhotoCredit: William Meppem

Issue 25 March 2019

21


Food

WITH TOASTED WALNUTS

Serves 4 A lot of my books feature chicken salads because they are just so damned delicious. Also, they are an easy, quick and tasty way to use up leftover roast chicken. Take whatever leafy greens you love the most and make that your base, then add the chicken, vegetables or fruit and some crunchy seeds or nuts, fresh herbs and kraut. Dress, add some good fats, such as avocado, olives or hard-boiled eggs, and you’re done. INGREDIENTS 9 4 boneless chicken thighs, skin on sea salt and freshly ground black pepper 9 1 tablespoon coconut oil or good-quality animal fat* 9 Extra-virgin olive oil, for drizzling Dressing 9 100g Mayonnaise (recipe to the right) 9 1 ½ tablespoons lemon juice 9 ¼ teaspoon grated garlic Salad 9 400g savoy cabbage, shredded 9 2 large handfuls of baby spinach leaves 9 ½ red onion, finely chopped 9 1 pink lady apple, cored and cut into matchsticks 9 1 handful of mint leaves, torn 22

roamingpanthermagazine.com.au

9 1 handful of flat-leaf parsley leaves 9 1 handful of chervil leaves 9 1 handful of tarragon leaves 9 100g toasted walnuts. METHOD 1 To make the crispy chicken, pat the chicken thighs dry with paper towel, then place between two sheets of baking paper and flatten with a meat mallet. Season the skin with 2 teaspoons of salt. 2 Heat the coconut oil or fat in a large heavy-based

frying pan over medium – high heat. Add the chicken thighs, skin-side down, and season the exposed flesh with a little salt. Fry, undisturbed, for 6 – 8 minutes until the skin is crispy and golden brown. Turn and cook for 3 – 4 minutes until cooked through. Transfer the chicken, skin-side up, to a wire rack and leave to rest for 5 minutes. Chop into bite-sized pieces. 3 To make the dressing, place the mayonnaise,

lemon juice, garlic and 2 teaspoons of water in a small bowl and mix to combine. Season with salt and pepper. 4 Arrange all the salad ingredients in a large bowl,

top with the chicken, then pour over the dressing. Drizzle over some olive oil and season with salt and pepper. Give the salad a good toss before eating.

NUTRITIONAL INFORMATION PER SERVE

Crispy Chicken Salad

Total carbs: 16g | Net carbs: 9g | Fat: 66g | Protein: 26g Fat: 78% | Protein: 14% | Carbs: 8%

Mayonnaise

MAKES ABOUT 500G (2 CUPS)

INGREDIENTS 9 4 egg yolks 9 2 teaspoons Dijon mustard 9 1 tablespoon apple cider vinegar 9 1 tablespoon lemon juice 9 400ml olive oil or macadamia oil (or 200ml of each) 9 Sea salt and freshly ground black pepper. METHOD Place the egg yolks, mustard, vinegar, lemon juice, oil and a pinch of salt in a glass jug or jar and blend with a hand-held blender until smooth and creamy. Season with salt and pepper. Alternatively, place the egg yolks, mustard, vinegar, lemon juice and a pinch of salt in the bowl of a food processor and process until combined. With the motor running, slowly pour in the oil in a thin stream and process until the mayonnaise is thick and creamy. Season with salt and pepper. Store in a jar in the fridge for up to 5 days.


Food

Chicken Burgers

WITH GARLIC, LEMON & THYME

Serves 4 Your meals needn’t be difficult or expensive but they should always be delicious. Here, we have one of the simplest recipes in the book and it is sure to be a winner. Make a big batch of these (you can do this in a muffin tray if you like) as they are wonderful to have on hand for snacks and lunches.

NUTRITIONAL INFORMATION PER SERVE Total carbs: 4g | Net carbs: 3g | Fat: 41g | Protein: 27g Fat: 75% | Protein: 22% | Carbs: 3%

INGREDIENTS 9 2 baby cos lettuces, leaves separated 9 100g Mayonnaise (recipe on page 22) 9 1 lemon, cut into wedges Chicken burgers 9 3 tablespoons coconut oil or good-quality animal fat* 9 ½ onion, finely diced 9 3 garlic cloves, finely chopped 9 1 teaspoon chopped thyme leaves 9 500 g chicken mince 9 1 egg 9 1 tablespoon chopped flat-leaf parsley leaves 9 Zest of 1 lemon 9 1 teaspoon sea salt 9 ½ teaspoon freshly ground black pepper.

METHOD 1

To make the burgers, heat 1 tablespoon of the coconut oil or fat in a frying pan over medium heat. Add the onion and cook for 5 minutes or until softened. Add the garlic and thyme and cook for 30 seconds, or until fragrant. Remove from the heat and allow to cool.

2 Place the cooled onion mixture in a bowl, then add

the remaining burger ingredients and mix well. Shape into eight patties. 3 Heat the remaining coconut oil or fat in a large

non-stick frying pan over medium – high heat. Add the patties, in batches if necessary, and cook for 2½ – 3 minutes on each side until they are cooked through. 4 Place the patties on the cos leaves and top with the

mayonnaise. Serve with lemon wedges to squeeze over the top.

*Good-quality animal fat I use either coconut oil or good-quality animal fats for cooking as they have high smoke points (meaning they do not oxidise at high temperatures). Some of my favourite animal fats to use are lard (pork fat), tallow (rendered beef fat), rendered chicken fat and duck fat. These may be hard to find - ask at your local butcher or meat supplier, look online for meat suppliers who sell them, or make your own when making bone broths.

Issue 25 March 2019

23


Adventure

In the Footsteps of Heroes… THE KOKODA YOUTH LEADERSHIP CHALLENGE

Penrith RSL Club is calling for applications for the Kokoda Youth Leadership Challenge, which takes young community leaders on a 10-day trek across the 155km Kokoda Trail in Papua New Guinea.

O

verseen by the RSL & Services Clubs Association, the program is aimed at creating greater awareness among young people of the Diggers’ sacrifice in the Kokoda Campaign. In doing so, traditions live on, a commitment to community service is instilled, personal development is enhanced, and participants are encouraged to become future leaders in their own communities. “It breaks you down, tears you to your knees, but then it builds you back up again,’ said former participant Brendon Speechley. Penrith RSL Club and Penrith RSL sub-Branch have been major supporters of the Kokoda Youth Leadership

24

roamingpanthermagazine.com.au

Challenge for many years, sponsoring both staff and local youths. Their sponsorship covers the cost of the airfare, accommodation and food expenses, reaching well over $6,000 per participant. “It is a big expense, but we think it’s a great program. The experience that participants have is life changing,” said Penrith RSL Club CEO Neel Chand. Ms Amber Walker, a Kokoda Trek participant sponsored by Penrith RSL Club, described her experience as, “once in a lifetime; one that I am so grateful to have been given and one that will forever be kept in my memory. I can honestly say this has been the most rewarding, informative and emotional experience of my life.” “Participants will hike over impossible terrain in tropical humidity. They will battle mosquitos, rough sleeping, constant mud, and physical and emotional exhaustion. For all that, though, they will also walk through real battle grounds, hearing stories about the soldiers and the ‘Fuzzy Wuzzy Angels’. They will experience first-hand the power and importance of mateship,” said Mr Chand.

