Page 1

ISSUE 17 JUNE 2018

FREE TO YOUR

HOME MONTHLY

NEPEAN BELLE PENRITH’S ICONIC NEPEAN BELLE

N E P E A N ’ S

L I F E S T Y L E

M A G A Z I N E


The Highest Standard in Concreting Services in Penrith & Blue Mountains LO CA LLY OWNED A N D O P E R AT E D, WIT H E XCE LL E N T WOR KM A N S HI P AT AFFO RDA B LE P RICE S

î ś slconcrete5@bigpond.com

WWW.SLCONCRETE.COM.AU


CALL US NOW 0411 704 302 Domestic & Residential With over 18 years of experience, S & L Concrete can give you expert advice on the most suitable fit for the project you want to do for your home. Whatever you are doing, be it building a home, renovating your entertainment area, adding a pool to your yard or uplifting your driveway, S & L Concrete can do the job for you. We provide the best quality for your various home concreting needs. With our expert guidance, you can make an informed decision on the best concrete products to use for your home. This will ensure that the job is done right the first time around.

Commercial Concreting Services & Construction Work We are experts in providing quality, made-to-measure products for commercial buildings as well as various construction work. If you’re a business looking to expand or improve your establishment, or perhaps a construction company looking for professional help with a project, S & L Concrete can do the job for you. With our cutting-edge equipment, we guarantee to deliver friendly services on time and to budget. Our staff is also all fully trained in occupational health and safety practices. We are here to make concreting easy for you.

SE RVICE S TAILO RE D TO S UIT YOU S L A B S | D R I V E WAY S | C O M M E R C I A L & I N D U S T R I A L | O S D TA N K | C U S T O M D E S I G N


m

m

mulgoasanctuary.com.au

Forestwood Drive, Glenmore Park

To the best of our knowledge no relevant information has been omitted from this advertisement. Whilst all care has been


DON’T MISS YOUR CHANCE TO LIVE IN AN EXCEPTIONAL PLACE

Mulgoa Sanctuary is a new estate that sets itself apart from everything else. Surrounded by nature, you’ll be delighted with the tranquility - it’s not the Glenmore Park you know. Our spectacular homesites range from 800m2 – 1200m2 and boast magnificent sweeping views of the Blue Mountains. You simply have to see it to appreciate the breathtaking beauty. Close to nature with connections to bike paths, walking tracks through the National Park and a number of local sporting clubs & facilities. Minutes from the rejuvenated Penrith CBD; exciting new retail & shopping and diverse & vibrant dining & entertainment. Just minutes from a wide variety of local schools and close to the new Glenmore Park Town Shopping Centre. Just off the M4, Northern Road.

REGISTER NOW OR VISIT US ON SITE SUNDAY 10am - 2pm taken in presenting the benefits of Mulgoa Sanctuary, we encourage all potential purchasers to inspect for themselves.


For All Your Health & Medical Needs

FREE LOCAL DELIVERY

Visit our pharmacy for friendly & professional service Services & Expert Advice • Prescriptions Filled

• Workers Compensation

• Surgical Supplies

• Specialty Vitamins & Herbal Supplements

• MedsChecks

• Home-aids

• Injury Supportwear

• Baby & Mum Care

• National Diabetes Service

• Hires - Wheelchairs, Crutches & Breast Pumps

• Wide Range of Gifts

• Webster Packing

• Photocopying, Faxing, and Laminating

Greater Western Hwy

 specialistclinicpharmacykingswood  pharmacy@specialistclinicpharmacy.com

 4737 3456

BY

ST

SOM

ST

DER

ERS

Penrith

ET

Nepean Hospital

ST

Kingswood Station

KER

7.30am - 7.30pm 8.00am - 5.00pm CLOSED 9.00am - 1.00pm

Within the Specialist Clinic

PA R

Trading Hours Monday - Friday Saturday Sunday Public Holidays

• Newspapers, Milk, Drinks, Chips & Lollies

S TA F F O R D NEPEAN HOSPITAL WE ARE JUST OPPOSITE ST

M4 Motorway

 Suite 3, 64 - 68 Derby Street, Kingswood


K O ! O B OW

N

PRESENTS

Music and Lyrics by George Gershwin and Ira Gershwin Book by Ken Ludwig

If you want to experience something completely different, this is it! A snapshot of Crazy for You ® - When a rich boy meets a hometown girl… New York banker Bobby Child (Noah Mullins) is sent to the town of Deadrock to foreclose on a theatre. But while he’s there, he falls for the owner’s daughter, Polly Baker (Natasha O’Hehir). Polly doesn’t like what he’s doing, so Bobby takes on the fictitious character of Bela Zangler (Noah Godsell) who uses his New York connections to wrangle the locals and put on a show. The goal? To save the theatre and win Polly’s heart.

EVENT AND TICKET INFORMATION Playing at St Paul’s Grammar School - The Centre | 52 Taylor Rd, Cranebrook

BOOK NOW at www.trybooking.com/VADQ Pricing: Adult - $35.00 | Concession (Child/Pensioner) - $27.50 | Family - $115.00 (2 Adults, 2 Children) Friday 8 June 2018 7pm - Opening Night

Saturday 9 June 2018 7pm

Sunday 10 June 2018 2pm - Matinee

Wednesday 13 June 2018 7pm

Friday 15 June 2018 7pm

Saturday 16 June 2018 7pm - Closing Night

Wheelchair accessible seating is available. Enquiries: (02) 4777 4888 or email info@stpauls.nsw.edu.au

Proudly Sponsored By

Co-Conception by Ken Ludwig and Mike Ockrent. Inspired by Material by Guy Bolton and John McGowan. Originally produced on Broadway by Roger Horchow and Elizabeth Williams. Original Broadway Choreography by Susan Stroman. “Crazy For You” is presented by permission of ORiGiN™ Theatrical. On behalf of Tams-Witmark Music Library, Inc. The worldwide copyrights in the music of George and Ira Gershwin® for this presentation are licensed by the Gershwin Family. GERSHWIN is a registered trademark and service mark of Gershwin Enterprises. CRAZY FOR YOU is a registered trademark and service mark of CRAZY FOR YOU Enterprises. CRAZY FOR YOU®, THE NEW GERSHWIN® MUSICAL is presented by arrangement with TAMS-WITMARK MUSIC LIBRARY, INC. 560 Lexington Avenue, New York, New York 10022


Welcome

Hi Readers, ARE YOU AS RUGGED UP AS I AM? WELCOME TO JUNE!

IN THI S

S

o Autumn was supposed to gently acclimatise us to Winter – I wish! The recent drop in temperature has almost been instant. It certainly hasn’t slowed down the introduction of new local events, though. One of these is the newly launched Nepean Belle dining experience – but more on that in a minute. First, I’d like to introduce a few new faces in this issue. One of these is our newly appointed property expert, Sharon Mudiman, who’ll be bringing us the latest in property news each month. As owner and operator of real estate firm Bespoke Realty Group, she has her finger well and truly on the local property pulse! And for those of us who battle with day-to-day practical budgeting, please welcome local mum Maria-Luisa Patisso. Maria-Luisa is renowned in the region for her amazing budgeting skills. Her first column with us is on page 33, where she brings us some fantastic tips and tricks to help your family save. And finally, our stunning cover. We’re so excited to bring you the story of the gorgeous Nepean Belle, including the very latest initiative from the Nepean Belle team – a brand new dining event. For those of you who are yet to experience the Belle, it really is a must. The cruise is absolutely glorious and the food is divine. And with their new dining experience, there really is no better time to spend a few relaxing hours on our beautiful river.

22

Cover Feature The Nepean Belle

24

Food The Busy Mum’s Guide to Weight Loss

30

Health Trent Talks - Social Media & Mental Health

Sam

PO Box 3106, East Blaxland, NSW 2774 Advertising Enquiries Samantha Foley  0431 281 689 samantha@roamingpanthermagazine.com.au  @roamingpanthermagazine  @roamingpanthermagazine  www.roamingpanthermagazine.com.au

30

FEATURED THIS MONTH

Enjoy this issue.

Issue

22

24 >> OUR TEAM Publisher • Kimberley Kennedy kimberley@roamingpanthermagazine.com.au Editorial • editorial@roamingpanthermagazine.com.au Creative Director • Kwang Tran Manager • Samantha Foley samantha@roamingpanthermagazine.com.au Magazine Co-ordinator • Mel Bevan mel@roamingpanthermagazine.com.au Copy Editor • Melinda Leyshon, WriteCopy Journalist • Cassandra Elliott Images • iStock photos

>> REGULAR CONTRIBUTORS • Melissa Ferrari, Counselling & Psychotherapy • Melissa Browne, Accountant at A&TA & The Money Barre • Douglas Ely, York Jewellers • Maria, Fellowes & Turner Travel Associates • Sharon Mudiman, Bespoke Realty Group • Marianne Arthur, Insignia Hair & Day Spa • Rob Lees, Mortgage Choice • Trish Fehon, Online Influence • Joseph Grassi, Joseph Grassi & Associates • Kris Caloia & Karl Thornton, Progressive Physiotherapy • Erin Short, Coreen Avenue Veterinary Clinic • Sherrynne Dalby, Author of Star Parenting >> WITH THANKS TO OUR CONTRIBUTORS FOR THIS ISSUE • BeaMade Foods • Trent Merrin • Skye McIntyre Nail Stylist • Maria-Luisa Patisso, Facebook.com/MySClifestyle • Luke Priddis Foundation

Published by Penzance Publishing Pty Ltd ABN 18615296118. Printed by Fairfax Media 159 Bells Line of Road North Richmond NSW 2754 All prices and information are correct and to the best of the publisher’s knowledge at the time of print. Roaming Panther Magazine does not accept or assume responsibility for advertising material accepted. Comments and opinions of contributors do not necessarily reflect the opinion or view of the publishers or editor.

We recommend material such as dates, times and prices of a changing nature be confirmed with individual advertisers, contributors or persons and industry professionals in regard to advertising and editorial. Material in Roaming Panther Magazine is copyright © Penzance Publishing and may not be reproduced without the permission of the publisher. All rights reserved. Issue 17, June 2018

All reasonable efforts have been made to trace copyright owners.

Could you be saving thousands on your home loan? Meet with me to review your home loan before 15th August and you could win a $10k holiday!* Peita Davies Director | Local home loan specialist

0452 214 202 1B Castlereagh St, Penrith *The promotion commences at 12.01am AEDT on 15/5/18 and closes at 11.59pm AEDT on 15/8/18. For full terms and conditions visit rea.to/win10kterms. Authorised under ACT Permit No.TP 18/00801, NSW Permit No.TPLTPS/18/23915, SA Permit No. T18/699. Peita Davies is a credit representative (399495) of BLSSA Pty Ltd ABN 69 117 651 760 (Australian Credit Licence 391237).

8

roamingpanthermagazine.com.au


Local Roaming LOCAL SHOWS CRAZY FOR YOU 8 – 16 JUNE ST PAUL’S GRAMMAR SCHOOL

PRESENTS

It’s not your average school musical! T HE N

DECODED

MY FRIEND THE CHOCOLATE CAKE

29 JUNE THE JOAN Two blokes juggle over 20 instruments live on stage in a spellbinding performance. One of the most innovative musical performances to grace the stage in many years.

6 JULY THE JOAN The Joan’s Annual Youth Theatre Festival returns in 2018 with DECODED. DECODED allows students to participate in two ways - as creators or as audiences. Applications are now open.

22 JUNE BLUE MT THEATRE & HUB Quintessentially Australian chamber pop noir group My Friend The Chocolate Cake take to the road performing songs from their highly acclaimed 2017 album, The Revival Meeting.

thejoan.com.au

thejoan.com.au

bluemountainstheatreandhub.com.au

AMBER LAWRENCE & FRIENDS – CHRISTIE LAMB AND MICKEY PYE

IN ®

MU SI C

AL

TUBULAR BELLS FOR TWO

EW GERSHW

Music and Lyrics by George Gershwin and Ira Gershwin, Book by Ken Ludwig

In one of the largest musical performances to come to Penrith in years, St Paul’s Grammar School is presenting George Gershwin’s iconic musical comedy, Crazy for You. Limited sessions available. Book now! www.trybooking.com/VADQ

MELBOURNE INTERNATIONAL COMEDY FESTIVAL ROADSHOW

29 JUNE ROOTY HILL RSL Amber Lawrence is an award-winning singer-songwriter like no other. Fresh off the back of three Golden Guitars at the Tamworth CMAA Awards, this triple-threat artist is joined by good friends Christie Lamb and Micky Pye.

19 JUNE THE JOAN The Festival is on the road and coming to Penrith, delivering hot and tasty comic treats. Featuring fantastic funny-makers from Australia and beyond, the Roadshow has it all - stand-up, sketch, satire, silliness and song all in one side-splitting show!

rootyhillrsl.com.au

thejoan.com.au

BOOK NOW

4723 5050

BlueMountainsTheatre.com 106 Macquarie Road Springwood

Issue 17 June 2018

9


Local Roaming LOCAL SHOWS

AN EVENING WITH ROD AND SIR ELTON – THE DREAM CONCERT

MIRUSIA Celebrated as the ‘angel of André Rieu’, for her pure and true soprano vocals, Mirusia now soars as a soloist with her own chamber orchestra.

DRAGON – 80’S UK CHARTBUSTERS

27 JUNE THE JOAN The dream concert experience – a double concert with two of the world’s most iconic and treasured entertainers! Starring Dave “Rodney” Patten and Shannon G Brown, audiences will delight in the celebration of Rod and Elton as they perform masterpieces from five decades. Magnificently crafted, with amazing vocal and visual performances.

30 JUNE PANTHERS PENRITH Celebrate all the classic hits of “The Everly Brothers and Frankie Valli & The Four Seasons in Concert”. Come and hear the magical hits and soaring harmonies from a great era.

