Page 1

I S S UE 24 FE B R U A R Y 1 9

The 115th Annual Luddenham Show

DELIVERED FREE TO

60,000 HOMES MONTHLY

Photo credit: Jack Willmington – JBW Photography

115 YEARS OF HOME-GROWN FAMILY FUN!

FREE 201 9 DR AW P O ST ER I N SI DE

N E P E A N ’ S

L I F E S T Y L E

M A G A Z I N E


The Highest Standard in Concreting Services in Penrith & Blue Mountains LO CALLY OWNED A N D O P E R AT E D, WIT H E XCE LL E N T WOR KM A N S HI P AT AFFO RDA B LE P RICE S

MENTION THIS AD AT TIME OF CONTACT FOR

FREE REMOVAL OF OLD DRIVEWAY

SPE

OFFE CIAL

R

 slconcrete5@bigpond.com

 facebook.com/slconcretensw

WWW.SLCONCRETE.COM.AU


S ASK U R O T U ABOU

R SENIO T UN DISCO

CALL US NOW - 0411 704 302

SE RVICE S TAILO RE D TO S UIT YOU S L A B S | D R I V E WAY S | C O M M E R C I A L & I N D U S T R I A L | O S D TA N K | C U S T O M D E S I G N


Welcome

Issue I N

R OA M I N G M AGA Z

INE TURNS 2

T

H I

S

24

FEATURED THIS ISSUE 24 F ood Chrissy Teigen:

Cravings - Hungry for More

Hi Readers,

17 C ommunity

Penrith’s New Wine Bar, Allan Grammar

IT’S OUR 2ND BIRTHDAY!

22 P enrith Panthers

Thank you to all of our wonderful partners and readers for joining us on our journey so far; we love having you as part of our family. Here’s to us - and to many more good times ahead!

2019 Draw Poster

22 17

Sam PO Box 3106, East Blaxland, NSW 2774

Advertising Enquiries Samantha Foley  0431 281 689 samantha@roamingpanthermagazine. com.au  @roamingpanthermagazine  @roamingpanthermagazine  www.roamingpanthermagazine.com.au

>> OUR TEAM Publisher • Kimberley Kennedy kimberley@roamingpanthermagazine.com.au Editorial • editorial@roamingpanthermagazine.com.au Creative Director • Kwang Tran Manager • Samantha Foley samantha@roamingpanthermagazine.com.au Magazine Coordinator • Mel Bevan mel@roamingpanthermagazine.com.au Copy Editor • Melinda Leyshon, WriteCopy Journalist • Cassandra Elliott Images • iStock photos

>> REGULAR CONTRIBUTORS • Melissa Ferrari, Counselling & Psychotherapy • Maria, Fellowes & Turner Travel Associates • Peita Davies, realestate.com.au Home Loans Penrith • Joseph Grassi, Joseph Grassi & Associates • Kris Caloia & Karl Thornton, Progressive Physiotherapy • Erin Short, Greencross Vets Coreen Avenue • Sherrynne Dalby, Author of Star Parenting • Trish Fehon, Online Influence • Paul Merrick, Merrick Property Group

>> WITH THANKS TO OUR CONTRIBUTORS FOR THIS ISSUE • Penrith Homemaker Centre • Fiona Kane, Informed Health Nutritional Wellbeing Centre • Penrith City Council

Published by Penzance Publishing Pty Ltd ABN 18615296118. Printed by Fairfax Media 159 Bells Line of Road North Richmond NSW 2754

We recommend material such as dates, times and prices of a changing nature be confirmed with individual advertisers, contributors or persons and industry professionals in regard to advertising and editorial.

All prices and information are correct and to the best of the publisher’s knowledge at the time of print. Roaming Panther Magazine does not accept or assume responsibility for advertising material accepted. Comments and opinions of contributors do not necessarily reflect the opinion or view of the publishers or editor.

Material in Roaming Panther Magazine is copyright © Penzance Publishing and may not be reproduced without the permission of the publisher. All rights reserved. Issue 24, February 2019

All reasonable efforts have been made to trace copyright owners.

CREATING BEAUTIFUL HOMES Family owned with 20 years experience of quality and workmanship.

BLUE SKY SHUTTERS

Plantation Shutters, Roller Blinds, Panel Glides, Vertical Drapes, Dual Shades, Security Doors and Grilles, Fly Screens and Awnings.

Plantation Shutters Blinds Security Doors Awnings

CALL BLUE SKY SHUTTERS today for a free measure and quote on Office 02 4733 6214 or Peter 0414 706 142 Email blueskyshutters@gmail.com

6

roamingpanthermagazine.com.au

Website www.blueskyshutters.com.au

Facebook Blue Sky Shutters


FEEL AT HOME AT QUEST PENRITH Quest Penrith Penrith brings brings aa new new standard standardof ofaccommodation accommodationto toPenrith Penrith for the short short and and long long stay stay traveller. traveller.Located Locatedin inthe theregional regionalhub hubof of Penrith, Quest Quest Penrith Penrith is is situated situatedon onLord LordSheffield SheffieldCircuit, Circuit,strategically strategically positioned within close proximity of the Penrith Train Station within close proximity of the Penrith Train Stationand andjust justaa short stroll stroll from from Westfield Westfield Penrith. Penrith.

On-site On-siteProperty PropertyManager Manager

Offering Offering different different apartment apartment style styleroom roomtypes, types,to tocater caterto towhatever whateveryour your accommodation needs are. accommodation needs are.

Conference ConferenceFacilities Facilities

Visit Visit questpenrith.com.au questpenrith.com.au or or call call 02 02 9136 9136 1100 1100

Free FreeHigh HighSpeed SpeedWiFi WiFi Gymnasium Gymnasium Business Businesslounge lounge Laundry Laundryfacilities facilities


Local Roaming LOCAL MUSIC

JOHN COGHLANS QUO & TED MULRY GANG

THE COAT OF MANY COLORS – THE SONGS OF DOLLY PARTON

DON’T CHANGE – THE ULTIMATE INXS EXPERIENCE

1 MARCH PANTHERS PENRITH Featuring a collection of songs from the classic era of “Status Quo”, a full set of songs from the Ted Mulry Gang plus extras from Melbourne’s TASTE!

23 FEBRUARY PANTHERS PENRITH A truly one-of-a-kind live experience that captures the passion and energy that is INXS. Don’t Change, featuring a line-up of six exceptional musicians fronted by the charismatic Blair Dwyer, recreate a concert-style tribute to one of the greatest live stadium acts the world has ever seen.

penrith.panthers.com.au

penrith.panthers.com.au

28 FEBRUARY THE JOAN From rags to riches, Dolly Parton’s life story has remained humble and honest in her performance. After 60 years she remains an icon and America’s sweetheart of Country Music. The Coat of Many Colors is performed by Brooke McMullen who, at just 23, is a superstar in the making. Her performance will feature all your favourites, from 9 to 5, Jolene and the award winning, I Will Always Love You, backed by a six-piece band and some of the best country songs ever written. thejoan.com.au

NOW WE’RE SWINGIN’

Your Conveyancing Simply Made Easy!

KINGS OF COUNTRY ROCK TOUR

27 FEBRUARY THE JOAN Tom Burlinson’s newest show includes the greatest songs from the era of swing, with classics from all the legends including Sammy Davis Jnr, Dean Martin, Nat King Cole, and Bobby Darin. Accompanying Tom on stage will be a swingin’ big band including some of Sydney’s best jazz musicians. Definitely one not to be missed!

22 FEBRUARY THE JOAN This two-hour stage spectacular captures the sounds and excitement of America’s country rock icons, with all the timeless rock and roll classics that defined The Eagles and Creedence Clearwater Revival as 1970’s superstars.

thejoan.com.au

thejoan.com.au

SPINA-BENIGNETTI PIANO DUO

Specialists in all property transactions throughout NSW We pride ourselves on treating each transaction as if it were our own, making it a stress-free and simple process that is tailored specifically to each individual clients circumstances.

CONTACT US FOR AN OBLIGATION

Shop 1, 1216 Mulgoa Road, Mulgoa NSW 2745 Ph: 02 4704 3100 | Fax: 02 4704 3101

FREE QUOTE

www.conveyancingsimplif ied.com.au 8

roamingpanthermagazine.com.au

9 FEBRUARY BLUE MT THEATRE & HUB From the concert halls of Europe and London, this compelling and talented award-winning Italian piano duo present a fascinating and enthralling 4 Hands on a Grand piano recital with music from Mendelssohn, Saint-Saëns, Schubert, and Rachmaninov. Eleonora Spina and Michele Benignetti are captivating and gifted young musicians that come from strong backgrounds as soloists and chamber musicians. Their partnership as a piano duo began in 2013, immediately receiving positive acclaim. bluemountainstheatreandhub.com.au


Local Roaming LOCAL MUSIC

LOCAL SHOWS THE GOSPEL ACCORDING TO PAUL

THE FOREVER DIAMOND SHOW

DIGGER REVELL & VICKY O’KEEFE

8-9 MARCH THE JOAN Full of intelligence and wit, The Gospel According to Paul is a funny, insightful and occasionally poignant portrait of Paul Keating; the man that – as he tells it – single-handedly shaped contemporary Australia. Showcasing his eviscerating wit, rich rhetoric and ego the size of Everest, The Gospel According to Paul distills Keating’s essence into 75 minutes.

THE NEVER ENDING 80’S PARTY

9 FEBRUARY PANTHERS PENRITH A 40-year tribute to the music of Neil Diamond. Featuring his greatest hits and spanning three decades, this award-winning show will have you tapping your feet and singing along.

24 FEBRUARY PANTHERS PENRITH Join Australia’s King of Rock n Roll and Johnny O’Keefe’s daughter for this must-see celebration of Aussie rock combined with a 40thanniversary tribute to The Wild One, Johnny O’Keefe.

15 FEBRUARY O’DONOGHUES Due to popular demand, Australia’s hottest 80’s show is bringing the BIGGEST PARTY of the summer with their all-new MIX TAPE SHOW. Hit after hit, and mixed to perfection.

penrith.panthers.com.au

penrith.panthers.com.au

odonoghues.com.au

MORNING MELODIES: THE GOLDEN BOYS OF ROCK N ROLL

thejoan.com.au

PROJECT BESTFRIENDSHIP

13 FEBRUARY BLUE MOUNTAINS THEATRE & COMMUNITY HUB $20 includes Devonshire morning tea prior to the concert *A Special Seniors Festival Event*. Legendary performers Lucky Starr, Roland Storm and the John Watson Band will share songs and stories from the Bandstand years.

25 FEBRUARY – 2 MARCH THE JOAN Three intrepid playwrights, alongside a cat possessed by the ghost of Judy Garland, journey in search of the most wholesome play ever. Will they defeat the odds and stay strong, or will the funding wizard beat them again?

bluemountainstheatreandhub.com.au

thejoan.com.au

LOCAL SHOWS MANPOWER AUSTRALIA 2 MARCH PANTHERS PENRITH Also known as Australia’s Thunder from Down Under, this is the most sought-after Girl’s Night Out on the entire planet! Direct from Las Vegas, these sexy performers bring ladies nights to a whole new level. penrith.panthers.com.au

ARJ BARKER – WE NEED TO TALK 8 MARCH BLUE MT THEATRE & HUB Australia’s adopted son of comedy returns to Australia with his brand new show, We Need To Talk. You had better sit down for this… Arj needs to talk to you and what he’s going to say will make you laugh very,very hard. Please note: Not suitable for under 15 years. “A must see for anyone who loves a laugh…” – Adelaide Now

bluemountainstheatreandhub.com.au Issue 24 February 2019

9


Local Roaming

ORAVA QUARTET

THINGS TO DO

WITH GRETA BRADMAN

FINE MUSIC

Seniors Festival 13 -24 FEB

LAST DAYS OF SUMMER @ PENRITH HOMEMAKER CENTRE 16 FEBRUARY, 11AM – 3PM LOT 2, PATTYS PLACE, PENRITH Celebrate the last days of Summer with an afternoon of fun, games, food and music at our Summer celebration. You’ll also enjoy FREE gelato, popcorn, fairy floss, face-painting, glitter tattoos and loads more fun for the kids! It’s a fun-filled event for the entire family - find out more online. penrithhomemakercentre.com.au

SENIORS MORNING TEA

21 FEBRUARY, 10.30AM PENRITH RSL CLUB FREE TICKET EVENT! Bookings essential. Free tea, coffee, and cake. Lucky door prize, and free goodie bag. Tickets available at reception. Call for enquiries 02 4728 5200 penrithrsl.com.au

ASTRONOMY NIGHT 16 FEBRUARY, 8PM WESTERN SYDNEY UNI Ever wondered if there are other intelligent beings in the universe looking out from their home planet wondering the same? Then this is the presentation for you. westernsydney.edu.au/ observatorypenrith

CONCERT HALL

SAT 23 FEB 7.30PM The most exciting young quartet on the block bring their unique sound and breathtaking intensity to the classics of the string quartet canon. Joined by Greta Bradman, one of Australasia’s most celebrated operatic and concert artists, the combination will send shivers up your spine.

“…warmth of sound, sublime inner voicing and spontaneity”

7TH ANNUAL SYDNEY CHILLI CHALLENGE

$10 HALF ROASTED CHOOK

LUDDENHAM SHOW

23 FEBRUARY, 1-7PM HAWKESBURY HOTEL The Sydney Chilli Challenge brings together Australia’s greatest Chilli food stalls, with eating contests, live music and entertainment for ALL the family. Check their Facebook page for more details.

MONDAYS – ALL MONTH LONG THE BAVARIAN Mondays are the hardest day of the week, so take Monday dinners off the ever-growing to-do list and head down to The Bavarian for a $10 Chook, Chips & Slaw dinner - great for the whole family!