Many of them were my age or even younger than me; and to know that they fought so hard and showed so much courage in protecting our country makes me feel tremendously grateful and proud

“As challenging as the experience is, it is the most transformational and rewarding experience that one could ever have. It’s a once in a lifetime opportunity.” Applications to Penrith RSL Club will close on Thursday 11 April 2019. The trek will take place in September and October of 2019. Applicants must be aged between 17 and 25 years, physically fit, and willing to undergo training as well as a medical.

PENR ITH KO KO RS L C H A L DA LENG E APPL I C AT I O OPEN NS

FIND OUT more For more information about the Kokoda Youth Leadership Challenge, go to;  penrithrsl.com.au/Community/  leannes@penrithrsl.com.au


Travel

Local Experts Lynette, Kerrie, Jenny & Nicole

Places to Visit in Ireland We might love Ireland for giving us St Patrick's day, but beyond the Guinness-fuelled celebrations every March there are other reasons to head to Ireland. Here are just a few places that should be on your must-visit list. THE BLARNEY STONE... is located at Blarney Castle, near Cork. The Blarney Stone is said to have magical powers. Legend says that if you kiss the stone, you’ll be blessed with the gift of the gab. GIANT’S CAUSEWAY... is the only UNESCO World Heritage site in Northern Ireland, an area of about 40,000 spectacular interlocking basalt columns on the coastline. CASTLES... With over 30,000 castles and castle ruins

Travel Experts Maria, Fellowes & Turner Travel Associates Penrith

scattered around the Irish countryside, you cannot visit Ireland without seeing a castle. There are a number of castles that now operate as luxury hotels, so you can even stay in a royal suite for a night or two. NATIONAL GALLERIES AND MUSEUMS... in Ireland are free to the public so you can appreciate some of the most incredible art without paying for it. IRISH PUBS... Head into an Irish pub anywhere and you’ll be greeted with that friendly, fun atmosphere. Do yourself a favour and enjoy a pint and a meal, soaking up their friendly hospitality. CORNNERMARA NATIONAL PARK... sits next to Kylemore Abbey on the remote west coast. This stunning area of natural wilderness is ideal for walking, trekking, or simply driving around. With a host of beautiful lakes, mountains sit amidst the rolling countryside. DUBLIN... is a vibrant city with a friendly street culture, a developing art scene, excellent pubs and restaurants, live music and history. Dublin is much more than a gateway to the Irish countryside. Be sure to visit St Stephens Green,

the Guinness Storehouse and Trinity College for a dose of beauty and history. BELFAST... is the centre of much of Ireland’s turbulent history. Belfast is a must-visit for its areas of cultural and political significance. Once a no-go zone for tourists, the Belfast of today has undergone a remarkable transformation, now home to trendy hotels, historically-significant museums telling the city’s bloodied history, and of course the slipway where the Titanic was built, now an excellent museum. GLENIFF HORSESHOE... is a 10km loop of single lane road, where you travel to marvel at and breathe in the unbeatable scenery. The loop is surrounded by stunning mountains that provide limitless photo opportunities. ireland awaits you We look forward to sharing our travel experiences with you. Give us a call on 1800 040 744 - we would love to be part of your next amazing journey.

Giant's Causeway

MARITIMES

Discovery

WITH RHYTHMS OF THE SOUTH

18 Day Cruise and Tour Halifax to New Orleans

Blarney Castle

Unravel the wonders of the Canadian Maritimes and New England together with America’s vibrant southern states. Cruise in all-inclusive luxury from Halifax to New York City then discover the vibrant music, culture and history of America’s South.

& Departs - 20 September 2019 & 9 night all-inclusive luxury Scenic Eclipse cruise & Guaranteed Earlybird fare for first 15 suites & 1 night pre stopover Halifax including

airport transfers & 400 USD per couple onboard credit & 500 AUD per couple Earlybird discount & Complimentary 20 minute submarine excursion#

from $17,590* per person

Newfoundland Rose Blanche New Brunswick Charlottetown CANADA

St Andrews

Nova Scotia

Louisbourg

Halifax Lunenburg

Portland USA

9 Martha’s Vineyard

New York City

Freecall 1800 040 744 or email Freecall 1800 040 744 or email penrith@travelassociates.com penrith@travel-associates.com.au 14 Macquarie 14 Avenue, Penrith.Avenue, Penrith Macquarie travel-associates.com.au/mariafellowes travelassociates.com/mariafellowes

Dublin

*Subject to availability. Must book by 31 March 2019. Exclusive to Maria, Fellowes & Turner Travel Associates. Onboard credit and Earlybird discount is per couple. Cab cat: Verandah. Price is per person. #Submarine excursions subject to regulatory approval.

Issue 25 March 2019

25


Wellbeing

Headaches & Migraines HOW PHYSIO CAN HELP Headaches and migraines are extremely common, and are continuing to be something we see often in the practice.

Local Experts Kris Caloia & Karl Thornton

Physiotherapy Experts Progressive Sports & Spinal Physiotherapy

LET’S TALK HEADACHES. Headaches and migraines don’t discriminate. They can affect anyone at any time, and they’re not pleasant. Did you know that there are more than 300 different causes for headaches? There are also many different types of headaches and, in some cases, a person can suffer two at the same time. THE DIFFERENCE BETWEEN A HEADACHE AND A MIGRAINE. Another important thing to distinguish is the difference between a headache and a migraine. A migraine is a type of headache. They’re extremely severe and can make you feel nauseous, cause disturbances to your vision, and make you sensitive to noise, light and, in some cases, odours. This debilitating form of headache can start with numbness or tingling in your hands or arms. They can be accompanied by skin that is painful to the lightest touch. Migraines leave most sufferers bed-ridden for a substantial period.

DON’T IGNORE THESE SIGNS AND SYMPTOMS. We must note that there are significant signs and symptoms associated with headaches that must not be ignored. We strongly recommend seeking medical attention if you experience a headache that is: • Accompanied by memory loss or motor weakness • Associated with a symptom-like fever • Markedly different to your previous headaches

POWER TO

KEEP MOVING

• Sudden and severe in its onset, like a ‘thunderclap’, and • Recurrent and persists in those over 50.