8 JUNE ROOTY HILL RSL The 80’s UK Chartbusters celebrate some of Countdown’s favourite songs by bands like Queen, Tears for Fears, The Police, Madness, Duran Duran and more!

thejoan.com.au

penrith.panthers.com.au

rootyhillrsl.com.au

MEAT LOAF – BAT OUT OF HELL

30 JUN 7.30PM

THE EVERLY BROS & FRANKIE VALLI

THE ANGELS – FACE TO FACE 40 YEARS ON

MELBOURNE CITY BALLET: CARMEN

22 JUNE ROOTY HILL RSL Go an epic Rock ’n’ Roll journey of Meat Loaf’s greatest hits with a 10-piece band that faithfully recreates the full Meat Loaf Concert experience “Live!”.

30 JUNE ROOTY HILL RSL Paying homage to the album that made an indelible imprint on the Aussie music scene, the two-hour show features two sets, the complete album Face To Face, and all The Angels classics.

10 JUNE BLUE MOUNTAINS THEATRE & HUB Carmen features intricate footwork, dazzling costumes, and an emotionally intoxicating storyline that will have you captivated from beginning to end. Carmen tells the story of city policeman Don Jose, whose mother calls him to return home to marry childhood sweetheart Micaela. However, a chance encounter with the enchanting gypsy girl Carmen leads them into a relationship of both passion and destruction.

rootyhillrsl.com.au

rootyhillrsl.com.au

bluemountainstheatreandhub.com.au

LOCAL MUSIC

…something of a jewel in the national period instrument crown. LIMELIGHT MAGAZINE

TICKETS STANDARD $65 CONCESSION $60 OR SUBSCRIBE & SAVE!

4723 7600 www.thejoan.com.au JOAN SUTHERLAND PERFORMING ARTS CENTRE, 597 HIGH STREET, PENRITH NSW 2750

10

roamingpanthermagazine.com.au

MIRUSIA

TWO GRANDS – FOUR HANDS

MUSICAL OPPOSITES – CHILDREN’S CONCERT

ACACIA QUARTET

30 JUNE THE JOAN Australia’s angel, soprano Mirusia and her own Chamber Orchestra, will absolutely wow you with her command of opera, musical theatre, pop and jazz styles.

16 JUNE THE JOAN By popular demand, Jennifer Hammond & Frank O’Brien return to The Joan for a beautiful two-piano recital, playing works by Mozart, Schumann and Rachmaninov.

17 JUNE THE JOAN Join George Ellis and the musicians of the orchestra in this fun and inspiring introduction to classical music for children. The whole family will love finding out how music comes together.

23 JUNE BLUE MT THEATRE & HUB One of Australia’s leading contemporary quartets, be transported with Lisa Stewart and Myee Clohessy on violin, Stefan Duwe on viola, and Anna MartinScrase on cello.

thejoan.com.au

thejoan.com.au

thejoan.com.au

bluemountainstheatreandhub.com.au


Local Roaming LOCAL MUSIC

THINGS TO DO

KASEY CHAMBERS & THE FIRESIDE DISCIPLES CAMPFIRE TOUR 2018

SONGS IN THE KEY OF MOTOWN

REAL MEN WEAR PINK

SAILABILITY COME & TRY DAY

16 JUNE ROOTY HILL RSL Join Kasey Chambers by the “Campfire” for a musical journey through the stories of places, people, cultures and sounds that have inspired one of Australia’s most revered performers. An intimate acoustic experience, enjoy songs from Kasey’s past and present - songs shaped by her rich and unique life travelling through the vast lands of Australia, America and Africa.

8 JUNE PANTHERS PENRITH This all-singing, all-dancing show is a tribute to the Motown greats. A unique musical concert, it’s playing to sold out shows and standing ovations around the world.

18 - 24 JUNE WHO WILL YOU GO PINK FOR? We’re challenging all people of Australia to GO PINK in support of the thousands whose lives have been - or will be - affected by breast cancer. Raise funds for research and help Australia meet the goal of zero deaths from breast cancer by 2030. #gopink #realmenwearpink

8 JULY PENRITH LAKES Sailing for ALL abilities! Sailability has one, two and four-person yachts for group hire, and can even accommodate people with a disability. Bookings essential on 0412 505 854.

rootyhillrsl.com.au

penrith.panthers.com.au

realmenwearpink.org.au

sailabilitypenrithlakes.org.au

INTERNATIONAL ASSAULT – BEST OF THE BEST 25 JUNE PANTHERS PENRITH World Series Wrestling returns for International Assault – Best of the Best. Featuring the USA’s former WWE superstar, John Morrison, Impact Wrestling’s Master Abyss, and many more! penrith.panthers.com.au

THE JAMES TAYLOR SONGBOOK

SONS OF ZION

A TRIBUTE TO PRINCE PURPLE REVOLUTION

30 JUNE BLUE MT THEATRE & HUB Darren Coggan presents an eloquent journey through the songbook of one of the most music world’s most magnetic figures, James Taylor - a modern-day troubadour.

15 JUNE ROOTY HILL RSL Sons of Zion’s hard work and commitment to taking their music to their fans has established them as one of the best live acts on the touring circuit. Don’t miss their only show in Sydney.

16 JUNE ROOTY HILL RSL Andrew De Silva from R&B sensation CDB and some of Australia’s finest touring stars lead a Purple Revolution to celebrate the life and music of Prince.

bluemountainstheatreandhub.com.au

rootyhillrsl.com.au

rootyhillrsl.com.au

NEW CONCEPT

FITNESS

LIKE NO OTHER shared PENRITH LAKES PARKRUN

YOGA @ THE MONDO

EVERY SATURDAY PENRITH LAKES & NEPEAN RIVER Get fit, be outdoors, and enjoy the best of Penrith. Anyone can join in, whatever pace! Register online to be timed, just bring along a printed copy of your barcode. On the river, it’s a timed event for runners and walkers of all ages and abilities. The Nepean River Parkrun utilises the Jamison Road pathway and parts of Tench Reserve.

WEDNESDAY MORNINGS 7AM - 8AM THE MONDO, PENRITH PLAZA Enjoy free yoga classes at the Mondo, located between Westfield, the Library and The Joan.

parkrun.com.au/nepeanriver

westfield.com.au/penrith

FOOD SERVICE www.nepeanbelle.com.au

Issue 17 June 2018

11


Local Roaming

Grounds AROUND THE

YOUR GUIDE TO WHAT’S HAPPENING IN SPORT THIS MONTH.

Penrith Panthers NRL - RUGBY LEAGUE

GWS Giants

AFL - AUSSIE RULES

Local Markets WANDER AROUND YOUR LOCAL MARKET PENRITH REGION AUSSIE NIGHT MARKETS WEDNESDAY NIGHTS An international food market on the doorstep of Penrith Panthers! Enjoy with family and friends, and give your tastebuds an experience you won’t forget. aussienightmarkets.com.au

Round 14

 Friday 8 June, 6pm  Panthers v Raiders  GIO Stadium

Round 15

 Friday 15 June, 7.55pm  Panthers v Roosters  Allianz Stadium

Round 12

Round 13

 Bye Round

Round 16

 Saturday 30 June, 3pm  Panthers v Sea Eagles  Panthers Stadium

Round 14

 Saturday 23 June, 4.35pm  Giants v Brisbane Lions  The Gabba

Round 17

 Friday 6 July, 7.55pm  Panthers v Warriors  Panthers Stadium

Round 15

 Saturday 30 June, 7.25pm  Giants v Hawthorn  Spotless Stadium

Round 16

 Sunday 8 July, 2.40pm  Giants v West Coast Eagles  Optus Stadium

Journey AT S T PA U L ' S P R E - K

Inspiring Your Child to Learn.

Primary Logotype Horizontal

International Baccalaureate Learning from Pre-Kindergarten

LIMITED SPOTS AVAILABLE BOOK A TOUR OR ENROL TODAY

roamingpanthermagazine.com.au

Secondary

HAWKESBURY REGION RICHMOND GOOD FOOD MARKET

BEGIN YOUR

12

 Saturday 9 June, 4.35pm  Giants v Gold Coast Suns  Spotless Stadium

p. 02 4777 4888 e. enrol@stpauls.nsw.edu.au w. stpauls.nsw.edu.au

EVERY SATURDAY Featuring local fresh produce and food in Richmond Park, corner of March & Windsor Streets, Richmond. richmondmarket.com.au

BLUE MOUNTAINS REGION SPRINGWOOD GROWERS’ MARKET FOURTH SUNDAY Enjoy fresh food and products from over over 50 local growers and producers at the Blue Mountains Theatre and Community Hub. blackcastleevents.com.au/markets


Spotlight

Letters to Lindy

EVENT IN THE SPOTLIGHT

EVERYBODY REMEMBERS THE STORY OF LINDY CHAMBERLAIN.

A

ccused of murdering her child, her claim – that the baby was taken by a dingo – was denied and discredited by zealous police and a flawed legal system. A poignant story and reminder that the criminal justice system sometimes does get it wrong, Letters to Lindy highlights the human cost of these errors. Over three decades, spanning baby Azaria's death through to the delivery of the final Coroner's report, the public wrote more than 20,000 letters to Lindy. Letters from children and letters from those who have lost a child, and ranging from sympathy to abuse, the letters traversed the wide range of human response to Lindy's story. Letters to Lindy draws on this correspondence, as well as extensive interviews with Lindy Chamberlain-Creighton herself. The result is an enthralling, moving, and long overdue dialogue between Lindy and the nation. Directed by Darren Yap and featuring a critically-acclaimed performance from Jeanette Cronin as Lindy Chamberlain-Creighton, Letters to Lindy provides a deep insight into one of the most compelling legal and human dramas of our time. It paints a singular portrait of the heartbreak, wisdom and resilience of a grieving mother and her 30-year fight for justice. Filled with humour and heartbreak, this stunning work by award-winning playwright Alana Valentine explores the public’s relationship with one of Australia’s most iconic 20th Century figures.

i

EVENT DETAILS Letters to Lindy 

Tuesday 26 & Wednesday 27  June 7:30pm Standard $65  Concession $60 Under 30's $30 The Joan | 597 High Street  Penrith NSW 2750 4723 7600  thejoan.com.au 

Think Pink THINK PINK IS THE ULTIMATE P!NK TRIBUTE

This is the final show in Australia for the most authentic P!NK tribute.

W

EVENT DETAILS

i

 T  h!nk Pink  S  aturday 23 June Doors Open 8pm, Show starts 8.30pm  Tickets: $36.70

Photo credit: Nu-Soul Photography

ith Kylie Clarke’s uncanny visual and vocal likeness to the American superstar, she is sensational as P!NK. The attention to detail that's been reproduced in this tribute is second-to-none, playing testament to the level of talent and professionalism on offer. Comprising multi-award winning musicians, award-winning sound technicians, an intelligent light show that has been choreographed to the set list, and costumes provided by N.S. Costume Design (think Kylie Minogue and Lady Gaga), the show will leave you breathless. Kylie sounds and looks so much like P!NK, it’s unbelievable - you'll love it!

 Penrith  Panthers 123 Mulgoa Road, Penrith, NSW 2750  1800 061 991  penrith.panthers.com.au

Issue 17 June 2018

13


Community

YOUR UPDATE ON

High Street Written by Manisha Foley - Penrith CBD Corp

DISCOVER

As you may have noticed, High Street is getting a facelift. Penrith Council is working on transforming and upgrading High Street to help the CBD flourish.

T

his is an important, city-shaping project that will have major benefits for residents, workers, visitors and local businesses. Replacing and upgrading the aging infrastructure along High Street will make a big difference to the attractiveness and accessibility of the precinct. New storm water drainage is also being installed, which will protect High Street and businesses from flash flooding for years to come. We know there have been disruptions throughout High Street during the upgrade. To provide support to businesses affected by the essential improvements of our town centre, Penrith CBD Corp has launched a strong marketing strategy to encourage the community to continue shopping and dining local. There is so much to discover along and within the

many arcades of High Street, and we want the community and local businesses to be a key part of that. We agree that it is a challenging time, but High Street is still accessible by foot. There are also plenty of parking options available behind the arcades, with others only a short walk away. Our local businesses are still here to bring you optimum services and trade. During the construction upgrade of the town centre, we're working closely with property owners and local businesses, encouraging and partnering to upgrade and refresh their businesses ready for the future. The multi-faceted strategy involves the following initiatives, some of which are in play now and others which are on their way to implementation:

Old School Band

Jellybean Jam

LIVE FRIDAY, 8th June 2018 from 9pm

LIVE SATURDAY, 9th June 2018 from 9pm

Midnight Drifters LIVE SUNDAY, 10th June 2018 from 2pm

14

roamingpanthermagazine.com.au

Monday, 11th June 2018 // Games start 11am

Penrith CBD

• Marketing and PR • Painting • Fresh façade fronts • LED lighting upgrades or replacement • Updated and new signage • Education opportunities for staff and business owners. By working together in developing the CBD, our businesses will become stronger and more resilient, ready to accommodate future changes and growth.

REMEMBER TO DISCOVER PENRITH CBD #discoverpenrithcbd #shoplocal #dinelocal


Trust the experts to transform your home

Contact us for a Free Measure & Quote

Carport

Patio

Pergola

Pool Cover

Combination

Deck

Alfresco

Sunroom

Room Extension

Sydney’s leader in home improvements since 1959 Showroom: Cnr Great Western Hwy & Russell St, Emu Plains

1300 659 276

hicraft.com.au Builders Licence Number 37487


Local Business

ROAMING WITH

Local Business

SHUTTERS | SCREENS | DOORS

We spoke to Andrew Franklin, Sales Manager at GuardRight located on Batt Street, Penrith.

G 1

uardRight is a local family-run business that has provided high quality products and service since 2015.

When did you decide to open  GuardRight?

The business was registered in June 2014 and we opened our doors in 2015. We're located on Batt Street, Penrith. 2

Tell us about the experience your  team has within the industry

Craig, the owner and operator, is a registered builder by trade. Craig first joined the industry in his father’s business when he was 13 years old. He's now been in the industry for 25 years. 3

 hat services do you provide and W what do you think your point of difference is?

