Page 1

INSIDE SPORT: CYMS, MACQUARIE AND WELLINGTON IN FOOTY GRAND FINALS

PhotoNews DUBBO

SEPTEMBER 7-13, 2017 | LOCALLY OWNED & INDEPENDENT | FREE!

Flaunt Your Assets Meet Tully. A donkey with attitude and an Instagram star in his own right. He’s the face of Dubbo Pets Month, when Dubbo Photo News runs our annual pet photo competition with the Dubbo Regional Council and participating sponsors offering $1,000 worth of prizes for pics of your pet that make you smile. See inside for more details and be sure to catch the Q&A with Tully.

The benefits of chook therapy

Election weekend! Voting guide inside

Page 4

Page 26

CALL US with your news ideas 6885 4433 | EMAIL photos@dubbophotonews.com.au | VISIT US at 89 Wingewarra St, Dubbo


2

September 7-13, 2017 Dubbo Photo News

DUBBO CITY LIFE

Walk Towards Hope LOCALS are encouraged to come along to the NALAG ‘Walk Towards Hope’ Suicide Prevention walk across the L.H. Ford Bridge this Saturday, September 9. The walk will begin at 11.30am from Bob Jane T-Mart on the Macquarie Street side of the bridge, with a short ceremony and barbecue lunch to follow at Lions Park on the Western side of the bridge. Pictured encouraging everyone to take the Walk Towards Hope are Terry Fahey, Ross Tighe, Shelley Carolan, Andrew Hamblin, Martin Cook, Bob Pilon and Ronny Gibbs. PHOTO: SARAH HARVEY

Comment by TIM PANKHURST MANAGING EDITOR

Make your vote count THE flurry of pre-poll and postal voting aside, for most of us this Saturday, September 9, is our big chance to help decide the ten councillors who will lead the new Dubbo Regional Council over the next few years. Don’t take the decision lightly. Vote formally and vote well. Think about the type of person you’d like to help drive this region forward. Think about the people who are positive and who have the leadership qualities we need. Dubbo Photo News’s Yvette Aubusson-Foley has compiled a guide to this Saturday’s election, including candidate listings for each ward, which you’ll find inside today’s paper.

‘Take a minute, change a life’ WITH all the plusses that come with living away from the big capital cities, one of the most troubling minuses is that we’re more likely to die by suicide. I’ll say it again: People in rural and remote areas are more likely to die by suicide than those in major cities. “We know people living in rural and remote areas face a range of challenges unique to living outside a major city. These include drought, floods and fire as well as isolation,” Director of the Centre for Rural and Remote Mental Health (CRRMH) Professor David Perkins said this week. “Everyone needs to be part of the solution,” he encouraged. This weekend will see World Suicide Prevention Day commemorated and so the spotlight shone extra brightly on ways we can all make a difference. We’re all being encouraged to take time to notice what’s

going on with family, friends and colleagues – and ourselves. “Take a Minute, Change a Life” is this year’s theme. Professor Perkins says each and every one of us should take the time – even if it’s just a minute – to have a conversation with someone who you think has changed.

Join the Walk Toward Hope this Saturday EVERYONE is invited to join NALAG’s Walk Toward Hope across the L.H. Ford Bridge this Saturday morning. “I believe suicide prevention is everybody’s business and we need to have those conversations around suicide prevention,” NALAG’s Trudy Hanson said. “The Walk Towards Hope is a start towards having communities engage in these talks.” Men of League Western Region President, Martin Cook, says his organisation is proudly supporting NALAG’s Walk Toward Hope. “We’re hoping the rugby league

community can turn up on Saturday to show their support for this very important cause,” Martin said. “We hope this raised awareness can then lead to more community action,” he added. Everyone – from all walks of life – is welcome to gather at the Bob Jane T-Mart site, on Macquarie Street near the bridge, this Saturday morning from 11 where you’ll receive a T-shirt to wear and a balloon to carry – there’s limited stock so arrive early. The walk across the bridge is due to start at 11.30 for a brief Remembrance Ceremony at midday at Lions Park in West Dubbo, followed by a free barbecue lunch at 12.30. Activities in Dubbo this Saturday come in the same week we had a visit from the R U OK? Conversation Convoy which stopped in Dubbo on Monday as part of a six-week journey around Australia’s cities and regional towns.

Footy’s big weekend FOOTY fans are looking forward to a big Sunday with the 2017 Group XI Grand Fi-

nals being played and decided at Caltex Park. CYMS have three of their four teams competing on the day – their Under-18s bowed out last weekend and finished third for the year. CYMS spokesman Damien Porter said this week: “Your attendance and vocal support is needed and would be greatly appreciated on Sunday. This Grand Final day will be the toughest for many years as the entire town of Nyngan will be there to support the Tigers.” Sunday’s action kicks off at 10am when CYMS take on Parkes in League Tag. The Wellington Cowboys and Macquarie Raiders are also represented in other grades. CYMS and Nyngan play the main game. See Geoff Mann’s sport in today’s paper for more info.

Who is our top tipster? DUBBO Photo News readers have been following the weekly “Battle Of The Tipsters” throughout the NRL season, and enjoying the weekly battle report by Kev Engeler. Today’s the big day when Kev announces the winner of this year’s comp. See today’s Sport for the final result. - Until next week, Keep Smiling!

Warming up at Swish

Open Mon – Fri 9 – 5ish, Saturdays 9 – 12ish 29 Talbragar Street, Dubbo Ph: 6882 9528 The Swish Gallery

@theswishgallery

THE

Swish

GALLERY


3

Dubbo Photo News September 7-13, 2017 PAGE 3 COMMENT

PAGE 3 GIRL

The story of Rocket and Snowball

Kirsten Mann & V ola Vi Age: 20 Status: Single I am a... veterinary nurse at Duncan McGinness Veterinary Surgery If I could visit anywhere, it would be...England I am passionate about... dramatic arts and photography Comfort or style? Style Three ways to win your heart? Humour, passion, romancing Three ways to win Viola’s heart? Smackos, cuddles and new toys Something you miss? My cattle dog, Esmae Who are your top three heroes/inspirations? Emilia Clarke, Charlie Bewley, Nina Dobrev If you could give one piece of advice to the whole world, what would it be? Do whatever makes you happy My favourite local place to visit is... One 7 Eight restaurant A gentleman is someone who... is always courteous I spend most of my time... with family My favourite product is. s .. a pretty max dress

By YVETTE AUBUSSON-FOLEY

ROCKET and Snowball were gerbils. Not mice, not guinea pigs, but something small and furry in between. They would clutch their morsels of food with tiny pink spindly fingers and their beady black eyes could stare straight into your soul. With each mini bite their wiry whiskers twitched. Melt. How adorable, until, it came to Rocket and Snowball’s pecking order. Snowball was a white Supremist. Bigger in size, permanently in charge; he ruled the cage. Rocket, despite her pacey name, was timid and shy, happy to follow Snow’s mandate. They lived in a house of love with three children mostly on the second floor of their two-storey house but despite the mother’s dire warnings against the practice, the children frequently converted the upstairs playroom into a gerbil’s gymnasium, fencing off gaps under doorways with rolled up towels, to allow the pets to run free. Inevitably Snowball saw his chance one day, thanks to the children’s poor workmanship which left a gap under the door a train could drive through, and he escaped. Small people gave over-enthusiastic chase. Their thumping footsteps and shouts of “Catch him! Catch him!�, rattled Snowball’s inner-cage and he lost his cool, paying the ultimate price for freedom. As he scurried off the upstairs landing into the arms of Nature’s betrayal - he could not fly –instead, he plummeted like a small but heavy stone, to the tiled floor in the entrance hall below. The odds for Snow’s survival were next to nil. The family rushed to his side. The room was silent. Snowball lay still. That kind of still brought on by the onset of only one condition. Tears in children’s eyes began to well. Quick on his feet, the Dad dashed to the kitchen and returned moments later with a tea towel – as a sort of makeshift gerbil ambulance – in which to wrap the mortal remains of Snow. Children’s tears turned to sobs and someone whispered, ‘don’t go to the light, Snowball’. The Dad gently pressed down on Snowball’s chest with his pointer finger and blew air on his little whiskered face. “Come on Snowball.� The family held its breath witnessing the miracle of the world’s first gerbil CPR. A little foot twitched. “Did you see that?!!� It twitched again. “He’s alive! He’s alive!� Snowball was resurrected that day, but the tables had turned for him and Rocket, and she ruled with an iron whisker from that day forward. Such are the highs and lows of pet ownership. Welcome to Pet’s Month. See details inside.  feedback@dubbophotonews.com.au

WHERE TO FIND US: ERSKINE ST

• • • • • •

Flours Nuts Bread Cakes Fruit Gluten free options

IDEAL RUGS

BRISBANE ST

BUY BULK FOR A DISCOUNTED PRICE!

FIND US HERE

PCYC

DARLING ST

Sarah Jane Fine Foods Factory Outlet

CARRINGTON AVE

BEN FURNEY FLOUR MILLS

SNAP VILLAGE FITNESS BAKERY CAFE

Ben Furney Flour Mills 101 Brisbane St, Dubbo | Telephone: (02) 6883 5218 | Open Monday to Friday 9.00am to 5.00pm


4

September 7-13, 2017 Dubbo Photo News

A bird in the hand is worth gentle therapy As told to Sarah Harvey

UPA (United Protestant Association of NSW Limited) Regional Clinical Nurse Consultant Ernest Benson Quizon Quetulio has been overseeing the introduction of chicken therapy into Bracken House to assist dementia and aged care. What is the program? It is a follow up to previous pioneering projects which started in the UK (Chook House Challenge) and has been practiced in some parts of Australia where residents in residential homes keep hens at hand as it has proven to be beneficial for people with dementia. When did it begin and why? It began about eight weeks ago as part of our ongoing initiatives to holistically care for our residents especially those with dementia. As the landscape of the aged care industry is ever changing, we have to continually search for safe, innovative ways that promote positive impact for many people living with dementia. What is the importance

of the program? Studies reveal that hen keeping wasn’t simply a pleasurable but a social activity for people with dementia (many of whom had kept chickens as children). It could also have a calming effect, helped lower blood pressure and heart rate, and reduced the use of anti-psychotic drugs for aggression. What has the response from the patients been? Very well. Taking care of chickens and looking forward to eggs on a daily basis have given our residents the chance to genuinely care for something real and feel needed and useful. Some residents who generally stay inside are now going outside to see their chooks. It has also increased resident and staff morale. Any funny/interesting stories that have resulted from the program? While trying to assemble the chook house, we (Joe the activity officer and myself) found that some pieces were missing. After a bit of searching we suddenly found three of our residents

Participating in the chicken therapy at Bracken ken House are Kate Loxley, Joan Browning, Pat Stoddard, Lorna Pearson. PHOTO: DUBBO PHOTO NEWS/WENDY MERRICK

(Paul, Colin, and Kyle) giving us their take on the how to build properly. We ended more confused until eventually asking help from our maintenance personnel who at the end just improvised some aspects of the build. You have an opening day coming up, what can visitors expect? It is more an opening of our doors to visitors and family members alike for our own take on “Dementia

Day�, September being Dementia Awareness month. We will have a keynote speaker who will talk about the life of the people living with dementia. Singer John Cook, schoolchildren, and farm animals will be here to entertain for the day. Sausage sizzles and drinks for those in attendance as Joan Browning well.

IN BRIEF

Funding for Victoria Park redevelopment DUBBO Regional Council (DRC) has endorsed a recommendation that a Victoria Park Redevelopment Advisory Committee be formed to enable stakeholders to provide advice in regards to the development of infrastructure design and impacts of construction on the relevant sports. “This project received $8 million from the NSW Government as announced by Member for Dubbo Troy Grant earlier this month, $4 million of which is for a new cycle facility and $4 million for the upgrade of the Victoria Park Number 1 Oval,� DRC interim administrator Michael Kneipp said. “This enables Council to create genuine regional centres for rugby union/rugby league/cricket and cycling that are capable of holding provincial/national level tournaments and representative fixtures.�

Have your say on Wellington Caves A DRAFT master plan for the major upgrade at Wellington Caves is now on exhibition and the public is being encouraged to have their say on the future direction of the complex. Wellington Caves has secured $2.5 million from the NSW Stronger Communities Fund for a new Visitor Experience Centre, and an additional $1.3 million of State Government funding “to support growth in the education market�, council says. The master plan encourages both tourists and locals to be more involved.

7+(:25/'$&&25',1*72 By FINN RANDELL THE ZRUOGLVDODUJHSODQHWÂżOOHGZLWK imagination, danger and excitement. %XWLQP\SHUVSHFWLYHWKHZRUOGZLWK its gift of life, is a treat. 7KH ZRUOG LV OLNH D ODE\ULQWK ZLWK VXUSULVHVKLGLQJDURXQGHYHU\FRUQHU waiting patiently to be revealed. Unexplainable WKLQJV KDSSHQ D ORW LQ WKLV ODE\ULQWKRIDZRUOG /LIH FDQ give you a twist and a turn, and can PDNHWKLQJVEHHPRWLRQDOLQDQ\ZD\ possible. /LIHcreates, astounds and perplexes. :KDW LV D ZRUOG ZLWKRXW VXUSULVHV" 1RWKLQJ Nature JLYHV WKLV ODE\ULQWK WKH OLIH DQGVRXORIORYHOLQHVVDQGPDNHVWKH ZRUOGDWKLQJRIEHDXW\ If DOLHQV NQHZ RI WKHVH OXVFLRXV SODQWV,EHWWKDWWKHUHZRXOGEHDWUDIÂżF MDPRI8)2ÂśVWKHLURZQHUVFUDYLQJWR VHHWKHEHDXW\RI(DUWK Nature VKRXOGQÂśW EH GHVWUR\HG E\ KHDUWOHVV KXPDQV ,Q P\ RSLQLRQ WKLQJVWKDWFKRSGRZQWUHHVGRQÂśWH[LVW 7KHworld, according to me, grants wonderful surprises and glorious WUHDWV,PDJLQDWLRQUXQVZLOGDQGWKH world is free. So, WKH ZRUOG VKDOO IRUHYHU OLYH HYHQZKHQ,SDVVDZD\(DUWKDQGLWV ZRQGHUVVKDOOOLYHRQLQP\VWLOOKHDUW forever.

3528'/<6321625('%<0&'21$/'¡6'8%%2$1':(//,1*721

L¡PORYLQ¡LW


5

Dubbo Photo News September 7-13, 2017

Where old trees go to retire By YVETTE AUBUSSON-FOLEY

Geof and Dawn Wright have donated trees, including this 25-tonne monster to exhibits at the Taronga Western Plains Zoo. PHOTO: CONTRIBUTED.

HAPPY BIRTHDAY

REPURPOSING an old tree to a lion enclosure at a zoo is possibly the last thing Geof and Dawn Wright thought they’d ever be doing in their lifetime, but when the local farmers had to cut down a 25 tonne monster proving a hazard on their property that’s exactly what happened. Making a delivery of the trunk pictured to Taronga Western Plains Zoo on Sunday, August 27, the site caused quite a stir for zoo goers attending a large event there. “We went to the zoo not realising there was a zoo run taking place and that there would be so many people,” explained Geof. “We went in order to see where

the various trees would be located. When we informed the first zoo attendant we spoke to that we had donated the trees she said the tree caused quite a stir when it arrived with cameras being flashed everywhere due to its size and then not being able to go through the front gate had to be escorted around to the back gates. “That tree we were told was placed in the new lion exhibit being built which will be opened to the public in December. We were told there will be around 25 lions in that exhibit in contrast to the present number of nine lions. You will find it next to a lake near the end of the zoo where there used to be birds. It took two excavators to load the

trunk pictured. Other trees were delivered and went to the Savanna exhibit. “When the trees were delivered to the Savanna exhibit the giraffes essentially went ape over the trees licking them and chewing the bark. Apparently there was a zoo bus group who were privileged to see all this take place. Anyway great ending for these trees whose life was literally cut short but have gone on to create enjoyment for others,” said Dawn. The trees were becoming increasingly dangerous during winds and storms as they were located next to an access road to their property. Taronga Western Plains Zoo were very willing to take the trees for use in their exhibitions.

O

Sep 7: Gloria Gaynor, pop singer, 68. Julie Kavner, the voice of cartoon character Marge Simpson, 67. Chrissie Hynde, US singer of The Pretenders, 66. Andrew Voss, rugby league commentator, 51. Shannon Elizabeth, US actress, 44. George Bailey, cricketer, 35. Evan Rachel Wood, US actress, 30. Sep 8: Dave Stewart, of the Eurythmics, 65. Paul Zanetti, political cartoonist, 56. James Packer, businessman, 50. Lachlan Murdoch, businessman, 46. Martin Freeman, English actor, 46. Nathan Hindmarsh, NRL player, 38. Pink, US singer, 38. Chris Judd, AFL player, 34. Sep 9: Susilo Bambang Yudhoyono, former Indonesian president, 68. Alexander Downer, former Liberal politician, 66. Hugh Grant, British actor, 57. Adam Sandler, US actor-comedian, 51. Natasha Stott Despoja, former politician, 48. Rachel Hunter, NZ model-actress, 48. Henry Thomas, US actor, ET: The Extra-Terrestrial, 46. Michael Buble, Canadian singer, 42. Michelle Williams, US actress, 37. Shaun Johnson, NRL player, 27. Shannon Boyd, NRL player, 25. Sep 10: Karl Lagerfeld, German fashion designer, 84. Lynda Stoner, TV actress, 64. Geoff Jansz, TV chef, 59. Colin Firth, British actor, 57. William McInnes, actor, 54. Guy Ritchie, UK film director, 49. Ryan Phillippe, US actor, 43. James Graham, rugby league player, 32. Sep 11: Renee Geyer, singer, 64. Moby, US DJ-musician, 52. Princess Akishino, Japanese Imperial Family, 51. Harry Connick Jr, US actor-singer, 50. Ludacris, rapper, 40. Ben Lee, singer/songwriter, 39. Jarrod Croker, rugby league player, 27. Sep 12: Linda Gray, US actress, 77. Rachel Ward, actress, 60. Nathan Bracken, cricketer, 40. Grant Denyer, Family Feud host, 40 (below). Emmy Rossum, US singer-actor, 31. Sep 13: Marjorie Jackson-Nelson, Olympic athlete, 86. Jacqueline Bisset, English actress, 73. Randy Jones, from The Village People, 65. Anne Geddes, baby photographer, 61. Andrew Gee, Federal Member for Calare, 49. Shane Warne, cricketer, 48. Stella McCartney, British fashion designer, 46. Goran Ivanisevic, Croatian tennis player, 46. Fiona Apple, US singer-songwriter, 40. Ben Savage, Cory on TV’s Boy Meets World, 37.

VOTE FOR YOU. REMEMBER TO VOTE THIS SATURDAY. NSW Local Council election day is Saturday, 9 September. It’s your chance to vote for what’s important to you locally. On Saturday, you must vote at a polling place in your Council or ward area between 8am and 6pm. If you can’t vote on Saturday you can vote early until 6pm this Friday, 8 September at your local pre-poll voting centre.

Not all councils are holding elections this Saturday. To check whether you need to vote visit our website or call us. IN BRIEF

VOTING IS COMPULSORY IN ALL AREAS CONDUCTING ELECTIONS. FINES APPLY FOR NOT VOTING.

Water Connection, Backflow Prevention and Pricing Policy

For information visit www.votensw.info or call 1300 135 736.

A SERVICED strata title and community plan properties water connection, backflow prevention and pricing policy will go on public exhibition at the Dubbo Regional Council next week. A new draft proposes changes relating to Council’s billing arrangements and if adopted, will see Council directly bill the owner’s corporation or community association for all water usage within developments, where each lot is not separately metered by a Council authorised, installed and maintained water meter. The proposed change means Owners Corporations and Community Associations can determine water billing for individual customers within these developments. The draft Policy will be on public exhibition Friday, September 29, 2017, 5pm.

For enquiries in languages other than English, call our interpreting service on 13 14 50. For hearing or speech impaired enquiries call us via the National Relay Service on 13 36 77.

Authorised by John Schmidt, NSW Electoral Commissioner, Level 25, 201 Kent Street Sydney, NSW, 2000.


6

September 7-13, 2017 Dubbo Photo News

PETS MONTH

WHO AM I?

Tully the Donkey makes waves on Instagram By YVETTE AUBUSSON-FOLEY

HE’S fast becoming an influencer on Instagram, picking up followers from across the globe, but Tully the Donkey from the west side of Dubbo (though, that would be in the South ward) is taking it all in his stride. Tully’s talent manager Kim Goldsmith kindly allowed us a few minutes with the social star and assisted with interpreting this interview, exclusive to Dubbo Photo News. Is Tully your full name? Yes, but I’ve had a few others over time. I can’t repeat them in a family publication. How old are you? Depends who’s asking, but about 15. Have you lived near Dubbo long, if not, where do you come from? I moved to Dubbo about six weeks ago from Tullamore NSW, not Ireland. Are you a donkey or an ass? That depends on what side of the bed I got out on. On a good day, I’m a donkey. You’re a rising Insta-Star. Is fame your goal or do you have another purpose? I’ve never sought fame. I do believe I have a purpose in life though, to make humans go all warm and fuzzy and write witty messages to me in that cutesy voice reserved for babies and kittens. What do you love the most about Instagram? It’s like a dating site for pets. I’ve met dogs, cats, horses and other donkeys from all over the world on Instagram… even a few guinea pigs. I’ve seen a cute donkey or two. We chat regularly. BTW, it’s @tully_the_donkey if you want to be my friend. Is it possible to make a living out of posting pictures online? So I’m told. I’m thinking that a few strategically placed product placements could prove to be quite lucrative. I’ll need to be quite careful about what products I endorse though. If I’m going to be an influencer in this space I’ll need to carefully manage my credibility.

Tully’s social media manager (and owner) Kim Goldsmith tempts the Instagram star with his favourite snack: a carrot. Follow Tully @tully_the_ donkey PHOTO: DUBBO PHOTO NEWS Social media can be very time consuming. How do you balance the demands of your real life and your online life? It’s all about efficiency. One or two solid photo shoots each week can provide enough content for a couple of weeks. Having a social media manager who understands how it all works helps too. Having an Instagram account for a donkey must be breaking new ground. Have you received any offers from Hollywood or the like? ABC Radio and Online is about

as big as it’s been lately. I’m still waiting on a call from Hollywood. If an actor were to play you in a movie, who would you like it/he/ she to be? George Clooney. I wouldn’t even consider auditioning anyone else – just the right amount of grey, gravitas and charisma in one package. Do you have an elevator pitch? I’m not a fan of elevators. It’s bad enough being inside a horse float. If you could read, what do you

think you’d be reading at the moment? The Wonky Donky is a favourite, and you can sing it too: “He was a spunky, hanky-panky cranky stinky dinky lanky honky-tonky winky wonky donkey.” Hee-haw! It could have been written about me. Have you been following the Dubbo election and what would your hopes be for the new council? I’d hope that the new council might get over the petty stuff and focus on the big picture. Dubbo’s proven to be a great place to live so far and I’d like to think there’d be opportunities here for other donkeys. There’s nothing we can’t do in the bush but we need intelligent decision-makers who show a bit of class and foresight. As they say, don’t be an ass. It’s also Pet’s Month. Do you classify yourself as a pet, or something else? I’m more than a pet, I’m an investment. Would you say a donkey is an ideal pet? Why? No, I wouldn’t. Taking on a donkey is a commitment for a very, very, very long time. You know we can live to be 40 plus years old? We need companionship, feed, veterinary care and lots and lots of love. You’ve got to be pretty special to take on a donkey. What would you say are the special challenges that come with donkey ownership? Learning to think like a donkey. We’re not stubborn, we just like to consider all our options before making a decision. Sometimes that means just doing it… later. Oh, but food works. Carrots. A carrot will get me every time. What would your owner say are the special challenges of owning a donkey? If I’ve said it once, I’ll say it again: Learn to think like a donkey. She’s a horsey-gal from way back but we’re nothing like those uppity equines. I think she’s getting used me braying – I’ve been desensitising her to it for a few weeks now. Is there anything else you’d like to add? Nope. It’s dinner time.

EMPLOYEE OF THE MONTH AS VOTED BY THE ENTIRE TEAM AT DUBBO CITY TOYOTA.

SHARON MUNRO Administration JULY 2017

Dubbo City Toyota 2-12 Bourke St, Dubbo T (02) 6882 1511 Servco Australia Dubbo Pty Ltd ABN 41 124 473 454 Dealer Licence No MD20520

dubbocitytoyota.com.au

GREAT PEOPLE = GREAT SERVICE

z I was born on February 22, 1983, in Nairne, South Australia. z I made an early reputation as a fast bowler when I broke the cheekbone of an opponent in the under-12s. z I made my first-class debut for South Australia in the 2002/03 season. z I was selected in the touring squad for 2005 Ashes tour, and made my Test debut. z I battled injuries over the next 18 months, keeping me out of the Test team, but was selected for the 2007 One Day Internationals World Cup. I finished as the second leading wicket taker with 23 scalps. z I represented Australia again at the 2011 World Cup in India. z I finished my professional career as a specialist Twenty20 player. z I married Indian swimsuit model Mashoom Singha in 2014. ANSWER: SEE OUR TV+ GUIDE

IN BRIEF

Eumungerie water supply scheme opens THE Eumungerie Water Supply Scheme was officially opened last week at an informal function at the Eumungerie RSL Hall. There were 48 households in Eumungerie and six households in Mogriguy using rainwater tanks and purchasing bulk water during dry periods which now have access to a consistent and reliable source of quality drinking water under the scheme. Further benefits to the community include better fire protection with direct access to water for emergency services. The scheme includes over 35 kilometres of new pipeline to access a reservoir north of Mogriguy and distributions to and within Mogriguy and Eumungerie.

:::NUM3ER5 ER5 3.5kg The amount of avocado the average Australian now consumes per year. Our love affair with the avocado has seen demand in Australia grow by almost 10 per cent in the past 12 months. Australia’s supplies of the fruit are dwindling, forcing local sellers to tap New Zealand growers for extra stocks, according to The Australian.


ADVERTISEMENT

FOR AN INDEPENDENT COUNCIL

VOTE

UNGROUPED

BELOW THE LINE 1 2

1 2 3 1

1 2 Authorsied by Richard Mutton, 1 Waverley Drive, Dubbo NSW 2830


8

September 7-13, 2017 Dubbo Photo News

PETS MONTH

Learners on Lead By SARAH HARVEY THE bond between us and our furry friends is something we cherish, but when communication barriers affect the relationship it’s hard to know who to turn to for help so when Karen Johnston started having problems with her dog she decided to take matters into her own hands. “I had a problem dog that I couldn’t get any help with locally so I decided to study a two year course with the Delta Society to earn a certificate IV in Companion Animal Services and become an Accredited Canine Instructor.” After running a one-off dog training class while completing her course, Karen noticed a high demand from locals and decided to start up her very own dog training business, Learners on Lead. Learners on Lead has now been

running for 14 years and works to build better relationships between owners and their dogs through variety of lessons and activities. Nine classes are held each week ranging from Puppy Pre-School, Manners Courses, Advanced Training and Private Lessons. Karen’s favourite thing about her job is being able to fix behavioural and communication problems, enhancing owner’s relationships with their dog. “Being able to open up people’s eyes and mind to the relationship they can have with their dog is a great feeling. I’d like to see more people getting involved in some sort of activity with their dog because there’s so much to offer, it can improve your dog’s life.” To find out more or to get in contact with Karen and her team visit the Learners on Lead website, www.learnersonlead.com.au.

Karen with a group of Learners on Lead students on August 26 at Tamworth Agility Trial. Evelyn Walker with Hank, Meg Parsons with Milo and Mira, Melissa Field with Pepper, Karen Johnston with Scooter, Abbey and Bazil, Hanna Hinton with Lila, and Bob Hinton with Jessie. PHOTOS: SUPPLIED.

Karen on holiday with her dogs Zac, Abbey and Bazil, jogging on the beach

Karen with Abbey competing in Agil

ity in Tamwor th.

Yes, chooks make eggcellent pets By YVETTE AUBUSSON-FOLEY ASIDE from the endless funny stories you’ll have about these unpredictable birds thanks to their big personalities, chooks make great pets for families for lots of reasons. Fresh eggs are always a bonus and if you hatch chickens you can’t beat their cute factor plus you’ll have fertliser on tap. Building a coop, cooking, egg crafts, and spending time with chickens which are docile gentle creatures. You can teach them tricks, like flying to your arm, walking across ladders, counting things and for something fun, you can hypnotise them. Keeping chooks in your backyard is legal and as long as they’re kept well and healthy, councils don’t have a limit on how many you can have. Roosters however are not allowed. While this fierce feathered face is that of a functional fowl from Mother Clucker eggs, chooks make great backyard pets with many added benefits. PHOTO: DUBBO PHOTO NEWS/YVETTE AUBUSSON-FOLEY

IN BRIEF

Charles Sturt University (CSU) cut concerns

DUBBO’S Charles Sturt University (CSU) campus is likely to be impacted by proposed cuts to the higher education sector totalling $2.8 billion over the next four years. The government proposes cuts to the Higher Education Participation and Partnerships Program (HEPPP) which allows Charles Sturt University to support people from lower SES or disadvantaged backgrounds to attend university and make a difference to their lives through higher education. Charles Sturt University has the highest number of low SES students and the highest graduate employment rates in Australia. Share your concerns with Federal Member for Parkes, Mark Coulton who is based here in Dubbo.

Top 10 movies at the Aussie box office this week 1 The Hitman’s Bodyguard (pictured) ed d) 2 American Made 3 Girl’s Trip 4 Dunkirk 5 Annabelle: Creation on 6 The Dark Tower 7 Hampstead 8 Ali’s Wedding 9 Gifted 10 Celebrate Studioo Gibili SOURCE: MPDAA

IN BRIEF

South Dubbo Weir Rock Ramp and Fishway Project completed CONSTRUCTION is now complete on a rock ramp and fish way at the South Dubbo Weir. The fish way will allow native fish to move upstream and downstream providing great benefits for native fish stocks between Dubbo and Burrendong Dam. The rock ramp reduces dangerous turbulence and water depth reducing the risk of drowning. Nine people have drowned at the South Dubbo Weir since its construction in 1942 The project has been delayed by a high water flow releases from Burrendong Dam and high rainfall periods. David Payne Constructions and NSW Public Works were engaged by Council to oversee the project.


