Page 1

I S S U E 1 8 J U LY 2 0 1 8

FREE TO YOUR

HOME MONTHLY

PENWAY PLACE A D E V ELO P M E N T I N S P I R ED BY T HE P E N R I TH C O M M U N I T Y

N E P E A N ’ S

L I F E S T Y L E

M A G A Z I N E


LIVE.

YOUR

WAY.

1, 2 & 3 BEDROOM APARTMENTS IN PENRITH, NOW AVAIL ABLE! PEN WAY PL ACE .COM. AU 180 0 736 929 PROUDLY DEVELOPED & BUILT BY


The Highest Standard in Concreting Services in Penrith & Blue Mountains LO CA LLY OWNED A N D O P E R AT E D, WIT H E XCE LL E N T WOR KM A N S HI P AT AFFO RDA B LE P RICE S

MENTION THIS AD AT TIME OF CONTACT FOR

FREE REMOVAL OF OLD DRIVEWAY

R E F F O J U LY

 slconcrete5@bigpond.com

WWW.SLCONCRETE.COM.AU


S ASK U R O T U ABOU

R SENIO T UN DISCO

CALL US NOW - 0411 704 302

SE RVICE S TAILO RE D TO S UIT YOU S L A B S | D R I V E WAY S | C O M M E R C I A L & I N D U S T R I A L | O S D TA N K | C U S T O M D E S I G N


EXCLUSIVE VIEWS YOU SIMPLY CAN’T OVERLOOK

800m2 – 1,200m2 mulgoasanctuary.com.au To the best of our knowledge no relevant information has been omitted from this advertisement. Whilst all care has been taken in presenting


W A K E U P T O B R E AT H TA K I N G V I E W S E V E R Y D AY W H E R E N AT U R E I S Y O U R N E I G H B O U R Imagine the spacious feeling of living with your own exclusive view of the Blue Mountains and pristine bushland. With our prestige hillside homesites ranging from 800m2 –1,200m2 – it’s the perfect place for your new dream home in an exceptional location surrounded by nature. 0 Just minutes from Glenmore Park Town Centre shopping. 0 Close to schools and sporting fields. 0 Minutes to the Penrith CBD. 0 Convenient to the M4.

This enviable lifestyle can be yours. Hurry, homesites in this highly desirable new estate are selling fast. Visit our Sales Centre Sunday 10am–2pm to see

a range of house and land packages. Or register your interest at mulgoasanctuary.com.au. the benefits of Mulgoa Sanctuary, we encourage all potential purchasers to inspect for themselves. Home with view is artist’s impression.


WINDOW REPLACEMENTS

Affordable, High Quality Home Improvement Solutions CRIMSAFE SECURITY PRODUCTS

20%

OFF OUR FULL RANGE*

ROLLER SHUTTERS

PLANTATION SHUTTERS

At GuardRight we are very different to our competitors. As different as an apple to an orange. That’s because we give you better service, price and product choice with real flexibility to suit your home. And that is why GuardRight is the right choice.

Roller Shutters  Crimsafe Security Products  Plantation Shutters - Blinds 

Our Premium Product Range Window Replacements - Magnetite  External Blinds & Awnings  Security Screens - Fly Screens  Window Films 

LOCALLY OWNED CRIME PREVENTION PARTNERS

AND OPERATED IN PENRITH

Come see us at Unit 4, 103-107 Batt Street, Penrith NSW 2750

CALL US 4721 8536 WWW.GUARDRIGHT.COM.AU  GuardRight Industries

SHUTTERS | SCREENS | DOORS *Conditions apply


Welcome

Hi Readers, WELCOME TO JULY ISSUE

IN THI S

T

here is just something truly special about the mountains during this time of year. I absolutely love living on the doorstep of the beautiful Blue Mountains, which is why we’re featuring a Blue Mountains Getaway Guide. Even if it’s just a day trip, there is so much to explore, do and see. Most importantly, the region is blessed with some of the best cafes and restaurants in NSW. This month we also spoke to the team at Toga who are developing the new Penway Place in the Penrith CBD. It’s yet to break ground, but the office is located on the corner of Mulgoa and Union Roads. It was fantastic to get some insight into the development - we actually found out that Penway Place was inspired by the local community! They ran community focus groups to get local input and ensure they were putting their best foot forward when it came to design and livability. Their article is well worth a read.

FEATURED THIS MONTH 23

Feature Blue Mountains Getaway

28

Food Winter Warmers with Continental

20

Community Pinot & Picasso

Finally, we teamed up with Continental to bring you some hearty recipes to warm us up in this cold weather. And trust me - the Paella is truly divine.

Issue

28

23

Enjoy the read!

20

Sam

PO Box 3106, East Blaxland, NSW 2774 Advertising Enquiries Samantha Foley  0431 281 689 samantha@roamingpanthermagazine.com.au  @roamingpanthermagazine @roamingpanthermagazine www.roamingpanthermagazine.com.au

>> OUR TEAM Publisher • Kimberley Kennedy kimberley@roamingpanthermagazine.com.au Editorial • editorial@roamingpanthermagazine.com.au Creative Director • Kwang Tran Manager • Samantha Foley samantha@roamingpanthermagazine.com.au Magazine Coordinator • Mel Bevan mel@roamingpanthermagazine.com.au Copy Editor • Melinda Leyshon, WriteCopy Journalist • Cassandra Elliott Images • iStock photos >> REGULAR CONTRIBUTORS • Melissa Ferrari, Counselling & Psychotherapy • Melissa Browne, Accountant at A&TA & The Money Barre • Douglas Ely, York Jewellers

Expert help with your home loan...

• Maria, Fellowes & Turner Travel Associates • Sharon Mudiman, Bespoke Realty Group • Marianne Arthur and Amanda Wyllie, Insignia Hair & Day Spa • Rob Lees, Mortgage Choice • Trish Fehon, Online Influence • Joseph Grassi, Joseph Grassi & Associates • Kris Caloia & Karl Thornton, Progressive Physiotherapy • Erin Short, Coreen Avenue Veterinary Clinic • Sherrynne Dalby, Author of Star Parenting >> WITH THANKS TO OUR CONTRIBUTORS FOR THIS ISSUE • Mountain Getaway • Pinot & Picasso • Continental • BeaMade Foods • Trent Merrin • Maria-Luisa Patisso, Facebook.com/MySClifestyle • Luke Priddis Foundation • Toga • Freedom Furniture, Penrith

Published by Penzance Publishing Pty Ltd ABN 18615296118. Printed by Fairfax Media 159 Bells Line of Road North Richmond NSW 2754 All prices and information are correct and to the best of the publisher’s knowledge at the time of print. Roaming Panther Magazine does not accept or assume responsibility for advertising material accepted. Comments and opinions of contributors do not necessarily reflect the opinion or view of the publishers or editor.

Exper help with your home loan...

We recommend material such as dates, times and prices of a changing nature be confirmed with individual advertisers, contributors or persons and industry professionals in regard to advertising and editorial.

Material in Roaming Panther Magazine is copyright © Penzance Publishing and may not be reproduced without the permission of the publisher. All rights reserved. Issue 18, July 2018

All reasonable efforts have been made to trace copyright owners.

We make refinancing or purchasing stress-free and rewarding. We’ll take you further We will work with you to help correctly structure your finances and achieve your dreams and goals with minimal hassle. Grab a golden opportunity - visit www.theloanssuite.com.au

Karlie’s Scharfenberg Director - The Loan Suite

2018 Finalist for Outstanding Business Person of the Year

E S T.

the

We’ll tak

We will work w finances and ac minimal hassle

Grab a gold www.thelo

2016

LOA N S S U I T E AUSTRALIA

Issue 18 July 2018

9


Local Roaming LOCAL MUSIC THE 2 OF US – DAVID HOBSON & MARINA PRIOR 28 JULY PANTHERS PENRITH ‘The 2 of Us’ is live at Panthers Penrith, and you do not want to miss this rare event!

Want more flex in your deposit options?

Australia’s leading stars of Opera and Musical Theatre, David Hobson and Marina Prior, come together in their very own show. In a two-hour intimate performance, Marina and David will perform their classics from productions such as The Phantom of the Opera, Les Miserables, West Side Story, Guys and Dolls, Chitty Chitty Bang Bang, La Boheme, and Carousel, as well as songs from their award-winning albums. Make a night of it and enjoy dinner before the show, with 11 restaurants to choose from. penrith.panthers.com.au

LEADING MEN AND A LEADING LADY

JOSEPH HAYDN – THE SEASONS

25 JULY THE JOAN Lead musical performers Darryl Lovegrove, Wayne Kermond, Scott Irwin and Danielle Barnes perform a range of famous duets and anthems, all inspired by the greatest songs of musical theatre and the very best of Broadway.

6 JULY BLUE MT THEATRE & HUB Phoenix Choir presents Joseph Haydn’s final oratorio, a masterwork of creative story-telling through music. Classically elegant, the Seasons is unmistakably Haydn at his very best.

14 JULY ROOTY HILL RSL Adam Brand celebrates his 20-year milestone in country music with the launch of his new album, Milestones. Adam is touring nationally with his powerhouse band, playing all the hits that made him a household name in modern-day Australian country music. In a concert dedicated to his fans, enjoy the trademark energy that has made him one of Australia’s most loved performers.

thejoan.com.au

bluemountainstheatreandhub.com.au

rootyhillrsl.com.au

THE BAR AT BUENA VISTA

More Information: Credit criteria apply. RAMS Financial Group Pty Limited ABN 30 105 207 538 AR 405465 Australian credit licence 388065. Credit provider and issuer of RAMS deposit products: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714. 18485/0618

10

roamingpanthermagazine.com.au

ADAM BRAND MILESTONES - 20 YEARS

BIRD YARD BIG BAND

ROGER WOODWARD

26 JULY THE JOAN The Bar at Buena Vista – The Grandfathers of Cuban Music brings us a cocktail of Cuban music and dance. Enjoy an intoxicating tribute to old Havana in a night of pure passion and undeniable magic! It’s a passport to another time. You’ll be dancing in the aisle as they celebrate the original spirit of the Caribbean groove, bringing the golden era of Cuban music in the 40’s and 50’s back to life.

7 JULY BLUE MT THEATRE & HUB Join the Mountain’s very own Bird Yard Big Band for a night of rocketfuelled swing music. Dance the night away or simply sit back and enjoy Bird Yard’s big sound as they transform the town into ‘Swingwood’!

28 JULY BLUE MT THEATRE & HUB Internationally-celebrated pianist Roger Woodward, one of the most revered and adventurous pianists of our time, returns to Australia to perform Chopin Etudes and the ethereal works of Debussy.

thejoan.com.au

bluemountainstheatreandhub.com.au

bluemountainstheatreandhub.com.au


Local Roaming LOCAL SHOWS

OPERA GALA 28 JULY THE JOAN Delight in an evening of energy, wit and romanticism as dynamic young soloists Joshua Oxley and Anna McDougall join the PSO for Opera classics and Broadway highlights.

4 AUGUST BLUE MT THEATRE & HUB An all-star cast performs more than 20 iconic songs, interwoven with tales that reveal the surprising - and unknown - stories behind some of the world’s most legendary performers.

thejoan.com.au

bluemountainstheatreandhub.com.au

THE LEGEND OF LUKE KELLY

Our range of flexible deposit options could help you get into your first home sooner.

THE SONGS AND TALES OF ANGRY OLD MEN

THE BAY CITY ROLLERS

15 JULY ROOTY HILL RSL The depth and passion of Luke Kelly, one of the greatest traditional singers Ireland has seen, is brought to life by Chris Kavanagh. Critically acclaimed, Chris gives a taste of what a Luke Kelly performance was about.

20 JULY ROOTY HILL RSL Re-live the excitement of Rollermania! Scotland’s greatest pop/glam export, the Bay City Rollers, is back. Enjoy classics such as Shang-A-Lang and Bye, Bye Baby, as well as music from their new album, The Lost Songs. VIP tickets available.

rootyhillrsl.com.au

rootyhillrsl.com.au

DREW MCALISTER – COMING YOUR WAY TOUR

CELEBRATING ELVIS 11 JULY BLUE MOUNTAINS THEATRE & HUB Celebrating the 50th Anniversary of Elvis’s 1968 Comeback Special, Grant Galea presents a unique and refreshing tribute to the legendary King of Rock ‘n’ Roll. The show features hits from Elvis’s movies, a few romantic classics, some gospel, and surprises that only Grant and his mighty band can provide. WARNING - this show strictly prohibits the use of white jumpsuits! bluemountainstheatreandhub.com.au

ALEYCE SIMMONDS & BRAD BUTCHER – COUNTRY IN YOUR TOWN

28 JULY ROOTY HILL RSL The ‘Coming Your Way’ Tour features a collection of songs from Drew McAlister’s two solo albums, Black Sky and Coming Your Way, with a few surprises thrown in along the way. It’s a ‘get up from your seat’ kind of show, leaving that feel-good feeling in your heart and a tune in your head long after the song is through. As a seasoned live performer, Drew is known for his outstanding vocal ability and high energy performances, often leaving his audience breathless.

3 AUGUST ROOTY HILL RSL Don’t miss this unique opportunity to see two of Australia’s leading country music acts perform together. 2018 Golden Guitar Winners Aleyce Simmonds and Brad Butcher are joining forces for the very first time to deliver their honest and unique styles of Australian country music, radio singles and deep cuts in an intimate and collaborative setting as they gear up for their A+B = Country nationwide tour.

rootyhillrsl.com.au

rootyhillrsl.com.au

To find out more, talk to your local RAMS Home Loan Specialist today.

Call 13 RAMS RAMS.com.au More Information: Credit criteria apply. RAMS Financial Group Pty Limited ABN 30 105 207 538 AR 405465 Australian credit licence 388065. Credit provider and issuer of RAMS deposit products: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714. 18485/0618

Issue 18 July 2018

11


Local Roaming

Winter

Scho o l Holidays at The Joan!