Quality and service are what we pride ourselves on. Our biggest point of difference is that we're able to design custom products and carry out complex installs, giving customers a personal solution. Other products and services we provide include roller shutters, plantation shutters & blinds, security & fly screens, window films, external blinds & awnings, and window replacements. And we're proud to offer Crimsafe to our clients.

16

roamingpanthermagazine.com.au

SUPP

4

Tell us more about your team

We have two administration staff that have 20 years' experience in the home improvement industry. Our main Crimsafe product fabricator is a licenced carpenter by trade with a tremendous eye for detail. Then we have our sales team of two people - they have around 10 years’ industry experience, as well as extensive sales experience in other industries. 5

What's the most rewarding aspect of  what you do?

We like to produce a quality product and assist each and every customer to the very best of our ability. The most rewarding aspect for us at GuardRight is when you return to the same customer multiple times to continue helping them on other projects. We also love helping our existing client’s friends and family. This is a result of our ever-growing word of mouth recommendations. 6

Any highlights or achievements that  you're proud of ?

We were lucky enough to be announced a Finalist in the 2017 Local Business Awards, and I'm happy to announce that we've been announced a Finalist in the 2018 Business Awards!

7

O RT I

NG

What do you appreciate about  working and living in the local community?

Penrith and the Western Suburbs are fantastic places to live. We've seen the area grow as more people flock here to buy and build, which is great for the local economy. The people we meet and deal with in the Penrith community are genuine, hard-working people. We've built a great name in the Western Suburbs, and we really enjoy working with the people in our community.

GET THE RIGHT SOLUTION FOR YOUR HOME  GuardRight  Unit 4, 103-107 Batt Street Penrith  1300 133 474  guardright.com.au  facebook.com/GuardRight.Industries


WINDOW REPLACEMENTS

Affordable, High Quality Home Improvement Solutions CRIMSAFE SECURITY PRODUCTS

20%

OFF OUR FULL RANGE*

ROLLER SHUTTERS

PLANTATION SHUTTERS

At GuardRight we are very different to our competitors. As different as an apple to an orange. That’s because we give you better service, price and product choice with real flexibility to suit your home. And that is why GuardRight is the right choice.

Roller Shutters  Crimsafe Security Products  Plantation Shutters - Blinds 

Our Premium Product Range Window Replacements - Magnetite  External Blinds & Awnings  Security Screens - Fly Screens  Window Films 

CRIME PREVENTION PARTNERS

Come see us at Unit 4, 103-107 Batt Street, Penrith NSW 2750

CALL US 1300 133 474 WWW.GUARDRIGHT.COM.AU  GuardRight Industries

SHUTTERS | SCREENS | DOORS *Conditions apply


Local Business

ROAMING WITH

Local Business

Meet Penrith local Robyn Foster, owner of RAMS RAMS Home Loan Home Loan Centre in Penrith Centre in Penrith

Robyn Foster 1

When did you decide to open RAMS Penrith and why?

Call RAMS While the 13 RAMS Penrith franchise launched in 2005, I'd been thinking for many years about running RAMS.com.au a small business. At the time I’d been working for

a major bank as a Regional Manager and while I found the role fulfilling, I wanted a greater challenge. RAMS seemed a great fit, particularly because it aligned with my passion to help people. While I can’t take all the credit for the founding work in establishing the Penrith Franchise, I have worked extremely hard since those early days to build up a business with people at its heart. After all, we're not just a home loan provider; we're a people business that happens to help people into the home of their dreams. 2

Tell us about the experience you have within the industry

I've been in the finance industry for 38 years, mainly on the retail side managing bank branches and helping people with home loans. For this reason, RAMS was a natural shift for me in my career - sort of like slipping on a fresh pair of shoes in the same size and design as your old ones! I still get a thrill out of helping people into the home of their dreams, especially if it's their first home. Nothing satisfies me more. 3

What services do you provide and what do you think your points of difference are?

At RAMS Penrith, my team get to know our clients and what their aspirations for home ownership are. We genuinely want to build relationships with our customers that go beyond securing finance and helping them open that door for the very first time. In terms of our key points of difference, at RAMS we specialise in helping customers who need that little bit of extra help to get their foot in the property market. 18

roamingpanthermagazine.com.au

SUPP

Two key segments are first home buyers and self-employed customers. In fact, for the last two years RAMS has been awarded the ‘Best Self-Employed Lender of the Year’ at the Australian Lending Awards. This is testament to the focus that RAMS has on helping this niche market of customers into the home of their dreams. One other thing people may not realise is that RAMS also offer a great transactional and savings account, so customers can deposit with RAMS as well. It’s something our deposit customers love and often comment on. 4

Tell us more about your team

Here at RAMS Penrith we're a team of six dynamic women affectionately known as the “RAMettes”. So apart from myself, the rest of my RAMettes team are the two Julie’s, Nicole, Cathy, and Emily. Between us we have experience in real estate, small business ownership, and administration and retail work. Collectively we have 48 years of RAMS experience, all in the one franchise here in Penrith. 5

What's the most rewarding aspect of what you do?

Our customers are at the very heart of everything we do. We have a long history of helping people to achieve their goal of home ownership, and it’s a history I’m absolutely proud of. Providing support and solutions to a customer who is either buying their first home or who has struggled finding a home loan provider, and being able to assist, is very satisfying. 6

Any highlight or achievements that you're proud of ?

While I’m proud that the RAMS business collectively has been awarded ‘Best Self-Employed Lender’ for two years running at the Australian Lending Awards, from a personal point of view I was delighted that, in our first year of operation here, RAMS Penrith was awarded the “New Office on the Block” award at the Australian Mortgage Awards (AMA).

7

O RT I

NG

What do you appreciate about working and living in the local community?

My team members at RAMS Penrith are all locals and we're all very involved in the community with our families. We have children involved in the local basketball and soccer teams, and we also sponsor local schools like St Nicholas. Getting involved in the community gives us all a buzz. We're all really people-oriented and love working with all members of the community.

We are not just a home loan provider; we are a people business that happens to help people into the home of their dreams. LET US HELP YOU FIND YOUR DREAM HOME  RAMS Home Loan Centre - Penrith  235 High St, Penrith  4731 3777  rams.com.au/penrith More Information: Credit criteria apply. RAMS Home Loans Penrith/ Katoomba is owned and operated by Greater West Home Loans Pty Ltd ABN 25 113 229 324. Credit Provider & issuer of RAMS Deposit Products: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714. 18181/0118


Get helpful step-by-step support from Australia’s Best Self-Employed Lender. Your local RAMS Home Loan Specialist understands exactly what it’s like to run your own business; it’s one of the reasons RAMS has won Best Self-Employed Lender for two years running at the Australian Lending Awards.

RAMS Home Loan Centre in Penrith Robyn Foster Call 13 RAMS RAMS.com.au

More Information: Credit criteria apply. RAMS Home Loans Penrith/Katoomba is owned and operated by Greater West Home Loans Pty Ltd ABN 25 113 229 324. Credit provider and issuer of RAMS deposit products: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714.

18446/0518


ROAMING FEATURE

THE

NEPEAN BELLE By Cassandra Elliott

IF YOU LIVE IN WESTERN SYDNEY, YOU’VE MOST LIKELY HEARD OF THE NEPEAN BELLE. YOU’VE PROBABLY SEEN THE ICONIC PADDLEWHEELER CRUISING UP AND DOWN THE NEPEAN RIVER MULTIPLE TIMES EACH WEEK.

The Belle has recently introduced a new dining experience, putting a modern vibe on an old classic.

22

roamingpanthermagazine.com.au


ROAMING FEATURE

It’s (The Nepean Belle) actually a great experience for young people and young families, too.

T

he Belle offers breathtaking views, taking you into the Nepean Gorge, which is around 22 million years old!

The Nepean Belle has recently introduced a new dining experience that puts a modern vibe onto an old classic. Owners Carol and Chris Bennett believe that the majority of people who live in the area have never been up into the Nepean Gorge because of its isolation. Carol says, ‘We’ve had people on the boat tell us that the sights in the Nepean Gorge rival sights anywhere in the world.’ Built on the banks of the Nepean River and launched in 1982, the Belle’s been offering cruises for about 36 years. Now, along with their famous Devonshire Tea and Lunch Cruises, they’re continuing to cater to the ever-changing Penrith area. ‘What we're trying to do is keep up with the fact that Penrith is such a growing city. We're offering new, innovative cruises and menus to appeal to the crowds that are starting to come through and live in the Penrith area,’ says Carol. The new Saturday night dinner cruises are putting a modern twist on the way we think of the Nepean Belle. ‘We have live music on our new dinner cruise, as well as a fully licenced bar on board.’ The Nepean Belle is so majestic because of the access it has to the amazing views. In Winter, though, even though you can still see the sights thanks to the new floodlights, the attention at dinner seems to be more focused inwards. Carol describes the daytime cruises as, ‘an experience that just happens to have great food. But at night, the focus is more on the food now.’ Which is why they’ve decided to enhance the nighttime dining experience. Whether you’re dining as a couple, a small group, or as part of a large party, the focus on the dinner cruises becomes more intimate this time of year, which is now

reflected in the dining concept. As Carol says, ‘It’s almost like a private buffet, on a per-table basis.’ Using local produce, prepared on-board by the in-house chefs, it’s an intimate dining experience. ‘Our chef is amazing, and has been with us for about four years now,' explains Carol. The last three months have been spent testing out the new menu to recreate the closeness of the ‘meal time’ experience we had as young Aussies growing up. Dining on the Belle is an experience. Guests are allocated a table, but you're also encouraged to make yourself at home in your own way. You can wander round the many viewing decks, taking in the fresh air and the sights of the World Heritage Listed Blue Mountains National Park as you cruise past the lower end. You can experience the front of the boat, speak to Captain Chris or, if you wish, put on your Captain’s hat and ‘take the helm’. ‘You actually experience the Belle,' smiles Carol. 'And you can experience as much or as little of it as you want. If you want to just sit at your table and relax in the warmth of the gas heaters, you’re quite welcome to do so.’ Her husband Chris is the Captain of the Nepean Belle. ‘Having grown up on the river, and spending most of his life skiing on the river and working on the boat, owning the Nepean Belle is full circle for him really,' Carol explains. ‘It’s almost like the dream job where he gets to combine his love of the water with work and his appreciation and respect for the Belle every single day.' Both Chris and the Belle share a rich history with the area. Chris grew up in Leonay and attended St Dominics College in Kingswood. He started working on the Belle as a deck hand at the age of 14 when she first started back

in 1982. Captain Chris has a wealth of knowledge about the area and its history, and welcomes your questions on all the cruises. If you go on the daytime cruises, he provides interesting and informative commentary. Some of the other cruises are themed for specific events, parties, and holidays. They recently held a Mother’s Day Cruise, and soon they will be hosting another Nepean Gorge Discovery Cruise, which they run twice a year. For this sell-out cruise the Belle welcomes a local historian, Bruce Cameron, who's written a book about the area. The six-hour cruise includes morning tea, lunch and afternoon tea, and stops along the river at all the points of interest where Bruce speaks about what’s happened on that part of the river since the time of settlement. Again, you’re encouraged to experience as much or as little of the Belle as you like. You can ask the historian questions, or you can sit back and enjoy the lulls of the Belle on the water. ‘People find it very relaxing; it’s amazing how calming being on the river can be,' Carol smiles. But she also says the Belle’s not what people might think it is. Everyone can enjoy it. ‘It used to be that people thought, “Aw, you’ve gotta be old to go on that,” but what we’re trying to tell people is that, “No, you don’t have to be old - it’s actually a great experience for people of all ages and families. Kids love the Belle because they get to interact with the Captain and even have a drive.” The Belle is even wheelchair accessible on the lower deck.’ There is a renewed enthusiasm for cruising on the Nepean Belle and Carol and Chris are welcoming many local people and young families onboard that have never been before. It’s a privilege to be able to travel up into the Nepean Gorge and take in the breathtaking scenery and with the fantastic new Dinner menu the experience is that much more special, you’ll love it!

THE NEW SATURDAY NIGHT CRUISES The new Saturday night cruises offer fresh food, live music, a dance floor and a fully stocked bar. And if that hasn’t swayed you, you’re also guaranteed service with a smile. For more information or bookings call 02 4733 1274 or visit www.nepeanbelle.com.au

Issue 17 June 2018

23


Food

THE BUSY MUM'S GUIDE TO WEIGHT LOSS

Recipes For Busy Mums

 Rhian Allen  RRP $34.99 Paperback  Available from all good bookstores

J

oin the thousands of women who have lost weight with The Healthy Mummy!

The Healthy Mummy is Australia's fastestgrowing online hub for busy mums who want to lose weight and improve their health and fitness. With more than 1.5 million followers, founder Rhian Allen has helped thousands of women lose weight with the hugely popular Healthy Mummy 28 Day Weight-Loss Challenge devised by her team of nutritionists and health experts.

THE HEALTHY MUMMY GIVE US A TASTE OF SOME OF THEIR SIMPLE, DELICIOUS RECIPES FROM THEIR POPULAR GUIDE TO WEIGHT LOSS

Now, for the first time, Rhian combines this eating and exercise plan in one book, including more than 100 simple, delicious recipes the whole family will love. This is the perfect book for busy mums on a budget who are ready to achieve their weight-loss and fitness goals.

