Page 1

I S S UE 2 0 SE PT E M B E R 2 0 1 8

FREE TO YOUR

HOME MONTHLY

RUSSELL TUCKER Photo credit: Lauren Elyse Photography

M R M UM

Inspiring

HOW HIS FIERCE LOVE CARRIED THIS FAMILY THROUGH TRAGEDY

LOCAL DAD FE AT U RE

N E P E A N ’ S

L I F E S T Y L E

M A G A Z I N E


The Highest Standard in Concreting Services in Penrith & Blue Mountains LO CA LLY OWNED A N D O P E R AT E D, WIT H E XCE LL E N T WOR KM A N S HI P AT AFFO RDA B LE P RICE S

MENTION THIS AD AT TIME OF CONTACT FOR

FREE REMOVAL OF OLD DRIVEWAY

SEPT

E

OFFE R E B M

R

 slconcrete5@bigpond.com

 facebook.com/slconcretensw

WWW.SLCONCRETE.COM.AU


S ASK U R O T U ABOU

R SENIO T UN DISCO

CALL US NOW - 0411 704 302

SE RVICE S TAILO RE D TO S UIT YOU S L A B S | D R I V E WAY S | C O M M E R C I A L & I N D U S T R I A L | O S D TA N K | C U S T O M D E S I G N


OUTDOOR AWNING & BLINDS

Affordable, High Quality Home Improvement Solutions ROLLER SHUTTERS

CRIMSAFE SECURITY PRODUCTS

YOU CAN AFFORD FACTORY DIRECT PLANTATION SHUTTERS

ROLLER SHUTTERS

At GuardRight we are very different to our competitors. As different as an apple to an orange. That’s because we give you better service, price and product choice with real flexibility to suit your home. And that is why GuardRight is the right choice.

Roller Shutters  Crimsafe Security Products  Plantation Shutters - Blinds 

Our Premium Product Range Window Replacements - Magnetite  External Blinds & Awnings  Security Screens - Fly Screens  Window Films 

LOCALLY OWNED CRIME PREVENTION PARTNERS

AND OPERATED IN PENRITH

Come see us at Unit 4, 103-107 Batt Street, Penrith NSW 2750

CALL US 4721 8536 WWW.GUARDRIGHT.COM.AU  GuardRight Industries

SHUTTERS | SCREENS | DOORS


Welcome

Hi Readers, WELCOME TO SEPTEMBER ISSUE.

IN THI S

Spring is here! Apart from the gorgeous weather, Spring means outdoor entertaining and spring cleaning. For some, it’s also a time to start updating the home, so this month we’ve included a home improvement section to help. On that topic, I’d love to extend a warm welcome to Peita Davies from Realestate.com.au Home Loans. Peita will be writing for us on all topics relating to lending – and yes, she can also help finance those home improvements you’ve been wanting to do for so long! We have a familiar face this month with Jamie Oliver introducing his new cookbook, Jamie Cooks Italy. We just had to include the Amalfi Lemon Tart – it’s fresh but comforting at the same time. Be sure to give it a go – with one taste you’ll know exactly why this recipe had to make an appearance! Our main feature this month celebrates an incredible local dad, Russell Tucker. Russell and his wife Bec found out that Bec had breast cancer when she was 38 weeks pregnant. From there, find out how he juggled roles as carer, new dad and business owner while Bec undertook rigorous treatment.

FEATURED THIS MONTH 18

F  ood Jamie Cooks Italy Home Improvement

26

I nteriors Kmart Reveals New Season Living Range

Enjoy this issue.

Sam

Advertising Enquiries Samantha Foley  0431 281 689 samantha@ roamingpanthermagazine.com.au  @roamingpanthermagazine  @roamingpanthermagazine  www.roamingpanthermagazine. com.au

18

24 F eature

Their story is nothing short of inspiring. The thing we found mind-blowing is Russell’s humility; he genuinely doesn’t realise how amazing he is. And, given that the past few Father’s Days have been rough for the family, our friends at Panthers Penrith have been kind enough to gift the Tucker’s a $100 gift voucher for The Ming – enjoy guys!

PO Box 3106, East Blaxland, NSW 2774

24

Issue

26 >> OUR TEAM Publisher • Kimberley Kennedy kimberley@roamingpanthermagazine.com.au Editorial • editorial@roamingpanthermagazine.com.au Creative Director • Kwang Tran Manager • Samantha Foley samantha@roamingpanthermagazine.com.au Magazine Coordinator • Mel Bevan mel@roamingpanthermagazine.com.au Copy Editor • Melinda Leyshon, WriteCopy Journalist • Cassandra Elliott Images • iStock photos

>> REGULAR CONTRIBUTORS •M  elissa Ferrari, Counselling & Psychotherapy •M  elissa Browne, Accountant at A&TA & The Money Barre • Douglas Ely, York Jewellers •M  aria, Fellowes & Turner Travel Associates •S  haron Mudiman, Bespoke Realty Group • Marianne Arthur, Insignia Hair & Day Spa •P  eita Davies, realestate.com.au Home Loans Penrith • Trish Fehon, Online Influence • J oseph Grassi, Joseph Grassi & Associates •K  ris Caloia & Karl Thornton, Progressive Physiotherapy •E  rin Short, Greencross Vets, Coreen Avenue

• Sherrynne Dalby, Author of Star Parenting • Steve Jennings, Trivett Classic BMW Penrith >> WITH THANKS TO OUR CONTRIBUTORS FOR THIS ISSUE • Trent Merrin • Maria-Luisa Patisso, Facebook.com/ MySClifestyle • Luke Priddis Foundation • Jamie Cooks Italy – Penguin Random House • Manisha Foley - Penrith CBD Corp • F45 Training • Kmart Australia

Published by Penzance Publishing Pty Ltd ABN 18615296118. Printed by Fairfax Media 159 Bells Line of Road North Richmond NSW 2754 All prices and information are correct and to the best of the publisher’s knowledge at the time of print. Roaming Panther Magazine does not accept or assume responsibility for advertising material accepted. Comments and opinions of contributors do not necessarily reflect the opinion or view of the publishers or editor.

All reasonable efforts have been made to trace copyright owners. We recommend material such as dates, times and prices of a changing nature be confirmed with individual advertisers, contributors or persons and industry professionals in regard to advertising and editorial. Material in Roaming Panther Magazine is copyright © Penzance Publishing and may not be reproduced without the permission of the publisher. All rights reserved. Issue 20, September 2018

CREATING BEAUTIFUL HOMES Family owned with 20 years experience of quality and workmanship.

BLUE SKY SHUTTERS

Plantation Shutters, Roller Blinds, Panel Glides, Vertical Drapes, Dual Shades, Security Doors and Grilles, Fly Screens and Awnings.

Plantation Shutters Blinds Security Doors Awnings

CALL BLUE SKY SHUTTERS today for a free measure and quote on Office 02 4733 6214 or Peter 0414 706 142 Email blueskyshutters@gmail.com

Website www.blueskyshutters.com.au

Facebook Blue Sky Shutters

Issue 20 September 2018

5


Local Roaming LOCAL SHOWS

Get helpful step-by-step support from Australia’s Best Self-Employed Lender.

XYLOURIS WHITE

LENNON: THROUGH A GLASS ONION

HOW SWEET IT IS

21 SEPTEMBER BLUE MT THEATRE & HUB The visionary collaboration of Cretan lute player and vocalist George Xylouris and Aussie post-punk drummer Jim White (The Dirty Three), celebrate the release of their third album, Mother.

26 SEPTEMBER THE JOAN Frankie J Holden and Michelle Pettigrove, two of Australia’s best-known performers, tell their story of living and loving through songs, stories and a lot of laughs.

bluemountainstheatreandhub.com.au

thejoan.com.au

28 SEPTEMBER BLUE MOUNTAINS THEATRE & HUB Lennon: Through a Glass Onion is back in Australia following a sensational 16-week season in New York. The internationally-acclaimed theatrical event celebrating the genius, music and phenomenon of John Lennon, which we know and loved as LOOKING THROUGH A GLASS ONION, was re-produced and re-branded for its Off-Broadway debut at the Union Square Theatre. Created and performed by renowned Australian actor/musician John Waters and esteemed singer/ pianist Stewart D’Arrietta, Lennon: Through a Glass Onion is part-concert, part-biography. It features 31 iconic hits, including solo works such as ‘Imagine’, ‘Woman’, ‘Working Class Hero’, and ‘Jealous Guy’, as well as Lennon’s collaborations with Paul McCartney including ‘Strawberry Fields Forever’, ‘Revolution’, and ‘Lucy in the Sky with Diamonds’. bluemountainstheatreandhub.com.au

DESPERADO, THE EAGLES SHOW 29 SEPTEMBER ROOTY HILL RSL Desperado, The Eagles Show was created to fill the void left by this prolific band. It combines awesome vocals and harmonies, and great musicianship, with audience members witnessing that unique sound heard by the original Eagles. Desperado pays attention to every detail. It authentically recreates the sound of the classic band as seen and heard on the Eagles’ most recent tour, and captures the sounds of so many timeless classics that have won the hearts of millions of fans all over the world. rootyhillrsl.com.au

A CONVERSATION WITH RICHARD FIDLER

More Information: Credit criteria apply. RAMS Financial Group Pty Limited ABN 30 105 207 538 AR 405465 Australian credit licence 388065. Credit provider and issuer of RAMS deposit products: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714. 18513/0718

6

roamingpanthermagazine.com.au

SYDNEY COMEDY FESTIVAL

23 SEPTEMBER BLUE MOUNTAINS THEATRE & HUB Richard Fidler’s ‘Conversations’ has become one of Australia’s most loved radio programs and is Australia’s most downloaded podcast. Featuring favourite interviews, the disasters, the how and why, and the art of ‘Conversations’, this will be a broad ranging and revelatory conversation conducted by fellow ABC host James Valentine. Audiences can expect exceptional insight into the most popular broadcast interviewer in Australian history in this special live show experience.

7 SEPTEMBER ROOTY HILL RSL The sixth year of the Sydney Comedy Festival Showcase Tour sees the crème de la crème of the 2018 Festival coming to Rooty Hill! Expertly curated and lovingly presented, the Showcase will feature some of the Festival’s hottest acts live on stage for an incredible two hours of hard-hitting laughter. It boasts a line up of veteran favourites, international stars, and some of the freshest emerging talents guaranteed to leave you sore from belly laughs!

bluemountainstheatreandhub.com.au

rootyhillrsl.com.au


Local Roaming LOCAL SHOWS

MJ – LEGACY TOUR

PETER WILLIAMS – PSYCHIC MEDIUM

THE WHARF REVUE 2018

7 SEPTEMBER PANTHERS PENRITH Direct from The United States comes Legacy, the world’s greatest tribute to the world’s greatest entertainer, Michael Jackson. Enjoy a visual and musical voyage.

20 SEPTEMBER PANTHERS PENRITH Hugely popular psychic medium Peter Williams will demonstrate his amazing ability as he contacts and communicates with loved ones on the other side, delivering messages live.

20-22 SEPTEMBER THE JOAN Those indefatigable kings of comedy, sorcerers of satire and masters of mockery, Jonathan Biggins and Drew Forsythe, are back in the saddle and gearing up for another glorious year of political satire – the laughs will be bigger than ever. Politicians take cover and pundits stand back because there will be songs, there will be dance, and there will be some very funny impressions.

penrith.panthers.com.au

penrith.panthers.com.au

thejoan.com.au

LOCAL MUSIC THE MCCLYMONTS 22 SEPTEMBER PANTHERS PENRITH Australia’s favourite and most successful country group are ready to kick it up in style. The girls and their band are fired up and ready to go, and with over 20 smash hit singles from their five much-loved albums, you’re sure to be in for an unforgettable night. They’ll be performing hits like Forever Begins Tonight, Here’s To You & I, Wrapped Up Good and Kick It Up, all sung with their stunning harmonies and backed by their incredible band. penrith.panthers.com.au

STORY AND SONGS OF OLIVIA NEWTON-JOHN

LAST NIGHT AT THE PROMS

Your local RAMS Home Loan Specialist understands exactly what it’s like to run your own business; it’s one of the reasons RAMS has won Best Self-Employed Lender for two years running at the Australian Lending Awards.

SHEPPARD 8 SEPTEMBER ROOTY HILL RSL Chart-toppers Sheppard are presenting a special massive show to celebrate their #1 album, Watching The Sky. Special guest support is Jacob Lee. Enjoy a meet and greet after the show. rootyhillrsl.com.au

GLENN A BAKER PRESENTS: THE NANCY SINATRA & LEE HAZLEWOOD EXPERIENCE

12 SEPTEMBER BLUE MT THEATRE & HUB You’ll be charmed by this wonderful show celebrating the great songs and story of our ‘Liv’. Dorathy Cooper and her fabulous band will take you on a journey from Olivia’s early days when she was discovered by the great JOK to the present.

9 SEPTEMBER BLUE MT THEATRE & HUB Spend your Sunday afternoon enjoying music from The Blue Mountains Orchestra joined by the 100 Voice Choir and soloists. Last Night at the Proms will be a great community event.

14 SEPTEMBER BLUE MOUNTAINS THEATRE & HUB Join us for another unforgettable night of entertainment when Glenn A Baker once more graces our stage to host a presentation of the acclaimed Nancy Sinatra/Lee Hazlewood Experience starring Zoe Carides, Scott Holmes, and The Nancy Boys, celebrating the 50th anniversary of the release of the classic album Nancy & Lee. Nancy Sinatra and Lee Hazlewood were pop’s weirdest duo, a beauty and the beast pairing whose quirky success confounded the critics while creating some of ‘60s America’s most iconic pop.

bluemountainstheatreandhub.com.au

bluemountainstheatreandhub.com.au

bluemountainstheatreandhub.com.au

Call 13 RAMS RAMS.com.au More Information: Credit criteria apply. RAMS Financial Group Pty Limited ABN 30 105 207 538 AR 405465 Australian credit licence 388065. Credit provider and issuer of RAMS deposit products: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714. 18513/0718

Issue 20 September 2018

7


Local Roaming LOCAL MUSIC

BRITISH INVASION

IAN COOPER AND EMMA PASK

FOUR-COLOUR -SEASON

BRITISH INVASION

BOOTLEG BEATLES

15 SEPTEMBER BLUE MT THEATRE & HUB One of Australia’s most exciting virtuoso violinists, together with one of Australia’s favourite Jazz voices, delight audiences with Jazz Soul & Gypsy Swing.