ACCREDITED BY THE WATSON HEADACHE INSTITUTE. The good news is that physiotherapy can assist with identifying the cause and then managing the pain for headache and migraine sufferers. Progressive Sports & Spinal Physiotherapy is accredited by the Watson Headache Institute. In our experience, many headaches and migraines are caused by structural issues, including a neck disorder or physical and emotional tension. An assessment from the team at Progressive Sports & Spinal Physiotherapy can determine if your headache or migraine is caused by your upper neck and the associated muscles. • Gentle hands-on physiotherapy can help ease your symptoms. • Poor posture can lead to neck disorders that cause headaches.

• Education is a key step to avoid headache and migraine triggers. • At-home exercises can help keep headaches and migraines at bay.

DON’T PUT UP WITH HEADACHES AND MIGRAINES ANY LONGER. Headaches and migraines can be extremely debilitating. If you or a family member is experiencing severe or regular headaches, don’t wait – get help from an experienced physiotherapist. You can be confident our qualified and highly-skilled physiotherapists will do all they can to get to the source of your pain and bring relief.

get on top of your headache and migraines

4/29 York Road, Jamisontown | (02) 4721 7798 www&rorssi+raoma* | ind *s on soia" 26

roamingpanthermagazine.com.au

The team at Progressive Sports & Spinal Physiotherapy can assess your pain and customise a plan to get you feeling your best. Contact the practice today on (02) 4721 7798.


Wellbeing

Emotional Eating

Written by Fiona Kane

Emotional eating is a common behaviour we use to manage stress, and numb and comfort ourselves. But how do we stop?

I

f you're heavily reliant on your ‘comfort foods’, don’t try to cut them out immediately. This will cause stress and make you want to eat more. Focus on bringing new habits in, rather than giving anything up. It’s less stressful and more likely to be successful, giving time for the new habits to slowly replace the old ones. Start by adding more tools to your stress management toolkit – what makes you calm, happy and gives you comfort? • Music, reading, arts and hobbies? • Chatting to a friend? • Making a pot of tea? • Spending time with pets? • Activity, from yoga or walking through to running? • Gardening? Try different things to see what works for you. If you have various tools to rely on, the

Focus on bringing new habits in, rather than giving anything up.

occasional comfort eating can be enjoyable without negatively impacting on your health. If you still struggle with this and with your feelings, go to a mental health professional to get help. It’s okay to ask for help – this is stuff that isn’t taught at school and often not by parents as they usually don’t have the skills themselves. Be patient and kind, and show compassion to yourself; it will take time, but you will develop the skills you need to manage your emotional eating.

FIND OUT MORE Fiona Kane, Nutritional Medicine Practitioner, Holistic Counsellor and Life Coach at the Informed Health Nutritional Wellbeing Centre  informedhealth.com.au

Same Great Team, Same Great Service We’ve changed our name! Coreen Avenue Vets have changed names to Greencross Vets Coreen Avenue

But we’re still the place where every pet has the opportunity to be loved, cared for and recognised as a priority. Every pet entering the practice becomes an integral part of our family unit.

Unit 2 & 3/117 Coreen Ave Penrith, NSW, 2750

 02 4731 3055

 www.greencrossvet.com.au Issue 25 March 2019

27


Parent Hacks

Parent Hack MAKE-AHEAD SCHOOL LUNCHES Time-saving tips to delight the school lunchbox and the wallet

SHARE Y OUR PARENT HACKS!

Do you have a Parent Hac k that helps you with the kids? Email us yo ur tips and tr icks and you could b e featured in our next issue of Roam ing: editorial@ro amingmagaz ine.com.au

W

here does the time go? We’re already well into 2019 and I feel like I haven’t had a minute to myself! There's two child drop offs and pickups every day, full-time work, trying to keep fit, kid's activities, feeding the family, and keeping the house clean – despite sharing it equally with my partner, it’s never-ending! My absolute saviour? The lunchbox plan I have for my daughter’s school days. It’s time-saving, money-preserving, and simple for everyone to follow. To start, I created a Monday to Friday roster, making sure I included mostly freezer items that would defrost perfectly in her lunchbox. A lot of people turn their nose up at frozen produce but if it’s cooked and stored correctly, it’s delicious and healthy. So, what can be frozen? Sandwiches, cooked meatballs, chipolatas, chicken drumsticks, cheese and biscuits, cupcakes, muffins, pastry items – the list goes on!

-Luisa Patisso Written By Maria d Lifestyle from My So-Calle

Each night I take a meal out of the freezer, pop it in the lunchbox, and straight into the fridge. By lunchtime, it’s thawed to perfection! I have the lunch roster up on the fridge, so both my partner and I know exactly what she’s having. What’s in the lunchbox today? An apple, cheese and biscuits, three chipolatas, carrot sticks, salsa, and a sugar-free blueberry muffin. Everything but the apple, carrot and salsa is frozen. It’s that easy.

FOR MORE TIPS AND TRICKS For more money-saving ideas and lifestyle hacks, follow me on: Facebook: My So-Called Lifestyle Instagram: @mysclifestyle

TIPS

FOR THE PERFECT FROZEN SANDWICH

• Make your sandwiches with fresh bread – preferably bought that day • Always butter the bread to form a barrier against the filling • Use grated cheese rather than sliced • Instead of salads, opt for grilled vegetables or bag the salad separately • Meats, smoked salmon and tuna freeze brilliantly • Mayonnaise and cream cheese are great to use • For more flavour, opt for chutneys or a spicy sauce • Avoid using egg, as it comes out rubbery • Wrap the sandwiches in baking paper and then cling wrap, or simply pop in a zip-lock bag. This way, they are fine for up to three months in the freezer. (I label mine for a grab and go approach!)

ONE

MINUTE WALK FROM

NEPEAN HOSPITAL Greater Western Hwy

Visit our Pharmacy for Friendly

Services & Expert Advice • Prescriptions Filled

• Workers Compensation

• Surgical Supplies

• Specialty Vitamins & Herbal Supplements

• MedsChecks

• Home-aids

• Injury Supportwear

• Baby & Mum Care

• Hires - Wheelchairs, Crutches & Breast Pumps

• Wide Range of Gifts

• National Diabetes Service • Webster Packing

 specialistclinicpharmacykingswood

 4737 3456 28

roamingpanthermagazine.com.au

ST ET ERS

ST

Within the Specialist Clinic

S TA F

• Newspapers, Milk, Drinks, Chips & Lollies

BY

SOM

ST

DER

PA R

Professional Service

Penrith

KER

Local & Convenient

Kingswood Station

Nepean Hospital

FORD

ST

M4 Motorway

• Photocopying, Faxing, and Laminating

 pharmacy@specialistclinicpharmacy.com

 Suite 3, 64 - 68 Derby St, Kingswood

Trading Hours Monday - Friday Saturday Sunday Public Holidays

7.30am - 7.30pm 8.00am - 5.00pm CLOSED 9.00am - 1.00pm


ENTER NOMINATE VOTE

the 2019 altitude awards The Altitude Awards recognise and honours the excellence, achievement and contribution of businesses, community groups and leaders in our region. 16 Categories sponsored by local businesses Presented by Women with Altitude + The Mens Altitude Network Sharing the stories of everyday people achieving extraordinary things Nominate someone who inspires you Vote for your favourite business Entries close April 22nd