BACON, SPINACH AND TOMATO

Risotto

Serves 4

PREP

| 5 MINUTES

COOK | 35 MINUTES

INGREDIENTS 9 1 tablespoon extra-virgin olive oil 9 6 lean bacon rashers, trimmed and diced 9 1 cup arborio rice 9 3 cups salt-reduced hot vegetable stock, plus extra if needed 9 2 tomatoes, diced 9 120 g baby spinach leaves 9 Salt, freshly-ground black pepper, and parmesan METHOD

NUTRI DETAILS PER SERVE 9 338 cals/1421 kjs 9 Protein: 16g 9 Fibre: 1.9g 9 Total fat: 10.7g 9 Sat fat: 3.5g 9 Carbs: 43.3g 9 Total sugar: 1.7g 9 Free sugar: 0.0g  24

roamingpanthermagazine.com.au

1

Heat the olive oil in a large, heavy-based saucepan over medium to high heat. Add the bacon and cook for 4 - 5 minutes or until crispy. Add the rice and stir for a few minutes to coat the grains in the oil.

2

Add the stock, 3 tablespoons at a time, stirring until each addition has been absorbed by the rice before adding the next. This will take approximately 20 minutes.

3

Add the tomato and spinach with the last addition of stock, then cover with a lid. Reduce to a gentle simmer for 10 minutes or until the rice is cooked through and tender (add a little more stock if needed).

4

Season to taste with salt and pepper, and sprinkle with parmesan to serve.


Food

Fish and Vegetable Curry Serves 4 INGREDIENTS 9 2 tablespoons coconut oil 9 4 garlic cloves, minced 9 1 tablespoon grated ginger 9 2 tablespoons red curry paste 9 1 cup reduced-fat coconut milk

PREP | 10 MINUTES COOK | 10 MINUTES 9 2 red capsicums, seeds removed, sliced 9 200g broccoli, cut into florets  white fish fillet of choice, 9 600g skin and bones removed, cut into 3cm cubes 9 ¹⁄³ cup coriander leaves

METHOD 1

Melt the coconut oil in a medium saucepan over medium to high heat. Add the  garlic and cook for 1 minute. Add the ginger and curry paste, and cook for a further 30 seconds or until fragrant. Pour in the coconut milk and 1 cup water, and stir to combine.

2

Add the capsicum, broccoli and fish, and simmer for 4 - 5 minutes or until the fish is  cooked through and the vegetables are tender.

3

Spoon the curry into four bowls and serve sprinkled with coriander. 

NUTRI DETAILS PER SERVE 9 351 cals/1475 kjs 9 Protein: 35g 9 Fibre: 4.1g 9 Total fat: 20.5g 9 Sat fat: 14g

9 Carbs: 5.6g 9 Total sugar: 4.1g 9 Free sugar: 0.0g

Chocolate Muesli Bars Serves 8

PREP | 5 MINUTES, PLUS CHILLING TIME COOK | 10 MINUTES

INGREDIENTS 9 ½ cup coconut oil 9 3 tablespoons pure maple syrup 9 ½ cup cacao/cocoa powder 9 1 cup untoasted muesli METHOD 1

Line a 20cm square cake tin or container with baking paper and set aside. 

2

Place the coconut oil and maple syrup in a saucepan, heating until warm and  melted. Remove from the heat and add the cacao/cocoa powder, stirring quickly to combine and smooth out any lumps. Mix in the muesli, making sure it is evenly coated in the chocolate mixture.

3

Pour the muesli mixture into the prepared tin and chill in the fridge for  1 hour or until firm.

4

Cut into eight bars. Leftovers will keep in an airtight container in the fridge  for up to 2 weeks or in the freezer for a month.

NUTRI DETAILS PER SERVE 9 197 cals/829kjs 9 Protein: 2.3g 9 Fibre: 1.9g 9 Total fat: 14.3g 9 Sat fat: 12.7g

9 Carbs: 14.8g 9 Total sugar: 8.5g 9 Free sugar: 6g

Issue 17 June 2018

25


Food

Homemade Recipes WITH BEAMADE FOODS

L SUPP

O RT I

ooking for a quick and easy mid-week recipe for the family? Here’s a quick and easy answer for you! It goes with mashed potatoes, rice, cous cous – most of your standard dinner additions. And it tastes amazing.

Apricot Chicken

NG

USING BEAMADE FOODS' APRICOT JAM INGREDIENTS 9 ½ cup plain flour 9 Salt and pepper (for seasoning) 9 8 chicken thighs 9 2 tablespoons olive oil 9 1 large brown onion, cut into quarters 9 2 garlic cloves, crushed 9 300ml BeaMade Foods Apricot Jam 9 ¹⁄³ cup fresh parsley leaves 9 Rice, mashed potato or anything you’d like to pair with the Apricot Chicken

YOU'LL NEED... 9 Deep frying pan 9 Tongs 9 Large plate

METHOD 1

Get a flat bowl for coating the chicken. Add the flour, salt, and pepper to the bowl.

2

Trim up the chicken thighs, then coat them in the flour mixture. Set aside.

3

Grab the fry pan and add half the oil, heating to a medium heat. Brown the chicken in batches; approximately 2 - 3 minutes each side then set on a plate.

4

Add the other half of the oil to that same fry pan, then add the onion and garlic. Cook these until tender (about 5 minutes).

5

Add the BeaMade Foods Apricot Jam to the pan with the onion and garlic – this is going to boil down to become almost a glaze.

6

Add the chicken back into the pan, coating the chicken, onion and garlic evenly.

7

Continue to cook the chicken through in the sauce, turning occasionally to keep coating it. This should take about 20 - 25 minutes.

8

Add the chicken to the top of your rice, mash or otherwise, then sprinkle with the parsley.

100% local. 100% additive free.

BeaMade Foods is a FaMily owned and run Business, Based out oF the Blue Mountains. we Bring you the Best Jams, chutneys, conserves and more, using only locally sourced ingredients.

learn More today!

www.beamadefoods.com.au

/BeaMadeFoods

@BeaMadeFoods

ENJOY!

DISCOVER THE FULL RANGE OF BEAMADE FOODS For more information about any of BeaMade Foods products, visit www.beamadefoods.com.au  facebook.com/BeaMadeFoods/  instagram.com/beamadefoods/

26

roamingpanthermagazine.com.au


2018

CONGRATULATIONS TO ALL THE FINALISTS!

We are thrilled to announce your finalists for the 2018 Altitude Awards, recognising the achievements of local entrepreneurs, social enterprises and change makers. Winners will be announced at an awards ball in June.

ROAMING MAGAZINE IS EXCITED TO BE SPONSORING THE PAY IT FORWARD AWARD

BUSINESS CATEGORIES 1. Soaring Solo Best Micro Business

Sponsored by Susan Templeman MP (Fedreal Member for Macquarie)

FINALISTS • Rapid 1st Aid Training & Supplies • Empowered Alchemy • Inspire Harmony • Email Solutions and Consulting • Serotonin Running Pty Ltd • Hot Properties Staging & Styling • On Brand Design • The Erotic Coach

5. The Change-Maker For the individual or business disrupting or shaking up their industry Sponsored by Two Red Shoes

FINALISTS • SheThrives • Bridging the Gap • Pain Transformation • Three Feathers • Jemimah Ashleigh.com • The Haven - Nepean Women’s Shelter • Specialists in Communications

PUBLIC VOTED CATEGORIES 2. On My Way Best New Business Under 2 Years Sponsored by Accounting Taxation Advantage

FINALISTS • Quan Yin Healing Centre • Uptown Communications • Four36 • PB Fit Pty Ltd • Because You Matter • Connecting HR • Jasmine & Stone

6. Two Peas Partnership Best Business Partnership Sponsored by Joos Productions

FINALISTS • Angus Car Service • Accounting Logic • Sentryca Pty Ltd • E-Smart Solar • Evolution Health Services • Paudha Healing • The Best Me I Can Be - Health & Business Solutions • Dreamtime Native Arts /Dreamtime Sporting and Corporate Apparel

3. Climb Every Mountain Best Small Business Under 5 Years Sponsored by Australian Tapping Institute

FINALISTS • Butternut Café • The Gap Consultancy • Empowering Health • 20 Mile Hollow • Mountains Pilates Studio • Tech Consultants Australia PTY Ltd • Cosimfree Home Loans

7. Business Excellence A business who has made significant advances, growth, change or renewal in the Past 18 months Sponsored by Western Sydney Business Centre

FINALISTS • Mount Vic and Me • EMU Wellness • Rachael Goldsworthy Realty • Riverlands Therapy Services • Clear Path Accounting

4. Through the Woods Best Business 5+ years Sponsored by The Gap Consultancy

FINALISTS • Lighthouse • Towns Conveyancing Services • Glenbrook Legal Services • The Turning Page Bookshop • Hands on Superhealth • BEYOND BEAUT-T-FUL BAGS • Telopea Services • Informed Health Pty Ltd • UMI Real Estate 8. Young Entrepreneur Young Entrepreneur Under 34 Sponsored by Nordoff Robbins

FINALISTS • White Fox Massage • HER Property Co • Harper Lane Design • La vita e dolce • Wild Blue Studio • Local Edge Marketing

Sponsored by Woodford Homes

FINALISTS • Kumon Casula Education Centre • Diva Transformations • Western Sydney University • Jay Gabriel Consulting • Energy Medicine Institute • CasaMia Lingerie

10. Emerging Leader, Employee of the Year An award for a team member or person who is displaying great potential and leadership Sponsored by Nova Employment

FINALISTS • Verto • Informed Health Nutritional Wellbeing Centre • Just B Financial Pty Ltd • Curves North Richmond • The Blue Datto Foundation • Hands on Superhealth

Sponsored by Roaming Magazine

FINALISTS • Leola Rose • Blue Datto Foundation Ltd • Breast Aware Australia • Riding for the Disabled Association (NSW) • Women in Aviation Australia • Heartfelt • The Blue Mountains Ukulele Group 14. Artisan Inspired Award An award for a person or business that is creative, creates original products, or is an artisan, designer or innovator Sponsored by Dreamtime Native Arts

FINALISTS • New Realmz • Kylie Sweeney de Havilland - Artist • Megan Dunn Photography • Teddy J Bears • Blue Mountains Floral Designs 15. Digital Dynamo Online Award Best blog, website, online presence in social media Sponsored by Attention Experts

FINALISTS • Entertain My Tribe • Impressa Equine • Digital Visibility Group Wollongong • Emma P. • Soap de Villa

LEADERSHIP CATEGORIES 9. Revolutionary Award For individual who has made 20+ years industry contribution

13. Pay It Forward Award Best Charity/Non Profit

11. Strategic Connector An individual who is an influencer, gives of themselves to others Sponsored by Women with Altitude

FINALISTS • Pacific Women’s Professional Business Network • Fish out a Water Productions • Western Sydney Business Centre • Kylie Sweeney de Havilland - Artist • Canberra Wise Women & Therapy Masters

12. Purpose Driven Entrepreneur Award

Sponsored by Mind My Marketing

FINALISTS • Blue Datto Foundation Ltd • Gratitude™ • Paths to One • The Hope Project • Work Life Balance Academy • Nepean Tutoring • Sacred Journeys Nepal • RooCreate

16. Unsung Hero Award Best blog, website, online presence Sponsored by Beaut-T-Ful Bags

FINALISTS • Helping Hands • Made With Love - Murrum • Penrith Relay for Life • IntuARTive Kids • The Oil Lady

F O R M O R E A B O UT TH E AWARDS VIS IT WWW.ALTITUD EAWARD S. C OM Proudly supported by


Health

Elbow Pain Written by Karl Thornton

Local Experts Kris Caloia & Karl Thornton Physiotherapy Experts, Progressive Sports and Spinal Physiotherapy

Despite popular belief, elbow pain can arise from a variety of contributing factors, not just from playing tennis. That’s right, just about anyone can suffer an elbow injury.

W

hen you think about it, your elbow is constantly moving in a repetitive motion. Everyday tasks and day-to-day living demands that your elbows are at work, constantly. Take a moment to think about how many times your elbow has to move throughout the day - it’s a lot! So it’s no wonder that, from time to time, just about anyone can develop a sore elbow. It’s a lot more common than you think, and we see it here in our practice often. EVERYDAY TRIGGERS OF ELBOW PAIN CAN INCLUDE THE FOLLOWING SIMPLE TASKS AND MOVEMENTS: • Typing • Intricate assembly work • Food preparation. Repetitive movements such as these can potentially cause discomfort and pain as a result of strain injuries or even possible nerve entrapment. Of course, elbow pain can also arise from a particular event, such as: • A fall, or • A sporting accident. As we continue to age, osteoarthritis can also be a leading cause of elbow pain. It’s important to treat your elbow pain quickly as long-term pain can result in poor mobility and limit you from undertaking your usual activities. While physio is a highly effective way to manage elbow pain, it can be difficult to avoid triggers during treatment. This is why a personalised treatment plan is often recommended. If you’ve got a problem elbow, don’t put up with the pain any longer. Unfortunately, the longer you leave elbow injuries, the more severe they can become. The elbow is a crucial joint that allows us to perform our day-to-day tasks with ease, so it’s important to get on top of elbow pain sooner rather than later.

get your physio assessment today An early assessment and treatment from the team at Progressive Sports and Spinal Physiotherapy will help you recover sooner. Call today to arrange a thorough assessment on (02) 4721 7798.

28

roamingpanthermagazine.com.au


Health

The A Team Written by Simon Gould – Luke Priddis Foundation

Often, society finds it easy to dismiss people with Autism as disabled, or somehow less likely to make a real contribution to the world.

T

o do that, however, would be a big mistake. We just love bursting stereotypes here at the Luke Priddis Foundation, so we’re looking at the bright side of Autism - the creative and brilliant minds of our time that have been identified as Autistic. Let’s start with Hollywood Superstar, Daryl Hannah. Daryl has starred in mega blockbusters like Blade Runner with Harrison Ford, the tear-jerking Steel Magnolias, the hilarious Grumpy Old Men with legends Jack Lemmon and Walter Matthau, Quentin Tarantino’s Kill Bill Volumes 1 and 2, and many more. Hannah, now 58, was diagnosed as a child and said in an interview with Forbes Magazine that she suffered debilitating shyness which made public events a terrifying experience. It was recommended by medical professionals that she be sedated and institutionalised. Just imagine if her family had allowed that to happen. Instead, she went on to become the star we know today.