LOCAL FITNESS

THINGS TO DO

YOGA @ THE MONDO

21ST AUSTRALIAN ORCHID COUNCIL CONFERENCE AND SHOW – ORCHIDS IN THE FOOTHILLS

EVERY SATURDAY PENRITH LAKES & NEPEAN RIVER Open to all, walk/run for your own enjoyment and at your own pace. Register online to be timed, and catch up with others for a coffee afterwards.

WEDNESDAY MORNINGS 7AM - 8AM THE MONDO, PENRITH PLAZA Enjoy free yoga classes at the Mondo, located between Westfield, the Library, and The Joan.

18 - 22 JULY HAWKESBURY INDOOR STADIUM, STH WINDSOR Showcasing unique orchids featuring exotic characteristics and rare colours, thousands of strikingly beautiful species and hybrids will be on display at the Orchid Council Conference and Show. Eminent speakers will share their scientific expertise, and international experts will provide insight into the art of orchid growing and culture. A range of products and materials will also be on sale.

parkrun.com.au penrithlakes

west eld.com.au penrith

aocc2018.orchidsocietynsw.com.au

PENRITH LAKES PARKRUN

THE VERY HUNGRY CATERPILLAR SHOW

Ages 1–7 Friday 13 & Saturday 14 July | 10am, 12pm, 2pm Four classic stories, 75 magical puppets. Journey through Eric Carle’s incredible stories as they come to life on stage in this enchanting show! 50 mins Tickets: $25 / $20 / $76 family

The 78 -S TO RE

LOCAL ARTS

Y

TREE HOUS E

BLACK MIST BURNT COUNTRY

THE 78-STOREY TREEHOUSE

Ages 6–12 17 July 12pm, 2pm | 18 July 10am, 12pm, 3pm Andy and Terry’s treehouse just keeps growing! Now with another 13 levels, the treehouse returns in the newest, biggest, brightest blockbuster live on stage at The Joan. 60 mins Tickets: $25 / $20 / $76 family

VICKY BROWNE – COSMIC NOISE

UNTIL 29 JULY PENRITH REGIONAL GALLERY Black Mist Burnt Country is an award-winning national touring exhibition of artworks by over 30 Indigenous and non-Indigenous artists commemorating the British atomic tests in Australia in the 1950’s. It examines the impact on people and land, as well as the program’s ongoing legacies. Selected from public and private collections, the exhibition features works from the past seven decades and by artists such as Nolan and Boyd.

UNTIL 22 JULY PENRITH REGIONAL GALLERY Vicky Browne’s Cosmic Noise harks back to a simpler time when the belief in a cosmic eternity that included humans was still viable. The installation suggests an astronomical explosion, the big bang, that leads us to the celestial notion that life exists throughout the universe, held within space dust, meteoroids and far-flung planets.

penrithregionalgallery.org

penrithregionalgallery.org

PLUS

Local Markets KATE SHAW

ART WORKSHOPS AT PENRITH REGIONAL GALLERY 16 – 20 July Landscape: Clay Landscapes, Bubble Wrap Trees, Moving Mobiles, Exploding Animations; Find it, Paste it, Poster it, Spooky Sceneries. All skill levels. Ages 3 – 12 Bookings essential. For more information or to book visit penrithregionalgallery.org or phone 4735 1100. Penrith Regional Gallery | 86 River Road, Emu Plains

PENRITH REGION

BLUE MOUNTAINS REGION

AUSSIE NIGHT MARKETS

GLENBROOK ROTARY MARKETS

WEDNESDAY NIGHTS An international food market on the doorstep of Penrith Panthers! Enjoy with family and friends, and give your tastebuds an experience they won’t forget.

FARMERS MARKET • FIRST SATURDAY Stock up on organic fruit and veggies, sourdough bread, home-baked cakes and biscuits, pickles, jams and honey, and lots of other local goodies.

aussienightmarkets.com.au

HAWKESBURY REGION RICHMOND GOOD FOOD MARKET EVERY SATURDAY, 8 AM - 1 PM The best of the Hawkesbury’s local produce, crafts and food situated beside Richmond Park. richmondmarket.com.au

BOOKINGS thejoan.com.au | 4723 7600 12

roamingpanthermagazine.com.au

WANDER AROUND YOUR LOCAL MARKET

GENERAL MARKET • THIRD SATURDAY Quality jewellery and crafts, with plenty to spoil yourself and others. Gardeners can delight at the array of flowers and plants. glenbrookrotarymarkets.com.au


Grounds AROUND THE

Local Roaming

YOUR GUIDE TO WHAT’S HAPPENING IN SPORT THIS MONTH.

Penrith Panthers

GWS Giants

NRL - RUGBY LEAGUE

AFL - AUSSIE RULES

Round 17

Friday 6 July, 7.55pm Panthers v Warriors Panthers Stadium

Round 16

Sunday 8 July, 2.40pm Giants v West Coast Eagles Optus Stadium

Round 18

Friday 13 July, 6pm Panthers v Sharks Panthers Stadium

Round 17

Saturday 14 July, 7.25pm Giants v Richmond Spotless Stadium

Round 19

Friday 20 July, 7.55pm Panthers v Broncos Suncorp Stadium

Round 18

Sunday 22 July, 4.10pm Giants v Port Adelaide Adelaide Oval

Round 20

Saturday 28 July, 3pm Panthers v Sea Eagles Lottoland

Round 19

Saturday 28 July, 4.35pm Giants v St Kilda Spotless Stadium

Round 21

Sunday 5 August, 4.10pm Panthers v Raiders Panthers Stadium

Round 20

Sunday 5 August, 1.10pm Giants v Carlton Etihad Stadium

Journey BEGIN YOUR

AT S T PA U L ' S P R E - K

Inspiring Your Child to Learn.

Primary Logotype Horizontal

International Baccalaureate Learning from Pre-Kindergarten

LIMITED SPOTS AVAILABLE BOOK A TOUR OR ENROL TODAY

p. 02 4777 4888 e. enrol@stpauls.nsw.edu.au w. stpauls.nsw.edu.au

Issue 18 July 2018

Secondary

13


Spotlight

Tijuana Taxi

EVENT IN THE SPOTLIGHT

A TRIBUTE TO THE MUSIC OF HERB ALPERT AND THE TIJUANA BRASS

T EVENT DETAILS

i

Tijuana Taxi 27 July, 8:00 pm $33, Concession $30 Blue Mountains Theatre and Community Hub 104-108 Macquarie Road, Springwood NSW 2777  4723 5050 bluemountainstheatreandhub.com.au

14

roamingpanthermagazine.com.au

ijuana Taxi is a natty eight-piece ensemble (with real marimba!) that evokes the mood and music of the swinging 60’s. They faithfully recreate the music of Herb Alpert and the Tijuana Brass, presenting 21 classics of this unique, upbeat, melodic group whose tunes became the backdrop for the 60’s and 70’s. It will undeniably strike chords of deep nostalgia for baby boomers, while also intriguing and delighting the next generation of quality, kitsch-loving younger folks. It’s music that spans generations.

Hits such as Spanish Flea, Tijuana Taxi, The Lonely Bull and A Taste of Honey are only the tip of the iceberg of the great body of work put out by Herb and his band. The band itself is a who’s who of Sydney’s finest latin and jazz musicians. It’s led by bassist Tina Harris, who also leads a 12-piece Cuban salsa orchestra, El Orqueston, as well as playing for several other multicultural music outfits including West African funk

band Keyim Ba, 15-piece Cumbia band Cumbiamuffin, and latin trio, Oriente Tres. Straddling musical worlds, she’s also involved in musical theatre, recently playing in the Tony award-winning show In The Heights at Darlinghurst’s The Hayes Theatre, and in Sondheim’s Assassins at the Sydney Opera House. Presented by Glenn A. Baker, renowned for his intimate knowledge of rock music, Tijuana Taxi provides a night of entertainment that you absolutely cannot miss!

The band itself is a who’s who of Sydney’s finest latin and jazz musicians...


Spotlight

Afternoons Tonight!

ABC’S HILARIOUS RADIO SHOW, BUT AFTER DARK! AND IN A THEATRE.

J

ames Valentine’s Afternoons show is like no other. It’s funny, but not just because he’s funny – it’s his callers. They're hilarious and often bizarre, and they tell him all the weird stuff that happens in their life. James will share the best, worst and most intriguing callers from his Afternoons radio show, and then he’ll turn it over to you for a live session of talkback theatre that will bring out the strange, the wonderful, and the completely hilarious sitting right there in the room.

I love JV and his callers. My favourite radio driven laughs of the day… Julia Zemiro

G

et ready for more music and more memories to see where it all began at the ultimate Girls’ Night Out Advance Screening of Mamma Mia - Here we go again!

Mamma Mia HERE WE GO AGAIN!

The Girls’ Night Out ticket* includes an exclusive beauty parcel, the latest issue of WHO aga ine pgrade to HO T , and you’ll also receive a glass of sparkling wine on arrival ^. ecure your seats for this special HO T Out now.

*^For full terms and conditions please go online.

irls’

ight

EVENT DETAILS

i

Afternoons Tonight! with James Valentine Friday 3 August Show starts 8pm $38 adults | $35 seniors $35 pensioners / groups / students Blue Mountains Theatre 104-108 Macquarie Road, Springwood  4723 5050 bluemountainstheatre.com

EVENT DETAILS

i

GIRLS' NIGHT OUT

Mamma Mia! Here We Go Again Wednesday 18 July - Advance Screening 6:30pm arrival for a 7pm session Visit online for details Westfield enrith Jane t, enrith  4749 5600 hoyts.com.au cinemas

enrith

Issue 18 July 2018

15


Spotlight

The ‘Garage’ was established to enable community members to express their own culture and beliefs... POWERFUL WORKS FROM THE ORGANISATION THAT WAS AT THE FOREFRONT OF COMMUNITY ARTS PRACTICE AND ARTIST ACTIVISM Garage Graphix Community Arts Inc was a community art, design and screen printing workshop based in Mount Druitt between 1981 and 1998. Arts workers active in the women’s movement and who wanted to enable community members to express their own culture and beliefs, as well as illuminate issues of concern, established the ‘Garage’. Garage Graphix employed artists and cultural workers to develop, train and mentor local community, students and artists in the collaborative production of posters. As seen in this exhibition, these posters articulated and promoted a range of concerns and issues including education, health, environment and pollution, Aboriginal rights, deaths in custody, and women’s rights.

EVENT DETAILS

i

Garage Graphix ON NOW until 29 July FREE enrith egional allery The ewers Be uest 86 River Road mu lains W  4735 1100 penrithregionalgallery.org

NEW CONCEPT LIKE NO OTHER shared

FOOD SERVICE

The Songs & Tales of Angry OLD Men

BOOK NOW

4723 5050

www.nepeanbelle.com.au

16

roamingpanthermagazine.com.au

BlueMountainsTheatre.com 106 Macquarie Road Springwood


School Holidays

IDEAS INTRODUCE YOUR KIDS TO SOMETHING DIFFERENT THESE SCHOOL HOLIDAYS. CHECK OUT WHAT’S HAPPENING IN THE LOCAL AREA KID'S FLIX Various dates available  Blue Mt Theatre & Hub  4723 5050 bluemountainstheatre andhub.com.au

Taking the kids to the movies these school holidays doesn’t have to be expensive. With several movies showing over the holidays and tickets only $7 each, and with popcorn and drinks for sale, it’s a great way to relax on a cold Winter day. ovies that will be showing include eter abbit on July 12th, Ferdinand on July 13th, Coco on July 17th, and Happy Feet on July 19th. For more details visit online.

MAGICAL WORLD OF CRAZY SCIENCE Friday 13 July  anthers enrith  1800 061 991 penrith.panthers.com.au

THE ENCHANTED WINTER BALL 14 July  enrith  4728 5200 penrithrsl.com.au

With banquet tables decorated to a individual theme and hosted by an iconic Disney-inspired character, children at heart will feast on a three-course meal while children enjoy their two courses, all entertained by roaming performers. A delightful evening show of song, dance, trivia, food, games and more for all ages! Enjoy an enchanting gift to take home. A portion of the ticket price is donated to support our reefs!

THE 78-STOREY TREEHOUSE 17-18 July  The Joan  4723 7600 thejoan.com.au

KID'S PIZZA MAKING 10 & 17 July  t arys eagues lub  9677 7777 stmarysleagues.com.au

Take a wild ride with your host Richard Scholes through his Magical World of Crazy Science and witness... giant columns of elephant toothpaste, rockets zooming, massive smoke rings, toilet paper flying, giant bubbles, and billowing concoctions. Add to this a hilarious mix of comedy and interactive scientrific’ magic from an award-winning entertainer, and you have one truly incredible science show!

Children must be accompanied by an adult 18+

Andy and Terry’s treehouse just keeps on growing. With yet another 13 levels, it’s now got a Scribbletorium, a high-security potato chip storage facility (guarded by one very angry duck!), and even an open-air movie theatre. But when a moviemaker arrives and wants to replace Andy with a monkey, will the Treehouse blockbuster get made? Suitable for ages 6 – 12.

our kids will let their inner chef out as they learn to make their own wood-fired pi a at the Ironbark Terrace i eria. They’ll be entertained with balloon animal making and face painting, and they can even decorate their own Gelato! It’s three hours of jammed-packed fun and just imited spaces available, bookings essential. For ages 6 and up. arental supervision of each child is re uired.