ENTER: WWW.ALTITUDEAWARDS.COM 2019

womenwithaltitudeaust

wwaltitude

womenwithaltitude

#WhoMe #YesYou

SOARING MICRO • SOARING SOLO • THROUGH THE WOODS • CLIMB EVERY MOUNTAIN • ON MY WAY • THE CHANGEMAKER • TWO PEAS PARTNERSHIP • BUSINESS EXCELLENCE • YOUNG ENTREPRENEUR • REVOLUTIONARY • EMERGING LEADER, EMPLOYEE OF THE YEAR • STRATEGIC CONNECTOR OF THE YEAR • PURPOSE DRIVEN ENTREPRENEURS • PAY IT FORWARD / UNSUNG HERO • ARTISAN INSPIRED • DIGITAL DYNAMO ONLINE


Digital

How Social is Social Media? More and more Australians are suffering from anxiety and loneliness, and some health professionals point the finger at the rising use of social media.

I

t seems strange and sad to me that, in a world where we are more connected than ever, so many of us should feel alone.

Did you know that 60% of Australians use Facebook regularly, around 9 million use Instagram, 6.4 million are Snapchatting and 4.7 million use Twitter? Big numbers indicate a lot of social connections, but we know that an active social media account is not the same as an active social life. Indeed, many studies suggest social media use can lead to stress, anxiety and low self-esteem. But there are other studies which say Twitter reduces stress levels (it’s a useful place to vent), Facebook creates community and Instagram makes people work harder towards their goals. Which is right? The answer is probably both. We’re all different and for me it’s all about balance. I have a list of pros and cons that justify, and keep in check, the time I give to social media. Among the pros are how I’ve reconnected with cousins and old school friends, that I can research

Local Expert Trish Fehon Digital Expert Online Influence

a business before I use them, and the convenience of Facebook messenger. The cons include the unhelpful comparisons invited by Instagram, the highly curated nature of what you see, and the time I waste. This list helps me recognise where I need to take care and limit my use of social media accordingly. For some, social media is a harmful space and they should definitely opt out, but I believe most of us can find a balance and benefit from getting social online. This is particularly true in terms of connecting businesses to potential clients.

WANT TO KNOW MORE? Online Influence is a trusted Google Partner; we can help your business use the internet to connect to the right audience. Contact us on 02 4724 9555 today to find out how our friendly team can help.

Pets

Parvo Free P Penrith BY 2020

AN EXCITING UPDATE

About this time last year I spoke about our mission to have the Penrith region free from parvovirus by the year 2020.

Local Vet

Dr Erin Short VETERINARIAN Greencross Vets Coreen Avenue

arvovirus is a deadly, highly infectious viral disease of dogs. To detect parvovirus infection, a quick and simple test is available. There is no medication to kill parvovirus in infected dogs. Intensive, supportive treatment in isolation is required until the virus is fought off by the dog’s own immune system. Most dogs will survive if treated, but sadly not all dogs can be saved. The best protection from parvovirus is vaccination. The vaccination is highly effective, but puppies require a series of vaccinations and adult dogs require regular boosters to maintain adequate immunity. There are now alternatives to annual vaccination in adult dogs. These include long-acting vaccinations that protect against parvovirus, distemper and adenovirus for three years, and parvovirus antibody titre testing. It may be unsafe to vaccinate pets with health issues like cancer and immune diseases. If a pet is unwell, the vaccination may need to be postponed until they are well again. 'Herd immunity' is the term used to describe how increased vaccination rates protect those in population that are not vaccinated. This is especially important with parvovirus due to the nature of transmission. Parvovirus is shed in the saliva, vomit and faeces of infected dogs. It can survive for long periods and be transported on clothes, people and soil. Infection does not require direct contact with an infected dog. But higher vaccination rates dramatically reduce the amount of the virus in the environment and, in turn, the risk of a non-vaccinated dog being exposed to the virus. Through ongoing support from the RSPCA, the veterinary students at Sydney University and our staff volunteering their

30

roamingpanthermagazine.com.au

free time, we have developed community service programs to assist eligible owners to access vaccinations. We are very happy to report our first Spring and Summer period with no parvo cases at our clinic. We endeavour to continue these programs and ensure we are truly parvo free by 2020. Free dog and cat microchipping day  23 March 2019, 9am – 12pm at Jamison Oval Microchipping your dog or cat helps keep them safe and can reunite you much more quickly if they become lost. In NSW, all dogs and cats must be microchipped by 12 weeks old or before being sold or given away (whichever happens first). Join us at Jamison Oval to have your pet microchipped. Have you checked your pet’s microchip information lately? The easiest way to update your pet’s microchip details is via  petregistry.nsw.gov.au.


Local Expert

The ATO is Watching

YOUR INCOME

It doesn’t matter whether it’s a business, interest, dividends, rent earned on an overseas property, Airbnb, Deliveroo delivering... you need to declare this income in your tax return.

you earned income from, or from the sale of that property, you can expect a please explain from the ATO. • The ATO has also announced it will be collecting information regarding sharing economy accommodation (including Airbnb, Stayz and others) to identify individuals who have, or may be engaged in, providing accommodation services through an online platform during the 2017 to 2020 income year. If you’ve earned income from one of these platforms and didn’t declare it, you can also expect a please explain from the ATO.

T

he problem with self-assessment is that it’s up to us what goes into our tax returns, but the folks at the ATO are savvier than you give them credit for. And they have a truckload of cash to spend on benchmarking audits to catch you out if you don’t play by the rules. So, if you’ve earned a little extra income and you’re preparing your tax return, what do you need to be aware of?

• Be aware than just because Partner A lists the home on Airbnb, styles the house, greets the guests and does all the other running around while Partner B does nothing, if the property is owned in both names the income needs to be declared in both Partner A and Partner B’s tax returns (this is also the case for car rental, sharing or hiring through a third party platform).

• The ATO has announced it's in the process of acquiring rental bond data for the period 20 September 1985 to 30 June 2020 from the relevant bodies in each State and Territory. So if you haven’t declared income from a property

More than ever before, it’s important to declare all income earned and be aware of whose name it should be declared in. If you suspect you’ve left income out and you could be caught out, it’s better to do something about that now

Finance

Melissa Browne Money & Business Strategy Expert Accounting & Taxation Advantage

rather than wait for a please explain by the ATO. Of course, if you’re unsure and it seems too difficult, make sure you seek help from a great tax accountant.

More than ever before, it’s important to declare all income earned... MELISSA BROWNE Melissa Browne is CEO of accounting firm A&TA and financial planning firm The Money Barre. Her latest book, Unf*ck your Finances, is instore now at all good bookstores.