2 – 3 MARCH, 5-9PM LUDDENHAM SHOWGROUND, PARK ROAD Don’t miss the 114th annual Luddenham Show - it’s the original country show featuring horses, cattle and poultry on display, and the ever-popular animal farm art, craft, produce and poultry exhibits. The fun doesn’t stop there, with entertainment on stage, sheep shearing and timber cutting displays, plus sideshows and rides. With lots of great food and knick-knacks for sale, there is something for everyone.

 SydneyChilliChallenge

thebavarians.com/venue/penrith/

luddenhamshow.com.au

LOCAL ART

LOCAL FITNESS

The Sydney Morning Herald

GO A LITTLE DEEPER • Pre-show talk 6.45pm, prior to 7.30pm performance • Post-show meet the artists and merchandise sales

Stnd $60 | Conc $55 | Under 30s $30 | Family $160

SUBSCRIBE & SAVE

thejoan.com.au | 4723 7600

10

roamingpanthermagazine.com.au

Eliza Gosse - Ancher on River Road, 2018, gouache on paper.

THE IDEAL HOME

PENRITH PARKRUNS

YOGA @ THE MONDO

1 DECEMBER – 24 MARCH GET INVOLVED – GO ONLINE FOR DETAILS This exhibition and public program seeks to explore Australian experiences of home across the past 100 years. It encompasses domestic architecture, design, and technology alongside contemporary social issues which threaten the fabric of our intimate lives; domestic violence, homelessness, housing affordability, and the notion of Australia as refuge.

EVERY SATURDAY PENRITH LAKES & NEPEAN RIVER Open to all, walk/run for your own enjoyment and at your own pace. Register online to be timed, and catch up with others for a coffee afterwards.

WEDNESDAY MORNINGS 7-8AM THE MONDO, PENRITH PLAZA Enjoy free yoga classes at the Mondo, located between Westfield, the Library, and The Joan.

penrithregionalgallery.com.au

parkrun.com.au/penrithlakes

westfield.com.au/penrith


Local Roaming

Grounds AROUND THE

CONNECTING

Local Businesses

Business NETWORKING EVENTS

GEN YQ 7 FEBRUARY, 5PM START ALLAN GRAMMAR 14-16 WOODRIFF STREET, PENRITH GenYQ is a member-only networking group that caters to young professionals, entrepreneurs, business owners and intenders aged 18-35. genyq.com.au

WE’RE FOR YOUR BUSINESS - COMBINED NETWORKS 22 FEBRUARY, 7AM - 9.30AM PANTHERS PENRITH - JAMISON ROOM Women with Altitude, Penrith Chamber of Commerce, Men’s Altitude Network Unite to present; Annual Business Networking Event, We’re for Your Business: Supporting growth and strategy for your small business in the Nepean Region. We believe that together we can achieve more for local small business owners. Speakers to be advised. womenwithaltitude.com.au

CHAMBER CONNECT AT PENRITH CITY COUNCIL 12 FEBRUARY, 6PM - 8PM PENRITH CIVIC CENTRE 601 HIGH STREET, PENRITH NSW 2710 What better way to start off a fabulous new year than with fantastic networking opportunities at our Chamber Connect event at Penrith City Council. Visit their Facebook page to register. penrithchamber.org.au

YOUR GUIDE TO WHAT’S HAPPENING IN SPORT THIS MONTH.

WS Wanderers A LEAGUE - SOCCER

Round 19

 Saturday 16 February, 7:50pm  Adelaide United v Wanderers  Coopers Stadium

Round 20

 Sunday 24 February, 7pm  Wanderers v Perth Glory  Spotless Stadium

Penrith Panthers NRL - RUGBY LEAGUE

Trail Game

 Saturday 2 March, 7pm  Panthers v Eels  Panthers Stadium The Panthers will host bitter rivals Parramatta Eels in A Battle of the West trial game. This will be the first chance fans will get to see our new recruits in action.

Local Markets

WANDER AROUND YOUR LOCAL MARKET & FIND A HIDDEN GEM HAWKESBURY REGION WINDSOR MALL SUNDAY MARKETS EVERY SUNDAY Located in the George St Mall, purchase quality handmade homewares, arts, crafts, fashion and fresh produce - all while local bands and buskers entertain. www.hawkesburyaustralia.com.au

Featured Market

THE WESTIES MARKET – COMING TO GLENMORE PARK GLENMORE PARK TOWN CENTRE 2 MARCH, 9AM - 2PM

FOURTH SUNDAY Located at the Blue Mountains Theatre and Community Hub. Proudly hosting over 50 local growers and producers offering fresh food and local products.

The very popular Westies Market is coming to Glenmore Park! Featuring stallholders trading local produce, handmade, one off fashion items and homewares, as well as freshly made and ready-to-eat gourmet treats, delicious food to take home, live music, performers and workshops. Known as more than just a market, it’s a place for locals and visitors alike to come and interact with their local community.

blackcastleevents.com.au/markets

thewesties.com.au

BLUE MOUNTAINS REGION SPRINGWOOD GROWERS’ MARKET

WE’RE LOCAL Servicing the Blue Mountains, Penrith and surrounding areas since 1998.

We create the space you will love... our guarantee DESIGN TO COMPLETION

Address & Display Unit 5/118-120 Somers St, Lawson NSW 2783

Allen and Lyn Smith Owner/Operators

CALL US TODAY 4751 9577 | woodfordhomes.com.au Issue 24 February 2019

11


Special - Valentine's Day

LOCA L HOT SPOTS

EAT AND SUPPORT LOCAL THIS VALENTINE’S DAY!

B

US

INESSE

S

Looking for somewhere different this Valentine's Day? Whether you're a foodie couple or just love good music (and good wine!), we've sourced the very best date destinations Penrith has to offer.

The Village - for a truly romantic vibe The Village, located in a charming historic building in the heart of Penrith, is the perfect setting for a romantic Valentine's Day dinner. The lofty Atrium is an urban sanctuary, guaranteed to impress with its romantic cathedral ceilings, enchanting wall of greenery, and bespoke vintage lighting. Spend Valentine’s Day with someone special in a truly special place.

The Union - for a contemporary love story BOOK NOW

 74 Henry Street, Penrith

 4721 1155  @thevillage

THEVILLAGE.COM.AU

ENZOSCUCINA.COM.AU 12

roamingpanthermagazine.com.au

BOOK NOW

 542 High Street, Penrith

 4721 4501  @theunionrestaurant

THEUNIONRESTAURANT.COM.AU

Enzo’s Glenmore Park - for food made with love Spend Valentine’s Day at your local Italian where the delicious food is traditional, made with love, and served in a caring yet professional manner in an authentic Italian dining environment. Enzo’s is offering a special three-course set menu for Valentine’s Day that is sure to please - and impress. Visit the website or Facebook to view the menu and book your table now.

The Union is a fully licensed tapas restaurant that exudes a simplistic, inner-city charm with a calculated haphazard look. It offers traditional and contemporary dishes that incorporate the flavours of Spain, Morocco and the Middle East, and is friendly and affordable. If you love wine, sangria and tapas, this is the place for you. A tempting Valentine’s Day set menu is on offer over two session times. First Seating: 5:30pm – 7:45pm. Second Seating: 8pm – till late.

BOOK NOW

 Shop L05,

1-11 Town Terrace, Glenmore Park  4737 2441  @enzosglenmorepark

Mr Watkin's - for a groovy kind of love Located in the heart of Penrith’s CBD, Mr Watkins offers a quiet and cosy environment that transports you to a time forgotten and pays tribute to Australia’s colonial past. Spend a romantic evening with that someone special, choosing from the great menu that has made Mr Watkin’s one of Penrith’s favourites. Visit the website to discover what great food Mr Watkins will be offering for Valentine’s Day. MRWATKINS.COM.AU

BOOK NOW

 467 High Street, Penrith

 4708 0605  @mrwatkinsbar


Spotlight

Anh Do

The Happiest Refugee

A

LIVE

nh Do’s bestselling book, The Happiest Refugee, is Do's own memoir about his life and family. It's made readers laugh and cry, and was described by Russell Crowe as “the most surprising and inspiring read I have had in years.” The story follows Do’s life, beginning in Vietnam and through to his current success as a law graduate, comedian and media celebrity. His family’s journey to a refugee camp in Australia, their place of refuge, saw them experience poverty, tragedy, family breakup, racism and cruelty. Do’s story, though, is not one of sorrow or pity. He tells it with genuine humour and shares delightful scenes of fun and family life. The memoir shows the extraordinary courage and resilience of Do’s family - and others like them - and is a success story about people who are thankful for the life they have now. When one of Australia’s most talented comedians delves deep into his own life’s joys and sorrows, the result is an unforgettable night at the theatre that leaves an audience uplifted and experiencing, quite simply... true happiness.

EVENT IN THE SPOTLIGHT

i

EVENT DETAILS Anh Do  The Happiest Refugee Live 15 - 19 February @ 8pm  Standard $64.90  Concession $59.90 Joan Sutherland  Performing Arts Centre 597 High Street, Penrith 02 4723 7600  thejoan.com.au 

the meatballl

GET THEM AT BAVARIAN PENRITH THEBAVARIANS.COM

Issue 24 February 2019

13


Spotlight

Penrith Reptile Expo Meet breeders, and buy your own reptile and all the products you will need...

And Family Fun Day It's that time of year again... drum roll please... Penrith Reptile Expo!

T

his year is the 10th annual Reptile Expo, so be sure not to miss out! Perfect for the entire family, this year the expo welcomes two very special international guests and loads of Australian ones.

Herpetological Society where you can meet people who have experience keeping and breeding reptiles.

EVENT DETAILS

If you've never visited a Reptile Expo but you want to buy

 Penrith Reptile Expo & Family Fun Day

a reptile, you need a valid Animal Keeper's licence so be

It's a fun day out for everyone - see live reptile shows, meet breeders, and buy your own reptile - as well as all the products you'll need to house them and keep them happy and healthy!

sure to visit the link below and find out how to become

You'll also be able to find out about your local

 3 March, 9am – 4pm

licenced.

 Panthers Penrith - Panthers Marquee Mulgoa Rd, Penrith

www.environment.nsw.gov.au/wildlifelicences/

 @PenrithReptileExpo

GettingAReptileKeepersLicence.htm

Spoil Her this Valentine’s Day

Ge t he r som e t h in g sh e ’s guaranteed to adore with one of thes e i n d ul g e n t s pa pac kag e s . Sweet Heart Only $110 Save $65 • 1/2 Hour Massage • Mini Facial • Shampoo & Blowdry

Be My Valentine Only $150 Save $40

• 1/2 Hr Massage • 1 Hr Facial • 1/2 Hr Pedicure

Happy Wife, Happy Life • • • • •

True Love

1 Hr Deluxe Signature Facial Full Body exfoliation Personalised Body Wrap Steam infusion & Vichy Shower Shampoo & Blowdry

Only $270 Save $100

Only $160 Save $90 • • • •

Mini Facial Spa Pedicure Manicure Eyebrow Wax Shape & Tint • Scalp Massage Treatment • Shampoo & Blowdry

Because I Love You Only $230 Save $80

• 1 Hr Massage • 1 Hr Deluxe Signature Facial • 1/2 Hr Pedicure • Deep Condition Hair Treatment • Shampoo & Blowdry

Valentine Lovers Package • 1 Hr Massage • 1 Hr Deluxe Signature Facial or Mens Skin Treatment • 1/2 Hr Spa Pedicure

All offers valid until 14 February 2019

Valentine’s Gift Vouchers  (02) 4722 3503

AVA I L A BL E ON L I N E OR I N S TOR E

 14/69 York Rd, Penrith NSW 2750

i ns igni ah ai r an dday s p a . c o m . a u 14

roamingpanthermagazine.com.au

Only $340 Save $100

i


Local Roaming

Orava Quartet With Greta Bradman

W

orld Class Strings Performance is known for their thrilling performances, and the Orava Quartet is one of the most electrifying string quartets of its generation. Earning a reputation and a devoted following for their passionate and thrilling performances, the Quartet bring their unique sound and breathtaking intensity to the classics of the string quartet canon. They're joined by one of Australia’s most celebrated operatic and concert artists, Greta Bradman, for a celebrated evening of breathtaking strings and soprano.

My Hero (conducted by Richard Bonynge, English Chamber Orchestra) received five-star reviews and topped the classical and classical crossover ARIA charts for several months.

Found in 2007 by brothers Daniel Kowalik (violin) and Karol Kowalik (cello), and Thomas Chawner (viola), then joined in 2011 by David Dalseno (violin), the Orava Quartet has earned a solid reputation and devoted following for their unique sound and awe-inspiring intensity.

 Orava Quartet with Greta Bradman

Greta Bradman has also risen to classical fame; her 2015 debut album for Decca Classics

There will be a pre-show talk at 6.45pm prior to the 7.30pm performance. In addition, there will be a post-show meet and greet with the artists with merchandise available for purchase on the day.