THE VERY HUNGRY CATERPILLAR SHOW 13-14 July  The Joan  4723 7600 thejoan.com.au

One of the most-read and famous children’s books of all time, The Very Hungry Caterpillar emerges off the page in a masterful theatrical experience for the whole family. Featuring 75 magical puppets, journey through Eric Carle’s incredible stories as they come to life on stage in this enchanting show, returning to enrith by popular demand. Issue 18 July 2018

17


Could you be saving thousands on your home loan? Meet with me to review your home loan before 15th August and you could win a $10k holiday!*

Peita Davies Director Local home loan specialist 0452 214 202 1B Castlereagh St, Penrith

*The promotion commences at 12.01am AEDT on 15/5/18 and closes at 11.59pm AEDT on 15/8/18. For full terms and conditions visit rea.to/win10kterms. Authorised under ACT Permit No.TP 18/00801, NSW Permit No.TPLTPS/18/23915, SA Permit No. T18/699. Peita Davies is a credit representative (399495) of BLSSA Pty Ltd ABN 69 117 651 760 (Australian Credit Licence 391237).

Thursday 12th & 19th July 2018 Games start- 10:30am Members Bingo Only Monkey Mania & Bingo

$7.50 $19.50

Visitors Bingo Only Monkey Mania & Bingo

$10.00 $22.50

-Bingo Includes-

8 games of bingo Chips, lollies, drinks & lucky door prizes -Monkey Mania & Bingo includesAll bingo inclusions PLUS: Entry to Monkey Mania Entry fee per adult $4.50 (includ. coffee) Socks required.

Pre-book at reception so you don’t miss out!

18

roamingpanthermagazine.com.au

Thursday 5th July 2018


Photo credit: Megan Dunn

Community

Wigs for Kids HAIR-RAISING EVENT A HUGE SUCCESS! Written by Amanda Wyllie, owner of Insignia Hair & Day Spa

On 27 May, Insignia Hair & Day Spa held a HAIRraising event called Wig for Kids.

We also had local antherette elsie Brodribb join us on the day. Kelsie also suffers from Alopecia. I was so thankful to these ladies for helping raise awareness of the event and being part of the day.

A

ucy and I would like to say a sincere thank you to all of the businesses that came on board to make this day amazing. I would like to extend those thanks to my amazing team for their support and their willingness to donate their time on a Sunday.

s a business owner, giving back to our community is something I'm incredibly passionate about. For this event I collaborated with ucy ichards from Vintage FM to help put together an amazing day. Wigs for Kids was hugely successful - we collected a total of 56 ponytails that will be donated to kids suffering Alopecia. Alopecia can affect people in two ways; either through total hair loss, or hair loss in patches. Most of the time it's untreatable. To a little girl, suddenly loosing all of her hair can be quite devastating. And these wigs are in the thousands to purchase.

DONATE YOUR PONYTAIL

To give you an idea, it takes between seven and 10 ponytails to make one wig.

We take donations of ponytails all year round. Please call the salon to discuss further I'd love to hear from you! 4722 3503

On the day we had Gabrielle Rivers from Channel 9's Married at First Sight join us. Gabrielle was open on the show about her Alopecia, and it was absolutely massive for us to have her support!

F45 Training South Penrith is a group-training facility that features the most dynamic and effective training style to date by offering a 45 minute High-Intensity, Circuit Training workout for our studio members.

SOUTH

PENRITH

The classes at South Penrith F45 are delivered by highly-capable coaches, leading our members in not only the workouts but also motivating them to reach their potential in all aspects of their fitness journey.

enrith is known to have a get in and help attitude, and I could never have done this event without the help of local businesses who gave their time or service free of charge. I would like to personally thank these businesses individually. Thank you to Essential Bodyworks, Vintage FM, The Blonde Butler, eune, egan unn hotography, Western Weekender, Valley Blooms Flower Co, Emma Husar , abrielle ivers from hannel ’s Married at First Sight, elsie Brodribb from the antherettes, bcoe, and Soul Sports. Finally, to the wonderful and brave people who donated their hair - thank you. ou have made such a difference in a child's life.

FREE O P E N DAY

SATURDAY 14TH J ULY 6.30 A M -1 0 .30 A M JOIN US for breakfast, coffee, protein balls and supplement tasting

WINTER

PROMO SIGN UP TO A 6 MONTH MEMBERSHIP AND RECEIVE 4 WEEKS

FREE! R EGIS TER FOR 7 DAY FRE E T R I A L

55-61 York Road, Penrith (underneath Valentino’s Italian Restaurant) www.f45training.com.au/southpenrith  0432 819 849

Issue 18 July 2018

19


Community

UNLEASH YOUR

Inner Picasso Written by Cassandra Elliott

TWO FRIENDS HAVE DECIDED TO COMBINE THEIR ‘LOVE OF WINE AND LACK OF ART ABILITY’. James Crowe and Aaron Carrasco have created inot and icasso, an intimate art studio with a difference.

T

he three-hour sessions combine upbeat music and your favourite wine to get your creative juices flowing. ou’re then guided by a local artist to paint the selected image. James says the entire experience works so well together. ‘We always play really good music. The wine, the company... it’s just a relaxing environment. Obviously the wine helps you to switch off a little bit, but there’s something very therapeutic about painting a canvas.’ That’s also the beauty of inot and icasso you don’t need any artistic experience. We’re more of the wine-appreciation types, we’re definitely not artists.’ Interestingly, though, many people are surprised when they reveal abilities they never knew they had. ou bring your own wine and food to the sessions. If you’d like something extra, inot and icasso have partnered with am’s i a o - for an extra charge you can select an optional grazing platter to enjoy while you paint. ‘We’re all about community engagement,' says James. 'It’s run by local artists and we want to be a bit of the driving force towards the cultural shift that’s happening in enrith at the moment. We’re getting some really great bars and restaurants and high-end cafes, and this shift is changing the town to something more on-trend.’ James says that drinking relaxes people and makes them more creative, so inot and icasso makes for a fun, relaxing night out. As for the sessions? ‘It’s kind of a step-by-step process. It’s guided, but at the same time we encourage people to do their own thing. It’s more about giving someone a platform and the means to do those sorts of things, more than telling them what to do. The art is approachable; we don’t want to alienate people with a difficult artwork. We want everyone to feel like they exceeded their own expectations.’

CHECK US OUT

20

roamingpanthermagazine.com.au

The studio is currently running Friday, Saturday and Sunday sessions, but is looking to expand into theme nights, team-building sessions, and school holiday classes in the near future. If you’d like to book a session, visit pinotandpicasso.com.au.


Local Business

ROAMING WITH

Local Business

SUPP

O RT I

NG

We met with BeaMade Foods, producers of premium jams, conserves, chutneys and more.

All of our products use 100% seasonal Australian produce, direct from the grower. And we don't allow preservatives or additives, making the flavours so much better.

WHEN DID BEAMADE FOODS FIRST OPEN ITS DOORS?

5 WHAT IS THE MOST REWARDING ASPECT OF

Bea ade Foods officially opened its doors late last year, but we’ve been producing our products for many years. It was only after strong encouragement (almost a shove) from some close friends in the hospitality industry who absolutely loved our product – and knew everyone else would love it too – that we decided to open our range to everyone!

In short, it's making a difference. With Australians becoming far more aware of what they’re eating (in regards to what’s in it and where it comes from), we make sure to do the right thing there. To some, food is fuel, but to others, this fuel is what motivates and drives them we’re definitely in the latter category.

1

6 ANY HIGHLIGHT OR ACHIEVEMENTS THAT 2 TELL US ABOUT YOUR WONDERFUL

PRODUCTS AND WHAT YOU THINK YOUR POINTS OF DIFFERENCE ARE

All of our products use 100% seasonal Australian produce, direct from the grower. We don't allow any preservatives or additives into our products, which makes the flavours so much better. We do jams, conserves, chutneys, and more, but they're far from average. They always have a twist; such as our Strawberry Conserve with Balsamic Vinegar and racked epper. ou and your kids will love them! 3 TELL US ABOUT THE EXPERIENCE YOU HAVE

WITHIN THE FOOD INDUSTRY Bea, our Head of roduct, has been in hospitality for over 15 years. She's also been in horticulture for over 30 years, so she knows it all – from the ripeness of the fruit, through to how to meld those magnificent flavours together to create our uni ue range.

DISCOVER OUR FULL RANGE OF PRODUCTS BeaMade Foods  eura W  1300 823 262 beamadefoods.com.au  @BeaMade Foods beamadefoods

WHAT YOU DO?

4 TELL US MORE ABOUT YOUR TEAM

The business is jointly owned and run by Bea and her son, Josh. Bea has decades of experience on the product side, and Josh brings the business experience with more than 10 years working across a variety of industries. This pairing works to provide the right checks and balances – we try to be business savvy with what we do, while always making sure the product quality is kept at the top of the priorities list.

YOU'RE PROUD OF? So far, our biggest achievement would have to be starting the business. BeaMade Foods is a direct reflection of Bea’s passion for food and horticulture, and a delicious way of bringing them together for everyone to enjoy. 7 WHAT DO YOU APPRECIATE ABOUT

WORKING AND LIVING IN THE COMMUNITY? What is a business without its team? A business’ team is the community who help support us, just as we support them however we can. Keeping in touch with your community is key to a successful relationship with your customers, so living alongside them and working with them makes sure we deliver what our community needs. 8 FINALLY, HOW DO WE GET OUR HANDS

ON OUR VERY OWN JAR OF BEAMADE GOODNESS?

ou can get our range from us directly, via our website. We’re also working with cafes, restaurants and retailers in the area. Once you try our product, if you love it, let us know! And please also let your local cafes know, too, so they can try the products for their business. And if you don’t like it, we FI IT want to hear from you – every bit of feedback helps.

Issue 18 July 2018

21


Community

LEADING DEVELOPER OUTLINES VISION FOR

The 'New West' enrith is shaping up as one of ydney s newest growth hotspots! opulation levels are expected to jump from 195,000 to 260,000 by 2031, and the area’s economic catchment is tipped to expand to one million people over the same period. In line with this growth, a number of visionary property developments are set to transform the enrith skyline. The latest is enway lace, located on the corner of nion lace and ulgoa oad, from leading ustralian developer, TOGA. Known for award-winning projects such as the Jones Bay Wharf rejuvenation and Bondi Boheme, TOGA has an exceptional pedigree in property development. The company expects enway lace to play a transformational role in the future of enrith. TOGA has now revealed the vision for the development, the first stage of which will include apartments. This follows the completion of a design competition which was won by market-leading built environment specialists, SJB Architects, and their design partner rchitect rineas. The winning design envisions a four-building development that provides a new urban residential and mixed-use precinct, and acts as a marker for the western gateway of enrith’s B . The first release of the development is set to feature a mix of one, two and three-bedroom apartments, with a number enjoying views of the Nepean River and neighbouring Blue Mountains. enway lace is also planned to include a vibrant public pla a and retail precinct, providing a lively space for enrith locals and visitors to enjoy. Meanwhile, residents will have access to a private landscaped podium with a BBQ and seating areas, a community garden, gym, multi-purpose / kids playroom, and outdoor dog park. ccording to TO O Fabri io erilli, JB’s design stood out in what was a high uality field of design competition entrants. “We received some truly fantastic submissions from highlyrespected design and architecture firms, but at the end of the day, JB and rchitect rineas’ concept for enway

22

roamingpanthermagazine.com.au

lace most closely matched our own vision for this part of enrith and the community, said r erilli. “The development will draw on feedback from local residents by directly connecting with its environment and the local landscape, finding inspiration in natural elements such as layered barks, gum leaves and earthy textures. The project’s key theme is ive our Way’, and what JB has put forward will allow the growing enrith community at enway lace to enjoy life to the fullest in what is being termed ydney’s ew West’. Indeed, the idea of the ew West’ is a key driver in enrith City Council’s Economic Development Strategy, which has outlined a vision targeting an increase of between 42,000 and 55,000 local jobs by 2031. The jobs will be across the health, education, tourism, arts and culture, advanced manufacturing, and advanced logistics sectors, further boosting the suburb’s future prospects. ooking ahead at what the next decade or so will mean for enrith, it’s exciting times, added r erilli. “The railway station and interchange have been recently upgraded, with sustainable developments and smart infrastructure already underway to support the growing population. “This population will undoubtedly need access to uality, affordable housing, from first homebuyers to downsizing locals, and this is what we are aiming to provide for the community. The opportunity to contribute to the growth of enrith is also a key reason JB collaborated with rchitect rineas to submit their designs for enway lace, according to JB Director, Nick Hatzi. We see this development playing a major part in enrith’s increasing recognition as a key destination in an emerging market, through the delivery of a high-quality public realm, as well as first-class civic and retail amenities, said r Hat i. “We’re very fortunate to be working with such an experienced and reputable developer as TOGA, and we look forward to helping them bring this exciting project to the people of Western ydney.

The development will draw on feedback from local residents by directly connecting with its environment and the local landscape, finding inspiration in natural elements such as layered barks, gum leaves and earthy textures. FIND OUT MORE o fin o t ore abo t enway lace or to register yo r interest call or isit enway lace co a

LIVE YOUR WAY


ROAMING FEATURE

BLUE MOUNTAINS G E T AW AY CLOSE ENOUGH FOR A DAY TRIP YET FAR ENOUGH FOR A GETAWAY, EAT, PLAY AND STAY IN THE GLORIOUS MOUNTAINS.

EAT

P LAY

S TAY

Issue 18 July 2018

23


Blue Mountains Getaway

EAT Whether it's for a lazy day out or a special occasion, experience food and wine at a whole new level. And the atmosphere? Well, that's just an incredible bonus.

Scenic World Cnr Violet St & Cliff Dr, Katoomba  4780 0200 scenicworld.com.au Enjoy the breathtaking Blue Mountains from all angles. The Scenic Skyway takes you 720 metres between cliff tops with a glass floor, you ll also enjoy 360-degree views!). The Scenic Railway takes you 310 metres through a cliffside tunnel and into the ancient rainforest. The Scenic Cableway provides great views of The Three Sisters, Orphan Rock, and Katoomba Falls via a gentle descent. And of course, the Scenic Walkway lets you stroll into an ancient rainforest.