EXPERIENCE & RELIABILITY Personal Legal Services • Property and Conveyancing • Wills, Probate & Administration • Estate Planning

• Asset Protection Planning & Implementation • Notarial Services

Commercial Legal Services • Planning & Environment Law • Commercial Advice • Corporate Law & Governance • Business Law • Employment & Industrial Law

• Retail, Commercial & Industrial Leasing • OH&S Law • Debt Recovery, Bankruptcy & Insolvency Law

• Intellectual Property

Solicitor Director: Joseph M Grassi Dip Law (SAB) LLM Accredited Specialist Property Law Notary Public Solicitor: Grant Wiblin LLB, BSocSc, GDipLegalPrac Licensed Conveyancer: Wendy Harvey | Office Manager: Lois Grassi | Administration: Emily Beal

 Suite 1, 86 Henry Street, Penrith 2750  info@grassiassociates.com.au

 4702 5905

www.grassiassociates.com.au Issue 25 March 2019

31


Lending

Mortgage Broker?

WHY USE A

If you’re time poor and not sure where to start with buying or refinancing, here are three key reasons to use a broker. 1

SIMPLIFY THE LOAN APPLICATION PROCESS

Applying for a home loan on your own isn’t always a straightforward task. From seeking conditional approval to making your final arrangements on settlement day, there’s a lot you’ll need to be aware of – and even more information you’ll need to provide. A mortgage broker can take away a lot of the pain and stress, helping you through the process. A mortgage broker can: • Work to give you the best chance of receiving a loan in the first place • Assist with finding you a lender if you don’t have a 20% deposit • Help with refinancing your existing home or moving onto your next home, and • Ensure the changeover in mortgage happens as smoothly as possible.

Local Expert Peita Davies

Home Loan Specialist realestate.com.au Home Loans Penrith

2 SAVE TIME

There are a lot of lenders offering many different types of home loans, so knowing which home loan is right for you can be a daunting and time-consuming experience. Some questions your broker will help you consider include: • Are you better off taking out a variable, fixed rate or split-interest rate loan? • Should you pay back principal and interest, or interest only? • Is it worth paying more for extra features, such as an offset account or redraw facility?

option. This won’t just involve pointing you towards the lowest interest rate; they’ll calculate the true cost of the loan once fees, charges and other costs are considered. A broker can help consider cost factors such as: • Extra fees for paying off the home loan early • An establishment fee or other upfront fees, and • Lenders mortgage insurance. By going directly to a mortgage broker at the start of your journey, you can save a lot of time researching and get direct expert help at no cost. It’s a win/win!

A broker can work out the most costeffective option.

3 SAVE MONEY

With access to so many different lenders and home loans, a broker can work out the more cost-effective

Here for you, today and tomorrow Peita Davies Local home loan specialist 0452 214 202 @peita.davies.realestatehls Peita.davies@realestatehls.com.au 1B Castlereagh St, Penrith NSW 2750 Peita Davies is a credit representative (399445) of BLSSA Pty Ltd ACN 117 651 760 (Australian Credit Licence 391237)

LAM0029 - Peita Davies_Press Ad (275x156mm).indd 1 32 roamingpanthermagazine.com.au

11/2/19 6:35 pm


The Highest Standard in Concreting Services in Penrith & Blue Mountains LOCALLY RUN, FAMILY BUSINESS, WITH EXCELLENT WORKMANSHIP AT AFFORDABLE PRICES S E R V I C E S TA I L O R E D T O S U I T Y O U S L A B S | D R I V E W AY S | C O M M E R C I A L & I N D U S T R I A L | O S D TA N K | C U S T O M D E S I G N | G E O S T O N E

D O N ’ TT ! E FORG

E E R F

LD L OF O A V O REM WAY DRIVE n this ad at time *Whe

o m e n ti n yo u ta c t of c o n

CALL US N OW!

0411 704 302

 SLCONCRETE5@BIGPOND.COM

 FA C E B O O K . C O M / S L C O N C R E T E N S W

W W W. S L C O N C R E T E . C O M . A U


Home Living

Master Mid-Century Modern Everything old is still new, thanks to this clean, functional and timeless look.

Win!

For your chance to win an interior style session with Kara and $20,000 of your favourite pieces from the centre, be sure to enter our Style My Home competition. Simply spend $100 in-centre to enter.* penrithhomemakercentre.com.au/stylemyhome *Terms & conditions apply. Visit penrithhomemakercentre.com.au for more information.

Northcote renovation Image courtesy of Kara & Kyal

Mid-Century modern blends so well with other styles of décor that its perennial popularity is no surprise. This less-is-more take on the 1940s look is all about warm woods, simple lines, muted palettes and woven textures.

Get the Mid-Century Bedroom Look THINK SLEEK AND COSY MINIMALISM THAT MAKES OUR BUSY LIVES A LITTLE SIMPLER – AND A LOT MORE ENJOYABLE.

ALL ITEMS AVAILABLE AT PENRITH HOMEMAKER CENTRE

RETRO REMIX Modernise the look by mixing and matching new pieces with old. Blush pink is a modern neutral that works really well with muted tones. CLUTTER-FREE FINISH

Only display important items that simplify or enhance your daily routines – plants, pillows, books – and anything else that makes you happy.

POP IN STORE FOR ALL THE INSPIRATION YOU NEED

Oasis cushion $69.95, Oz Design Furniture

Seed pendant in mint $79.96, Beacon Lighting

Bella mirror $386, Oz Design Furniture

Home Republic gable plant stand in gold from $69.99, Adairs

Austin six drawer dresser in light oak $1,299, Forty Winks

Iris Nights queen bed frame $1,799, Snooze

Visit Penrith Homemaker Centre for all your decor and entertaining needs.  Cnr Mulgoa Rd and Wolseley St, Jamisontown 2749  penrithhomemakercentre.com.au

34

roamingpanthermagazine.com.au

Early Settler Outdoor


Social

Social Media MATTERS The power of social media; it can make or break a brand. So make it your business ally.

A

Written by Nicole Fahey from Local Edge Marketing

s of January 2019, statistics have revealed that Australians are spending an average of five hours and four minutes on the internet every single day. And one hour and 31 minutes of that is spent browsing social media. In the past year, Australia has also witnessed a 5.9% growth in active social media users, equating to an additional one million people. These figures may also surprise you.

71%

of consumers who have had a good social media service experience with a brand are likely to recommend it to others.

63%

of customers expect companies to offer customer service via their social media channels.

90%

of social media users have used social media as a way to communicate with a brand or business.