EVENT DETAILS

i

 23 February – 7:30pm  Adult $60 | Concession $55 Under 30s $30 | Family $160  Joan Sutherland Performing Arts Centre 597 High Street, Penrith  thejoan.com.au

We are delighted to have received the following prestigious awards at the 2019 Mortgage Choice National Conference in Melbourne • Winner of the National Financial Planning Franchise of the Year – Rob Lees & Tim Hayman • Winner of the National Admin Staff Member of the Year – Business Manager, Christine Chapman • Winner of the NSW Multi-Operator of the Year – Rob Lees

Helping Helping you make you make betterbetter choices choices in thein the

“We look forward to a great year in 2019, continuing to provide Helping Helping you make you make betterbetter choices choices in thein the excellent customer service and helping locals realise their Blue Mountains, Blue Mountains, Penrith Penrith and Glenmore and soongoals.” atOpening the new soon Opening at Opening the Opening new soon soon soon atat the at the the new new new Glenmore Helping you make better choices in the financial and Opening property ownership

Helping Helping Helping you you you make make make better better better choices choices choices inPenrith inin the the the Glenmore Opening Opening Opening soon soon soon at at at the the thenew new new Opening soon new Blue Mountains, Blue Mountains, Penrith and and Glenmore Helping you makePark better choices in the Blue Blue Blue Mountains, Mountains, Mountains, Penrith Penrith Penrith and and and Glenmore Glenmore Glenmore Park Park Glenmore Glenmore Glenmore Park Park Park Shopping Shopping Shopping Centre Centre Centre Helping you make better choices in the Park Glenmore Park Centre ParkBlue Glenmore Park Park Shopping Glenmore Centre Park Glenmore Glenmore Shopping Glenmore Park Centre Park Park Shopping Shopping Shopping Centre Centre Centre Park Park Helping you make better choices in thePark Mountains, Penrith and Glenmore Helping you make better choices in the Blue Mountains, Penrith and Glenmore

Blue Mountains, Penrith and Glenmore Park ppp 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland ppp 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith www MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees Blue Mountains, Penrith and Glenmore Park Park Helping you make better choices in the Blue Mountains, Penrith and Glenmore Helping you make better choices in the talk talk talk to us ustoday us today today today talk tototo us talk topus4739 today9749 Blaxland talk talk to4739 talk touspus today to4721 today usBlaxland todayPenrith 1733 w MortgageChoice.com.au/rob.lees p 9749 p 4721 1733 Penrith w MortgageChoice.com.au/rob.lees talk to us today p 4739 p and 4739 Blaxland 9749 Blaxland p 4721 1733 p 9749 Penrith 4721 17334721 w Penrith MortgageChoice.com.au/rob.lees w 1733 MortgageChoice.com.au/rob.lees p 4739 9749 p and 4739 Blaxland Blaxland p 1733 p Penrith 4721 w Penrith MortgageChoice.com.au/rob.lees w MortgageChoice.com.au/rob.lees p 4739 9749 Blaxland p 4721 1733 Penrith w MortgageChoice.com.au/rob.lees pMountains, 4739 9749 9749 Blaxland p9749 4721 1733 Penrith w MortgageChoice.com.au/rob.lees Blue Penrith Glenmore Park Blue Mountains, Penrith Glenmore Park Glenmore Park p 4739 Blaxland p 4721 1733 Penrith w MortgageChoice.com.au/rob.lees p 4739 9749 Blaxland p p 4721 4739 1733 9749 Penrith Blaxland p p p 4739 4739 4721 p9749 4739 1733 9749 Blaxland 9749 Penrith Blaxland Blaxland pp4721 4721 p1733 4721 1733 Penrith 1733 Penrith Penrith p p p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland p p p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith pwHome 4739 9749 Blaxland p 4721 1733 Penrith MortgageChoice.com.au/rob.lees w w| w MortgageChoice.com.au/rob.lees w MortgageChoice.com.au/rob.lees Home Home loans loans loans | Financial | Financial | Financial planning planning planning | Risk | MortgageChoice.com.au/rob.lees Risk | Risk and and and General General General insurance insurance insurance Car |MortgageChoice.com.au/rob.lees Car | loans Car loans loans | Business | Business | Business lending lending lending Helping you make better choices in the Helpingw you make better choices in the w w MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees w MortgageChoice.com.au/rob.lees Home loans| |Risk Financial planning | Risk and insurance |lending Car loans | Business Home loans Financial planning and General insurance |General Car loans | Business lending Home loans Home ||planning Financial loans | Financial planning and General | Risk and insurance General || Car insurance || Business |Business Car loans | Business lending lending Home loans Financial planning | Risk and General insurance Car loans lending Home loans Home || Financial loans planning | Financial || |Risk and General |planning Risk and insurance General || Car insurance loans || |Business Business Car loans lending |loans Business lending Blue Mountains, Penrith and Glenmore Park Home loans Financial planning Risk and General insurance Car loans lending Blue Mountains, Penrith andHome Glenmore Park loans | Financial planning | Risk and General insurance | Car loans | Business lending Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN 645 158 ACN 624. 645 158AFSL 624. 645 422854. AFSL 624. AFSL 422854. 422854.

Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Pty Limited ACN 158 645 624. AFSL 422854. Home loans | Financial planning | Risk Home and General loansMortgage | Financial insurance planning | ACN Car loans Home |Australian Risk Home |Credit Business and loans Home loans General | Financial lending loans | Financial insurance |Financial Financial planning planning |PtyCar planning | Limited Risk loans | 158Risk and |645|Business and Risk General General and insurance General | Car | Car loans loans | Car | Business loans | Business | Business lending lending lending Mortgage Limited 009 Mortgage 161 979. Choice Limited Credit ACN Licence 009 161 382869. 979. Australian Mortgage Credit Choice Licence 382869. Planning Mortgage Limited Choice ACN Financial 645 Planning 624. AFSL Pty422854. Limited ACN 158lending 645 624.insurance AFSL 422854.insurance Choice Choice Limited ACN 009 161 979. Australian Licence 382869. Mortgage Choice Financial Planning Pty ACN 158 624. AFSL 422854. Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Pty Limited ACN 158 645 624. AFSL 422854.

Mortgage Choice Limited ACN 009 Mortgage 161 979.Choice Australian Limited Credit ACN Licence 009 161 382869. 979. Australian MortgageCredit ChoiceLicence Financial 382869. Planning Mortgage Pty Limited ChoiceACN Financial 158 645Planning 624. AFSL Pty422854. Limited ACN 158 645 624. AFSL 422854. Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Pty Limited ACN 158 645 624. AFSL 422854. Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Pty Limited ACN 158 645 624. AFSL 422854.

Home Home Home loans loans loans | Financial | Financial planning planning planning | Risk | Risk |p Risk and and and General General General insurance insurance insurance |MortgageChoice.com.au/rob.lees Car | Car loans loans loans | Business | Business | Business lending lending lending p| Financial 4739 9749 Blaxland 4721 1733 Penrith w| Car p 4739 9749Home Blaxland 4721 1733 Penrith MortgageChoice.com.au/rob.lees loans |p Financial planning | Riskw and General insurance | Car loans | Business lending

Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Mortgage Mortgage PtyChoice Choice Limited Limited Limited ACN 158 ACN ACN 645009 009 624. 161 161 AFSL 979. 979.422854. Australian AustralianCredit CreditLicence Licence382869. 382869.Mortgage MortgageChoice Choice Mortgage Financial Financial Mortgage Choice Planning Planning Limited Choice Pty PtyLimited Limited ACN Mortgage Limited 009 ACN ACN 161 ACN Choice 158 979. 158 009 645 645 Australian Limited 161 624. 624. 979. AFSL AFSL ACN Australian Credit 422854. 422854. 009 Licence 161Credit 979. Australian 382869. LicenceMortgage 382869. Credit Mortgage Licence Choice 382869. Financial ChoiceMortgage Financial PlanningChoice Planning Pty Limited Financial PtyACN Limited Planning 158 645 ACN 624. Pty 158AFSL 645 Limited 624. 422854. ACN AFSL158 422854. 645 624. AFSL 422854.

Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN645 158 ACN 624. 645 158AFSL 624. 645 AFSL 422854. 624. AFSL 422854. 422854.

Issue 24 February 2019

15


Community

Sandy and Immy

Written by Cassandra Elliott

We’re bringing these parents up for air, letting them know that a brave face isn't necessary in our community. I suppose it all started in August, when I recorded a Facebook Live. It was about the fatality statistics of parents of children with additional needs, and the amount of cardio vascular deaths, cancer and deaths by misadventure. Like, a special needs mum was 200% more likely to die of that stuff, so I recorded a video and it went bananas. I wasn’t expecting that response. I thought, this shouldn’t be the case for parents.

Sandy and Stephanie

Sandy and Immy

L

ocal mums Steph and Sandy, who’d bonded over having children with special needs, sought a community of people who understood what they’re going through. They found there was a gap in the support available for families that have children with additional needs. This gap was that the parents weren’t looking after their own health and wellbeing. And so Thrive Tribe & Co was born. "We’re a community of like-minded people who understand and offer a space where we can provide support, but also find solutions," explains Steph. "We’ve got a group called Thrive Tribe & Co Connect, which is a community Facebook page designed for the parents of children with additional needs and focuses on self-care tips and different advice strategies. "In February we’re launching a membership platform for more targeted coaching that focuses on different areas of health every fortnight through webinars, so parents can work on something small every day." Thrive Tribe & Co will be having special guests and experts coming in for the webinars. These will include financial planners, meditation coaches, naturopaths and many more professionals who can offer their expertise in an accessible way so parents don’t have to go out to get this information. "We look at health holistically: physical health, emotional and mental health, social, spiritual and financial health

- they’re all intertwined. There’s about 27 different topics that we work on, but they’re all in that sphere of the holistic health concept," explains Sandy. "We’re also having a live event in March, it’ll be a live three-hour workshop where parents can spend time working on their own health and wellbeing, and we’ll give them some take-away strategies too. We’re working with a company called Plan Wise Living and they’re going to help if parents need some sort of care organised for their children on the day. “You don’t have to go through life sacrificing your own health for your children. You’re not supposed to. If we make self-care a priority, the other stuff becomes easier.” Their story aired on Channel 7 on Christmas Day, and the Thrive Tribe & Co community has grown rapidly since. “It’s just cemented that we were on the right track and there were so many people that needed this that weren’t being heard. “We want to redefine ‘self-care’ - we’ve realised that it’s actually really difficult for parents to get their heads around. By taking care of ourselves and making sure that we’re a priority, we’re not loving our families less. It’s not that at all. It’s balance and it’s about that headspace, through really small, basic things, day to day.” FOLLOW THRIVE TRIBE & CO! You can find them on Facebook at  thrivetribeandco

Charlie

Steph and Charlie

16

roamingpanthermagazine.com.au

Sandy and Stephanie


Community

PENRITH'S NEW WINE BAR

Allan Grammar Written by Penrith City Council

Everything you need to know!

D

elicious food, boutique wines and a great atmosphere. Penrith’s fancy new wine bar has everything you need for your next night out.

The talented duo behind the popular Henri Marc cafè have opened a fancy new wine bar. Allan Grammar (we’ll get to the name later) is located in a quiet laneway off bustling High St in Penrith’s CBD. It might be tucked away off the main street but you definitely know when you’ve arrived; the grand entranceway, complete with potted trees flanking the large door, is the first sign that you’re in for something special. Husband and wife team Sophia and Aaron Bernacki have spent the past few months getting every detail of their new wine bar just perfect, starting with the name. Allan Grammar is a tribute to Sophia’s fond memories of being home schooled and growing up on Allan Street in Mulgoa, and at the same time is a subtle dig at those who said she’d never succeed because of it. Well played.

The interior, which includes crisp white walls set against intimate table settles with mint green velvet chair coverings, is the perfect combination of old-world charm and fresh modern décor. The bar is undoubtedly the centrepiece of the space, showcasing the large range of boutique wines on offer along with ales and ciders. As a wine bar you’d expect there to be some amazing wines available - and you’re right. The wine list has been curated by Seamus Brandt (Quay Restaurant’s current sommelier), so your tastebuds are in very good hands. Don’t expect to drink the same thing every time you go, though; each month a different wine producer will be profiled. Both Sophie and Aaron are trained chefs with experience at some of Sydney’s best restaurants, so it’s no surprise that their menu of bar snacks and share plates is next-level delicious. Some of our favourite bar snacks include the ham hock croquettes with mustard crème fraiche ($4.5), glazed lamb ribs with macadamias ($6), and the baby chicken wing sambo with salsa verde and pickled carrot ($6).

And if you love your wine served with cheese (and who doesn’t), then plates of Gippsland Tarago brie with local honeycomb ($9), Milawa Blue with vanilla apple butter ($9) and Pyengana cheddar with pinot paste ($9), all served with house-made linseed lavosh, will certainly do the trick. If you can’t choose one, you can order a share plate with the lot for $25. Alternatively, indulge in larger dishes such as hiramasa kingfish with pomelo and radish ($28), orecchiette with spring greens and truffle pecorino ($28), linguine with clams, dashi and chilli ($29), and wagyu bavette steak with café dé paris sauce ($36).

POP ON IN, YOU WON'T BE DISAPPOINTED    

Open Wednesday to Saturday, 5pm until late 14-16 Woodriff St, Penrith NSW 2750 0402 715 986 @allangrammar2750

PE NRIT H

www.starbuffet.com.au (02) 4728 5277

Issue 24 February 2019

17


ROAMING FEATURE

The 115 Annual Luddenham Show th

Written by Cassandra Elliott

2 - 3 MARCH 2019 115 YEARS OF HOME-GROWN FAMILY FUN!

The Luddenham Show is steeped in history - from the families that run it to the showground itself.

T

he Luddenham Agricultural, Horticultural and Industrial Society was established in 1891 and has been delighting Sydney families for generations. In the lead up to this year’s show, Roaming spoke with LAHIS President, Wayne Willmington. “There are three families that have been involved with the show since its inception back in 1891. These three families have had descendants on the committee that have been running the show since way back in 1891. They are: Willmington, which is my family, Adams, and the Roots. It's very special because to think that these three families have been here all this time is amazing,” he says. “The Luddenham Showground holds a very unique status, being one of the very few showgrounds that’s 100% owned by the local residents and not the council or government,” he boasts proudly. “A lot of the buildings here are tin sheds; they’re the same ones that were purpose-built for the show society back in 1891. “The show’s run entirely by volunteers, and nowadays that’s great to see; it says a lot about the community.