Secret Creek Cafe & Restaurant 35 Crane Road Lithgow

 6352 1133 secretcreekcafe.com

ecret reek afe and estaurant is located within ecret reek anctuary, only five minutes from the centre of Lithgow. Tucked up in a tranquil and secluded gully, it's a quiet place to relax and enjoy the bush while enjoying amazing cuisine. The plant-based dishes are vibrant, delicious and inventive, paying homage to the comfort food we all know and love. Their monthly degustation dinner (on a Saturday) is incredibly popular - with four savoury courses, two dessert courses and a cheese course, it's the perfect indulgence!

Blue Mountains Explorer Bus 283 Main Street Katoomba

 4782 1866 explorerbus.com.au

With so many amazing places to visit and things to do in the Blue Mountains, a great way to see everything that’s on offer is to jump on the Blue Mountains Explorer Bus. There are 31 stops in the Blue Mountains World Heritage Area of Katoomba, Leura, and Wentworth Falls - catch the bus and then hop off wherever you like, for as long as you like! Plan your day at your pace, enjoying all the major attractions as well as galleries, gardens, bushwalks, cafes and restaurants. The Explorer Bus departs Katoomba Railway Station regularly from 9am daily.

Scenic World really is as much for locals as it is for tourists. Enjoy great dining options, and unforgettable experiences.

STAY The only challenge with staying at these amazing places? You'll never want to get out to see the sights.

24

roamingpanthermagazine.com.au

Love Cabins 88 Bulgamatta Road Bilpin

 0409 393 425 lovecabins.com.au

Looking for a romantic getaway that's different? Love Cabins has six uniquely designed, private bush cabins near Mt Tomah – two of our favourites are the Enchanted Cave and the Treehouse. The Enchanted Cave is a beautiful sanctuary carved out of the natural bush rock. It has fully expandable glass walls that open the front of the cabin to showcase the amazing views - heavenly! The Treehouse is set up high amongst the trees and has a spa, kitchenette and fireplace, as well as floor to ceiling windows and fully expandable glass doors. If you're looking for romance, you've found it.


ROAMING FEATURE

Pins On Lurline

Leura Garage 84 Railway Parade, Leura  4784 3391 leuragarage.com.au

132 Lurline Street Katoomba

 4782 2281 pinsonlurline.com.au

This grand house is heralded as a unique and authentic dining experience by locals and tourists alike. The menu is dynamic and contemporary, fusing traditional editerranean influence with modern techni ue. nd who can say no to their Bottomless Bubbles lunch, with a three-course meal and unlimited French bubbles for only $80pp? Relax with friends, enjoy a family gathering, or indulge in an impromptu lazy lunch. You don't need a reason to enjoy the amazing food and wine at Pins on Lurline - just know that it's best shared with family and friends.

Leura Garage is an award-winning restaurant, cafe and bar. Having been transformed from a garage to an environmentally-responsible restaurant, it could easily be called Eco Garage. Leura Garage is an absolute must if you want to experience fun dining. It will engage your senses with silky smooth tunes, sensual fragrances, and inspiring textures. Seasonal menus using the region's best local food and wine will have your tastebuds in rapture. Foodie or not, you ll find the eura arage experience one of a kind.

Dryridge Estate 226 Aspinall Road Megalong Valley

 0403 118 990 dryridge.com.au

How does a great day out sound, soaking up the beautiful Megalong Valley while enjoying great wine and cheese? Sign me up! Only 20 minutes from Blackheath, Dryridge Estate is a stunning boutique vineyard nestled in the beautiful Megalong Valley. Visit their Cellar Door (open every weekend from 11am) and enjoy delicious wines, cheese platters, and a ploughman's lunch that will tantalise your tastebuds, all while taking in some of the best scenery in the Blue Mountains. Luckily they also offer 4.5-star accommodation, as one night just won't be enough.

Echos Boutique Hotel & Restaurant 3 Lilianfels Ave Katoomba

 4782 1966 echoeshotel.com.au

Whether you're planning a romantic getaway, a weekend with the girls or your mates, or a fun-filled family holiday, choes Bouti ue Hotel estaurant has something for everyone. Perched at the very edge of the Jamison Valley at Echo Point in the Blue Mountains, you can unwind and be pampered in the Day Spa before dining in the restaurant and enjoying a few drinks at the bar. With their sister hotel Lilianfels located next door, you'll also enjoy access to their leisure facilities including a heated swimming pool, floodlit tennis court, gym, and billiard and games room. hess, anyone

PLAY Got a bucket list? From the adventurous to the romantic (and everything in between), here are a few of the best ways to play in the Mountains.

Suzarosa Berambing Crest, Berambing  0411 179 920 suzarosa.com.au Down a quiet leafy country lane in the fruit orchard region of the Blue Mountains, you ll find this ama ing and private -acre property. Enjoy a self-catering getaway with accommodation for up to 13 people. Only one group booking is taken at a time, giving you exclusive use of the house and grounds. Outside, kick back on the enormous timber deck, heat up the BBQ and play a game of cricket or soccer on the huge manicured lawns. Alternatively, relax with a good friend or a great book - you'll never want to leave. And the views? Fabulous.

Issue 18 July 2018

25


Local Roaming

26

roamingpanthermagazine.com.au


Local Roaming

Issue 18 July 2018

27


Food

Winter Warmers COMFORTING SOUP AND DELICIOUSLY CREAMY PASTA BAKE – WINTER MEANS IT’S TIME TO HIBERNATE WITH SOMETHING HEARTY. Discover more Winter recipe inspirations by visiting Continental at continental.com.au.

SMOKY CHORIZO & PRAWN

¼ teaspoon ground turmeric 1½ cups (340g) medium grain rice 1 litre Continental Superb Stock Liquid – Chicken 400g can diced tomatoes ½ cup frozen peas, thawed 400g raw green prawns, peeled ¼ cup chopped parsley, to garnish Lemon wedges, to serve

Paella

Serves 4

PREP

| 15 MINUTES

COOK | 40 MINUTES

INGREDIENTS 2 chorizo, thinly sliced 1 tablespoon olive oil onion, finely chopped 1 red capsicum, chopped 2 cloves garlic, crushed 1½ teaspoons smoked paprika

28

roamingpanthermagazine.com.au

METHOD 1

Heat a large, heavy-based deep frying pan over medium heat. Add chorizo and cook, stirring occasionally, for 5 minutes until golden brown. Transfer chorizo to a bowl.

2

Heat oil in pan over medium heat. Add onion, garlic and capsicum and cook, stirring occasionally, for 5 minutes or until softened.

3

Add rice, paprika and turmeric and cook, stirring, for 1 minute. Stir in stock, tomatoes and reserved chorizo. Bring to the boil. Reduce heat to low and simmer gently, stirring occasionally, for 20 minutes. Stir in peas.

4

Place prawns on top of the rice and press down slightly so they are partly submerged into the rice. Cover and cook for a further for 5 - 8 minutes or until prawns are cooked and liquid is absorbed. Sprinkle with parsley. Serve with lemon wedges.


Food

Chicken Boscaiola Bakes Serves 2

PREP

| 10 MINUTES

COOK | 30 MINUTES

INGREDIENTS 1 tablespoon oil 300g chicken breast, sliced packet ontinental asta auce Boscaiola with Bacon armesan ¾ cup milk 1 cup water 2 cups baby spinach leaves ½ cup grated mozzarella cheese METHOD 1

Preheat oven to 200°C. Heat oil in a saucepan and brown chicken.

2

Add pasta, milk and water. Bring to the boil and simmer for 14 minutes.

3

Stir through spinach and divide between two ovenproof baking dishes. Sprinkle with cheese and bake for 10 minutes until golden brown.

4

Serve with salad.

CREAMY CHICKEN & CORN

Soup

Serves 4

PREP

| 10 MINUTES

COOK | 20 MINUTES

INGREDIENTS 2 teaspoons oil 2 rashers bacon, trimmed of fat and diced onion, finely chopped 400g diced chicken breast 1 x Continental Stock Pot Chicken, Salt Reduced 2 cups water 2 potatoes, peeled and diced ½ cup corn kernels 425g canned creamed corn ¼ cup cream METHOD 1

Heat oil in a large pan and brown bacon, onion and chicken. Add Stock Pot and water, bringing to the boil. Add potatoes and simmer for 10 minutes until tender.

2

Add creamed corn and kernels, and return to the boil.

3

Stir through cream and top with chopped chives and cracked pepper.

4

Serve with crusty bread.

Issue 18 July 2018

29


Food

Homemade Recipes WITH BEAMADE FOODS

W

e all love a hearty roast at this time of the year. This spiced lamb recipe offers an alternative to your typical roast dinner. It's simple to make and will have everyone running to the table - and then asking for seconds!

Roasted Spiced Lamb WITH PEACH & CHILLI CHUTNEY

SUPP

O RT I

INGREDIENTS 1 lemon, juiced with rind grated (set aside some zest for serving) 4 garlic cloves, crushed ¼ cup of extra virgin olive oil 1 teaspoon of ground cinnamon 1 tablespoon of ground cumin 1 tablespoon of sweet paprika 2 large red onions, cut into wedges 600g sweet potato, halved lengthways 1/3 cup chopped coriander leaves

NG

teaspoons dried chilli flakes . kg butterflied lamb leg 1 cup of chicken stock 1 jar of BeaMade Foods Peach hilli hutney YOU'LL NEED... Two large bowls Baking tray for the BBQ Tongs Plate for lamb to rest

METHOD 1

Prepare the spice rub by combining the lemon rind and juice, garlic, cinnamon, tablespoons of oil, and of your cumin, paprika and chilli flakes in a large bowl. Add your lamb and coat it well, then cover and put in the fridge for at least four hours (preferably overnight).

2

Remove the lamb from the fridge and let sit until it's at room temperature. Grease the baking tray.

3

Preheat the BBQ to 200 degrees (this dish is ideally done in a BBQ, but can also be done in the oven).

4

While the BBQ is heating up, grab the remaining spices and oil, and put them in a bowl with your sweet potato and onion. Coat well.

5

When the BB is hot enough, grill each side of the lamb until browned about five minutes). Repeat with the veggies for a minute or two, again until browned. If you want to use the oven, do this step in a pan on the stove.

6

Put the browned meat and veggies into a baking dish suitable for the BBQ. Pour in the stock, cover with foil, and place in the BBQ, cover down. Turn off the burners directly under the dish, but turn the surrounding ones on low to help maintain the temperature.

7

Depending on how you like your meat - it will take about 25 minutes for medium - adjust times to your preference. Remove lamb from the baking dish and place it on a plate covered in foil, letting it rest. Leave the veggies in until they’re tender.

8

Time to dish up. Stir half of the coriander through the chutney, slice the lamb, and then sprinkle with lemon zest and remaining coriander. Dinner is served!

100% LOCAL. 100% ADDITIVE FREE.

BEAMADE FOODS IS A FAMILY OWNED AND RUN BUSINESS, BASED OUT OF THE BLUE MOUNTAINS. WE BRING YOU THE BEST JAMS, CHUTNEYS, CONSERVES AND MORE, USING ONLY LOCALLY SOURCED INGREDIENTS.

LEARN MORE TODAY!

WWW.BEAMADEFOODS.COM.AU

/BEAMADEFOODS

@BEAMADEFOODS

DISCOVER THE FULL RANGE OF BEAMADE FOODS For more information about BeaMade Foods products, visit beamadefoods.com.au.  facebook.com/BeaMadeFoods/

30

roamingpanthermagazine.com.au

instagram.com/beamadefoods/


Health

Lower Back Pain EXPLAINED

HAVE YOU EVER EXPERIENCED LOWER BACK PAIN? Written by Kris Caloia

Local Experts Kris Caloia & Karl Thornton Physiotherapy Experts, Progressive Sports and Spinal Physiotherapy

I

f you have, you’re certainly not alone. Research suggests that around 80% of us have experienced some back pain in our lives.

The back is an amazing and complex system of vertebrae, discs, nerves, ligaments, tendons and muscles. Your back is heavily involved with your overall ability to keep upright, to walk, and to move. However, when lower back pain strikes, everyday movements and tasks can feel like a severe struggle. It can very quickly decrease your quality of life and ability to lead a healthy, active lifestyle. SOME OF THE MOST COMMON CAUSES OF LOWER BACK PAIN ARE: • Muscular strains • Ligament strains • Bulging discs • Bone injuries. • Poor posture HERE ARE A FEW EVERYDAY HABITS YOU CAN ADOPT TO HELP MANAGE LOWER BACK PAIN: • Avoid bending or twisting the lower back • Decrease your time spent sitting and, when you do sit down, maintain good posture • Keep a heat pack or hot water bottle handy at home or at work. This can help decrease spasms and improve blood flow to the area • Try sleeping on your side and with a pillow between your legs • Try to keep moving as much as possible, and avoid staying in the same position for too long • Never apply the ‘no pain, no gain’ theory to your back. If you're experiencing back pain, you need to stop and rest, and • For females, avoid high heels or other uncomfortable shoes. A combination of hands-on physiotherapy and core strengthening exercises can be some of the first steps to get you on your way to a healthy, pain-free back. Although we’ve mentioned some of the more common causes of back pain, there are a multitude of different causes, so it’s best to get an accurate assessment to identify the source of your pain. At Progressive Sports and Spinal Physiotherapy, we know just how crucial leading an active lifestyle is for a healthy, happy life. So, the last thing you need is for lower back pain to prevent you from doing the things you enjoy most.

get your physio assessment today An early assessment and treatment from the team at Progressive Sports and Spinal Physiotherapy will help you recover sooner. Call today to arrange a thorough assessment on 4721 7798.

Issue 18 July 2018

31


Health

It Takes a Village

A meltdown is often the only way someone with Autism can express themselves when they're overwhelmed with something in their environment.

Written by Simon Gould – Luke Priddis Foundation

According to Wikipedia, that bastion of credibility and font of all things truthful, the proverb ‘it takes a village to raise a child’ has been attributed to various African cultures. Here at the Luke Priddis Foundation, we think it rings true in our society as well.

around us can, and do, have a monumental influence on how we cope in any given situation.