FORTUNER CRUSADE AUTO from

$56,990

driveaway

[A3]

HILUX 4X4 SR5 TURBO-DIESEL DOUBLE-CAB PICK-UP Manual from

Automatic from

$52,990 $54,990 driveaway [A]

LANDCRUISER PRADO GXL TURBO-DIESEL AUTO from

$62,990

driveaway [A]

RAV4 GX 2WD CVT

from

drive [A4] away

$31,990

driveaway [A1]

$500 + FREE FUEL BONUS

ACROSS THE RANGE^^

THIS WEEKâ&#x20AC;&#x2122;S USED CAR SPECIALS 2013 FORD TERRITORY TX WAGON, 106,948 KMS, TURBO DIESEL, AUTOMATIC, AWD. $18,990 REGO BX49DY, VIN: 6FPAAAJGATDU24337.

2015 MAZDA 3 SP25, 23,320KM SPORTY, AUTO. REDUCED TO $23,990

2013 MAZDA MX-5 SPORTS ROADSTER COUPE, 29,851 KMS, SPORTY, LOW KM, CONVERTIBLE. $26,990

2014 MAZDA CX-9 LUXURY WAGON, 80,367 KMS, LEATHER, AUTOMATIC, 7 SEATS. $29,990

REGO CVH74D, VIN: JM0NC30F2E0203726.

VIN: JM0BM523810204714. REGO: DBG19X.

2013 HOLDEN COMMODORE VF SV6 SEDAN, 71,860 KMS, AUTOMATIC, LOW KM, PARTIAL LEATHER. $23,990

2008 TOYOTA HIACE COMMUTER BUS, 143,287 KMS, TURBO DIESEL, MANUAL, 7 SEAT. $25,990

2013 AMAROK HIGHLINE DUAL CAB, MANUAL TURBO DIESEL. REDUCED TO $29,990

2014 PRADO KAKADU WAGON, LUXURY, AUTOMATIC, FAMILY SIZE. REDUCED TO $60,990

VIN: 6G1FB5E31EL942192 - REGO: CPH43V.

REGO CSF27R, VIN: JM0TB10A5E0415130.

REGO CJ19WT, VIN: WV1ZZZ2HZDA036675.

VIN: JTFST22P200003592. REGO: AV28EB.

VIN JTEBH3FJ10K132333. REGO: DMM35C.

Visit dubbocitytoyota.com.au for more of our Used Cars. Due to newspaper deadlines some vehicles may be sold at the time of publication of the newspaper. We apologise for any inconvenience.

Over 70 quality used vehicles in stock. Visit dubbocitytoyota.com.au for more.

Dubbo City Toyota Due to newspaper deadlines some vehicles may be sold at the time of publication of the newspaper. We apologise for any inconvenience. 2-12 Bourke St, Dubbo T (02) 6882 1511

Servco Australia Dubbo Pty Ltd ABN 41 124 473 454

Dealer Licence No MD20520

dubbocitytoyota.com.au

NEW CAR SALES TEAM: Richard Condon 0432 512 757, Niall McNicol 0417 410 474, Andrew Kierath 0418 346 337, Tom Sullivan 0429 822 008, Jordan Sutton 0432 068 148. USED CAR SALES TEAM: Dylan Triplett 0413 577 540, Jimmy Ring 0438 892 753, Robert Williams 0409 273 753.

TOYOTA T OYOTA ACCESS A SMARTER WAY TO BUY

>$@5HFRPPHQGHGGULYHDZD\VKRZQLQFOXGHVPRQWKVUHJLVWUDWLRQPRQWKVFRPSXOVRU\WKLUGSDUW\LQVXUDQFH &73 DPD[LPXPGHDOHUGHOLYHU\FKDUJHDQGVWDPSGXW\3ULFLQJLVDSSOLFDEOHIRU3ULYDWH%URQ]HDQG6LOYHUÆ«HHWFXVWRPHUVDQGSULPDU\SURGXFHUVRQO\DWSDUWLFLSDWLQJ GHDOHUV2Æ©HUDYDLODEOHRQYHKLFOHVSURGXFHG-DQXDU\WR6HSWHPEHUDQGSXUFKDVHGE\XQOHVVRÆ©HUH[WHQGHG>$@5HFRPPHQGHGGULYHDZD\VKRZQLQFOXGHVPRQWKVUHJLVWUDWLRQPRQWKVFRPSXOVRU\WKLUGSDUW\LQVXUDQFH &73 DPD[LPXPGHDOHUGHOLYHU\ FKDUJHVWDPSGXW\DQGPHWDOOLFSDLQW3ULFLQJLVDSSOLFDEOHIRU3ULYDWH%URQ]HDQG6LOYHUÆ«HHWFXVWRPHUVDQGSULPDU\SURGXFHUVRQO\DWSDUWLFLSDWLQJGHDOHUV2Æ©HUDYDLODEOHRQYHKLFOHVSURGXFHG-DQXDU\WR-XO\DQGSXUFKDVHGE\XQOHVVRÆ©HUH[WHQGHGAA $SSOLFDEOHIRU3ULYDWH%URQ]HDQG6LOYHUÆ«HHWFXVWRPHUVDQGSULPDU\SURGXFHUVRQO\DWSDUWLFLSDWLQJGHDOHUVIXHOYRXFKHURÆ©HUDYDLODEOHRQDOO&RUROOD.OXJHUDQG5$9PRGHOVRQO\SXUFKDVHGE\XQOHVVRÆ©HUH[WHQGHG)XHOYRXFKHUVDUHQRWUHGHHPDEOHIRUFDVK DQGH[SLUHPRQWKVIURPLVVXHGDWH9DOLGIRUVLQJOHDFWLYDWLRQRQO\7R\RWDLVQRWUHVSRQVLEOHIRUORVVRUWKHIWRIIXHOYRXFKHU)RUIXOOIXHOYRXFKHUWHUPVSOHDVHYLVLWKWWSVZZZFDOWH[FRPDXRXUVROXWLRQVIXHOFDUGV>$@5HFRPPHQGHGGULYHDZD\VKRZQLQFOXGHVPRQWKV UHJLVWUDWLRQPRQWKVFRPSXOVRU\WKLUGSDUW\LQVXUDQFH &73 DPD[LPXPGHDOHUGHOLYHU\FKDUJHDQGVWDPSGXW\3ULFLQJLVDSSOLFDEOHIRU3ULYDWH%URQ]HDQG6LOYHUÆ«HHWFXVWRPHUVDQGSULPDU\SURGXFHUVRQO\DWSDUWLFLSDWLQJGHDOHUV2Æ©HUDYDLODEOHRQYHKLFOHVSURGXFHG-DQXDU\ WR-XO\DQGSXUFKDVHGE\XQOHVVRÆ©HUH[WHQGHG>$@5HFRPPHQGHGGULYHDZD\VKRZQLQFOXGHVPRQWKVUHJLVWUDWLRQPRQWKVFRPSXOVRU\WKLUGSDUW\LQVXUDQFH &73 DPD[LPXPGHDOHUGHOLYHU\FKDUJHDQGVWDPSGXW\3ULFLQJLVDSSOLFDEOHIRU3ULYDWH %URQ]HDQG6LOYHUÆ«HHWFXVWRPHUVDQGSULPDU\SURGXFHUVRQO\DWSDUWLFLSDWLQJGHDOHUV2Æ©HUDYDLODEOHRQYHKLFOHVSURGXFHG-DQXDU\WR$XJXVWDQGSXUFKDVHGE\XQOHVVRÆ©HUH[WHQGHG


10

September 7-13, 2017 Dubbo Photo News

LOVE THE LUXURY? 2WTEJCUGQPGQHVJGĆ&#x201A;PCNTGOCKPKPI.CMGXKGY UVCIGQPGJQOGUCPFOQXGKPDGHQTG%JTKUVOCU

"Ă&#x2022;Ă&#x20AC;Â&#x201C;>}Â&#x2DC;Â&#x2C6;wViÂ&#x2DC;Ă&#x152;Â?Ă&#x17E; appointed, resort Ă&#x192;Ă&#x152;Ă&#x17E;Â?iiĂ&#x192;Ă&#x152;>Ă&#x152;iLÂ&#x153;>Ă&#x192;Ă&#x152;Ă&#x192;\ Pool

Â?Ă&#x2022;LÂ&#x2026;Â&#x153;Ă&#x2022;Ă&#x192;i BBQ Areas CCTV Cameras And NO dreaded exit fees Â&#x153;Ă&#x2022;Ă&#x192;i]Â?>Â&#x2DC;`ÂŤ>VÂ&#x17D;>}iĂ&#x192;­Â&#x2C6;Â&#x2DC;VÂ? Â?>Â&#x2DC;`Ă&#x192;V>ÂŤÂ&#x2C6;Â&#x2DC;}ÂŽLiĂ&#x152;Ă&#x153;iiÂ&#x2DC;

$380,000 - $480,000 www.maasgroupfamilyproperties.com.au #\WTG#XGPWG5QWVJNCMGU'UVCVG rr1RGP&C[UCORO 5CNGUEQQTFKPCVQTU$KNN-GNN[CPF/CTGG'ICP


11

Dubbo Photo News September 7-13, 2017

LOVE THE VIEW? Wake up to it every day in one of our exclusive waterfront villas - ready to move into now!

3

2

1

3

2

1

WATERFRONT VILLA - READY TO OCCUPY

WATERFRONT VILLA - READY TO OCCUPY

Open for Brand new, this boutique three bedroom home boasts inspection by UWRGTKQTÆ&#x201A;PKUJGUVQOCVEJTGUKFGPVKCNFGUKIP+PVGTKQT appointment HGCVWTGUKPENWFGCYCNMKPTQDGCPFGPUWKVGFGUKIPGT MKVEJGPYKVJ5OGICRRNKCPEGUYCNMKPRCPVT[CPFOO UVQPGDGPEJVQRUKPVJGMKVEJGPGPUWKVGNCWPFT[CPFRCPVT[

$TCPFPGYVJKUVJTGGDGFTQQOJQOGJCUDGGPVCUVGHWNN[ Open for inspection by FGUKIPGFVQKORTGUUGXGPVJGOQUVCUVWVGQHDW[GTU appointment +PVGTKQTHGCVWTGUKPENWFGCYCNMKPTQDGCPFGPUWKVG FGUKIPGTMKVEJGPYKVJ5OGICRRNKCPEGUYCNMKPRCPVT[CPF OOUVQPGDGPEJVQRUKPVJGMKVEJGPGPUWKVGNCWPFT[CPFRCPVT[

2GTHGEVHQTVJGGPVGTVCKPGTOCMGVJGOQUVQHVJGQWVFQQTUYKVJCTGCT EQXGTGFRCVKQCPFFKPKPICTGCNQQMKPIQWVCETQUUVJGYCVGT 2NWU[GCTTQWPFEQOHQTVKUIWCTCPVGGFYKVJ\QPGFFWEVGFTGXGTUG E[ENGCKTEQPFKVKQPKPICPFRTQHGUUKQPCNNCPFUECRKPIYKVJVWTHCPF YCVGTKPIU[UVGOUVQICTFGPDGFUKUCNUQKPENWFGF

/CMGVJGOQUVQHVJGQWVFQQTUYKVJCTGCTEQXGTGFRCVKQCPFFKPKPI CTGCNQQMKPIQWVCETQUUVJGYCVGTRGTHGEVHQTTGNCZKPI 2NWU[GCTTQWPFEQOHQTVKUIWCTCPVGGFYKVJ\QPGFFWEVGFTGXGTUGE[ENG CKTEQPFKVKQPKPICPFRTQHGUUKQPCNNCPFUECRKPIYKVJVWTHCPFYCVGTKPI U[UVGOUVQICTFGPDGFUKUCNUQKPENWFGF

47 Amadeus Ave, Southlakes Estate â&#x20AC;¢ $442,000 0

49 Amadeus Ave, Southlakes Estate â&#x20AC;¢ $442,000


12

September 7-13, 2017 Dubbo Photo News CONSERVATION

WHAT KIDS SAY

Dubbo Field Naturalist and Conservation Society celebrate 40 years By SARAH HARVEY

Alexie Etheridge, 6 Favourite song? Humpty Dumpty Favourite colour? Purple and yellow Favourite game? Hide and seek because I can count really good Who is your best friend? Kaylee What makes you laugh? Kaylee, she giggles What makes you sad? Nothing What are you afraid of? Ghosts, they’re scary If you could change your name what would it be? Lucy What are you really good at? Gymnastics, I’m good at cartwheels What is your favourite thing to eat for lunch? Baked beans What is your favourite fruit? Apples because they start with an A like me! What would you like to be when you grow up? A zoo keeper because I like the zoo How old is grown up? 50

IT’S been 40 years since the formation of the Dubbo Field Naturalist and Conservation Society and over the years the group has successfully advocated and raised awareness regarding the environmental issues facing the Dubbo region. The Dubbo Field Naturalist and Conservation Society is the only environmental group in the area and work towards ensuring a sustainable future for residents of Dubbo through their three aims; to foster interest, knowledge and enjoyment in natural history, particularly in the Dubbo region, to speak out on environmental and conservation issues, particularly those affecting our area and to achieve these aims by meetings with lectures, discussions and field trips. The group consists of 80 members who all share an interest in preserving

the natural cultural heritage of Dubbo. The society’s correspondent secretary Janis Hosking said they work with the local council, monitoring any issues that may arise and taking action when needed. “We’re always putting in submissions to council for various things, we have a This photo includes Erin Collins, good working relationship Len Wallace, Sue Cooper, Gisela Wallace, Bruce Astill, Dick MacFarlane, Sally with them.” Forsstrom, and Elsie Howe (kneeling). While Janis notes the positive increase in solar panels and recycling throughout and clearing it.” the community, she believes conservaShe states that trying to get people intion in Dubbo has changed mostly for the terested and helping is becoming really worst in recent years. hard and encourages people to sign up. “Dubbo’s getting bigger, I’d like to see it The group holds monthly meetings and stop growing. They’re getting into areas field trips, conducting bird surveys and that we’d like them to stay out of, knock- learning more about the plants in the ing down the odd paddock here and there region.

FOOTY F O OT TY YF FINALS INAL S FIN GER FOOD FINGER FOOD F FRENZY! RENZY! Kailis Bros. Mini Breaded Onion Rings 1kg

$3.99

McCain i Pizza Pi Singles Si l 2 pack

Patties Party Pies Caterers Selection 12 pack

Patties Cocktail Sausage Rolls 72 pack

$31.99

$17.99

$35.99

Thom Thum Mini Spring Rolls (4 varieties) 1.5kg bags

A&T Large Crumbed Formed Calamari Rings 1kg

Ingham Chicken Devil Chips 1kg

$10.59

$10.75

$13.99

Steggles Chicken Breast Crackles 1kg

McCain Hash Brown Nuggets 1kg

Primo Cocktail Frankfurts approx. 2.5kg bag

$15.99

$6.85

$7.95/kg

Where to find us:

WHILE STOCKS LAST. SALE ENDS 13 SEPTEMBER. IN-STORE CUSTOMERS ONLY

OPEN: MON TO FRI 9:00AM - 5:30PM & SAT 9:00AM TO 2:00PM

2 CAPITAL DRIVE, BLUERIDGE BUSINESS PARK, DUBBO PH: (02) 6800 2100


13

Dubbo Photo News September 7-13, 2017

YOUR STARS ARIES: You wonâ&#x20AC;&#x2122;t mince your words, even if what you have to say may be misconstrued. Afterward you will have to lead by example to make sure you were clearly understood. TAURUS: Some unexpected expenses may pop up, but you will be resourceful in negotiating a loan with your bank manager to avoid having to tighten your belt too much. GEMINI: Expect a lot ot of action. You should be able to carry out a feat thatt will be talked about a lot. ot. A nice pay hike is in the he cards at work following wing the signing of a big contract. CANCER: Take a moment to reďŹ&#x201A;ect before ore starting any project. t. You are not likely to ask for anybodyâ&#x20AC;&#x2122;s advice, even n if your decisions affect others. hers.

BOOK GIVEAWAY Win your own copy of â&#x20AC;&#x153;Plants and Animals of the Dubbo Regionâ&#x20AC;? by Dubbo Field Naturalist and Conservation Society members Robert Taylor, Darren Shelly, Tim Hosking, Janis Hosking, Steve Lewer, David Geering and David Coote.

LEO: Stress will be a big part of your week and you will have to rest, otherwise your health may send you signals to slow down. A little relaxation will go a long way. VIRGO: Even though you have a tight schedule and many professional and family responsibilities, take the time to unwind and visit good friends youâ&#x20AC;&#x2122;ve neglected lately. LIBRA: If youâ&#x20AC;&#x2122;ve been neglecting your relationship relat because of work, time to think itâ&#x20AC;&#x2122;s tim about taking abo a rromantic holiday to h reconnect r with w your better half. b SCORPIO: S There will be Th lot of emoa lo tion in the air! A situation could move

you deeply. One of your children will accomplish something special, if only baby steps. SAGITTARIUS: You will carefully weigh the pros and cons before making a decision. Even if you have all the information you require, intuition will be your best guide. CAPRICORN: Lots of work is on the horizon and many details will need sorting out. You should also ďŹ nalise an agreement or settle a legal dispute, which should be a windfall for you. AQUARIUS: You will have to look your best. You will take the time to spoil yourself, renew your wardrobe or maybe even treat yourself to a full makeover. One way or another, youâ&#x20AC;&#x2122;ll be putting your best foot forward. PISCES: You will devote a lot of time to your home and family life. You may also engage in a seemingly ordinary family activity that will turn out to be an absolute delight. The luckiest signs this week: Virgo, Libra and Scorpio

IN BRIEF

IN BRIEF

The bank that keeps on giving and giving

Have a say on â&#x20AC;&#x2DC;Start Your Adventureâ&#x20AC;&#x2122;

THE Westhaven Association, Royal Flying Doctor Service Dubbo - Support Group, Dubbo Rescue Squad, Dubbo and District Parent Support Group for Deaf/Heading and Pink Angels Incorporated received donations in the past week from the Regional Australia Bankâ&#x20AC;&#x2122;s innovative Community Partnership Program. Under the program, new bank customers open a transaction account and select which group they would like to support. Regional Australia Bank then calculates the average annual balance of all supportersâ&#x20AC;&#x2122; accounts and donates 1 per cent of the total to the cause on the customersâ&#x20AC;&#x2122; behalf â&#x20AC;&#x201C; all without costing them a cent. A record $105, 437.73 was donated to local community organisations at a ceremony on Thursday, August 31.

HAVE a say on the â&#x20AC;&#x2DC;Start Your Adventureâ&#x20AC;&#x2122; destination brand for Wellington to promote the town as great place to live, work and visit. Youâ&#x20AC;&#x2122;ve got until Wednesday, September 27, 2017 at 5pm, to give your feedback in person or via councilâ&#x20AC;&#x2122;s website (www.dubbo. nsw.gov.au), about the draft design which was developed in-house by Dubbo Regional Council marketing and graphic design teams. Extensive research and consultation with targeted stakeholders in the Wellington community was conducted to create a logo, tagline, advertising campaign, signage ideas and more. Visit your local branch or go online to view the designs.

DAY OUT FOR A GOOD CAUSE

$'9(5725,$/

WHAT IS DEMENTIA? 'HPHQWLDLVWKHWHUPXVHGWRGHVFULEHWKH V\PSWRPVRIDODUJHJURXSRILOOQHVVHVZKLFK FDXVHDSURJUHVVLYHGHFOLQHLQDSHUVRQ¡V IXQFWLRQLQJ ,WLVDEURDGWHUPXVHGWRGHVFULEHDORVVRI PHPRU\LQWHOOHFWUDWLRQDOLW\VRFLDOVNLOOVDQG SK\VLFDOIXQFWLRQLQJ 7KHUHDUHPDQ\W\SHVRIGHPHQWLDLQFOXGLQJ $O]KHLPHU¡VGLVHDVHYDVFXODUGHPHQWLD IURQWRWHPSRUDOGHPHQWLDDQG/HZ\%RG\ GLVHDVH 'HPHQWLDFDQKDSSHQWRDQ\ERG\EXWLWLV PRUHFRPPRQDIWHUWKHDJHRI &XUUHQWO\WKHUHDUHPRUHWKDQ $XVWUDOLDQVOLYLQJZLWKGHPHQWLD

At UPA Dubbo Bracken House, September not only marks the start of Spring time, Ă RZHUVDQGZDUPZHDWKHU,WDOVRZKHQZH DFNQRZOHGJH'HPHQWLD$ZDUHQHVV0RQWK The theme of this yearâ&#x20AC;&#x2122;s celebrations is ´<28$5(127$/21(Âľ

SHRSOHOLYLQJZLWKGHPHQWLDIURPDNH\QRWH VSHDNHUUHSUHVHQWLQJ$O]KHLPHU¡V$XVWUDOLD

2Q)ULGD\6HSWHPEHUWKH FRPPXQLW\LVLQYLWHGWRYLVLW%UDFNHQ+RXVH DW0DFTXDULH6WUHHWDQGWDNHWKHWLPH to learn a little bit more about the life of

7KHUHZLOOEHVRPHWKLQJIRUHYHU\ERG\ZLWK DFWLYLWLHVWDNLQJSODFHDOOGD\LQFOXGLQJ performances by singer John Cook, a SHWWLQJ]RRRIIDUPDQLPDOVDQGDIUHH

2XUFDULQJVWDIIZLOODOVREHRQKDQGWR DQVZHUDQ\TXHVWLRQV\RXPD\KDYHDERXW GHPHQWLDUHWLUHPHQWYLOODJHVUHVLGHQWLDO FDUHKRPHFDUHDQGQXUVLQJVHUYLFHV

VDXVDJHVL]]OH %ULQJDORQJ\RXUIULHQGVDQGIDPLO\ FKLOGUHQDUHPRVWZHOFRPH DQGOHDUQ more about the single greatest cause of GLVDELOLW\LQROGHU$XVWUDOLDQV DJHG \HDUVRUROGHU DQGKRZZH FDQDOODVVLVWLQSURYLGLQJ a supportive, caring environment for those OLYLQJZLWKGHPHQWLD

For more information and to RSVP by Monday, September 11, 2017 please call UPA Dubbo Bracken House (02) 6884 4604.


14

September 7-13, 2017 Dubbo Photo News

Renowned illustrator to inspire budding artists at festival By YVETTE AUBUSSON-FOLEY WESTWORDSFEST 2017, being held in Dubbo next weekend, is an event to celebrate all things publishing – from the simple joy of reading to learning skills like book illustrating. Organisers, Outback Writers, have worked hard to bring leaders in their field to town for the event, including renowned Australian visual artist and illustrator, Graeme Compton. Families will be very familiar with Graeme’s work as illustrator on the children’s books of Dubbo-based author, Pat Clarke. Titles like “Howie the Yowie”, Return of the Fox” and “Elvira and the Pilliga Mouse”, all by Clarke, are beautifully illustrated by the artistry of Graeme. Since 2013, he has been collaborating with children’s authors, Alec Trost, Cherelle Fleming, Fred Strassberg, and many more, filling 12 books with his images. Born in Narrabri, Graeme fell in love with drawing from childhood and today he works professionally in his home studio completing commissions for portraiture and illustrations and holding regular classes and workshops. While in town on Saturday, September 16, Graeme will host a practical workshop at West-

WordsFest 2017 from 9.30am until 1p in Fantasy Art teaching tricks of the trade. Graeme’s subjects and styles are very broad so you can expect the unexpected, from fierce dragons to happy humans, oneeyed chooks to piano-crunching pachyderms. He works in graphite, ink, charcoal, acrylic or pixels. He has twice been a finalist for portraiture in the Mortimer Prize for Realism (2011-2012) and received the Grand Champion award for his work ‘Egret on Tap’ in the Gunnedah Art Exhibition 2013. Graeme is currently working on the sketches for an exhibition of his fantasy works, rks, along with a series of elephantised ephantised masters. Three of his larger works are featured ed in ‘Who’s Who in Visual isual Art - Masters off Realistic Imagery 20150152016’, compiled d by editor Ulrich Goette Himmelblau. Hee continues to draw cartoons artoons of elephants thumping mping pianos for the elucilucidation and inspiraration of his music sic students.

TRIVIA TEST 1

“Jessica” was an Australian miniseries based on a novel by which author?

2

One metric tonne equals how many kilograms?

3

Online email service Hotmail was given what new name?

4

Tabata Training was founded in which country by a scientist and fellow colleagues in physiology?

5

Which Australian band has an album named “Odysey No. 5”?

6

In what year did South Melbourne become the Sydney Swans?

7

Which band recorded the soundtrack to the first “Highlander” film?

8 9

What does the A in DNA stand for? Where would you find the ‘Big Pineapple’?

year did Australia first win 10 Inthewhat Rugby World Cup? TQ382. SEE THE TV+ GUIDE FOR ANSWERS.

WHERE ON GOOGLE EARTH ?

An example of Graeme’s fantasy work which he will discuss in a practical workshop at WestWordsFest 2017, Dubbo. PHOTO: SUPPLIED.

Where in our region is shown in this satellite image? Clues: All about driving; Oh what a…. ANSWER: SEE OUR TV+ GUIDE

OUTBACK WRITERS’ PRESENTS

FRI 15 – SUN 17 SEPTEMBER

MEET THE SPEAKERS SEAN WILLIAMS

FREE & TICKETED EVENTS SCIENCE & FANTASY FICTION THEME

G A L L E RY . M U S E U M . C A F E

RIK LAGARTO

GRAEME COMPTON

FRIDAY 15 SEPTEMBER 10am: Workshops 6.30pm: Outlook Café - Festival Launch 10pm: Stargazing, Dubbo Observatory

FOR THE FULL PROGRAM & LINKS VISIT: OUTBACKWRITERS.WEEBLY.COM

PAT CLARKE

SATURDAY 16 SEPTEMBER 9.30am: Registration 9.45am: panels, workshops, book signings. 7pm: Cosplay dinner (dress up!) Western Plains Cultural Centre SUNDAY 17 SEPTEMBER 10am: publisher readings, board gaming, WORKSHOP


15

Dubbo Photo News September 7-13, 2017

Spring Garden 8

A

$

B

C

EACH

OSTEOSPERMUM • 140mm pot. A Flower Power. B Copper Amethyst. C Blue Eye. (4-6) 9314372894084/2370/0574

3

$

3750

$

3

50

$

ASSORTED O TOMATO O SEEDLINGS

50

STRAWBERRY CO COLLECTION • 100mm pot. • Assorted varieties.

(1) 9323584087979

22

$

(2) 9323584099910 A

B

WOBBLE-TEE LAWN SPRINKLER • Waters up to 15m (DIA). • Also available - Top-Tee Sprinkler Head $15

C

(62,63) 9324742000045/52

SUDDEN IMPACT FERTILISER FOR LAWNS • 10kg. (55) 9315221061008

5

$

10

$

EACH

EARTHCORE CO AND NATUREGROW GARDEN RANGE • 25L. A Potting Mix. B Tomato & Vegetable Grow Mix. C Cow Manure. D D Garden Soil. E Chicken Manure. F Mushroom Compost.

SUGAR G C CANE MULCH BALE • Covers 10m2. (8) 9338456001106

E

F

5

“They know their stuff”

$

ON SALE Sept

17th - S u n d ay 17 e mb e r 2 0

EARTHCORE ALL-IN-ONE FERTILISER • 2kg. (7) 9315280552172

Don’t run out of gas this Winter!

WE 8.5KG SW SKU: 30373 AP ANY BRA ND

QUICK SWAP! 21.

$

95

64-70 MACQUARIE ST, DUBBO, PH 6882 6133 Terms and conditions apply. See instore for details. Products on sale until September 17th or until sold out. Limited stock.