18

roamingpanthermagazine.com.au

The show is designed for the whole family... we have a lot of novelty events because we really focus on having the kids involved

And it’s a year in the making, so we want everyone to come down and enjoy themselves.” The show really is designed for the whole family. “We have a lot of novelty events because we really focus on having the kids involved. Unlike a lot of the shows now, if kids can go, they focus on the rides and it can cost a lot of money, so we try to make sure it has lots of family entertainment so it’s easier on families.” Some of the novelty events you can expect to see at this year’s show include whip-cracking, lawnmower racing, bull riding, tail-tagging and barrel racing, the conventional type of country rodeo, and there’s steer-rides for the older kids and calf rides for the younger ones. If you’re interested in a specific event, make sure you check out the website to see which day it’s happening because there’s so much going on over the two days. Wayne says it’s important to have entertainment happening the whole time. One of his favourite events is the ice cream eating competition. “It’s one of our most popular events. You’ve got to eat a plate of ice-cream with your hands behind your back - using your face!” he laughs. “There’s so much happening though. It’s about getting the families involved, which makes it such a great event.” Along with the competitions, there is plenty of entertainment. There are shows on the main stage, food stalls if you get hungry and they’re licenced so

Stage Shows

Horse Sporting Events


The Luddenham Show

you can have a drink in the designated areas. You can buy knick-knacks, browse the unique craft stalls and cooking stalls, enjoy rides with the kids, and watch the animal shows. “There are lots of farm animals to see. There’s shows too; the horses and riders compete here and then they go onto the Royal Easter Show in Sydney.”

Photo credit: Jack Willmington – JBW Photography

The entertainment changes every year, but as tradition is very much important to the society, family entertainment is always at the heart of the show. On top of a fireworks display, a demolition derby, live wrestling, bands and amusement rides, you can look forward to some of the more unique attractions that you’ll only find at the Luddenham Show. This year these include scarecrow building, a homebrew competition, gumboot decorating, a Lego building competition, wood chopping, sheep-shearing and plenty more.

Wayne emphasises proudly that “this is a traditional, old-time country show and that’s very much our focus.” You’re encouraged to dress the kids up in their best ‘country kid’ or ‘farmer’ costume and head down to the Luddenham Showground to spend the weekend enjoying some good ol’ fashioned family fun. There’s plenty of parking available, but please be advised, it is paid parking. Tickets are available at the gate on the day. You can check out luddenhamshow.com.au to see the full schedule, or you can purchase a weekend pass for the whole family to make sure you don’t miss a thing! Mower Mania Ice Cream Eating Competition

This is a traditional old-time country show and that’s very much our focus

“This is our 115th show; it started back in 1891, but it hasn't run every year because of things like the war, droughts and, in my time, the horse flu which was around one year. So some of the shows were cancelled, but this year we're up to 115,” he says proudly. “The Luddenham Showground is located near the new Western Sydney Airport, so it's gonna be important for us to keep the country show tradition alive, where we're going to have a 24hour, international airport a kilometre from the showground. It's a bit of a trying time for us, but it's good to see them come on as a major sponsor this year, so that’s great.”

Chainsaw Competition

Rodeo

GOOD OL' FASHION FUN  The Luddenham Show  The Luddenham Showground Corner of Park Road and Campbell Street  Saturday 2 March: 8am-11pm Sunday 3 March: 8am-6pm

The watchful crowd at the show

Demolition Derby

 $10 for kids $15 for adults $40 for families (2 adults and 4 kids) $50 for a family weekend pass (2 adults and 4 kids for the whole weekend).

Issue 24 February 2019

19


Home Living

Transform Your Outdoor Space AT PENRITH HOMEMAKER CENTRE

It’s all sun, fun and entertaining!

Osmen Moon Lounge 4-piece set $6,699

Penrith Homemaker Centre has all the inspiration you need to make Summer last just a little bit longer, with the ultimate outdoor essentials for your next get together.

W

arm days mean more time spent outdoors, so why not make the most of your outdoor space with stylish and clever pieces that transform your backyard, garden or balcony into an extension of your living space? Whether you’d like to relax, entertain or escape, Penrith Homemaker Centre has everything you need to create an outdoor oasis you’ll love all year long.

Heston-Level Grill Master

Welcome to the Jungle

Poolside Tunes

Take your skills up a notch with this clever and easy to use gas BBQ designed by Michelin-chef Heston Blumenthal. $999 at Harvey Norman.

Bring your backyard to life with this vibrant, tropical print outdoor beanbag cover. Beanbag $69 at Domayne.

Super-portable wireless Bluetooth® speaker: balanced 360° sound, deep bass, one-touch music control, water, dust and drop proof, and stunning high-performance fabric. It’s the ultimate go-anywhere speaker. UE Boom $169 from JB Hi-Fi.

POP IN STORE FOR ALL THE INSPIRATION YOU NEED Visit Penrith Homemaker Centre for all your decor and entertaining needs.  Cnr Mulgoa Rd and Wolseley St, Jamisontown 2749  penrithhomemakercentre.com.au

20

roamingpanthermagazine.com.au

Early Settler Outdoor


Last Days of Summer Outdoor Family Event Saturday 16 February Penrith Homemaker Centre Celebrate the last days of summer with an afternoon of fun, games, food and music at our Summer celebration. 11am – 3pm Giant Lawn Games / Super Tasty Food Trucks / Gelato, Popcorn & Fairy Floss Face Painting / Live Music & Entertainment

Find out more at facebook.com/penrithhomemaker

Late night shopping every Thursday until 9pm Cnr. Mulgoa Rd & Wolseley St, Jamisontown penrithhomemakercentre.com.au   


SUNDAY 1

KICK-OFF: 4.05PM | P

PANTHERS 2019 SEASON DRAW

ROUND 2

ROUND 3

ROUND 4

ROUND 5

SATURDAY

SATURDAY

FRIDAY

FRIDAY

MARCH KICK-OFF: 5.30PM

MARCH KICK-OFF: 7.35PM

APRIL KICK-OFF: 7.55PM

APRIL KICK-OFF: 6.00PM

MCDONALD JONES STADIUM

CARRINGTON PARK

PANTHERS STADIUM

CBUS SUPER STADIUM

ROUND 10

ROUND 11

ROUND 12

ROUND 13

FRIDAY

THURSDAY

THURSDAY

SUNDAY

MAY KICK-OFF: 6.00PM

MAY KICK-OFF: 7.50PM

MAY KICK-OFF: 7.50PM

JUNE KICK-OFF: 4.05PM

PANTHERS STADIUM

BANKWEST STADIUM

PANTHERS STADIUM

PANTHERS STADIUM

ROUND 18

ROUND 19

ROUND 20

ROUND 21

FRIDAY

SUNDAY

SATURDAY

FRIDAY

JULY KICK-OFF: 7.55PM

JULY KICK-OFF: 4.05PM

AUGUST KICK-OFF: 5.30PM

AUGUST KICK-OFF: 7.55PM

PANTHERS STADIUM

PANTHERS STADIUM

BANKWEST STADIUM

PANTHERS STADIUM


17 MARCH

PANTHERS STADIUM

ROUND 9

ROUND 7

ROUND 8

THURSDAY

FRIDAY

SATURDAY

FRIDAY

APRIL KICK-OFF: 7.50PM

APRIL KICK-OFF: 7.55PM

MAY KICK-OFF: 3.00PM

MAY KICK-OFF: 6.00PM

SHARK PARK

PANTHERS STADIUM

MCDONALDS PARK WAGGA WAGGA

SUNCORP STADIUM

ROUND 14

ROUND 15

SATURDAY

SUNDAY

JUNE KICK-OFF: 5.30PM

JUNE KICK-OFF: 2.00PM AEST

JULY KICK-OFF: 6.00PM

ANZ STADIUM

MT SMART STADIUM

PANTHERS STADIUM

ROUND 22

ROUND 23

ROUND 24

FRIDAY

FRIDAY

ROUND 25

SATURDAY

SUNDAY

AUGUST KICK-OFF: 7.55PM

AUGUST KICK-OFF: 6.00PM

AUGUST KICK-OFF: 7.35PM

SEPTEMBER KICK-OFF: 4.05PM

SUNCORP STADIUM

1300 SMILES STADIUM

SYDNEY CRICKET GROUND

PANTHERS STADIUM

ROUND 6

ROUND 17 ROUND 16

FRIDAY

SHOW YOUR #PANTHERPRIDE AND TAG @PENRITHPANTHERS


Food

Cravings

HUNGR Y F O R MOR E

CRAVINGS: HUNGRY FOR MORE  Chrissy Teigen

 RRP $45.00 (HardCover) Available at all good bookstores  penguin.com.au Cravings: Hungry for More takes us further into Chrissy's kitchen... and life. It's a life of pancakes that remind you of blueberry pie, eating onion dip with your glam squad, banana bread that breaks the internet, and a little something called Pad Thai Carbonara. This book is like Chrissy's new edible diary: recipes for quick-as-a-snap meals; recipes for lighter, brighter, healthier-ish living; and recipes that, well, are gonna put you to bed, holding your belly. And it will have you hungry for more.

Garlic-Honey Prawns Serves 4

ACTIVE TIME: 15 MINS* TOTAL TIME: 20 MINS

INGREDIENTS 9 2 medium oranges 9 3 tablespoons honey 9 2 tablespoons soy sauce 9 1 tablespoon unseasoned rice vinegar 9 1 tablespoon cornflour 9 450g large (16-20 count) prawns, peeled and deveined 9 Kosher salt and freshly ground black pepper

9 3 tablespoons rapeseed oil 9 6 cloves garlic, minced 9 1 tablespoon finely minced fresh ginger 9 2 spring onions, whites thinly sliced, greens cut into 5cm lengths 9 1 teaspoon chilli flakes 9 Cooked rice, for serving

METHOD 1 Using a vegetable peeler, pull off a 2.5-cm-wide strip of zest

from 1 orange, then finely grate the zest from about half the orange. Reserve both kinds of zest. Juice both oranges into a bowl (you should have just over 125ml juice; if you have a lot less… borrow another orange from somebody). Whisk in the honey, soy sauce and vinegar.

2 In a small bowl, combine the cornflour with 1 tablespoon of the

orange-soy mixture to form a paste, then stir that back into the bowl with the rest of the orange-soy mixture.

3 Pat the prawns dry with paper towels and season both sides

generously with salt and pepper. In the largest frying pan you have, heat 1 ½ tablespoons of the oil over medium-high heat until shimmering-hot, almost smoking. Add the prawns, spread it out in one layer, DFWI, and cook until the underside is bright pink, 1 to 1 ½ minutes. Flip and cook 1 minute more, then transfer them to a plate.

4 Add the remaining 1 ½ tablespoons oil to the pan. Add the

garlic, ginger, spring onion whites and chilli flakes and cook until fragrant, 30 seconds to 1 minute. Add the orange-soy liquid and the strip of orange zest and cook, stirring, until thickened, 1 to 2 minutes. Return the prawns to the pan, add the spring onion greens, and toss to coat with the sauce.

5 Divide the prawns among bowls, garnish with a few pinches of

the grates orange zest, and serve with rice.

24

roamingpanthermagazine.com.au

*If you’re not using pre-cleaned prawns, this is more like 25 mins.


Food

Egg-Mozzarella Ham Cups Makes 6

ACTIVE TIME: 15 MINS TOTAL TIME: 30 MINS

Oh, ham cups. You remind me so much of my early blog days. When cooking was merely a hobby and there was zero pressure to pump out the prettiest, filtered photos. No deadlines. No ‘Can I say this or will I get in trouble?!’ Oh, those were the days. Sharing this recipe humbles me. It’s so simple. When I posted it many years ago, it was so ugly, so dry, so overcooked, but you loved it. You BELIEVED in it. You didn’t make fun of me. Instead, you flooded my comment section with tips and tricks and other fillings that could be great. That blog was our little community. I was super insecure about sharing (at the time) and REALLY insecure about sharing my love for cooking when I had sooooo little actual knowledge, just a passion for it. But you guys were so cool to me and we learned together. Think this might be the recipe that kept me going. It’s the recipe that is why we are here today with my second book! That’s pretty awesome. You guys are awesome.

INGREDIENTS Egg-Mozzarella Ham Cups 9 6 thin slices ham 9 45g finely diced mozzarella, or tiny mozzarella balls 9 80g halved cherry tomatoes or diced tomatoes 9 2 tablespoons pesto (recipe follows), or store-bought 9 2 table spoons fresh breadcrumbs 9 Kosher salt and freshly ground black pepper 9 6 eggs 9 330g salad leaves 9 Red wine vinegar 9 Extra-virgin olive oil Pesto (makes 250ml) 9 50g fresh basil leaves 9 45g pine nuts 9 3 garlic cloves, minced 9 80 g finely grated Parmigiano-Reggiano cheese 9 125ml extra-virgin olive oil 9 Salt and freshly ground black pepper

3 In a bowl, combine the mozzarella, tomatoes, pesto 

and breadcrumbs. Season to taste with salt and pepper and divide the mixture among the ham cups. Carefully crack an egg into each cup. Bake until the tomato juices are lightly bubbling and the whites are set, about 15 minutes.

4 In a large bowl, toss the leaves with salt, pepper, 

vinegar and oil to taste to make a simple salad. Let the ham cups cool slightly, then unmold them to a plate. Serve the ham cups with the salad on the side.

5 Pesto: Pulse the basil, pine nuts, garlic and Parm in 

a food processor 15 times. Turn on the processor and add the oil in a slow, small stream. Scrape down the sides of the bowl if necessary. Season with salt and pepper to taste.

METHOD 1

Preheat the oven to 400 Fahrenheit/200 degrees.  Coat 6 cups of a standard non-stick muffin tin with cooking spray.