28 SEPTEMBER THE JOAN An atmospheric journey from Vivaldi’s The Four Seasons to new Australian music. An evergreen selection of song and brand-new Indigenous dance.

14 SEPTEMBER PANTHERS PENRITH In a tribute to Rod Stewart, Elton John, and David Bowie, enjoy the best tribute acts in the world together on stage performing the most beloved songs of all time.

29 SEPTEMBER PANTHERS PENRITH The Bootleg Beatles, the world’s greatest Beatles show, is direct from London and back by popular demand. Enjoy a musical and visual journey of epic proportions.

bluemountainstheatreandhub.com.au

thejoan.com.au

penrith.panthers.com.au

penrith.panthers.com.au

THINGS TO DO westfield.com.au/penrith

DOGS IN THE PARK

NEPEAN DISABILITY EXPO

16 SEPTEMBER JAMISON PARK Enjoy a fun day out with your fur friends! Participate in all activities such as Dog Competitions, Dog Races, and Pet Adoption Day. Proposed activities for the event include dog sports demos, best-dressed pet competitions, a dog trick contest, and interactive stalls. You’ll also help raise money for a dog-related charitable organisation.

14-15 SEPTEMBER PANTHERS EXHIBITION MARQUEE A great opportunity to connect with everyone in the Sydney disability sector, with the aim of enhancing the lives of people with a disability.

16 SEPTEMBER TENCH RESERVE Enjoy a lazy Sunday afternoon with stunning sights and spectacular sounds at Music by the River. Fun for the entire family, set on the banks of the beautiful Nepean River.

 Dogs in the Park Penrith

disabilityexpo.org.au

penrithcity.nsw.gov.au/events

ART

LEONORA HOWLETT

8

roamingpanthermagazine.com.au

MUSIC AT THE RIVER

LOCAL FITNESS

SAMUEL QUINTEROS

PENRITH LAKES PARKRUN

YOGA @ THE MONDO

OPEN NOW TIL 11 NOV PENRITH REGIONAL GALLERY From the Head and the Heart, this survey exhibition highlights some of the pivotal shifts and key influences behind her extensive artistic career.

OPEN NOW TIL 11 NOV PENRITH REGIONAL GALLERY The central impulse behind these works is the ecstatic, fresh feeling of being alive, through an exploration of painting inspired by natural forms.

EVERY SATURDAY PENRITH LAKES & NEPEAN RIVER Open to all, walk/run for your own enjoyment and at your own pace. Register online to be timed, and catch up with others for a coffee afterwards.

WEDNESDAY MORNINGS 7AM - 8AM THE MONDO, PENRITH PLAZA Enjoy free yoga classes at the Mondo, located between Westfield, the Library, and The Joan.

penrithregionalgallery.com.au

penrithregionalgallery.com.au

parkrun.com.au/penrithlakes

westfield.com.au/penrith


Local Markets

WANDER AROUND YOUR LOCAL MARKET & FIND A HIDDEN GEM PENRITH REGION

HAWKESBURY REGION

PENRITH SHOWGROUND MARKET

RICHMOND GOOD FOOD MARKET

EVERY WEDNESDAY Penrith’s only weekday market has approximately 250-300 stalls selling products ranging from plants, fruit and vegetables, clothing, lingerie, tools, craft supplies, car supplies, pets, bric a brac, and much more.

EVERY SATURDAY Features local fresh produce and food in Richmond Park, corner of March and Windsor Streets, Richmond.

clubpacewaypenrith.com/penrith-markets

richmondmarket.com.au

WINDSOR MALL SUNDAY MARKETS

AUSSIE NIGHT MARKETS WEDNESDAY NIGHTS An international food market on the doorstep of Panthers. Bring your family and friends, and give your tastebuds an experience they won’t forget.

EVERY SUNDAY Located in the George St Mall. Purchase quality handmade homewares, arts, crafts, fashion and fresh produce, while local bands and buskers entertain. www.hawkesburyaustralia.com.au

aussienightmarkets.com.au

RICHMOND ROTARY MARKETS BLUE MOUNTAINS REGION SPRINGWOOD GROWERS’ MARKET FOURTH SUNDAY Located at the Blue Mountains Theatre and Community Hub. The market proudly hosts over 50 local growers and producers, fearturing a variety of products and fresh food.

FOURTH SATURDAY Come down to McQuade Park and check out the community markets – you’ll see plenty of stalls selling old and quality new products, with everything from vegetables to handmade jewellery. rotaryrichmond.com.au

blackcastleevents.com.au/markets

Local Roaming

Featured Markets MY KIDS MARKETS SUNDAY 9 SEPT, 9AM – 12PM PENRITH REGIONAL VALLEY SPORTS CENTRE HERBERT ST, CAMBRIDGE PK. My Kids Market NSW is the premier market for families to source quality pre-loved kids and baby items by popular brands with huge savings. The market is filled with stallholders selling their family’s gently used baby and kids goods that they no longer need. It’s a great way to reuse and recycle kids goods! clubpacewaypenrith.com/penrith-markets

THE WESTIES MARKETS EVERY THIRD SUNDAY NEPEAN CREATIVE AND PERFORMING ARTS HIGH SCHOOL Held at the Nepean Creative and Performing Arts High School, Great Western Hwy, Emu Plains. Stallholders trade local produce, handmade, one-off fashion items and homewares, freshly-made and ready to eat gourmet treats, as well as delicious food to take home. All with live music and friendly faces. thewesties.com.au/emuplains_markets

Explore OPPORTUNITIES AT S T PA U L ' S

International Baccalaureate Learning from Pre K to Year 12. Limited vacancies available in 2019. Accepting enrolments for Year 7 2020 NOW.

BOOK A TOUR OR ENROL TODAY

p. 02 4777 4888 e. enrol@stpauls.nsw.edu.au w. stpauls.nsw.edu.au

Issue 20 September 2018

9


Spotlight

A LW AY S . . .

Patsy Cline

EVENT IN THE SPOTLIGHT

FROM FAN WORSHIP TO FRIENDSHIP: THE TRUE STORY OF PATSY AND A HOUSTON HOUSEWIFE

A

lways… Patsy Cline is more than a tribute to the legendary country singer who died tragically at age 30 in a plane crash in 1963.

The show is based on a true story about Cline’s friendship with a fan from Houston. Louise Seger befriended the star in a Texas honky-tonk in 1961 and continued a correspondence with Cline until her death. The show’s title was inspired by Cline’s letters to Seger, which were consistently signed “Love ALWAYS… Patsy Cline.”

EVENT DETAILS  Always... Patsy Cline

i

 Saturday 22 September, 8pm  $55 | Concession $50  Blue Mountains Theatre & Hub 106 Macquarie Road, Springwood  4723 5050  bluemountainstheatreandhub.com.au

The musical play, complete with country humour, true emotion and audience participation, includes many of Patsy’s unforgettable hits such as Crazy, I Fall to Pieces, Sweet Dreams and Walking After Midnight… 27 songs in all. Always… Patsy Cline has enjoyed great success internationally, particularly in the US where it had a successful run Off-Broadway. This new production is directed by AFI award-winner Denny Lawrence, and stars Helpmann award-winner Kerrie Anne Greenland alongside popular stage star Mandi Lodge (Menopause The Musical) as Louise Seger. Definitely one to book in the diary!

Do you need a Will?

Have there been recent changes in your life?

We’ve Expanded!

WE NOW SERVICE ORAN PARK AS WELL AS PENRITH

“Let us help you plan for the future”

50% OFF

WILLS & POWER OF ATTORNEYS DURING THE MONTH OF SEPTEMBER

• Are you an Executor of an estate and don’t know where to start? • Probate forms confusing? • No Will and you need to apply for Letters of Administration? • We also offer Estate Administration including, applying for Probate, Letters of Administration, calling in and disbursement of assets to beneficiaries. • We offer fixed price Estate Administration.

Please contact Amanda Little - Principal Solicitor Suite 10, 86 Henry St Penrith NSW 2750 us for further T. 4761 6935 F. 4761 6939 information www.amandalittleassociates.com.au 10

roamingpanthermagazine.com.au

CALL US TODAY FOR A

FREE QUOTE!

ORAN PARK/NARELLAN  0467 839 501 PENRITH  (02) 4731 2483  info@townsconveyancing.com.au

Specialists in conveyancing. We have the key… to make conveyancing STRESS FREE for you

townsconveyancing.com.au    towns conveyancing services


Spotlight

Justene Williams THE CURTAIN BREATHED DEEPLY

The Curtain Breathed Deeply presents an immersive and truly captivating collection of video and sculptural work by artist Justene Williams.

H

er largest and most ambitious undertaking to date, Williams uses found objects and waste materials to create dazzling theatrical environments, seducing visitors through a variety of hypnotizing sets and performative video installations.

Williams takes inspiration from many sources, including memories of her father’s wrecking yard, her childhood training in dance, and her experiences constructing elaborate retail window displays. These are combined with influences from early 20th century avant-garde art and theatre, as well as contemporary pop culture. Williams blends ritualistic references from Shamanism, Voodoo and Modernist Primitivism with art historical giants – Picasso, Leger, Klein and Flavin – and a range of pop culture influences including hip hop, Milli Vanilli and A Chorus Line. You’ve never seen, or experienced, anything like it. The Curtain Breathed Deeply was curated and developed by Artspace, and is touring nationally in partnership with Museums & Galleries of NSW. If you’re looking for something completely and utterly unique, this is it.

Williams uses found objects and waste materials to create dazzling theatrical environments...

EVENT DETAILS  Justene Williams – The Curtain Breathed Deeply

i

 ON NOW until 11 Nov 2018

 Penrith Regional Gallery and the Lewers Bequest 86 River Road, Emu Plains

 FREE

 penrithregionalgallery.com.au

 4735 1100

J UL IUS CAE S A R JULIUS CAESAR IS SHAKESPEARE’S POLITICAL THRILLER, A MASTERPIECE OF INTRIGUE AND TREACHERY.

S

tand witness to the assassination that leads to a life and death struggle in the Republic. Caesar’s power is growing – dangerous if you live in a world driven by ego, where those that rise too fast must be dealt with.

Bell Shakespeare’s Associate Director, James Evans, directs a production that’s seething with rage, leaving audiences breathless at how quickly violence reveals the fragility of democracy. Starring Kenneth Ransom (Gods of Egypt, Belvoir’s Prize Fighter) as Caesar and touring Australia-wide, it’s a must-see production. EVENT DETAILS  Julius Caesar

i

 Friday Oct 5 – 7:30pm Saturday Oct 6 – 2pm and 7:30pm  Standard $65 | Concession $60 Under 30’s $30  Joan Sutherland Performing Arts Centre 597 High Street Penrith  4723 7600  thejoan.com.au

BOOK NOW

4723 5050

BlueMountainsTheatre.com 106 Macquarie Road Springwood

Issue 20 September 2018

11


Community

Pink Up Penrith PENRITH WILL BE TICKLED PINK FOR THE MONTH OF OCTOBER.

THE PINK UP PENRITH COMMITTEE. Left to right: Joe Masters, Simon Gould, Marlene Shipley, Lea Hicks, Kerry Hansen, Elizabeth Spanos, Gai Hawthorn, Marie Chitos, Rhonda Hanbury, Sue Fryer, Deb Ferguson, Tom Bell.

Written by Manisha Foley – Penrith CBD Corporation

Why? Our beautiful town has been personally asked to be the first metro area to Pink Up on behalf of the McGrath Foundation.

T

and passion to make sure that Penrith and its surrounding suburbs are Pink. Made up of local business people, the committee’s vision is to showcase our strong pride for the town by supporting the McGrath Foundation. This will be done by driving awareness and fundraising for the cause, and encouraging as many local businesses, schools, organisations, sporting clubs, charities, families and individuals to Pink Up.

he McGrath name is synonymous with the late Jane McGrath, whose brave battle with breast cancer was extremely tough. Throughout her journey, Jane had access to a breast care nurse for the first time and became aware of the tremendous impact that they can have on a patient’s physical and mental wellbeing, both during and after treatment.

“It’s a great honour that the McGrath Foundation chose Penrith to lead this fantastic cause,” said Gai Hawthorn, Chairperson of the Pink Up Penrith Committee. “We have such a tight-knit community here, I know we’ll band together to raise money for Breast Care Nurses to help individuals and their families affected by breast cancer.”

The McGrath Foundation was co-founded by Jane and her cricketing husband Glenn, after Jane’s diagnosis. Today, it’s considered to be one of Australia’s leading breast cancer support charities.

The Pink Up Penrith Committee wants this initiative to be as big and eye-catching as possible; no fundraising event or idea is too big or too small!

Sadly, cancer doesn’t give anyone a choice. So it wasn’t hard to take on this initiative for the Penrith area, especially since passion and pride are ingrained within our community. An enterprise of this magnitude needs a strong team, and Penrith has assembled a committee bursting with pride

“We want as many local businesses and community members as possible to get involved,” says Gai. “Whether it’s pinking up your pooch, wrapping your entire shopfront in pink wrapping paper, or having your whole office wear pink for the day, we want to know about it!”

FREE ENTRY

HOW DO I GET INVOLVED? 1

Organise and register your fundraising event with the Pink Up Penrith Committee

2 Make a donation and receive a Pink Up

Penrith Decal

3 Purchase a Pink Up Penrith Kit.

Fundraising by groups and individuals can occur during the entire month of October, and a calendar will be created so you can register your business, family or group to participate. The Committee will also have some great creative ideas for you in the upcoming weeks on our newly-created Pink Up Penrith Facebook page, so please join us!