16

September 7-13, 2017 Dubbo Photo News

2006 SUZUKI SWIFT ECONOMICAL, STYLISH, COMPACT S/N 8024

ECONOMICAL, READY FOR WORK, UNDER TRAY STORAGE S/N 8141

BLUETTO OTH TOOTH

ECONOMICAL, 4 CYLINDER, SIDE STEPS S/N 8015

FAMILY SIZED

TURBO DIESEL

$6,9 $6,990 990

$7,9 $7 $7,990 990

FORD TERRITORY SR

HOLDEN RODEO

AUTO, LEATHER TRIM, 7 SEATER S/N 8012

HONDA CRV SE

HOLDEN RODEO 2004

TURBO DIESEL, 4X4, READY FOR WORK S/N CC06FC

$9,9 $9,990 990 MITSUBISHI OUTLANDER ECONOMICAL, 4X4, ON DEMAND, CRUISE CONTROL, FAMILY SIZED S/N 7687

LOADED WITH EXTRAS

FAMILY SIZED

$

78pw

SUBARU FORESTER

HOLDEN COMMODORE

AWD, ECONOMICAL, ROOF RACKS & BULLBAR S/N 8005

LOW K’S, AUTO, FAMILY SIZED S/N 8128

Family Sized

$9,9 $9,990 990

$10,990 $10 990 990

TOYOTA RAV 4 CV

HYUNDAI iX35 HIGHLANDER

ECONOMICAL, AWD, CRUISE CONTROL, FAMILY SIZED & READY FOR DELIVERY S/N 7882

86pw

$16,990 $16 990 990

$17,990 $17 79 990 90 (M)

$19,9 $19,990 990 (O)

NISSAN NAVARA ST-X

MITSUBISHI TRITON

FORD RANGER 4X4

HYUNDAI IX35 ELITE 2013

TURBO DIESEL, 4X4, LOADED WITH EXTRAS S/N 8018

$

AUTO

$2 $22,990 22 990 22,9

TURBO DIESEL, TOOL BOXES, TOWBAR, READY FOR WORKL S/N 7830

98pw

$2 $22,990 22 990 (R) 22,9

$

106pw

$24,990 $24 $2 24 990 24 990 (T)

HOLDEN LTZ COLORADO 2013 TURBO DIESEL, AUTO, LOADED WITH EXTRAS S/N 8094

TURBO DIESEL, SUNROOF, AUTO, STYLISH S/N 8090

$

$13,9 $13,990 990 TURBO DIESEL, AUTO, 4X4, READY FOR WORK OR PLAY S/N 7924

AUTO

AUTO , SAT NAV, AWD, LOW K'S S/N 8095

$

86pw

$19,9 $19,990 990 (O) FORD RANGER TURBO DIESEL, 4X4, UPGRADED SUSPENSION, WARN WINCH S/N 7818

$

106pw

$24,990

$

110pw

(T)

$25 $2 $25,990 25,9 990 (U)

NISSAN NAVARA ST 2013

HOLDEN COLORADO 2014

TURBO DIESEL, LOW K’S, AUTO S/N 8117

TURBO DIESEL, 4X4, ELECTRIC BRAKES, READY FOR WORK S/N 8099 $ pw

$

134pw

146

$

150pw $31 $31,990 1,9 990

(A1)

NISSAN NAVARA ST

$34,990 $34 4 990 990 (A4) TOYOTA HILUX

TURBO DIESEL, 4X4, LOW K’S, CRUISE CONTOL, STEEL TRAY BODY S/N 7876 $ pw

TURBO DIESEL, 4X4, STEEL BULLBAR, TOW PACK, CUSTOM POWDER COATED TRAY BODY S/N 7890

$35,990 $35 35 5 990 990 (A5)

$36,9 $36,990 990 (A6)

150

$35,990

(A5)

$

154pw

F I N A N C E AVA I L A B L E T. A . P. Finance to approved purchasers based on 20% deposit at 10.99% over a 60 month term, including a $770 origination fee. Please use these payments as a guide only, all payments rounded up to the nearest dollar amount. Total (F) $10,990 (H) $12,990 (M) $20, 242 (O) $22,329 (Q) $24, 415 (R) $25,459 (T) $27,546 (U) $28,589 (W) $30,676 (Y) $32,763 (A1) $34,849 (A4) $37,980 (A5) $39,023 (A6) $$40,066 (A9) $43,197 Offer ends: 30/09/2017

HAVING TROUBLE WITH FINANCE? GIVE US A CALL TODAY 02 6885 5911 PENSIONER finance available T.A.P MD1391


17

Dubbo Photo News September 7-13, 2017

HOLDEN CAPTIVA

HOLDEN CRUZE

HOLDEN SPORTWAGON

AUTO, FAMILY SIZED, ECONOMICAL S/N 8016

V6, AUTOMATIC, FAMILY SIZED S/N 8073

$

$

$12,9 $12,990 990

$10,9 $10,990 990 (F)

(H)

$12,9 $12,990 990

MITSUBISHI TRITON GLX

HOLDEN COLORADO 4X4

MITSUBISHI TRITON GLX 2010

TURBO DIESEL, BLUETOOTH, 4X4, REVERSE SENSORS S/N 8026

TURBO DIESEL, TOWBAR, BULLBAR, ELECTRIC BRAKES S/N 7970

TURBO DIESEL, 4X4, SOLID STEEL TRAY STEEL BULLBAR & DRIVING LIGHTS S/N 8151

LOW KM’S

$2 $21,990 21,9 990

(Q)

2010 MITSUBISHI TRITON

FORD RANGER

TURBO DIESEL, AUTO, 4X4, LOCKABLE HARD COVER, BULLBAR, TOWBAR S/N 7688 $ pw

3.0L TURBO DIESEL, 4X4, LOADED WITH LOTS OF ARB EXTRAS S/N 7862

$25 $2 $25,990 25,9 990 (U)

$27,990 $27 27 990 990 (W)

ISUZU DMAX 2014

TOYOTA HILUX 4X4

$12,9 $12,990 990

146pw

$22,990 $22 $2 22 990 22 990

(A4)

$

98pw

(R)

$22,990 $22 22 9 990 90 (R) FORD RANGER S/CAB

2012 HOLDEN COLORADO TURBO DIESEL, AUTOMATIC, 4X4 S/N 8071

TURBO DIESEL, 4X4, HUGE STEEL TRAY TOWBAR S/N 7972

$

118pw

3.2 TURBO DIESEL, READY FOR WORK OR PLAY, LOADED WITH EXTRAS S/N 8061

$

126pw

$2 $29,990 29,9 990 (Y)

$27,990 $27 27 990 990 (W)

$

126pw

$29 $2 $29,990 29 90 (Y)

2012 TOYOTA PRADO GXL TURBO DIESEL, AUTO, 7 SEATER S/N 8025

$

150pw

LOW KM’S, 4X4, MANUAL, LOADED WITH EXTRAS S/N 7829

98pw

TURBO DIESEL, EQUIPPED FOR WORK & PLAY S/N 7755

$

MITSUBISHI TRITON VR

FORD KUGA TREND

$

FORD RANGER

118pw

TURBO DIESEL, 4X4 , STEEL TRAY, READY FOR WORK S/N 8089

$34,990

$12,990 $12 990 990 AUTO, TURBO, LOW K’S, REVERSE CAMERA S/N 8098

$21,990 $21 $2 21,9 990 9 90 (Q)

$

110

AUTO

94pw

94pw

$21,9 $2 $21,990 990

DUAL FUEL

$

$

V6, AUTOMATIC, HEAVY DUTY TOWBAR, READY FOR WORK S/N 8029

4X2, CANOPY, ALLOYS, READY FOR WORK S/N 8044

AUTO

94pw

50pw

2005 HOLDEN CREWMAN

HOLDEN RODEO

FAMILY SIZED, CRUISE CONTROL, HUGE BOOT S/N 7989

$

166pw

$35,990 $35 59 990 90 (A(A5)) TOYOTA HILUX SR

FORD RANGER 2014

TURBO DIESEL, 4X4, LOW K’S, OPTIONED WITH THE LOT S/N 7850

TURBO DIESEL, 4X4, AUTOMATIC S/N 8069

$

166pw

$

166pw

$3 990 (A9) $39,990

$3 990 (A9) $39,990

$39,9 $39,990 990

(A9)

14 BOURKE ST DUBBO wholesale911.com.au

A/H Damien Seton 0404 977 607 or Darren McGuire 0409 112 911 MD17391


18

September 7-13, 2017 Dubbo Photo News

COUNTRY TOP 10

LOVE YOUR WORK

TW | LW | TITLE | ARTIST 1

1 Men Of Country 2017

2

2 Ripcord

3

5 So Country 2017

VARIOUS KEITH URBAN

VARIOUS

4 12 The Glen Campbell Collection

Sorkheng Seb Company: Peter & Angela’s Gourmet Takeaway Position: Owner I got involved in business... Because I wanted to have my own business Our business is known for... The best barbecue chickens, and fish and chips in town Our bestselling product is... Hamburgers, kebabs and salads My role in the business is… Cooking and serving customers I manage... My staff and stock According to my staff, working for me is... A dream I spend my down time... With my lovely kids and family I’m inspired by… My loyal customers On my beside table is… A family photo, iPad and books In my opinion, the biggest issue facing small business is... Working long hours My secret to success is... Fabulous takeaway food and service I’m most proud of... My family If I could, I’d tell my 20-year-old self that... I would be a successful business woman The best piece of career advice I can offer is... Work hard and do not give up And if I wasn’t in my current role, I’d... Be a solicitor

GLEN CAMPBELL

5

3 Count On Me

6

9 Glen Campbell’s Twenty Golden Greats

7

4 Hit Country 2017

JUDAH KELLY GLEN CAMPBELL VARIOUS

8

7 The Great Country Songbook Vol. II

9

6 Montevallo

ADAM HARVEY & BECCY COLE SAM HUNT

10 10 Greatest Hits SHANIA TWAIN

IN BRIEF

National Stroke Week is time to learn to think F.A.S.T. A THOUSAND more strokes have taken place in 2014 in our electorate than the national average and currently over 130,000 people are at risk due to high blood pressure and cholesterol, irregular heartbeat and physical inactivity. National Stroke Week is on until Sunday, September 10 highlighting the Think F.A.S.T. and act FAST stroke response. F.A.S.T. stands for Face, Arms, Speech and Time. Check the person’s face. Is their mouth drooping? Can they lift both arms? Is their speech slurred? Do they understand you? Almost 1.9 million brain cells die each minute during a stroke so time is critical. Call 000 immediately.

Can you, in eight moves, turn the top word into the bottom one? You may alter only one letter at a time to make another word. We have entered the centre word to keep you on the right track.

W

I

N

D

PHOTO: DUBBO PHOTO NEWS/ SARAH HARVEY

B

U

N

G

G

U

S

T

© australianwordgames.com.au 186

G O O D F O O D . G O O D C O F F E E . G O O D C O M PA N Y

I t ’ s w h at w e d o at T h e G r a p e v i n e This is our Lasagne – a best seller during the colder months at The Grapevine. It’s mouth-watering food like this that makes The Grapevine one of Dubbo’s favourite cafes. It’s where friends meet and where business meetings thrive. :LY]PUNNYLH[JVɈLLIYLHRMHZ[IY\UJOS\UJOHUKSPNO[HM[LYUVVU[LH¶ZL]LUKH`Z H^LLR6^ULYZ;PT 2PT/V\NO[VUPU]P[L`V\QVPU[OLTH[;OL.YHWL]PUL[VKH`

Eat in or takeaway. Enjoy! 144 BRISBANE ST 6884 7354


19

Dubbo Photo News September 7-13, 2017

SNAPSHOT CONNECTING COUNCIL AND THE COMMUNITY IT SERVES

9 SEPTEMBER

12 SEPTEMBER

Local Government Elections

The Merchant of Venice at the DRTCC at 7:30pm Tickets available at drtcc.com.au

9 SEPTEMBER 2017

PUBLIC NOTICES

PUBLIC EXHIBITION OF DRAFT WATER CONNECTION, BACKFLOW PREVENTION AND PRICING POLICY Dubbo Regional Council is inviting comment on the draft Water Connection, Backflow Prevention and Pricing Policy. The draft Policy, if adopted, may affect owners of Strata/ Community Plan properties in relation to Council’s billing for water usage within these developments. The draft Policy can be viewed at the following locations: • Council website at dubbo.nsw.gov.au • Council’s Dubbo Civic Administration Building, Church Street, Dubbo • Macquarie Regional Library, Dubbo Branch, corner Macquarie and Talbragar streets, Dubbo • Council’s Wellington Civic Administration Building, corner Nanima Crescent and Warne Street, Wellington Written or electronic submissions are invited during the exhibition period. Written submissions are to be addressed to Mr Mark Riley, General Manager, Dubbo Regional Council, PO Box 81, Dubbo or by email council@dubbo.nsw.gov.au and will be received up to 29 September 2017 at 5:00 pm. For further information, please contact Council’s Customer Service Centre on (02) 6801 4000 or visit Council’s website at dubbo.nsw.gov.au

PUBLIC EXHIBITION OF PLANNING PROPOSAL SUBJECT LAND: LOT 399 DP 199356, LOT 12 DP 1207280 AND Lot 503 DP 1152321, Boundary Road, Dubbo PROPOSAL:

APPLICANT:

To undertake amendments to the Dubbo Local Environmental Plan 2011 in respect of the subject land (including an associated amendment to the Stage 1 Structure Plan for the South-East Residential Urban Release Area)

Make sure you have your say on the Wellington destination brand.

DESTINATION BRAND TO PROMOTE WELLINGTON AS A GREAT PLACE TO LIVE, WORK AND VISIT Dubbo Regional Council is inviting the community to have their say on a destination brand for Wellington. The destination brand was developed after extensive research and consultation with targeted stakeholders in the Wellington community, including businesses, industry groups, residents, community and cultural leaders and tourism operators, Council’s Manager Economic Development and Marketing, Josie Howard, said. “The development of a standalone destination brand for Wellington has long been a priority and was identified in several of the former Wellington Council

Throughout September, Council is offering all residents in the region the chance to win prizes and learn what it takes to be a great pet owner.

The Planning Proposal has sought to undertake the following amendments to the Dubbo LEP 2011 in respect of the subject land:

Council’s Manager Environmental Control, Debbie Archer, said there are terrific prizes up for grabs compliments of local sponsors in the annual Pets Month Photo Competition and the Pets Month Colouring-in Competition.

A draft amendment to the Stage 1 Structure Plan is exhibited concurrently to ensure the Structure Plan is consistent with the proposed amendments as included in the Planning Proposal.

“We would love you to share pictures of your animals that make you smile, so whether your pet has feathers, fur, fins – or something else – you can enter a photo and be in with a chance of winning,” Ms Archer said. Council’s Rangers will be rewarding those who are seen doing the right thing.

Written or electronic submissions are invited during the public exhibition period.

LOCAL GOVERNMENT ELECTIONS

Please not that, in accordance with the Person Information Protection Act 1998, written submissions received by Council containing personal information may be made public when the matter goes before Council for consideration, as it may be included in Council’s Business Papers. Persons have the right to remain anonymous if they so choose by refraining from submitting their personal information, however, the submission may be given less weight in the overall assessment and consideration of the draft Amendment.

The NSW Local Council Elections will be held on Saturday 9 September 2017 where polling venues will be open from 8.00am to 6.00pm for community members to lodge their vote.

For more information please contact Council’s Strategic Planning Services Branch on (02) 6801 4000.

To provide feedback on the concept developed visit Council’s website dubbo.nsw.gov.au, Council’s administration buildings or Visitor Information Centres in Dubbo and Wellington. The public exhibition period will close on Wednesday 27 September 2017 at 5.00pm.

Dubbo Regional Council’s Pet Month has kicked off in a bid to educate residents about their responsibilities as pet owners.

Notice is hereby given of the public exhibition of a Planning Proposal that seeks to amend the Dubbo Local Environmental Plan 2011 (Dubbo LEP 2011).

A copy of the Planning Proposal can be obtained from Council’s website or from the Dubbo Civic Administration Building.

The brand and some concept marketing material has been placed on public exhibition and Council wants to hear from the community about their thoughts on the brand presented and its flexibility across the visitation and investment markets.

PETS MONTH SET TO EDUCATE COMMUNITY

MAAS Group Properties

The Planning Proposal and supporting documentation will be on public exhibition during normal office hours (9.00am to 5.00pm) at Council’s Dubbo Civic Administration Building, corner Church and Darling Streets, Dubbo and the Macquarie Regional Library, Macquarie Street, Dubbo from Thursday 31 August 2017 to Friday 29 September 2017. The information will also be available on Council’s website at dubbo.nsw.gov.au.

strategies and research papers.”

Dubbo Regional Council was formed on 12 May 2016 following the merger of the former Dubbo City and Wellington councils. Upon the announcement of the newly formed Council, the then Minister of Local Government, Paul Toole, also announced that the new Council area would

For more details about the photo and colouring in competitions as well as great tips for looking after your pet, visit dubbo.nsw.gov.au/pets-month.

include five wards; Central, East, North, South and Wellington. The location of polling venues will be provided by the Electoral Commission of NSW and are available at votensw.info. It is important that you ensure that you are able to vote for the ward you are registered in at your proposed polling venue. For more information, go to dubbo.nsw.gov.au.

For more information regarding the above, phone Dubbo Regional Council on (02) 6801 4000 or head to our website dubbo.nsw.gov.au


20

September 7-13, 2017 Dubbo Photo News

IN FOCUS

YOUR PHOTOS, YOUR NEWS send your contributions to photos@dubbophotonews.com.au mail 89 Wingewarra St, Dubbo NSW 2830 phone 6885 4433 fax 6885 4434

Inner Wheel plays Guess Whose Shoes

THE THUMBS Thumbs up to Aaron from & &Thumbs up to everyone at Macquarie Appliances for offering Dubbo City Toyota for their excelexcellent prompt warranty service in servicing a near-new oven for a very happy Dubbo Photo News reading family. Thumbs down to the Dubbo ' Regional Council. Rather than waste $10 million on the Cobra/ Fitzroy junction at $1 per trip hazard they could fix 10,000,000 footpath trip hazards. That would fix most of them. Thumbs up to Ben and & Staff at Blooms West Dubbo Pharmacy for the expert advice, friendly service a big thank you Thumbs up to the ‘World & According To’ column in the Dubbo Photo News. With these kids in the world there is hope for the future. Thumbs down to the DDSA ' officials who thought it clever to disqualify a 15 year-old team from the semis for running late. One game finished at 1.45pm in Dubbo the other due to start in Wellington at 2pm - it doesn’t add up. Thumbs up to the bowser & attendant at Inland Petroleum, your service was wonderful!

'

Thumbs down To the Wellington businesses who do not return calls to potential customers. They are obviously not worried about their businesses in the future.

lent service given when we went to purchase a vehicle. They were very professional. To Jimmy and the team, we very much appreciate it. Thumbs up to David and & staff of Uncle Pete’s Toys for excellent aftersales service in replacing netting and a jumping matt on a near-new trampoline for a very happy Dubbo Photo News reading family. You really did go the extra mile. Thumbs up to Mark & Kelly & at Dubbo Meat and Seafood centre I recently had a gathering for 80 people there and the selection of food was amazing. The meat and seafood was out of this world, as was their professionalism. A triple thumbs up. Thumbs up to Jodie and & all the girls at Early Settlers for finding my dog, she was microchipped , so once she was scanned the owner was found . The dog’s name is Chloe, I’m ever so grateful Chloe was found and is now safe at home. Thumbs down to those who ' keep bringing party politics into

Thumbs up to Megan at & Orana Mall Pharmacy. Thank

local Council elections. This type of thing does not promote for a cohesive type Council where all will work together for the good of Dubbo Region like our most recent past group of councilors appeared to do. Back to the bad old days?

you for all your help with the eye drops, much appreciated Megan. Thank you.

Thumbs up to Cath, Nicole & and Jamie at DOnut King Orana

Thumbs up to Perry at Mitre & 10 Plumbing for going way be-

Mall. Thank you ladies for a wonderful experience everytime I buy a coffee.

yond duty to deliver excellent service. Many thanks. Thumbs up to Rodney at & the State Rail Booking Office for being so helpful and giving me a huge amount of information about trips available through State Rail. Thank you very much

&

Thumbs up to all the staff at Kings Hall Jewellers. Every time I go in there I am greeted with a friendly smile and great customer service by all the staff. Well done to you all. Thumbs up to Saddler & Co & for good old fashioned service.

COMMUNITY service group Dubbo Inner Wheel Club holds monthly dinners to discuss fundraising programs, socialise and have a bit of fun, as pictured here during a ‘guess whose shoes’ contest recently. Find out more at a meet and greet this Saturday, September 9, at the back of Myer between 11am and 1pm. PHOTO: SUPPLIED.

Paris Underground Encore at DRTCC Photos by LAURA MCINTYRE DUBBO Regional Theatre and Convention Centre presented Paris Underground Encore on Saturday, August 26. The Convention Centre was transformed into a grand Parisian candle-lit cabaret setting where 250 patrons enjoyed astounding magic, burlesque, illusion, spectacular dance and circus acts. Madotti and Vegas promised to return in 2019 with an even more spectacular show due to audience demand.

Linzi Aland-Berkley and Paul Berkley

Kate Griffiths, Darcy Ryder and Lucy Spackman

Thumbs down to the can' didates who are playing party politics for Council elections. We want the best possible people for our Council, not someone who only wants to use the Council for higher level of Government. Party politics have destroyed Councils in the past and could do so again.

)

Janet and Ian Elliott

Audrey Sokolowski, Sarah Trebley, Julia Brougham and Annie Kicinski

Hannah Soole and Cheryl Burke

●●●

Send your Thumbs up or Thumbs Down via email to photos@dubbophotonews.com.au, mail to 89 Wingewarra Street Dubbo NSW 2830, phone 6885 4433 or fax 6885 4434.

Managing Director Tim Pankhurst

Journalist Yvette Aubusson -Foley

Journalist John Ryan

Journalist Natalie Holmes

Sports “Mann” Geoff Mann

Sports Photographer Mel Pocknall

Graphic Designer Rochelle Hinton

Graphic Designer Hayley Ferris

Sales Consultant Frances Rowley

Sales Consultant Kathy McAneney

Sales Consultant Donna Falconer

Photographer Sarah Harvey

Photographer Wendy Merrick

Photographer Greg Marginson

Photographer Brenda Hutchins

Photographer Morgan Williams

Published by Panscott Media Pty Ltd (ABN 94 080 152 021) General disclaimer: The publisher accepts no responsibility for letters, notices and other material contributed for publication. The submitter accepts full responsibility for material, warrants that it is accurate, and indemnifies the publisher against any claim or action that may arise from its publication. All advertisers, including those placing display, classified or advertorial material, warrant that such material is true and accurate and meets all applicable laws and indemnifies the publisher against all liabilities that may arise from the publication of such material. Whilst every care is taken in preparing this publication, we cannot be held responsible for errors or omissions. Opinions expressed in this publication are not necessarily those of the publisher. The editor, Tim Pankhurst, accepts responsibility for election comment. Articles contain information of a general nature – readers should always seek professional advice relevant to their particular circumstances. Complaints: Panscott Media has a policy of correcting mistakes promptly. If you have a complaint about published material, contact us in writing. If the matter remains unresolved, you may wish to contact the Australian Press Council. © Copyright 2017 Panscott Media Pty Ltd. Copyright in all material – including photographs and advertisements – is held by Panscott Media Pty Ltd or its providers and must not be reproduced in any form without prior written permission from the Publisher.


21

Dubbo Photo News September 7-13, 2017

OPINION, ANALYSIS, FEATURES, DEPTH.

Stephen Lawrence, Kevin Parker, Kris Stevens, John Ryan. PHOTO: DUBBO PHOTO NEWS/WENDY MERRICK

Council election day is Saturday, September 9. By YVETTE AUBUSSON-FOLEY AFTER a momentous wait for a democratic election of the Dubbo Regional Council the day has finally come. If you haven’t heard, the amalgamated local government area is now divided into five wards: • Central Ward • South Dubbo Ward • North Dubbo Ward • East Dubbo Ward • Wellington Ward

Group B: • John Ryan (journalist) • & Joshua Black Below the line Greg Matthews (Self-employed, nominated by radio station DCFM88.9, Member of the National Party) Kris Stevens (Member of the Greens)

EAST WARD

WHO ARE THE CANDIDATES?

Above the Line Group A: • Dayne Gumley (Member of the Liberal Party, on Team Shields) • & Lisa James (no party affiliation) Group B: • Stephen Lawrence (County Labor Party member, Barrister for NSW Bar Association) • & Cody Jones (Country Labor Party member, Diploma of Community Services Work) Below the Line • Ana Patemen (CEO, Western Student Connections, no party affiliations) • Chris Edwards (Chairman Harness Racing NSW, Eumungerie Coboco RSL, Dubbo Show Society)

CENTRAL WARD

NORTH WARDS

Above the Line Group A: • Vicki Etheridge (Support worker at Westhaven, no political party affiliation, on Team Shield’s team) • & Nicki Catelotti (self-employed, registered Liberal Party member)

Above the Line Group A: • Ben Shields (radio producer, councillor 17 years, deputy mayor 2012-2016, self employed, Liberal party member) • & Tyler Przerada (No political party, self-employed)

HOW DO I FIND MY WARD? To find your ward, visit, map.elections. nsw.gov.au, the Macquarie Regional Library has free computers if you need internet access. WHO CAN I VOTE FOR? Only for people standing for your ward. WHAT AM I VOTING FOR? Ten councillors who will work hard to better the local government area, Dubbo Regional Council.

Group B: • Merrilyn Mulcahy (No political party, retired) • & Nathan Ellis (Liberal party member, related to Shields partner) Below the Line • Jane Diffey (No political party, real estate agent, Dubbo Show Society, D&D Preschool, Clare’s Angels, Orana Early Childhood Centre)

SOUTH WARD Above the Line Group A: • Greg Mohr, Wongarbon (Liberal party members, former Dubbo City Councillor) • Shayne Stiff (no political party, bookmaker) Below the Line • Manny Portelli (no political party, self-employed practicing accountant) • Doug Prior (no political party, piano technician) • Kevin Parker (National Party, banker)

WELLINGTON WARD • Anne Jones (No political party, self employed accountant) • Mark Griggs (No political party, photo journalist) • Michael Augee (Country Labor, Wellington Deputy Mayor 2004-2012) • Adam Ryan (no political party, teacher) • Jacob Perry (NSW Nationals, tradesman) • David Grant (no political party, insurance agent)

HOW TO VOTE

When you arrive at your polling booth, you will be advised which ward you are in. You will then be given a ballot paper relating to your ward. In most wards you will have group of candidates above the line, and independent candidates below the line. You can only vote for a maximum of two people. Above the line If you cast your vote above the line, all you need to do is put the number ‘1’ inside one ‘group’ box you prefer. This makes your vote formal. In reality you have used both your preferences in the one vote by selecting the group (ie two people). You must: • Use the number ‘1’ only once • Use the number ‘1’, not the word • Put the number in the box provided, not beside a candidate’s name at the end • A tick (✓) or cross (x) on its own is counted as 1, Above the Line. Below the Line If you cast your number ‘1’ vote below the line, and you wish to use your second vote, then your number ‘2’ vote must also be below the line. However, it is not compulsory to show a second preference. Where there are just two councillors to be elected (as for each ward) a vote will still be formal if just one below the line candidate has been voted for with the number ‘1’.


22

September 7-13, 2017 Dubbo Photo News

7 DAYS • ANALYSIS OF THE WEEK’S NEWS

Call for royal commission over water thefts John Ryan ❚ OPINION & ANALYSIS Send your news tips to john.ryan@panscott.com.au or 0429 452 245 txt is best

A river runs through us THERE was standing room only as about 100 people filled the meeting room at the Garden Hotel on Monday night, calling for a Royal Commission into the alleged mishandling of public money through the Murray Darling Basin Plan. Dubbo Macquarie Bushcare’s Mel Gray, the driving force behind the Dubbo event, said the roll-up “exceeded all expectations”. She told the crowd how important it was that the struggling Darling Barwon River had enough water in the system to ensure constant connectivity with the Macquarie River via the iconic, and heritage listed, Macquarie Marshes. “There are breeding sites for birds that come from the other side of the world – it’s hard enough to fly on a plane from the other side of the world, let alone using your arms,” Ms Gray said. “A healthy river is a resilient river that can handle times of drought and bounce back as strong as ever. “We have a responsibility to speak up for the health of our river,” she said. The meeting was held under the backdrop of existing claims of mass water theft along the Barwon River, and more recent allegations of illegal groundworks near Goondiwindi along the MacIntyre River for the purposes of backing up flood waters for unmetered harvesting. River ecologist Bill Johnson was a member of Monday night’s panel, his words on ABC national TV from a week ago resonating with local fears. “Even though that’s a big operation it is still only one of many and there are many on the Macintyre River, there are many on the other rivers in the northern basin – all of those rivers in an arc, from the Paroo, the Condamine, Barwon, all the way around in a big circle down to the Macquarie near Dubbo, flow into the Barwon-Darling,” Mr Johnson said. “This sort of work is happening on all of those flood plains right across the northern basin so it’s profoundly significant. “It is unacceptable that with Barnaby Joyce holding both the Water and Agriculture portfolios, we are faced with a situation where fox is in charge of the henhouse,” he said. Inland Waterways David Harris runs the River Repair Bus and told the crowd how all disruptions of the natural processes, including water theft and artificial river barricades, had been decimating the numbers of native fish for decades.

Carp to be killed and evaluated RESEARCH to better understand the economic impact of carp and expected benefits and costs associated with carp control in Aus-

It was standing room only at the Garden Hotel on Monday, September 4, when stakeholders met to call for a Royal Commission into the Murray Darling Basin Plan mishandling of public money. PHOTO: DUBBO PHOTO NEWS

tralia is now underway to inform development of a plan for the control of the pest fish species in Australia. Principal Investigator Dr Peter Chudleigh of Agtrans Research says the project will consider both market-related issues such as changes in water treatment costs, and non-market costs and benefits such as changes in recreational fishing experiences and biodiversity. “We will identify the benefits and costs to different industries and community groups relating to reducing carp numbers,” says Dr Chudleigh.

Pre-poll fight A FAIR scuffle across the road from Dubbo pre-poll booth was a source of interest on Monday morning. Two police were in a dicey situation, using capsicum spray to keep potential attackers off their backs as they attempted to arrest two people. I was over the road and dashed across Macquarie Street in case police needed help, glad to see council candidates Greg Mohr and Dayne Gumley hard on my heels. In the end police reinforcements arrived quickly including western region commander Geoff McKechnie – that impresses me when a boss boasting the rank of assistant commissioner runs to a fight to back up his troops.

White balloons not luft balloons TOMORROW (Friday, September 8) Wellington Information and Neighbourhood Services will be holding a White Balloon Day; it’s all about helping kids to keep safe. The event is to raise awareness of how important it is to support

Daniel Conn is OK and the girls were impressed. The former NRL player was in Dubbo on Monday with the R U OK? Conversation Convoy, which is on a six-week journey around Australia’s cities and regional towns, raising awareness of suicide prevention. The Convoy also acts as a platform for local mental health support services. PHOTO: DUBBO PHOTO NEWS

survivors of child sexual assault. Morning tea will be at 10am – that’ll cost you a gold coin donation and while you’re there you can try your luck with the lolly-jar guessing competition.

Stem Schools hit town TWO preschools in Dubbo will be among the first in Australia to be introduced to science, technology, mathematics and engineering (STEM) through play-based digital learning program. Parkes MP Mark Coulton said the preschools were among 100 selected to be part of a nationwide pilot. “These preschools will receive free workshops and will be the first to use the ELSA apps and resources to incorporate STEM practices into their preschool program,” Mr Coulton said. “We want to help children ex-

plore new ideas and skills in science, technology, engineering and math that will in turn boost their literacy and numeracy.” Mr Coulton said the first app will introduce the concepts of sorting, ordering, patterns and representations through activities including creating decorations and organising food onto different plates, all within the theme of ‘celebration’.

Domestic violence pathways DOMESTIC and family violence victims living in the Orana Local Area Command (LAC) will now have a single contact point to access the support they need with the commencement of a new Safer Pathway site this month. Minister for Police and Member for Dubbo Troy Grant and Minister for the Prevention of Domestic Violence and Sexual Assault Pru

Goward announced today that Safer Pathway will become operational this month with the first Safety Action Meeting (SAM) taking place on Thursday, September 21, at Dubbo Police Station.