2 Tuck one thin slice of ham into each cup, trying to 

make as much of a cup shape as possible with the edges sticking out the top. Issue 24 February 2019

25


Food Roaming Local

Three-Ingredient Chocolate Mousse WITH SALTY RICE KRISPIES-HAZELNUT CRACKLE

Serves 4

ACTIVE TIME: 15 MINS TOTAL TIME: 2 HRS 15 MINS

Have you ever noticed that like every restaurant that doesn’t have an actual pastry chef (meaning someone whose only job it is to make desserts) always has a mousse on the menu? Now I know why: pretty much anyone can make it, and you can stash it in the fridge and top it with whipped cream and basically be the champion of the sweet things. This version is even easier than usual because you don’t have to whip egg whites (plus the Universe of Twittershame can’t ride my butt about endangering the health of my children by eating raw eggs). It’s just chocolate, milk and cream for the mousse – and the win. Bonus points if you can load it into pretty glasses, though it tastes just as good in a paper cup. And you can make the crispy cereal candy toys that go on the top in ten minutes flat and they are insaaaaaaaanely good.

INGREDIENTS Mousse 9 170g good semisweet or dark chocolate chips or roughly chopped solid chocolate 9 85ml whole milk 9 185ml double cream Crackle 9 Oil, for the pan 9 150g sugar 9 4 teaspoons light corn syrup 9 ¹/8 teaspoon baking soda 9 ¼ teaspoon kosher salt, plus more for sprinkling 9 20g Rice Krispies (Rice Bubbles) cereal 9 60g chopped toasted hazelnuts Ingredients for Serving 9 125ml double cream 9 1 tablespoon sugar METHOD 1

TIP

‘Soft peak’ cream means the cream holds nice shapes when lifted with a spoon or whisk, but the tips will still kinda flop over. ‘Stiff peak’ cream is prrrrrrrrretty stiff. If you run a finger through the centre, there’ll be a hollow channel there.

26

roamingpanthermagazine.com.au

Make the Mousse. In a large microwave-safe bowl, combine the chocolate chips and milk. Microwave on high for 1 minute 15 seconds. Remove and stir the mixture until melted and smooth; let it cool for 15 minutes.

2 Once the chocolate is cooled, whip the cream

with a whisk or electric mixer until stiff peaks form (See Tip), 2 to 3 minutes. Gently fold the whipped cream into the cooled chocolate until uniform, making sure not to stir too hard or the mousse will deflate. Divide evenly among four smallish glasses, like juice glasses or martini glasses (use them for something else for a change). Chill in the refrigerator for at least 2 hours or up to 24. 3 Make the Crackle. Line a baking sheet with

parchment paper and grease lightly with oil. In a small (2-litre) saucepan, combine the sugar, 2 tablespoons water and the corn syrup. Bring to a boil over medium heat and let it bubble, swirling it occasionally, until the mixture turns toasty, the colour of nice caramel; about 5 minutes from when it starts to bubble. Remove the pot from the heat and stir in the baking soda and salt, then the Rice Krispies (Rice Bubbles) and hazelnuts. Working fast (the stuff hardens), spread the mixture on to the parchment and sprinkle with more salt. Let it cool and harden, then break into pieces.

4 Assemble the Mousse. With a whisk or electric

mixer, whip the cream and the sugar to soft peaks. Top each glass of mousse with some of the whipped cream and the broken crackle.


Travel

Ultimate Experience

DISCOVER THE

New Orleans skyline from the Crescent City Connection Bridge

Trying to think of somewhere for your next holiday that really is in a class of its own?

Halifax waterfront, Canada

Travelling with Scenic: Luxury Cruises & Tours, you know you can be confident that every detail is taken care of.

Local Experts

Street musicians in New Orleans

Lunenburg, Canada

Lynette, Kerrie, Jenny & Nicole Travel Experts Maria, Fellowes & Turner Travel Associates Penrith

W

elcome to the next generation in ocean cruising! Travelling with Scenic: Luxury Cruises & Tours, you know you can be confident that every detail is taken care of. Scenic really will make your cruise a truly carefree experience.

When I cruised the Mekong, from Ho Chi Minh City to Siem Reap, I had the opportunity to experience every aspect of comfort that had been considered by Scenic including airport transfers, all tipping and gratuities (this tends to suit Australians). The food was amazing and catered for all tastes, including those like myself who aren't very adventurous. And the staff? They were simply amazing. I won’t lie, these trips don’t come cheap but you need to consider what's included in the price and I can honestly say they are worth every penny. I was very excited to hear that Scenic have taken things to a whole new level with the introduction of Scenic Eclipse, 'The World’s First Discovery Yachts'. Scenic combines a small group, escorted land journey with a Scenic Eclipse cruise for the ultimate holiday. I've had the trip of a lifetime with Scenic, and hope to be lucky enough to travel with them again. EXCLUSIVE OFFER! To celebrate, Maria, Fellowes & Turner Travel Associates has put together an exclusive offer if you book before 31/3/19. (As advertised to the right.) We have chosen the Maritime Discovery with Rhythms of the South departing 20/9/19. Whether you are an experienced cruiser or a novice, this is a fantastic opportunity to explore the fascinating ports of maritime Canada and soak up the music, culture and history of the USA. You will enjoy a guaranteed luxury verandah suite, all-inclusive dining and beverages, Scenic Enrich experiences, Scenic Freechoice excursions, and a Butler service for all guests (don’t let anyone tell you that you don’t need one). This is a truly unique adventure that deserves a prominent place on everyone’s bucket list. start your ultimate travel experience We look forward to sharing our travel experiences with you. Give us a call on 1800 040 744 - we would love to be part of your next amazing journey.

MARITIMES

Discovery

WITH RHYTHMS OF THE SOUTH

18 Day Cruise and Tour Halifax to New Orleans Unravel the wonders of the Canadian Maritimes and New England together with America’s vibrant southern states. Cruise in all-inclusive luxury from Halifax to New York City then discover the vibrant music, culture and history of America’s South.

& Departs - 20 September 2019 & 9 night all-inclusive luxury Scenic Eclipse cruise & Guaranteed Earlybird fare for first 15 suites & 1 night pre stopover Halifax including

airport transfers & 400 USD per couple onboard credit & 500 AUD per couple Earlybird discount & Complimentary 20 minute submarine excursion#

from $17,590* per person

Newfoundland Rose Blanche New Brunswick Charlottetown CANADA

St Andrews

Nova Scotia

Louisbourg

Halifax Lunenburg

Portland USA

9 Martha’s Vineyard

New York City

Freecall 1800 040 744 or email Freecall 1800 040 744 or email penrith@travelassociates.com penrith@travel-associates.com.au 14 Macquarie 14 Avenue, Penrith.Avenue, Penrith Macquarie travel-associates.com.au/mariafellowes travelassociates.com/mariafellowes *Subject to availability. Must book by 31 March 2019. Exclusive to Maria, Fellowes & Turner Travel Associates. Onboard credit and Earlybird discount is per couple. Cab cat: Verandah. Price is per person. #Submarine excursions subject to regulatory approval.

Issue 24 February 2019

27


Physio

Sitting at the Desk

A HEALTH RISK

Sometimes, sitting down at your desk for 8+ hours a day is unavoidable.

Local Experts Kris Caloia & Karl Thornton

Physiotherapy Experts Progressive Sports & Spinal Physiotherapy

D

esk jobs are a part of life and for some, the time spent at the desk can increase the longer you’re in the job. We all know that sitting for long periods of time isn’t exactly great for us, but do you know how sitting actually affects the body?

We want to give you a little more of an idea as to what that desk time can actually be doing to your body. Sitting for prolonged periods of time is known to: • Increase your risk of circulation issues, such as DVT • Potentially lead to muscle atrophy (breaking down of muscle) • Increase your risk of developing diabetes by 91% • Increase your risk of developing cancer by 13% • Increase your risk of cardiovascular disease by 14%, and • Possibly cause issues and pain relating to your back, hips and much more. Despite all of this, the potential to reverse these affects is possible for those who make the time to fit exercise into their day, either before or after an eight-hour day at the desk.

POWER TO

KEEP MOVING

New research suggests that the above risks were significantly eliminated for those who sit for eight hours a day but also achieve one hours worth of exercise a day. In other words, if you make time for at least an hours worth of exercise every day, despite sitting for eight hours a day, you still have a chance to avoid some of these nasty lifestyle conditions as a result of your desk job. Some helpful tips to keep active during those eight hours at the desk are: • Taking the long route to the toilet block throughout the day • Ensuring you take breaks or perhaps a tea/coffee break regularly • Making the most of walking to the bin or the photocopier • Getting up to ask your co-worker a question instead of emailing them • Taking the stairs instead of the lifts • Parking further away from your workplace so you get in a few extra steps, and • Doing a few stretches throughout the day such as a back arch, hip flexor stretches, and torso rotations. All of these instances of what we call 'incidental exercise' are ways in which you can look after your body and your health while maintaining your desk job. By actively implementing ways to clock up your steps and keep the body moving throughout the day, you’ll spend less time with your physiotherapist and other healthcare professionals later in life.

feeling the effects of your desk job?

4/29 York Road, Jamisontown | (02) 4721 7798 www&rorssi+raoma* | ind *s on soia" 28

roamingpanthermagazine.com.au

The team at Progressive Sports & Spinal Physiotherapy can assess your pain and customise a plan for you to get you feeling your best. Contact the practice today on (02) 4721 7798.


Health

Have a Weight Loss Goal THIS YEAR?

Written by Fiona Kane, Nutritionist, Holistic Counsellor & Life Coach. www.informedhealth.com.au

Here are some things to consider. PORTION SIZES You only need to look at average plate size and serving size now compared to our grandparents. Their dinner plate was about the same size as our current bread and butter plates. A different size plate does affect how much you eat; we tend to automatically fill it up. On the flipside, sometimes overweight people under-eat. Their body then assumes they're in a famine and won’t let go of any fat! If you overeat, notice how it happens - is it availability or habit? Slow down when you eat to allow the 'satisfied' message time to get through. Listen to your body; learn the difference between satisfied and full, and eat until you are satisfied. Are you really hungry, craving sugar or carbohydrates, feeling tired and irritable until you eat? If so, you may be experiencing low blood sugar levels. This can be corrected by eating in a balanced way by including protein and fat with each meal along with

vegies/salad (eg chicken or fish with salad, avocado and olive oil). Eating this way ensures you remain satisfied and your blood sugar levels stay stable, avoiding those big blood sugar drops and cravings. If you still crave sugar, you may need help to correct your microbiome; the wrong balance of gut bacteria can make you crave sugar! PAY ATTENTION TO HOW MUCH SUGAR YOU ARE EATING Especially in things like yoghurt, sauce and mayonnaise. Eat full fat natural varieties and avoid low fat options (often high in sugar). A teaspoon of sugar is 4g, so when you look on the nutrition panel, 20g of sugar is five teaspoons. The World Health Organisation recommends that adults have an upper limit of six teaspoons per day. DO YOU EMOTIONALLY EAT? This is very common; many of us use food to push down uncomfortable emotions and as a drug to numb. If this is the case you need to learn how to have uncomfortable emotions. If we don’t experience them, they can’t be

processed and they just all build up like they are going to burst. You may need to work with a health professional to help learn how to manage your feelings in a healthy way. It's just another life skill that many of us don’t have, nothing to be ashamed of. If your parents didn’t have the skills they couldn’t pass them on to you, and if you don’t have the skills, how will your children learn? THE CALORIES IN/CALORIES OUT THEORY No matter how much you're told that that weight loss is simply about calories in/calories out, this is partly true but it's way more complicated than that. The assumption that all people who are overweight are gluttons and/or sloths is simply not true. Before you begin any health or weight loss journey, it's important to remember nobody ever hated themselves to health; let go of yours and other people’s judgements and learn to nourish and nurture yourself. If you punish, despise and deprive yourself, it will lead you nowhere and continue to feed the emotional eating cycle. There are no pre-requisites for love or worthiness; you are worthy of being loved and nourished now, and that is a great place to begin your journey to health.

ONE

MINUTE WALK FROM

NEPEAN HOSPITAL Greater Western Hwy

Visit our Pharmacy for Friendly

Services & Expert Advice • Prescriptions Filled

• Workers Compensation

• Surgical Supplies

• Specialty Vitamins & Herbal Supplements

• MedsChecks

• Home-aids

• Injury Supportwear

• Baby & Mum Care

• Hires - Wheelchairs, Crutches & Breast Pumps

• Wide Range of Gifts

• National Diabetes Service • Webster Packing

 specialistclinicpharmacykingswood

 4737 3456

ST ET ERS

ST

Within the Specialist Clinic

S TA F

• Newspapers, Milk, Drinks, Chips & Lollies

BY

SOM

ST

DER

PA R

Professional Service

Penrith

KER

Local & Convenient

Kingswood Station

Nepean Hospital

FORD

ST

M4 Motorway

• Photocopying, Faxing, and Laminating

 pharmacy@specialistclinicpharmacy.com

 Suite 3, 64 - 68 Derby St, Kingswood

Trading Hours Monday - Friday Saturday Sunday Public Holidays

7.30am - 7.30pm 8.00am - 5.00pm CLOSED 9.00am - 1.00pm

Issue 24 February 2019

29


Wellbeing

Valentine's Day Blues

Local Expert

AVOID THE

Melissa Ferrari

Psychotherapist & Relationship Expert

With Valentine’s Day around the corner, what are your expectations?