Others in the performing arts who may be (or have been) on the spectrum include legendary director Stanley Kubric, Mozart, Andy Warhol, and Pokemon inventor Satoshi Tajiri, who is confirmed as having Asperger’s Syndrome. It’s not only in the performing arts where people with ASD excel. It's long been suspected by specialists in the Autism field that Einstein, Charles Darwin, Sir Isaac Newton, and even Nikola Tesla fell somewhere on the spectrum. Thanks to such brilliant minds we have the reflecting telescope, the colour spectrum, the laws of universal gravitation, Calculus, E=mc2 (remember that from school?), the theory of evolution, and electric light. Oh - and we also know the Earth revolves around the sun! Some of the most significant discoveries of our time, arguably of all time, have come from people who demonstrate classic behavioural signs of Autism Spectrum Disorders.

world. Temple didn’t start speaking until she was four years old and has been an outspoken advocate in the Autism community for many years. Lastly, we even have our very own Dr Holly Priddis. Holly was diagnosed as an adult, and is a driving force behind the Luke Priddis Foundation. She's a mother, a Doctor, a lecturer in Midwifery, a photographer, and a researcher. Less capable? Disabled? Really? The fact is, some of the perceived deficiencies of those with ASD (such as the inability to consider the thoughts of others, an obsession with seemingly small details, and an absolute adherence to processes and repetition) is actually what has allowed some of the greatest minds in history to flourish. So thank goodness for the amazing, brilliant, creative and wonderful world of Autism.

Amazing people with Autism are everywhere

From arts and science through to the world of academia, amazing people with Autism are everywhere. Look at Temple Grandin. A renowned published author, professor and lecturer at Colorado State University, and leading mind in the field of animal sciences, she was named by Time Magazine as one of the 100 most influential people in the

An analysis of our current situation [by Clear Path Accounting] has led to proactive changes…we value their role as an innovative business advisor who always responds promptly to our enquiries. Tom & Asha Dooley - Grace Funerals, Emu Plains

Our mission is to empower you with clarity and direction to build your perfect business We share relevant solutions, provide outstanding support and inspire positive change. We strive to unlock the full potential of your business and we will help you take control and accelerate results to achieve your goals. We will bring clarity and simplicity to the accounting and financial side of your business. We price our services upfront, which means no surprise accounting fees for you. Business Advisory Accounting Taxation Bookkeeping Self-Managed Super Funds

Contact us now to find out more!

clearpathaccounting.com.au

 02 4739 2700  Suite 1, 13 Hope Street, Blaxland NSW 2774

Issue 17 June 2018

29


Health

Social Media & Mental Health

Trent Talks

ABOUT TRENT: Trent Merrin is studying towards a Bachelor of Psychology at the University of Wollongong. He plays rugby league for the Penrith Panthers, and owns and operates his own business Move Out Of Your Head which has recently launched a #moveoutofyourhead dance challenge!

W

hen undertaking research for my #moveoutofyourhead initiative, we confirmed what most of us already knew: that individuals exposed to social media, at any age, are more likely to experience mental health issues.

Know you're not alone: Social media can provide a platform for people to see they're not alone in particular circumstances. It can provide peer support through groups and communities, chats and forums.

I want to touch on why social media can be such a negative space, how we can be aware of the negativity, and how we can help shape it into a positive place.

Awareness: Just like #moveoutofyourhead, there are plenty of awareness campaigns and charities who use social media in a positive way to help spread messages and raise awareness for initiatives or projects.

NEGATIVE SPACE Addiction: Studies show that 13 million Australians spend 18 hours a day online. As well as being a time waster, studies also show that people are prone to psychological symptoms of withdrawal and anxiety when they stop using social media.

Connecting: Social media provides a sense of connection among friends and families. Despite our busy lives, we can keep up with what our loved ones are up to - but it’s important to remember that being connected on social media doesn’t mean you're connected in real life.

Comparisons and jealousy: We're all guilty of comparing ourselves to what we see on social media. This leads to jealousy, low self-esteem and, in extreme cases, depression, anxiety and suicide risk.

Inspiration: Many people use socials to gain inspiration, motivation and ideas, whether it be for business or personal use. Socials are filled with inspirational quotes, cool ideas, and more positive content.

Filtered life: Most people only post their best photos and content. Everyone ‘looks’ attractive or ‘looks’ like they're always enjoying themselves. The key word here is ‘look’, so don’t forget that people’s lives may not be as perfect as their Instagram feed suggests.

Despite what you're using social media platforms for, if we make a conscious effort to use them correctly in a healthy way, as well as be conscious of the time we spend online, we can ensure that we do our part in creating a positive place for everyone to enjoy.

Not living in the moment: Sometimes we can get too focused on capturing the moment on social media rather than experiencing it in real life. Remember that everything looks better through your eyes rather than through a screen. POSITIVE PLACE Along with the negativity, social media also provides some positives, too.

F J

PIANO MAN

THE BILLY JOEL EXPERIENCE

TICKET S $37.45 | 8PM

#moveoutofyourhead Don’t forget, for those small emotions that you can handle on your own, you can do a little dance and #moveoutofyourhead.

R

I

S

A

T

U

N

J

U

N

F

R

I

J

U

N

01

02

DESPERADO THE EAGLES T I C K E T S $25 | 8PM

08

SONGS IN THE KEY OF MOTOWN TICKET S $54.35 | 8PM

PANTHERS.COM.AU 30

roamingpanthermagazine.com.au

1300 PANTHERS TRIBUTE SHOW


WIN $10,000 CASH EVERY THURSDAY

(DRAWN BETWEEN 6PM - 7PM)

WIN $10,000 CASH EVERY SUNDAY

(DRAWN BETWEEN 5PM - 6PM)

MAJOR

BOUNTY BONUS DRAW

$50,000 CASH

if major draw not claimed

WIN A SHARE OF $5,000.

DRAW EVERY 10 WEEKS

Swipe your membership card & place ticket

See staff for details.

Terms & Conditions apply. LTPS/18/23076

QUEEN’S BIRTHDAY CARNIVAL 2PM – 7PM

ND A E M O C ! JOIN US PANTHERS.COM.AU

Fireworks Food Trucks Best Dressed Competition and Games $30 Unlimited Carnival Ride Passes* Live Music from Royale with Cheese

FREE ENTRY & PARKING

1300 PANTHERS


Relationships

Put Your W Relationship First

hether it’s parents, siblings or friends, how we deal with the impact of these ‘thirds’ will go a long way to determining the success of our relationship. Life prior to joining as a couple meant that we had far more independence, so when our best friend called on a Friday and said, 'let’s head out for a drink', or mum popped around unannounced for a cuppa' and chat, we never had to really consider the feelings of another.

When we enter into a relationship we don't only have to work on how to evolve into the perfect, loving twosome, but we also have to deal with the impact of outside influencers.

Local Expert Melissa Ferrari Psychotherapist & Relationship Expert

• Create signals and cues for each other that highlight when your partner is uncomfortable, enabling you to step in where needed. By having your partner's back and letting them know that they come first, you will go a long way to taking the heat out of any potential conflict.

Once you're sharing a home with somebody else, if we put these outside interests ahead of our partner, we're opening the door to resentment and conflict. When we seem to prioritise those outside of our twosome, the natural reaction is for our partner to begin to take a dislike to this outside influence. So yes - that may be why your partner and best friend don't get along. If this then results in the ‘third’ party seeming to take sides against the partner, you'll have serious issues as your partner will begin feeling marginalised. Such feelings will quickly turn into disharmony. If they're a close relation or friend, then the 'me or them' arguments will begin and your relationship will now be at great risk. So, if you find yourself in a situation where close friends or relations are seemingly having too much say in your relationship, what can you do? • Work together and create a pact that puts your relationship first • Do not ignore or dismiss the issue, as saying things such as, 'it’s my friend so just get over it' just won't work, and

The Relationship Expert Make an appointment today for a better relationship with yourself and your partner. Melissa can help you in all areas including Couples Counselling  Individual Therapy  Psychotherapy Melissa also hosts weekend Couple Retreats & Private Couple Intensives for busy couples who need a comprehensive therapy programme 

Lilianfels Resort @ Blue Mountians Couples Retreat Please enquire for future dates

melissaferrari.com.au Connect with me on social media by searching ‘Melissa Ferrari’

32

roamingpanthermagazine.com.au

Couples 3 Day Intensive Workshops • 29th June • 20th July • 17th August

 02 4733 4094 or 0413 806 880  melissa@melissaferrari.com.au  Suite 11, 20-24 Castlereagh St, Penrith

Melissa Ferrari Melissa Ferrari is a Sydney registered psychotherapist and counsellor with more than 20 years of experience in couples counselling and individual therapy. She is one of Australia’s most sought-after therapists and is regularly called upon as a relationship expert in national media.


Beauty

LET'S TALK

Winter Trends For Nails

I

Written by Skye McIntyre

t's nail day. You're at your nail salon, staring at the array of nail polishes and feeling indecisive and frustrated. You can’t make a decision for the life of you. First world problems, right? We here at Roaming feel exactly the same, so we thought we'd reach out to our local Nail Stylist, Skye McIntyre, who's just finished working at Mercedes Benz Fashion Week where she collaborated with designers on the latest season trends. "As always, many designers opted for a very simplistic nail, and this year there were various shades of Nudes used,” Skye said. “Nudes are a safe and classy option. And because they come in peachy, taupe, beige, oyster and dusky shades, they suit absolutely every skin tone.”

Photo credit: CND™

However, with Winter trends in clothing often being black, grey and white, Skye believes that changing seasons provides the perfect excuse to experiment with new colours. "An immaculate manicure in a red polish, such as CND™ Wild Fire, is my Winter go-to.” However if you're not game to try red, she suggests a matte finish. "Matte nails are so chic. Try CND™ Black Pool or Mystic Slate for a stunning statement, or Indigo Frock for a cool dark grey/blue.”

And what about nail art - is it still as big as ever, or does Winter change this? “Nail art is still on trend, with an overwhelming number of options. A splash of sparkle and a half moon are my favourite manicures. "The one thing with nail art is that it's custom-designed to suit individual clients, which is why I love it so much - you can never go wrong! It's always easy to change it up and try something new. That's the one thing I really love about nails - you can try a new colour or design as frequently as you like.”

follow skye mcintyre for more nail inspiration You can follow Skye McIntyre on Social Media to get inspiration for your next nail look.  @skyemcintyre  @skyemcintyrenailstylist  skyemcintyre.com.au

Budget Buster

CAN YOU

Grocery Shop for Less Than $100 Per Week? Penrith local Maria-Luisa Patisso, from My So-Called Lifestyle, explains how… I haven’t always been great at budgeting, and I certainly haven’t always helped others with how to budget. But over the past few years I’ve had to tighten my family’s belt and think outside the box. It’s inspired me to share my money-saving ideas and general life hacks with a growing community through Facebook and Instagram. I believe in saving money on the ‘not so important' things, and spending money on the things that are important to you and make you happy. Take food, for example. Why do we spend so much on food? Why do we have to buy a certain brand? Why do the kids need to have Tiny Teddies? Why do we have to eat meat daily? I believe it’s a habit, and it's also a myth that it’s expensive to eat healthily. It just takes a little more preparation. I don’t spend any more than $90 - $100 on groceries each

Local Expert

Maria-Luisa Patisso Budget Expert My So-Called Lifestyle

week. We are a family of four, with one child still in nappies - and no, we don’t dumpster dive! I have simple, easy steps that have cut my bills in half, and I’ve successfully helped many others with their budgeting, too. Your freezer should be your best friend; great for storing reduced items or leftovers, but not for storing frostbitten forgotten foods that have been in there for six months plus. For starters, you need to do a freezer inventory and plan meals around what’s in there. Buy food and consume within one month - it tastes better! Once you’ve completed your freezer, list what’s in your pantry and fridge. Before you make your shopping list, devise meals using all the ingredients you already have, only adding 'extras needed' to the shopping list. Try making easy snacks for the kids. Even better, make snacks with them! My kids love getting involved and it teaches them good habits for their future, too. I post my weekly meal plans and other money-saving ideas on Facebook @My So-Called Lifestyle and Instagram @mysclifestyle. You can also contact me via mysclifestyle@outlook.com.

My So - Called Lifestyle’s Guide to Grocery Shopping  Write down what’s in your freezer, fridge and pantry and devise meals around what you have, only adding ‘extras’ to your list  Remember to also devise breakfasts, lunches, and snacks  Shop in at least 2 places to get the best deals  Keep fruit less than $3kg and meat as close to $10 as possible. Be strict; if it’s not in your budget, don’t buy it  Write down fruit in pieces; for example, I need 5 bananas and 2 apples  Include at least 2 meat-free meals each week  Make your own snacks  When listing your groceries, write down a rough price next to each item so you know what your total bill should come to. This takes time to learn, but then you can decide to get a certain item from Aldi instead of Woolies if it’s cheaper  If your bill is sky-high, start changing your meals around or take non-essentials off your list  If you can, keep some money aside for any reduced items that can be frozen for the following week  When shopping, stick to your list!


Beauty

HOW A DAY AT THE SPA CAN

Improve Your Overall Health With Winter officially here, the colder and shorter days can bring on the ‘Winter blues’ - also known as Seasonal Affective Disorder (yes, this is a real condition!).

Local Expert

Marianne Arthur Beauty Expert Insignia Hair and Day Spa

C

older days result in a reduced production of serotonin; a chemical neurotransmitter (or happy hormone) that impacts every part of your body. Serotonin helps regulate your moods and improve your sleep while encouraging focus and increased energy. Winter also means we're nearing the end of financial year - a very busy time for many businesses, which can cause lots of stress and anxiety for employers and employees. Well… guess what? All of this COULD be reduced by a trip to the salon to pamper yourself! Studies have shown that all forms of massage, whether it be body massage, facial massage or even a scalp massage, could help to significantly reduce stress and anxiety, and feelings of negativity, while also promoting a good night’s sleep. During massage, parasympathetic nervous activity is activated. This helps you relax, with your body releasing serotonin. Serotonin improves our overall

wellness and our mood. Having a facial is one of my favourite ways to unwind and de-stress.

neck, but also helps boost hair growth by channeling more nutrients to the hair follicles.