Full stop OFFICERS from Western Plains Traffic and Highway Patrol have been targeting risky driver behaviour at level crossings in support of a campaign in the state’s Central West this week. The enforcement campaign is aimed at reinforcing level crossing safety in the area around Wellington with a particular focus on Mumbil and Stuart Town. The campaign will continue until September 15, 2017. ■ z Send your news tips to john.ryan@panscott.com.au or 0429 452 245 txt is best


Dubbo Photo News September 7-13, 2017

WANT TO BETTER UNDERSTAND THE STATE OF THE NATION? HERE ARE JUST A FEW OF MANY GOOD BOOKS THAT PROVIDE A WIDE INSIGHT.

From the bookshelves

by Dave Pankhurst The Book Connection, Dubbo

They couldn’t run water downhill Our world is a mess and those in charge have ĞŝƚŚĞƌŶŽĂďŝůŝƚLJŶŽƌŝŶƚĞŶƟŽŶƚŽĮdžŝƚ͘tĞ ŚĂǀĞƚŽĂƐŬƚŚĞƋƵĞƐƟŽŶ͕ǁŚŽŝŶƚŚĞtĞƐƚĞƌŶ tŽƌůĚŽĨǁŚŝĐŚƵƐƚƌĂůŝĂƚŚŝŶŬƐŝƚŝƐƉĂƌƚ ƚŚĞƌŽĨ͕ŝƐŐŽŝŶŐƚŽĐŽƌƌĞĐƚƚŚĞƐŝƚƵĂƟŽŶ͍ In Jared Diamond’s Ŭ͞ŽůůĂƉƐĞ͟ several countries including ours are ĂŶĂůLJƐĞĚ͘dŚĞĐŚĂƉƚĞƌ ƌĞůĂƟŶŐƚŽƵƐďĞŐŝŶƐ with “Mining in the ůŝƚĞƌĂůƐĞŶƐĞʹŝ͘Ğ͘ƚŚĞ ŵŝŶŝŶŐŽĨĐŽĂů͕ŝƌŽŶ etc – is the key to ƵƐƚƌĂůŝĂ͛ƐĞĐŽŶŽŵLJ ƚŽĚĂLJ͘͟tĞĂƌĞ ĞdžƉŽƌƟŶŐĐŽĂůƚŽ ŽƚŚĞƌĐŽƵŶƚƌŝĞƐƚŚĂƚƵƐĞŝƚƚŽŽƉĞƌĂƚĞ ƐƚĞĞůƉƌŽĚƵĐƟŽŶƚŽƐĞůůďĂĐŬƚŽƵƐĂŶĚ ŐĞŶĞƌĂƚĞƚŚĞŝƌŽǁŶĞůĞĐƚƌŝĐĂůƉŽǁĞƌ͕LJĞƚǁĞ ĐůŽƐĞĚŽƵƌƐƚĞĞůŵŝůůƐ͕ĂŶĚŝŶƚŚĞŝŶƚĞƌĞƐƚŽĨ ůŽǁĞƌŝŶŐĐůŝŵĂƚĞĞŵŝƐƐŝŽŶƐ͕ĐůŽƐĞĐŽĂůƉŽǁĞƌ ƐƚĂƟŽŶƐ͘ŶĚƚŚĞƉƌŝĐĞŽĨĞůĞĐƚƌŝĐƉŽǁĞƌ ĐŽŶƟŶƵĞƐƚŽƌŝƐĞ͘tĞĞdžƉŽƌƚŐĂƐƚŽĐŽƵŶƚƌŝĞƐ ĂƚůŽǁƉƌŝĐĞƐ͕LJĞƚĐŚĂƌŐĞƉŽǁĞƌƐƚĂƟŽŶƐŚĞƌĞ ĂƉƌĞŵŝƵŵ͘:ĂƌĞĚŝĂŵŽŶĚƐƵŵŵĂƌŝnjĞƐƚŚĞ ĐŝƌĐƵŵƐƚĂŶĐĞƐƚŚĂƚĂƐĂƐŽĐŝĞƚLJ͕ǁĞĞŝƚŚĞƌ ĐŚŽŽƐĞƚŽĨĂŝůŽƌƐƵƌǀŝǀĞ͘ ĞŝƚŚĞƌĞŽƌŽǀĞƌƐĞĂƐ͕ƚŚŽƐĞǁŚŽŚĂǀĞƚŚĞ ƉŽǁĞƌƚŽďĞĞīĞĐƟǀĞĂƌĞŝŶƚŚĞƚŽƉϭй͘ :ŽƐĞƉŚ^ƟŐůŝƚnjŝŶŚŝƐŬ͞dŚĞ'ƌĞĂƚŝǀŝĚĞ͟ ŚŝŐŚůŝŐŚƚƐƚŚĞŝŶŇƵĞŶĐĞŽĨƚŚĞdŽƉϭй͘dŚĞƌĞ ŝƐĂĐŚĂƉƚĞƌŽŶƚŚŝŶŬŝŶŐďŝŐͲ͞dŚĞdŽƉ ϭй͕ďLJƚŚĞϭй͕ĨŽƌƚŚĞϭй͘͟WƵƚƉŽůŝƟĐŝĂŶƐ͕ ďĂŶŬĞƌƐ͕ŵĂũŽƌ businesses and media ŝŶƚŚĞĨƌĂŵĞĂŶĚƚŚĞLJ ƚŚŝŶŬŽĨƚŚĞŵƐĞůǀĞƐ ĂůŽŶĞ͕ƉĂƌƟĐƵůĂƌůLJ when it comes to not being legally ŽƌĐŽŶƐƟƚƵƟŽŶĂůůLJ ĂĐĐŽƵŶƚĂďůĞĨŽƌƚŚĞŝƌ ĂĐƟŽŶƐ͘ŌĞƌĂůů͕ŝĨ ĐĂƵŐŚƚƚŚĞLJũƵƐƚƌĞƟƌĞ ŽŶŵƵůƟͲŵŝůůŝŽŶĚŽůůĂƌ ƉĂLJŽƵƚƐ͘ŝĚLJŽƵƌĞĂĚ ƌĞĐĞŶƚůLJƚŚĞ:ĞīĞnjŽƐ͕ŚĞĂĚŽĨŵĂnjŽŶ ǁĂƐĨŽƌŽŶĞĚĂLJ͕ƚŚĞǁŽƌůĚ͛ǁĞĂůƚŚŝĞƐƚ ƉĞƌƐŽŶ͍ŶĚƐŽŵĂŶLJŚĂǀĞǀŽƚĞĚĨŽƌŚŝŵǁŝƚŚ ƚŚĞŝƌĐƌĞĚŝƚĐĂƌĚ͘͞dŚĞWƌŝĐĞŽĨ/ŶĞƋƵĂůŝƚLJ͟ ďLJ:ŽƐĞƉŚ^ƟŐůŝƚnjƐƵŵŵĂƌŝƐĞƐƚŚĞƌĞƐƵůƚƐŽĨ ŚŽǁƚŚĞŝŶŝƟĂƟǀĞƐŽĨƚŚĞdŽƉϭйǁŝƚŚƚŚĞŝƌ ŵĂĐƌŽĞĐŽŶŽŵŝĐƐĂŶĚŵŽŶĞƚĂƌLJƉŽůŝĐŝĞƐŚĂǀĞ ŚƵƌƚƚŚĞϵϵй͘ ƌĞĐĞŶƚ&ŽƵƌŽƌŶĞƌƐdsƉƌŽŐƌĂŵĨĞĂƚƵƌĞĚ ƚŚĞƐŽͲĐĂůůĞĚŝůůĞŐĂůƉƵŵƉŝŶŐŽĨǁĂƚĞƌĨƌŽŵ ƚŚĞDƵƌƌĂLJͲĂƌůŝŶŐƐLJƐƚĞŵ͘/ƚǁĂƐĂŶĞdžĂŵƉůĞ ŽĨƚŚĞǁĂLJŵĞĚŝĂƉƌŽƉĂŐĂŶĚĂŝƐƵƐĞĚƚŽ ƐĞůĞĐƟǀĞůLJƉƌŽŵŽƚĞƚŚĞŝƌĂŐĞŶĚĂ͘dĂůŬŝŶŐƚŽ ĨĂƌŵĞƌƐŝŶƚŚĞƌĞǁĂƌƌŝŶĂĂƌĞĂ͕ĂŶĚŽƚŚĞƌƐŽŶ ƚŚĞĂƌǁŽŶZŝǀĞƌŶĞĂƌtĂůŐĞƩ͕ŵƵĐŚŽĨƚŚĂƚ ǁĂƚĞƌǁĂƐƉƵŵƉĞĚŝŶƚŽƐƚŽƌĂŐĞĚƵƌŝŶŐƚŚĞ

ϮϬϭϲŇŽŽĚͲŇŽǁƐ͘dŚĞ ΨϭϯďŝůůŽŶƉƌŝĐĞ ƚĂŐƵƐĞĚ ďLJƚŚĞŽŶƚŚĞŝƌ ƉƌŽŐƌĂŵǁŝŶƐƚŚĞŝƌ ƐƵƉƉŽƌƚŝŶŵĞƚƌŽƉŽůŝƚĂŶ areas and does nothing ƚŽŵŽƟǀĂƚĞƉŽůŝƟĐŝĂŶƐ to use the dollars ĞīĞĐƟǀĞůLJ͘,ŽǁĚŽĞƐ ƚŚŝƐŵŽŶĞLJƐƚŽƉƚŚĞ >ĂĐŚůĂŶZŝǀĞƌŇŽŽĚŝŶŐ ŚƵŶĚƌĞĚƐŽĨƐƋƵĂƌĞ ŬŝůŽŵĞƚĞƌƐĨŽƌĂ ĨĞǁ ŵŽŶƚŚƐ͕ ĂŶĚǁŚĞƌĞǁĂƐƚŚŝƐǁĂƚĞƌƐƚŽƌĞĚ ĨŽƌƚŚĞ^LJƐƚĞŵ͍/Ŷ͞dŚĞZŝǀĞƌ͟ďLJŚƌŝƐ ,ĂŵŵĞƌǁĞƌĞĂĚŽĨůŝĨĞ ĂůŽŶŐƚŚĞ ĂƌůŝŶŐ ZŝǀĞƌƐLJƐƚĞŵ͘tŝƚŚĂƐŽƵƌĐĞŝŶYƵĞĞŶƐůĂŶĚ͕ ƚŚĞWĂƌŽŽZŝǀĞƌƌĂƌĞůLJŇŽǁƐŝŶƚŽƚŚĞ ĂƌůŝŶŐ ʹŝĨLJŽƵĂƌĞ ĂŶ ŝƌƌŝŐĂƚŽƌŝŶYƵĞĞŶƐůĂŶĚ͕ ǁŝƚŚĂ ŶƵŵďĞƌŽĨůĞǀĞĞƐ͕ĂŶĚƐƚĂƚĞůĞŐŝƐůĂƟŽŶĂůůŽǁƐ ĨĂƌŵĞƌƐƚŽƉƵŵƉǁĂƚĞƌǁŝƚŚĚŝƐƌĞŐĂƌĚĨŽƌƚŚĞ ĚŽǁŶƐƚƌĞĂŵĞīĞĐƚƐ͘ ĂŶďĞƌƌĂƚĂůŬƐŽĨƚŚĞ ^ŶŽǁLJZŝǀĞƌ^ĐŚĞŵĞ Ϯ͘ϬďƵƚǁŚĞƌĞ ŝƐƚŚĞŝŶƚĞŶƟŽŶƚŽďƵŝůĚĂ similar scheme on the Clarence River to ŐĞŶĞƌĂƚĞƉŽǁĞƌĂŶĚŇŽǁǁĂƚĞƌƚŽƚŚĞǁĞƐƚ͘ >ĂŶĐĞŶĚĞƌƐďĞĞǁŚŽǁƌŽƚĞ ͞sŽLJĂ ͞ ŐĞ ŽĨ ŝƐĐŽǀĞƌLJ͟ƉůĂŶŶĞĚ ŝƚŝŶƚŚĞ ϭϵϱϬƐ͘&ƌŽŵ a region that has an ĂŶŶƵĂůƌĂŝŶĨĂůůŽĨ ϭϱϬϬĐŵĂŶĚŽŶƚŚĞ ůĂƌŐĞƐƚƌŝǀĞƌŇŽǁŝŶŐ ƚŽƚŚĞWĂĐŝĮĐĐŽĂƐƚ͕ when will we see any ŵĞĚŝĂƉƌŽŐƌĂŵƚŽŐĞƚ it started and solve ŵƵĐŚŽĨƚŚĞDƵƌƌĂLJͲ ĂƌůŝŶŐƉƌŽďůĞŵ͘/Ŷ ƚŚĞŵĞĂŶƟŵĞ͕ŽƵƌĨŽŽĚƉƌŽĚƵĐƟŽŶ ĐĂƉĂďŝůŝƚLJƐƵīĞƌƐĂŶĚƚŚĞďƵƌĞĂĐƌĂĐLJŐƌŽǁƐ͘ ,ĂǀŝŶŐƉĂŝĚΨϯϬ͕ϬϬϬƉĞƌLJĞĂƌĨŽƌĂůŝĐĞŶƐĞ͕ ŽŶĞEĂƌƌŽŵŝŶĞĨĂƌŵŝŶŐĨĂŵŝůLJƐŽůĚ ƚŚĞŝƌ ǁĂƚĞƌůŝĐĞŶĐĞ ʹŝƚĨĂŝůĞĚƚŽŐĞƚƚŚĞŵĂƌĞůŝĂďůĞ ŝƌƌŝŐĂƟŽŶǁĂƚĞƌŇŽǁʹĂŶĚƚŚĞLJƌĞǀĞƌƚĞĚƚŽ ĐĞƌĞĂůͬŐƌĂnjŝŶŐ͘ ůŽŶŐǁŝƚŚŵŽŶĞƚĂƌLJƉŽůŝĐLJ͕ ƐŽĐŝĂůďĞŚĂǀŝŽƌĂů ĚŝƐĐŝƉůŝŶĞƐŝŶƐŽĐŝĞƚLJŚĂǀĞĐŚĂŶŐĞĚĨƌŽŵ ƉƵŶŝƐŚŵĞŶƚƚŽƉƐLJĐŚŽůŽŐŝĐĂůƌĞĨĞƌĂůƐĂŶĚ ŝŶĐĂƌĐĞƌĂƚŝŽŶǁŚŝĐŚƐŽŵĞƌĞƉĞĂƚŽĨĨĞŶĚĞƌƐ ƌĞŐĂƌĚĂƐĂĨŽƌŵŽĨǁĞůĨĂƌĞ͘dŚĞ ƉĞƌƉĞƚƌĂƚŽƌ ŽĨƚŚĞ>ŝŶĚƚ^ĞŝŐĞǁĂƐůŝǀŝŶŐŽŶǁĞůĨĂƌĞ͕ had several bail ĐŽŶĚŝƟŽŶƐ͕ LJĞƚƚŚĞ ĐŽƵƌƚƐLJƐƚĞŵůĞŌ ŚŝŵĨƌĞĞƚŽĐŽŵŵŝƚ ŵƵƌĚĞƌ͘KƚŚĞƌƐ͕ ƌ as described by :ĂŵĞƐWŚĞůƉƐŝŶ ͞ ͞ƵƐƚƌĂůŝĂ͛Ɛ,Ă ƌĚĞƐƚ WƌŝƐŽŶ͟ĐŽŶƟŶƵĞ ƚŚĞŝƌĮŐŚƚƐŽŶƚŚĞ ŝŶƐŝĚĞ͘'ŽǀĞƌŶŵĞŶƚƐ ŶŽǁƐƉĞŶĚŚƵŶĚƌĞĚƐ

ŽĨŵŝůůŝŽŶƐŽĨĚŽůůĂƌƐƚŽĂĐĐŽŵŵŽĚĂƚĞƚŚŽƐĞ ƐĞŶƚĞŶĐĞĚ͘ŝůů,ŽƌŶĂĚŐĞ ŝŶŚŝƐŬƋƵŽƚĞĚ Ă ǁĂƌĚĞƌĂƚ'ƌĂĨƚŽŶ'ĂŽůǁŚŽƉĂƌƚŝĐŝƉĂƚĞĚ ŝŶ ƉŚLJƐŝĐĂůĚŝƐĐŝƉůŝŶĞ͕ ĂĐůĞĂƌŵŽƚŝǀĂƚŝŽŶĨŽƌ ƉƌŝƐŽŶĞƌƐƚŽďĞŚĂǀĞ ĂŶĚŶŽƚƚŽĐŽŵĞĂŐĂŝŶ ǁŚĞŶĚŝƐĐŚĂƌŐĞĚ͘ tŚĞŶ ǁĞ ƚŚŝŶŬŽĨƚŚĞ ĐŚĂůůĞŶŐĞ͕ ƚŚĞ ŝŶũƵƐƟĐĞƐ ĂŶĚƚŚĞ ŽƉƉƌĞƐƐŝŽŶ͕EŽĂŵŽŵƐŬLJ͛ƐŬ ͞tŚŽZƵůĞƐƚŚĞtŽƌůĚ͍͟ŝƐĂƉƉƌŽƉƌŝĂƚĞ ƌĞĂĚŝŶŐ͘tĞ ŚĂǀĞƚŽ ĂƐŬƋƵĞƐƟŽŶƐǁŚĞƚŚĞƌ ƚŚĞďŝŐƐƵƉĞƌŵĂƌŬĞƚƐ͕ ďĂŶŬƐ͕ĨĂ Ĩ ƐƚĨŽŽĚ ďƵƐŝŶĞƐƐĞƐǁŚŽĨŝŐŚƚĨŽƌŵĂƌŬĞƚƐƵƉƌĞŵĂĐLJ͕ ŝŐŶŽƌĞƚŚĞŝƌƌŽƵƚŝŶĞ ƉƌŽĐĞƐƐŝŶŐŽďůŝŐĂƚŝŽŶƐ ĂŶĚƐŚŽƌƚƉĂLJ ĞŵƉůŽLJĞĞƐ͕ƌƵůĞƚŚĞ ƉŽůŝƟĐŝĂŶƐ͘ŽLJŽƵ ƐĞĞ ĂŶLJĂƉƉƌŽƉƌŝĂƚĞ ĚŝƐĐŝƉůŝŶĂƌLJLJ ĂĐƚŝŽŶƚŽ ensure they work ƚŽƚŚĞƌƵůĞƐ͍Ɛ Chomsky says “the ǁŽƌůĚ͛ƐƉŽůŝƟĐĂů ĂŶĚĮŶĂŶĐŝĂůĞůŝƚĞ have become ever more insulated ĨƌŽŵĚĞŵŽĐƌĂƟĐ ĐŽŶƐƚƌĂŝŶƚƐŽŶ ƚŚĞŝƌĂĐƟŽŶ͘/ƚ ŝƐĂŶ ŝŶĐŽŶǀĞŶŝĞŶƚƚƌƵƚŚ͘͟ dŚĞĚĞĐůŝŶĞ ŽĨƚŚĞtĞƐƚŝƐƐŽŵĞƚŚŝŶŐƚŚĂƚ ŚĂƐůŽŶŐďĞĞŶƉƌŽƉŚĞƐŝĞĚ͘dŚĞƐLJŵƉƚŽŵƐŽĨ ĚĞĐůŝŶĞĂƌĞĂůůĂƌŽƵŶĚƵƐʹƐůŽǁŝŶŐŐƌŽǁƚŚ͕ ĐƌƵƐŚŝŶŐĚĞďƚƐ͕ĂŐŝŶŐ ƉŽƉƵůĂƟŽŶƐ͕ĂŶƟͲƐŽĐŝĂů ďĞŚĂǀŝŽƵƌ͘ ƌ ŶĚǁŚĂƚ ŝƐƚŚĞĐĂƵƐĞ͍ EŝĂů &ĞƌŐƵƐŽŶĂƌŐƵĞƐƚŚĂƚŝƚ ŝƐƚŚĞŝŶƐƟƚƵƟŽŶƐ͕ƚŚĞ ŝŶƚƌŝĐĂƚĞĨƌĂŵĞǁŽƌŬƐ within which causes ŽƵƌƐŽĐŝĞƚLJƚŽŇŽƵƌŝƐŚ ŽƌĨĂŝů͕ƐĞĞŽƵƌ ĐŽŵŵƵŶŝƟĞƐĚĞĐĂLJ ĂŶĚĞĐŽŶŽŵŝĞƐĚŝĞ͘ ,ŝƐŬ ŝƐƟƚůĞĚ͞dŚĞ'ƌĞĂƚĞŐĞŶĞƌĂƟŽŶ͘͟ dŚĞůĂƚĞƐƚĞĚŝƚŝŽŶ ŽĨEĞǁWŚŝůŽƐŽƉŚĞƌ ĨŽĐƵƐĞƐŽŶ͞&ĂŬĞ EĞǁƐ͘͟dŚĞĞŵƉŚĂƐŝƐ ƚŚĞŵĞĚŝĂƉůĂĐĞƐ ŝƐŽŶƚŚĞ agenda that they have ƐĞůĞĐƚĞĚƚŽŵĂŶŝƉƵůĂƚĞ͕ ďĞ ŝƚƉŽůŝƚŝĐƐ͕ŵĂƌƌŝĂŐĞ ĞƋƵĂůŝƚLJ͕ĐƌŝŵĞ͕ ŽƌƌĞůŝŐŝŽŶ͕ ĞƚĐ͘ dŚĞLJ ƚŚĞŶ ƌĞƐƉŽŶĚ ďLJƌĞƉŽƌƚŝŶŐŽŶ ƚŚĞƉƵďůŝĐ ƉƌŽƚĞƐƚƐ ƚŚĞLJĂŐƌĞĞǁŝƚŚ͕ ĂŶĚƌƵŶŝƚĂĚ ŝŶĨŝŶŝƚƵŵ͘ ĞƌŶĂƌĚ<ĞĂŶĞĂŶĚ,ĞůĞŶZĂnjĞƌŚĂǀĞǁƌŝƩĞŶ ͞͞^ŚŽƌƚ,ŝƐƚŽƌLJŽĨ^ƚƵƉŝĚ͟ǁŚŝĐŚĚĞĂůƐǁŝƚŚ ƚŚĞĚĞĐůŝŶĞŽĨƌĞĂƐŽŶĂŶĚǁŚLJƉƵďůŝĐĚĞďĂƚĞ ŵĂŬĞƐƵƐǁĂŶƚƚŽƐĐƌĞĂŵ͘dŚĞĚĞƚĞƌŝŽƌĂƚŝŶŐ quality and dwindling common sense in ŵĞĚŝĂ͕ ƉŽůŝƟĐƐĂŶĚĐƵůƚƵƌĞŝŶĐƌĞĂƐĞƐƚŚĞ ƌĂŐĞ͘

ŶĚŽĨĐŽƵƌƐĞƉƌŽƚĞƐƚƐ have become the norm but you have to get ƚŚĞdsĐĂŵĞƌĂƐĂůŽŶŐ ƚŽŵĂŬĞ ŝƚǁŽƌƚŚǁŚŝůĞ͘ ^ĞůůŝŶŐŽĨĨƚŽŚŝŶĂ ƉƵďůŝĐĂƐƐĞƚƐƐƵĐŚĂƐ ƚŚĞWŽƌƚŽĨĂƌǁŝŶ͕ƚŚĞ ŝĐŽŶŝĐ'WKŝŶDĂƌƟŶ WůĂĐĞ͕ ƉůƵƐĚŽŵĞƐƟĐ ĂŶĚƌƵƌĂůƉƌŽƉĞƌƟĞƐŝƐ ĐĞƌƚĂŝŶůLJĐůĂƐƐŝĮĞĚĂƐƐƚƵƉŝĚ͘ /ĨLJŽƵŚĂǀĞůŝǀĞĚŝŶƵďďŽĨŽƌĂĨĞǁĚĞĐĂĚĞƐ LJŽƵǁŝůůŚĂǀĞŶŽƟĐĞĚƚŚĞ ĐŚĂŶŐĞƐŝŶ ďĞŚĂǀŝŽƵƌ͘ƌ tĞƐĞƩůĞĚŚĞƌĞŝŶƚŚĞ ĞĂƌůLJϭϵϲϬƐ ĂŶĚůŝǀĞĚŝŶĂŇĂƚƚŚĂƚĚŝĚŶ͛ƚŚĂǀĞĂŶLJůŽĐŬŽŶ ƚŚĞĚŽŽƌƐ͘,ĂǀŝŶŐĐŽŵĞĨƌŽŵĂĨĂƌŵŽƵƚǁĞƐƚ͕ ƚŚŝƐǁĂƐŶŽƚĂĐŽŶĐĞƌŶ͘ƵƚĚƌŝǀŝŶŐĂƌŽƵŶĚ ƚŚĞĐŝƚLJƚŽĚĂLJ͕ ĂůůŵĂŶŶĞƌŽĨƐĞĐƵƌŝƚLJƐLJƐƚĞŵƐ͕ ĞdžƉĞŶƐŝǀĞĨĞŶĐĞƐĂƌŽƵŶĚƐĐŚŽŽůƐ͕ ƉƌŽƚĞĐƚŝŽŶ ůŝŐŚƚƐĂŶĚĂůĂƌŵƐLJƐƚĞŵƐĂƌĞ ĞǀĞƌLJǁŚĞƌĞ͘ ŽƐƚƐƚŽĐŽŵŵƵŶŝƚLJŵĞŵďĞƌƐ have to be met on such ŝŶƐƚĂůůĂƟŽŶƐ͕ ŽŶƚŚĞ ĐƌŝŵĞƐ͕ ŽƌďŽƚŚ͘dŚĞ ĚĞĐůŝŶĞŝŶĂĐĐĞƉƚĞĚ͘ ^ĂĨĞƐŽĐŝĂůďĞŚĂǀŝŽƵƌŝƐ ĨĞĂƚƵƌĞĚŝŶ͞dŚĞ&ƌĂƵĚ ŽĨ,ƵŵĂŶZŝŐŚƚƐ͟ ďLJ ZŽďĞƌƚ^ƚĂŶŵŽƌĞǁŚŽ details the manner ŝŶǁŚŝĐŚƉŽůŝƟĐŝĂŶƐ͕ ũƵĚŐĞƐĂŶĚďƵƌĞĂƵĐƌĂƚƐ ĞdžƚĞŶĚƚŚĞŝƌƉŽǁĞƌƐ ŽǀĞƌĐŽŵŵƵŶŝƟĞƐ͘ tĞŚĂǀĞƐĞĞŶƐŽŵĞŐŽǀĞƌŶŵĞŶƚĨƵŶĚƐ ĂůůŽĐĂƚĞĚƚŽǀĂƌŝŽƵƐƉƌŽũĞĐƚƐŝŶƚŚĞƌĞŐŝŽŶ͘ Measure those dollars against those being ĂƉƉůŝĞĚƚŽƚŚĞ^LJĚŶĞLJǁŝƚŚƌĂŝůĂŶĚ ĨƌĞĞǁĂLJƉƌŽũĞĐƚƐĐŽŶƐƵŵŝŶŐďŝůůŝŽŶƐ͘tŚĞŶ these create controversy with likely users ƐƵĨĨĞƌŝŶŐŵĂũŽƌŝŵƉĂĐƚƐ͕ ůŽŶŐƚĞƌŵƌĞƐŝĚĞŶƚƐ ŚĂǀŝŶŐƚŚĞŝƌĚǁĞůůŝŶŐƐĚĞŵŽůŝƐŚĞĚ͕ ĂŶĚ ŐŽǀĞƌŶŵĞŶƚƐƉĞŶĚŝŶŐďůŽǁŝŶŐŽƵƚƚŚĞŝƌ ďƵĚŐĞƚ͕ ƚŚĞŬ͞ĂŶĂ ŝƚLJĞ ^ƵƐƚĂŝŶĂďůĞ͍͟ ŝƐĂƉƉƌŽƉƌŝĂƚĞ͘DŽƌĞƚŚĂŶŚĂůĨ ƚŚĞ ŐůŽďĂůƉŽƉƵůĂƚŝŽŶůŝǀŝŶŐŝŶƵƌďĂŶĂƌĞĂƐ͕ ĂŶĚ ƚŚŝƐŝƐĞdžƉĞĐƚĞĚƚŽĚŽƵďůĞ ďLJϮϬϱϬ͘dŚĞĐƌĞĂƟŽŶ ŽĨŝŶĚƵƐƚƌŝĞƐŝŶ ŽƵƌ ƌĞŐŝŽŶƐ͕ ŝŶƉůĂĐĞƐůŝŬĞ Dubbo where the ƉĞĂŬŚŽƵƌůĂƐƚƐĮǀĞ ŵŝŶƵƚĞƐ͕ǁŽƵůĚƚĂŬĞ ĂǁĂLJƚŚĞ ĞŵƉŚĂƐŝƐ ĨƌŽŵŽǀĞƌĐƌŽǁĚĞĚ ^LJĚŶĞLJǁŚŽƐĞŵĂŝŶ ĂŝŵŝƐƚŽĐŽŵƉĞƚĞ ǁŝƚŚDĞůďŽƵƌŶĞ͘ dŚĞƉƌŽŽĨŝƐƚŚĞƌĞ͘KƵƌƉŽůŝƟĐĂůůĞĂĚĞƌƐĂƌĞ ƉƌŽǀŝŶŐƚŚĂƚƚŚĞLJĐŽƵůĚ͛ƚƌƵŶǁĂƚĞƌĚŽǁŶŚŝůů͘ ŶũŽLJLJŽƵƌďƌŽǁƐŝŶŐ͕ ĂǀĞWĂŶŬŚƵƌƐƚ

The Book Connection 178 Macquarie Street, Dubbo • OPEN 7 DAYSͻ;ϬϮͿϲϴϴϮϯϯϭϭͻǁǁǁ͘ŬĐŽŶŶĞĐƟŽŶ͘ĐŽŵ͘ĂƵ

tĞŵĂŝůŽƌĚĞƌƐƚŽĐƵƐƚŽŵĞƌƐĂĐƌŽƐƐƚŚĞĐŽƵŶƚƌLJĞĂĐŚǁĞĞŬĚĂLJ͘^ŝŵƉůLJƉŚŽŶĞƵƐ;ϬϮͿϲϴϴϮϯϯϭϭ͕ĞŵĂŝůĂƚ ŽƌĚĞƌƐΛŬĐŽŶŶĞĐƟŽŶ͘ĐŽŵ͘ĂƵ͕ƵƐĞŽƵƌǁĞďƐŝƚĞǁǁǁ͘ŬĐŽŶŶĞĐƟŽŶ͘ĐŽŵ͘ĂƵŽƌŵĂŝůƵƐĂƚWKŽdžϱϴϯ͕ƵďďŽϮϴϯϬ͘

23


24

September 7-13, 2017 Dubbo Photo News

FEATURE

The Royal Freemasons Benevolent Institution (RFBI) Home Care carer Melissa Tink with local senior, Valda Naden. PHOTO: DUBBO PHOTO NEWS/WENDY MERRICK

Trend toward staying at home for longer By NATALIE HOLMES

GIVEN added choice about how to spend their twilight years, more people are opting to remain in their own homes instead of moving into an aged care facility. Dubbo Area Nursing Service (DANS) helps elderly people to live their best life at home. Director Jacqui Martel says that more people are choosing that option all the time. “The wave is certainly changing,” she said. “In the past, it was accepted that people would go to a retirement hostel or nursing facility. Now, people are looking at their options. We have definitely noticed a change.” DANS started as a provider for veterans’ services but now offers private services as well. Describing the shift towards at-home care, Jacqui said it has become a lifelong decision. “Not only do they want to live at home, they want to stay at home for life which means they also want to die at home,” she explained. “We have nursed people in palliative care. There is also a community palliative team based at Lourdes.” The advantage of staying at home for longer is that it enables people to continue to be in familiar surroundings and enjoy all the creature comforts of their own place, including the local neighbourhood. “You are still living the life you want to live, including the time you have guests and prepare food. And you are still part of the wider community.” Jacqui says that even when people experi-

ence the memory loss associated with conditions such as dementia, it’s still important to be where they feel most comfortable. “Having that familiarity and people you love still living with you is good.” That’s not to say that people can’t choose to go into a communal living arrangement. “It’s really an individual choice and based on individual circumstances,” Jacqui explained. Regardless of current circumstances, Jacqui believes that it’s important to plan for old age. “Having a care plan or a service plan, it’s really individual, but it’s a good idea to start thinking about it.”