W

ill your partner push all the right buttons, making it a magical time, or are you sensing that you may be a little let down by the whole Valentine experience? If you answered yes to the latter then don’t worry, as you're not alone. Often the hype of Valentine’s Day fails to live up to our expectations. Of course, for some it is disappointing because there is currently no one special to share the day with, with Valentine’s Day making them feel even more alone. To them I say hang in there. Your Valentine’s Day will come. For those in a relationship who believe that their partner is likely to forget, or only half buy into the Valentine’s Day experience, here is what you need to do to make sure that you shake loose the prospects of those Valentine’s Day blues. 1

DO NOT HOLD BACK

Too many couples fail to communicate with each other, leaving both with little idea as to what the other wants,

or expects from the relationship. Valentine’s Day is a case in point. The lack of communication may see one partner think that it is not important to the other, when it clearly is. So to avoid the same situation happening again next year, it is time to start communicating about what is important to you. 2

day of the year. So don't make it the only time that you share these feelings with each other. 4

TAKE A GOOD LOOK AT YOUR RELATIONSHIP

If Valentine’s Day means that much to you, it may be a sign that you need to prioritise things like date nights and finding a little more one-on-one time together. When we are in a relationship it can be easy to become complacent or distracted by our busy lives. This may be the warning sign you need to place more importance on your love for each other.

This could be a wake up call for your relationship. Do you have different ideas on how to show your love for one another, or could you be drifting apart? Perhaps you believed the relationship to be more serious than it was? Once aired and addressed, issues can usually be resolved. In some cases, though, it can indicate something deeper is amiss. So take a good look at where you stand in your relationship and if you have real concerns, perhaps it’s time for some couples therapy. 3

DATE NIGHT IS RIGHT

5

DON’T GIVE UP ON LOVE

IT IS ONLY ONE DAY OF THE YEAR

OK, so even if Valentine’s Day is a bit of a dud, do not give up on love or be overly negative. You can work through most misunderstandings and make changes to your relationship. As long as you are looking after yourself all will be OK, as self-love and care is the foundation for any successful relationship.

A happy couple celebrate their love every day. So while Valentine’s Day can be a special day and a wonderful way of showing how much you care for each other, it is only one

Fi Retrerastt o 2019 f

TheThe Relationship Relationship Expert Expert

MAY 24 TH 20

19

Join Melissa Ferrari for An Insightful and Inspirational Small Group Couples Weekend the gorgeous 2019 isRetreat fully atinatgear now and I’m looking Crowne Plaza Hawkesbury Valley boutique hotel nestled forward with excitement to what this year will at the foothills of the Blue Mountains

Final Retr bring, not just for myself but for everyone.eat

Friday 26th October – Sunday 28th October 2018

2018

Let’s make it a habit make the most Visit my website for more details, to register andtoread reviews fromof each and every day. Take care of ourselves and those near and dear to us. the retreat attendees Couples: • 2 day program Enjoy more withCouple’s relationship Retreats education at new and exciting experiential venues learning in 2019. in And group if you’re and interstate or have time restraints, take advantage of our Couples Intensive. 1 to 1 private sessions Online therapy: I’m spacious certified and offer online therapy for both individuals • Private, exclusive spa accredited room for 2tonights and couples - you can book appointments directly on our updated website. • Buffet breakfast, morning tea, lunch & afternoon tea provided And of course, my regular media appearances will continue next year (as well as a few • Friday night new ones!), as dinner will my feast professional development. • Fine dining night at the Second Office:Saturday I’ll be working out of Harvest my new Restaurant second office two days a week located at Good inking Psychology - Shop 12, 191 Ramsay Street, Haberfield NSW 2045. • $100Thspa voucher

melissaferrari.com.au Connect with me on social media by searching ‘Melissa Ferrari’

30

roamingpanthermagazine.com.au

 02 4733 4094 or 0413 806 880  melissa@melissaferrari.com.au  Suite 11, 20-24 Castlereagh St, Penrith

Melissa Ferrari

Psychotherapist

Melissa Ferrari is one of Australia’s most sought-after therapists who possesses over 20 years’ experience in couples counselling and individual therapy, and is regularly Psychotherapist called upon as a relationship expert across national media.

Melissa Ferrari

IHaving welcome couples to participate dedicated herself to a life of in this retreat. e program will learning, Melissa uses Th a range of proven approaches in her practice to help couples guide you both through explorative heal and reconnect. A Clinical engagement together to leadMember you to of the Australian College of Relationship a secure-functioning relationship thatfew is Counsellors, Melissa is also one of the truly mutual, faircountry and collaborative and therapists in the to have received training from the world’s most renowned a relationship enlightened with the pioneer couples counselling, Dr Stan higherinexpectations we all wish to Tatkin, founder of the PACT achieve with our chosen life partner. Training Institute.


Jewellery

OLD IS GOLD

Remodelling or resetting your jewellery will create a gift that's a cut above your average bouquet.

Reinventing Valentine's T Day Written by Doug Ely, York Jewellers

he 14th of February lends itself to all manners of romance - which usually means an exchange of flowers, chocolates and gretting cards. But a sentimental few are taking a more meaningful approach to Valentine's Day with custom-made gifts of love that last forever. Dazzling with ingenuity, restored and remodelled jewellery is the ultimate symbol of enduring love. LOVE IN ALL ITS FORMER GLORY Often it's the simplest gift ideas that have the ability to move our loved ones the most. We've all heard the adage "old is gold". It's why our transformed heirloom, vintage and other sentimental pieces of jewellery make for an everlasting way to show love this year. If a beloved piece has lost its lustre or no longer suits your personal style, you have yourself a golden opportunity. There are plenty of ways to modernise a design or restore something to its original beauty. Consider melting down metals to have the piece reset. Consolidating heirlooms to create something different is another way to add meaning to an otherwise consumer-driven holiday. You’ll invoke

fond memories by turning a family ring into a lovely locket. Or perhaps you could adorn your partner or spouse with a beautiful new pair of earrings made with some of their gemstone and diamond bequests. LIVING FOR THOSE SPECIAL MOMENTS It should come as no surprise that, as head jeweller, I'm a true romantic at heart. It’s why all of our custom pieces are crafted with such poise and passion. While you could argue every day should be treated as if it were Valentine’s Day, it isn’t exactly the most practical mantra to live by. Life happens, routine ensues, and it’s days like these that remind us of our spousal or partner-ly duties. Sometimes all it takes is a hallmark occasion to reignite the flame with our better half. Don’t let those poignant moments in life slip away. We, at York Jewellers, are here to help you embrace this romantic occasion.

EMBRACE VALENTINE'S DAY AT YORK JEWELLERS  Westfield Penrith, Shop 51A/585 High St, Penrith NSW 2750  02 4721 0780  yorkjewellers.com.au

An analysis of our current situation [by Clear Path Accounting] has led to proactive changes…we value their role as an innovative business advisor who always responds promptly to our enquiries. Tom & Asha Dooley - Grace Funerals, Emu Plains

Our mission is to empower you with clarity and direction to build your perfect business We share relevant solutions, provide outstanding support and inspire positive change. We strive to unlock the full potential of your business and we will help you take control and accelerate results to achieve your goals. We will bring clarity and simplicity to the accounting and financial side of your business. We price our services upfront, which means no surprise accounting fees for you. Business Advisory Accounting Taxation Bookkeeping Self-Managed Super Funds

Contact us now to find out more!

clearpathaccounting.com.au

 02 4739 2700  Suite 1, 13 Hope Street, Blaxland NSW 2774

Issue 24 February 2019

31


Legal

Local Expert

Business Secrets

Joseph Grassi Legal Expert Joseph Grassi + Associates

WITHIN YOUR BUSINESS

A restraint of trade clause is meant to prevent employees from working for a competitor or a client after they leave your company.

The case involved an employee who stopped working for a supplier (Quantum) to work for a client (Schenker). The employee had worked on site with the client for many months. Interestingly, the supplier and the client also had a service agreement which prevented employees of either party taking up employment with the other.

T

In an interim judgment, Justice Robb ordered that the employee of Quantum be restrained from working for Schenker because, at the preliminary stage of the hearing, the restraints of trade were reasonable and intended to protect the legitimate commercial interests of Quantum: the protection of confidential information.

hese clauses are common in employment contracts but section 4 of the Restraints of Trade Act 1976 (NSW), says that restraints of trade are invalid if they are “against public policy”. It is a principle of law that all restraint of trade clauses are against public policy unless: • They are reasonable geographically; • They cover a reasonable time period; and • The enforcer has a “legitimate commercial interest” being protected by the clause.

Justice Robb has reserved his final judgment for a final hearing and to allow the parties to prepare their cases properly. This highlights important concerns for businesses working on their employment contracts. 1 If your business has trade secrets or confidential information (which all businesses do!), you need to ensure

A recent case, Quantum Service and Logistics Pty Limited v Schenker Australia Pty Limited [2019] NSWSC 2, covered restraint of trade provisions.

your employment contracts are properly drafted to protect your secrets and information. 2 Restraint of trade clauses need to be reasonable (by limiting geographical scope and restraint periods) and must protect a legitimate commercial interest. It is not reasonable to stop employees from taking up employment with a competitor for no genuine commercial reason. 3 Act quickly. Enforcing a restraint before your employees take up new roles elsewhere gives you more options in ensuring the restraints are properly enforced. 4 Review your existing employment contracts and ensure that employees who possess confidential information, trade secrets or any other information vital to your business have adequate restraint provisions in their contract.

Although restraint of trade clauses are meant to be unenforceable by a Court, a properly drafted restraint of trade clause is a simple and cost-effective way to protect the commercial interests of your business.

EXPERIENCE & RELIABILITY Personal Legal Services • Property and Conveyancing • Wills, Probate & Administration • Estate Planning

• Asset Protection Planning & Implementation • Notarial Services

Commercial Legal Services • Planning & Environment Law • Commercial Advice • Corporate Law & Governance • Business Law • Employment & Industrial Law

• Retail, Commercial & Industrial Leasing • OH&S Law • Debt Recovery, Bankruptcy & Insolvency Law

• Intellectual Property

Solicitor Director: Joseph M Grassi Dip Law (SAB) LLM Accredited Specialist Property Law Notary Public Solicitor: Grant Wiblin LLB, BSocSc, GDipLegalPrac Licensed Conveyancer: Wendy Harvey | Office Manager: Lois Grassi | Administration: Emily Beal

 Suite 1, 86 Henry Street, Penrith 2750  info@grassiassociates.com.au

 4702 5905 32

roamingpanthermagazine.com.au

www.grassiassociates.com.au

This article is for general information only and is not intended as legal advice. If you need specific help, contact your solicitor.

KEEPING YOUR


Education

ST PAUL'S GRAMMAR SCHOOL

Preparing Children for a Global Future Roaming spoke to Antony Mayrhofer, Director of Learning Services, about all things HSC and IB, and what this means for students. 1 TELL US ABOUT YOUR EXPERIENCE IN

THE INTERNATIONAL BACCALAUREATE (IB) DIPLOMA AND THE HIGHER SCHOOL CERTIFICATE (HSC). At St Paul’s, I have predominantly taught Biology in the HSC and IB Diploma. More recently I have been teaching Theory of Knowledge in the IB Diploma, which is a critical thinking course investigating the nature of knowledge. I also facilitate teacher training courses and conduct school visits for the IB organisation throughout the Asia Pacific region. These provide valuable insight into the outstanding teaching practice in other schools, so we can then incorporate best practice into the way we manage learning at St Paul’s. I have been a member of Curriculum Committees that wrote Senior Biology courses for the NSW HSC and IB Diploma courses. I have also supervised examiners and been a member of writing teams that prepared final IB Biology examinations, sat by students around the world. 2 HOW DOES ST PAUL’S HELP STUDENTS

EXCEL IN THEIR ACADEMIC STUDIES AND SUBJECT AREAS? St Paul’s has outstanding teachers who are specialists in the areas that they teach. Many are examiners or members

of Curriculum Committees for the NSW Educational Standards Authority (NESA) or the IB. Teachers are led by an extraordinarily gifted team of Heads of each faculty, who guide and challenge the teachers to provide the best possible classroom experience for students on a day-to-day basis. 3 HOW DOES ST PAUL’S SUPPORT STUDENTS

IN CHOOSING THE BEST COURSE OF STUDY FOR THEIR CAREER PATH? At St Paul’s we spend more than six months working with students and their families to ensure that they understand the requirements of the different curricular offered in Years 11 and 12. Few schools offer the wide range of subject choice between the HSC and IB Diploma that is available at St Paul’s. We facilitate a student and parent information evening where Year 11 and 12 teachers can meet students and families to discuss the study pathways that are available. The Head of Students and Family Services, Mr Philip Heath, and I then meet with each Year 10 student and their parents to discuss course and subject selections that compliment the student’s plans for their future career. Finally, we construct the Secondary School timetable to ensure that the maximum number of students receive their course and subject preferences. 4 WHAT ARE THE MAIN POINTS OF DIFFERENCE

BETWEEN THE HSC AND IB CREDENTIAL? The HSC was designed to prepare students for all possible post school options. As a result, it is an extremely flexible

St Paul’s has outstanding teachers who are specialists in the areas that they teach

course of study, enabling students to specialise in a specific area through subject choice and the ability to refine those choices upon entry to Year 12. The subject choices of our HSC students are very diverse, with some taking on extension subjects in English, Mathematics, Science, History or Music, as they focus on specific areas of interest. Other students study vocational courses as part of their HSC programme. Assessment in the HSC is divided equally between school-based assessment and final external examination. The University Admissions Centre (UAC) ranks HSC students each year to produce the Australian Tertiary Admissions Rank (ATAR). The IB Diploma was designed as a pre-university course, focussing specifically on developing the critical and creative thinking skills as well as research experience that is essential for success at university. Many IB Diploma courses have similarities to HSC extension courses. The IB curriculum is not as flexible as the HSC, with a requirement to study English Literature, a second Language, a Humanities subject, Science and Mathematics. Students may also choose to study an Arts subject. In addition, students must study Theory of Knowledge, write a 4,000 word research essay in an IB subject area, and complete Community Service and Physical Activity. IB Diploma assessment includes school-based work but is much more strongly weighted towards the final external examination in Year 12. IB Diploma results are converted to an ATAR equivalent.