In other words, your business’ social media presence is an absolute priority if you want to stay ahead of your competitors. Today, when potential consumers are researching prior to buying a product or service, they are more likely to steer clear of a business who has little to no social media presence. Social media platforms are free, easily accessible, and cost-effective. With them, you can consistently warm your local target audience, enhance and promote the credibility of your business, build trust with your audience, and ultimately convert your online community into qualified, nurtured leads. Not to mention the potential of online advocates – we all know the power of a recommendation or review on social media! The best part? Marketing your small business on social media is all completely measurable. You have access to an incredible amount of detail and data as to how your efforts on social media are performing. You can see exactly what is and isn’t working and, in today’s media landscape, it’s crucial to know the numbers.

When used and managed correctly, social media has the potential to build your brand and grow your business without spending copious amounts of money. It’s something all business owners should take seriously and certainly not something to neglect.

get social media on your side Nicole, owner of Local Edge Marketing in Penrith, is a social media management expert. She has helped many local businesses build their brand online and become top of mind thanks to a strong social media presence. Need help with your socials?  0415 246 565  info@localedgemarketing.com.au  localedgemarketing.com.au

FEEL AT HOME HOME AT QUEST QUEST ‘INSERT PENRITHLOCATION’ At Quest, we’ve built a network of apartment Quest Penrith brings a new standard of accommodation to Penrith hotels to provide business travellers with spacious and for the short and long stay traveller. Located in the regional hub comfortable accommodation, that’s conveniently located of Penrith, Quest Penrith is situated on Lord Sheffield Circuit, wherever you need to be. strategically positioned within close proximity of the Penrith Train Station‘location’ and just aoffers shortxx stroll Westfistudios, eld Penrith. Quest selffrom contained one, two and three bedroom apartments for whenever business takes you to Quest Penrith offers a variety of different apartment style room ‘insert location’. types, to cater to whatever your accommodation needs might be. Complimentary WiFi On-site Property Manager Separate living and dining areas Complimentary High Speed WiFi Fully equipped kitchens Gymnasium On-site car parking Businessgym lounge On-site and sauna Conference facilities Laundry facilities

Visit questpenrith.com.au Visit questlocation.com.au or call call 01 022345 91366789 1100

36

roamingpanthermagazine.com.au


This article is for general information only and is not intended as legal advice. If you need specific help, contact your solicitor.

Legal

Been Chopped Out of a Will?

Local Expert

Joseph Grassi Legal Expert Joseph Grassi + Associates

THERE IS STILL HOPE… Do you think that you have been treated fairly in a Will?

I

f not, you may be able to make a family provision claim under the Succession Act 2006.

A family provision claim starts with an application to the Supreme Court of NSW for a share, or a larger share, of the estate of a deceased person. You can make this claim if you are an “eligible person” and a have been left out of a will; or b did not receive what you thought you were entitled to receive. A family provision claim must be started within 12 months of the date of death of the person whose Will you wish to challenge.

An “eligible person” could be: a the wife or husband of the deceased; b a person who was living in a de facto relationship with the deceased (including same-sex couples); c a child of the deceased (including an adopted child); d a former wife or husband of the deceased; e a person who was, at any particular time, entirely or partly dependent on the deceased, and who is a grandchild or was, at that time, a member of the same household as the deceased; or f a person with whom the deceased was living in a close personal relationship at the time of the death. Before making an order, the court will consider: a the relationship between you and the deceased person; b any obligations or responsibilities owed to you by the deceased; c the value and location of the estate; d your financial circumstances;

e

f

g h i

j

k l

m n

whether you are being financially supported by another person; whether you have any physical, intellectual or mental disabilities; your age; your contribution in increasing the value of the estate; whether the deceased has already provided for you during his or her lifetime; whether any other person is responsible for supporting you; your character; any applicable customary law if the deceased was Aboriginal or a Torres Strait Islander; any other claims on the estate; and any other matter the court may consider as relevant.

If you are an eligible person and you think you are entitled to make a claim on the estate, or if you are unsure if you are entitled to make a claim, you should seek legal advice.

Online Influence Penrith can help you with all your online marketing needs Website Design and Development Google Advertising Facebook Advertising Email Marketing campaigns Search Engine Optimisation (SEO) E-commerce (Shopping carts)

Online Influence is a Google Partner, a Facebook Ad agency and a boutique Web development company that specialises in helping you get leads and sales from your website.

www.Onlineinfluence.com.au

0247 249 555 Level 1, 331 High Street, Penrith NSW 2750 Specialized in:

Search ads

Issue 25 March 2019

37


Home Living

Local Expert

Does it Bring You Joy?

Shirley Gavin

Interior Design Expert Nepean Inner Designs

THE QUESTION ON EVERYONE’S MINDS THIS YEAR I want to talk about The Konmari Method. Created by Japanese tidying expert Marie Kondo, it explores the art of organisation.

A

lthough Kondo has released three books, it’s her new Netflix series that’s inspiring people worldwide to embrace her unique process for transforming cluttered spaces into serene environments. And it’s no longer just a concept; it’s now being described as a forward-looking cultural revolution. There are six basic rules to get you started: • Commit yourself to tidying up • Imagine your ideal lifestyle • Finish discarding first • Tidy by category, not location • Follow the right order, and • Ask yourself if the item sparks joy.

P R E PA R E YOUR CHILD FOR A

Most tidying methods promote a room-by-room approach, which sometimes ends in throwing in the towel and a few expletives! Kondo’s practice is category-by-category and is said to offer lasting results. The categories are:

make the items inside feel less valuable.

• Clothes • Papers • Sentimental items

Use the KonMari folding method so that your clothes stand up vertically. This one is a little harder to explain, so I recommend checking out a video on YouTube. Once you see the outcome, you won’t look back!

• Books • Komono (miscellaneous items).

Her method encourages you to keep only items that speak to the heart, discarding those that lack personal value. To start, place all of your items from each category into one pile (clothes in one pile, books in another, and so on). Assess each element and consider if it sparks joy. If it doesn’t, thank the item for its service and dispose of appropriately (gifting and recycling is fantastic). Make sure you finish one category before moving onto the next. Once you’ve sorted through everything, you should have a much smaller pile left. But organising these items is another story! Here are a few tips to help: Use transparent tubs for storage so you can see what’s inside. Steer clear of garbage bags – they will

Store things you use more frequently in easier to reach places. For example, store your everyday kitchen items at eye level on your shelves or in cabinets.

Use small boxes in drawers to sort out smaller items – I’ve done it in my kitchen and dresser, and absolutely love it. People around the world have been drawn to this philosophy for its effectiveness and mindful nature. So… if it doesn’t bring you joy, say thank you and move on. 2019 is the year to kick the clutter habit!

FOR MORE INSPIRATION follow me on facebook at  facebook.com/NepeanInnerDesigns

Global Future

BOOK A TOUR OR ENROL TODAY

stpauls.nsw.edu.au 38

roamingpanthermagazine.com.au

p. 02 4777 4888 e. enrol@stpauls.nsw.edu.au


Property

Love It OR LIST IT? The decision to stay in the current home and renovate, or sell up and move into a new home, really can cause incredible angst, worry and concern.