From the moment you walk into the treatment room, with the soothing relaxation music and the gentle facial massage, your body starts releasing serotonin. Not only that, but facial massage is also a natural form of anti-aging. It increases blood circulation and oxygen flow to the area, stimulating collagen production in the skin and giving you a healthy glow.

Having your hair done is also fantastic for your confidence and mood. Like they say, ‘look good, feel good’. I know I certainly feel on top of the world when I have a fresh colour or cut!

After a massage or facial we usually end up with some cream and oils in our hair, no matter how careful the therapist is. So why not continue getting pampered by having your hair done after? Having your hair done may also help to put the pep back in your step. Firstly, the scalp massage when having your hair washed is - let’s face it - the best part of getting your hair done. Even scalp massages release serotonin, helping relax you. They also stimulate blood circulation, which not only loosens tight areas in your scalp and

The Highest Standard in Concreting Services in Penrith & Blue Mountains AF FORDABL E S E RVICE S TA ILO RE D TO S U I T YOU

To me, a day at the spa is the epitome of relaxation and a guaranteed mood booster. I definitely know what I’ll be doing to beat the Winter blues...

book in at the day spa now Make an appointment now to escape the 'Winter Blues' by contacting Marianne at Insignia Hair and Day Spa 02 4722 3503

CALL US NOW

0411 704 302

WWW.SLCONCRETE.COM.AU


Jewellery

Remodelling Jewellery

Jewellery is crafted from precious materials found naturally on earth. Part of the magic of jewellery is that these elements, including gold, diamonds and gemstones, are eternal.

T Jewellery With DOUGLAS ELY Designer | Jeweller

he enduring nature of these precious materials means that we often have family heirlooms, or older jewellery pieces, that hold sentimental value. Sometimes, the longevity of jewellery means that these sentimental pieces may be worn or outdated. Perhaps your jewellery needs an update in style to make it more wearable? Is it time to incorporate new elements that represent your journey or your growing family? Or has your piece worn down over time, needing a rebuild to strengthen its integrity? Whatever the reason, remodelling jewellery is a safe and accessible option for breathing new life into your pieces. The beauty of jewellery remodelling is that you can use your existing precious materials to build your new, handcrafted piece.

industry experience and vast product knowledge, which ensures the process is smooth and accurate. It's their job to know the ins and outs of the process, including the technical side, so you can trust your jewellery is in safe hands and that you'll leave with your dream piece. Your jeweller or designer will help you create a new design that suits your needs and wants. They will draw the new design, incorporating your old elements and new style. Once you're happy with the design it will go to the workshop for work to begin. This can include anything from resetting stones to melting down gold and starting from scratch. For help to get started on your jewellery remodel, visit York Jewellers and our expert team will be happy to assist.

The options for jewellery redesign are limitless. You can turn a ring into a pendant, or earrings into a ring. You can build on the existing design, or start afresh reusing your current materials. The process of remodelling jewellery is easy. The first step is to make an appointment with your local jeweller. You will need to select a jewellery store that has jewellers and designers on site. Jewellers and designers have

InsigniaWinter Specials FOR AL L YOUR B EAUT Y N EED S

Winter Warm Up

Escape the Cold

Relax & Unwind

• Full Body Exfoliation • Personalised Body Wrap • Steam Infusion & Vichy Shower • 1 Hour Full Body Massage • 1 Hour Deluxe Signature Facial • Scalp Massage Shampoo & Blowdry

• 1 Hour Deluxe Signature Facial • Eyelash Tint • 1 Hour Deluxe Pedicure • Scalp Massage Shampoo & Blowdry

• Aromatherapy Deep Conditioning Treatment & Scalp Massage • Shampoo & Blowdry

Total value $220 Only $180 Save $40

Total Value $85 Short Length $30 Medium Length $40 Long Length $50

Total value $400 Only $300 Save $100

Offers valid until 30 June 2018

 (02) 4722 3503  14/69 York Rd, Penrith NSW 2750

insigniahairanddayspa.com.au Issue 17 June 2018

35


Travel

Local Experts

VISI T

Magical Bhutan The small Kingdom of Bhutan had been on our bucket list for some time, and we were recently fortunate enough to visit this land of mystery and magic.

T

his small and predominantly Buddhist nation is a landlocked country in South Asia, tucked in between China and India.

Lynette, Kerrie, Jenny & Nicole

Travel Experts Maria, Fellowes & Turner Travel Associates Penrith

locals were required to wear their national dress as part of their daily working life.

top. It's hard to imagine how they managed to build such a structure in a location like this.

You feel like you have dived into the pages of an Asian history book when you see the unique and breathtaking landscapes and architecture. The people were very friendly and welcoming to foreigners. In fact, this is the only country in the world who measure their GNH - Gross National Happiness! Another interesting fact is that there are no traffic lights in the entire country.

The modern world is infiltrating Bhutan but the people seem to be trying to embrace this without losing their traditions and heritage. You see people everywhere in traditional dress checking their social media. It really is a unique destination that deserves a prominent place on everyone’s bucket list.

We were booked on an organised tour, the only way you can currently get a Visa to visit. The flight into Paro is an experience in itself, as you wind down a river valley on one of the most difficult airport approaches in the world.

Our tour was timed to coincide with the Paro Tshechu (festival). Visiting one of these festivals is an excellent way to experience the ancient culture of this most fascinating of destinations. On our visit to the Tshechu, we were even fortunate enough to have a chat to the King!

Our guide met us at the airport dressed in his national dress. This was not a gimmick for the tourists but his normal work attire. He explained that, in fact, many

One of many highlights was the climb to the Tiger’s Nest. This is a Buddhist Monastery built high on a cliff. It was a difficult, but incredibly rewarding, walk to the

15 DAY LUXURY EUROPEAN RIVER CRUISE

from $6995* THE HIDDEN WONDERS EXPERIENCE Experience centuries of history, legend and enchantment as you OF MYANMAR & INLE LAKE- BONUS discover Europe with APT. From cruising along tranquil estuaries

FLY FREE* and mighty rivers to traversing storybook scenery, they’ve left no course uncharted in creating an unforgettable European journey. Uncover the hidden gems of Myanmar on a spellbinding APT cruise along one ofIncludes: Asia’s finest backwaters, the Irrawaddy River. Your luxury experience l Return economy class airfare from Australia to Europe Your unforgettable holiday includes l 14 Nights accommodation onboard the luxurious MS AmaBella l 18 day Asia river cruise and tour l 3 nights post-cruise accommodation l departing Yangon at Sanctum Resort* 14 breakfasts, 13 lunches, 14 dinners and a range of complimentary l Return l Finest dining - a total of 48 meals beverages served on board economy airfare to Asia prepaid taxes ofin$200* l Complimentary beverages served l including All-inclusive sightseeing up to 16 destinations l 14 nights accommodation on board your cruise l 3 APT exclusive Royal Signature Experiences, The Grand Empress steam train, onboard RV Samatha Princess Heide’s Namedy Castle & Vienna City Palace concert All-inclusive sightseeing in up to 17 destinations from $12,195*

Freecall 1800 040 744 or email penrith@travel-associates.com.au 14 Macquarie Avenue, Penrith. travel-associates.com.au/mariafellowes *Travel restrictions & conditions apply. Prices person & subject to availability. Valid for sale 20 Jun unless *Travel restrictions & conditions apply. Prices areare perper person & subject to availability. Valid for sale untiluntil 30 Apr 18, 18, unless soldsold out prior. out prior. Price is based on outside Jan 19on dept. Deal 5165152. accommodation at Sanctum Resort or similar in Inle Price24 is based inside cabin 13 AprPost 19 departure. DEAL 5129319. Lake. Flight Centre Travel Group Limited (ABN 25 003 377 188) trading as Travel Associates. ATAS Accreditation No. A10412 Flight Centre Travel Group Limited (ABN 25 003 377 188) trading as Travel Associates. ATAS Accreditation No. A10412 36

roamingpanthermagazine.com.au

You feel like you have dived into the pages of an Asian history book...


Pets

Exciting & exotic

Local Vet

Dr Erin Short Coreen Avenue Veterinary Clinic

What is an exotic pet?

W

e often discuss cats and dogs, as they’re the most common pets we veterinarians see. However, there are many alternatives to dogs and cats, which are commonly termed ‘exotic’ pets. They include small mammals, birds, reptiles, crustaceans, amphibians, fish, arachnids, and insects. Exotic pets are often smaller, cleaner, quieter and relatively easy to care for compared to dogs and cats. There is a wide variety of exotic pets available. As with any decision to get a new pet, research is key. We recommend investigating what animals will suit your lifestyle and ensure you can meet the needs of your new pet. Age expectancies can vary greatly. While rats and mice will only live a few years, some reptiles and birds can live a few decades! Most exotic pets can be happily housed in enclosures. These enclosures must be safe and secure, and provide

adequate shelter, warmth and light. Suitable containers for food and water must be provided. Positive handling experiences are essential to animals, even those housed in enclosures for periods of time. Many animals are affectionate and will develop strong bonds with their owners.

We recommend investigating what animals will suit your lifestyle and ensure you can meet the needs of your new pet. Most of the issues seen with exotic pets are related to inadequate or inappropriate housing and diet. Only rabbits and ferrets require vaccinations, but regular health checks are advised for all species. Veterinary care for exotic pets can be very specialised. We are lucky to have several exotic specialists we can refer to.

Many exotic pets are social creatures and will be happier housed together, although there are some that are solitary and best housed alone. Each species has their own specialised needs for housing and diet, and we do not recommend housing different species together. If housing animals of the same species together, care must be taken to prevent unwanted breeding. Many exotic pets will mature at comparatively early ages and breed rapidly. To prevent unwanted pregnancies, desexing may be recommended but for some species, sexing and then separation is better.

Where every pet has the opportunity to be loved, cared for and recognised as a priority.

2017 201 7

AW

ARDS

WINNER PENRITH CITY

Every pet entering the practice becomes an integral part of our family unit.

Come and join our family

L BUSIN CA

S ES

LO

Coreen Avenue Veterinary Clinic and Western Sydney Cat Hospital

 Unit 2 & 3/117 Coreen Ave Penrith, NSW, 2750 A U S T R A L I A N SMALL BUSINESS

 02 4731 3055

CHAMPION

AWARDS 2017

FINALIST

 www.cavets.com.au

Issue 17 June 2018

37


Finance

5

Local Expert

Melissa Browne

Ways to Save

Money & Business Strategy Expert Accounting & Taxation Advantage

$250 A MONTH

Too often our expenses lift as our income increases, and we accept this is how much things cost now. Or when we’re stretched, it’s hard to see how we can find extra pennies to save in our already thin budget.

T

hat’s why I wanted to share five ways to save $250 a month. My suggestion is to grab your friends and family (including kids), rope them into this saving challenge and then put the money towards something you’re excited about. Maybe it’s a holiday, paying off the mortgage, paying off credit card debt, or saving for a house. 1

STOP LAZY SPENDING

Yes, if you’ve had a big weekend you may not feel like preparing your lunches for the week on a Sunday but this comes at a cost. Being prepared, and stopping your

marketplace sites such as Fiverr, Airtasker or Upwork, being paid to complete online surveys on sites such as Swagbucks, or even babysitting or tutoring.

impulse buying and expensive lazy spending, is a quick way to save cash. 2 CANCEL THINGS YOU’RE NOT USING

Yes, the gym membership seemed like a good idea at the time but you’ve only been once in the last month and, if you’re honest, that’s going to be the case the next month too. It doesn’t matter if the membership only costs $15 a week - that’s $65 back in your pocket. Whether it’s technology subscriptions, apps, or memberships you’re not using, make sure you cancel any that are no longer right for you. 3 EARN MORE INCOME

Sounds simple but the easiest way to find extra income is to find more cash. This might mean hitting your boss up for a pay rise, taking a second job, or starting a business on the side. Get creative about how to earn extra income. It might even be moonlighting as an Uber driver, becoming a virtual assistant, selling your skills or services on one of the many

4 FIND MORE CASH

Look around the average house and you’ll see so much stuff. Most of it we’re not using and, if we’re honest, we don’t even know we have. A quick way to make money is to sell it. This might mean a garage sale, or selling via eBay or other online sites. Don’t forget the house itself - think about renting your home on AirBnB, particularly when you’re away on holidays. And that spare room or granny flat that’s sitting vacant? Consider offering more permanent rental. 5 CUT UP YOUR CREDIT CARDS

Research proves we spend 10% more when we’re using credit cards, so cut up your cards and use debit cards instead.

Expert help with your home loan

We make refinancing or purchasing stress-free and rewarding We Are Your Finance Solution We strongly believe that we can help almost anybody get into a better financial position, whether it be helping purchase your first home, refinancing to reduce your interest rate or lower repayments, or simply by consolidating your existing loans and finances to reduce your monthly repayments. We will work with you to help correctly structure your finances and achieve your dreams and goals with minimal hassle.

We’ll take you further We will work with you to help correctly structure your finances and achieve your dreams and goals with minimal hassle. Grab a golden opportunity - visit www.theloanssuite.com.au 38

roamingpanthermagazine.com.au

We are available anytime, and although we are based in the Western Sydney Area, we would be happy to help out wherever you are. E S T.

the

2016

LOA N S S U I T E AUSTRALIA


Legal

Fights with Your Builder

Building a house is frantic at the best of times, but disputes with your builder can make it positively nightmarish. Recent changes to the 1989 Home Building Act can reduce the stress on both sides.

CUTTING DOWN

C

A ‘major element’ of a building is defined as: • An internal or external component that is essential to its stability including, but not limited to, foundations, footings, floors, walls, roofs, columns and beams • A fire safety system • Waterproofing, or • Any other element prescribed by the regulations.

hanges to the Home Building Act came into force in March 2015, but few people know about them or understand them.