W

A meltdown IS NOT the same as a temper tantrum. It's often the only way someone with Autism can express themselves when they've become overwhelmed by something in their environment. It can manifest itself as shouting and screaming, or even physically, such as kicking and biting.

e’ve talked about the dark side of Autism, the amazingly brilliant and creative side of Autism, and the reality of living with Autism. This month, we’re looking outwards. We’re looking at the community that surrounds people living with Autism and the impact that village has on their lives. No one lives in a vacuum, and so the actions, opinions and views of those

Today we’re asking you to turn the mirror on yourself, just for a moment. What is your first reaction when you see or hear a parent struggling with a screaming child in a supermarket or cinema, or on a train? Not a baby, but a toddler, or even an adolescent. Be honest. Are you thinking ‘what a brat’ or ‘what a terrible parent', or even something worse? Have you ever considered, though, that the parent may be struggling with a 'meltdown'?

People with Autism react very differently to stimuli in their surroundings. Too much noise can trigger a meltdown. Too

many people around them, unwanted or unexpected touching (such as someone brushing past them), a change in routine, or even bright lights, can all be triggers. Despite the best efforts of parents and carers to plan for and minimise the chances of being exposed to these triggers, sometimes they're unpredictable and an EPIC meltdown follows. It’s an uncomfortable feeling when you realise you’ve been judging people unfairly, isn’t it? Don’t worry, you’re not alone. It’s not easy to tell the difference between a tantrum and a meltdown. Next time you see what could be a meltdown, ask yourself if there is anything you can do to help. Better still, ask the parent. You may be able to help them while they tend to their child. You may even unwittingly be the cause of the meltdown if you’re too close, or your music or voice is too loud. Just by asking you can change that person’s entire day.

Do you need a Will?

Have there been recent changes in your life?

“Let us help you plan for the future”

50% OFF

WILLS & POWER OF ATTORNEYS DURING THE MONTHS OF JULY & AUGUST

• Are you an Executor of an estate and don’t know where to start? • Probate forms confusing? • No Will and you need to apply for Letters of Administration? • We also offer Estate Administration including, applying for Probate, Letters of Administration, calling in and disbursement of assets to beneficiaries. • We offer fixed price Estate Administration.

Amanda Little - Principal Solicitor Please contact Suite 10, 86 Henry St Penrith NSW 2750 us for further T. 4761 6935 F. 4761 6939 information www.amandalittleassociates.com.au 32

roamingpanthermagazine.com.au

help support our village Here at LPF we spend much of our time providing support to families who just need some understanding and support. We, in turn, need help from you, our village, so we can continue providing this support. For all the ways you can help, check out lukepriddisfoundation.com.


Relationships

Who Brings Home The Bread SO

Local Expert Melissa Ferrari Psychotherapist & Relationship Expert

IN YOUR HOUSEHOLD?

There has been a change in the balance of financial power across the country as more and more women begin to out earn their male partners.

S

o rapid has been this growth in wage-earning capacity that women in over half a million homes are now seen as the main breadwinner. This a rise of close to 30% over the past decade.

Feeling threatened can cause him to attempt to reverse this ‘imbalance’ by becoming more dominant in the partnership, which can cause serious damage to the relationship.

Vulnerability is the issue here, which is why we need to work on our trust to be able to share our vulnerable feelings regularly with each other. Such discussions create other opportunities, such as the male partner embracing the earning capacity of his partner so that if kids do come along, he may elect to stay home to care for them, seeing this as a better financial outcome for the family.

With this statistic likely to continue increasing in the modern age, the obvious question is: What impact is this shift having on our relationships?

The good news is that I am already seeing change on this front, with younger men who come into my practice far more accepting of the earning capacity of their partners than generations past.

This will come down to the attitude of the male partner. If he has been psychologically conditioned to a patriarchal belief that he ‘should’ be the main breadwinner, then it can cause an imbalance to the relationship as his ‘beliefs’ become challenged.

Vulnerabilities will always arise in a relationship, and a couple who have each other’s back in a 'what’s good for me is good for you' understanding will have a far greater chance of protecting their safe and loving twosome.

find the right balance For those who could use a little more help in finding the right balance in their relationship, please join me at my upcoming couples retreat at the exclusive Lilianfels Resort and Spa in the Blue Mountains on October 12-14. For more details visit melissaferrari.com.au.

The Relationship Expert Join Melissa Ferrari for An Insightful and Inspirational Small Group Couples Weekend Retreat at the exclusive Lilianfels Resort and Spa in the World Heritage Blue Mountains Friday 12th October - Sunday 14th October 2018 Visit my website for more details, to register and read reviews from the retreat attendees

Final Retreat 2018

• 2 day program with relationship education and experiential learning in group and 1 to 1 private sessions • Private, exclusive spacious spa room or valley room views for two nights • Buffet breakfast, morning tea, lunch and afternoon tea prepared by chefs at Lilianfels • 1 hour meet & greet pre-dinner refreshments and canapes on arrival • 3-course dinners - table for two at the hatted Darley’s and Echoes Restaurant & Bar • $100 spa voucher

melissaferrari.com.au Connect with me on social media by searching ‘Melissa Ferrari’

 02 4733 4094 or 0413 806 880  melissa@melissaferrari.com.au  Suite 11, 20-24 Castlereagh St, Penrith

Melissa Ferrari

Psychotherapist

I welcome couples to participate in this retreat. The program will guide you both through explorative engagement together to lead you to a secure-functioning relationship that is truly mutual, fair and collaborative and a relationship enlightened with the higher expectations we all wish to achieve with our chosen life partner.

Issue 18 July 2018

33


Health

Recognising Signs of Mental Health

Trent Talks

W

e constantly hear about mental health - ways we can deal with it and who we can seek for professional help, but how do we recognise the signs of mental health issues within ourselves and our loved ones? There are signs you can look out for inside yourself and those closest to you, but it’s important not to diagnose yourself or others; simply use the signs as a starting point for a means to explore further and seek professional help.

SUBSTANCE ABUSE Some people turn to drugs and alcohol, and sometimes unusual and risky behaviour, to feel 'normal', to feel better about their situations and circumstances, or to forget about their issues. EXPERIENCING OTHER EMOTIONS Having negative or unusual thoughts, having trouble concentrating or remembering things, being easily irritated and distracted, having problems with loved ones for no reason, and even low self-esteem may also be signs of a mental health problem.

STRESS AND ANXIETY Feeling upset, tense or anxious are all everyday emotions. But when stress and worry become intense, and are experienced for extended periods, they can become a part of a mental health problem that can affect your day-to-day life.

Help is available

FEELING UNHAPPY OR NOT YOURSELF Sometimes we can feel unhappy, sad or down for no reason at all. But sometimes these feelings can become so strong that they can develop into depression. Other times we may not feel like ourselves. Maybe you've lost interest, motivation or energy, or you just aren’t enjoying the things you used to.

If you are concerned about yours or a friend’s wellbeing, there are so many places available and willing to help. ids Helpline and ifeline offer free, confidential and anonymous advice 24/7. Kids Helpline: 1800 55 1800, web chat or email them.

SLEEPING AND APPETITE CHANGES ABOUT TRENT: Trent Merrin is studying towards a Bachelor of Psychology at the University of Wollongong. He plays rugby league for the Penrith Panthers, and owns and operates his own business Move Out Of Your Head which has recently launched a #moveoutofyourhead dance challenge!

Lifeline: 13 11 14 or web chat.

We know that we need around eight hours sleep a night to perform at our best. Sleeping too little or too much, as well as not sleeping at all, could be a sign of bad mental health. A lot of mental health issues can affect weight loss, but fluctuating weight, rapid weight loss, or not having an appetite could be a sign of depression or an eating disorder.

Don’t forget, it’s okay to accept help. We seek help when we have a flu or cold, so it’s just as important, if not more important, to seek help for issues within your mind as well.

WIN $10,000 CASH EVERY THURSDAY

(DRAWN BETWEEN 6PM - 7PM)

WIN $10,000 CASH EVERY SUNDAY

(DRAWN BETWEEN 5PM - 6PM)

MAJOR $50,000 CASH DRAW EVERY 10 WEEKS

PANTHERS.COM.AU 34

roamingpanthermagazine.com.au

1300 PANTHERS

BOUNTY BONUS DRAW if major draw not claimed

WIN A SHARE OF $5,000.

Swipe your membership card & place ticket

See staff for details.

Terms & Conditions apply. LTPS/18/23076


5 TRIPS LEFT!

WIN

A TRIP TO

every

HOW?

Receive an entry ticket when you: Swipe member card daily at a kiosk Spend $10 at selected* outlets Spend $20 on raffle tickets

1 TRIP WON EVERY FRIDAY

DRAWS

Fridays between 7pm & 9pm Must be here to WIN *Kelly’s Brasserie, Kelly’s Café & Bar, The Ming all & Panthers owned bars. Terms & conditions apply. LTPS/18/23322

S A

A

T

F

R

I

U

G

S

E

P

A

T

E

P

18

07

SHANNON NOLL T I C K E T S F R O M $42.55 | 8PM

T I CKE T S F RO M $49.35 | 8PM

F S

R

I

S

E

P

S

14

BRITISH

BOOTLEG

BEATLES

INVASION

T I CK E T S $41.50 | 8PM

PANTHERS.COM.AU

T I CKE T S $64.55 | 8PM

1300 PANTHERS

29


Pets

Local Vet

Old Age

Dr Erin Short Coreen Avenue Veterinary Clinic

IT'S NOT A DISEASE

A

s our pets get older we often notice that they're less active, less mobile and, sometimes, less happy. Owners may notice changes in appetite, thirst, weight and behaviour. “That’s just a sign of old age, isn’t it?” many people ask. As their bodies age, animals are prone to many diseases that can affect their quality of life, but old age in itself is not a disease. While many of the diseases that affect our older patients cannot be cured, they can be well managed. When a pet slows down it may be due to joint pain from arthritis or reduced exercise tolerance from heart disease. Weight loss may be due to organ dysfunction or cancer. Confused or changed behaviour may be due to dementia. Incontinence may be due to metabolic diseases affecting thirst and urination.

Quality of life is the most important factor in assessing and managing our older patients.

assess organ function. They also test for metabolic diseases like diabetes and thyroid disease. Imaging may be required to further assess any abnormalities. Radiographs and ultrasounds can be performed in-house, but referral is required for CT and MRI. Early detection can often enable more cost-effective and successful treatment of diseases. We're fortunate that there are a range of supplements, prescription diets and medications that can treat many diseases.

Regular health checks are a vital means of assessing our patients. A presumptive diagnosis may be possible from a thorough history and examination.

Treatment options are always discussed for each patient. The risk of performing a procedure may be too high for an individual. Or the cost of particular treatments can be high and not carry a guaranteed positive outcome. Palliative care can be used in these cases, which is aimed at keeping a patient as happy and comfortable as possible, for as long as possible. The treatments will often depend on the disease but are often centred on pain relief.

Screening blood and urine tests can be easily performed in-house, and are an important way to

Quality of life is the most important factor in assessing and managing the health of our older patients.

Coreen Avenue Veterinary Clinic and Western Sydney Cat Hospital

Every pet entering the practice becomes an integral part of our family unit.

Come and join our family 36

roamingpanthermagazine.com.au

LO

2017 201 7

AW

PENRITH CITY

 02 4731 3055

CHAMPION

AWARDS 2017

FINALIST

ARDS

WINNER

Unit 2 & 3/117 Coreen Ave Penrith, NSW, 2750 A U S T R A L I A N SMALL BUSINESS

L BUSIN CA

S ES

AMANDA LITTLE Where every pet has the & ASSOC. opportunity to be loved, cared for and recognised as QP AD a priority.

www.cavets.com.au


Travel

Wonderful World of Canada

Local Experts

THE

If you're looking to visit Canada, or if you've travelled there before, you'll know that it's a big place with so much to explore.

T

Lynette, Kerrie, Jenny & Nicole

Travel Experts Maria, Fellowes & Turner Travel Associates Penrith

famous Lake Louise, which is spectacular all year round. Take a walk to the base of the Athabasca Glacier and marvel at its size. The famous Rocky Mountaineer rail trip from Vancouver can take you on four jawdropping journeys through the heart of this rugged landscape, all in style and comfort, and creating a truly unforgettable experience.

he weather varies greatly from region to region, making Canada a diverse country to explore any time of the year. ou ll find ama ing hikes and walking trails, some of the best ski runs and powdered snow in the world, beautiful sandy beaches, water sports and activities... the list goes on.

The Northwest Territories provide some of the best aurora borealis viewing in the world. The magical reds, blues, greens and yellows dance across the night sky to create a surreal experience; a moment in time you'll treasure forever. Yellowknife or Whitehorse are great places to start the experience.

Canada is famous for its Rocky Mountains, home to iconic national parks, glaciers, valleys, rivers and forests, all of which will dazzle you with their scale and beauty. Visit the

Across the country, New Brunswick and Nova Scotia lay home to the Bay of Fundy (which is itself home to the highest tides in the world, responsible for the coastline's

unique landscape). Get up-close and personal with whales and other marine life on a zodiac, view the spectacular Autumn colours with the changing of the leaves, taste exquisite delicacies from the sea, and explore the beautiful city of Halifax. Just across the way is the Province of Quebec, predominantly French speaking and the home of two of the most spectacular cities in all of Canada - Quebec City and ontreal. With their magnificent architecture, history, art and style, enjoy walking through these beautiful cities and experiencing their delicious cuisine. And of course, one of the most famous places of interest in Canada is Niagara Falls. The most expansive cascade section of the falls, the famous Horseshoe Falls, gives you a lower and wetter vantage point behind the falls for a truly invigorating experience.

Canada 15 DAY LUXURY EUROPEAN RIVERVictoria, CRUISE

from $6995*

VANCOUVER

Let Travel Experience centuries of history, legend and enchantment as you discover Europe with APT. From cruising along tranquil estuaries from $6755* Associates and mighty rivers to traversing storybook scenery, they’ve left no acquaint course unchartedyou in creating an unforgettable European journey.