Local Expert Paul Merrick Property Expert Merrick Property Group

H

ere are some tips and thoughts to manage the emotion and stress.

you are not in a fixed loan that may have excessive exit fees when you sell. Ultimately, whether you LOVE IT OR LIST IT, you must decide where you and your family will be at your happiest.

CONSULT THE EXPERTS Builders, trades, council, architects and real estate agents can all help with ideas and experienced advice. They will help you to know what you currently don’t know to help you make an informed decision. LOOK AT THE COST OF A RENOVATION Be realistic about what a renovation will cost you. Despite articles citing the average costs of renovating, anyone who has undergone a renovation knows the end cost is almost always far more than expected. Always allow a good financial buffer. LOOK AT THE COST OF SELLING AND RELOCATING If you decide to sell, it’s a much easier cost to calculate. The key numbers are stamp duty on your next purchase – roughly around 4% (can be higher for homes over $1m). Agent’s fees to sell your current home will generally range from 2% to 3% depending on marketing and the quality of your agent. And allow around $3k to $4k for legal fees, and between $2k to $5k for removalists costs depending on quantity and distance. You should also check with your bank that

AT A CROSSROAD? If you’re at a crossroad and want to discuss a possible move or renovation, always feel free to call me directly on 0404 599 146. I’ll happily offer confidential real estate advice without obligation, or put you in contact with builders, trades, architects or finance professionals to help you on your journey.

Specialising in the Sale of Quality Residential and Acreage Properties

14 YEARS O F LO CAL REAL ES E X P E R TAT E IE N C E

Established by Paul Merrick, one of the leading and most trusted agents in the Nepean Valley and Lower Mountains for over a decade, the company has been founded with a vision to give clients the value and service that they rightfully deserve, delivered with honesty, professionalism and integrity. With access to exceptional marketing material, a vast network of clients and contacts and intimate local knowledge that comes from living in this community for over 40 years, we are here to help and offer a completely refreshing approach to ensure your next big move in life is a great one! Experienced Local Boutique Agency

Customised Sales Campaigns Designed To Suit You And Property

Innovative Video & Social Media Marketing Paul Merrick

Office. 02 4760 0812 Mobile. 0404 599 146 Email. merrick@merrickpropertygroup.com.au Address. PO Box 1825 Penrith BC, PENRITH NSW 2751

merrickpropertygroup.com.au Issue 25 March 2019

39


Puzzles

Puzzle Time

If you enjoy crossword puzzles, word ďŹ nds, anagrams or trivia quizzes, you’re going to love our Puzzles section! Just make sure you grab it before anyone else does...

Crossword ACROSS 8 Fit (7) 10 Small long-tailed bird (3-4) 11 Claire Hooper, for example (5) 12 Misnamed fruit bat (6,3) 13 Utopian (7) 14 Some arts (7) 15 Sydney-born country singer (7,6) 20 At the start (5,2) DOWN 1 Clairvoyant (7) 2 Consternation (6) 3 Powerful (8) 4 Enforce pit discipline to achieve improvement (10) 5 180-degree turn (4) 6 Disposable mobile phone (6) 7 Some wall art (8) 8 Banished (2,5)













22 24 26 27 28

Flat-bottomed canal or harbour barge (7) Coiner of “Those who cannot remember the past are condemned to repeat it� (9) Register (5) Mocked (7) Developed over time (7)

Popular NSW National Park (5,5) Bombastic monologue (8) Enlisted (6,2) Mass-to-volume ratio (7) Musical introduction (7) Like fresh bread (6) Prosper (6) Chucks in (4)

















14 16 17 18 19 21 23 25







 

 















Sudoku

A logic-based, number-placement puzzle. The objective is to ďŹ ll the 9Ă—9 grid with digits in such a way that each column, each row, and each of the nine 3Ă—3 grids that make up the larger 9Ă—9 grid contains all of the digits from 1 to 9. Note that no number from 1 to 9 can be repeated in any row or column. Good luck!

 

 

EASY

   

  

   

   

40

roamingpanthermagazine.com.au

 

MEDIUM



        

 



 



 

   





 



  


SUDOKU - MEDIUM

        

        

        

        

CROSSWORD Across: 9 Seizure, 10 Emu-wren, 11 Comic, 12 Flying fox, 13 Idyllic, 14 Martial, 15 SherriĂŠ Austin, 20 Early on, 22 Lighter, 24 Santayana, 26 Enrol, 27 Taunted, 28 Evolved. Down: 1 Psychic, 2 Dismay, 3 Muscular, 4 Perfection, 5 Yewy, 6 Burner, 7 GrafďŹ ti, 8 In exile, 14 Myall Lakes, 16 Harangue, 17 Signed on, 18 Density, 19 Prelude, 21 Yeasty, 23 Thrive, 25 Adds.

Lime

Pot

Wok

Cumin

Liver

Rice

Cup

Mace

Rusk

Dish

Milk

Sago

SUDOKU - EASY

        

Chop

$ * , $ . 2 : ( $ 8 /

& * $ / & 9 / 7 ( 6 ,

Issue 25 March 2019

41

FINDER WORD

        

Veal

        

Poach

        

Lard

        

Chili

        

Towel

        

Pickle

        

Ladle

        

Can

        

Tea

        

Peel

        

Ham

        

Bun

        

Tart

) / $ 1 3 1 0 , / . (

Pan

+ = 7 6 , ( 9 ( 7 . 0

Grill

& * $ / & 9 / 7 ( 6 ,

Beer

$ * , $ . 2 : ( $ 8 /

Soy

2 ( 0 ( / ( ( 3 : 5 3

Oven

2 ( 0 ( / ( ( 3 : 5 3

3 / , 9 ( 5 3 8 & 2 7

Flan

3 / , 9 ( 5 3 8 & 2 7

4 / / & , / 2 $ + 7 7

Basil

4 / / & , / 2 $ + 7 7

5 , , + ( = 7 & 1 + 0

Sieve

5 , , + ( = 7 & 1 + 0

( 5 + 6 2 < ' 5 $ / 8

Mug

( 5 + 6 2 < ' 5 $ / 8

( * & , $ & 8 0 , 1 *

Egg

Food for Thought >>>

( * & , $ & 8 0 , 1 *

+ = 7 6 , ( 9 ( 7 . 0

% 8 1 ' 9 % / $ ' / (

Donâ&#x20AC;&#x2122;t be sneaky and peek at the answers before youâ&#x20AC;&#x2122;re done - give the puzzles a good hard crack!

ANSWERS Apple

% 8 1 ' 9 % / $ ' / (

) / $ 1 3 1 0 , / . (

We exercise our bodies - now letâ&#x20AC;&#x2122;s exercise our brains! Stretch your mind with this word ďŹ nder puzzle and see how many food words you can ďŹ nd.