REGISTER NOW!  admin@penrithcbdcorp.com.au  4722 5556 or  www.pinkuppenrith.com.au

Fri 14th - Sat 15th September 2018 9am - 3pm Exhibition Marquee, Penrith Panthers

Register Online

disabilityexpo.org.au

OVER 120 EXHIBITORS 12

roamingpanthermagazine.com.au

KIDS SPEAKERS

ENTERTAINMENT


Community

18

New Police Officers

FOR NEPEAN/BLUE MOUNTAINS LOCAL AREA COMMANDS

Stuart Ayres MP, Member for Penrith announced that 18 new recruits will join the Nepean and Blue Mountains Local Area Commands following on from their recent graduation from the Goulburn Police Academy.

“A

fter more than eight months of training at the academy and university-level education it’s great news that our community will see 18 new officers patrolling the streets and attending to incidents, following today’s Police attestation parade of Class 334,” said Stuart Ayres “Community safety is of paramount importance and I am absolutely thrilled to welcome the new probationary constables to the Nepean/blue Mountains region. “Becoming a sworn police officer is a tremendous honour. The mere presence of a blue uniform puts our minds at ease, however it also comes with enormous challenges. “As a community, we turn to the police in our worst hour and expect them to stand in harm’s way to prevent and disrupt criminal activity.

“I commend our newest officers on making the decision to put the community’s safety above their own and joining one of the proudest organisations in the state.” The Minister for Police Troy Grant said the Liberals & Nationals Government committed to increasing the authorised strength of the NSW Police Force to a record 16,795 over this term, and we have achieved that and more. “The security and safety of the people of NSW is a top priority for this Government and these new Probationary Officers will be a great asset in helping to identify, disrupt and combat crime in the local community,” Mr Grant said. “These men and women are about to embark on a tough but rewarding career. I am proud to welcome the newest members to the NSW Police family, and I wish them the best for their future policing career.”

el whe l. ring tee contro ms miu uise Pre ith cr w

16”

ls

hee

yw

Allo

lay® arP . le C ities Appapabil c

CHAMPAGNE COCKTAILS & SPRITZ’S

ne.

ngi

Di e

G 1.6

VODKA’S, MIDORI’S, JIM BEAMS, & SPARKLING WINE ALL NIGHT

Issue 20 September 2018

13


EXCLUSIVE VIEWS YOU SIMPLY CAN’T OVERLOOK

800m2 – 1,200m2 mulgoasanctuary.com.au To the best of our knowledge no relevant information has been omitted from this advertisement. Whilst all care has been taken in presenting 14

roamingpanthermagazine.com.au


W A K E U P T O B R E AT H TA K I N G V I E W S E V E R Y D AY W H E R E N AT U R E I S Y O U R N E I G H B O U R Imagine the spacious feeling of living with your own exclusive view of the Blue Mountains and pristine bushland. With our prestige hillside homesites ranging from 800m2 –1,200m2 – it’s the perfect place for your new dream home in an exceptional location surrounded by nature. 0 Just minutes from Glenmore Park Town Centre shopping. 0 Close to schools and sporting fields. 0 Minutes to the Penrith CBD. 0 Convenient to the M4.

This enviable lifestyle can be yours. Hurry, homesites in this highly desirable new estate are selling fast. Visit our Sales Centre Sunday 10am–2pm to see

a range of house and land packages. Or register your interest at mulgoasanctuary.com.au. the benefits of Mulgoa Sanctuary, we encourage all potential purchasers to inspect for themselves. Home with view is artist’s impression. Issue 20 September 2018

15


Local Roaming ROAMING FEATURE

RUSSELL TUCKER MR M UM

WH E N A Y O U NG FA M I LY I S FAC E D W I T H A C H A LL E NG E , FA M I LY DYNA M I C S C H A N G E. A ND P E O P LE ST E P U P .

Inspiring LOCAL DAD

It wasn’t exactly how we planned it, but nothing has really been the way we’d planned it over the last couple of years. You just sort of have to roll with the punches and continue on.

16

roamingpanthermagazine.com.au

Professional family photo credit: Lauren Elyse Photography

FEATUR E


Russell Tucker - Mr Mum

That’s just what happened to Russell Tucker, a young dad from St Clair.

H

is wife, Bec, was 38 weeks pregnant with their second child when she was diagnosed with breast cancer. Reeling from the bad news, their son was delivered that night. Russ was again a new father, having to support his wife and children in another way. ‘The shock of finding out my wife had breast cancer, and then the mixed emotions of having a newborn son the same night... was very hard,’ he said. Bec says Russ was initially terrified of having kids. 'Until we had our daughter, he had never even held a baby. But from day one he just switched into dad mode and hasn’t really come out of it. He’s just amazing!’ Shortly after Ava was born, they had started their own business, Aspire Plumbing & Gas. Russ wanted more flexibility to be available if the family needed him. This decision paid off when Bec was diagnosed. ‘I had to take time off to be at home with the kids and do a lot more. The chemo knocked Bec around a fair bit at the start.’ It was only eight days after their son was born that Bec started chemotherapy treatment. ‘He became the mum and the dad,’ Bec says. ‘He was a rock. He stayed every day and night at the hospital with me. He was up doing the night feeds every 2-3 hours so that I could sleep, and he was constantly telling me to rest and relax. He kept reassuring me that we were a team and that he’s not going anywhere, saying, “I got this”.’ She says that Russ just kept stepping up, no matter what was thrown at him. ‘From changing pooey nappies, staying home with me until I was up, holding my hair back if I was throwing up, through to literally helping me out of bed when I physically couldn’t get myself up ‘coz I was in too much pain and even crying with me ‘coz my hair was falling out. He would make sure the kids got fed and everything was normal to them. I don’t know how he did it, I really don’t.’ Russ says that it was tough at the start; he’d have to ‘wake up and do all the night feeds every 2-3 hours, get up and go to work, and then be back at it again at night. I sort of had to be Mr Mum for most of it’. Twelve months later, after receiving the ‘all clear’, Bec and Russ bought a family home together for a fresh start. Unfortunately, on Aidan’s first birthday, Bec was re-diagnosed with breast cancer. The young family had just started renovations when this happened, so Russ decided to ‘ramp it up’.

‘We had to get it finished as quickly as possible so we could move in and get settled for the next round of chemo and surgery she had to go through.’ ‘It wasn’t exactly how we planned it, but nothing has really been the way we’d planned it over the last couple of years. You just sort of have to roll with the punches and continue on.’ Russ renovated the entire house in eight weeks, transforming it into their dream home. ‘I don’t think there is a part of this house that we haven’t renovated,’ he laughs. ‘We built walls and bathrooms and painted the whole house. We did a lot of work here.’ Russ says he called in a lot of favours and ‘spent lots of long nights working away, trying to get the house ready for them. We pretty much gutted the whole place and renovated every surface, but it’s been worthwhile; the family loves it.’ They both say they couldn’t have gotten through these tough times without the support of the local community. ‘I just really want to send a big thankyou to everyone that’s helped out; all our family and friends, and a lot of people that have done kind things and didn’t even know us personally. It’s good to see that in a bad situation, it can bring out the good in people,’ says Russ. They’re especially thankful for their parents, Sarah Williamson and Nicole Newton, for their help during such a hard time. After going through so much together, the couple both agree it’s made them stronger. While Russ says Bec’s the strongest woman he knows, Bec says Russ is ‘an absolute dream father, and there’s nothing this magnificent man won’t do for his family. We are so blessed.’ ‘He’s got lots of patience, he’s very caring and gentle, and at the same time he roughs them up; it’s a good balance. One minute he’s throwing them up in the air and the next he’s snuggled up on the lounge with them watching Paw Patrol and singing along to some terrible pre-school song,’ she laughs. ‘I’ve always tried to be as hands-on as possible as a father,’ Russ adds. ‘I’m a plumber, so dirty nappies don’t scare me,’ he laughs.

Russ says he didn’t really think too much about it all when things got hard, he just did what needed to be done to keep the family strong and ensure everything kept moving. ‘I just went straight into action mode. As a husband, it’s a horrible thing. You want to protect your wife and keep her safe and you can’t. You feel sort of helpless. It’s really horrible, you want to do so much more.’ ‘I tried to shoulder whatever I could, making sure I’m home enough to do everything with the kids that I can — whether it’s cook dinner, get them in the bath every night, bed time — just making sure I’m there to do as much as possible.’ ‘I couldn’t do the chemo for her and I couldn’t do the surgeries for her, so I just made sure I was there to do everything else.’ Going through so much together, it’s obvious the love between these two is very strong. Bec says that Russ is still the man she ‘fell’ for over 13 years ago at a friend’s BBQ. Russ says that Bec conveniently invited herself to his 21st a week later and ‘she’s been around ever since’. As for their future, Bec’s just been given the ‘all clear’ at her 12-month check. They celebrated with family photos at the Nepean River. Ava is about to turn five and continues to be a great big sister to Aidan, getting his nappies and helping dress him in the mornings. She’s a bit of an over-sharer at daycare where she talks about her ‘mum’s sick boobie,’ but her understanding and nurturing instincts make her parents proud. Aidan just turned two, which was celebrated with a Hot Wheels party with family and friends. Russ says they’re looking forward to some sense of ‘normality’ again. ‘The little things don’t bother you as much anymore, but we’re really looking forward to just enjoying family time, which we haven’t been able to do for the last couple of years.’ One thing the whole family is looking forward to is having an outdoors family picnic. However they choose to celebrate this Father’s Day, Roaming wishes them all well.

Issue 20 September 2018

17


Food

Jamie COOKS ITALY

Minestrone

RISOTTO RICE & SEASONAL VEG WITH PARMESAN, LEMON & GARLIC PESTO Serves 6-8

TOTAL TIME: 1 HOUR 10 MINUTES

I 

love this minestrone – it feels fresh and electric with the contrasting pesto, while the risotto rice sucks up all the incredible flavour and is extremely comforting. Minestrone has always felt like a wonderful fallback recipe – from my days as a student to being a busy parent, I love reacting to what’s available at the market, growing in the garden, or even the odds and ends hiding in the veg drawer, to create a beautiful bowl of soup. INGREDIENTS 9 2 onions 9 2 sticks of celery 9 Olive oil 9 600g mixed green veg, such as courgettes, fennel, tenderstem broccoli, asparagus, chard, kale, peas, broad beans 200g Arborio risotto rice 9 2 litres organic chicken or veg stock 9 1 mixed bunch of fresh rosemary & thyme (30g) 9 2 cloves of garlic 9 50g Parmesan cheese 9 1 lemon 9 9 Extra virgin olive oil METHOD 1

Peel the onions and celery, then finely chop both and place in a large pan on a medium heat with 2 tablespoons of olive oil. Cook for 15 minutes, stirring occasionally. This is a good time to prep your green veg, chopping courgettes and fennel into ½cm chunks, and finely slicing broccoli, asparagus, chard and kale. Put the veg aside. Stir the rice into the pan for 2 minutes, then pour in the stock. Tie the herbs together and add to the pan. Bring to the boil, then simmer gently for 15 minutes.

2 Meanwhile, peel the garlic and pound into

a paste in a pestle and mortar with a pinch of sea salt. Finely grate in the Parmesan and lemon zest, squeeze in the juice, and muddle in 4 tablespoons of extra virgin olive oil.

3 Stir the veg into the soup and simmer for

a final 10 to 15 minutes, ensuring that the veggies retain their vibrancy. Season to perfection, then divide between warm bowls. Finish with spoonfuls of the pesto. NUTRITIONAL INFORMATION 9 9 9 9 9 9 9 9

18

roamingpanthermagazine.com.au

CALORIES FAT SAT FAT PROTEIN CARBS SUGAR SALT FIBRE

324kcal 13g 3.4g 16.8g 36.9g 6.3g 0.9g 3.7g

Jamie Cooks Italy by Jamie Oliver is published by Penguin Random House © Jamie Oliver Enterprises Limited (2018 Jamie Cooks Italy), photography: David Loftus.

ENJOY THE WORLD'S FAVOURITE CUISINE IN YOUR OWN KITCHEN, WITH JAMIE OLIVER'S TRIED AND TRUSTED RECIPES.


Food

Mozzarella Fried Eggs SWEET TOMATOES, FRESH BASIL & TOAST Serves 4-6

T

his is the most fantastic starter or brunch. It’s so easy to put together, and perfect placed in the middle of the table ready to share with friends and family. The way the mozzarella melts into the tomatoes creates the most wonderfully tasty casing for the eggs as they cook, which is just divine. You’ll love tucking into this one. INGREDIENTS 9 1 dried red chilli 9 1 clove of garlic 9 Olive oil 9 2 sprigs of fresh basil 9 6 ripe mixed-colour tomatoes 9 125g ball of mozzarella cheese 9 6 large free-range eggs 9 4 – 6 slices of sourdough bread

TOTAL TIME: 15 MINUTES

METHOD 1

Deseed the chilli and tear it into a large cold frying  pan. Peel and finely slice the garlic, add with 4 tablespoons of oil, and place the pan on a medium heat. Season with sea salt and black pepper, tear in the basil leaves and let it all fry for around 1 minute while you randomly chop up the tomatoes.

2 As soon as everything starts to sizzle, throw the 

tomatoes into the pan, then, a couple of minutes later, tear in the mozzarella. Making little gaps, crack in the eggs. Cover, then cook for 3 to 5 minutes, or until the eggs are cooked to your liking. Meanwhile, toast the bread. Season the pan of eggs from a height with black pepper, and serve up with the hot toasts.