Business Class flying Air Canada

- BONUS -

FLY FREE*

VANCOUVER TO SYDNEY with the majesty Your luxury experience Includes: CRUISE theeconomy Golden l of Return class airfare from Australia to Europe Princess exploring l 14 Nights nights Golden Princess accommodation onboard the 29 luxurious MSon AmaBella lthe 14 breakfasts, 13 lunches, of complimentary wonders of 14 dinners and a range Balcony from $8019* beverages served on board Vancouver and Itinerary: Vancouver - Victoria - San Francisco - Hilo l All-inclusive sightseeing in up to 16 destinations - Honolulu - Bora Bora - Tahiti (Papeete) - Pago beyond. l

Pago - Auckland Tauranga - Napier Marlborough 3 APT exclusive Royal Signature Experiences, The-Grand Empress steam-train, Princess Heide’s Namedy Castle & Vienna Palace concert SoundsCity - Sydney *BONUS onboard credit*

Freecall 1800 040 744 or email penrith@travel-associates.com.au 14 Macquarie Avenue, Penrith. travel-associates.com.au/mariafellowes *Travel restrictions & conditions apply. apply. Prices are per are person subject twin to availability. Valid for to sale until 30 AprValid 18, unless sold out prior. *Travel restrictions & conditions Prices per&person, share & subject availability. for sale until PriceVancouver is based ontoinside cabin 13 Apr 19 departure. DEAL 31 Jul 18, unless sold out prior. Sydney (Deal 5226071): Airfare not 5129319. included. 25 Sept 2019 dept. Flight Flight Centre Travel Group (ABN Limited 003 377trading 188) trading as Travel Associates. ATAS AccreditationNo. No.A10412 A10412 Centre Travel Group Limited 25(ABN 003 25 377 188) as Travel Associates. ATAS Accreditation

Issue 18 July 2018

37


Beauty

Brazilian Waxing EVER WONDERED WHY SO MANY OF US ARE MAKING THE TRIP DOWN SOUTH TO BRAZIL?

Local Expert

Marianne Arthur Beauty Expert Insignia Hair and Day Spa

Some of you may be curious as to exactly what a Brazilian wax entails. If you currently remove the hair on your bikini line, you're halfway there.

A

Brazilian is very similar to a regular bikini wax except that we remove all of the hair in the pubic region.

Bra ilian waxing was first introduced back in by a group of Brazilian sisters, but the hair removal method only became popular over the past two decades. And that popularity really skyrocketed over the last years. I find that a lot of women originally start having Bra ilian waxing done for their partner’s benefit. But it s interesting to watch how, after the first wax or two, it becomes something they get done for themselves. There are so many benefits that come with Bra ilian waxing, despite that little bit of… ahem… pain.

Not only does waxing remove hair, but it’s a physical exfoliation, too. This means it removes dead skin cells in the process. And because you're removing the hair from the root rather than cutting it off with a razor, or burning it off with hair removal cream, you’ll be as smooth as a baby’s bottom. This also means you'll enjoy longerlasting results, with hair taking longer to grow back than it would with shaving. There’s no stubble or prickly regrowth, and it will grow back finer, softer and sparser. Waxing also causes minimal skin irritation, especially compared to creams. Not only that, but you won’t have to worry about any stray hairs coming out of your swimwear! And of course, everything just feels fresher down there. So - ready to take a trip to Brazil? get your brazilian wax on Make an appointment now and experience the benefits of a Brazilian wax by contacting Marianne at Insignia Hair and Day Spa on 4722 3503.

The Highest Standard in Concreting Services in Penrith & Blue Mountains 38

roamingpanthermagazine.com.au

I find that a lot of women originally start having Brazilian waxing done for their partner’s benefit. But after the first wax or two, it quickly becomes something they get done for themselves.

AF FORDABL E S E RVICE S TA ILO RE D TO S U I T YOU

CALL US NOW

0411 704 302

WWW.SLCONCRETE.COM.AU


Myths and folklore There are a lot of misconceptions surrounding jewellery. As consumers, it’s important that you’re aware of the realities of jewellery before you purchase your pieces.

Jewellery HERE ARE SOME OF THE MOST COMMON MYTHS THAT NEED DEBUNKING. One of the most misleading beliefs surrounding jewellery is the myth that 9ct gold is harder than 18ct gold. This misconception is born from the fact that 24ct gold, or pure gold, is a malleable metal. While it is true that pure gold is soft, the notion that 9ct gold is harder than 18ct is false. Allow me to explain; gold is a dense, ductile metal that bonds strongly to itself and is capable of absorbing pressure. Gold is often alloyed with other metals, including silver, palladium and copper, in varied amounts depending on the carat of gold. These alloyed metals help to bind the gold and give it a more solid form for long-term wear. However, the strength of the gold actually comes from the gold itself. As gold is a ductile metal, it is strongest when it can bind to itself, therefore the higher the gold content the better it will hold its form. If you knock a 9ct gold ring, the ring might not show any sign of wear. If anything, you might see a small scratch but the gold will wear away over time at a quicker rate with those knocks. On the other hand, if you knock an 18ct gold ring, while you may see a physical sign of wear like a dent, the gold will absorb the hit and remain intact.

This brings us to our next jewellery misconception; jewellery does not require maintenance. As gold and precious metals are capable of wearing away over time, they do require servicing to keep them strong and in good condition. It’s common in jewellery for metal to wear down, which puts you at risk of losing gemstones or losing your piece. Jewellers recommend having your jewellery serviced regularly. Items you wear every day, like wedding rings or necklaces, should be serviced twice a year. A service provides the benefit of cleaning your jewellery, as well as ensuring that it’s in good condition and that you’re not at risk of permanent damage to your piece or losing stones. Over time, more work will be required to keep your jewellery in the best condition. This may include replacing parts, adding gold, or resetting stones to ensure it’s wearable. Finally, the myth that diamonds don’t break. Diamonds are among the hardest materials on earth; in fact, they measure at 10 on the Mohs scale (an international measure of mineral hardness). However, this doesn’t mean that your diamond will never break. Diamonds are made up of a crystallised carbon structure so, if your diamond experiences pressure, such as a hard knock, the structure can be damaged or broken.

FOR MORE INFO ON JEWELLERY

Jewellery With DOUGLAS ELY

For more information on jewellery, or to have your own questions answered, head into York Jewellers where our team of experts can help you advance your own jewellery knowledge.

Designer | Jeweller

 York Jewellers estfiel enrit o ig

t

enrit

For All Your Beauty Needs

Insignia Hair & Day Spa is an award winning hairdresser located in Penrith. We also have a full Day Spa with Beauty Salon, Massage Therapist and Nail Parlour all in the heart of Penrith. Insignia Hair & Day Spa is your Hairdresser in Penrith we specialise in creative cutting and colouring for men, women and children, colour correction, total restyles and makeovers to make you look and feel amazing.

HAIR

BEAUTY

DAY SPA

 (02) 4722 3503

14/69 York Rd, Penrith NSW 2750

i n si gn ia h a ira n d d a ysp a .com.au Issue 18 July 2018

39


Budget

HOW YOU CAN SAVE ON YOUR

Household Budget Is paying your bills a confusing nightmare?

Local Expert

Maria-Luisa Patisso Budget Expert My So-Called Lifestyle

P

aying different bills at different intervals can be confusing, especially if you’re paid weekly or fortnightly. I always use a budget (on a basic spreadsheet), which allows me to know exactly how much I have for luxuries and additional spending. I always forecast the year ahead. By writing down when certain bills are due in specific months, I then know when I have to tighten the belt or carry money over from the healthier months. It works for me, but I think any written budget that shows what you have left to spend is a good budget! Next, withdraw in cash the money you have left to spend - and don’t grab the plastic to PayPass! This lets you keep control and not overspend. Every week I take out my grocery, fuel and personal spends cash. Once it’s gone, it’s gone! Finally, every month take a few minutes to go through your list and see where you can save. Look at switching providers or changing plans to save money. Here are a few ideas for you: Mortgage: Call your broker/provider and ask if they can reduce your rate. I did it and they automatically dropped my rate by 0.5%, which saved me $200 per month! Internet: Are you paying for top speed or extra gigabytes? I was paying for the top speed and wasn’t getting it, so I dropped to the lowest plan. Mobile one When your contract is up, don’t take the upgrade and switch to SIM only. Instead, investigate the great plans that are only $30 or less per month.

Gas/Electricity: Call a range of providers and compare quotes by giving them the details of your last bill usage. Also, be clever about the power you use. Even though it’s cold, every time you put the heating over 21 degrees it adds 10% to your bill! Use draft excluders at the doors, turn switches off, and don’t boil a full kettle if you only want one cup. Car/House/Life Insurance: Check around; there are plenty of good deals out there. Look at paying your life insurances from your Super if you need to free up some cash. Credit Cards: If you have any credit debts, pay them off as quickly as you can. Look at balance transferring to a 0% interest card, or pay off the debts in order of the highest interest charged first. Groceries: Plan meals, write a list, and budget. Winter calls for slow cooking using cheap cuts of meats. And swap your fresh veggies for frozen - they’re just as good for you. Household Cleaning: White vinegar is so versatile. Mix with water to wash floors, clean surfaces, and use cup in your washing machine instead of fabric conditioner. Trust me - it works a treat! FOR MORE TIPS AND TRICKS For money-saving tips, money-saving recipes, and hacks to make life a bit easier, follow me on Facebook: My So-Called Lifestyle Instagram: @mysclifestyle Email: mysclifestyle@outlook.com

An analysis of our current situation [by Clear Path Accounting] has led to proactive changes…we value their role as an innovative business advisor who always responds promptly to our enquiries. Tom & Asha Dooley - Grace Funerals, Emu Plains

Our mission is to empower you with clarity and direction to build your perfect business We share relevant solutions, provide outstanding support and inspire positive change. We strive to unlock the full potential of your business and we will help you take control and accelerate results to achieve your goals. We will bring clarity and simplicity to the accounting and financial side of your business. We price our services upfront, which means no surprise accounting fees for you. Business Advisory Accounting Taxation Bookkeeping Self-Managed Super Funds

Contact us now to find out more!

clearpathaccounting.com.au 40

roamingpanthermagazine.com.au

 02 4739 2700 Suite 1, 13 Hope Street, Blaxland NSW 2774


Interiors

Comfort at Home this Winter

BEGINS WI TH FREEDOM PENRI TH

Darby Table Lamp in Black $30.00

Accra Hanging Wall Art $65.00 Amerto Hanging Wall Art $30.00

Den Armchair in Access Fire $499.00

s ect iece Fabric Modular + Ottoman in Ryder Mineral $1,699.00

Ibori Rug from $449.00

There’s something about cold weather and the whole ‘wanting to hibernate and watch a TV series or two’. So why not do it in style with Freedom Penrith’s Autumn Winter Collection?

Andersen 2.5 Seat Leather Modular with Chaise in Union Tobacco $4,999.00 Holcomb Table Lamp $169.00

We’ve selected a few of our favourites; head in store for styles and options.

Romain o ffe $199.00

Wharf Coffee Table $499.00

Add Warmth & Texture Layer your bedroom with tactile faux fur and cosy knitted accessories to add warmth and texture during the cooler months.

DRAGONSTONE Faux Fur Throw $129.00

RAFFAELE Cushion 50x50cm $40.00

KIEL Cushion 50x50cm $50.00

GOMEZ Cushion in rose smoke 50x50cm $40.00

The Highest Standard in Concreting Services in Penrith & Blue Mountains AF FORDABL E S E RVICE S TA ILO RE D TO S U I T YOU

Kenza Rug From $699.00

WINTERFELL Faux Fur Throw $119.00

NYMERIA Faux Fur Throw $99.00

REGINA Throw $179.00

AKORI Throw 130x150cm $169.00

LYLA Cushion in natural 40x60cm $40.00

CALL US NOW

0411 704 302

WWW.SLCONCRETE.COM.AU


Property

Comparibles and the Value Honest Agent

OF AN

O

ften it seems that one agent will passionately proclaim they can get the highest price, while the other provides seemingly dry data to quantify the value of your home. Who do you choose? Is one less determined than the other? Does one not see the value in your home that you see? This is a scenario when logic should outweigh emotion. An agent may give you the number you want to hear in order to secure your business, but this doesn’t provide what you need; being the reality of the current market and an honest appraisal. During these conversations you may hear the word ‘comparables’ and wonder, what are they? Agents have access to several databases with records of millions of home sales across the country. This gives us real sales data of homes like yours in your area, providing a ‘comparable’ on which to price your home. That said, no agent or database can predict the exact value of your property. Only the buyers in the market can do that.

So is a conservative agent underselling your home? The simple answer is no. A good agent will always provide you with the current market value of your home based on recorded data, then aim to attract buyers with an emotional response to your property. This, in turn, increases the odds that competition among buyers will drive the price upward. To equalise the process of pricing a home, Fair Trading NSW upholds underquoting laws pertaining to the sale of residential properties. The practice of underquoting causes active buyers to waste time and money at inspections and auctions because of misleading estimates of the selling price. Agents charged with underquoting face a potentially hefty fine and the loss of their commission. On the flip side, overpricing a property is equally misguided. The reality is that consumers rarely purchase anything that’s overpriced. Today’s buyers are savvy and aware of the market trends in their chosen area. Having a home on the market for too

Local Expert

Sharon Mudiman Property Expert Bespoke Realty Group

long causes suspicion in an active market, and the likelihood of offers reduces when buyers are offside. So, have a forthright conversation with your agent. Ask for a comparables report. If you don’t receive one, choose an agent offering expert advice. Then build a good rapport with that agent that sustains you through honest conversations during the sales process. SPEAK TO BESPOKE REALTY GROUP FOR HONEST ADVICE Sharon Mudiman, Licensee and Principal of Bespoke Realty Group (formerly Glenmore Park First National), has been negotiating the sale of property for over 25 years in the Greater Penrith Region. Get in touch with Sharon today on 4737 9977 or visit bespokerg.com.au.