Kidâ&#x20AC;&#x2122;s Korner

Kidâ&#x20AC;&#x2122;s Puzzles


Horoscopes

Horoscopes By Sherrynne Dalby

Pisces

(19 FEB – 21 MAR)

Aries (21 MAR – 20 APR) You have been undergoing some major transformation for a number of years now. The good news is that this phase is now coming to a close. You should head into the next stage of life feeling refreshed, renewed and having shed much unwanted baggage. The next 12 months can be a mopping up phase where you are dealing with anything left unfinished in this area. This can be a productive month for you socially, but be cautious with spending as you may have a tendency to overdo things at the moment. Meditation may be useful for turning off the repetitive voice in your head.

Gemini (21 MAY – 21 JUN)

Ruling Planet: Jupiter / Neptune Sign:

You are entering a seven-year period which provides opportunity for new beginnings. There can be moments when you feel quite discombobulated and definitely out of your comfort zone. Remember, change is a process. It can hit you like a lightning bolt but the processing takes much longer. It’s time to shed unwanted people, things and habits from your life. This will be an underlying theme during the next few years, beginning with April birthdays. For now though, you should be feeling an extra boost of energy to assist taking action on any career moves in the pipeline.

Cancer (21 JUN – 23 JUL) It’s time to put your dreams of distant places into action. Time to stop dreaming and move. Now is also a good time for exploring higher education options, something you have been wanting to do for some time especially early July birthdays. You should begin to feel an easing of pressure in career-related matters and this area of life should become more stable and settled over the coming year. The intensity you have been feeling in relationships should also be tapering off as the month unfolds. Time to take a deep breath and relax.

The Fishes

Gemstones:

Amethyst, blood-stone

Colours:

Sea Green, Silver, mauve, purple and violet

Day:

Thursday

Number:

Seven

This is your annual time for renewal – Happy Solar Return Pisces! The saying ‘Many Happy Returns’ is a reference to the sun returning each year to the same area in the sky that it was at the time of birth. For Pisces this year – that is from 19 February until 21 March – it covers all those born under the sign of the Fish. The coming month will give you a snapshot of the year ahead. Pay attention to what is going on around your birthday for clues. February birthdays will find relationships dominate 2019. It’s a chance to re-evaluate how you approach and interact with others. Early March birthdays will have opportunities for self improvement, a chance to shed unwanted habits and improve career prospects, etc. It’s important to remove those rose-coloured glasses as you can be more prone than usual to the charms and sweet talk of others. Do reality checks every now and then. Mid-March birthdays can find small things like phones and keys, annoyingly, go missing. Keep a close eye out and pay attention to where you put things.

Sagittarius (22 NOV – 22 DEC) You can be experiencing quite a busy time now and may feel as though you’re heading at high speed into overdrive. Home and family are the base of a lot of the activity; it appears there is a lot going on here right now. There are some new turns and it is definitely not the same old, same old. There can be confusion around something or someone close to you. It’s vital at the moment that you make sure you have all the facts and information before you react, as chinese whispers rarely end well.

42

March can be fraught with misunderstandings as communications go awry, so be very clear in all dealings with others. This can particularly affect career matters. It is therefore important that, throughout March, you double check all messages and take extra care with all mobile devices, such as phones and tablets. It can be too easy to misplace things at the moment, especially small important things like keys and phones. This can be a good time for career moves. Dreams can come true but don’t forget it usually involves hard work to make that happen.

Taurus (20 APR – 21 MAY)

roamingpanthermagazine.com.au

Leo (23 JUL – 23 AUG) Relationships receive a pleasant boost during March. Acting on this early in the month is a good choice, as later in March career issues may demand more of your time. This is not an unusual juggle as career and home, and family and relationships, are usually a finely-tuned balancing act. You will find that your place in the world will undergo change over the coming years. This can involve changes to your career but also covers marital status and parenting. So basically, opportunities to improve your career, marriage, or become a parent or grandparent are all positive changes waiting in the wings.

Libra (23 SEP – 23 OCT) If you have found yourself spending an inordinate amount of time and money on home and family of late, take time out. You need to refresh your batteries and there is nothing better for that than doing something you enjoy. Let your hair down, be creative and playful, and do it without self-judgement. There can be a flurry of activity around health and fitness matters for you. If you have been neglecting your physical self, things can begin to catch up with you now. It is never too late to begin a health and fitness regime. No more procrastinating.

Capricorn (22 DEC – 20 JAN) You may still be feeling a little under the hammer and have certainly been under pressure on and off for some time. You should, by now, be sensing that something better is just around the corner. Better times are coming but you can’t take your eyes off the ball yet. Just know that life will be getting better soon. You should see the beginning of this through March with opportunities to improve your financial situation. There can be a tendency to overspend, so if you do find yourself with a little extra in your pocket, try to leave it there.

Virgo (23 AUG – 23 SEP) Relationships can take up much of your time and energy at the moment, especially early September birthdays. Something is brewing. If you have been on your own for a while, someone new can come in and sweep you off your feet. Remember to take the rose-coloured glasses off for a dose of reality occasionally. It is important to not get carried away by the romance, which can be intoxicating. You are vulnerable at the moment and it’s probably a good idea to run things by a trusted friend. Taking a different approach to health and fitness will pay off.

Scorpio (23 OCT – 22 NOV) You can find it difficult to maintain focus on anything pressing at the moment. Your mind is wandering to things you find much more fun and stimulating. Relationships are currently paying a prominent role and you would prefer to be putting your time and energy around your home and on family and loved ones at the moment. There is opportunity for you to fire up your creative side now. It can be you put your creativity to work, creating a more aesthetically-pleasing living environment. On the other hand, you may just want to create beauty in the world.

Aquarius (20 JAN – 19 FEB) March has a focus on you. Perfect for a physical makeover. This can be a beneficial time for lifting your spirits by focusing on the outside, including your surroundings. A day spent pampering yourself, doing something nice for your body (this applies to both men and women). Your body is the vessel for your soul; how can you expect good mental and emotional health if you don’t take care of the container? Improving your living conditions can also be beneficial at the moment. It doesn’t need to be expensive; fresh paint, new curtains and cushions can make a huge difference.


36 B A R B E R ARTIST IMPRESSION


My home, inspired.

+25x

$100 gift vouchers

to be won each week

Win $20,000

to refresh your home style

Plus win a styling session with expert Kara (The Living Room & Fans v Favs) Spend $100 or more in-centre to enter penrithhomemakercentre.com.au/ stylemyhome

Late night shopping every Thursday until 9pm Cnr. Mulgoa Rd & Wolsely St, Jamisontown penrithhomemakercentre.com.au    Terms and conditions apply, see penrithhomemakercentre.com.au/stylemyhome for details.

Profile for Penzance Publishing

Roaming Magazine March 2019 Issue  

Nepean's Lifestyle Magazine

Roaming Magazine March 2019 Issue  

Nepean's Lifestyle Magazine

Advertisement