` There’s also different levels of care, they decide the level of care they want in the home then it depends on the level of care needed. It’s very individual. We offer low, medium and high level care. We like to make sure everyone gets their individual needs met - RFBI Home Care Coordinator Natalie McHarg a The types of self-care are many and varied, ranging from personal live-in care to basic assistance with shopping and cleaning around the home. The Royal Freemasons Benevolent Institution (RFBI) has recently built a nursing home in Dubbo, but has offered at-home

care to clients for many years. RFBI Home Care Coordinator Natalie McHarg said their Care at Home service offers assistance with showering and dressing, meal preparation and housework, shopping, pet care, gardening, using technology, along with transport to appointments, personal and clinical care. There are also options for respite and overnight care, with each care package tailored to the needs of the client. Like Jacqui, Natalie has observed the trend towards elderly people remaining at home for as long as they can. “I think that people want to stay in their own home and they don’t want to go into a facility where possible,” she said. “There’s also different levels of care, they decide the level of care they want in the home then it depends on the level of care needed. It’s very individual. We offer low, medium and high level care. We like to make sure everyone gets their individual needs met.” Natalie believes that staying at home for longer offers the person more independence for longer. “It allows them to stay independent and not have to move out of the family home with its important surroundings,” she said. “We can also ensure support and wellbeing and work with them to allow them to live in comfort and safety in their own home. “It also allows them to maintain friendships in their neighbourhood. They also tend to form relationships with their carer who might be the only person they see that

day. Consistency is important to the family as well.” Other than desire to remain in their own home, decision-making may be influenced by the number of placements available in care facilities. “There’s a 95 per cent occupancy in residential care in Australia at the moment,” Natalie pointed out. “There’s definitely a need for care, so if we have more care at home, it’s a solution.” Natalie said the RFBI has increased its home care service in recent years to keep up with demand. “It’s all in line with an ageing population, growth in this area and the limited residential care available,” she explained. And Natalie say it’s never too early to request some assistance, even if it’s just to discuss an arrangement for the future.

My Aged Care The Federal Government’s dedicated My Aged Care program has greatly influenced this sector in terms of choice, availability and access to services. It gives people an entry point into information about aged care, the different services available and how individual needs can be met. Both DANS and RFBI have experienced a surge in clientele since the program was launched. For more information, or to ask for an assessment, call 1800 200 422 or visit myagedcare.gov.au


25

Dubbo Photo News September 7-13, 2017

OPINION & ANALYSIS THE TOONS’ VIEWS

LETTERS & FEEDBACK Wanted: Councillors who see through the pork barrelling’ Dear Editor, Best wishes to all the people who have nominated to be elected to council – let’s hope ratepayers do a good job and elect councillors smart enough to see through the pork barrelling that the state government has come up with, aimed at holding on to the state seat of Dubbo as well as moving to regain the state seat of Orange. Wasn’t there a former National Party politician who was going to solve all of Dubbo’s problems by getting elected to council some time ago – and we all know how that turned out – and are there people who have nominated to be on council that think the state Premier is “Santa Claus” and will continue to hand out bags of lollies for ever more, along with her elves, one of whom holds the distinguished title of “The Commissioner of the NSW Police Force”? Why is it that the media in the area has completely overlooked the fact that nearly all the Wellington council area is not in the state seat of Dubbo? How is it that the local “guru” who resides on Mugga Hill and, according to his disciples who number all the media, hasn’t informed his parishioners that people from Wellington reside in the state seat of Orange? Dubbo managed to set up a regional saleyards half a century before other areas so why couldn’t the same be done with solving the city’s traffic problem. It’s only a matter of keeping the fertiliser salesman away as was done in setting up the regional saleyards successfully. Ron Gillis, Neilrex •••

The World According to Mali Dear Editor, I was so impressed by the thoughts and words in the article “The World According to: Mali Hopkins-Davies” as published in the August 31-September 6, 2017 edition of Dubbo Photo News, that I could not help but write and congratulate Mali on her incred-

ible maturity, insightfulness, and positivity which has enabled her to rise above the sadness and grief of her baby brother’s most untimely death. The way she has built on the relationship and bond she shared with her brother, and no doubt the support and attitude of her family, and can look to the future in such an accepting and positive way to the point where she can say “I want to live my life better and do things that matter” and “I have changed my goals” and “I take more notice of beautiful... things more...” because of the relationship and bond she shared with her brother, is truly amazing and an example to us all. Thank you, Mali. Brian Semmler Dubbo •••

It’s Spinal Cord Injury Awareness Week Dear Editor, Spinal Cord Injury Awareness Week (September 4 to 10) aims to not only raise awareness of the people living with a debilitating spinal cord injury, but to also encourage disability inclusion within society. Right now, about 12,000 Australians are living with a spinal cord injury with more than 350 new cases recorded each year. This year, the theme is ‘I can’ which challenges the perceptions of what it means to have a spinal cord injury. Every day, my colleagues and I work with clients who are suffering with a spinal cord injury, many of which were the result of a split-second accident that has had a life- altering impact on not only themselves, but their families. Unfortunately, medical breakthroughs don’t happen overnight – there is an enormous amount of dedication and persistence that goes into finding a cure for such debilitating injuries. Together, we can all play a part in raising awareness of the daily struggle spinal cord injuries have on thousands of Australians and to ensure they have every possible opportunity to participate in society. Genevieve Henderson, Slater and Gordon Practice Group Leader.

Power to the people to gold plate the few Yvette AubussonFoley ❚ OPINION THERE’S a crisis in the energy industry in Australia. Profits apparently don’t seem big enough. AGL Energy reported a statutory profit after tax of $325 million for the six months to December 31 last year, a turnaround of $774 million from the prior period, according to an ABC News report in February 2017. That might have been around the time I entered into an agreement with AGL which essential caps my payments in a backward attempt to reign in an electricity bill which demonstrates the meaning of ‘to rise exponentially’. So while the little man tightens his belt, cooks, heats and lights their nights less and less to avoid financial disarray, the energy pro-

viders appear to be in a lot less pain, planning, in AGL’s case for a year end profit of between $720 million to $800 million. Leaving three energy providers to control 90 per cent of the NSW electricity market kind of guarantees they call the shots. If it feels like we’re being conned, you’d be right. Price gauging is the ‘gold’ standard. AGL’s boss Andy Vesey, who was recruited from America, pockets $6.96 million. A poor cousin by comparison, Origin CEO Frank Calabria earns $1.7 million, including superannuation with the opportunity to earn incentives capped at 130 per cent of his fixed salary (an extra $2.2 million). But if you believe that, there are probably more bonuses in the offing for Calabria considering his predecessor, Grant King, had a take home pay of $7.28 million in 2014 which at the time was a $6.9 million pay rise! Energy Australia’s chief executive Catherine Tanna has been re-

warded with a $5.1 million salary and bonus. It’s the kind of money people in high places bend over to keep and while I’m all for making money per se, I think remuneration ought to be commensurate with effort. Meanwhile off Elysium and back on earth, sixty-thousand homes in Sydney face disconnection while energy providers cry poor over fictitious rising coal costs. Perhaps the real reason they’re lining their pockets with money is just to keep warm, bless them. The Australia Institute, a think tank based in Canberra released the Electricity Update of the National Energy Emissions Audit this month and have given an alternate theory to using money as a blanket, based on real data. Author of the report, energy analyst Dr Hugh Saddler said: “This year consumers have seen a very sharp rise in electricity price due to generation cost. However, for the last six years price rises seen by consumers were almost entirely caused by network ‘gold-plating’.

Tellingly he concluded from his research: “Electricity consumers are continuing to pay for the policy failures of the last decade in the regulation of monopoly network businesses. “The reduction in brown coal production in the National Energy Market is being met by increased black coal as well as increased renewable production – notably wind power, which bounced back to record another all-time production record in July.” The truth is the cost of producing 90 per cent of all Australian electricity has been stagnant or declined over the last decade. Australia Institute data also shows the Australian energy pro-

` Australia Institute data also shows the Australian energy providers have increased their management teams by 200 per cent over the past 20 years.a

viders have increased their management teams by 200 per cent over the past 20 years. The Australian Competition and Consumer Commission’s Electricity supply and prices inquiry which was directed by Treasurer Scott Morrison on March 27, 2017, has received a significant number of submissions made to the ACCC (and are available for viewing on their website.) Public forums were held in July this year in Brisbane, Adelaide, Melbourne, Townsville and Sydney – but no regional centres made the cut. A preliminary report is due to the Treasurer by September 27, this month and a final report by June 30, 2018. In the short term, it’s going to be a long hot summer and another long cold winter then, for many energy consumers in this country who continue to foot management salaries. No time like the present to get off the grid.


26

September 7-13, 2017 Dubbo Photo News

ELECTION GUIDE

Legend

Local Government Area Hydro Area Suburb Road Railway Watercourse Wellington Dubbo South Dubbo Central Dubbo East Dubbo North


27

Dubbo Photo News September 7-13, 2017

ELECTION GUIDE

September 9 is election day Saturday, September 9, is the last day to cast your vote for a new Dubbo Regional Council. EAST WARD

Ana Pateman

Cody Jones

Dayne Gumley

Stephen Lawrence

Lisa James

Chris Edwards

Adam Ryan

Anne Jones

Jacob Perry

David Grant

Mark Griggs

Michael Augee

Greg Mohr

Alfred (Kevin) Parker

Manny Portelli

Douglas Prior

Shayne Stiff

Jane Diffey

Ben Shields

Merrilyn Mulcahy

Tyler Przerada

Nathan Ellis

John Ryan

Kris Stevens

Josh Black

Greg Matthews

WELLINGTON WARD

SOUTH WARD

NORTH WARD

CENTRAL WARD

Vicki Ethereidge

THE POLLING PLACES ARE: • • • • • • • • •

Ballimore Public School Buninyong Public School Dubbo College Delroy Campus Dubbo College South Campus Dubbo North Public School Dubbo South Public School Eumungerie Public School Geurie Public School Lourdes Hospital and Community Health Service

• • • • • • • • •

Mumbil Public School Orana Heights Public School Stuart Town Public School Sydney Town Hall Wellington Public School – Gould League Hall Wellington Scout Hall Wesley Centre Dubbo Wongarbon Public School Yeoval Central School

PRE-POLLING CLOSES FRIDAY Yes, you can vote before Saturday. Pre-polling is open today and tomorrow (Friday, September 8) until 5pm.

ELECTION DAY VOTING Election Day - Saturday, September 9, 2017 Between 8am and 6pm

Nikki Catelotti

EXTRA BITS & PIECES *No matter which ward you live in, every polling place will have your ballot card. **All except Stuart Town Public School have disability access.


28

September 7-13, 2017 Dubbo Photo News

New Spring Menu

At the Quality Inn, 165 Whylandra St, Dubbo Bookings: (02) 6882 4777 TGÆ&#x192;GEVKQPUTGUVCWTCPVEQOCW


29

Dubbo Photo News September 7-13, 2017

WELLINGTON NEWS Wellington deserves the same respect as Dubbo By NATALIE HOLMES WELLINGTON people are nervous about the upcoming Dubbo Regional Council elections on September 9, fearing that they will be under-represented in the newly-amalgamated Local Government Area. That’s the message from well-respected local businessman Barry Jeffery who spoke frankly about the mood in town, saying that residents were worried about what the future holds – particularly when only two candidates from 10 representatives elected can be from Wellington. “The mood in the business community is a little bit disappointed,” Mr Jeffery said. “I don’t feel we have enough representatives on Dubbo Regional Council. To tell the truth, I don’t think two (representatives) is enough for the size of the area and the revenue this area creates. “And I think that there are too many wards. People are not used to having a small group of candidates. Mr Jeffery believes that three wards with three elected representatives in each would have been a more even distribution. “Two wards in Dubbo and one in Wellington would have been fairer.” Describing the current ward system as faulty, Mr Jeffery also said it has been ‘left open for manipulation.’ Given that Wellington has now been swallowed up by the larger Council area since the neighbouring LGAs merged in May last year, Mr Jeffery hopes the

Wellington candidates:

Local dignitaries including Member for Dubbo Troy Grant, Federal Member Andrew McGee, Dubbo Regional Council interim administrator Michael Kneipp and Wellington Wiradjuri elder Aunty Joyce Williams watch on during the unveiling of the Binjang memorial in front of council chambers at the recent Wellington Bicentenary celebrations. PHOTO: DUBBO PHOTO NEWS/COLIN ROUSE

town and its needs don’t get forgotten. “I hope it doesn’t happen but I can just see us being left behind because there’s only two people having a say.” When it comes to future planning and economic development of the region, Mr Jeffery hopes for equality. “I’d like to see Wellington businesses treated with the same respect as Dubbo in regard to Development Applications.” With the township and villages only making up one out of the five ward system which is dominated by the urban centre of Dubbo, Mr Jeffery said it does put Wellington and surrounds at a disadvantage.

“It appears that Wellington is just a suburb of Dubbo – or a poorer cousin. I feel that with only two representatives, we can’t get more.” As one of the opponents of the Wellington-Dubbo amalgamation, Mr Jeffery believes that it has been somewhat detrimental for townspeople. “I fought hard against the amalgamation,” he said. “I know there will be job losses (at a local level). I just hope the new Dubbo Regional Council has enough common sense to keep the Wellington Depot. “We need to keep as many outdoor staff as we can. Wellington doesn’t need any job losses.”

As a member of the Wellington Business Chamber, Mr Jeffery has already had dealings with some of the staff at Dubbo Regional Council. “We found them to be very approachable, very professional, and concerned about the physical impacts on Wellington. I just hope that the new Council will have the same concerns and thoughtfulness.” Almost all of the Wellington candidates have previously been councillors with a couple of new faces among the more experienced candidates. Mr Jeffery would have liked to be involved too – but with his own business at Twin Rivers Printing, a second job as a school

bus driver and his Chamber commitments, there wasn’t much time available for a new role. “I would have liked to see more newbies throw their hat into the ring. I would have liked to nominate as well but felt that I didn’t have the time to focus on being a councillor if I was elected.” “Ultimately, you need two people with a strong voice to make Wellington, Mumbil, Stuart Town, Euchareena and all the other villages put their point of view across as strong as they can. We are a small voting population in a large area so it’s important that we get proper representatives that will stand up for the town.”

(in the order they will appear on the ballot paper) Anne JONES Mark GRIGGS Michael AUGEE Adam RYAN Jacob PERRY David GRANT

The issues: In Mr Jeffery’s eyes, the issues that need to be addressed by the new Council include: • Population growth “I hope that the new Council will encourage people to live in Wellington and see it promoted as a cheaper alternative.” • Future development – “I would like to see DA approvals sped up.” • Road maintenance – “The roads need more work. Under Dubbo Regional Council, I think rural roads will suffer.”

STEM education for Indigenous kids a plus Contributed WELLINGTON High School students attended the STEM Youth Development Camp, a science, technology, engineering and mathematics excursion, at Lake Burrendong Sport and Recreation Centre early this month. The Aboriginal students learnt about the science behind the boomerang and how it influenced the development of drones. An initiative of the Department of Education, the NSW Aboriginal Education Consultative Group (AECG) and the Aboriginal and Torres Strait Islander Mathematics Association, the camp was held over three days, from Wednesday, August 30 to Friday, September 1, 2017. Approximately 100 Year 5 to 11 students including from Wellington High and across the state, participated. It is just the second year the initiative has been offered. Aboriginal Education and Community Engagement for the Department of Education director Mary Senj said the STEM camps have been highly successful and have in-

spired Aboriginal students to enrol in STEM courses. “It’s a great opportunity for Aboriginal students to see the connections between science, technology, engineering and mathematics and their cultural knowledge,” Mary said. Aboriginal and Torres Strait Islander Mathematics Association chair Dr Chris Matthews has been instrumental in arranging academics for the workshop sessions. The students will also visit the CSIRO Parkes Observatory. The President of the AECG, Cindy Berwick, said: “The camps are important for Aboriginal students to see the connection between cultural practices and modern technology and how incorporating both will lead to sustainable futures for both Aboriginal communities and the broader Australian community. “The NSW AECG is committed to ensuring students see Aboriginal knowledges, histories and cultures in their teaching and learning.” A similar camp was held in Sydney earlier this year and another will be held in Batemans Bay in Giaan Cabby, Kharni Chatfield and Arthur Turaga of Wellington Public School enjoyed learning with students and October. teachers from across the state at the Aboriginal STEM Camp at Lake Burrendong. PHOTO: SUPPLIED.


30

September 7-13, 2017 Dubbo Photo News

WELLINGTON NEWS Wellingtonâ&#x20AC;&#x2122;s Bicentenary Dinner By COLIN ROUSE WELLINGTON turned out in all its finery to mark the special occasion of its 200th year, with a special Bicentenary Dinner at the Hermitage Hill on Friday, August 18, 2017.

Bicentenary committee members, Barbara, Jennifer and Marie

Brad Rodgers, Julie Sheppary, Liz Rich, Aaron Rice, Barb Plestom

Malcom and Carol Rich, Sue and Trevor Owens

Pip and Norm

Libby Bryant and Richard Atkinson

Special guest, Wellington born actor Max Cullen with Simone Smith

Bobby Jo and Michael Britlan

Garry and Linda Carney

Herb Smith and Barbara Preston

Brett and Natasha Comber

Greg and Jennifer Wykes

Former Nurses, Patty McCarthy, Lynda Burchael, Pam Fineian, Pauline Canynghane, Judy Forrest, Cecily Wilson, Jan Payne

Colette and John Mackay, John and Anne Ericsson, Phil and Trish Mackay

Beth Hattenfels, Tracy Campbell, Jo Johnson and Hud Johnston

Judy Forrest, Mick Cashman and Maree Cornish

Revellers attending the Bicentenary Dinner

Diane Butt and Jenni StreatďŹ eld


Andrew GEE MP

Your CountryYour Voice

Federal Member for Calare

TIME TO INTRODUCE NATIONAL POWER PRICE CONTROLS There has been some good work recently to bring down power prices. The PM got the power companies together in an effort to get consumers switched to the cheapest power deals. There are also some signs that gas prices may be heading south again soon.

I’ve seen and heard enough. I believe it’s time that the Federal Government introduced short-term price controls on gas and electricity prices.

JOHN FOWLER STEAM LOCOMOTIVE It was great to see Wellington’s iconic John Fowler steam locomotive in action at Wellington’s Bicentennial celebrations. It was restored some years ago with the help of a $50,000 NSW Heritage grant.

They can stay in place until power companies start doing the right thing and longer term policies start taking effect.

This is all very encouraging, but it’s just not enough in my book.

Electricity is traditionally the domain of the states. However, the Federal Government has the constitutional ability to control power prices.

For weeks I’ve been hearing about how individuals and businesses are suffering under these soaring prices. How did we get here? This nation has an abundance of natural resources able to deliver cost effective baseload power.

Yes, it’s drastic and the economic purists will hate it, but I think it’s justified. If we want jobs in country Australia strong and decisive action is needed. Right now.

BINJANG COMMUNITY RADIO $45 MILLION LOST TO SCAMS IN EARLY 2017 According to the latest statistics from the Australian Competition & Consumer Commission’s (ACCC) Scamwatch, phishing, identity theft, and false billing were the top three scams reported by Australians in the first six months of 2017. There are a number of different ways you can protect yourself from scams: • Never send money or give personal information, credit card details or online account details to anyone you don’t know or trust and never by email. ]Andrew pictured with Binjang presenters Cathy Donnelly and Tony Graham.

Last week I caught up with Binjang Community Radio presenters Cathy Donnelly and Tony Graham in Wellington. Earlier this year I made special mention of Binjang Community Radio in Parliament, outlining the history of the station and the wonderful team behind it. Binjang Community Radio is overseen by a management committee which helps to ensure the smooth operation of the station. The committee consists of Mark Griggs, Jayson O’Brien, Anne Jones, Marcus Hanney, Wes Taylor, Beryl-Anne Altopher , Cathy Donnelly, Michael White and Tony Graham.

LOCAL SPORTING CHAMPIONS

The presenting team at Binjang consists of many people who kindly volunteer their time, including Farren Hotham (guest presenter), Chris Lucas, Helen O’Brien, Geoff Plasto, Ross Plasto, Thomas Broome, Rick Bremner, Dale Elliott, Daniel Rutter, Jeff McEachen, Mark Griggs, Phil Denniston, Jack Broome, Dr Mike Augee and Matt Barry. Binjang Community Radio provides a valuable local broadcasting service for the Wellington area, and I congratulate the committee members, presenters and volunteers who make this possible!

Twenty junior athletes in Calare were successful under Round 1 of the Local Sporting Champions Grant, and last week I met with Lachlan Thompson from Gulgong who was one of the grant recipients. Lachlan is 12 years old and has only been competing in lawn bowls for two years. In June Lachlan travelled to the Gold Coast and represented the Gulgong Bowling Club at the Australian Open. Lachlan and his teammates Jordon Thompson, Mark Gorrie and Scott Fitzalen competed in the fours and finished in the top 16. In these playoffs they went up against Scotland who went on to win the Australian Open Fours Event. In the junior section Lachlan finished in the top 20 and his brother Jordan finished in the top 10. What an amazing achievement! Local athletes, like Lachlan, are inspiring young leaders in our community and I wish all the round 1 recipients all the best in their sporting pursuits.

]Andrew pictured with Michael Thompson and his son Lachlan, and Mid-Western Regional Council General Manager Brad Cam at the Mudgee afternoon tea and presentation.

Round 2 of the 2017-2018 Local Sporting Champions Grant closes on 31 October 2017.

• Approach charity organisations directly to make a donation or offer support and Check the organisation’s name and look them up. • Understand that scams exist and use caution online. Be careful when online shopping and be particularly wary of any uninvited contact—whether it’s from businesses or individuals, via email, social media or other means. • Use strong passwords online, take steps to protect your computer and use safe behaviour when using the web. • Avoid malicious messages—don’t share your email address online unless you need to, use a spam filter to catch bogus messages before they get to your inbox and delete spam that does get through without opening it. • Don’t open messages or click on links if you don’t know the sender or if you’re not expecting them. Be especially suspicious of messages that: • are not addressed to you directly or misspell your name • ask you to provide your banking details or other personal information • promise you money • present hard luck or exotic stories telling you that you can share in hidden millions of dollars. • Don’t accept friend or contact requests on social media from people you don’t know. Criminals may use information they gather about you from social media in order to make their messages more appealing or appear more authentic. For further information on how to spot and avoid a potential scam visit www.scamwatch.gov.au/

More information can be found at www.ausport.gov.au/lsc

ORANGE ELECTORATE OFFICE Suite 1/179A Anson Street, ORANGE NSW 2800 P: (02) 6361 7138 or 1300 301 740 | F: (02) 6362 3480 | E: andrew.gee.mp@aph.gov.au | POSTAL ADDRESS: PO Box 673 Orange NSW 2800 Authorised by Andrew Gee MP Suite1/179A Anson Street, Orange. Produced and printed using parliamentary entitlements. September 2017.


32

September 7-13, 2017 Dubbo Photo News

The Book Connection

THE PLAY PAGE PHOTO NEWS SUDOKU

178 Macquarie Street, Dubbo • OPEN 7 DAYS

CROSSWORD TIME ACROSS

HOW TO PLAY: Fill in the grid so that every row, every column, and every 3x3 box GRID614 contains the numbers 1 through 9 only once. Each 3x3 box is outlined with a darker line. You already have a few numbers to get you started. Remember: You must not repeat the numbers 1 through 9 in the same line, column, or 3x3 box.

1. Pack animal 4. Extend 8. Stage production 12. Sticky mess 13. Aesop racer 14. Caesar’s garment 15. Santa’s worker 16. Originally 18. Ocean plant 20. Towels off 21. Building wing 22. … the line 23. Made a choice 26. Guy’s date 27. Direct 30. Tap problem 31. Jazz

instrument 32. Talking bird 33. Enjoy dinner 34. Flat-faced dog 35. Dark 36. Dragons or Sea Eagles 38. Periodical, for short 39. Severe 41. Huge 45. Essay division 47. Big four bank 48. 24th letters 49. Shaft 50. White lie 51. Roomy 52. Laced 53. Offs’ opposites

FIND THE WORDS

DOWN 1. Birthday numbers 2. Flounder’s relative 3. Love seat 4. Knight’s protector 5. Group of judges 6. Saharan 7. Revenue 8. Gaze intently 9. Festive occasions 10. Rude look 11. … and means 17. Adored one 19. Calendar row 22. Levy 23. Fiesta shout 24. Pod

inhabitant 25. Ragged 26. Squelch 28. Scribe’s need 29. Month after April 31. Entirety 32. Cups 34. Twinge 35. Destroyed, as hopes 37. Blot out 38. Canadian syrup 39. Gush out 40. Car for hire 41. Skirt type 42. Data 43. Conceited 44. Diminishes 46. Scoundrel PUZZ882

WUMO

This is a theme puzzle with the subject stated below. Find the listed words in the grid. (They may run in any direction but always in a straight line. Some letters are used more than once.) Ring each word as you find it and when you have completed the puzzle, there will be 18 letters left over. They spell out the alternative theme of the puzzle.

Formative years

acne action alert anger blues cars date disco dress emotion energy evenings excitement face mask growing hate homework laughter love make-up mates mess oatmeal

by Wulff & Morgenthaler

soap parties peers phone pimples pressures rage rebel regrets shower speed swimming tantrums temptation troubles

INSANITY STREAK

by Tony Lopes

© AUSTRALIANWORDGAMES.COM.AU 968

BAKER’S DOZEN TRIVIA TEST

1. LITERATURE: How many lines are in a standard limerick? 2. GEOGRAPHY: Which South American nation controls Easter Island in the Pacific Ocean? 3. LANGUAGE: What is the Latin plural of the word opus? 4. MUSIC: What famous 20th-century American bandleader died in an airplane crash? 5. GENERAL KNOWLEDGE: What is the appropriate gift for a 15th anniversary? 6. MONEY: Whose picture is on the New Zealand $5 note?

7. RELIGION: What is the longest chapter in the Bible? 8. HISTORY: When was the Encyclopaedia Britannica first published? 9. ANIMAL KINGDOM: Which animal has the longest gestation period? 10. FOOD & DRINK: What French sauce served with grilled meat uses tarragon as a key ingredient? 11. FLASHBACK: “How Will I Know” was on which artist’s debut album? 12. SPORT: Who was the Flagbearer and Team Captain for the 2016 Australian Olympic Team in Rio? 13. LYRICS: Name the song that contains this lyric: “I’ve never seen so many men ask you if you wanted to dance, looking for a little romance, given half a chance.”

OUT ON A LIMB

by Gary Kopervas

SOLUTIONS: Are in the TV+ Guide

Every book has an

amazing

story to tell

The Book Connection 178 Macquarie Street, Dubbo • OPEN 7 DAYS


33

Dubbo Photo News September 7-13, 2017

PAPARAZZI

email your photos to photos@dubbophotonews.com.au instagram dubbophotonews facebook.com/dubbophotonews

Clearly the bees who moved into the country mailbox didn’t find this well appointed abode on the Narromine Road!

When our photographer was on location doing this week’s cover shoot with Tully the donkey, she met Farouq, a very photogenic chook.

You’ve got mail! And good luck delivering or collecting it! Thanks to Pauline Griffiths for sending in this image of a country mailbox, home to a swarm of bees on a warm sunny afternoon.

Taronga Western Plains Zoo is an unlimited opportunity for photographers as local Garry Taylor demonstrates with the great moments he’s captured on camera.