An agent may give you the number you want to hear in order to secure your business, but this doesn’t provide what you need; which is the reality of the current market and an honest appraisal.

42

roamingpanthermagazine.com.au


GLENMORE PARK


Lending

Comprehensive Credit History

Local Expert Rob Lees

Lending Expert Mortgage Choice Blaxland, Penrith and Glenmore Park

HOW THIS CAN HELP OR HINDER YOU WHEN APPLYING FOR A LOAN.

I

f you have ever applied for any form of credit, a credit reporting agency will hold a report detailing your credit history. The report will have your personal information, such as your name and address. It will also include applications you may have made for credit cards, loans you’ve applied for, your monthly repayment history, whether you paid your bills on time, and any overdue debts or bankruptcies against your name. Defaults, late payment history and bankruptcies will stay on your credit report for a number of years, so it’s important to take a disciplined approach to paying your bills and loans on time. Your credit report is used to help credit providers assess the level of risk associated with providing you a loan or credit facility. If you plan to apply for a home loan, it’s a good idea to get a copy of your credit report before approaching a lender so you know where you stand. You are entitled to a free copy of your credit report once a year from a trusted credit reporting agency. CREDIT HISTORY Over the last few years there have been a number of changes that affect how your credit history is collected

44

roamingpanthermagazine.com.au

and used. In 2012, the Privacy Act was amended to allow credit providers and credit reporting bodies to collect, use and disclose comprehensive credit information.

situation, allowing them to better meet their responsible lending obligations.

The credit reporting system, which is regulated by the Privacy Act, limited the information that could be collected, used and disclosed by credit providers and credit reporting bodies to ‘negative information’ about you. This meant any positive behaviour, such as paying bills on time or paying off a loan, was overlooked.

This increased transparency around credit reporting will arm you with more knowledge about your own financial situation. It will also provide lenders and credit providers with a more balanced assessment of your credit history.

WHAT ARE THE CHANGES? Following a government mandate from the 2017 Federal Budget, the National Consumer Credit Protection Amendment Bill 2018 looks to give both you and credit providers with more access to your credit history and, therefore, more control over your financial situation. Effective 1 July 2018, large lenders, which account for more than 80% of household lending, must provide credit information on your credit accounts to credit reporting bodies. This will allow credit providers to obtain a comprehensive view of your financial

WHAT DOES THIS MEAN FOR YOU?

Such comprehensive reporting is also expected to improve competition and efficiency in the market. In fact, lenders may incentivise good credit behaviour by giving you access to loans with more competitive interest rates. Unfortunately, though, this increased transparency enables lenders to now see a more detailed version of your credit history, and they may use a poor credit history against you. That being said, you should take the opportunity to change your habits in order to improve your chances when applying for credit or a loan.


Helping Helping Helping you you you make make make better better better choices choices choices in in in the the the Opening Opening Opening soon soon soon at at at the the the new new new Opening soon new Helping Helping Helping you you you make make make better better better choices choices choices in in in the the the at the Opening soon at Opening the new soon Opening at Opening the Opening new soon soon soon at at the at th Opening soon at Opening the new soon Opening at Opening the Opening new soon soon soon at at the at th Blue Blue Blue Mountains, Mountains, Mountains, Penrith Penrith Penrith and and and Glenmore Glenmore Glenmore Park Park Park Blue Blue Blue Mountains, Mountains, Mountains, Penrith Penrith Penrith and and and Glenmore Glenmore Glenmore Park Park Park Glenmore Glenmore Glenmore Park Park Park Shopping Shopping Shopping Centre Centre Centre Glenmore Park Centre Shopping Glenmore Park Shopping GlenmoreCentre Park Glenmore Glenmore Shopping Glenmore Park Centre Park Park Shop Sho S

Glenmore Park Shopping GlenmoreCentre Park Glenmore Glenmore Shopping Glenmore Park Centre Park Park Shop Sho S p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith w MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees pp pp p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland pp pp p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith ww ww w MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees talk talk talk to to us us us today today today talk toto us today talk to us today talk talk to talk to us us today to today us today talk talk talk to to to us us us today today today talk us today talk to us today talk talk to talk to us us today to today us today to us today talk to us today

Glenmore Park p 4739 9749 Blaxland p p 4721 4739 1733 9749 Penrith Blaxland p p p 4739 4739 4721 p 9749 4739 1733 9749 Blaxland 9749 Penrith Blaxland Blaxland p p 4721 47 p p p p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland p p p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith Glenmore Park p 4739 9749 Blaxland p p 4721 4739 1733 9749 Penrith Blaxland p p p 4739 4739 4721 p 9749 4739 1733 9749 Blaxland 9749 Penrith Blaxland Blaxland p p 4721 47 p p p p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland p p p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith 4739 9749 Blaxland 1733 Penrith pw 4739 9749 Blaxland p 4721 1733 Penrith MortgageChoice.com.au/rob.lees w w MortgageChoice.com.au/ro w MortgageChoice.com.a Home Home Home loans loans loans || Financial || Financial || Financial planning planning planning || Risk || MortgageChoice.com.au/rob.lees Risk || Risk and and and General General General insurance insurance insurance || w Car ||MortgageChoice.com.au/rob.l Car || loans Car loans loans || Business || Business || Business lending lending lending w MortgageChoice.com.au/rob.lees w MortgageChoice.com.au/rob.lees w w MortgageChoice.com.au/rob.l MortgageChoice.com.au/ro w MortgageChoice.com.a Home Home Home loans loans loans Financial Financial Financial planning planning planning Risk Risk Risk and and and General General General insurance insurance insurance Car Car loans Car loans loans Business Business Business lending lending lending w w w MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees w ww MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees w MortgageChoice.com.au/rob.lees

Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN 645 158 ACN 624. 645 158AFSL 624. 645 422854. AFSL 624. AFSL 422854. 422854. Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN 645 158 ACN 624. 645 158AFSL 624. 645 422854. AFSL 624. AFSL 422854. 422854.

Home loans | Financial planning | Risk Home and General loans | Financial insuranceplanning | Car loans Home | Risk Home | Business and loans Home loans General | Financial lending loans | Financial insurance | Financial planning planning | Car planning | Risk loans | Risk and | |Busines and Risk Gener Gen an Home loans | Financial planning | Risk Home and General loans | Financial insuranceplanning | Car loans Home | Risk Home | Business and loans Home loans General | Financial lending loans | Financial insurance | Financial planning planning | Car planning | Risk loans | Risk and | |Busines and Risk Gener Gen an

Home Home Home loans loans loans || Financial || Financial || Financial planning planning planning || Risk || Risk || Risk and and and General General General insurance insurance insurance || Car || Car || Car loans loans loans || Business || Business || Business lending lending lending Home Home Home loans loans loans Financial Financial Financial planning planning planning Risk Risk Risk and and and General General General insurance insurance insurance Car Car Car loans loans loans Business Business Business lending lending lending Home loans | Financial planning | Risk and General insurance | Car loans | Business lending Home loans | Financial planning | Risk and General insurance | Car loans | Business lending

Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Mortgage Mortgage PtyChoice Choice Limited Limited Limited ACN 158 ACN ACN 645009 009 624. 161 161 AFSL 979. 979.422854. Australian AustralianCredit CreditLicence Licence382869. 382869.Mortgage MortgageChoice Choice Mortgage Financial Financial Mortgage Choice Planning Planning Limited Choice Pty PtyLimited Limited ACN Mortgage Limited 009 ACN ACN 161 ACN Choice 158 979. 158 009 645 645 Australian Limited 161 624. 624. 979. AFSL AFSL ACN Australian Credit 422854. 422854. 009 Licence 161Credit 979. Australian 382869. LicenceMortgage 382869. Credit Mortgage Licence Choice 382869. Financial ChoiceMortgage Financial PlanningChoice Planning Pty Limited Financial PtyACN Limited Planning 158 645 ACN 624 Pty 158

Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Mortgage Mortgage PtyChoice Choice Limited Limited Limited ACN 158 ACN ACN 645009 009 624. 161 161 AFSL 979. 979.422854. Australian AustralianCredit CreditLicence Licence382869. 382869.Mortgage MortgageChoice Choice Mortgage Financial Financial Mortgage Choice Planning Planning Limited Choice Pty PtyLimited Limited ACN Mortgage Limited 009 ACN ACN 161 ACN Choice 158 979. 158 009 645 645 Australian Limited 161 624. 624. 979. AFSL AFSL ACN Australian Credit 422854. 422854. 009 Licence 161Credit 979. Australian 382869. LicenceMortgage 382869. Credit Mortgage Licence Choice 382869. Financial ChoiceMortgage Financial PlanningChoice Planning Pty Limited Financial PtyACN Limited Planning 158 645 ACN 624 Pty 158

Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN645 158 ACN 624. 645 158AFSL 624. 645 AFSL 422854. 624. AFSL 422854. 422854. Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN645 158 ACN 624. 645 158AFSL 624. 645 AFSL 422854. 624. AFSL 422854. 422854.


Finance

Renting Your Home on Airbnb

Local Expert Melissa Browne Money & Business Strategy Expert Accounting & Taxation Advantage

WHAT YOU NEED TO KNOW

More and more homeowners are looking for ways to increase their household income. This includes looking to their family home to provide extra funds through Airbnb, or renting out the granny flat in the backyard.

W

hile this might seem like a short-term win, which may also include the ability to claim a percentage of your mortgage as a tax deduction, it’s important to be aware of both the shortterm and the long-term tax implications. If you decide to rent your granny flat on irbnb, let’s look at your short-term tax obligations first. If it’s available to rent every week and it’s available for market rent, then you may be entitled to claim a percentage of your interest, council rates and more against the income

derived. This means that part of your ownership costs may be tax deductible. This can be great, as it may mean that the income and expenses cancel each other out and you end up paying no income tax on the net income. However, the long-term tax implications are the ones that too many people forget. That’s because most people aren’t aware that they may lose their main residence exemption if they use their house for income producing purposes. This means you’ll potentially pay Capital Gains Tax (CGT) when it’s time to sell your home. Now when it comes to declaring income earned, if you’re thinking to yourself, ‘I’m only renting my spare room out every other weekend on irbnb, the Tax Office will never find out’ I urge you to think again. That’s because the Tax Office can data-match your information on sites such as Airbnb to ensure that you’re declaring income. Does this mean that you shouldn’t be renting out the granny flat or making a few extra bucks on irbnb Generally, no. However it’s important to understand the tax implications of the income you’re making.

WE ARE THE

WINNERS!

Specialists in conveyancing. We have the key… to make conveyancing STRESS FREE for you

CALL US TODAY  (02) 4731 2483 kristi@townsconveyancing.com.au

townsconveyancing.com.au

46

roamingpanthermagazine.com.au

When you eventually sell your house, usually you wouldn’t pay tax on the profit as you would be entitled to the main residence exemption. However, if your property was income-producing for part of that time, it’s potentially now subject to Capital Gains Tax (CGT). The good news is that you’re potentially entitled to a 50% discount and to pro-rata any time when the property was not being rented on Airbnb, which may dramatically reduce any tax payable. What’s important is to not bury your head in the sand and claim that you didn’t know you needed to pay tax. That’s simply not a good enough excuse, and the ATO will issue fines and penalties if you’re not declaring both the income and the CGT. irbnb and granny flats can be a fantastic way to make some extra money from what’s often our biggest and costliest asset, however it’s important to be aware of your tax obligations both in the short term and over the long term.


Legal

Protect Your Family? DOES YOUR WILL REALLY

Local Expert Joseph Grassi Legal Expert Joseph Grassi + Associates

The trustee may distribute capital and income to any beneficiary at any time and in any proportion. Testamentary Trust gives the beneficiaries flexibility and control over when and how they take their inheritance.

Putting a Testamentary Trust in your will can give you great flexibility and protect your assets. It can also minimise tax payments for those you wish to benefit from your estate.

one of t e assets are legally owne by t e beneficiaries ntil t e tr stee exercises is or er iscretion w en istrib ting t e assets e tr stee ay rotect t e assets in so e of t e following circ stances

A

Testamentary Trust set up under a will only comes into effect after death. In a Trust, the assets are managed by one or more trustees for the benefit of those who are to share in the assets the beneficiaries .

• i orce brea own in the relationship of a beneficiary • re itor rotection • ig ris beneficiaries, such as those who may be at risk of being sued • ill c allenges • oss of ocial ec rity entitle ents lnerable beneficiaries, such as spendthrifts or those with gambling drug addictions, and e arriage of s o se - in this case, the Testamentary Trust is useful for families who wish to provide for their spouses but are concerned that they may remarry and divert the family assets to a new family.

In a Testamentary Trust, the trustee has the discretion as to when to distribute the capital and income among those nominated in your will. It is a good practice to include a number of beneficiaries to give the trustee flexibility in distributing the capital and income among them. Testamentary Trusts, like wills, are not standard documents. They are drafted to suit the specific needs of each individual.

Taxable income generated by the Trust can be allocated to the beneficiaries of the Trust in a tax-effective way. The trustee has the power to distribute the Trust income to any of those who are nominated as beneficiaries. For example, if the spouse, partner or dependant of a beneficiary is not working, nor receiving an income, the Trust may allocate income to such a person provided he she is a beneficiary . There will also be administrative costs for maintaining a Trust, such as accountancy fees for preparing Trust taxation returns. o s o l a e s re t at t e inco e generate by yo r estate will a be s fficient to warrant a esta entary r st an b a e s fficient assets lso check whether any of the conditions outlined above apply to one or more of your intended beneficiaries.

This article is for general information only, and is not intended as legal advice. If you need specific help contact your solicitor.