NUTRITIONAL INFORMATION 9 9 9 9 9 9 9 9

CALORIES FAT SAT FAT PROTEIN CARBS SUGAR SALT FIBRE

437kcal 29.5g 8.8g 20.4g 23.9g 4.7g 1.5g 1.8g

 Issue 20 September 2018

19


Food

Amalfi Lemon Tart WHITE WINE, OLIVE OIL & VANILLA PASTRY

Serves 10-12

TOTAL TIME: 2 HOURS, PLUS CHILLING

T

his wonderful, rather delicious baked lemon tart is fresh but comforting and just a stone’s throw away from a baked cheesecake. It’s great served with ice cream, and really nice with seasonal berries, such as raspberries or strawberries. If you’re feeling the Italian vibe, a little slice for breakfast with a black coffee is a real treat. INGREDIENTS

Pastry 9 250g plain flour, plus extra for dusting 9 50g icing sugar, plus extra for dusting 9 75ml olive oil 9 75ml Greco di Tufo white wine 9 ½ teaspoon vanilla bean paste Filling 9 5 large lemons 9 500g quality ricotta cheese 9 150g caster sugar 9 2 large free-range eggs METHOD 1

To make the pastry, put the flour and icing sugar into a large bowl with a good pinch of sea salt. Make a well in the middle, then add the oil, wine and vanilla paste. Use a fork to whip up the wet mixture, gradually bringing the flour in from the outside until it comes together as a ball of dough. Tip onto a lightly floured surface and knead for just a couple of minutes, then wrap in clingfilm and place in the fridge for 30 minutes.

2 On a flour-dusted surface, roll out the pastry

to about 3mm thick. Loosely roll it up around the rolling pin and unroll it over a 25cm loose-bottomed tart tin, easing and pushing it carefully into the sides. Trim off any excess, patch up any holes, then prick the base with a fork, cover with clingfilm, and chill in the freezer for 1 hour 30 minutes.

NUTRITIONAL

INFORMATION

9 CALORIES 323kcal 14.4g 9 FAT 4.9g 9 SAT FAT

9 PROTEIN 9 CARBS 9 SUGAR

8.5g 41.5g 22.8g

9 SALT 9 FIBRE

0.2g 0.8g

3 Preheat the oven to 180ºC. When the time’s

up, bake the pastry case blind for 25 minutes, or until lightly golden. Meanwhile, finely grate the zest of 1 lemon and put aside. Squeeze all the lemons to give you 150ml of juice, then whisk with the rest of the filling ingredients until smooth, by hand or in a food processor. Pour into the tart case and bake for 30 minutes, dusting with icing sugar and sprinkling over the lemon zest for the last 5 minutes. Transfer to a wire rack to cool – it will have a slight wobble, but will set as it cools. Dust with extra icing sugar, then slice and serve.

20

roamingpanthermagazine.com.au

JAMIE COOKS ITALY  Jamie Oliver  RRP $49.99 | Hardback or EBook  www.penguin.com.au Jamie Cooks Italy is a celebration of the joy of Italian food. Jamie wants to share his love of all things Italian with accessible, best-ever recipes for Classic Carbonara, Salina Chicken, Stuffed Focaccia, Baked Risotto Pie, Pot-Roasted Cauliflower and Limoncello Tiramisu. This is about bringing the pleasure and passion of the world's favourite cuisine to your kitchen at home. Featuring 130 recipes in Jamie's easy-to-follow style, the book has chapters on Antipasti, Salad, Soup, Meat, Pasta, Fish, Rice & Dumplings, Bread & Pastry, Sides, Desserts, and all the Basics you need.


Health

What Does SELF mean

TO YOU?

Written by Tamara VanAntwerpen

Learning to be yourSELF? In our world, SELF means something very different.

S

ELF stands for ‘Spectrum Empowered Learning Framework’, a program designed to empower young adults with social and self-care skills to enable independent living. Research states that adaptive skills, or daily living skills, often need to be taught to people on the Autism spectrum. For many adults it may be important to explicitly teach independent living skills such as taking a shower, navigating transport, crossing the road, cooking, shopping, and general life organisation. What does this look like practically? A young lady with a broken alarm clock. She fears oversleeping for an 8:30am start at work, which is a common concern for many. Her solution, however, was anything but typical. She decided to sleep in the workplace kitchen to make

sure she wasn't late to work the next day. This is not a sustainable solution, or one that would be understood by someone who simply buys a new clock. The SELF Program is designed to help with challenges like this. On October 20, around 350 people will gather to raise much-needed funds to expand Western Sydney’s LPF Centre for Autism. During this event, the Luke Priddis Foundation will reveal plans to expand the current facilities and launch the SELF Program. This purpose-built living simulation facility within the current premises, designed to facilitate the training of independent living skills, will bring adults with Autism closer to independent living. This year’s Spring Ball will be pivotal in building the next phase of the Foundation’s future services and will showcase the phenomenal growth of the Foundation over the past 12 years. Chairman Luke Priddis, father of 16-year-old Cooper, has said, “Autism does not discriminate; it touches all cultures and demographics, and NO… you don’t grow

out of it. Children with Autism grow to be adults with Autism, and our community must begin to address their needs”. The 5th Annual Gala Ball will bring together Sydney businesses, celebrities, families and the disability sector to focus on the special abilities of those living with Autism Spectrum Disorders. We hope Western Sydney will throw its support behind those living with ASD to simply be themSELF!

...adaptive skills, or daily living skills, often need to be taught to people on the Autism spectrum.

Issue 20 September 2018

21


M4 Moto

Glenm o

rway

re Pkw y

ey Dr

Dr yah Gun

James R il

The Nor thern R d

Darug Ave

Bradley St

N


Home Improvement Feature

IMPROVE YOUR HOME SPRING INSPIRES CHANGE. FOR SOME, THAT STOPS AT A SPRING CLEAN. FOR OTHERS? IT'S TIME TO RENOVATE.

S

pring is the season of rebirth and renewal; it's also the most popular time of year to kick-start a renovation or home improvement project!

To give you a hand, we've sourced the very best local trades to help. Perhaps you're inspired to renovate your internal kitchen? Or is now the time to install

an external one for entertaining and lazy days outdoors? Maybe you want new security shutters, to do some landscaping, or improve your driveway? However you want to spruce up your home, these specialists guarantee you're spolit for choice.

EAST WEST KITCHENS & JOINERY

FREE QUOTE

SERVICES | KITCHENS, RESIDENTIAL AND COMMERCIAL BUILDING CONTACT | 9673 2621

ADDRESS | UNIT 3/16 LINKS ROAD, ST MARYS NSW 2760

WEBSITE | WWW.EASTWESTKITCHENS.COM.AU

NO OBLIGATION

SOCIAL MEDIA |  @EWKitchens2017  eastwestkitchens WHEN QUALIT Y MATTERS! Why use East West for your new kitchen? 1

2

3 4

5 6

7

With over 15 years’ industry experience, the East West team is Western Sydney’s leading kitchen renovation brand. Our Director, Will, is a licensed builder who has spent that last 15 years travelling Australia and abroad to hone his skills. He’s developed knowledge and expertise second to none, ensuring you enjoy a kitchen renovation that’s simple and enjoyable. At East West Kitchens, we project manage your renovation from start to finish. This includes supplying additional trades and services, so the only team you deal with is ours. And keep your finger on the pulse with our day-to-day schedule, which outlines what’s happening step by step through the whole experience. Our attention to detail is unmatched. We never leave any stone unturned or job unfinished. Our trade partners are an extension of East West, so we insist on partnering with the most reliable and very best in each industry to make your experience stress-free. We only use suppliers and products of the highest quality. If we wouldn’t use them in our home, we won’t use them in yours. You receive constant support. At no extra cost, benefit from award-winning Interior Designer Ange Hingcliffe’s expertise as she guides you through the decision-making process. We offer interest-free finance, so you can have your dream kitchen NOW!

Call us on 9673 2621 today. You can see our work at www.eastwestkitchens.com.au, or follow us on Facebook at www.facebook.com/EWKitchens2017.

24

roamingpanthermagazine.com.au

Your One Stop Shop!

WITH OVER 10 YEARS EXPERIENCE

At East West Kitchens, we project manage the whole renovation for you. We organise all the trades required for your job and the only people you will have to communicate with is us!

NEED A NEW KITCHEN? CALL US TODAY ON 9673 2621 TO ARRANGE YOUR FREE QUOTE


Home Improvement Feature

Affordable, High Quality Home Improvement Solutions ROLLER

Our Premium Product Range

YOU CAN AFFORD

Window Replacements  - Magnetite

SHUTTERS

FACTORY DIRECT

Roller Shutters  Crimsafe Security Products  Plantation Shutters - Blinds 

External Blinds & Awnings  Security Screens - Fly Screens  Window Films 

CRIME PREVENTION PARTNERS

LOCALLY OWNED

AND OPERATED IN PENRITH

SHUTTERS | SCREENS | DOORS

GUARDRIGHT SERVICES | HOME IMPROVEMENT SOLUTIONS TO PROTECT YOUR HOME 0R BUSINESS CONTACT | 4721 8536

ADDRESS | UNIT 4, 103-107 BATT STREET, PENRITH 2750

WEBSITE | WWW.GUARDRIGHT.COM.AU SOCIAL MEDIA |  @GuardRight.Industries  guardrightshuttersscreensdoors SECURE YOUR ST YLE AND SAFET Y WITH THE INDUSTRY'S BEST

O

ne of few manufacturers to be Crimsafe approved, GuardRight delivers meticulously engineered roller shutters, plantation shutters, blinds, security doors, and more. With us, there's no importing - we engineer onsite to ensure the very highest of standards So don't just secure your home or premises - secure incredible value, the pinnacle of engineering know-how, and exceptional customer service. Call the team today on 4721 8536 and experience it yourself.

S&L CONCRETE

The Highest Standard in Concreting Services in Penrith & Blue Mountains

SERVICES | RESIDENTIAL, COMMERCIAL, AND INDUSTRIAL CONCRETING CONTACT | 0411 704 302 WEBSITE | WWW.SLCONCRETE.COM.AU SOCIAL MEDIA |  @S&LCONCRETENSW RENOVATING? LANDSCAPING? PERHAPS YOU'RE PUTTING IN A POOL OR ENTERTAINING AREA? START WITH THE RIGHT FOUNDATION

I

f you're giving your home a facelift, S&L Concrete can help. For many, the landscaping bug is biting - our custom concrete solutions for landscaping jobs, pools and entertaining areas, patios and verandahs, and even driveways, make it enjoyable and stress-free. Don't compromise on the dream - talk to us for expert advice and a quality outcome.

S ASK U UR T O ABOU

R SENIO T UN O C S I D

CALL US NOW

MENTION THIS AD AT TIME OF CONTACT FOR

0411 704 302

FREE

REMOVAL OF OLD DRIVEWAY

LOCALLY OWNED AND OPERATED, WITH EXCELLENT WORKMANSHIP AT AFFORDABLE PRICES

Spring is here

Trust the experts to transform your outdoor living space

HI-CRAFT SERVICES | OUTDOOR LIVING SPACE CONTACT | 1300 659 276

ADDRESS | 236 - 238 GREAT WESTERN HWY, EMU PLAINS 2750

WEBSITE | WWW.HICRAFT.COM.AU SOCIAL MEDIA |  @HICRAFTAUSTRALIA

Contact us today for a

THERE'S NEVER BEEN A BETTER TIME TO CREATE YOUR DREAM OUTDOOR LIVING SPACE

FREE

in-home design consultation

H Alfresco - Carport - Deck - Patio - Pergola - Sunroom 1300 659 276 hicraft.com.au

i-Craft Home Improvements is a family owned and operated company, running from our Emu Plains location since 1959. If you want a quality built structure that looks amazing and adds value to your home, we're here to help - from design concept to creation. Talk to the team on 1300 659 276 or visit our showroom today!

Issue 20 September 2018

25


Interiors Pleated Velvet Chair $69

KMAR T REVEALS

New-Season Living Range Photo credit: Kmart Australia

Kmart has recently introduced a new level of affordable luxury with the launch of its brand new Living range.

T

he design-led range, presenting Natural, Timeless and Urban trends, welcomes new textures, finishes, shapes and colours to Kmart’s ever-growing product range. Spanning furniture, dining, bedding, interior and outdoor décor, home storage and more, Kmart’s Living range delivers versatile pieces to refresh any room, all available at irresistibly low prices.

Round Mirror with Shelf $19

Kmart’s Living range delivers versatile pieces to refresh any room, all available at irresistibly low prices.

Protea Cushion $8

Matte Blush Pink Dinner Plate $1.50

The hero this season is Kmart’s Natural collection. Inspired by a sense of adventure, the collection combines warm tones and layered textures including fringing, terracotta, faux leather, blonde timber, and reflective glaze, reminiscent of a whimsical desert landscape. Adapting a refined elegance, this season’s Timeless trend celebrates delicacy. Beautiful materials like brass, perforated metal, softly coloured glass, marble and faux fur bring a sense of femininity, along with linear embossing and intricate wire work. This season’s Urban trend is reintroduced with a simplified approach. Focused less on visual detail and more on striking line work, the Urban trend adds a touch of masculinity to the range with the combination of powder-coated metal, brass, faux leather and velvet all used to create a sophisticated and bold collection.

Terrazzo Base Lamp $10

Matte Blush Pink Small Bowl $1.50

3 Tier Wire Floor Caddy $15

Julie Miller Sensini, Kmart’s General Manager Living and Design, explains, “We are so proud to introduce Kmart’s newest Living range to our Australian and New Zealand customers. Each season our team delves deeply to learn about what our customers would love to see in their homes, and we’re thrilled to be able to present them with this incredibly versatile collection.” Highlight products in the Living range include the Pleated Velvet Chair ($69), Mongolian Faux Fur Bench ($45), Oak-look Sideboard ($39), Protea Cushion ($8), Round Mirror with Shelf ($19), and Reactive Dinnerware ($3ea). Kmart’s new Living range is available in-store and online at www.kmart.com.au now. 26

roamingpanthermagazine.com.au

Mongolian Faux Fur Bench $45


FREE LOCAL DELIVERY

For All Your Health & Medical Needs

Seniors Discount

Visit our pharmacy for friendly & professional service

AVAILABLE

Services & Expert Advice • Prescriptions Filled

• Workers Compensation

• Surgical Supplies

• Specialty Vitamins & Herbal Supplements

• MedsChecks

• Home-aids

• Injury Supportwear

• Baby & Mum Care

• Hires - Wheelchairs, Crutches & Breast Pumps

• Wide Range of Gifts

Trading Hours

CLOSED

Public Holidays

9.00am - 1.00pm

 specialistclinicpharmacykingswood  pharmacy@specialistclinicpharmacy.com

Penrith DER

ST

Sunday

Nepean Hospital

ET

8.00am - 5.00pm

ST

Saturday

Kingswood Station

KER

7.30am - 7.30pm

BY

ST

Within the Specialist Clinic

PA R

Monday - Friday

Greater Western Hwy

ERS

• Webster Packing

• Photocopying, Faxing, and Laminating

SOM

• National Diabetes Service

• Newspapers, Milk, Drinks, Chips & Lollies

S TA F F O R D NEPEAN HOSPITAL WE ARE JUST OPPOSITE ST

M4 Motorway

 4737 3456  Suite 3, 64 - 68 Derby Street, Kingswood


Health

Osteoporosis

Local Experts Kris Caloia & Karl Thornton Physiotherapy Experts, Progressive Sports & Spinal Physiotherapy

HOW PHYSIO CAN HELP With osteoporosis affecting more than 1 million Australians, physiotherapists are key to managing it successfully.