5 STARS FOR ADVENTURE!

We have a wide range of tours, that suit every taste! “Absolutely brilliant way to see the sights of Dubbo, Peter has heaps of information ^YVVcY_SXYX._LLY”. KARYN & PETER GLOVER, 5 STAR FACEBOOK REVIEW

FOR MORE INFORMATION PHONE PETER: 1300 874 537


34

September 7-13, 2017 Dubbo Photo News

HATCHES

David Andrew JOHNSON Born 31/08/17 Weight 3770g Parents Rachael Wallace and Dale Johnson of Coonamble Siblings First child Grandparents Andrew and Robyn, Charmaine and Jonothan

Eevana POUDEL Born 31/08/17 Weight 3190g Parents Kalpana and Sanjeev of Dubbo Siblings First child Grandparents Namraj and Devaki

Photos by Wendy Merrick Photography Dubbo | www.wendymphotography.com.au Contribute your baby photo to photos@dubbophotonews.com.au

Skylar Lee MARKS Born 1/09/17 Weight 3870g Parents Kristy Ivers and Chris Marks of Dubbo Siblings Brayden (2 1/2 yrs)

Henry Richard GALE Born 30/08/17 Weight 4120g Parents Leandra Kirby and Dean Gale of Trangie Siblings First child Grandparents Sharon and Richard Kirby, Lyn and Rusty Gale

Alexis Georgia ANDERSON Born 31/08/17 Weight 3090g Parents Emma and Ben Anderson of Wellington Siblings Lucinda (21mths) Grandparents Danielle and Robert Anderson, Gary and Pauline Collett

Lexi Rae McMILLAN Born 31/08/17 Weight 3060g Parents Emma Roberts and Dylan McMillan of Dubbo Siblings Allister (3 1/2 yrs), Mia (3yrs)

Hallie Rae BAKER Born 30/08/17 Weight 3390g Parents Holly Willoughby and Joel Baker of Dubbo Siblings First child

Zibusiso Gordon MTETWA Born 30/08/17 Weight 4060g Parents Linda Nyama and Ska Mtetwa Siblings Samara (2yrs), Sarah (12yrs) Grandparents Edith and Sadie

RECREATION ROOM 5m x 3m

* $9000 *Conditions apply

6m x 4m Patio SUPPLIED AND ERECTED

* $4500 *Conditions apply

PROFESSIONAL PHOTOGRAPHER FOR OVER 15 YEARS

CLADDING SPECIALS Based on an average 85m2 home

$7995*

PH: 0421 634 096 wendymphotography.com.au FAIRY PORTRAITS, COMMERCIAL, REAL ESTATE, PORTRAITS, SPORTS & TEAMS

*Conditions apply

6884 9620

www.panelspan.com.au Showroom opposite Aldi 183 Talbragar St, Dubbo

PICTON BROS BL83737C


Dubbo Photo News September 7-13, 2017

HITCHES Maddi

Leroy A Dubbo Wedding PHOTOGRAPHY BY AMY LOUISE PHOTOGRAPHY & DESIGN x A PREMIUM #TBASUPPLIER MADDI & Leroy’s elegant Winter wedding in Dubbo was the perfect combination of class and country charm. It was a day filled with love, laughter and so much joy. When asked about their wedding day, Maddi commented, “we both grew up in country NSW, Leroy in Coonamble and I in Dubbo. We wanted a rustic, elegant country wedding that would represent us as a couple. But most of all a beautiful, fun and stress free day for all! Everything went off perfectly on the day, the cake and flowers especially blew my mind. Amy was a great photographer, embracing our fun, silly nature but kept things running smoothly as well, which made things easier for Leroy and I. She also made the most of the beautiful setting we had coming up with ideas and concepts for photo opportunities. The Meadow took my vague idea for flowers and turned them into something totally out of this world that tied everything together perfectly! The venue staff were also great and dependable through all the organising.” It sounded like it really was the most perfect day. We think these two local lovers have a long, happy life ahead of them! Dress // Nicolina from The Wedding Shoppe Hair // Onyx Dubbo x Makeup // Onyx Dubbo x Bridesmaid Dresses // JJ’s (online) Groomsmen’s Attire // The Wedding Shoppe Florals // The Meadow x Venue // Lazy River Estate x Cake Artist // Cakes by Kay Entertainment // Hayleigh Hing View more // www.thebridesavenue.com. au/realweddings x = a premium #TBAsupplier

If you’re a wedding photographer or have recently been married across Central West NSW, submit your wedding for the opportunity to be featured via www.thebridesavenue.com.au/submityourwedding

35


36 y LOVIN’ LOCAL SHOPPING NEWS | DEALS | DISCOUNTS | DISCOVERIES | NEWS FROM OUR ADVERTISERS

LOVIN’ LOCAL

September 7-13, 2017 Dubbo Photo News

Shopping News | Business News | Deals | Discounts | Discoveries To feature here phone 6885 4433

Pets are a person’ss P best friend Reg Regardless of what kind of pet you own, you’re ’re sure sur to find something they’ll love at Furneys ys Pet P Extra. Call in today to check out their amazing range of pet products!

4. 5.

1.

3.

2. 1. Cat Bed, prices vary, 2. Dog Bowl, prices vary, 3. Mammoth Chew Toy, $32.95, 4. Ezi-Out Pet Cage and Habitat Cleaner, $25, 5. Artificial Plant, $9.95, .95, Stockist: Furneys Pet Extra, 127 Erskine St, Dubbo, 6884 0222.

To feature your weekly specials here, call DUBBO PHOTO NEWS on 02 6885 4433

W E E K LY S P E C I A L S 38-40 Victoria Street, West Dubbo Tel: 02 6882 3466 Specials available Thursday 07.09.2017 until Wednesday 13.09.2017

YUMMYat Jimmy’s SPECIALS

s k c a P e u l Va

DINNER TONIGHT • Lots of dishes to choose from • Choose any 2 dishes + rice FROM $28.90* •Choose any 3 dishes + rice FROM $37.90*

*Evening takeaway only.

h c n u l i h S us **Lunch takeaway only.

70g Fortune Cup Noodle Beef or Chicken Flavour

79

¢ Each

$1.13 PER 100G

100g Fantastic Rice Cracker Original

99

¢ Each 99¢ PER 100G

SPECIALS ONLY AVAILABLE AT YOUR IGA WEST DUBBO

• Choose any 2 sushi + can of drink or bottled water Just $7.90** • Choose any 3 sushi Just $7.90**

See Jimmy’s menu in store

6882 4978 28 Wingewarra Street, Dubbo Mon-Fri 10am-2pm & 5-9pm • Saturday 5-9pm Offers end 30/06/17. JIMMY’S DEALS SMILE!


Dubbo Photo News September 7-13, 2017

LOVIN’ LOCAL SHOPPING NEWS | DEALS | DISCOUNTS | DISCOVERIES | NEWS FROM OUR ADVERTISERS y 37

Go solar for the environment and your pocket’s sake SOLAR energy is one of the cleanest sources of energy you will find and it’s free from the sun. Local solar supplier, Orana Energy Systems Solahart Central West have full confidence in Solahart Industries’ ability to support them and their customers, being able to, for example, provide ongoing support to consumers right down to monitoring individual solar panels to ensure optimum efficiency for the life of the system! From the outset, nothing is done by halves at Orana Energy Systems when it comes to assessing your home or business current energy use, and preparing it for solar installation. “We’ll have a look at your meter box, whether it’s single or three phase; we’ll look at whether you have a tin or tile roof, whether it’s a terracotta tile or flat concrete tile. What roof space you actually have, what orientation the roof is,” Orana Energy Systems finance and marketing manager Suellyn Rees said. “Preferably you want the roof facing north so that you can generate as much as possible during the winter. Sometimes, if people are at home during the day and most of their power’s used during the day, you’d want an east/west configuration and that can be a better scenario because you’ll produce more power over a longer period of the day. “You can imagine the westerly sun in the summer time when it doesn’t go down until 8 o’clock so your system would be turning off

a lot later,” she said. Based on all the factors of assessment, your home or business is then put through the Solahart Estimator. “The Solahart Estimator has been developed to estimate what your savings will be in the first year, the second year; right up to 15 years,” Suellyn said. “It will tell you how long the quoted system will take to pay for itself and how much power you’ll be generating. Then, we give an on sight quote. At the moment we offer 48 months interest free and offer a $400 discount off your Solahart hot water system. “Sometimes a combo of hot water and PV (photovoltaic) is the best scenario for you if you’ve got a few kids in the house using the hot water or you wash in hot water. Every household’s completely different so you really need to assess how that household uses power to assess it properly.” Subsidies still do exist and Orana Energy Systems include that as a point of sale discount. They’re called small scale tech certificates (STC) and are calculated on the basis of their price on the day of install. The size of the system purchased and where you live determines how many STC’s are given. “In Dubbo, in this postcode, which dictates a particular kind of UV (ultra violet) reading, you get 107 of those STCs for a 5KW system, so it’s about $2,500 to $3,000 off your system as a point of sale discount at current STC prices,” Suellyn said. These government

rebates are being phased out and the discount will be reducing each year so now is a good time to look at your solar options. “Our preferred solar roof system allows panels to operate separately rather than in a series so if one panel is affected by something, like bird poo or is in the shade, the rest of the panels aren’t affected. “This solar system we monitor

for free for the life of the system. It has an online portal where you can log on and see how much energy is being created or you can connect to the inverter via your smart phone. “We check these systems every morning and if there’s an alert we can go and have a look and identify a particular panel and the optimiser attached, identify the problem and have it fixed quickly” said

Suellyn. Along with so many benefits the energy created is done cleanly which is good news for the environment. “Sometimes people will generate more electricity than they need, so we can install a battery to store your excess power. Your PV system will shut down at the end of the day and your battery will take care of the peak time.”

Easy, local & reliable!

Orana Energy Systems Solahart Central West are your local solar energy and gas experts, servicing the Central West region of NSW from our base in Dubbo. Let us make your home or I\ZPULZZTVYLLULYN`LɉJPLU[^P[OV\Y]HYPL[` VMYLUL^HISLLULYN`WYVK\J[ZHUKZLY]PJLZ

Solar Electricity & Hot Water

Orana Energy Systems Solahart Central West stand out from the competition by providing quality products MVYZVSHYLSLJ[YPJP[`ZVSHYOV[^H[LYNHZVW[PVUZHZ ^LSSHZYLSPHISLJVUZPZ[LU[HUKMYPLUKS`ZLY]PJL>L give honest advice and easy to understand quotes for ZVSHYPUZ[HSSH[PVUZHUKZLY]PJLZ6\YZ[HMM^VYRZOHYK to support the local community that has supported us for so many years. We provide a range of finance options for business and domestic installations and freely and responsibly share reliable information. *VU[HJ[V\YVMMPJL[VKH`[VZLLPM^LJHUZH]LTVUL` for you.

Leading provider in the Central West Localised after sales service

PH: 6885 2295 oranaenergysystems.com


Dubb Pets M nth!

Each week we will publish your entries, along with great hints and tips for pet ownership, thanks to Dubbo Regional Council and participating sponsors. ii Photos can relate to the best pet/owner look alike, most unique pet, cutest pet or most active pet! It’s entirely up to you... and your pet!

ii TO ENTER SEND YOUR ENTRIES TO:

P\HQWU\#GXEERSKRWRQHZVFRPDXRUGURSLQWRRXURIƓFH XURIƓFH at 89 Wingewarra St, Dubbo – we will scan them while hile yyou wait! Include your name, address, daytime phone number, your pet’s name & breed, along with a caption for your photo // One photo per pet // Entries close: Fri 22 September at 4pm // Winners published: Thurs 28 September in the Dubbo Photo News.

R BOA DING K ST N EL S EN

PINEC RE

ii FOR MORE PETS MONTH INFO HEAD TO: dubbo.nsw.gov.au/pets-month & CATTERY

Wellington Veterinary Hospital


Our 10 week old puppy Bindi with her brother Nixon because every little boy needs a puppy play mate - Karly

“I’ve been betrayed. Get. Me. Out.” says Roman - Haylee

This is how Moose keeps cool… he spills his water on the kitchen floor and flops right into it - Julie

“If you leave me, can I come too” says Huxley- Peta

“My bed is better than your bed” says Ruby - Amanda

Rocco and Roman “Can ya like... throw the ball!” - Haylee

Roo was my Amstaff x cattledog female that passed away on September 1. Not only was she a very much loved member of our family and very missed, she was also a pets as therapy accredited dog. She had the most gentle soul. She was a once in a lifetime dog - Kaz

My teddy bear loving gentle giant - Karen


40

September 7-13, 2017 Dubbo Photo News

MEET THE BOSS Wayne Mitchell Position: Manager, the Garden Hotel I got involved in business... after I left the Army Our business is known for... the most beers on tap and an awesome sports bar Our bestselling product is... food My role in the business is… the manager of the Garden Hotel I manage... the everyday running of the business According to my staff, working for me is... awesome I spend my down time... with my family I’m inspired by… the hotel industry On my beside table is… what I empty out of my pockets at the end of the day In my opinion, the biggest issue facing small business is... staff and costs of running a business My secret to success is... hard work, long hours and enjoying your job I’m most proud of... my family and being out with my wife for over 30 years If I could, I’d tell my 20-year-old self that... it gets easier The best piece of career advice I can offer is... learn from your mistakes And if I wasn’t in my current role, I’d... be in sales of some kind PHOTO: DUBBO PHOTO NEWS/SARAH HARVEY

Builders Lic. 61247C. BELL 2599-03

AUSTRALIA’S

ONLY TRULY FIXED PRICE

Even if we hit rock

We are offering a “No Excuses Fixed Price Home Building Contract.” So you have the peace of mind knowing exactly what your home build will cost.

WHO’S BUILDING YOUR HOME?

DISPLAY HOME 3 Champagne Drive, Dubbo, NSW 2830

Zara Jom: 0428 128 860


41

Dubbo Photo News September 7-13, 2017

Wear It Purple Day By SARAH HARVEY WEAR It Purple Day was celebrated across the country on Friday, August 25, supporting and raising awareness for LGBTQIA+ youth. Staff from headspace Dubbo and the Dubbo Police Station weâ&#x20AC;&#x2122;re decked out in purple as they hosted a barbeque at the Rotunda. Kellyann Grayson, Jeremy Walsh and Melinda Brown

Scott Tanner, Nic Steepe, Narelle Jeffrey, Christina Rodgers and Dan Skelly

Staff from headspace Dubbo Kevin Saul, Keith Robinson, Paul Rich, Christina Rodgers and Nic Steepe

Kellyann Grayson, Scott Tanner, Dan Skelly, Melinda Brown and Lauren Acheson

Dubbo Celebrates Daffodil Day By SARAH HARVEY

Cancer Council Community programs coordinator Camilla Thompson and Orana Relay for Life chairperson Jason Dearmer with Dubbo Oncology Centreâ&#x20AC;&#x2122;s Dr Florian Honeyball.

Cancer Council Community programs coordinator Camilla Thompson and Orana Relay for Life chairperson Jason Dearmer presenting a bouquet of daffodils to patient Laurel Wakley at the Dubbo Oncology centre on Friday, August 25.

MANY community groups rallied together on Friday, August 25, to celebrate Daffodil Day. The money raised will help the fund the Cancer Councils vital research, providing support services, prevention programs and advocacy. Members of the Dubbo Cancer Support Group sold daffodils donated by Hot Poppyz Florist at their stall in Talbragar Street.

Irene Smith, Flo Ashby, Lorraine Scoble, Marlene Spittles, Nancy Farrell and Janelle Reid


42

September 7-13, 2017 Dubbo Photo News

National Aboriginal and Torres Strait Islander Day

Brooke Sullivan and Jena Glover from Live Better

Elsie Hocking, Brydie-Lee Olsen and Ryan Edwards

Joanna and Georgia Wiatkowski

By SARAH HARVEY STUDENTS from nine local pre-schools gathered at Victoria Park on Thursday, August 17, to celebrate National Aboriginal and Torres Strait Islander Day hosted by Live Better. The students participated in traditional dance lessons, made yarn dolls and learnt about the Aboriginal culture.

Students and staff from Playmates Cottage

Students and teachers with the Uniting Aboriginal Dancers

Students and staff from Carlton House Childcare Centre and Pre School

Dubbo’s Future Firefighters By SARAH HARVEY STUDENTS from Dubbo Early Learning Centre visited the Dubbo Fire Station on Thursday, August 26, getting the chance to tour the fire trucks and learn about fire safety. Keep your eye out for next year’s open day at the Dubbo Fire Station!

• FOR ALL YOUR WINDOW TREATMENTS • TO INSULATE – CUT HEATING & COOLING COSTS • NEW HOMES – BRING IN YOUR PLANS FOR A QUOTE • RENOVATING, NO JOB TOO BIG OR SMALL • BUILDERS & COMMERCIAL WORK MOST WELCOME NOW DOING FURNITURE UPHOLSTERY!

CUSTOM MADE CURTAINS, BLINDS, SHUTTERS & AWNINGS TO MATCH YOUR LIFESTYLE

KOOLTREND

98 Erskine St, Dubbo T: 6882 5790 www.kooltrenddubbo.com.au


43

Dubbo Photo News September 7-13, 2017

Andrey Gugnin wows audiences and students By GREG MARGINSON ANDREY Gugnin, the winner of the 2016 Sydney International Piano Competition, played a concert at Macquarie Conservatorium on Friday, August 11. At the end of the concert he was given a standing ovation from the appreciative and enthusiastic audience. In addition, Andrey gave a masterclass to three senior piano students and a small but interested audience.

Madelyn Fardell, Annette Fardell and Therese Bizakishaka

Andrew Glassop, Cynthia Xu and Vivienne Winther

Pam Harris, Talia Payne and Barbara Redgrave June Palmer, Sue and Bill Blackwell

Andrey Gugnin in Masterclass with Nadine Isbester

Start the weekend with a Grapevine coffee

Christine Lemon, Lilly Skinny

By MORGAN WILLIAMS SUCH a beautiful day at the Grapevine Cafe on Saturday, August 19, with locals taking advantage of the great weather to enjoy breakfast and a coffee.

Kellie Rainbow, Tim Houghton, Regi Kelleher, Kim Houghton, Naomi Post, Santosh GC

CLUB M MEMBERSHIP 1 YEAR - 5.50* 3 YEARS - $16.50*

JOIN

ONLINE OR FROM CLUB N RECEPTIO

Wes Barnes, Tyler Barnes

DUBBO RSL D U B B O

HUGE MEMBERS 70th BIRTHDAY PROMOTION

C H A N C E

*

NOT A MEMBER? JOIN NOW!

23 SEPTEMBER FROM 6PM

T O

Club Reception or www.dubborsl.com.au

EVERY THURSDAY FROM 6PM MEMBERS 70th BIRTHDAY PROMOTION N

96"5Ũ5 night away Y56281Ũ5

7 SEPTEMBER

FREE PHOTO BOOTH PLUS GIVEAWAYS ON THE NIGHT

members - free entry Non-members - $10 Doors open - 7.30pm FRIDAY 22 SEPTEMBER AUDITORIUM

CLUB MEMBERSHIP $5.50 JOIN NOW

14 SEPTEMBER | 21 SEPTEMBER

Calli n Supe g all r hero get h ere es in a flash !

Membership card must be presented at the door. 18 years and over. Limited Numbers

LTPS-17-14779 | LTPS-17-14936 *Conditions Apply

R S L

www.dubborsl.com.au | PH (02) 6882 4411

bo RSL Its Dub h day Bas h t ir 70th B ay 23 Saturd er 2017 Septemb m 11am – 1p

Entertainment Lounge Games, Activities sand art and Face Painting

LIKE US


44

September 7-13, 2017 Dubbo Photo News

classiďŹ eds

6885 4433  classies@dubbophotonews.com.au  CLASSIFIED ADVERTISING CLOSES AT MIDDAY EACH TUESDAY

PUBLIC NOTICES

FINANCE

HAIR & BEAUTY

HAND PICKED IMPORTS

Personal Insurance

HAIR SPECIALS

79 Macqaurie Street

UPCOMING TOURS

Murray River Ports 1st â&#x20AC;&#x201C; 6th Oct 2017

A Day on The Green 4th Nov 2017

Tasmanian Highlights 2nd â&#x20AC;&#x201C; 16th Oct 2017

Hunter Valley Garden Christmas Lights 8th â&#x20AC;&#x201C; 10th Dec 2017

Touch of Decadence Spring 11th â&#x20AC;&#x201C; 13th Oct 2017

Christmas on Norfolk 21st â&#x20AC;&#x201C; 30th Dec 2017

Queensland Gulf 28th Oct â&#x20AC;&#x201C; 9th Nov 2017

Australian Open Tennis 19th â&#x20AC;&#x201C; 25th Jan 2018

19 Day New Zealand Highlights 3rd â&#x20AC;&#x201C; 21st Nov 2017

The Wizard of Oz 3rd â&#x20AC;&#x201C; 4th Feb 2018

WE HAVE MOVED TO 4 JANNALI ROAD, DUBBO langleyscoaches.com.au PH: 6882 8977

'XEER$QWLTXHV &ROOHFWDEOHV :HVHOODQWLTXHIXUQLWXUHFKLQDFDVWLURQZDUH ROGWRROVDQGFROOHFWDEOHV

23(10RQ7KXUV)ULDPSP6DW 6XQDPSP &/26('7XHV :HG

Having the right cover can make all the difference when it counts - helping your family cope financially if you could no longer work or the unthinkable happens. If youi\ looking to establish new cover or simply want to review your existing personal insurance please call 02 6813 0977.

David McLennan

&Ć&#x152;Ä&#x17E;Ä&#x17E;/ĹśĆ&#x161;Ć&#x152;Ĺ˝Ä&#x161;ĆľÄ?Ć&#x161;Ĺ˝Ć&#x152;Ç&#x2021;dÄ&#x201A;ĹŻĹŹĆ?

0424 252 834 www.tm.org.au/dubbo

GARAGE SALE? FORGOT TO ADVERTISE? Call us by Tuesday 10am for our Thursday paper!

0431 200 466 Working from Sharon Fardellâ&#x20AC;&#x2122;s Hair Studio at 39 Bultje St

Â&#x2021; Resumes in 2-3 days Â&#x2021; Selection Criteria Â&#x2021; Job Applications Â&#x2021; All Correspondence Â&#x2021; Dubbo Based Â&#x2021; Servicing All Areas

M 0400 57 89 66

Nominate now for

E: putthatinwriting@bigpond.com Find us on facebook

Iâ&#x20AC;&#x2122;ll come to you...

Belinda Tink, Director CFP. MFinPlan. Adv. Dip. FS (FP) JP SMSF Specialist Advisorâ&#x201E;˘

Level 1, 139 Macquarie Street, DUBBO Foundation Wealth Planners Pty Ltd ABN 84 612 059 622 is an AR No. 1242404 and CR No. 488134 of FYG Planners Pty Ltd AFSL/ACL No. 224543 ABN 55 094 972 540

www.foundationwplan.com.au

PETS & LIVESTOCK

DOG TRAINING 0428 822 826 or 6882 4606 www.learnersonlead.com.au

FOR LEASE North Dubbo Highway Location. Refurbished office space, 2-3 offices. Older double lock up storage shed. Heating and cooling. $1000 plus GST per month.

DOG GROOMING IN NG \HDUVH[SHULHQFHÂ&#x2020;$OOEUHHGV :DVKFOLSDQGWKHZRUNV 6XPPHU DQG ZLQWHU FOLSV &DOO

PHONE: 333424 414 PHONE:0459 0417 277

TRADES & SERVICES

FOR SALE

STOP! DONâ&#x20AC;&#x2122;T MAKE A MOVE UNTIL YOU CALL

Formal cream material â&#x20AC;&#x2DC;Morganâ&#x20AC;&#x2122; lounge. 3 + 2 seater sections - will separate. As new, no marks. $800 for both.

NICK RYAN REMOVALS DUBBO â&#x20AC;˘ Affordable prices â&#x20AC;˘ Cartons for sale â&#x20AC;˘ Trading 7 days â&#x20AC;˘ Local and interstate

0448 878 320

nickryanremovals@hotmail.com

GARAGE SALE

PETER FINN ELECTRIC

SATURDAY, SEPTEMBER 9TH

PROP. STAN PRICE

Furniture, kitchen items and bric-a-brac for sale.

Licensed Electrical Contractor Dubbo and Surrounding areas

Phone 02 6882 2858 Lic No 214022C

38 Stroud Ave, Dubbo From 8am Moving sale. Household decor, kitchen bits and pieces, children toys and old collectables.

25 years experience in the local industry

0428 767 768 EFTPOS FACILITIES AVAILABLE

:+$7:(&$1'2)25<28Ę&#x2DC;

CALL DUDLEY

0417 467 330 COL THOMAS Plastering

- PLASTER RENOVATIONS - NEW WORK - RENOVATIONS & EXTENSIONS - INSURANCE CLAIMS

PHONE FOR A FREE QUOTE

0421 812 063

Get Plastered With Thomo Great service! Best picture!

SATURDAY, SEPTEMBER 9TH

O B I L E CO M M U

â&#x20AC;˘ Domestic irrigation installation & repairs â&#x20AC;˘ Mulch, large & small areas â&#x20AC;˘ Small tractor with backhoe & front end loader â&#x20AC;˘ Tree & shrub pruning â&#x20AC;˘ Lawn mowing & Garden maintenance

PHONE: 0459 414 PHONE: 6882333 9806

22 Darby Close, Dubbo From 8am

S â&#x20AC;&#x2122; O IO G R E AT F F C I M N

Mobile Phone Kits and Two-way sales & installations

FOR LEASE

FOR SALE

Ĺ?Ć&#x2030;Ä&#x161;Í&#x2022;Ä&#x17E;Ć&#x152;Ć&#x161;Ĺ?ĨĹ?Ä&#x17E;Ä&#x161; dDdÄ&#x17E;Ä&#x201A;Ä?Ĺ&#x161;Ä&#x17E;Ć&#x152;

Call Kelly for an appointment

PAGE 3 GIRL

'HSRW5RDG'XEER_3KRQH

dĆ&#x152;Ä&#x201A;ĹśĆ?Ä?Ä&#x17E;ĹśÄ&#x161;Ä&#x17E;ĹśĆ&#x161;Ä&#x201A;ĹŻDÄ&#x17E;Ä&#x161;Ĺ?Ć&#x161;Ä&#x201A;Ć&#x;ŽŜ ^Ĺ?ĹľĆ&#x2030;ĹŻÄ&#x17E;Í&#x2022;EÄ&#x201A;Ć&#x161;ĆľĆ&#x152;Ä&#x201A;ĹŻÍ&#x2022;ÄŤĹ˝Ć&#x152;Ć&#x161;ĹŻÄ&#x17E;Ć?Ć?Í&#x2DC; Ç&#x20AC;Ĺ?Ä&#x161;Ä&#x17E;ĹśÄ?Ä&#x17E;ͲÄ?Ä&#x201A;Ć?Ä&#x17E;Ä&#x161;Ä&#x17E;ĹśÄ&#x17E;ÄŽĆ&#x161;Ć?Í&#x2DC;

Âť Pensioner perms $90 Âť 1/2 head of foils or all over colour package from $100 Âť Packages include treatment, cut & straighten Âť More specials available!

NS

Awaken your inner hippie!

TRADES & SERVICES

Ian Brooks

TV Antenna Services AVAILABLE 7 DAYS - WILL TRAVEL Digital Antenna Installs Meter Testing & Tuning TV Wall Mounting 27 Doncaster Ave

Boosters & Accessories Extra Outlets Cable Concealing

0427 487 768

PHIL BOURKE GYPROCK PLASTERING Over 35 years experience in small and large repairs & extensions Lic No 2107C

PHONE 0418 452 474


45

Dubbo Photo News September 7-13, 2017

TRADES & SERVICES

TRADES & SERVICES

TRADES & SERVICES

STS AUTO ELECTRICS

AND COMMUNICATIONS YOUR LOCAL

DEALER

DO YOU NEED A TWO-WAY RADIO OR MOBILE PHONE KIT?

Mobile: 0418 638 299 Fax: 6884 7334

Stump Grinding | Tree Removal Mulching Cherry Picker Will travel | Qualified Insured | Free Quotes Pensioner-Rates

Email: cowboy46@bigpond.com

DAVE ALLAN’S ELECTRICAL SERVICE HOT WATER REPAIRS

Rob 0435 956 877 | Joe 0419 614 062

40 COBRA ST Lic no: MVRL48964 • RTA no: AU32536

0418 636 155 daveallanelectrical@bigpond.com ABN: 75 463 168 378

CURTAIN MAKING BY SUE GRISINGER ~ All soft furnishings and blinds ~ 20 years experience ~ Workroom is in my home in Dubbo ~ Professional free quotes

Phone 0428 880 439

Marks Budget Tree Service

HRG

Plumbing & Gas Fitting

Peter “Pistol” Edwards

0488 263 012

• All commercial and residential jobs • No jobs too small • Special pensioner rate • Servicing Dubbo and surrounding areas

OUTBACK VAC GUTTER CLEANING OutBack Vac specialises in gutter cleaning, the removal of Cellulose Insulation and cleaning of Roof Cavities.

TRADES & SERVICES ORANA HEADSTONES & MONUMENTS SERVICING THE CENTRAL WEST

Full graves & lawn cemeteries. Accessories & Plaques. Free Quotes. Restoration work. Competitive Pricing. Ph/Fax 6888 1015 Mob 0439 881 014

“Operating out of Dubbo”

STOVE REPAIRS FRIDGE REPAIRS HOT WATER REPAIRS - WASHER REPAIRS

DOUG PROPERT ELECTRICAL Licensed Electrician 33208C

FREE quotes Dubbo

Phone any time:

0419 628 941

CALL NOW to discuss your needs with Mick on 0448 680 845

LOCALLY OWNED

License no. 275861C

HOCKING IRRIGATION & TRENCHING • Domestic and rural pump repairs, new pump installations including solar pumps • Domestic and rural irrigation systems including stock water and garden sprinkler systems • Trenching and post hole digging • Free quotes Servicing Dubbo and Narromine

Terry: 0428 816 577 | ABN 90 797 749 250

Monday – Friday 9am – 5pm Saturday 9am – 12noon Book us to photograph your event! Smile and dial

90 Victoria St Dubbo

6885 4753

sales@poolhut.com.au visit us at www.poolhut.com.au

Garage Sale? Forgot to advertise? Book your classified by 10am Tuesday for that week’s publication classies@dubbophotonews.com.au or 6885 4433

Buy it. Tell it. Sell it.