EXPERIENCE & RELIABILITY Personal Legal Services • Property and Conveyancing • Wills, Probate & Administration • Estate Planning

• Asset Protection Planning & Implementation • Notarial Services

Commercial Legal Services • Planning & Environment Law • Commercial Advice • Corporate Law & Governance • Business Law • Employment & Industrial Law

• Retail, Commercial & Industrial Leasing • OH&S Law • Debt Recovery, Bankruptcy & Insolvency Law

Meet Joseph Grassi Director of the firm since it first opened in 2008. Joe’s area of practice is in domestic, commercial & industrial conveyancing, commercial leasing, Land & Environment, business, health and tax law. Joe and his family call Penrith home and he has a keen interest in the area and a desire to see it prosper.

• Intellectual Property

Solicitor Director: Joseph M Grassi Dip Law (SAB) LLM Accredited Specialist Property Law Notary Public Solicitor: Grant Wiblin LLB, BSocSc, GDipLegalPrac Licensed Conveyancer: Wendy Harvey | Office Manager: Lois Grassi | Administration: Emily Beal

Suite 1, 86 Henry Street, Penrith 2750  info@grassiassociates.com.au

 4702 5905

www.grassiassociates.com.au Issue 18 July 2018

47


Digital

Local Expert

SEO in 2018

Trish Fehon Digital Expert Online Influence

THE GOOD THE BAD AND THE UGLY Ever wondered what SEO means?

S

O is earch ngine Optimisation, or improving your ranking in an online search. ounds simple enough but achieving good’ O can be tricky.

To find out where your site fits, type your website name with spaces and no .com.au into the oogle search bar. If you’re in a competitive industry, add your suburb too I’m focusing on oogle here because it’s the most popular search engine in ustralia . If other businesses sit ahead of you, get in touch with an O expert.

GOOD SEO DEMANDS A MULTIFACETED APPROACH. On-page O involves structure, relevance, keywords, metadata, grammar and spelling, images, , and more. Off-page O includes strategic content marketing, guest posts on uality sites, links with influencers, an optimised oogle y Business listing, and more.

How does O work Well, oogle’s learning driven algorithms rank sites on relevance and uality, and they do it in a nanosecond. BAD (OR POOR) SEO USUALLY STEMS FROM ONE OF TWO THINGS: ou’ve used a cheap and cheerful O company so your site is full of backlinks to irrelevant and poor- uality sites; or ou haven’t put time or money into actively nurturing and improving your site.

THE SEO EXPERT CHECKLIST You’ve no doubt had emails or calls from companies claiming to be SEO experts. But how do you know who to trust? •

eir e ail s o l en in a o ain na e not @gmail, @hotmail or @someotherfreeemailservice earc t e o ain b t clic on any lin s • ey s o l ran first • ey s o l be base or a e a resence in stralia, and • ey s o l offer a strategy session to learn about your business. oo is affor able b t not c ea ONLINE INFLUENCE CAN HELP The team at Online Influence offers a free strategy session. We can help you achieve good O, giving the bad and the ugly the flick. Call us today on to fin o t ore

Online Influence Penrith can help you with all your online marketing needs Website Design and Development Google Advertising Facebook Advertising Email Marketing campaigns Search Engine Optimisation (SEO) E-commerce (Shopping carts)

Online Influence is a Google Partner, a Facebook Ad agency and a boutique Web development company that specialises in helping you get leads and sales from your website.

www.Onlineinfluence.com.au

0247 249 555 Level 1, 331 High Street, Penrith NSW 2750 Specialized in:

Search ads

48

roamingpanthermagazine.com.au


2018

CONGRATULATIONS

Sport

TO A L L T H E W I NNE RS ! We are ecstatic to present your WINNERS FOR THE 2018 ALTITUDE AWARDS Recognising the achievements of local entrepreneurs, social enterprises and change makers. We congratulate you on your success you are truly inspirational. BUSINESS CATEGORIES 1. Soaring Solo Best Micro Business Sponsored by Susan Templeman MP (Fedreal Member for Macquarie)

PUBLIC VOTED CATEGORIES 2. On My Way Best New Business Under 2 Years Sponsored by Accounting Taxation Advantage

WINNER Louise Xerri Email Solution and Consulting

5. The Change-Maker For the individual or business disrupting or shaking up their industry

WINNER Ashleigh Addison & Patty Barrett Uptown Communications 6. Two Peas Partnership Best Business Partnership

Sponsored by Two Red Shoes

WINNER Carole Tozer Bridging the Gap

Sponsored by Joos Productions

WINNER Melissa & Tristan Woodward Evolution Health Services

3. Climb Every Mountain Best Small Business Under 5 Years Sponsored by Australian Tapping Institute

WINNER Anne Barrat Empowering Health

7. Business Excellence A business who has made significant advances, growth, change or renewal in the Past 18 months Sponsored by Western Sydney Business Centre

WINNER Melinda Blundell EMU Wellness

4. Through the Woods Best Business 5+ years Sponsored by The Gap Consultancy

WINNER Kristi Towns Towns Conveyancing Services

8. Young Entrepreneur Young Entrepreneur Under 34 Sponsored by Nordoff Robbins

WINNER Maddie Searle & Jacqui Chan Wild Blue Studio

Sponsored by Roaming Magazine

WINNER The Blue Mountains Ukulele Group 14. Artisan Inspired Award An award for a person or business that is creative, creates original products, or is an artisan, designer or innovator Sponsored by Dreamtime Native Arts

WINNER Kylie Sweeney de Havilland - Artist 15. Digital Dynamo Online Award Best blog, website, online presence in social media Sponsored by Attention Experts

WINNER Emma Perrow - Emma P.

LEADERSHIP CATEGORIES 10. Emerging Leader, 11. Strategic Connector 9. Revolutionary Award Employee of the Year An individual who is For individual who has made An award for a team member an influencer, gives of 20+ years industry contribution or person who is displaying Sponsored by Woodford Homes themselves to others great potential and leadership WINNER Sponsored by Women with Altitude Elizabeth French Sponsored by Nova Employment WINNER Kumon Casula Education WINNER Lisa LaMaitre Centre Rebecca Varcoe Canberra Wise Women Informed Health Nutritional & Therapy Masters Wellbeing Centre

RISING STAR – BRAVE AWARD

13. Pay It Forward Award Best Charity/Non Profit

• • • •

Kate Seselja – The Hope Project Laura Libri – La vita e dolce Dawn Cady – Pain Myola Woods – The Erotic Coach

12. Purpose Driven Entrepreneur Award Sponsored by Mind My Marketing

WINNER Suzanne Haddon RooCreate

• Amanda Barrington – Butternut Café • Elizabeth Ellen – Empowered Alchemy • Melinda Parker – Made with Love

16. Unsung Hero Award Best blog, website, online presence Sponsored by Beaut-T-Ful Bags

WINNER Helping Hands

MOST INSPIRING INDIVIDUAL OF 2018

WINNER: Kate Seselja – The Hope Project Location: Canberra

F O R M O R E A B O UT TH E AWARDS VIS IT WWW.ALTITUD EAWARD S. C OM Proudly supported by Issue 18 July 2018

49


Horoscopes

Horoscopes By herrynne alby

Cancer

Virgo

Leo arly July sees a change of image. old weather getting you down Brighten yourself up with a new hairstyle or outfit. nything that makes you feel better about yourself can help put the spring back in your step. Just don’t go overboard or you may be scratching around for loose change mid-month. Those with July birthdays can be feeling a little drained or low on energy. Try to keep moving, no matter how tired you feel, and make sure you are getting the right foods and plenty of rest. dd more fruit and veg to your diet.

Scorpio

Libra

ling lanet

The

le ent

Water

olo rs

areer matters continue to be a focus for you. This can be causing ripples around the home. ou are trying to achieve something out in the world but have so many commitments with home and family that it can feel as though you’re the rope in the tug of war. o matter how hard we try, there is no escaping our responsibilities - and tying to is just postponing the inevitable. The key is to find a balance that allows you to take care of both your own desires and those things you can’t avoid. s the pressure eases, new opportunities present career wise.

oon

ign

ea green, silver, white, opal and onday

ber

Two

This is your annual time for renewal - Happy olar eturn ancerians The saying any Happy eturns’ is a reference to the sun returning each year to the same area in the sky that it was at the time of birth. For ancer this year, that is from June until July, it covers all those born under the sign of the rab. The coming month will give you a snapshot of the year ahead. ay attention to what is going on around your birthday for clues. June birthdays will find a focus on relationships both how you relate to others, and how others relate to you. Overall, for June and early July birthdays, there can be a feeling that someone or something is blocking your path. If you are old enough, looking back years can give clues as to the year ahead. It is always an easy option to blame external forces, but it can be our own inner demons that hold us in chains. Those with mid-July birthdays have the opportunity for new beginnings. owerful forces can be used for or against you, so take charge of your destiny.

Aries

M

arly July can see an increase in pressure outside the home, which then puts added pressure within the home and family. ou may need to employ a pretty creative juggling act to keep all of your balls in the air. Take this as a reminder or wake up call in terms of your priorities and deciding what it is in life that’s really important. ou have been more career-focused of late, but is that what you really want and will it be beneficial in the long run These are important uestions you need to ask yourself and perhaps discuss with loved ones.

50

ou should be feeling uite happy with yourself at the moment. ife, for the most part, is going along smoothly. ou can be feeling inspired and certainly creative. Birthdays around October may feel that life is a little unpredictable and someone may be rattling your cage. It’s not bad to have a little shake-up every now and then, especially if you’re stuck in a rut. It is always better to be the one directing change rather than having it thrust upon you, so look for areas in life you know need changing and stop procrastinating.

rab

iridescent hues Day

ou may find yourself feeling out of sorts early in the month. While you normally have a fairly well-oiled routine and pride yourself on your ability to stay on top of things, it could feel as though someone has thrown a spanner in the works at the moment. ou can also be feeling a little low on energy, especially those with ugust birthdays. on’t ignore the early warning signs taking care of something before it becomes a bigger problem is both cost-effective and better for your health. From mid-month you should be feeling better about and within yourself.

roamingpanthermagazine.com.au

Sagittarius

Capricorn

ou continue to find inspiration at the strangest times and in the strangest of places. It would be good if you could harness this newfound superpower you may need it to sort out your finances. ould it be that you find you’ve overextended yourself There is a solution, but you may need to tighten your belt for a while. Things get better where career matters are concerned, with your work finally being noticed. While this may not result in an immediate payrise or promotion, keep doing what you do and have faith in your own abilities.

Aquarius

B

our energy levels can be less than optimal. erhaps it’s a dose of the Winter blues, but it is important to rug up and take extra precautions against the cold. This can also be an ideal time for you to think about the state of your health in general and, in particular, those bad habits. Taking a new approach to an old problem can have lasting results, making this the perfect time to begin a new health and fitness regime. It is important, though, to begin with small steps and gradually build up rather than going too hard, too soon.

Taurus

M

Feeling a little like you have a personal earth uake shaking your world at the moment This can be more pronounced for pril birthdays. This is the beginning of a shake-up that may take several years to settle. ou aren’t comfortable with change, and it can take you uite a while before you make any moves. For a while you will be experiencing situations and people that move you out of your comfort one. Try not to be too rattled, but you do need to learn to move. ou are not the mountain, but may have become one.

elationships continue to take up your time and energy. It’s not only others who garner your attention, but also your own uestioning. How do you relate How serious are you regarding all of your relationships, not just your primary How do you treat those with whom you come into contact ou have some pretty serious soul searching going on at the moment. ou will be looking to move something or someone in a new direction mid-month, especially birthdays around the th. Friends or close relatives can be the source of unexpected joy around the th.

Pisces

B

M

ife may have been a little more hectic than you would like of late. There is not necessarily anything major happening, but a whole pile of little annoying things that are capable of throwing you off course. ou sometimes find yourself feeling a little lost and unsure of yourself but, at the moment and in spite of everything, you’re still feeling uite cheerful. This can be a positive time but you may need to work at it. llowing your creative side some action can be a very useful tool in more ways than one at the moment.

Gemini

M

hared finances could be under the hammer right now. There is more going out than coming in. Time for a new financial plan perhaps It is possible to have your cake and eat it too take small bites of the magic pudding. our sights are on the long term, which is good but you need to take action for it to work. artners are needed on board as this can only work if you are both aiming for the same goal. id-month sees a breakthrough, and a new direction can be just what you need.


For All Your Health & Medical Needs

FREE LOCAL DELIVERY

Visit our pharmacy for friendly & professional service Services & Expert Advice • Prescriptions Filled

• Workers Compensation

• Surgical Supplies

• Specialty Vitamins & Herbal Supplements

• MedsChecks

• Home-aids

• Injury Supportwear

• Baby & Mum Care

• National Diabetes Service

• Hires - Wheelchairs, Crutches & Breast Pumps

• Wide Range of Gifts

• Webster Packing

• Photocopying, Faxing, and Laminating

Greater Western Hwy

 specialistclinicpharmacykingswood  pharmacy@specialistclinicpharmacy.com

 4737 3456

BY

ST

SOM

ST

DER

ERS

Penrith

ET

Nepean Hospital

ST

Kingswood Station

KER

7.30am - 7.30pm 8.00am - 5.00pm CLOSED 9.00am - 1.00pm

Within the Specialist Clinic

PA R

Trading Hours Monday - Friday Saturday Sunday Public Holidays

• Newspapers, Milk, Drinks, Chips & Lollies

S TA F F O R D NEPEAN HOSPITAL WE ARE JUST OPPOSITE ST

M4 Motorway

 Suite 3, 64 - 68 Derby Street, Kingswood


E W GU O LO E N TA OR CA ST IN FINE JEWELLERY EDITION 2018

Shop 51A Westfield Penrith | (02) 4721 0780 | enquiries@yorkjewellers.com.au | www.yorkjewellers.com.au

THE DIAMOND PROFESSIONALS

Profile for Penzance Publishing

Roaming Magazine July 18 Issue  

Nepean's Lifestyle Magazine

Roaming Magazine July 18 Issue  

Nepean's Lifestyle Magazine

Advertisement