KEY CHANGES The Act had required work to be performed in a ‘proper and workmanlike’ manner. Legislation now states that work is to be done with ‘due care and skill’.

The limitation period for starting proceedings for an alleged breach of a statutory warranty is six years for a major defect, and two years for non-major defects.

The term ‘structural defect’ has been replaced by ‘major defect’ to cover significant defects that may not be structural. In other words, the range of defects covered by the former structural defect enforcement regime has broadened.

THE BUILDER’S DEFENCES The defences available to a builder on a claim have been expanded, with the builder having to prove that the deficiencies raised by the owner arise from: • Instructions given by the owner, contrary to the advice of the person who did the work (being advice given in writing before the work was done), or • Reasonable reliance by the builder on written instructions (given before the work was done or confirmed in writing afterwards) by a professional acting for the owner, who was independent of the builder.

Section 18E, which covers breaches of statutory warranties by the builder, defines a major defect as a major element of a building that has been caused by: • Defective design • Defective or faulty workmanship • Defective materials, or • A failure to comply with the requirements of the National Construction Code. It can be any combination of these and which causes, or is likely to cause: • The inability to inhabit or use the building for its intended purpose • The destruction of the building or any part of the building, or • A threat of collapse of the building or any part of the building.

IF YOU ARE A CLAIMANT As a claimant you have an obligation to: • Mitigate loss (to reduce the loss and not to increase it) • Make reasonable efforts to give written notice to the builder within six months after the breach becomes apparent, and

Local Expert Joseph Grassi Legal Expert Joseph Grassi + Associates

• Not be unreasonable in arranging access to the site by a builder or sub-contractor to fix any defective work. Failure to comply with these may be taken into account in court or at a tribunal. STATUTORY WARRANTIES The statutory warranties are implied in all contracts for residential buildings. This increases the chances that sub-contractors will be liable to the builder or principal contractor for a breach of the statutory warranties. RESOLUTION OF DISPUTES The changes include broadening the orders that can be made by the tribunal to allow for fixing in stages, with deadlines for specified works to be completed. Builders can, in certain circumstances, apply to have these deadlines extended. If the fault lies with a sub-contractor, then that contractor should attend to the fix, rather than leaving the responsibility to the builder. So, lay out the ground rules with your builders and contractors before you start and report any problems as soon as you can, once you spot them. This article is for general information only, and is not intended as legal advice. If you need specific help contact your solicitor.

EXPERIENCE & RELIABILITY Personal Legal Services • Property and Conveyancing • Wills, Probate & Administration • Estate Planning

Meet Joseph Grassi

• Asset Protection Planning & Implementation

Director of the firm since it first opened in 2008.

• Notarial Services

Joe’s area of practice is in domestic, commercial & industrial conveyancing, commercial leasing, Land & Environment, business, health and tax law.

Commercial Legal Services • Planning & Environment Law • Commercial Advice • Corporate Law & Governance • Business Law • Employment & Industrial Law

• Retail, Commercial & Industrial Leasing • OH&S Law

Joe and his family call Penrith home and he has a keen interest in the area and a desire to see it prosper.

• Debt Recovery, Bankruptcy & Insolvency Law

• Intellectual Property

Solicitor Director: Joseph M Grassi Dip Law (SAB) LLM Accredited Specialist Property Law Notary Public Solicitor: Grant Wiblin LLB, BSocSc, GDipLegalPrac Licensed Conveyancer: Wendy Harvey | Office Manager: Lois Grassi | Administration: Emily Beal

 Suite 1, 86 Henry Street, Penrith 2750  info@grassiassociates.com.au

 4702 5905

www.grassiassociates.com.au Issue 17 June 2018

39


Lending

EOFY

TIME TO

Get Your Finances in Order

Local Expert Rob Lees

As the financial year draws to a close, now’s the time to take stock of your property investment and tax considerations, and assess your future financial habits, needs and goals.

A

sk yourself - did you reach your financial goals? Were you looking to save for your first home deposit, pay down more of your home loan, car loan, or personal debt, or simply develop better savings habits? If you feel you could do with some help setting goals for the upcoming financial year, consider the following. HOME LOAN HEALTH CHECK As the most significant debt you hold, you should consider getting an annual home loan health check. This will ensure the product you signed up for still suits your current situation and you aren’t paying too much interest. Speak to a qualified mortgage professional to determine if you need to refinance into a new product to take advantage of any additional features and potentially pay down your debt faster. PREPARE FOR TAX TIME Tax time is right around the corner. Start getting your paperwork organised ahead of time so you’re ready to lodge your return. Know what your deductions are and keep all the receipts handy. You’ll also need to be across any income you’ve received throughout the year, such as your regular salary, employer lump sum payments, government benefits, income generated through property investment, and more. CONSOLIDATE YOUR SUPER The end of financial year is the perfect time to review your superannuation. If you have more than one super account, consider consolidating the accounts into a single super fund to reduce fees. You may also want to make extra super contributions to prepare for 40

roamingpanthermagazine.com.au

retirement or help save for your first home deposit as part of the Super Saver Scheme, which will be accessible from 1 July 2018. REVIEW YOUR BUDGET Do you still need to improve your budgeting skills? Take the time to review your existing budget to ensure it still aligns with your current situation. Analyse your household spending and assess whether you need to change service providers in order to save on bills. SET NEW GOALS Set new savings goals for the year ahead. If you already put aside a set amount of your salary each month, consider how much more you would be able to save if you increased that amount by 1% or 2%. There are a number of phone apps and websites on the market that can help you track your expenses by sending notifications to keep you accountable. SEEK PROFESSIONAL ADVICE A qualified financial professional will be able to offer expert advice tailored to your specific situation. Qualified professionals, such as a mortgage broker or financial adviser, can help you set realistic and achievable financial goals. If you struggle to stay motivated, these professionals can not only guide you but also keep you accountable.

Lending Expert Mortgage Choice Blaxland, Penrith and Glenmore Park

As the most significant debt you hold, you should consider getting an annual home loan health check


Helping Helping Helping you you you make make make better better better choices choices choices in in in the the the Opening Opening Opening soon soon soon at at at the the the new new new Opening soon new Helping Helping Helping you you you make make make better better better choices choices choices in in in the the the at the Opening soon at Opening the new soon Opening at Opening the Opening new soon soon soon at at the at th Opening soon at Opening the new soon Opening at Opening the Opening new soon soon soon at at the at th Blue Blue Blue Mountains, Mountains, Mountains, Penrith Penrith Penrith and and and Glenmore Glenmore Glenmore Park Park Park Blue Blue Blue Mountains, Mountains, Mountains, Penrith Penrith Penrith and and and Glenmore Glenmore Glenmore Park Park Park Glenmore Glenmore Glenmore Park Park Park Shopping Shopping Shopping Centre Centre Centre Glenmore Park Centre Shopping Glenmore Park Shopping GlenmoreCentre Park Glenmore Glenmore Shopping Glenmore Park Centre Park Park Shop Sho S

Glenmore Park Shopping GlenmoreCentre Park Glenmore Glenmore Shopping Glenmore Park Centre Park Park Shop Sho S p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith w MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees pp pp p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland pp pp p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith ww ww w MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees talk talk talk to to us us us today today today talk toto us today talk to us today talk talk to talk to us us today to today us today talk talk talk to to to us us us today today today talk us today talk to us today talk talk to talk to us us today to today us today to us today talk to us today

Glenmore Park p 4739 9749 Blaxland p p 4721 4739 1733 9749 Penrith Blaxland p p p 4739 4739 4721 p 9749 4739 1733 9749 Blaxland 9749 Penrith Blaxland Blaxland p p 4721 47 p p p p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland p p p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith Glenmore Park p 4739 9749 Blaxland p p 4721 4739 1733 9749 Penrith Blaxland p p p 4739 4739 4721 p 9749 4739 1733 9749 Blaxland 9749 Penrith Blaxland Blaxland p p 4721 47 p p p p 4739 4739 4739 9749 9749 9749 Blaxland Blaxland Blaxland p p p 4721 4721 4721 1733 1733 1733 Penrith Penrith Penrith 4739 9749 Blaxland 1733 Penrith pw 4739 9749 Blaxland p 4721 1733 Penrith MortgageChoice.com.au/rob.lees w w MortgageChoice.com.au/ro w MortgageChoice.com.a Home Home Home loans loans loans || Financial || Financial || Financial planning planning planning || Risk || MortgageChoice.com.au/rob.lees Risk || Risk and and and General General General insurance insurance insurance || w Car ||MortgageChoice.com.au/rob.l Car || loans Car loans loans || Business || Business || Business lending lending lending w MortgageChoice.com.au/rob.lees w MortgageChoice.com.au/rob.lees w w MortgageChoice.com.au/rob.l MortgageChoice.com.au/ro w MortgageChoice.com.a Home Home Home loans loans loans Financial Financial Financial planning planning planning Risk Risk Risk and and and General General General insurance insurance insurance Car Car loans Car loans loans Business Business Business lending lending lending w w w MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees w ww MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees MortgageChoice.com.au/rob.lees w MortgageChoice.com.au/rob.lees

Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN 645 158 ACN 624. 645 158AFSL 624. 645 422854. AFSL 624. AFSL 422854. 422854. Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN 645 158 ACN 624. 645 158AFSL 624. 645 422854. AFSL 624. AFSL 422854. 422854.

Home loans | Financial planning | Risk Home and General loans | Financial insuranceplanning | Car loans Home | Risk Home | Business and loans Home loans General | Financial lending loans | Financial insurance | Financial planning planning | Car planning | Risk loans | Risk and | |Busines and Risk Gener Gen an Home loans | Financial planning | Risk Home and General loans | Financial insuranceplanning | Car loans Home | Risk Home | Business and loans Home loans General | Financial lending loans | Financial insurance | Financial planning planning | Car planning | Risk loans | Risk and | |Busines and Risk Gener Gen an

Home Home Home loans loans loans || Financial || Financial || Financial planning planning planning || Risk || Risk || Risk and and and General General General insurance insurance insurance || Car || Car || Car loans loans loans || Business || Business || Business lending lending lending Home Home Home loans loans loans Financial Financial Financial planning planning planning Risk Risk Risk and and and General General General insurance insurance insurance Car Car Car loans loans loans Business Business Business lending lending lending Home loans | Financial planning | Risk and General insurance | Car loans | Business lending Home loans | Financial planning | Risk and General insurance | Car loans | Business lending

Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Mortgage Mortgage PtyChoice Choice Limited Limited Limited ACN 158 ACN ACN 645009 009 624. 161 161 AFSL 979. 979.422854. Australian AustralianCredit CreditLicence Licence382869. 382869.Mortgage MortgageChoice Choice Mortgage Financial Financial Mortgage Choice Planning Planning Limited Choice Pty PtyLimited Limited ACN Mortgage Limited 009 ACN ACN 161 ACN Choice 158 979. 158 009 645 645 Australian Limited 161 624. 624. 979. AFSL AFSL ACN Australian Credit 422854. 422854. 009 Licence 161Credit 979. Australian 382869. LicenceMortgage 382869. Credit Mortgage Licence Choice 382869. Financial ChoiceMortgage Financial PlanningChoice Planning Pty Limited Financial PtyACN Limited Planning 158 645 ACN 624 Pty 158

Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Mortgage Mortgage PtyChoice Choice Limited Limited Limited ACN 158 ACN ACN 645009 009 624. 161 161 AFSL 979. 979.422854. Australian AustralianCredit CreditLicence Licence382869. 382869.Mortgage MortgageChoice Choice Mortgage Financial Financial Mortgage Choice Planning Planning Limited Choice Pty PtyLimited Limited ACN Mortgage Limited 009 ACN ACN 161 ACN Choice 158 979. 158 009 645 645 Australian Limited 161 624. 624. 979. AFSL AFSL ACN Australian Credit 422854. 422854. 009 Licence 161Credit 979. Australian 382869. LicenceMortgage 382869. Credit Mortgage Licence Choice 382869. Financial ChoiceMortgage Financial PlanningChoice Planning Pty Limited Financial PtyACN Limited Planning 158 645 ACN 624 Pty 158

Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN645 158 ACN 624. 645 158AFSL 624. 645 AFSL 422854. 624. AFSL 422854. 422854. Mortgage Mortgage Mortgage Choice Choice Limited Choice Limited ACN Limited 009 ACN161 009 ACN 979. 161 009 Australian 979. 161 Australian 979. Australian CreditCredit Licence Credit Licence 382869. Licence 382869. Mortgage 382869. Mortgage Mortgage Choice Choice Financial Choice Financial Planning Financial Planning Pty Planning Limited Pty Limited Pty ACN Limited 158 ACN645 158 ACN 624. 645 158AFSL 624. 645 AFSL 422854. 624. AFSL 422854. 422854.


Property

THE

Negotiation Choosing an agent to represent the sale of your home can be an overwhelming prospect.

W

ith early considerations to be made for marketing, staging, open for inspections, conveyancers, finance and more, the often overlooked yet fundamental aspect of choosing an agent is their strength in negotiation at the final stage of sale. An agent with the ability to foresee variables and adapt to unique challenges during the sales process, from beginning to end, will be your most valuable asset. You should be able to see years of experience in relationship building with vendors and buyers in motion, coupled with a personable approach, broad industry knowledge, and an unwavering understanding that real estate is a customer service industry - and you are the customer. As the sale of a home is often an emotional journey for sellers, an agent who is forthright and honest with their vendor can provide a sense of security in a time that may be fraught with insecurity. Real estate is a dynamic industry that changes every day. Keeping vendors

informed of all the information gathered at an open for inspection puts the vendor in the very best position when it comes to deciding on an offer. How many people came through, what they said, and comparables in your area change constantly; a capable agent will be able to evidence these variables via an honest relationship, empowering their vendor to make informed decisions. The trust to have tough conversations and a vision to work together as a team helps keep the end goal in mind. This is when the paramount skill of negotiation comes into play. Often an underutilised asset, vendors and buyers are at times unaware that anything can be negotiated - time, leaseback, settlement periods, or tree removal may represent a monetary value during a deal. The most unusual items that we’ve negotiated have been cars or even livestock on rural properties. Hence the ‘art’ of negotiation - vendors that are somewhat inflexible on price may be flexible on other negotiable items, such as

Local Expert

Sharon Mudiman Property Expert Bespoke Realty Group

outdoor furniture or the perfect sized fridge. So remember, while Agents A, B or C may get the same buyers through their properties, the agent you want is the one that’s going to use their skills to negotiate the very best deal for you.