FIND OUT MORE ABOUT ST PAUL'S    

52 Taylor Road, Cranebook NSW 2749 02 4777 4888 info@stpauls.nsw.edu.au stpauls.nsw.edu.au

Issue 24 February 2019

33


OOL

2020 Scholarships at St Paul’s PMS 294 C

PMS 362 C

PMS 3935 C

C100 M69 Y7 K30

C78 M0 Y100 K2

C2 M0 Y60 K0

R0 G47 B108

R80 G158 B47

R243 G234 B93

Each year, St Paul’s Grammar School offers a limited number of scholarships to students entering Years 5, 7, 9 and 11, encouraging excellence and nurturing potential across the curriculum.

APPLICATIONS FOR ALL SCHOLARSHIPS CLOSING SOON!

Academic Scholarships

All-Rounder Scholarships

Performing Arts Scholarships

Are awarded to students on the basis of their ACER exam results and at the Principal’s discretion. All applicants must sit for the scholarship test in February.

Are available to students with significant ability in areas such as academic, performing arts, debating and/or public speaking, sport, and leadership.

Are available to students of exceptional achievement in music, dance or drama as well as excellence in academic studies.

Christian Congregational Scholarships Are offered to students with a developing understanding of the Christian faith and actively involved in a Christian Church.

The Don Harwin Scholarship Is offered to a new student who is able to demonstrate outstanding service and citizenship in their current school, church and community.

FOR MORE INFORMATION PLEASE SEE OUR WEBSITE FOR FULL DETAILS & APPLICATION FORMS

Ou

Co

The S of two the St wordm

Both visual mode that p


St Paul’s 2018 Duces

Congratulations On Your Outstanding Results

Our Crest

Our Crest

Our Crest

The St Paul’s crest represents the centrality of the cross to the Christian faith and thus mission of our school; profiled by the rising sun symbolising our hope and future in Christ. The crest is made up of the central logo with the name and motto of the school around the diameter.

The St Paul’s crest represents the centrality of the cross to the Christian faith and thus mission of our school; profiled by the rising sun symbolising our hope and future in Christ. The crest is made up of the central logo with the name and motto of the school around the diameter.

The St Paul’s crest represents the centrality of the cross to the Christian faith and thus mission of our school; profiled by the rising sun symbolising our hope and future in Christ. The crest is made up of the central logo with the name and motto of the school around the diameter.

The logo should not be redrawn, digitally manipulated or altered. No rescaling of the horizontal or vertical proportions should occur.

The logo should not be redrawn, digitally manipulated or altered. No rescaling of the horizontal or vertical proportions should occur.

The logo should not be redrawn, digitally manipulated or altered. No rescaling of the horizontal or vertical proportions should occur.

Design & Colour

Design & Colour

JO

Colours: Pantone, CMYK and RGB versions of the St Paul’s School crest have been created. The colour values are:

INT

0 IB DUX 2

18

PMS 294 C

PMS 362 C

PMS 3935 C

C100 M69 Y7 K30

C78 M0 Y100 K2

C2 M0 Y60 K0

R0 G47 B108

R80 G158 B47

R243 G234 B93

Emma Bryant

Colour Reverse White reverse / CMYK crest should be reversed out of St Paul’s Blue - PMS541

99.40 42 IB SCORE

ATAR

Mono / Mono Reverse To be used when appropriate for non colour reproduction (forms, reversed out of photographic background) or when colour isn’t available.

BRAND IDENTITY 2016

(Out of a possible 45)

ST PAUL’S GRAMMAR SCHOOL

JO

Colours: Pantone, CMYK and RGB versions of the St Paul’s School crest have been created. The colour values are:

INT

0 IB DUX 2

18

PMS 294 C

PMS 362 C

PMS 3935 C

C100 M69 Y7 K30

C78 M0 Y100 K2

C2 M0 Y60 K0

R0 G47 B108

R80 G158 B47

R243 G234 B93 been created. The colour values are:

Isabelle Duffy

Colour Reverse White reverse / CMYK crest should be reversed out of St Paul’s Blue - PMS541

99.40 42 IB SCORE

ATAR

Mono / Mono Reverse To be used when appropriate for non colour reproduction (forms, reversed out of photographic background) or when colour isn’t available.

ur Logotype PAGE 4

Design & Colour

PAGE 4

BRAND IDENTITY 2016

(Out of a possible 45)

ST PAUL’S GRAMMAR SCHOOL

HS

Colours: Pantone, CMYK and RGB versions of the St Paul’s School crest have

C DUX 2018

PMS 294 C

PMS 362 C

PMS 3935 C

C100 M69 Y7 K30

C78 M0 Y100 K2

C2 M0 Y60 K0

R0 G47 B108

R80 G158 B47

R243 G234 B93

Matthew Seckold

Colour Reverse White reverse / CMYK crest should be reversed out of St Paul’s Blue - PMS541

92.10 ATAR

Mono / Mono Reverse To be used when appropriate for non colour reproduction (forms, reversed out of photographic background) or when colour isn’t available.

PAGE 4

BRAND IDENTITY 2016

ST PAUL’S GRAMMAR SCHOOL

RESIDENCE Glenbrook

RESIDENCE Glenbrook

RESIDENCE Kurmond

CO-CURRICULAR Debating, Wrapt with Love, Junior School Reading Program, DOE Gold, and Cambodia Service Trip

CO-CURRICULAR Piano

CO-CURRICULAR Cricket, Debating and Soccer

PLANS FOR 2019 & BEYOND Studying Law and Bachelor of Arts, majoring in Environmental Studies at ANU or UNSW. Emma also hopes to study abroad during university.

PLANS FOR 2019 & BEYOND Studying a Bachelor of Design in Animation at University of Technology Primary Logotype Sydney (UTS), with the goal of Horizontal animating for feature films.

PLANS FOR 2019 & BEYOND Studying either Psychology or Commerce at University.

onfiguration

St Paul’s logotype consists o elements: the logo and t Paul’s Grammar School mark.

elements been p. 02have 4777 4888 e. enrol@stpauls.nsw.edu.au lly combined to create a w. stpauls.nsw.edu.au ern identity for St Paul’s profiles the name of the

*All students scores are accurate at the time of publishing


Pets

The Power of Purring

Local Vet

Dr Erin Short VETERINARIAN Greencross Vets Coreen Avenue

Purring has many more powerful properties than just displaying pleasure

P

urring is one of the most endearing and unique qualities of domestic cats. It is often reported that only domestic cats purr, but this is not correct.

All cats belong to the Felidae family, consisting of two subfamilies; the Pantherinea and Felinae. The Pantherinae subfamily contains the big cats including the tiger, lion, leopard and jaguar and they have evolved to roar. They can purr when exhaling, but the vocal cords are used for roaring and cannot be used for a true constant purr. The Felinae subfamily contains cats that vary from the domestic cat, lynx, and ocelot up to the puma and cheetah. These cats produce the constant purr we hear from our domestic cats. Purring is normally regarded as a sign of a pleasure or being content, however cats will also purr when they

are stressed or in pain. Kittens can purr before they open their eyes. It has been suggested that purring may have evolved as a means of communication that cannot be heard by predators. There is still confusion about exactly how a cat purrs. The purr is made up of both noise and vibration. It is believed that the frequency of vibration that occurs when a cat purrs may have not only calming effects, but also healing qualities. Purring during birth may reduce the pain and help with post partum healing. Several studies on the effects of purring have shown a reduction in stress and a positive effect on wound and bone healing. Purring has also been shown to reduce stress and blood pressure in humans.

It is believed that the frequency of vibration that occurs when a cat purrs may have not only calming effects, but also healing qualities.

Same Great Team, Same Great Service We’ve changed our name! Coreen Avenue Vets have changed names to Greencross Vets Coreen Avenue

Quality Loving Care

But we’re still the place where every pet has the opportunity to be loved, cared for and recognised as a priority. Every pet entering the practice becomes an integral part of our family unit.

Unit 2 & 3/117 Coreen Ave Penrith, NSW, 2750

 02 4731 3055 36

roamingpanthermagazine.com.au

 www.greencrossvet.com.au


Property

Local Expert Paul Merrick

NEW YEARS

Property Expert Merrick Property Group

Property Resolution F OR F I R ST H OME B UY E R S !

Is 2019 going to be your year?

S

o, your New Years resolution is to buy your first home. The good news is that right now is a great time for first home buyers to get on the property ladder, with prices cooling in the last quarter of 2018 and stamp duty savings of up to $26,857 on offer! Here are my five steps to help get your resolution underway. STEP 1 Talk to a mortgage broker or your bank to see if you can get a mortgage and, if so, how much the bank is likely to lend you. This means you know your budget and can go house-hunting with confidence. Looking at properties out of your price range can be disheartening, so keep focused on what your money will buy you. Take into consideration extra expenses too, such as council and water rates, and insurances.

STEP 2 Work out what suburbs you would like to live in and see what types of properties are available within your budget. Remember - it’s free to look, so don’t narrow your search too much in the early stages but do stick as close as possible to your budget. STEP 3 Do your research - knowledge is power. Get to know the ‘sold’ section of realestate.com and domain.com and you’ll soon have a wealth of market knowledge. Be wary of websites that give online valuations of what a property may be worth, though, as they can be wildly inaccurate. STEP 4 Once you have your finance ready and obtained a newfound level of real estate market knowledge, you’re ready to buy! Make contact with a solicitor or conveyancer so you have them ready to go to review

any contracts on properties you’re considering buying. You should also ask the selling agent on the property if there are any specific disclosures or issues with the property that they are aware of, as they must tell you this information. STEP 5 Once you have found your dream first home (not your forever home - there will be compromise), move quickly to negotiate a price both you and the seller are happy with and have a 0.25% deposit ready to take the property off the market. This will give you a cooling off period so you can arrange pest and building inspections and a valuation. Your broker and solicitor/ conveyancer will generally help with this. At the end of the cooling off period, if you’re happy to proceed with your purchase you will need to pay the balance of the agreed deposit (usually 5% to 10%). Then you’re ready to put the SOLD sticker on the sign and your New Years resolution is achieved. :-) CONGRATULATIONS!

Specialising in the Sale of Quality Residential and Acreage Properties

14 YEARS O F LO CAL REAL ES E X P E R TAT E IE N C E

Established by Paul Merrick, one of the leading and most trusted agents in the Nepean Valley and Lower Mountains for over a decade, the company has been founded with a vision to give clients the value and service that they rightfully deserve, delivered with honesty, professionalism and integrity. With access to exceptional marketing material, a vast network of clients and contacts and intimate local knowledge that comes from living in this community for over 40 years, we are here to help and offer a completely refreshing approach to ensure your next big move in life is a great one! Experienced Local Boutique Agency

Customised Sales Campaigns Designed To Suit You And Property

Innovative Video & Social Media Marketing Paul Merrick

Office. 02 4760 0812 Mobile. 0404 599 146 Email. merrick@merrickpropertygroup.com.au Address. PO Box 1825 Penrith BC, PENRITH NSW 2751

merrickpropertygroup.com.au Issue 24 February 2019

37


Lending

Refinance Your Home Loan HOW TO

Local Expert Peita Davies

Home Loan Specialist realestate.com.au Home Loans Penrith

TO BUY AN INVESTMENT PROPERTY

If you’re looking to buy an investment property and have equity in your own home, refinancing your home loan could be the best way to fund your purchase. Here’s how it works. WHY REFINANCE YOUR EXISTING HOME LOAN? Usually, when you take out a home loan to buy any property, you need to have a deposit. By refinancing your existing home loan, you may be able to avoid having to save this deposit. That’s because many lenders will let you use the equity in your home in place of a deposit. For instance, if your home is worth $1,000,000 and you owe $425,000 on your home loan, you have $575,000 in equity. A lender may let you use a portion of this as security against your investment property.

HOW MUCH OF YOUR EQUITY CAN YOU USE WHEN YOU REFINANCE? When you refinance you can generally borrow up to 80% of the value of your home and sometimes up to 95% with lender’s mortgage insurance. That means in the above scenario, a lender may let you use $225,000 towards the purchase of your new home, even without lender’s mortgage insurance. That’s your $425,000 equity minus a 20% buffer of $200,000.

you take out – including any fees – rather than simply choosing the loan with the lowest headline interest rate. You should also make sure that any new home loan continues to offer you any features you need, such as offset accounts or redraw facilities.

This $225,000, in turn, could be used towards the purchase of an investment property. SHOPPING AROUND TO REFINANCE When you refinance your home loan to buy an investment property you’ll have the choice of staying with your existing lender or switching to a new lender altogether. Before you decide, it’s always worth shopping around to see what the best deals are. When you do, make sure you take into account the true cost of any loan

Looking to refinance?

Peita Davies Local home loan specialist 0452 214 202 @peita.davies.realestatehls Peita.davies@realestatehls.com.au 1B Castlereagh St, Penrith NSW 2750 Peita Davies is a credit representative (399445) of BLSSA Pty Ltd ACN 117 651 760 (Australian Credit Licence 391237)

38

roamingpanthermagazine.com.au


Digital

Life & Business

Local Expert Trish Fehon Digital Expert Online Influence

WITHOUT THE INTERNET

What if Ralph really did break the internet?

F

• I’d visit my friends, not their Facebook page. • I’d get the weather forecast from the radio or TV. Am I less busy doing all this online? I don’t think so.

or those without young kids, Ralph Breaks the Internet is a Disney animation in which two arcade game characters travel through a modem into the bright, glitzy internet where Ralph wreaks havoc.

And I’ve realised plenty of businesses still operate offline and thrive. Here’s a reminder of how to get potential customers to “know, like and trust” you in the real world.

Which made me think – what would I do if that havoc was real and long-lasting? Of course, I only had to look back to life before the world wide web for the answer.

• Join a networking group and introduce yourself to people who need your services.

• I’d get my information from books, at a conference or by calling an expert.

• Hand out your business card – a lot.