T

he disease is more commonly known to affect middle-aged and elderly women, although men are also at risk. Women who are post-menopausal have a heightened risk of developing osteoporosis. WHAT EXACTLY IS OSTEOPOROSIS?

Osteoporosis is a disease that makes bones become brittle; those who have it are more likely to break or fracture a bone. Osteoporosis occurs as a result of our bones losing calcium and other minerals much faster than they can be reabsorbed. Bone mass, also referred to as bone density, generally decreases after 35 years of age. Reduced bone mass results in weak bones that are somewhat porous and easily compressed (similar to a sponge). WHAT ARE THE SYMPTOMS OF OSTEOPOROSIS? Some of the common symptoms of osteoporosis are: • Bones that break or fracture often • Back pain

• The development of poor posture or a ‘hunch’ • A decrease in height over time • Pain performing everyday tasks. More severe cases can even see bone breakage after something as simple as a sneeze or cough. HOW CAN PHYSIOTHERAPY HELP WITH OSTEOPOROSIS? Apart from reducing pain and discomfort, physiotherapists can help with your osteoporosis by: • Strengthening your core muscles, which can improve your posture • Increasing muscle strength, particularly in the legs, back and upper body • Improving your flexibility and balance, reducing the chance of falls and fractures • Providing relief to pain in the back • Improving bone strength with light exercise through physiotherapy.

All of this will get you stronger and more confident to perform everyday tasks with less pain. KEY TIPS FOR OSTEOPOROSIS PREVENTION • Get outside for your daily dose of Vitamin D (sunshine is great for strong bones) • Eat plenty of calcium-rich foods like milk, yoghurt and cheese • Eat a balanced diet containing lots of fruits and vegetables • Exercise in your early years if you know you have a family history • Exercise as regularly as possible to improve bone strength • Speak to your local physiotherapists about a tailored plan to increase bone strength.

get your physio assessment today Progressive Sports & Spinal Physiotherapy has an experienced team who can assess your scenario and talk you through your treatment options. If you’d like to take the first step to preventing or better managing your osteoporosis, contact the practice today on (02) 4721 7798.

Good luck Ben!

P

rogressive Sports & Spinal Physiotherapy would like to wish Ben English the best of luck with his upcoming Rugby League tour of New Zealand. For 10 days, Ben will be travelling with his U15/1s Windsor Wolves team to play in Rotorua, Hopu Hopu and Auckland. This is a priceless experience where he can visit a beautiful part of the world while playing the sport he loves. Ben has been a loyal member of the Progressive family and has worked tirelessly to overcome major injury hurdles in recent times. With Ben's dedication and talent, we're sure this a small stepping stone towards achieving his goal of one day becoming a professional Rugby League player and putting on the Panthers jersey. Good luck Ben!

28

roamingpanthermagazine.com.au

Ben training under the guidance of staff in the new rehab gym at Progressive Sports & Spinal Physiotherapy.


Health

Is Kombucha Good FOR YOU?

Written by F45 Training

The 2018 trend is definitely... KOMBUCHA! But is it just a fad?

T

his popular fermented probiotic drink has all the hipsters obsessed, although originally consumed in China more than 2,200 years ago.

Made from brewed green or black tea, Kombucha’s probiotic content can have a positive effect on our digestive system and stomach bacteria. The fermentation process, developing more antioxidants than other teas, produces compounds that can encourage detoxification. During the fermentation process, an acetic acid (also found in vinegar) is produced. This acetic acid can kill harmful microorganisms in the body. As Kombucha is high in this acid, it’s beneficial to the liver and supports a natural detox. Like yoghurt, Kombucha supports healthy gut bacteria. This can improve aspects of your health such as

inflammation and weight loss. Kombucha has the same health benefits as green tea; potentially increasing the number of calories you burn, improving blood sugar and cholesterol levels, and reducing belly fat. So, Kombucha is more than just a new fad that all the cool kids are drinking. BUT... WATCH YOUR KOMBUCHA SUGAR Some Kombucha can be high in sugar, increasing your calorie intake. Read the nutritional label - the added yeast and bacteria break down the sugar added during the fermentation process, so by the time it’s ready to be consumed there is no sugar content. But make sure no extra sugar is added after the fermentation process. MANUFACTURING Kombucha can cause serious health problems if not fermented correctly. Make sure you’re consuming a known and trusted brand, as the bacteria can potentially do more damage than good.

CONSUMPTION Like anything new to your diet, be smart with your intake. Limit your Kombucha to once a day, as too much can negatively affect your stomach acidity. ALCOHOL Most nutritional labels won’t state the alcohol content, though typically between 0.5% and 2%.

Kombucha’s probiotic content can have a positive effect on our digestive system and stomach bacteria.

8 WEEK CHALLENGE 8 OCT 2018 TO 2 DEC 2018 OUR CHALLENGE PACKAGE INCLUDES:

SOUTH PENRITH F45 Training South Penrith is a group training facility that features the most dynamic and effective training style to date. Our studio members enjoy a 45 minute, high intensity circuit training workout that gives results. The classes at South Penrith F45 are delivered by trained and supportive coaches. They’ll ensure you enjoy your workout while also motivating you in all aspects of your fitness journey.

FIRST PR I Z E

$500 TRAVEL VOUCHER AT H E L LO W O R L D EMU PLAINS

8 weeks of unlimited training Access to 8 week challenge portal (portal includes weekly meal plans, blogs, tracking your progress etc) F45 8 week challenge information night Before and after body composition scans Before and after photos A lionheart heart rate monitor

• • • •

$600 UPFRONT OR 4 X FORTNIGHTLY PAYMENTS OF $150

JO I N U S FO R O U R NEX T 8 W EEK C H A L L ENG E BEFORE

JOIN TO DAY !

• •

AFTER

 55-61 York Road, Penrith (underneath Valentino’s Italian Restaurant)  0432 819 849  www.f45training.com.au/southpenrith

Issue 20 September 2018

29


Health

Tips To Help Promote Positive Mental Health

Trent Talks

There are little things we can do every day to look after our own mental health and wellbeing. PHYSICAL WELLBEING It’s easy to overlook the importance of a good night’s sleep and fresh, nutritious food to our mental health. Sleep helps you feel focused and motivated. An effective sleeping pattern, routinely going to bed and waking up at the same time, can improve this. You can help your mind and body perform at their best with a balanced diet. Less sugar and more fresh food, as well as lots of water, makes a world of difference. PHYSICAL ACTIVITY Getting your body moving improves your physical health while also relieving stress and helping process your thoughts.

DO WHAT MAKES YOU HAPPY Do what makes you truly happy! Hang out with friends and family, read a book, draw a picture, play with your pet, help your parents cook dinner, play a sport you love... whatever it is, do what makes your heart happy. A happy heart will help create a happy mind. JUST BREATHE If you’re feeling overwhelmed or uncomfortable, stop and take a moment to breathe. Close your eyes, count to five, and take long, deep breaths to relax. Repeat until you’re feeling less pressure. You can then go back to what you were doing with a clearer head. DON’T FORGET There are times we all need a bit of backup, and help is always available. Talk to someone you trust, like a family member or teacher, or call a help line and speak to a professional. The sooner you let someone know how you’re feeling, the sooner you can go back to feeling your best.

KNOW YOURSELF The only person who truly knows you, and who will ever understand how you’re feeling, is yourself. It’s so important to know what makes you happy or sad, and to know how to manage those feelings. Replace negative thoughts with positive ones and value yourself.

FRESH NEW

Spring & Summer Menu

COMING SOON

PANTHERS.COM.AU 30

roamingpanthermagazine.com.au

1300 PANTHERS

Help is available Don’t forget, it’s okay to accept help. • Kids Helpline: 1800 55 1800 • Lifeline: 13 11 14

Y u m Cha MADE AND COOKED FRESH TO ORDER

NOW AVAILABLE 7 DAYS A WEEK FOR LUNCH


MJ- THE LEGACY TOUR

F

R

I

*Kelly’s Brasserie, Kelly’s Café & Bar, The Ming all & Panthers owned bars. S

E

P

07

Terms & conditions apply. LTPS/18/23322

Direct from The United States – the world’s greatest tribute to the world’s greatest entertainer Michael Jackson. The choreographed dance moves, live band and multi-faceted light show promises to repeat the Michael Jackson experience. With a show produced and endorsed by previous members of his crew, this is as close as you will get to experience the King of Pop!

T I C K E T S F R O M $49.35 | 8PM

SYDNEY

S

A

T

*Kelly’s Brasserie, Kelly’s Café & Bar, The Ming all & Panthers owned bars. O

C

T

COMEDY FESTIVAL

06

Terms & conditions apply. LTPS/18/23322

The festivals funniest in one hilarious night! Tearing up the freeways of Australia for the sixth year in a row to bring the crème de la crème of the 2018 festival to Penrith! Expertly curated and lovingly presented, the showcase will feature some of the festival’s hottest acts live on stage for an incredible two hours of hard-hitting laughter. Boasting a line-up of veteran favourites, international stars, and some of the freshest emerging talents, this jam-packed night of pure entertainment will leave you sore from belly laughs!

T I C K E T S F R O M $35.05 | 8PM

Multi-platinum Spanish pop sensation Veronica Romero brings her high-energy pop-rock production show to Australia for the very first time. With hits such as ‘Besame’, ‘La Fuerza Del Sol’, ‘Lluvia’ and more you’re in for one entertaining night!

VERONICA ROMERO

F O

R

I

C

T

12

T I C K E T S $35 | 8PM

OVER

18’s ONLY

THE PROFESSOR

The Professors Mad Monday is all the stuff the boys weren’t allowed to show on Air. Its an over 18s show so people with a weak constitution or fans of Wayne Bennett may be offended. Don’t miss The Professor live! S

A

T

C

T

27

O

T I C K E T S $49 | 8PM

PANTHERS.COM.AU

1300 PANTHERS

TRIBUTE SHOW


Pets

Local Vet

Vet Nurses

Dr Erin Short Greencross Vets Coreen Avenue

THE UNSUNG HEROES OF OUR INDUSTRY

Veterinary nursing is one of the most highly skilled and misunderstood roles in our industry.

Veterinary nurses are the ultimate multitaskers.

updates on your pet’s condition, counsel you through difficult times, and provide support in times of grief.

O

ur nurses do so much behind the scenes that a pet owner doesn't see. You may first have contact with them over the phone or at reception and assume that’s their only role. Some people think nursing is just cuddling animals. Veterinary nurses are the ultimate multitaskers. In a single day, they will give advice over the phone and schedule appointments, monitor an anaesthetic, assist in surgery, and triage an emergency. When an animal is being treated in hospital they will clean cages, walk dogs, provide food and water, and give comfort and support. They set up IV fluids for patients, collect and run blood tests in our lab, give medications, and monitor your pet’s vital signs. They will give you

Many of our nurses develop special interests, or undertake additional training, to gain specialised skills. Nurses run our cat adoption, puppy preschool and juvenile dog training programs, and foster kittens until they’re ready for adoption. There are opportunities to specialise in areas like medicine, surgery, behaviour, and management. To become a veterinary nurse, you must complete a traineeship with on-the-job training. Learning is diverse, with areas including anatomy, physiology, parasites, anaesthetics, surgery, medical conditions, treatment, and behaviour. The traineeship includes written assignments, examinations, and practical assessments. To be a veterinary nurse you need compassion, a love of animals, and to be a hard worker. Veterinary nursing can be challenging but very rewarding. Veterinary nurses play a vital role in our industry and it’s important to recognise how valuable they are. Without them, there is absolutely no way us vets could do our jobs!

Same Great Team, Same Great Service We’ve changed our name!

AMANDA LITTLE & ASSOC. QP AD

Coreen Avenue Vets have changed names to Greencross Vets Coreen Avenue

Quality Loving Care

But we’re still the place where every pet has the opportunity to be loved, cared for and recognised as a priority.

Every pet entering the practice becomes an integral part of our family unit.

Unit 2 & 3/117 Coreen Ave Penrith, NSW, 2750

 02 4731 3055 32

roamingpanthermagazine.com.au

 www.greencrossvet.com.au


Relationships

For Love O or Money

ne of the most common things we argue about in our relationships is the vexed topic of money.

Pressures around money become significant when one partner is not as mindful with their spending as the other, who may be more careful. This can create anxiety and tension.

Nearly 50% of partners argue seriously about finances... is your relationship at risk?

Local Expert Melissa Ferrari Psychotherapist & Relationship Expert

each other’s back and always putting the relationship first, then you’re heading in the right direction to ensure that money won't be a negative factor in your relationship.

As we come together as a couple, we bring psychological baggage from our past. Childhood experiences, such as being affluent or financially challenged, can have an enormous impact on how we view money. When two people from different worlds come together, there’s always the potential for conflict. As individuals we like to think we can do what we like with our money. However, once we’re in a committed relationship, we need to consider how our spending impacts our partner. Without an open line of communication, the sudden decision to buy a new outfit or head out with your mates and gamble heavily, is a recipe for distrust. You’re no longer single, so you need to respect the new dynamic. This involves both of you agreeing on how you spend and save money, making clear decisions on whether you have joint funds and the level of independent discretionary spending you’re both comfortable with. Communicating about how you each see money is key. If you’re open and honest from the beginning, have

need some help? Struggling through the issues of money together or simply looking to reconnect with one another? Sign up for my couples retreat and rediscover the love that brought you together. Call 4733 4094 for details or visit online at www.melissaferrari.com.au.