Fencing All Types COMMERCIAL • RURAL • RESIDENTIAL Lic # 303811C • Fully Insured Phone Andrew on 0412 253 628 Email: acpcontracting2830@gmail.com


46

THE DIARY

Gollan CWA Annual Craft Day THE Gollan CWA Annual Craft Day is being held on September 20 in Gollan Hall. 9.30am for 10am start. $12 entry includes morning tea, lunch, afternoon tea and lucky door. Lots of demonstrations throughout the day. RSVP to Margaret 68865207 or Karen 68865186. Australia Decorative and Fine Arts Society JOIN us on Monday, September 18 from 6pmat the Wesley Hall on Church Street when Ghislaine Howard will tickle our taste buds with her talk on artists, their recipes and anecdotes. Bring a pen along for the recipes of The Cuisine of Art and Art of Cuisine. Non-Members $20. Light refreshments to follow. For further information contact Bruce Gray 0419 299 795. Old Time/ New Vogue Dance WILL be held Sunday, September 10 at Masonic Hall in Church Street, from 2pm6pm, $10. BYO supper to share, tea and coffee provided. Contact: Graham 6888 5603. Dubbo Evening VIEW’s Card and Games Afternoon THE Dubbo Evening VIEW’s Card and Games Afternoon will be held Friday, September 15 at 1.00pm at the Masonic Hall on Derby Close. Entry fee is STILL only $5.00, and includes an excellent afternoon tea. For further information please call Shirley on 6882 2874. Dubbo Evening VIEW Club Dinner THE Dubbo Evening VIEW Club’s Dinner for September will be held at the RSL Monday, September 18 at 7.00pm. Members are reminded they are always most welcome to invite a guest to the dinner. For bookings, cancellations and further enquiries, please call Beth before 10.00am Friday, September 15 on 6882 7557. Orana Gardens Retirement Village Annual Spring Fair THE Orana Gardens Retirement Village Annual Spring Fair is being held on Saturday, September 23 at the Village’s Country Club located in Charles Crescent, East Dubbo. Lucky door prizes, raffles, afternoon tea, spinning demonstrations, candles, soaps, scarves, jewellery and yummy treats available. Adults $10, students $5 with proceeds going to upgrading facilities for residents. Dubbo Diabetes Support Group MEETING at Sporties on Tuesday, September 19 at 10am. Morning tea and guest speaker before the meeting. For more information phone Helen Tink on 6882 9770. Talbragar CWA Street Stall THE Talbragar CWA will be holding a street stall in Talbragar Street, front of

September 7-13, 2017 Dubbo Photo News

Send your community event info to diary@dubbophotonews.com.au or phone 6885 4433

the Post Office on Friday, September 15 from 8am. All the usual goods will be on sale with many books and a competition. Come along and assist Talbragar CWA raise money for the ongoing maintenance of their hall. Muller Park Tennis Club Inc. Charity Day THE Muller Park Tennis Club Grahame Priest & Warren McLennan Memorial Charity Day is being held on Sunday, September 24 at Muller Park Tennis Club in Brisbane Street between 11am and 4pm. All funds raised are going to Camp Quality Western Region. Adults $10, Under 16 $5. For more information email mullerparktennisclub@gmail.com. Orana C.P.S.A Pensioners Meeting ORANA C.P.S.A pensioners meeting will be held on Friday, September 8, at the Dubbo Neighbourhood Centre at 10am. Join in for a cuppa with a friendly group. Guest speaker will be Independent Candidate Peter Muller. Enquires to Ken Windsor 0412 016 228 or Liz Moxham 6885 0606. Arthritis Meeting THE next meeting of the Dubbo Support Group of Arthritis NSW will be held on Thursday, September 14, at the Dubbo Neighbourhood Centre, 1/80 Gipps Street commencing at 2pm. Please bring a plate for afternoon tea. Bay Audio will be our Guest Presenters. Diabetes Group members welcome. Join us for our Social Luncheons on the fourth Thursday of each month, from noon. Venue is Sporties, 101 Erskine St. Next one is on 24th August, then 28th September. Contact: Heather on 6887 2359 or 0431 583 128. Dubbo and Orana Region Orchid Society Spring Show OUR Spring Show will be held on Saturday, September 16, from 10am until 4pm and Sunday, September 17, from 10am until 2pm. Contact Christine on 0428 873 221. Transcendental Meditation (TM) MAHARISHI Foundation Australia and Dubbo Transcendental Meditation Centre provide free introductory talks on the scientifically proven benefits of TM every Sunday at 2pm. Contact David on 0424 252 834 or www.tm.org.au to book. Dubbo City Ladies Probus DUBBO City Ladies Probus will meet on Tuesday, September 12, from 10am to 12pm at the Masonic Village Hall, Darby Close (off White Street). Join us for two hours of fellowship, friendship, fun and morning tea. Guest speaker on the day with an interesting and informative talk. Admissions is $6.00. Contact: Nora 6882 0707 or Liz 6885 3542. Australian Red Cross CPR Course THE Australian Red Cross are hosting night a weekend CPR courses throughout

September working with families who are unable to attend day courses. Courses will be run every Monday and Wednesday Night from 6pm and Saturdays from 8.30am to 1pm. Bookings are now being taken. Call 1300 367 428. Annual Spring Fair WILL be held on Saturday, September 23, at Orana Gardens Retirement Village, Cnr of Charles Crescent and Coronation Drive. Australian Air Force Cadets NOW recruiting 13-18 year olds prepared for a challenge and to undertake fun and rewarding activities. Come down to your local unit, 313 “City of Dubbo” Squadron, at the Army Barracks (cnr Kokoda Pl and Wingewarra St). Parade time Mondays 6-9.30pm. Contact: Michael White 0437 997 708 Coffee and Craft CRAFT and morning tea group are meeting Thursdays this month at the Gospel Chapel, 74 Boundary Rd (Cnr Boundary and Taylor Street) from 9.30am to 12 noon. August meetings will be held on the 3rd, 17th and 31st. Contact: Beth 6885 3153. THURSDAY Clothing Pool SUPPORTED by Clothesline and Freemasons. Fortnightly on Thursdays from July 6. 9am to 11am. 151 Fitzroy Street, Dubbo (Allira Aboriginal Day Care Centre). Free and low cost clothing. Phone: 6882 9503. Seniors Strengthening Exercise Group THURSDAYS from 1.30pm to 2.30pm at St Bridges Hall. Usual arrangements, $2 donation. Contact: Richard and Elva 6888 5656. Woodturning & Carving Evening THURSDAYS, Art & Craft Cottage, 137 Cobra Street Dubbo. Contact: Phil Drew 6887 3257. Dubbo Community Men’s Shed OPEN Monday 9am to 1pm, Thursday and Saturday 1pm-5pm. To become members there is a small joining and annual membership fee, after 3 visits. “All men are welcome”. Contact: 6881 6987. Dubbo War Widows Guild GET together 11am the fourth Thursday of the month. Please register your attendance or apology with Avis 6882 5710 by 12pm the Wednesday prior. South Dubbo Veteran’s & Community Men’s Shed Bingo THURSDAYS, new players welcome. 11-12.30pm, West Dubbo Bowling Club. Walking Group THURSDAYS at 8am, meet corner Macquarie & Tamworth Streets, Contact: May 6882 4371.

Diary entries need to be 50 words or less, and placement will be at the editors discretion subject to content availability. Diary listings are free. Please include your daytime phone number and/or address. Entries close 10am Tuesday for that Thursday’s edition.

Dubbo Orana RSL Day Club MEET Thursdays at the Country Club from 10am to 2pm. $5 includes morning tea, card playing, games and light lunch followed by Bingo until 2pm. Transport can be arranged for $2. Contact: Ailsa on 6882 0036. Sugarcraft First Sunday of the month from 1pm-4pm, first and third Thursdays of the month from 10am-1pm and the fourth Monday of the month from 10am-1pm at The Art & Craft Cottage, 137 Cobra Street Dubbo. Contact: Shirley 6887 3150. Dubbo CWA MEET the first Thursday of the month at Sporties in Erskine Street at 9:30am for 10am. New members welcome. Contact: Marion 6884 2957. CWA Wongarbon FIRST Thursday of the month, held at Wongarbon CWA rooms 10am. Contact: Marjorie 6884 5558. Sketch Meet Dubbo FIRST Thursday of the month, 6.30pm8.30pm at the Macquarie Club, Dubbo. Come along for some sketching and a bit of banter! Find us on Facebook. Conversational English in Dubbo MEET Thursdays at Wesley Community Hall, cnr of Church St and Carrington Ave, 2.00pm to 3.00pm. Attendance is free. All welcome. Contact: Chris Owens 6884 0407. FRIDAY Tai Chi at U3A FRIDAYS from 10am at Community Arts Centre, Western Plains Cultural Centre, 76 Wingewarra Street, Dubbo. Contact: Richard 6888 5656. Central West Makers Place MEET each Friday from midday till 6pm at South Dubbo Veterans and Community Mens Shed property, corner of Palmer and High St’s Dubbo. Other times will be negotiated as member numbers grow. Activities include such things as 3D printing, basic electronics, robotics, silk screening and pottery. Contact: Adam Clark 0431 038 866. Spinning and Weaving FRIDAYS, 10am at The Art & Craft Cottage, 137 Cobra Street, Dubbo. Contact: Jo Thomas 6885 6875. Alzheimers & Dementia Support Group MEET the first Friday of the month at 2pm at The David Palmer Centre, Lourdes Hospital. Contact: Kath 6881 3704. Western Plains Trefoil Guild MEET second Friday of each month at Dubbo West Guide Hall, 10.30am. Contact: Dorothy 6884 6646 for confirmation of meeting. Everyone welcome.

Dubbo Parkinson’s Support Group MEETS at The David Palmer Centre, old Lourdes Hospital on the first Friday of each month at 11.00am. People with Parkinson’s and their Carer’s welcome. Contact: Lorna 0416 240 626. Smart Recovery ASSISTS individuals with changing any problematic behaviour, including alcohol and drugs, gambling, food, shopping, internet and others. The Smart Recovery Group meets at 3pm on Friday afternoons at the Dubbo Neighbourhood Centre. Smart Recovery, changing behaviour for a better life. SATURDAY Ladies Lawn Bowls LADIES lawn bowls at Sporties Dubbo every Tuesday and Saturday morning from 9.15 am for a 10.00 am start. Learn the game of bowls. Coaching is available and can be arranged by contacting the Bowls Co-ordinator, Nic Gannon on 6884 2044. There is no need to join the club unless you wish to progress competitively in the future. Experienced bowlers are also welcome to join our ranks. Dubbo & Dist. Kennel Club OBEDIENCE training Saturdays at the big shed, Dubbo Show Ground at 9.30am. No puppies under 14 weeks, must bring up to date vaccination certificates, $5 to join and $5 per session. Contact: Michael 0419 274 632. Old Time/ New Vogue Dance SECOND Saturday of the month. Masonic Hall in Church Street, commencing 7.30pm, $10. BYO supper to share, tea and coffee provided. Contact: Graham 6888 5603. Old Time/ New Vogue Dance FIRST and third Saturday of the month, 7.30pm to 11.30pm, Eumungerie RSL Hall, Railway Street, Eumungerie. BYO supper, tea/coffee provided. $10 admission. Music by Tony. Caravan Park with powered sites for travellers across the road. Contact: Tony 0427 472 142 or 6847 2142. Sit ‘n Knit FIRST Saturday of the month, Sit ‘n Knit 11am-1pm. All ages welcome. Macquarie Regional Library, Macquarie St Dubbo. Contact: 6801 4510. Farmers Markets EVERY first and third Saturday of the month. Lions Park adjacent to Visitors Centre, Bligh Street Dubbo. www. dubbofarmersmarket.org.au. Market coordinator 0488 685 006 or enquiries@ dubbofarmersmarket.org.au Dubbo Slot Car Racing Club Seniors (15+) FIRST and third Saturdays, 4pm at 147 Birch Avenue. Contact: Terry 0408 260 965.

Women’s Safety at the Dubbo Neighbourhood Centre Assisting victims of family and Domestic Violence through service co-ordination, case-management, advocacy, and navigation. Contact Teagan Martin: 02 6882 2100


47

Dubbo Photo News September 7-13, 2017 Narcotics Anonymous NA meets every Saturday at 6pm at St Brigid’s Church, in the old building, entry via Brisbane Street. Identification (ID) Meeting. Contact Linda on 0419 588 086. Seventh-day Adventist Church DUBBO Seventh-day Adventist Church, corner Cobra and Sterling Streets, invites you to fellowship on Saturdays. Small group bible study (Sabbath School) and children’s / youth Sabbath School at 9.30am. Divine service at 11am. For further information visit http://dubbo. adventist.org.au R.S.L. Tennis Club THE Dubbo R.S.L. Tennis Club invites locals to join the club for enjoyable social tennis at the RSL Park St courts on Saturdays from 12.45pm each week. Contact: 0428 825 480. SUNDAY Traditional Catholic Latin Mass SECOND Sunday of every month at 9am at the Rawsonville Soldier’s Memorial Hall, Rawsonville Road. Contact: 0429 872 241 or 6887 2241 for more information. Orana Country Music Inc. DUBBO RSL Club, last Sunday of the month, 2-6pm. “Walk up muster” all welcome. Contact: 6885 4995. Hope Christian Fellowship Dubbo NOW at the Girl Guides Hall, Dianne A’Beckett Place, Dubbo. Sunday at 10am. Any further information phone 6884 6287. Dubbo Folk Club SECOND Sunday of each month, 2.306pm at the Western Star Hotel. Come and enjoy an afternoon of all types of acoustic music. Pleasant surroundings and friendly people, sit and sing along or bring and instrument and join in. Contact: Dawn 6889 4427. Dubbo Country Music Hoedown SECOND Sunday of each month. RSL Entertainment Lounge, 2-6pm. All ages welcome. Contact: Shane 0407 022 999. Bicycle User Group Social Ride SUNDAYS, 9am at Wahroonga Park. Contact: Kathy 6882 5533 or Mick 0437 136 169. Orana Pistol Club SUNDAYS, Hyandra Lane, Dubbo at 9am. Contact after 9am at range Sunday only on 6887 3704. Dubbo Junior AFL COME along Sunday mornings for Dubbo Junior AFL. 8am, South Dubbo Oval. Lots of fun for boys and girls playing AFL in Dubbo. Ages 5 to 12. See Dubbo Junior AFL on Facebook. MONDAY Dubbo Camera Club THE Dubbo Camera Club is open to anyone who wants to improve their digital

GO FIGURE

Dubbo Club Inner Wheel Australia have inducted a new member to the community service group. Pictured is new member Annett Hoynes, district chairwoman Janet Power and current Dubbo Club president Meryl Usback. PHOTO: Supplied.

camera skills in a friendly, relaxed setting. We meet in the shed at the rear of the Dubbo Arts and Crafts Cottage, 137 Cobra St Dubbo on the second and fourth Mondays monthly at 7.30pm. Contact: Col 0429 689 158. Rotary Club of Dubbo MEET Monday nights at the Westside Hotel, Whylandra Street, West Dubbo from 6-8pm. Our President Sandy Birkett can be contacted on nap64@yahoo.com or 0412 158 940. Dubbo Multicultural Women’s Group MEET every third Monday of the month, 10am at the Dubbo Neighbourhood Centre. All women from non-English speaking backgrounds most welcome. Contact: 6882 2100. Monday Cards COME along and enjoy and afternoon of cards at Club Dubbo, 82 Whylandra Street West Dubbo, from 1pm on the fourth Monday of each month. Old Time Dance FIRST Monday of the month at Orana Gardens Country Club, 10am to 12pm. Come and enjoy some old time dance. Contact: Jean on 6882 8867. Dubbo Euchre Club MONDAYS, 6:30pm at the Dubbo City Bowling Club. Everyone is welcome to come along. $5 entry, prizes are won throughout the night. Trivia Night MONDAYS, 7pm, South Dubbo Tavern. Sing Australia Dubbo Choir MONDAYS, 7.30-9.30pm, Bridge Club, Bultje Street. NO auditions, no requirements to read music and no singing experience necessary. Contact: 0428 129 743. Patchwork MONDAYS, 10am-3pm, Art & Craft Cottage, 137 Cobra Street. Contact: June 6882 4677. Cake decorating FIRST Monday of the month at 10am at the Art & Craft Cottage, 137 Cobra Street Dubbo. Contact: Shirley 6887 3150. Anglican Women’s Association MONDAYS, 5.30pm at Holy Trinity.

Contact: Dorothy 6884 4990. RFDS Support Group FIRST Monday of the month, 6pm at the RFDS Base Dubbo Airport. Contact: Terry Clark 0407 444 690 (except P/H). Peace and Healing Meditations BEGINNERS meditation classes, every Monday 1-2pm at the Dubbo Neighbourhood Centre 1/80 Gipps St. By donation, beginners welcome. Presented by Wellington Buddhist Centre. Contact: 6845 4661. TUESDAY Ladies Lawn Bowls LADIES lawn bowls at Sporties Dubbo every Tuesday and Saturday morning from 9.15 am for a 10.00 am start. Learn the game of bowls. Coaching is available and can be arranged by contacting the Bowls Co-ordinator, Nic Gannon on 6884 2044. There is no need to join the club unless you wish to progress competitively in the future. Experienced bowlers are also welcome to join our ranks. Golf Croquet TUESDAY, Thursday and Saturday, 8.30am for 9am start at the Dubbo City Croquet Club (located behind the Dubbo City Bowling Club). Contact: Beth 6884 3015. Bingo TUESDAYS, 1.30pm-3.30pm, Sporties. Contact: Margaret 6882 4737 or Barb 6882 5893. AllAbilitiesDanz TUESDAYS 9.45am at Dubbo RSL Memorial Club. Classes are low impact, work on heart health, flexibility, mobility, coordination and strength. Call Tracy 0416 010 748 for a free trial or to join the free class. Seniors Strengthening Exercise Group TUESDAYS from 1.30pm to 2.30pm at St Bridges Hall. Usual arrangements, $2 donation. Contact: Richard and Elva 6888 5656. Girls Brigade THE Dubbo Girls’ Brigade meets each Tuesday, during school term at the Orana

PUZZLE EXTRA

Baptist Church, 4 Palmer St from 6pm to 8pm and is for all school aged girls. Enjoy craft, games, camps, stories, songs, cooking and much more. Contact: Julie 6882 4369. Swing Dancing Classes COME for a dance for great fun and fitness. No need to bring a partner. All ages welcome. Tuesdays 6:30pm at Charles Sturt University. $5. For more details check out www.facebook.com/ swingdancingdubbo or call 0401 928 998. Dubbo Embroiderer’s MEET the second and fourth Tuesday at the Dubbo Bridge Club, Elston Park from 9:30am to 3pm. All welcome. Contact: Isobel Morgan 6882 3889. For Saturday group information contact Ruth 6882 7336. Badminton TUESDAYS 7.30pm-9.30pm, Delroy High School Auditorium, East Street, West Dubbo. $5 to play ($3 for school students) $22 yearly insurance ($15 for school students). All welcome, great fun and exercise. Contact: Chris 6887 3413. NALAG Centre MENS morning tea on the first Tuesday of the month, women’s morning tea on the third Wednesday of the month. Contact: 6882 9222. South Dubbo Veteran’s & Community Men’s Shed MEET Tuesdays from 9am to 12noon, new members welcome. Rotary Club of Dubbo Macquarie Meets THE club meets at the Westside Hotel 12.30pm until 2.00pm. Contact: Lorna 0408 827 526. Depression Recovery Group TUESDAYS, 10.30am at the Department of Mental Health, 41 Bultje Street Dubbo. Contact: Norm 6882 6081, Brian 6885 6547 or Bill 6882 9826. Rotary Club of Dubbo South MEETS Tuesdays at 6pm for 6.30pm start meeting and Dinner, at the South Dubbo Tavern, Cnr Boundary Rd and Fitzroy St Dubbo. Toastmasters Club MEET at 7-9pm, first and third Tuesday of the month at Dubbo RSL Club, Brisbane St. Visit the club to gain confidence in speaking and leading skills. There are club, area and district competitions to participate in. Contact Sharon Allan 0408 156 015 or email sallan@rhdubbo.com.au for further information. Probus Mens TUESDAYS, 10am Masonic Village Hall, Darby Close, Dubbo. Fellowship and friendship. Morning tea and guest speaker. Contact: Ken 6885 2676.

MEGA MAZE

Book Club TUESDAYS, 2pm, Macquarie Regional Library, Macquarie St, Dubbo. Lions Club of Dubbo Inc TUESDAYS, 7pm for 7.30pm start, dinner and meeting at Club Dubbo. Contact: Bob 6882 8746 or 0408 636 953, Hugh 0429 151 348. Dubbo City Ladies Probus TUESDAYS, 10am to 12noon at the Masonic Village Hall, Darby Close (off White Street) Dubbo. All enquires to Liz 6885 3542 or Nora 6882 0707. Dubbo and District Computer Club TUESDAYS, 7pm Akela Place Hall Dubbo. Contact: Daryl 0408 284 300. Above Board Gamers GET involved in the fastest growing hobby in the world, board gaming. At Pipe Band Hall the second and fourth Wednesday of each month from 6pm. Bring a board game or borrow from the extensive library. No experience needed. Free. Contact: Alan 0432 278 235 or Andrew 0400 014 342. WEDNESDAY

Dundullimal Dubbo Support Crew Inc MEETS the fourth Wednesday of each month at 10am. We support the operations at the Homestead, guiding, tours, gardening, helping in café. Great fun, and friendship, you learn as you go! Come to our next meeting or ring 6884 9984 or email dundullimal@nationaltrust. com.au Geurie Craft Group MEETS every Wednesday at Geurie Bowling Club from 9am-2pm. Everyone welcome. Contact: Thelma 6887 1103. The Dubbo Garden Club MEET on the first Wednesday of every month at 10am, each month with a new garden or guest speaker. Come along and enjoy whatever is arranged. New members are most welcome with an application form available on request. Contact: Kay 0428 821 538, Marie 6881 6443 or Colleen 6882 2825. Blood Cancer Support Group MEET first Wednesday of each month. Contact: Louise or Emma on 0412 706 785. Overeaters Anonymous OA meets every Wednesday at 5.30pm at St Brigid’s Church, in the old building, entry via Brisbane Street. Speaker/ Identification Meeting. Contact: Rachel 0476 002 928. Cancer Support Group WEDNESDAYS, 12pm, David Palmer Centre, Lourdes Hospital. Contact: Genelle 6841 8513. CWA Evening Branch WEDNESDAYS, 7.30pm, Dubbo Library. Contact: Helen Walsh 6882 8050.

SPOT THE DIFFERENCE

SUDOKU EXTRA

The idea of Go Figure is to arrive at the figures given at the bottom and right-hand columns of the diagram by following the arithmetic signs in the order they are given (that is, from left to right and top to bottom). Use only the numbers below the diagram to complete its blank squares and use each of the nine numbers only once.

Place a number in the empty boxes in such a way that each row across, each column down and each small 9-box square contains all of the numbers from one to nine.

EXTRA SOLUTIONS: See the TV+ Guide


48

September 7-13, 2017 Dubbo Photo News

TV+

Friday September 8 ABC

PRIME7

6.00 News. (CC) 9.00 ABC News. (CC) 10.00 One Plus One. (CC) 10.30 Compass. (PG, R, CC) 11.00 Grand Designs. (R, CC) 12.00 ABC News At Noon. (CC) 1.00 The Home Show: A Foreign Correspondent Special. (R, CC) 2.00 The Doctor Blake Mysteries. (M, R, CC) (Final) 2.55 Home Fires. (R, CC) 3.45 Eggheads. (R, CC) 4.15 Pointless. (R, CC) 5.00 ABC News: Early Edition. (CC) 5.30 The Drum. (CC)

6.00 9.00 11.30 12.00 2.00 3.00 4.00 5.00

NINE

Sunrise. (CC) The Morning Show. (PG, CC) Seven Morning News. (CC) MOVIE: A Teacherâ&#x20AC;&#x2122;s Obsession. (M, CC) (2015) Molly Hagan. The Daily Edition. (CC) The hottest issues from the dayâ&#x20AC;&#x2122;s news. The Chase. (R, CC) Hosted by Bradley Walsh. Seven News At 4. (CC) The Chase Australia. (CC)

WIN

SBS

6.00 9.00 11.30 12.00 1.00

Today. (CC) Today Extra. (PG, CC) Morning News. (CC) The Ellen DeGeneres Show. (PG, CC) MOVIE: Pretty In Pink. (PG, R, CC) (1986) A poor girl must choose between two boys. Molly Ringwald, Jon Cryer. 3.00 News Now. (CC) 4.00 Afternoon News. (CC) 5.00 Millionaire Hot Seat. (R, CC) Hosted by Eddie McGuire.

6.00 Ent. Tonight. (PG, R, CC) 6.30 Family Feud. (R, CC) 7.00 WIN News. (R, CC) 8.00 The Bold And The Beautiful. (PG, R, CC) 8.30 Studio 10. (PG, CC) 12.00 Dr Phil. (PG, R, CC) 1.00 The Living Room. (PG, R, CC) 2.00 Entertainment Tonight. (CC) 2.30 Benâ&#x20AC;&#x2122;s Menu. (R, CC) 3.00 Judge Judy. (PG, CC) 3.30 Alive And Cooking. (CC) 4.00 Everyday Gourmet With Justine Schofield. (R, CC) 4.30 The Bold And The Beautiful. (PG, CC) 5.00 TEN Eyewitness News. (CC)

6.00 France 24 English News. (CC) 6.30 Al Jazeera. (CC) 7.00 BBC News. (CC) 7.30 Italian News. 8.10 Filipino News. 8.40 French News. 9.00 Tennis. (CC) US Open. Womenâ&#x20AC;&#x2122;s semi-finals. 2.00 Cold Justice. (R, CC) 2.30 The Point Review. (R, CC) 3.00 The Marngrook Footy Show. (R, CC) 4.30 Antonio Carluccioâ&#x20AC;&#x2122;s 6 Seasons. (R, CC) 5.00 Cycling. (CC) Vuelta a EspaĂąa. Stage 18. Suances to Santo Toribio de LiĂŠbana. 169 km hilly stage. Highlights. From Spain. 5.30 Letters And Numbers. (R, CC) 6.00 River Cottage Australia. (CC) Paul West is busy with his everexpanding farm, so he employs a local as a part-time farm hand. 6.30 SBS World News. (CC) 7.30 Great British Railway Journeys: Great Yarmouth To Beccles. (R, CC) Presenter Michael Portillo embarks on a journey from Great Yarmouth in Norfolk to Beccles in Suffolk. Along the way, he delves into the history of grave robbing and tries his hand at working a swing bridge. 8.40 MOVIE: The Girl With The Dragon Tattoo. (R, CC) (2011) A crusading journalist and a computer hacker investigate the disappearance of a young woman, a member of a wealthy Swedish family, at the behest of the girlâ&#x20AC;&#x2122;s uncle. Daniel Craig, Rooney Mara. 11.35 SBS World News Late Edition. (CC)

6.00 Sideliners. (PG, CC) 7.00 ABC News. (CC) Coverage of local, national and international news, including the dayâ&#x20AC;&#x2122;s sport and weather updates. 7.30 The Link. (CC) Host Stan Grant connects current topics and major news stories with peopleâ&#x20AC;&#x2122;s lives. 8.00 QI. (PG, R, CC) Guests Jo Brand, Andy Hamilton and Ben Goldacre join Stephen Fry for an â&#x20AC;&#x153;Iâ&#x20AC;?-themed episode. 8.30 Thirteen. (M, CC) Part 2 of 5. The arrival of a team from Scotland Yard puts Ivy under pressure to relive her ordeal, but her responses raise Merchantâ&#x20AC;&#x2122;s suspicions further. Ivy turns to Tim for support only to suffer a blow. 9.30 Happy Valley. (MA15+, CC) (Final) Catherine confronts a delusional Frances, while Johnâ&#x20AC;&#x2122;s torment leads him to desperate measures.

6.00 PRIME7 News. (CC) 6.30 PRIME7 News @ 6:30. (CC) 7.00 Better Homes And Gardens. (CC) Joh, Jason and Ed go behind the scenes at AgQuip, Australiaâ&#x20AC;&#x2122;s biggest agricultural event. 8.30 MOVIE: Sweet Home Alabama. (PG, R, CC) (2002) A New York socialite returns to Alabama to divorce the man she married, and left behind, years earlier. Though she is determined to end her contentious marriage and move on with her life, she soon realises putting her past to rest may be far more difficult than she ever imagined. Reese Witherspoon, Josh Lucas. 10.45 To Be Advised. 11.45 The Goldbergs. (M, R, CC) After Dana comes to town, Adam misinterprets her lack of enthusiasm for Weird Al Yankovic.

6.00 Nine News. (CC) 7.00 A Current Affair. (CC) 7.30 Rugby League. (CC) NRL. Second Qualifying Final. Sydney Roosters v Brisbane Broncos. From Allianz Stadium, Sydney. 10.10 MOVIE: Seeking Justice. (MA15+, R, CC) (2011) After his wife is assaulted, an English teacher enlists the services of a vigilante group to help him settle the score. However, they then reveal that they want a â&#x20AC;&#x153;favourâ&#x20AC;? from him in return for their aid. Nicolas Cage, Guy Pearce, January Jones.

6.00 WIN News. (CC) 6.30 The Project. (CC) Join the hosts for a look at the dayâ&#x20AC;&#x2122;s news. 7.30 The Living Room. (CC) Jamie brings new life to a familyâ&#x20AC;&#x2122;s garden. Amanda pays a visit to the musical, Kinky Boots. 8.30 Have You Been Paying Attention? (M, R, CC) Celebrity guests include Ed Kavalee, Chrissie Swan, Nick Cody, Kitty Flanagan and Sam Pang. 9.30 Shark Tank. (R, CC) A panel of business people is pitched inventions and innovations including spices, a squid-cleaning product and a dog grooming venture, that they then have the opportunity to invest in. Hosted by Sarah Harris. 10.30 Australian Survivor. (PG, R, CC) A surprise challenge sees one castaway return to camp with an unexpected power.