• I’d shop in a real store with no shipping or slow boats from overseas. • I’d subscribe to a magazine and newspapers, and pick up free local newspapers. • I’d pay bills in person, over the phone or visit the branch and set up a direct debit. • I’d use the white and yellow pages.

• Put up flyers in places your target audiences are. • Earn repeat business and referrals with exceptional service and reliability. • Keep your overheads low. So yes, it is possible to live and run a business without the internet, but would I really want to? Despite knowing that online searches and social media soak up a lot of time, and that I want and

spend way more thanks to online shopping, the internet really does enrich my life and enhance my business success. So, please Ralph, be careful.

It is possible to live and run a business without the internet, but would I really want to? WANT TO KNOW MORE? The friendly team at Online Influence can help your business harness the positives of the internet. Contact us on 02 4724 9555 to find out how we can help your business today.

Online Influence Penrith can help you with all your online marketing needs Website Design and Development Google Advertising Facebook Advertising

ONLINE INFLUENCE HPH AD

Email Marketing campaigns Search Engine Optimisation (SEO) E-commerce (Shopping carts)

Online Influence is a Google Partner, a Facebook Ad agency and a boutique Web development company that specialises in helping you get leads and sales from your website.

www.Onlineinfluence.com.au

0247 249 555 Level 1, 331 High Street, Penrith NSW 2750 Specialized in:

Search ads

Issue 24 February 2019

39


Puzzles

Puzzle Time

If you enjoy crossword puzzles, word ďŹ nds, anagrams or trivia quizzes, you’re going to love our Puzzles section! Just make sure you grab it before anyone else does...

Crossword ACROSS 8 Most intimate (6) 9 Former St. George Dragons pro rugby hooker and national captain (3,5) 10 ‘Iron Gloves’, Test wicketkeeper (3,5) 11 Sort of (2,1,3) 12 Gun butts (6) 13 What you usually see in a mirror (8)







14 18 21 23 24 25 26

Rare Queensland spider-eating ying mammal (6-6,3) Patriotic (4,4) Refuse to accept (6) Deadeye Annie (6) For the few (8) Ghastly (8) SA leader --- Marshall (6)

7 15 16 17 19 20 22

East Mediterranean democracy (6) Inhabitants (8) Playful dolphin relative (8) Place for old documents (8) Grounds (6) Give the pink slip (3,3) Bullying seabird (6)





















DOWN 1 Not too many (3,2,3) 2 Vast (6) 3 Gets cracking (6,2) 4 Long NW Australian coastal strip (6,4,5) 5 Instead (2,4) 6 Worried (8)



























Sudoku

A logic-based, number-placement puzzle. The objective is to ďŹ ll the 9Ă—9 grid with digits in such a way that each column, each row, and each of the nine 3Ă—3 grids that make up the larger 9Ă—9 grid contains all of the digits from 1 to 9. Note that no number from 1 to 9 can be repeated in any row or column. Good luck!

CROSSWORD

roamingpanthermagazine.com.au

Across: 8 Inmost, 9 Ian Walsh, 10 Rod Marsh, 11 In a way, 12 Stocks, 13 Yourself, 14 Goldentipped bat, 18 True blue, 21 Reject, 23 Oakley, 24 Esoteric, 25 HorriďŹ c, 26 Steven.

40

Down: 1 One or two, 2 Cosmic, 3 Starts in, 4 Eighty Mile Beach, 5 In lieu, 6 Harassed, 7 Israel, 15 Dwellers, 16 Porpoise, 17 Archives, 19 Reason, 20 Lay off, 22 Jaeger.



SUDOKU



        



        





    

        

 

        



        



        





Don’t be sneaky and peek at the answers before you’re done - give the puzzles a good hard crack!

        

 



        



 

        

 

ANSWERS


Kids Puzzles

Kids Korner

We exercise our bodies - now let’s exercise our brains! Stretch your mind with these word finder puzzles and see how many you can find.

3 7 + / $ : , 6 ( 2 / ' 2 : /

4 ( 8 5 5 . ) . 1 3 5 , $ ( ,

( . 2 ( 6 6 2 2 9 2 4 2 & 7

8 & * / & : = 2 ; 4 6 ' : , 7

/ 2 + , : ; 5 5 < < ( / 2 0 /

% / 7 $ < 0 ( 8 5 3 6 , 5 ' (

5 < / 7 $ 5 . % 2 ( $ + 5 1 %

( & & 5 0 ( $ $ 1 7 5 & 2 , 2

' 8 < ( 1 % & ' $ ( ( 6 6 / 3

1 / = . , 4 $ 8 . 5 5 < 5 % (

( 4 / 1 6 3 7 % & 3 ( $ 2 ( (

9 3 * , 7 3 $ ' $ , ' ' ) ( 3

$ 2 = 7 8 % 3 8 3 5 1 ( 5 ;

/ ; ' * 1 * * % 5 ( 5 2 1 + ;

% < 2 % < / / , % 5 . 0 2 7 =

Summer Time >>> Finder Word Allergy

Flower

Outdoor

Summer

Ant

Frisbee

Parasol

Sun

BBQ

Frolic

Patio

Surf

Beach

Heat

Pier

Swim

Bloom

Hike

Pool

Tan

Boat

Hot

Punch

Tent

Casual

Humid

Roast

Trips

Clear

Kite

Rose

T-shirt

Daisy

Lawn

Salad

Walk

Easy

Lazy

Sand

Warm

Fair

Light

Sea

Wasp

Fans

Ocean

Shade

Waves

<<< Nursery Rhyme Finder Word A Wise Old Owl

Little Bo Peep

Peter Piper

Billy Boy

Lucy Locket

Poor Mary

Bingo

Mondays Child

Roses are Red

Foxys Hole

Nuts in May

Rub-a-Dub Dub

Jack-a-Nory

One for Sorrow

Three Blind Mice

Lavender Blue

Pat-a-Cake

Tinker Tailor

$ + & 1 8 3 9 5 $ ( / & 2 0

. / $ : $ 5 + < & ' $ / $ : 1

) 5 , 6 % ( ( 6 7 6 $ 2 5 6 '

7 ' 0 3 ( 6 8 , 8 1 7 ' = , 4

2 1 % , 2 5 ( $ 3 7 $ $ 0 % 0

8 ) ( 5 ) 1 / ' 3 / 6 8 % 2 ,

7 / $ 7 . ) 8 % $ + + + $ :

' 2 & 3 $ 5 $ 6 2 / $ 0 , 7 6

2 : + 0 2 2 / % ) + ' 5 5 5 :

2 ( < . & / ( < * 5 ( / / $ 7

5 5 , = ( , 2 / 9 0 : $ 9 ) :

1 7 9 6 $ & ( 2 0 6 $ ( 7 $ 9

( $ < * 1 / $ 8 3 $ 6 ( . , +

2 , 7 $ 3 % 6 ( 6 1 3 0 6 5 =

& / ) $ 1 6 < < 4 ' / , * + 7

Issue 24 February 2019

41


Horoscopes

Horoscopes By Sherrynne Dalby

Aquarius

(20 JAN – 19 FEB)

Ruling Planet: Saturn / Uranus Sign:

The Water Bearer

Gemstones:

Aquamarine

Colours:

Aquamarine, turquoise, electric blue

Day:

Saturday

Number:

Four

This is your annual time for renewal - Happy Solar return Aquarius! The saying ‘Many Happy Returns’ is a reference to the sun returning each year to the same area in the sky that it was at the time of birth. For Aquarius this year, that is from 20 January until 19 February and covering all those born under the sign of the Water bearer, the coming month will give you a snapshot of the year ahead. Pay attention to what is going on around your birthday for clues. The year ahead will be very significant for you. There is a lunar eclipse affecting January birthdays; this eclipse shines a very bright light on relationships throughout 2019. This gives the opportunity to examine both what is good and not so good, and help you decide where you want to go. February birthdays can be doing some serious soul searching - not the belly-gazing kind but some real transformative thinking. You are both inspired and have direction in 2019. A rare combination; don’t waste it. Mid-February birthdays may need to do some creative budgeting and try not to spend more than you earn.

Scorpio (23 OCT – 22 NOV) Communications can go awry early February. Someone may be misinterpreting your intentions but the reaction can be intense. Try not to provoke arguments and keep a cool head, especially in work situations. There can be changes around the home or even a new family member, especially for birthdays around the sixth. Early February provides opportunities and there can be a little extra money as finances improve. You are feeling more creative and playful later in the month. This can flow into relationships and you may find it easier to express yourself at this time than you normally do.

42

roamingpanthermagazine.com.au

Pisces (19 FEB – 21 MAR)

Aries (21 MAR – 20 APR)

February born Pisces are doing some serious thinking about a relationship - it could be time to take action on something. Early March birthdays can be feeling confused about a decision that could impact your future. Don’t decide anything until you have a clear head and see a positive solution. Overall this can be a time for turning your creative urges into something more concrete. You are laying the groundwork and, even if you doubt the outcome, have faith in yourself and give yourself time. Rome wasn’t built in a day and anything worth having takes time. Patience grasshopper.

The new year is already kicking along at a rapid pace but be prepared for it to move up a notch during February. There can be positive moves where career matters are concerned, although to begin with there can be some fairly intense energy. Try to avoid arguments or power struggles in the work place. They are always counter productive. At the moment you should be relying on your individuality and independence rather than comparison. Friends and work colleagues can be a source of support and may provide new contacts that will ultimately prove beneficial.

Taurus (20 APR – 21 MAY)

Gemini (21 MAY – 21 JUN)

New beginnings or new opportunities are favoured under the current energy. You will find your worries are for nothing as the issue will resolve itself. You should feel increasing energy levels from Valentines Day onward. You can feel a little emotional at times and passions can run high later in February. Planning a holiday can be beneficial in the long term, but in the meantime you may find planning a romantic getaway helpful for the short term. Even just escaping through your own imagination can be of benefit when you find things are getting too much.

This can be the ideal time to begin a new course of learning. This can take many forms, not necessarily restricted to the classroom types of learning. It can be the opportunity to open your mind to a different way of thinking, a differing world view. Later in the month will see your focus shifting to career matters. You may feel some conflict or confusion over your current direction and the impact it is having on your relationships and home life. Now is not the time to shut down and go into hiding. It is time for communication, so talk it out.

Cancer (21 JUN – 23 JUL) Partners will be playing a larger role at the moment. You may be looking to make a commitment or at least take relationships more seriously. Career matters can be a little topsy turvey early in the month. Try to keep a cool head, even when it’s difficult, and don’t allow external events to trigger internal responses. Maintain control of yourself as you can’t control others. Later in the month find some time to relax and catch up with friends and loved ones. Pushing yourself too hard will only result in burnout. Stop and enjoy your life.

Virgo (23 AUG – 23 SEP) This can be a great time for starting a new fitness and health regime. Whether you are looking to lose weight or just improve general health and fitness, you should find anything you begin now has a greater chance of success than previous attempts. Back yourself and have faith that you can succeed. Later in the month relationships take more time and energy. You can allow romantic feelings to override common sense. So it is important to be aware of your own feelings in any situation and don’t commit to anything that doesn’t feel right.

Sagittarius (22 NOV – 22 DEC) Try to keep a lid on spending, as you may find an unexpected expense mid-month. There can be issues around a child or children early February that will not be fully resolved until mid-month. You can be feeling pressure around home and family that may affect your work situation. This is unintentional and trying to put things into a different perspective might help. Although it may be difficult, finding a way to relax will be of great benefit. Likewise, finding an outlet to blow off steam - preferably involving some form of intense physical activity - can really help.

Leo (23 JUL – 23 AUG) February sees an increase in action where relationships are concerned. You should be feeling quite light-hearted and playful. You can also find you are more expressive when it comes to loved ones. You find the right words come more easily at the moment. Your day-to-day routine may have been a bit of a drudge of late, but February should see a little more brightness creeping into your days. You sometimes need to take the initiative and bring that light in yourself. Do something positive to brighten up your surroundings, both at home and work.

Libra (23 SEP – 23 OCT) Plenty of action on the home front. Looks like some home improvements are on the cards. This doesn’t mean a knock down and rebuild - in fact, it can be as simple as a new coat of paint or some new linens for the bedroom. Whatever form it takes, you are looking to create harmony in your living conditions. You are feeling quite creative at the moment and are looking for an outlet for that energy. Remember, it doesn’t need to be on a huge scale or expensive. You can do a lot with cushions and prints. Relationships can be tense early month.

Capricorn (22 DEC – 20 JAN) A a former Prime Minister famously once said, ‘Life wasn’t meant to be easy’ but it also wasn’t meant to be this difficult. You are certainly taking the hard road at the moment. Time to take the pressure off and ease up on yourself. There may be unexpected repairs needed around the home, most likely electrical in nature. Call in a professional rather than trying to sort it yourself. You could find a little extra money at the moment. This will be hard earned, rather than manna from heaven, but will be welcome. Do something for yourself. Indulge a little.


SAVE THE DATE

SATURDAY 16TH MARCH

HIGH STREET, PENRITH 9AM – 3PM

ALL DAY ENTERTAINMENT

FOOD TRUCKS & MARKET STALLS

SPONSORSHIP AND STALLS AVAILABLE NOW STREET PARADE 12:30PM

ROAMING CHARACTERS

KIDS ACTIVITIES

FOR FESTIVAL ENQUIRIES, PLEASE CONTACT PENRITH CBD CORP 4722 5556 | admin@penrithcbdcorp.com.au Proudly Sponsored by:

activate • rejuvenate • populate


Romance by York Celebrating Lifeâ&#x20AC;&#x2122;s Special Moments

Profile for Penzance Publishing

Roaming Magazine Issue #24 February 2019  

Nepean's Lifestyle Magazine

Roaming Magazine Issue #24 February 2019  

Nepean's Lifestyle Magazine

Advertisement