The Relationship Expert Join Melissa Ferrari for An Insightful and Inspirational Small Group Couples Weekend Retreat at at the gorgeous Crowne Plaza Hawkesbury Valley boutique hotel nestled at the foothills of the Blue Mountains Friday 26th October – Sunday 28th October 2018

Final Retreat

Visit my website for more details, to register and read reviews from the retreat attendees

2018

• 2 day program with relationship education and experiential learning in group and 1 to 1 private sessions • Private, exclusive spacious spa room for 2 nights • Buffet breakfast, morning tea, lunch & afternoon tea provided • Friday night dinner feast • Fine dining Saturday night at the Harvest Restaurant • $100 spa voucher

melissaferrari.com.au Connect with me on social media by searching ‘Melissa Ferrari’

 02 4733 4094 or 0413 806 880  melissa@melissaferrari.com.au  Suite 11, 20-24 Castlereagh St, Penrith

Melissa Ferrari

Psychotherapist

I welcome couples to participate in this retreat. The program will guide you both through explorative engagement together to lead you to a secure-functioning relationship that is truly mutual, fair and collaborative and a relationship enlightened with the higher expectations we all wish to achieve with our chosen life partner.

Issue 20 September 2018

33


Beauty

Men Need Beauty Treatments Too! Local Expert

Marianne Arthur Beauty Expert Insignia Hair and Day Spa

Perhaps if we removed the word ‘beauty’ there might be more men who look after their skin.

I

n fact, due to their coarser skin, larger pores and increased chance of sun damage, I would say that men need facials more than women. A facial for a man will not only give a deep clean, sloughing off dead skin cells and helping unclog pores, but also soothe irritated skin. This will give a smoother shave, dissolve excess oils, and keep the skin hydrated. The skin on your face and neck is exposed to the negative effects of our environment. These external pollutants, in combination with daily shaving and lack of a good skin care regime, can wreak havoc on your skin. The result? Irritations, razor burns, pimples, blackheads and pigmentation. At home, all men should be cleansing and moisturising daily (twice a day would be fantastic!), and exfoliating a few times a week. A facial cleanser gets deep into the pores to remove any excess dirt and oils from the skin. DO NOT use body soaps! They will alter the PH of your skin, potentially making it drier, more irritated, and more prone to bacteria. (And think about it - if you use that soap on other areas of your body, do you really want it on your face?!)

also be the result of dehydration, which can cause the glands to produce more oil as a form of compensation. Every man should be moisturising, despite their skin type. Using a moisturiser with an SPF will help slow down premature ageing, as well as help prevent pigmentation and skin cancer. Exfoliation will be your best friend… yes, a best friend without a beer is hard to believe, I know! Regular exfoliation will reduce your chances of getting ingrown hairs from shaving. It will also control the build-up of oils, helping your skin look fresher and clearer. It’s a deeper clean that stimulates the growth of new skin cells, which means it’s great for wrinkles, too! Now guys, if you’re reading this you should not be stealing your partner’s facial products… well at least not until after you’ve had your first facial treatment! Chances are, due to the thickness of your skin and higher production of testosterone (which means you also produce more oil), you would more than likely need different products. There may be the odd product you can both use, but never assume or you can do more damage than good. Oh... did I mention that a facial involves massage as well? Men need some R&R too! Enough said!

A common mistake that many men with oily skin make is skimping out on the moisturiser. However, oily skin can

The Highest Standard in Concreting Services in Penrith & Blue Mountains AF FORDABL E S E RVICE S TA ILO RE D TO S U I T YOU

A facial for a man will not only give a deep clean, sloughing off dead skin cells and helping unclog pores, but also soothe irritated skin. This will give a smoother shave, dissolve excess oils, and keep the skin hydrated. get in touch for a facial today Make an appointment now and experience the benefits of a facial for men by contacting Marianne at Insignia Hair and Day Spa on 4722 3503.

CALL US NOW

0411 704 302

WWW.SLCONCRETE.COM.AU


Jewellery

Creating Memories ON YOUR ANNIVERSARY

Jewellery With DOUGLAS ELY Designer | Jeweller

Nothing says ‘I love you’ like a jewel to mark each milestone

E

very wedding anniversary is a milestone. Each year brings with it an opportunity to celebrate your love and commemorate your life together. You have a chance to reflect on memories, celebrating your partner and the life you’ve built. The perfect way to mark an anniversary is with a timeless gift that will not only represent your love today, but also last into your future.

for your partner. Gifts can include dress rings, earrings, bracelets and necklaces. More significant anniversaries include silver for 25 years, pearl for 30 years, ruby, sapphire, emerald and the Diamond Jubilee for your 60th anniversary. As you reach these longterm milestones, the precious nature of the traditional gifts means that there are more factors involved in your purchase decision. Ideally, you’ll be looking for gemstones that have formed naturally, with minimal inclusions. These elements guarantee the rarity and uniqueness of your jewellery.

Over time, wedding anniversaries have been symbolically represented by a traditional gift. The first wedding anniversary gift is gold. As one of the most precious natural materials on earth, gold is the perfect reminder of the nature of your relationship. Gold can be worked in a variety of ways and, as it’s a staple in jewellery, you have countless options available when picking your gift. One of the most meaningful ideas for a first anniversary is a gold eternity band. The eternity band is given to complete the symbol of your wedding ring set. The incorporation of gold ensures durability and beauty. Within the first decade of your marriage, traditional gifts include blue topaz, jade, garnet and tourmaline. These semi-precious gemstones come in an array of colours and hues, providing many options when choosing a gift. The attraction of these gems is that their naturallyoccurring differences, including colour variation, shape and size, allow you to choose a unique gift that’s perfect

NEED SOME HELP? For help finding the perfect gift for your spouse on your next anniversary, talk to the expert team at York Jewellers instore at Westfield Penrith or call us on 4721 0780.

For All Your Beauty Needs

Insignia Hair & Day Spa is an award winning hairdresser located in Penrith. We also have a full Day Spa with Beauty Salon, Massage Therapist and Nail Parlour all in the heart of Penrith. Insignia Hair & Day Spa is your Hairdresser in Penrith we specialise in creative cutting and colouring for men, women and children, colour correction, total restyles and makeovers to make you look and feel amazing.

HAIR

BEAUTY

DAY SPA

 (02) 4722 3503

 14/69 York Rd, Penrith NSW 2750

i n si gn ia h a ira n d d a ysp a .com.au Issue 20 September 2018

35


Budget

HOW TO GET

Cheaper Fuel I admit, I’m one of those people that checks the price of fuel every time I pass a service station.

Local Expert

Maria-Luisa Patisso Budget Expert My So-Called Lifestyle

I

can't believe that fuel prices differ as much as 30c depending on location and company – it’s crazy!

My car holds 60ltrs of fuel, which costs anywhere between $80 and $100 each week. I used to drive from station to station, using my supermarket coupons to find the cheapest pump, until I came across the government’s Fuel Check App. It’s a great time saver and easy to use. Download it in your phone’s app store and give it a go. As an example, I work in Lidcombe and live in Penrith. When leaving work, I checked the local prices of fuel. I also checked the prices in Penrith. I found that by filling up near work, I would save $10 in one transaction. Even just to check the best prices in Penrith, I would open the app, pop in the postcode, and have access to all the local prices (including those stations that I have a 4c coupon for). I encourage you all to take a look, download, and start saving money. FOR MORE TIPS AND TRICKS For more money-saving ideas and lifestyle hacks, follow me on: Facebook: My So-Called Lifestyle Instagram: @mysclifestyle

We can honestly say that we highly recommend Clear Path Accounting! We have worked with them for years now and we are more than satisfied! Nick - The Professional Painters

Our mission is to empower you with clarity and direction to build your perfect business We share relevant solutions, provide outstanding support and inspire positive change. We strive to unlock the full potential of your business and we will help you take control and accelerate results to achieve your goals. We will bring clarity and simplicity to the accounting and financial side of your business. We price our services upfront, which means no surprise accounting fees for you. Business Advisory Accounting Taxation Bookkeeping Self-Managed Super Funds

Contact us now to find out more!

clearpathaccounting.com.au 36

roamingpanthermagazine.com.au

 02 4739 2700  Suite 1, 13 Hope Street, Blaxland NSW 2774


Finance

TAX TREATMENT OF

Cryptocurrencies

Local Expert Melissa Browne Money & Business Strategy Expert Accounting & Taxation Advantage

Most of us have heard of the term cryptocurrency or, at the very least, Bitcoin.

I

f you haven’t, cryptocurrency is generally used to describe a digital asset in which encryption techniques are used to regulate the generation of additional units and verify transactions on the blockchain.

In the last financial year, millennials through to baby boomers have either owned or sold some type of cryptocurrency asset. If that’s you, the question you need to consider is: What does buying, selling or holding these cryptocurrencies mean for you? The ATO is taking a close interest in what you’re declaring when it comes to digital currencies. And the fact that you didn’t know won’t be an excuse if you receive a data matching audit and a ‘please explain’.

The ATO is taking a close interest in what you’re declaring when it comes to digital currencies. So... what does that mean for you at tax time? CRYPTOCURRENCY AS AN INVESTMENT If you purchased cryptocurrency as an investment, you may have to pay tax on any capital gain you make on disposal of the cryptocurrency. If you’ve held it for 12 months or more, you may be entitled to the CGT discount of up to 50%. And don’t forget to include any costs of holding, researching or selling your cryptocurrency, which can all be added to the cost base. CRYPTOCURRENCY AS A PERSONAL USE ASSET Cryptocurrency may be classified as a personal use asset if it’s acquired and kept or used mainly to purchase items for personal use or consumption. In this case, capital gains or losses that arise from its disposal may be disregarded. The catch is, only capital gains you make from personal use assets acquired for less than $10,000 are disregarded for CGT purposes.

Your Conveyancing Simply Made Easy!

CRYPTOCURRENCIES USED FOR BUSINESS TRANSACTIONS If you accept cryptocurrencies in exchange for products or services in the normal course of business, you need to include the value of the cryptocurrency in Australian dollars as part of your ordinary income in the same manner you would for any other non-cash barter arrangements. CARRYING ON A BUSINESS IN CRYPTOCURRENCY If your business is the trading of cryptocurrency, you may be able to declare your gains as normal income and not capital gains. If you’re unsure of whether you’re an investor or carrying on a business, the ATO considers such things as whether you have a business plan and are acting in accordance with that plan, whether you prepare accounting records, if you have a business name, and whether you intend to make a profit. SWAPPING ONE CRYPTOCURRENCY FOR ANOTHER

Specialists in all property transactions throughout NSW We pride ourselves on treating each transaction as if it were our own, making it a stress-free and simple process that is tailored specifically to each individual clients circumstances.

In your mind this may not be a sale, however according to the ATO, this may be a CGT event in which capital gains tax is payable. Essentially you have sold one CGT asset and purchased one or more CGT assets.

CONTACT US FOR AN OBLIGATION

MELISSA BROWNE Melissa Browne is CEO of accounting firm A&TA and financial planning firm The Money Barre. Her latest book, Unf*ck your Finances, is instore now at all good bookstores.

Shop 1, 1216 Mulgoa Road, Mulgoa NSW 2745 Ph: 02 4704 3100 | Fax: 02 4704 3101

FREE QUOTE

www.conveyancingsimplif ied.com.au Issue 20 September 2018

37


Property

Upsizing Your Home

Local Expert

Sharon Mudiman Property Expert Bespoke Realty Group

IN A SO F T M A RKE T

Can you really lower your costs by upsizing when the market is down?

C

hanges in legislation mid-year meant downsizers over 65 are now eligible to invest up to $300,000 per person into their super from the sale of their family home. While there are key considerations when deciding if this is profitable for baby boomers, there has been a sharp increase in those over 65 enquiring and actively selling their family homes. While the change in legislation doesn’t guarantee that a flood of family homes will soon hit the market, it does beg the question; What does this mean for daydreaming upsizers? Most homeowners only consider upsizing in a thriving market, based on the golden rule of ‘selling when the market is up’. There are, however, arguments to this approach. It’s suggested that the sale of your home in a soft market, with the direct intention of upsizing, can have a significant impact on lowering your overall costs. Generally, when the market is soft, the prices are lower. When selling, this may hinder your sale price. However, a slower market also means a stronger position from which to negotiate a purchase. From a dollar standpoint, a lower sale price also means potentially less capital gains tax for investment property sales. You’ll also enjoy a windfall of savings when upsizing to a larger home during a soft market by incurring lower stamp duty than when buying at a higher price in a booming market.

38

roamingpanthermagazine.com.au

From a marketing perspective, it’s also important to consider the timing of your sale. If possible, avoid hitting the market when it’s saturated with other homes. An excess of listings puts the power back into buyer’s hands. With an abundant selection of homes to choose from, their ability to negotiate is far stronger. Competition drives a strong market so for vendors, the less homes on the market at the time of your sale the better, regardless of the season. With so many considerations and an ever-evolving market, it’s important to ensure you have all the facts and a balanced view of the current climate. For further information on how the current market is impacting buyers and sellers in our area, please feel free to contact one of our local area experts.

SPEAK TO BESPOKE REALTY GROUP ABOUT YOUR UPSIZING OPTIONS

While the change in legislation doesn’t guarantee that a flood of family homes will soon hit the market, it does beg the question; What does this mean for daydreaming upsizers?

Sharon Mudiman, Licensee and Principal of Bespoke Realty Group (formerly Glenmore Park First National), has been negotiating the sale of property for over 25 years in the Greater Penrith Region. Get in touch with Sharon today on 4737 9977 or visit bespokerg.com.au.

Sharon Mudiman, Licensee and Principal of Bespoke Realty Group (formerly Glenmore Park First National), has been negotiating the sale of property for over 25 years in the Greater Penrith Region.