SPEAK TO BESPOKE REALTY GROUP TO HELP YOUR NEGOTIATIONS Sharon Mudiman, Licensee and Principal of Bespoke Realty Group (formerly Glenmore Park First National), has been negotiating the sale of property for over 25 years in the Greater Penrith Region. Get in touch with Sharon today on 4737 9977 or visit www.bespokerg.com.au.

An agent with the ability to foresee variables and adapt to unique challenges during the sales process, from beginning to end, will be your most valuable asset

42

roamingpanthermagazine.com.au


Ph 02 4737 9977

Glenmore Park | Penrith | Jamisontown

FO R S A L E

16 Eucalyptus Drive Cranebrook NSW 2749

4

Focus on CRANEBROOK POPULATION

16,068

HOUSES SOLD PER YEAR

HOUSES SOLD BY PRICE RANGE $1- $2m

26% HOUSEHOLDS

AGED 0 -19 YEARS

2

Offering pristine, tranquil surrounds near Penrith CBD, Cranebrook is popular with professionals and families seeking affordable housing. Remaining within reach for most investors with almost 70% of recent sales in the $600-$800K range, coupled with a healthy rental demand at 26%, Cranebrook is the ideal blend of lifestyle and livability.

78% COU PLE

15%

1

Sharon Mudiman Director / Licensed Estate Agent 0413 757 998

8% 10%

HOUSEHOLDS

RENTING

55.7% EARN HOUSEHOLD INCOME $78,000 OR MORE

$400-$600k

$800k - $1m 14% 320

319

258

232

228

69% ∆

2013

† Population and household statistics by .id population experts. ∆ Suburb statistics by CoreLogic.

2014

2015

2016

2017

$600-$800k

www.bespokerg.com.au


Digital

Local Expert

A Sturdy Padlock

Trish Fehon

YOU CAN’T BEAT

Digital Expert Online Influence

EVEN ONLINE

From 1 July, Google’s Chrome browser will brand all websites that don’t have an SSL Certificate as ‘not secure’.

with the fact that more than 48% of Australians use Chrome. It makes sense to get an SSL Certificate.

T

• It encrypts, or scrambles, your personal information so it can’t be accessed by a third party. • It authenticates the identity of the Certificate’s holder. • It gives the server a ‘key’ to unscramble the information.

his is great news for online consumers and a timely warning for business owners.

An SSL (Secure Socket Layer) Certificate keeps private information private. It’s indicated by the padlock you see when you visit a website.

A green padlock is your virtual ‘green light’ to trust a business with your personal details, such as credit card details, home address, and more. If an online customer is faced with two sites, one with a prominent ‘not secure’ message in its URL bar and one with a padlock symbol, it’s obvious which they will choose. If you’re a business owner, combine Google’s crackdown

An SSL is like a guard that patrols the line of communication you open between your browser and the server that hosts a site.

There are lots of companies that issue rock-solid SSL Certificates. They come in three main levels and range in price – the most basic are free. • DV SSL: Domain Validation is perfect for personal sites, blogs and social media. • OV SSL: Organisation Validation provides strong SSL protection for your website and your business. • EV SSL: Extended Validation offers the highest level of security and gives the green padlock. A Wildcard SSL Certificate is the best bet for businesses that host or manage multiple sites or pages on the same domain.

LEARN MORE ABOUT SSL CERTIFICATES To learn more about which SSL Certificate is right for you, read my blog on the topic at www.onlineinfluence.com.au or call the Online Influence team today on 4724 9555.

Online Influence Penrith can help you with all your online marketing needs Website Design and Development Google Advertising Facebook Advertising Email Marketing campaigns Search Engine Optimisation (SEO) E-commerce (Shopping carts)

Online Influence is a Google Partner, a Facebook Ad agency and a boutique Web development company that specialises in helping you get leads and sales from your website.

www.Onlineinfluence.com.au

0247 249 555 Level 1, 331 High Street, Penrith NSW 2750 Specialized in:

Search ads

44

roamingpanthermagazine.com.au


Sport

Rising Star Ryley  NAME | RYLEY SMITH

 TALENT | CRICKET & RUGBY LEAGUE

We’re extremely proud to announce the Southlands All Star, Ryley Smith.

A

t just 15 years of age, this young man has reached the elite levels of two sporting disciplines.

After a stellar season with Penrith Cricket Club where he played fourth grade and A.W. Greenshield in the Sydney Grade Competition, Ryley earned himself a position in the NSW Under-15 team. Ryley was the highest run scorer at the recent national carnival and, following his success at the carnival, was selected to tour Dubai with the Australian Under-16 team in early 2019. He’s also been selected in the Under-17 NSW squad to play in the national carnival towards the end of 2018. This is an amazing achievement for someone so young. Penrith Cricket Club President Paul Goldsmith, and current fourth grade captain Dale Turner, believe it’s Ryley’s strong work ethic and commitment to training that have driven his success at such a young age. Despite his accomplishments, Ryley has remained extremely humble. He’s a valued club member and well-liked among his peers. Not only is Ryley talented on the cricket field, but he’s also making a name for himself in the world of rugby league.

A player with the Glenmore Park Brumbies, Ryley is also part of the Penrith Panthers Under-15 representative squad. Nathan Cleary, recently-appointed Southlands Ambassador and Penrith Panthers halfback, was able to present Ryley with his award. Nathan was extremely impressed with Ryley’s humble nature and obvious talent. The Southlands Shopping Centre All Stars Program proudly supports talented youth who excel in a wide range of areas. Marketing Manager Vanessa Sullivan is incredibly proud of the program, and honoured to have received so many outstanding nominations since it began last year. “At Southlands Shopping Centre we pride ourselves on the role we play in the local community. Our All Stars Program gives us the opportunity to connect with our community and reward talent such as Ryley,” she said. As part of his prize, Ryley receives $250 to put towards his sporting costs and $250 for his nominated club, Penrith Cricket Club.

REMEMBER If you know an All Star, don’t forget to nominate them! Head over to www.southlandsshoppingcentre.com.au for all the details.

SO UT H L AN D S S H O P P I N G CE N T R E

ALL STARS

NOM INATIONS OPEN NOW!

ARE YOU THE STAR WE ARE LOOKING FOR? We are looking for kids who love to play sport, dance, act or sing. The search is on and we want to find a superstar. Whether you kick a footy, swim, shoot hoops or twirl and kick we are looking to reward you. With a monthly prize of $250 available for you and $250 for your club, school or association, we are celebrating the many talents of our local community. Head to www.southlandsshoppingcentre.com.au for details on how to enter and full terms and conditions.

Proudly managed by

Penrith

Issue 17 June 2018

45


Horoscopes

Horoscopes By Sherrynne Dalby

Gemini

(21 MAY – 21 JUN)

Cancer (21 JUN – 23 JUL) Early June can see you undertaking a physical makeover of either yourself or your home. You’re currently motivated to improve your immediate conditions and while you may be feeling inspired, there can also be a tendency to go overboard. Mid to late month has a financial focus; perhaps working out how to pay for the renovations you’ve undertaken. It’s a matter of rejigging and is doable, although it may require forgoing a few luxuries. Health matters can be on your mind, and working on a healthy lifestyle is important. Relationships take over late month.

Virgo (23 AUG – 23 SEP)

Ruling Planet: Mercury Sign:

The Twins

Gemstones:

Agate and all multi-coloured stones

Colours:

Multi-coloured, colours mixed together, yellow

Day:

Wednesday

Number:

Five

This is the Gemini’s annual time for renewal - Happy Solar Return, Gemini! The saying ‘Many Happy Returns’ is a reference to the sun returning each year to the same area in the sky that it was at the time of birth. For Gemini this year, the coming month will give you a snapshot of the year ahead. In particular, pay attention to what’s going on around your birthday for clues. It’s a busy month and year ahead for Gemini, with the focus on financial matters. There can be a need to negotiate with partners to improve the current situation. May birthdays can experience delays, which should improve as the month and year unfold. Early June birthdays need to call on diplomacy to navigate through tricky situations. Mid-June birthdays will have opportunities to begin new projects, and careful attention to detail can improve your chances of success. Overall, 2018 is a busy year for Gemini as it presents opportunities for self-improvement and moving forward in both business and relationship matters.

Pisces (19 FEB – 21 MAR) Home and family continue to dominate your time and energy. You can choose to make it a labour of love or a chore. Which makes you happier? So much of our happiness comes down to our perspective, and most of the time we have a choice as to what that perspective will be. Once you’ve taken care of what needs to be done, there will be plenty of time for play. In fact, you should be feeling quite creative at the moment. Perhaps you can utilise some of that creativity while you’re taking care of business.

46

roamingpanthermagazine.com.au

Career matters appear to be a big focus for you at the moment. This can reach a climax mid-month, especially for August birthdays. You have a good network of friends and work colleagues who are willing to give advice or practical help. You know who to trust and, if you’re unsure, just trust your instincts. Choices can always be scary until we unpack them and take the emotional element out. Look at it first to decide which is the best choice based on practicalities. Then see how you feel about it; if you’re happy, you have the answer.

Scorpio (23 OCT – 22 NOV) You can be feeling quite romantic, relaxed and at ease with yourself and the world. If you aren’t feeling the warm and fuzzies (unless you’ve experienced recent trauma), you need to ask yourself why not? Make the most of the positives when they’re around. Life is so busy these days that it’s important to make the most of the quiet times and take that much-needed deep breath. Career issues can cause tension later in the month, and you may find you’re needing to put in too much time for too little reward.

Capricorn (22 DEC – 20 JAN) Relationships tend to dominate. Even when things are going well you have a tendency to put yourself under pressure at the moment. You’re undergoing change but, as you’re aware, it’s a slow, ongoing transformation. You can feel it going up a notch or two, and this can be reflected in your relationships. This includes all relationships, not just your primary one. With communication playing an important role in these relationships, you may find this intensity challenging from mid-month. Take time to gather your thoughts before you speak and listen just as carefully.

Aries (21 MAR – 20 APR) Siblings or neighbours may require your assistance, particularly early in the month. Careful communication is required as misunderstandings are possible, and this can lead to overreaction on the part of one or both parties. Plan carefully and cautiously as there can be a tendency to go overboard. Mid-month the energy switches back to home and family, and there can be a lot of activity here. Perhaps you can call in a few favours to help achieve your goals. Your temper can be tested in the workplace or other group situations; as always, stop and think before you react.

Leo (23 JUL – 23 AUG) You are experiencing a prolonged period where the focus is on others. Sleep may have been a problem of late and can continue for a while. Are you losing sleep over somebody? Unresolved problems have a tendency to manifest in the subconscious while we sleep, either in the form of dreams or nightmares. Looking into our sleep pattern and any disturbances can help in solving our waking life problems. Try to recall your dreams and examine them. Keep a dream journal, writing down your dreams as soon as you wake. You are always the best person to interpret your dreams.

Libra (23 SEP – 23 OCT) You continue to juggle career and home matters. At times it really can feel as though you’re a juggler in the circus. Communication is the key to keeping all of your balls in the air. To keep on top of things, it’s important that you communicate well and pay close attention to others. It’s easy for things to be misunderstood. Pushing yourself too hard could have ramifications on your health later in the month. Watch especially for a recurrence of health issues that have been a recent concern. Take time for yourself and get sufficient rest.

Sagittarius (22 NOV – 22 DEC) Relationships can certainly keep you on your toes, and while things can be a little tricky early in the month, they should take a turn for the better by mid-month. You have the opportunity to take a relationship in a new direction, making a new start. If you’re looking to start a new relationship, now is the perfect time. Whatever you do though, keep your feet on the ground. Keep an eye on your finances later in the month. There may be the need to tighten your belt as a financial commitment turns out to be larger than you expected.

Aquarius (21 JAN – 19 FEB) With your energy levels reaching a high over the next few months, you may be feeling as though you have a new lease on life. You can use this energy creatively or by undertaking a new health and fitness regime. It’s a good use of the current energy if you’re serious about becoming fitter and more proactive in health matters. Be careful not to overdo it, though. You can also look at some of those ‘less than healthy’ habits you’ve developed and take action to eliminate them. Relationships should be smooth sailing from mid-month onward.

Taurus (20 APR – 21 MAY) Finances, particularly your own earning ability, come under the spotlight. Are you realising your potential or just settling for an income? Are you managing your finances for maximum benefit? These are questions you need to ask. Opportunities to improve your situation arise mid-month, including employment options. Going backwards may be necessary before moving forward, so you may need to move out of your comfort zone in order to take advantage of opportunities. A sibling may hold the key you’re looking for. Remember, opportunities can appear in many different guises.


" Why fit in when you were born to stand out..." - Dr. Seuss


MADE FOR HER IMAGINED BY HIM. B R E AT H TA K I N G LY C R A F T E D B Y Y O R K J E W E L L E R S . CUSTOM DESIGN YOUR OWN UNIQUE RING.

Shop 51A, WestямБeld Penrith | (02) 4721 0780 | enquiries@yorkjewellers.com.au www.yorkjewellers.com.au

Profile for Penzance Publishing

Roaming Magazine June 18 Issue  

Nepean's Lifestyle Magazine

Roaming Magazine June 18 Issue  

Nepean's Lifestyle Magazine

Advertisement