SHARON MUDIMAN 0413 757 9 9 8

CRANEBROOK 1 P L U TO C LO S E C R A N E B R O O K 2749 4 B E D | 2 B AT H | 2 G A R A G E


Lending

Finance to Renovate?

HOW DO I GET

Home renovations are often expensive. Whether it’s a new kitchen, bathroom or an extension, it’s likely you’ll need to borrow money. So here are some ways to finance that renovation. YOUR FINANCE CHOICES When it comes to financing a home renovation, your main options are to: • Redraw from your current loan • Refinance your existing loan • Consider a building and construction loan. The option you choose will depend on your particular circumstances, but some lenders will require you to take out a particular type of loan for a renovation. So it’s important to look at the pros and cons of each option, and also to consult your mortgage specialist upfront about the right finance option for you so that you can achieve your renovation sooner. REA Layoutai.pdf

1

C

M

Y

CM

MY

CY

CMY

K

40

roamingpanthermagazine.com.au

15/8/18

4:26 pm

1

Local Expert Peita Davies

Home Loan Specialist realestate.com.au Home Loans Penrith

REDRAW FROM YOUR CURRENT LOAN

Not all home loans have a redraw facility. For those that do and where you have made extra payments on your home loan, this can be a method of financing your renovation. If you use a redraw facility, the balance on your mortgage will increase, as will the amount of interest you pay. 2 INCREASE YOUR EXISTING LOAN

The information contained in this article is intended to be of a general nature only. It has been prepared without taking into account your personal objectives, financial situation or needs. realestate.com.au Home Loans recommends that you seek independent legal, financial, and taxation advice before acting on any information in this article.

if you had borrowed the whole amount upfront as you only pay interest on what you have drawn down. By paying for each bill as it comes in, you also help cash flow. These type of loans require some paperwork: you need to provide plans, permits and fixed price contracts, and there are also inspections and valuations required along the way. The progress payments are controlled by the bank based on the schedule provided in the contract. And you will generally have to pay a fee for each progressive drawdown.

You may want to consider refinancing your existing loan. This may mean moving your home loan to another lender, borrowing against equity, or simply changing the terms of a loan to increase your borrowing limit with your current lender and access more money. If you are changing the terms of your loan it’s also a good opportunity to consider whether debt consolidation would be of benefit. By putting all debts into the one loan, you make only one repayment.

If you’re an owner builder, your mortgage specialist will be able to advise you on the best way forward.

3 DISCUSS A BUILDING AND CONSTRUCTION LOAN

JOIN US FOR A Renovation Workshop

A building and construction loan allows you to receive your loan in increments or progress payments, so that you can pay invoices as they arrive. This facility is called “progressive drawdown” and your interest payments are usually lower than

FINALLY… You’ll need to research which of these common finance options is right for your particular circumstances. Renovations almost always require financial investment, but can add value to your home, not to mention improving your lifestyle.

Need more information in gaining finance for renovation? Attend our upcoming workshop.

 18 Sep from 6:30pm  1B Castlereagh St, Penrith  RSVP: 4751 1360


Travel

Local Experts

European Christmas Getaway

Lynette, Kerrie, Jenny & Nicole

PLAN YOUR

Prague, Vienna, Munich, Berlin... enjoy the festivities and magic of a gloriously white Christmas.

T

here’s no better way to enjoy a white Christmas than by visiting the European towns best known for their twinkling markets, Yuletide delights, towering Christmas trees, gingerbread, Glühwein, and carol singers. Christmas markets run from late November through to the end of December, with most open on Christmas Day. The history of Christmas markets goes back to the 1400’s in the German city of Dresden. It now attracts over two million visitors to explore the 250+ stalls every year. Stuttgart Christmas markets attracts more than three million visitors annually, with the Dortmund market, one of Germany’s largest, featuring 300+ stalls packed around a breathtaking 45-metre tall Christmas tree. Although there’s a variety of Christmas markets across central Europe, Munich’s Christmas markets are the most

Travel Experts Maria, Fellowes & Turner Travel Associates Penrith

famous. Authentic Bavarian food, ale and music make this an unforgettable experience. There’s also the 500-yearold tradition of the Krampus Run, showcasing spectacular medieval masks and costumes, as well as carols alongside the 30-metre tall Christmas tree at the Manger market. Prague’s city is a picturesque place to host two Christmas markets; Old Town Square and Wenceslas Square. Both markets can easily be explored in one day, but what really sets them apart is the yummy Czech treats (you just have to try a klobása (Czech sausage)). Both markets are open every day over the festive period until January 6, including Christmas Day. Austria’s capital, Vienna, is a historic backdrop for a traditional Christmas market. Serving everything from boozy Christmas punch to gut-busting Austrian sausages, the markets take place in front of City Hall and run until Christmas Eve. There’s a huge ice rink for skating, reindeer rides for kids, and a classic nativity scene. Strasbourg, in eastern France, is home to one of Europe’s oldest Christmas markets. It’s easy to spend the best part

of a week here indulging in end-of-year festivities, picking up decorations and presents, and drinking local Alsatian wine. Be sure to head to Place Kleber where you’ll find the Great Christmas Tree towering the city skyline. Of course, Berlin’s variety of markets make it a hugely popular destination during the festive season. One of the best is Gendarmenmarkt - visit the classic wooden huts for classic, elegant ornaments and trinkets, indulge in delicious sausages and warming cups of mulled wine, and relax at the nightly concerts, from jazz to carols. One thing remains certain - no matter which markets you choose, you can’t make a bad choice! plan your European Christmas Now! There truly is nothing like a European Christmas, filled with magic and wonder. We can help you get there – call the Travel Associates team on 1800 040 744 today and let’s see what St. Nick has on offer!

Prague, Czech. Christmas market at Old Town Square

15 DAY LUXURY EUROPEAN RIVER CRUISE * from $6995 ROMANTIC

RHONE - BONUS AND SEINEPLUS INLE HIDDENS WONDER OF MYANMAR FLY LAKE FREE*

Vienna, Austria. Rathaus and Christmas market

Downtown Munich, Germany

Experience centuries of history, legend and enchantment as you discover Europe with APT. From cruising along tranquil estuaries and mighty rivers to traversing storybook scenery, they’ve left no Uncover the hidden gems of Myanmar on a spellbinding APT cruise course uncharted in creating an unforgettable European journey. • Room service and complimentary • 15 Dayalong APT Europe Cruise one ofRiver Asia’s finest backwaters, the Irrawaddy River. Your luxury experience Includes: laundry for select suites Arles to Paris l Return economy class from Australia•to Europe All-inclusive sightseeing in up to • Return flights Sydney toairfare Europe Your unforgettable holiday includes 15 destinations including prepaid taxes up to $300* l l 18 l 3 nights 14day Nights onboard the luxurious MS AmaBella Asiaaccommodation river cruise and tour post-cruise accommodation • APT’s Freedom of Choice Inclusions • 14 Nights accommodation staying Yangon at Sanctum Resort* l departing 14 breakfasts, 13 lunches, 14 dinners and a range of complimentary 11 locations MS AmaLyra l onboard l in Return economy airfare to Asia Finest dining a total of 48 meals beverages served on board including prepaid taxes of 14 $200* •l Expert APT Cruise director served • Enjoy 41 Meals, including Complimentary beverages l All-inclusive sightseeing in up to 16 destinations 13 Lunches, 14 Dinners l Breakfasts, 14 nights accommodation on board your cruise FLY l RVcomplimentary Samatha 3range APT exclusive Royal Signature Experiences, The Grand Empress steam train, • Aonboard of FREE* Princess Heide’s Namedy Castle & Vienna Palace concert from $12,195* beverages served on board From All-inclusive sightseeing in upCity to 17 destinations

$11,095*

Freecall 1800 040 744 or email penrith@travel-associates.com.au 14 Macquarie Avenue, Penrith. travel-associates.com.au/mariafellowes Berlin, Germany. Fireworks over Christmas markets at Gendarmenmarkt

Trestrictions &restrictions C’s - Conditions apply. Prices are correct as at&8subject 2019 and based onfor 23for May 2019 departure. Travel conditions apply. Prices per person &Aug subject availability. Valid sale until unless sold *Travel && conditions apply. Prices areare per person to to availability. Valid sale until 3020 AprJun 18,18, unless sold outout prior. prior. Price based on TA293 outsidePrice 24 Jan 19 dept. at Sanctum Deal IDis5212668. is based on Deal inside5165152. cabin 13Post Apr accommodation 19 departure. DEAL 5129319.Resort or similar in Inle Lake. Flight Centre Travel Group Limited (ABN 25 003 377 188) trading as Travel Associates. ATAS Accreditation No. A10412 Flight Centre Travel Group Limited (ABN 25 003 377 188) trading as Travel Associates. ATAS Accreditation No. A10412 Issue 20 September 2018

41


Legal

Foreign Surcharge Duty

Local Expert Legal Expert Joseph Grassi + Associates

Is that overseas contact costing you money?

B

1 Someone who is not an Australian citizen, or 2 A company which is not incorporated in Australia or one

in which a foreign person holds a substantial interest. uyer beware. Since 21 June 2016, two things have happened that could cost you money:

The Chief Commissioner of State Revenue has issued Revenue Ruling No G010 Version 2. The following partly-reproduced paragraphs explain the effect the surcharge purchaser duty and surcharge land tax has on a discretionary trust:

1 A stamp duty surcharge has been applied to purchases

of NSW residential land by foreign persons, and

2 A land tax surcharge has been applied to foreign

1 For a discretionary trust, each beneficiary to whom

persons who are owners of residential land in NSW, including foreign corporations, trusts and governments.

the trustee has discretion to distribute the income or property is deemed to have the maximum percentage interest in the income or property that the trustee may exercise a discretion to distribute to them. …

These surcharges are payable in addition to other duties (such as stamp duty and land tax on land holdings), and do not apply to Australian citizens.

2 The result is that any beneficiary who is a foreign

person will almost always be deemed to hold a substantial interest in the trust, and the trustee

For this article, a foreign person (refer Revenue Ruling No G009) is:

will be deemed to be a foreign person who will be potentially liable for surcharge purchaser duty and surcharge land tax. In short, if there is a beneficiary in a discretionary trust who is a ‘foreign person’, then the surcharge will be payable by the trust - whether or not that particular beneficiary receives a distribution of income or capital. The Chief Commissioner has a discretion to give retrospective effect to amendments of trust deeds which will remove the Trustees’ power to make distributions to any ‘foreign person’. Existing discretionary trust deeds need to include a prohibition on the Trustees to ensure that there is no distribution to ‘foreign persons’. If they don’t have that provision, they should be amended; otherwise the Trustees may find themselves with an obligation to pay more to the State Government than they had originally planned. Reference: NSW Foreign Surcharges under the Duties Act 1997 and the Land Tax Act 1956.

EXPERIENCE & RELIABILITY Personal Legal Services • Property and Conveyancing • Wills, Probate & Administration • Estate Planning

• Asset Protection Planning & Implementation • Notarial Services

Commercial Legal Services • Planning & Environment Law • Commercial Advice • Corporate Law & Governance • Business Law • Employment & Industrial Law

• Retail, Commercial & Industrial Leasing • OH&S Law • Debt Recovery, Bankruptcy & Insolvency Law

• Intellectual Property

Solicitor Director: Joseph M Grassi Dip Law (SAB) LLM Accredited Specialist Property Law Notary Public Solicitor: Grant Wiblin LLB, BSocSc, GDipLegalPrac Licensed Conveyancer: Wendy Harvey | Office Manager: Lois Grassi | Administration: Emily Beal

 Suite 1, 86 Henry Street, Penrith 2750  info@grassiassociates.com.au

 4702 5905 42

roamingpanthermagazine.com.au

www.grassiassociates.com.au

This article is for general information only and is not intended as legal advice. If you need specific help, contact your solicitor.

Joseph Grassi


Digital

Our Favourite Apps & Extensions There’s no doubt that apps and extensions help us work smarter and faster.

S

ince they play a big part in our lives, I thought I’d share my absolute favourites!

LastPass: This nifty program saves all of your online passwords so you only have to remember one – your master password! It also lets you share passwords, which we don’t recommend for critical websites (such as banking), but it’s great for general sites.

iCloud Dashboard: Access your iCloud Dashboard from any computer or device, anywhere, anytime. Switch from computer to laptop to iPad to iPhone, picking

Local Expert Trish Fehon Digital Expert Online Influence

up where you left off. It’s also possible to login via the iCloud website without using the extension. Full Page Screen Capture: This extension lets you take a screenshot of an entire web page, which you can then save as a PDF or image. Bitly: Shorten, measure, customise, and optimise your links. Share your links straight from your browser and then track how often the link is clicked on. Zoom: A simple video sharing platform that allows you to share screens, record your calls, host online meetings, and much more. Podio Project Management: Get your teams working in sync. Content, conversations and processes structured and together in one tool.

Gmail extensions: Canned Responses – if you’re constantly asked the same question, this lets you create template emails to simply load into your response. MeisterTask for Gmail – lets you turn emails into tasks and automatically insert them in your MeisterTask project and section of your choice. DocuSign for Gmail – Send PDFs and documents for online signature or add your own in minutes. Sign or send online directly from Gmail. There you have it – some of my favourites. Here’s hoping one or more of these apps and extensions will make your online life simpler.

Loom: Capture, narrate and instantly share videos (and your screen) to communicate quickly and clearly. Loom also integrates with Gmail.

Online Influence Penrith can help you with all your online marketing needs Website Design and Development Google Advertising Facebook Advertising Email Marketing campaigns Search Engine Optimisation (SEO) E-commerce (Shopping carts)

Online Influence is a Google Partner, a Facebook Ad agency and a boutique Web development company that specialises in helping you get leads and sales from your website.

www.Onlineinfluence.com.au

0247 249 555 Level 1, 331 High Street, Penrith NSW 2750 Specialized in:

Search ads

Issue 20 September 2018

43


Motoring

Car Tyre Maintenance Tips Keeping your tyres in good condition is essential to maintaining a road-worthy car.

1 TYRE ROTATION

Manufacturers differ, but most advise that tyres should be rotated every 8,000 to 10,000 km’s. Front tyres carry more of the car’s weight and tend to wear out quicker than the rear tyres, so rotating can extend their life. 2

Local Expert

Steve Jennings Motoring Expert Trivett Classic BMW Penrith

TYRE PRESSURE

Tyre pressure is critical and should be checked monthly, more often if you drive many kilometres and always before setting out on a long journey. Properly inflated tyres protects against tyre damage, while driving with low pressure tyres increases fuel consumption. To find the correct tyre pressure for your car, check the user manual, the label on the door, or inside the fuel flap. 3 TYRE TREAD DEPTH

Tyre tread helps remove water between the tyre and road, ensuring the car remains under control and preventing the risk of aquaplaning. The minimum tread depth for NSW is 1.5mm. It’s easy to see if the tyre meets this by checking the tread wear indicator bars, placed at regular

points across the tread. They will be level with the tread blocks when the minimum tread is reached. 4 WHEEL BALANCE AND ALIGNMENT

Wheel alignment is the process of properly aligning the wheels and axles for optimum handling, safety and tyre protection. Wheel balancing balances the wheel and tyres, protecting the bearings and suspension, preventing premature tyre wear, and stopping vibration. 5 REPAIR AND REPLACEMENT

If you’re in any doubt as to the roadworthiness of your tyres, take them to a specialist. Specialists can check the internal and external condition of the tyre, ensuring compliance with all legal and manufacturer requirements. Following repair and/or replacement, they’ll also ensure the tyre is correctly re-fitted. There will come a time when your tyres require replacement. This may depend on kilometres, driving style, climate, and storage. It’s essential to check your tyres on a regular basis and replace them when required.

COMPLIMENTARY 5 YEAR SCHEDULED SERVICING. ^

AT TRIVETT CLASSIC PENRITH. Come and view our new and demonstrator models and drive away with complimentary 5 year/80,000KM BMW Service Inclusive – Basic.^ But hurry, offer ends 30 September.

Rd

Trivett Classic Penrith 14 Jack Williams Drive, Penrith. PH: (02) 4702 8960. www.trivettclassicbmw.com.au

Castle

reagh

Jack Williams Drv

Rd

Coreen Ave

h

g

Ca s

re a tle

Penrith Station

Great W estern Hw

y

Westfield Penrith

44

roamingpanthermagazine.com.au

^BMW Service Inclusive – Basic based on the vehicle’s Condition Based service monitoring system for 5 years from date of first registration or up to 80,000kms, whichever occurs first. Normal wear terms and other exclusions apply. Scheduled Servicing must be conducted by an authorised BMW dealer. BMW Service Inclusive – Basic is provided by Trivett Classic Pty Ltd, for vehicles distributed by Trivett Classic Pty Ltd ABN 35 000 874 706 and applies to all New, Demonstrator and Eligible Approved Used Premium Selection BMW & MINI vehicles purchased at Trivett Classic BMW Penrith (14 Jack Williams Dr, Penrith NSW 2750). Excludes M & Special Vehicles (6, 7 & i cars) and fleet, government & rental buyers. Offer valid on vehicles ordered between 1st August and 30th September 2018 and delivered by 31st October 2018. Redeemed by mentioning the Trivett Classic BMW Penrith Advertisement in Roaming Magazine. Please visit trivett.com.au or consult Trivett Classic BMW Penrith for more details. MD579. EB700


Local Business

ROAMING WITH

Local Business

1

WHEN DID YOU FIRST OPEN BESPOKE  REALTY GROUP?

We recently rebranded as Bespoke Realty after 11 years trading as Glenmore Park First National. We merged with Century 21 Renshaw in March 2017 and, given that Penrith already had a First National office, we chose to rebrand and start afresh as Bespoke Realty Group. 2 T ELL US MORE ABOUT YOUR INDUSTRY

EXPERIENCE. HOW LONG HAVE YOU BEEN A LOCAL REAL ESTATE AGENT AND BUSINESS OWNER?

MEET SHARON MUDIMAN, LICENSEE AND PRINCIPAL OF BESPOKE REALTY GROUP.

I’ve been negotiating property sales for over 25 years in the Greater Penrith region and a local business owner for over a decade. One career highlight was being a member of the Regional Council of First National for over five years. It gave me incredible insight into both the industry and the local area. 3 TELL US MORE ABOUT YOUR TEAM. 

We’re proud to be a family-run business. Bespoke Reality is directed by myself and co-managed by my sister, Narelle Withers. We have a team of 18 dedicated, knowledgeable, fun and committed individuals who genuinely care about what they do. Between all of us, we offer combined experience of over 120 years in residential sales and property management. 4 W HAT WOULD YOU SAY YOUR POINT

OF DIFFERENCE WOULD BE? It’s definitely the relationships we hold dear with clients past, present, and future. We have over a decade of

experience representing the local community with the sale of their homes. We’re locally owned, operated and staffed. And we’re a family-run business that tailors solutions to each client’s specific needs, every time. 5 B EING A LOCAL BUSINESS OWNER,

YOU WOULD KNOW THE IMPORTANCE OF COMMUNITY INVOLVEMENT. HOW DO YOU GIVE BACK TO THE COMMUNITY?

We take great pride in contributing to our local community. We’re long-time sponsors of a range of local school, sporting and interest groups, including the school holiday karate and colouring contests with Surveyors Creek Primary School, the Brumbies Junior Rugby League Club and, recently, the Seniors Week Tai Chi event. 6 F INALLY, WHAT DO YOU LOVE MOST

ABOUT WORKING AND LIVING IN THE PENRITH REGION?

The balanced work and lifestyle, as well as the friendly locals, are my favourite things about living locally. Family, friends, the Nepean River and Blue Mountains are all at my fingertips, yet I’m still close enough to enjoy city life and easy airport access. There’s also plenty of opportunity for growth – it really is the ultimate lifestyle location.

GET IN TOUCH    

Bespoke Realty Group Glenmore Park | Penrith | Jamisontown 4737 9977 bespokerg.com.au

SUPP

O RT I

NG

Issue 20 September 2018

45


Horoscopes

Horoscopes By Sherrynne Dalby

Virgo

(23 AUG – 23 SEP)

Libra (23 SEP – 23 OCT) Self focus can be a positive thing. There may be negative connotations attached but self focus is not selfish. You can find yourself doing a lot of contemplation or self focus right now. You’re looking for change, in both your surroundings and yourself. You feel something is lacking; something that you can improve yourself and, in doing so, improve your life. Sometimes all it takes is patience, perseverance and a willingness to put in a concerted effort. Make the decision now, make a plan, and put it into action. It doesn’t require money but if you need to you can find it.

Sagittarius (22 NOV – 22 DEC)

Ruling Planet: Mercury Sign:

The Virgin/Maiden

Gemstones:

Sardonyx

Colours:

Navy blue, dark brown, green

Day:

Wednesday

Number:

Five

This is your annual time for renewal. Happy Solar Return Virgo! The saying ‘Many Happy Returns’ is a reference to the sun returning each year to the same area in the sky that it was at the time of birth. For Virgo this year, that is from 23 August until September 23 and covers all those born under the sign of the Maiden. The coming month will give you a snapshot of the year ahead. Pay attention to what is going on around your birthday for clues.

You have been juggling career commitments and the demands of home and family. Although this can sometimes be very stressful, you’re managing it quite well at the moment. This should be translating into a positive return into your bank account as it results in not only an increase in responsibility, but also in rewards. There is still the need to maintain your budget but, if you have a little extra, by all means invest in a little fun. Remember to take any opportunities that come knocking as they may not make a return trip.

Aquarius (20 JAN – 19 FEB) You can be feeling a little unsettled at the moment. This can be affecting not just your self, but all facets of life. You have opportunities for career advancement but this can mean a shake-up around the home. This can also be an opportune time for investment, but make sure you read the fine print. Energy levels have been less than optimum of late but this should improve by the end of the month. As energy improves, be cautious that you don’t push too hard and go over the top, doing damage.

It’s a busy month and year ahead, especially for those with September birthdays. It can be frustrating trying to get your voice heard but, if you can strike the right note, this year can be the best time to be heard. It’s also a good year for study. August birthdays can expect a year where there is a greater focus on others. Relationships play a large role in the coming year. Birthdays around the 10th have the opportunity for beginning new projects, and this year can be positive for all new enterprises. No matter what you are doing over the coming month and year, keep your eyes wide open.

Career matters may have been on hold of late, or even moving in reverse. This should change mid-month, when you can again move forward on projects. It may feel as though you’re wading through mud initially, but enlisting the assistance of colleagues and friends can speed things up. You may have been experiencing some pretty intense moments where others are concerned, and there may be quite a build up of tension. This will begin to ease by mid-month but may heat up again before it resolves completely. Now is a good time to get healthy.

Gemini (21 MAY – 21 JUN)

Cancer (21 JUN – 23 JUL)

You can feel as though you’re being pulled in opposite directions. The trick is to find a way to bring it all together in balance. Having a plan, writing lists and being organised are all tools that can ease tension. Tapping into your creativity can also help find a solution. May birthdays in particular can feel a positive change moving through towards the end of the month. Make the most of opportunities as they arise over the next month or so. The opportunity to shine by expressing your true self is not that common, so make the most of it.

Relationships can take a more serious turn over the next few months. You may be looking to make a more serious or long-term commitment. It’s about consolidation; you’ve already made the decisions, it’s time to act on them. Life may not have been meant to be easy, to quote a former Prime Minister, but it also wasn’t meant to be so hard or so serious. Now is the time to lighten up and play a little, to let your hair down and relax. Do something you really enjoy for no other reason than you really enjoy it.

46

roamingpanthermagazine.com.au

Aries (21 MAR – 20 APR)

Scorpio (23 OCT – 22 NOV) Networking can bring unexpected returns this month, especially if you’re willing to be creative in your approach. Relationships can be a little more hectic mid-month. For some this can be an exciting time; for others, it can be unnerving. Whichever it is, there will be a shakeup. Sometimes you need to shake the complacency out in order to build more solid foundations. If you’re on for the long haul, you will welcome this. Always of prime importance in any relationship is communication. Keep the channels open, making sure it’s a two-way radio.

Capricorn (22 DEC – 20 JAN) You have been feeling a little indecisive lately, secondguessing yourself and lacking your usual confidence. Everything seems to have been in a holding pattern; you’re waiting, but nothing is happening. Things will begin moving forward again by mid-month. There will also be a shift in finances towards the end of the month. Your slump is coming to an end as you rediscover your mojo. Career comes back into focus from the 25th, and will highlight alongside family. Try to be innovative in your approach and not fall back into a rut.

Pisces (19 FEB – 21 MAR) You may be getting fed up with the need to accommodate others but relationships of all types are still at the forefront. If there is confusion, take a deep breath, a step back, and a realistic look. It’s time to take a fresh approach to the way you interact with others. If people take advantage, stand up for yourself. You can be very generous with your time and energy but remember to save some for yourself. It may become necessary to rein in spending late in the month, but new sources of income may become available.

Taurus (20 APR – 21 MAY) You are really trying to find yourself at the moment, looking to unlock your potential and turn it into something tangible. Things become easier mid-month but there may still be some opposition from partners. You again feel in a position where you’re forced to juggle in order to please everyone. The truth is, right now, you need to focus on whatever floats your boat. You have a new direction and new opportunities where career is concerned. It’s time for you to find your focus and be very clear on your direction and what needs to be done to achieve your goals.

Leo (23 JUL – 23 AUG) Feeling refreshed and invigorated? Make the most of the energy while you have it but don’t overdo it. You have a tendency to go overboard with a lot of things, but try to keep a balance here. Too much now can see you run out later or, worse still, put a strain on your system that results in injury or illness. This can be especially so for late July birthdays. It’s also important to take extra care as you can be more accident prone than usual. Now is a good time to think about a realistic health and fitness plan.


E N T E R T A I N

PANORAMIC VIEWS

N O T H I N G

L E S S

I N

Y O U R

TOP CLASS RESIDENCES

R E T I R E M E N T

NO STAMP DUTY

GRAND FOYER

DESIGN MEETS DESIRE IN

THE APARTMENT Y ONL

AT

CONSTRUCTION COMMENCED – NOW VIEWING 70% STAGE ONE RETIREMENT APARTMENTS SOLD SHOWCASING ARCHITECT DESIGNS. This is 5 star retirement living at

BIG SERVICE FEE SAVINGS FOR LIFE BEFORE 30 SEPT. Sign up today

its very best. Featuring 1, 2 and 3 bedroom apartments with exceptional

and recurrent Service Fees* will be fi xed at current rates for life.

kitchens, stylish living areas and wide balconies. You’ll love meeting

Offer must end 30 Sept 2018 so you best hurry. And of course, you’ll

friends in the lounge, dining in the provedore-style café and relaxing in

pay no stamp duty at The Royce.

the wellness centre or central courtyard gardens.

SHOWING 6 DAYS WITH THURSDAY VIP PREVIEWS. Display suite open

BIG PICTURE THINKING. A unique collaboration between Panthers

Monday to Saturday in Panthers Penrith foyer. Book an appointment or

Penrith and family-run seniors living specialist Tulich, The Royce

join us for morning tea at our Open Morning previews every Thursday

offers an unparalleled retirement lifestyle with friendly like-minded

10am -12 noon.

neighbours. Right next door to Panthers Penrith, here you can enjoy the finest facilities including dining, shows, events and gamedays. CALL 02 4720 5633 OR VISIT THEROYCE.COM.AU Display suite: 123 Mulgoa Road, Penrith NSW 2750 *Terms and conditions apply

Know our story


Douglas Ely

Award-Winning Jewellery Design Craftsman

Shop 51a WestďŹ eld Penrith, NSW

www.yorkjewellers.com.au

18ct White Gold Round Brilliant Cut and Pear Shape Diamond Trilogy Ring

Profile for Penzance Publishing

Roaming Magazine Issue #20 September 2018  

Nepean's Lifestyle Magazine

Roaming Magazine Issue #20 September 2018  

Nepean's Lifestyle Magazine

Advertisement