10.35 Lateline. (R, CC) 11.05 The Business. (R, CC) 11.20 Shaun Micallefâ&#x20AC;&#x2122;s MAD AS HELL. (M, R, CC) (Final) 11.50 Planet America. (R, CC) 12.20 Rage. (MA15+)

12.30 Home Shopping. (R)

12.15 Law & Order. (M, R, CC) 1.15 Nine Presents. (R, CC) 1.30 TV Shop: Home Shopping. (R) 2.00 Filthy Rich. (M, R, CC) 3.00 The Avengers. (PG, R) 4.00 Global Shop. 4.30 Good Morning America. (CC)

12.00 WINâ&#x20AC;&#x2122;s All Australian News. (CC) 1.00 The Project. (R, CC) A look at the dayâ&#x20AC;&#x2122;s news. 2.00 48 Hours: Murder In Pinyon Pines. (M, R, CC) 3.00 Home Shopping. (R)

ABC2

7TWO

6.00 Childrenâ&#x20AC;&#x2122;s Programs. 6.50 Shaun The Sheep. (R) 7.00 Spicks And Specks. (R, CC) 7.30 Dirty Jobs. (PG, R, CC) 8.20 Catfish: The TV Show. (PG, R, CC) 9.00 Secret Life Of The Human Pups. (MA15+, R, CC) 9.45 You Canâ&#x20AC;&#x2122;t Ask That. (MA15+, R, CC) 10.15 Penn & Teller: Fool Us. (PG, R, CC) 11.00 The Lie Detective. 11.45 Anthony Bourdain: Parts Unknown. 12.30 The Traffickers. 1.10 Highway Thru Hell. 2.45 Dirty Jobs. 3.35 News Update. 3.40 Close. 5.00 Childrenâ&#x20AC;&#x2122;s Programs.

ABC ME 6.00 Childrenâ&#x20AC;&#x2122;s Programs. 5.05 Eve. (R, CC) (Final) 5.35 Grojband. (R, CC) 6.00 Camp Lakebottom. (R, CC) 6.10 Slugterra. (R, CC) 6.35 Make It Pop! (R) 7.00 Horrible Histories. (R, CC) 7.30 Deadly 60. (R, CC) 8.00 BtN Newsbreak. (CC) 8.05 Backstage. (R, CC) 8.30 Dance Academy. (R, CC) 8.55 The Haunting Hour. (PG, R, CC) 9.15 Kamisama Kiss. (PG, R, CC) 9.40 Close. 5.00 Arthur. (R, CC) 5.25 Sally Bollywood. (R, CC) 5.35 Almost Naked Animals. (R, CC) 5.45 Childrenâ&#x20AC;&#x2122;s Programs.

ABC NEWS 6.00 News. (CC) 9.00 News. (CC) 6.00 ABC News National. 6.30 The Drum. (R, CC) 7.00 ABC News With The Business. 9.00 Planet America. 9.30 Lateline. (CC) 10.00 The World. 11.00 ABC News. (CC) 11.30 The Link. (R, CC) 12.00 News. 12.30 Drum. (R, CC) 1.00 Al Jazeera. 2.00 BBC World. 2.30 The Link. (R, CC) 3.00 BBC World. 3.30 Drum. (R, CC) 4.00 Al Jazeera. 5.00 BBC World. 5.30 Lateline. (R, CC)

9GO!

6.00 Morning Programs. 9.30 NBC Today. (R, CC) 12.00 House Of Wellness. (PG, R, CC) 1.00 Better Homes. (R, CC) 2.00 Deal Or No Deal. (R, CC) 2.30 Million Dollar Minute. (R, CC) 3.00 Animal Rescue. (R, CC) 3.30 60 Minute Makeover. (PG, R) 4.30 Escape To The Country. (R) 6.30 Bargain Hunt. (R) 7.30 Cities Of The Underworld. (PG, R) 8.30 Selling Houses Australia. (CC) 10.30 The House That ÂŁ100K Built: Tricks Of The Trade. (R) 11.30 Bargain Hunt. (R) 1.00 Late Programs.

7MATE

7FLIX

6.00 Childrenâ&#x20AC;&#x2122;s Programs. 11.00 Friends. (PG, R, CC) 12.00 Dawsonâ&#x20AC;&#x2122;s Creek. (PG, R, CC) 1.00 Airplane Repo. (PG, R) 2.00 Childrenâ&#x20AC;&#x2122;s Programs. 5.30 MOVIE: Nancy Drew. (2007) 7.30 MOVIE: Stick It. (PG, R, CC) (2006) 9.35 MOVIE: Fired Up! (M, R) (2009) 11.35 WWE Smackdown. (MA15+) 12.35 Car SOS. (PG, R) 1.35 Ben 10. (PG, R) 2.00 PokĂŠmon. (R) 2.30 Be Cool, Scooby-Doo! (PG, R) 3.00 Childrenâ&#x20AC;&#x2122;s Programs. 4.30 Surfing Australia TV. (R, CC) 4.50 Childrenâ&#x20AC;&#x2122;s Programs.

6.00 Morning Programs. 12.00 MOVIE: Arabian Adventure. (R, CC) (1979) 2.05 David Attenboroughâ&#x20AC;&#x2122;s Life In Cold Blood. (PG, R, CC) 3.05 Upstairs Downstairs. (PG, R) 4.15 Heartbeat. (PG, R) 5.20 Are You Being Served? (PG, R) 6.00 Friends. (PG, R, CC) 7.00 As Time Goes By. (R) 7.30 Monarch Of The Glen. (PG, R) 8.40 The Secret Life Of The Zoo. (PG, CC) 9.40 MOVIE: Sliding Doors. (M, R, CC) (1998) 11.40 Murder In The First. (M, R, CC) 12.35 Late Programs.

9LIFE

6.00 Morning Programs. 9.00 Spit It Out. (R, CC) 10.00 James Robison. (PG) 10.30 Travel Oz. (PG, R, CC) 12.00 Greyâ&#x20AC;&#x2122;s Anatomy. (M, R, CC) 2.00 Marvelâ&#x20AC;&#x2122;s Agents Of S.H.I.E.L.D. (M, R, CC) 3.10 Dog With A Blog. (R) 4.10 Jessie. (R) 5.10 MOVIE: The Prince & Me 4: The Elephant Adventure. (PG, R) (2010) 7.10 MOVIE: Inside Out. (PG, R, CC) (2015) 9.00 MOVIE: Horrible Bosses. (MA15+, R, CC) (2011) Jason Bateman. 11.05 MOVIE: Carnage. (M, R) (2011) 12.55 Late Programs.

12.05 MOVIE: Naked Ambition 2. (MA15+, R) (2014) 2.00 Bosch. (MA15+, R, CC) 4.30 Food Loversâ&#x20AC;&#x2122; Guide To Australia. (CC) 5.00 CGTN English News. (CC) 5.10 NHK World English News. (CC) 5.30 Deutsche Welle English News.

ONE

9GEM

6.00 Morning Programs. 10.00 Prospectors. (PG, R) 10.30 NFL. NFL. Week 1. New England Patriots v Kansas City Chiefs. 2.00 Outback Hunters. (M, R) 3.00 What Went Down. (PG, R) 4.30 Full Metal Jousting. (PG, R) 5.30 American Restoration. (PG, R) 6.00 Worldâ&#x20AC;&#x2122;s Craziest Fools. (PG, R) 6.30 Surveillance Oz. (PG, R, CC) 7.00 AFL Pre-Game Show. (CC) 7.30 Football. (CC) AFL. Second qualifying final. Geelong v Richmond. 11.00 Outback Truckers. (M, R) 12.00 Late Programs.

Dubboâ&#x20AC;&#x2122;s TV Guide

6.00 Morning Programs. 12.00 Million Dollar Listing San Francisco. (M, R) 1.00 Selling New York. (PG, R) 2.00 Postcards. (PG, R, CC) 2.30 Getaway. (PG, R, CC) 3.00 The Block Sky High. (PG, R, CC) 4.00 Come Dine With Me UK. (PG, R) 5.00 First Time Flippers. (PG, R) 6.00 House Hunters Int. (R) 7.00 House Hunters. 7.30 Beachfront Bargain Hunt. 8.30 Tiny House, Big Living. (R) 9.30 Texas Flip And Move. (R) 10.30 Beachfront Bargain Hunt. (R) 11.30 House Hunters Int. (R) 12.00 Late Programs.

SBS VICELAND

6.00 Shopping. (R) 8.00 Motor Racing. Formula 1. Race 13. Italian Grand Prix. Replay. 9.00 iFish. (R, CC) 9.30 Jake And The Fatman. (PG, R) 10.30 Hoganâ&#x20AC;&#x2122;s Heroes. (R) 11.00 M*A*S*H. (PG, R) 12.00 WIN News. (R, CC) 1.00 Nash Bridges. (M, R) 2.00 Matlock. (M, R) 3.00 Jake And The Fatman. (PG, R) 4.00 Scorpion. (PG, R, CC) 6.00 Hoganâ&#x20AC;&#x2122;s Heroes. (R) 6.30 M*A*S*H. (PG, R) 7.30 MacGyver. (PG, R) MacGyver helps his old hockey coach. 8.30 Walker, Texas Ranger. (M, R) A rookie cop goes undercover. 10.30 MOVIE: The Bag Man. (MA15+, R) (2014) John Cusack. 12.40 Shopping. (R) 2.10 Matlock. (M, R) 3.10 Walker, Texas Ranger. (M, R) 4.10 Numb3rs. (M, R, CC) 5.05 The Doctors. (M, R, CC)

ELEVEN 6.00 Toasted TV. 6.05 Matt Hatter Chronicles. (R) 6.30 Transformers: Robots In Disguise. (R) 7.05 PokĂŠmon. (R) 7.35 Blazing Team. (R) 8.00 Kuu Kuu Harajuku. (C, R, CC) 8.35 Pound Puppies. (R) 9.00 Super Wings. (R) 9.30 Crocamole. (P, R, CC) 10.00 Touched By An Angel. (PG, R) 11.00 Frasier. (PG, R) 11.30 New Girl. (PG, R) 12.00 Good Wife. (M, R, CC) 1.00 WIN News. (R, CC) 2.00 Rush. (M, R, CC) 3.00 The Grinder. (PG, R) 3.30 King Of Queens. (PG, R) 4.00 Malcolm. (PG, R, CC) 4.30 Becker. (PG, R, CC) 5.30 Raymond. (PG, R, CC) 6.00 Family Feud. (CC) 6.30 Neighbours. (CC) 7.00 Malcolm. (PG, R, CC) 7.30 Fresh Off The Boat. (PG) 8.00 New Girl. (PG) 8.30 MOVIE: Serendipity. (PG, R) (2001) John Cusack, Kate Beckinsale. 10.25 To Be Advised. 11.25 James Corden. (M) 12.25 King Of Queens. (PG, R) 1.00 Becker. (PG, R, CC) 2.00 Late Programs.

6.00 WorldWatch. 12.00 MOVIE: Agent Hamilton 2. (M, R, CC) (2012) 1.40 Commando School. (M, R, CC) 2.35 Black Market. (M, R) 3.00 Cities Of Gold. (PG, R) 3.35 The Feed. (R) 4.05 Tattoo Age. (PG, R) 4.35 Fameless. (R) 5.00 News. 5.30 If You Are The One. (R) 6.35 Batman. (PG) 7.30 The Mindy Project. (M) 8.30 Adam Looking For Eve. (MA15+, R) 9.20 Look Me In The Eye. (PG, R) 10.20 Commando School. (M, R, CC) 11.15 Cycling. Vuelta a EspaĂąa. Stage 19. 2.00 Late Programs.

SBS FOOD 6.00 Morning Programs. 1.00 Mystery Diners. (PG, R) 1.30 Food: Fact Or Fiction. (R) 2.00 Bizarre Foods. (PG, R) 3.00 Secret Meat Business. (R) 3.30 Giada Entertains. (R) 4.00 Surfing The Menu. (PG, R) 4.30 Good Eats. (R) 5.00 Kelseyâ&#x20AC;&#x2122;s Essentials. (R) 5.30 Chrissy Teigenâ&#x20AC;&#x2122;s Hungry Special. (PG, R) 6.00 Food: Fact Or Fiction. 6.30 Bizarre Foods. (PG, R) 7.30 No Reservations. (PG, R) 8.30 Cupcake Wars. (PG, R) 9.30 Mystery Diners. (PG, R) 10.30 Late Programs.

NITV 6.00 Morning Programs. 1.30 A Place In The Middle. 2.00 Protecting Manuwangku. 2.30 Desperate Measures. 3.00 Aussie Bush Tales. 3.15 Tales Of Tatonka. 3.30 Inuk. 4.00 Cities Of Gold. (PG) 4.30 Kagagi. (PG) 5.00 Tangaroa. 5.30 Colour Theory. 6.00 Unearthed. 6.30 UnderExposed. 7.00 Our Stories. 7.20 The Mulka Project. (PG) 7.25 News. 7.30 MOVIE: Shorts. (2009) 9.30 The Point Review. 10.00 Music Voyager. 11.00 On The Road. (PG) 12.00 Volumz. (PG)

CLASSIFICATIONS: (P) For preschoolers (C) Childrenâ&#x20AC;&#x2122;s programs (G) General viewing (PG) Parental guidance (M) Mature audiences (MA15+) Mature audiences only (AV15+) Extreme violence. (R) Repeat (CC) Closed Captions. Please Note: Listings are correct at the time of print and are subject to late change by networks.

SHOW DETAILS & BUY TICKETS

DRTCC.COM.AU

Keep up to date â&#x20AC;&#x201C; join our mailing list

&20('<

'5$0$

)$0,/< <287+

%R[RIĂ&#x20AC;FHKRXUV0RQGD\)ULGD\DP SPDQGKRXUSULRUWRWKHVKRZ

TUESDAY 12 SEPTEMBER, 10.30 AM & 7.30 PM

SATURDAY 16 SEPTEMBER, 10 AM & 2 PM

FRIDAY 22 SEPTEMBER, 7.30 PM

%HOO6KDNHVSHDUH

&LUFDDQG4XHHQVODQG3HUIRUPLQJ$UWV&HQWUH

3XVKZRUWKDQG$QWLFKRFNR3URGXFWLRQV

THE MERCHANT OF VENICE

CARNIVAL OF THE ANIMALS

0RQH\PDNHVWKHZRUOGJRDURXQG3RUWLDKDV LW%DVVDQLRZDQWVLW6K\ORFNOHQGVLW$QWRQLR RZHVWKHYDOXHRILW/RYHDOVRSOD\VDSDUW 3RUWLDRIIHUVLW%DVVDQLRZDQWVLW$QG$QWRQLR PD\ORVHDSRXQGRIà HVKIRULW'RQ¡WPLVVWKLV HGJ\GUDPD

&LUFD¡VDFUREDWVEULQJWKLVFODVVLFDOPXVLFVXLWH WROLIHIRUDZKROHQHZJHQHUDWLRQRIFLUFXV PXVLFDQGDQLPDOORYHUV6XLWDEOHIRUDQG WKHLUIDPLOLHVZKRMXVWPLJKWZDQWWRUXQDZD\ ZLWKWKH&LUFXV

PAULYâ&#x20AC;&#x2122;S FAT PIZZA AND HOUSOS COMEDY SPECTACULAR

%DURSHQEHIRUH GXULQJLQWHUYDOPRVWVKRZV 'DUOLQJ6W'XEER  

$ERXERQIXHOOHGERJDQVXEZRRIHUERQDQ]D RIFRPHG\IHDWXULQJDOWHUHJRV3DXO\DQG )UDQN\)DO]RQL DQGDIHZRWKHUSHUVRQDOLWLHV HYHQKH¡VQRWVXUHRI 'RQ¡WEHDVWRRJH² GRQ¡WPLVVRXW6XLWDEOH0$ $IDFLOLW\RI'XEER5HJLRQDO&RXQFL


49

Dubbo Photo News September 7-13, 2017

TV+

Saturday September 9 ABC 6.00 11.30 12.00 12.30

PRIME7

NINE

WIN

Dubbo’s TV Guide

SBS

Rage. (PG, CC) QI. (PG, R, CC) ABC News At Noon. (CC) Mary Berry’s Foolproof Cooking. (R, CC) Miss Fisher’s Murder Mysteries. (M, R, CC) Thirteen. (M, R, CC) Catalyst. (PG, R, CC) Landline. (R, CC) Midsomer Murders. (PG, R, CC) (Final)

6.00 Home Shopping. (R, CC) 7.00 Weekend Sunrise. (CC) 10.00 The Morning Show: Weekend. (PG, CC) 12.00 House Of Wellness. (PG, R, CC) 1.00 Dynamo: Magician Impossible – Top 10 Greatest Moments. (PG, R, CC) 2.00 To Be Advised. 3.30 AFL Pre-Game Show. (CC) 4.00 Football. (CC) AFL. Second elimination final. Sydney v Essendon.

6.00 PAW Patrol. (R, CC) 6.30 Dora. (R, CC) 7.00 Weekend Today. (CC) 10.00 Today Extra: Saturday. (PG, CC) 12.00 Destination Happiness. (CC) 12.30 Cybershack. (PG, CC) 1.00 Patriot Games. (CC) 2.00 The Garden Gurus. (CC) 2.30 Dr Lisa To The Rescue. (CC) 3.00 Getaway. (PG, CC) 3.30 Rugby League. (CC) NRL. First Qualifying Final. Melbourne Storm v Parramatta Eels. From AAMI Park, Melbourne.

6.00 Fishing Edge. (R, CC) 6.30 Everyday Gourmet. (R, CC) 7.00 RPM. (R, CC) 8.00 Family Feud. (R, CC) 8.30 GCBC. (R, CC) 9.00 Ben’s Menu. (R, CC) 9.30 St10. (PG, CC) 12.00 The Living Room. (R, CC) 1.00 Healthy Homes. (CC) 1.30 Fishing Aust. (CC) 2.00 Places We Go With Jennifer Adams. (R, CC) 2.30 iFish. (R, CC) 3.00 Australia By Design. (CC) (Final) 3.30 My Market Kitchen. (R, CC) 4.00 What’s Up Down Under. (CC) 4.30 Escape Fishing With ET. (CC) (Final) 5.00 TEN Eyewitness News. (CC)

6.00 Tennis. (CC) US Open. Men’s semi-finals. From USTA Billie Jean King National Tennis Center, Flushing, New York. 2.00 Small Business Secrets. (R, CC) 2.35 Cleopatra’s Lost Tomb. (PG, R, CC) 3.30 Weekend Warriors. (PG, R, CC) 4.30 Antonio Carluccio’s 6 Seasons. (R, CC) 5.00 Cycling. (CC) Vuelta a España. Stage 19. Highlights. 5.30 The Supervet. (PG, CC)

6.00 Compass. (PG, CC) Explores migration to Australia. 6.30 Gardening Australia. (CC) Jerry visits a formal native garden. 7.00 ABC News. (CC) Coverage of local, national and international news, including the day’s sport and weather updates. 7.30 Father Brown. (PG, CC) (Final) Flambeau is incarcerated for murder. 8.15 Shetland. (M, CC) Detective Inspector Jimmy Perez believes he and his team are finally closing in on the killer. 9.15 Doc Martin. (PG, R, CC) Louisa is less than pleased when Martin’s therapist suggests they should attend his sessions as a couple. 10.05 Pulse. (M, R, CC) (Final) Chad is determined to see through a complex set of paired kidney exchange transplants.

7.00 Seven News. (CC) 7.30 MOVIE: Raising Helen. (PG, R, CC) (2004) A young woman’s carefree lifestyle, in New York City, comes to a screeching halt when she becomes responsible for her sister’s three children after she and her husband perish in a car accident. Kate Hudson, Abigail Breslin, Hayden Panettiere. 10.00 MOVIE: Couples Retreat. (M, R, CC) (2009) Four overworked couples head to a tropical island resort for a much-needed break, only to discover they must attend mandatory therapy sessions under the watchful gaze of the club’s quirky counsellor. Jason Bateman, Malin Akerman, Kristen Bell.

6.00 Nine News. (CC) 7.00 Rugby League. (CC) NRL. Second Elimination Final. Manly Sea Eagles v Penrith Panthers. From Allianz Stadium, Sydney. 10.00 MOVIE: The Terminator. (M, R, CC) (1984) After a cyborg from a postapocalyptic future is sent back to 1984 by the ruling super-computer, Skynet, to assassinate the mother of a resistance leader, a freedom fighter volunteers to travel through time to save her. Arnold Schwarzenegger, Linda Hamilton, Michael Biehn.

6.00 Bondi Rescue. (PG, R, CC) Harries is first on the scene after a horrific incident occurs in front of families and locals in North Bondi. 6.30 Bondi Rescue. (PG, R, CC) Early morning beach walkers run up to the tower to say they think they have seen a body near North Bondi. 7.00 Gold Coast Cops. (PG, R, CC) Two officers hunt down a man charged with assault who has failed to show up for court. 7.30 Rugby Union. (CC) Rugby Championship. Round 3. Australia v South Africa. From nib Stadium, Perth. 10.15 NCIS: New Orleans. (M, R, CC) Pride’s family friend’s fiancé is murdered. 11.15 Australian Survivor. (PG, R, CC) Alliances continue to flip as a former power player finds themselves at the bottom of their tribe.

6.30 SBS World News. (CC) 7.35 Royal Murder Mysteries: Lord Erroll – Death In The Valley. (CC) Takes a look at the murder of Josslyn Hay, 22nd Earl of Erroll, who was discovered dead in his car in 1941. 8.30 Travel Man: Copenhagen. (PG, R, CC) Richard Ayoade is joined by comedian Noel Fielding for an efficient minibreak in Denmark’s stylish capital, Copenhagen. With just 48 hours, they join a bike tour to get their bearings and see the sights before dining on open sandwiches and visiting the city’s oldest bakery. 9.00 Soccer. (CC) EPL. Manchester City v Liverpool. From Etihad Stadium, Manchester, England. 11.50 MOVIE: The Black Balloon. (M, R, CC) (2008) A young man struggles with life. Rhys Wakefield, Luke Ford.

11.05 Adam Hills: The Last Leg. (MA15+, R, CC) Host Adam Hills and celebrity guest Alan Davies take an offbeat look at events of the week. 11.45 Rage. (MA15+) Music videos chosen by guest programmers.

12.30 Home Shopping. (R)

12.10 MOVIE: Ballistic. (M, R, CC) (2002) 2.00 TV Shop: Home Shopping. (R) 2.30 Four Weddings. (PG, R, CC) 3.30 The Baron. (PG, R) 4.30 Global Shop. 5.00 TV Shop: Home Shopping. (R) 5.30 Wesley Impact. (CC)

12.25 48 Hours: Death At The Parsonage. (M, R, CC) Discover how an apparent suicide in a Pennsylvania church exposes the secrets of a twice-widowed pastor. 3.30 Home Shopping. (R)

1.35 MOVIE: Melancholia. (M, R, CC) (2011) 4.00 Hunters Of The South Seas. (M, R, CC) 5.00 CGTN English News. (CC) 5.15 NHK World English News. (CC) 5.30 Deutsche Welle English News. (CC)

1.00 2.00 3.00 4.00 4.30

ABC2

7TWO

6.00 Children’s Programs. 6.25 Peter Rabbit. (R, CC) 6.35 Ben And Holly. (R, CC) 6.50 Shaun The Sheep. (R) 7.00 Spicks And Specks. (PG, R, CC) 7.30 Penn & Teller: Fool Us. (M, CC) 8.15 Would I Lie To You? (PG, R, CC) 8.45 Live At The Apollo. (M, R, CC) 9.30 The IT Crowd. (PG, R, CC) 10.00 Broad City. (MA15+, R, CC) 10.20 Video Killed The Radio Star. (M, CC) 10.45 That ’70s Show. 11.30 That ’70s Show. 11.55 That ’70s Show. 3.05 Would I Lie To You? 3.35 News Update. 3.40 Close. 5.00 Children’s Programs.

ABC ME

9GO!

6.00 Shopping. (R) 8.00 Travel Oz. (PG, R, CC) 9.30 NBC Today. (R, CC) 11.00 Sydney Weekender. (R, CC) 11.30 Qld Weekender. (CC) 12.00 Vasili’s Garden. (R) 12.30 The Great Day Out. (CC) 1.00 Creek To Coast. (CC) 1.30 Horse Racing. (CC) Cox Plate Qualifier Day. Run To The Rose Day. 5.30 Cities Of The Underworld. (PG, R) 6.30 Mighty Ships. (R) 7.30 All Round To Mrs Brown’s. (M, R, CC) 8.30 Escape To The Country. 10.30 Escape To The Continent. (R) 11.45 Mighty Ships. (R) 1.00 Late Programs.

7MATE

6.00 Children’s Programs. 5.35 Grojband. (R, CC) 6.00 Camp Lakebottom. (R, CC) 6.10 Slugterra. (R, CC) 6.35 Make It Pop! (R) 6.55 News To Me Featurettes. 7.00 Nippers. (R, CC) 7.30 Deadly 60. (R, CC) 8.00 The New Adventures Of Figaro Pho. (R, CC) 8.05 Backstage. (R, CC) 8.30 Dance Academy. (R, CC) 8.55 The Haunting Hour. (PG, R, CC) 9.15 Annoying Orange. (R, CC) 9.30 Close. 5.00 Arthur. (R, CC) 5.25 Sally Bollywood. (R, CC) 5.35 Children’s Programs.

ABC NEWS 6.00 Morning Programs. 1.00 News. 1.30 Planet America. (R, CC) 2.00 News. (CC) 2.30 One Plus One. (R, CC) 3.00 News. 3.30 The Link. (R, CC) 4.00 News. 4.30 The Breakfast Couch. (R, CC) 5.00 News. 5.30 The Drum Weekly. 6.00 ABC News. 6.30 The Mix. (CC) 7.00 ABC News. 7.30 Aust Story. (R, CC) 8.00 News. (CC) 8.10 Four Corners. (R, CC) 9.00 ABC News. 9.30 World This Week. (R, CC) 10.00 News. 10.30 Planet America. (R, CC) 11.00 News. (CC) 11.30 Late Programs.

ONE

6.00 Children’s Programs. 5.15 MOVIE: Scooby-Doo. (2002) 7.00 MOVIE: How To Train Your Dragon. (PG, R, CC) (2010) 9.00 MOVIE: Conan The Barbarian. (MA15+, R, CC) (2011) 11.10 Two And A Half Men. (PG, R, CC) 12.10 Adult Swim. (M, R) 1.00 Black Jesus. (M, R) 1.30 Swamp Hunters. (PG, R) 2.00 American Digger. (PG, R) 2.30 Ben 10. (PG, R) 3.00 Yo-Kai. (PG, R) 3.30 Yu-Gi-Oh! (PG, R) 4.00 My Little Pony: Friendship Is Magic. (R) 4.30 Children’s Programs.

9GEM

6.00 Morning Programs. 10.00 Prospectors. (PG, R) 10.30 Klondike Gold Fever. (PG, R) 11.30 Life Off Road. (PG) 12.00 Swamp People. (PG, R) 1.00 Blokesworld. (PG) 1.30 Prospectors. (PG, R) 3.30 Cajun Pawn Stars. (PG) 4.00 Big Australia. (PG, R, CC) 5.00 Ice Road Truckers. (PG, R) 6.00 Klondike Gold Fever. (PG, R) 7.00 Baggage Battles. (PG, R) 7.30 Football. (CC) AFL. First elimination final. Port Adelaide v West Coast. 11.00 America’s Hardest Prisons. (M, R) 12.15 Late Programs.

7FLIX

6.00 Rainbow Country. (R) 6.30 Skippy. (R) 7.00 TV Shop. (R) 8.00 Danoz. 8.30 TV Shop. (R) 10.00 The Baron. (PG, R) 11.00 Wild Alaska. (PG, R, CC) 12.00 World’s Best Beaches. (R, CC) 1.00 MOVIE: Our Man In Marrakesh. (R, CC) (1966) 3.00 MOVIE: Giant. (R, CC) (1956) 7.00 MOVIE: Miss Congeniality. (PG, R, CC) (2000) 9.15 MOVIE: The Wedding Planner. (PG, R, CC) (2001) Jennifer Lopez. 11.25 Murder In The First. (M, R, CC) 12.25 Are You Being Served? (PG, R) 1.00 Late Programs.

9LIFE

6.00 It’s Academic. (R, CC) 6.30 Morning Programs. 9.30 Girl Meets World. (R, CC) 10.00 Spit It Out. (R, CC) 11.00 Morning Programs. 12.05 Jessie. (R) 12.35 Girl Meets World. 1.35 Best Friends Whenever. 2.35 Star Wars Rebels. (PG, R) 4.05 MOVIE: Fly Away Home. (PG, R, CC) (1996) 6.20 MOVIE: Mars Attacks! (PG, R) (1996) 8.30 MOVIE: The Net. (M, R, CC) (1995) Sandra Bullock, Jeremy Northam. 10.55 MOVIE: Miami Vice. (MA15+, R, CC) (2006) 1.35 Late Programs.

6.00 Morning Programs. 11.00 Postcards. (PG, R, CC) 11.30 Getaway. (PG, R, CC) 12.00 Tiny House, Big Living. (R) 1.00 Beachfront Bargain Hunt. (R) 1.30 Texas Flip And Move. (R) 2.30 Fixer Upper. (PG, R) 3.30 House Hunters Reno. (R) 4.30 Beachfront Bargain Hunt. (R) 5.30 Extreme Homes. (R) 6.30 Restoring Charleston. (R) 7.30 House Hunters. 8.30 House Hunters International. 9.30 House Hunters Int Reno. 10.30 Island Hunters. (R) 11.30 House Hunters Int. (R) 12.00 Late Programs.

SBS VICELAND

6.00 Shopping. (R) 8.00 Storm Season. (PG, R, CC) 8.30 Whacked Out Sports. (PG, R) 9.00 World Sport. (R) 9.30 Operation Repo. (PG, R) 10.30 Hogan’s Heroes. (R) 11.00 M*A*S*H. (PG, R) 12.00 Jake And The Fatman. (PG, R) 1.00 Megastructures Breakdown. (R) 2.00 Monster Jam. 3.00 Extreme Fisherman. (PG, R) 4.00 Fishing. IFS Championship. 4.30 Reel Action. 5.00 MacGyver. (PG, R) 6.00 Undercover Boss. (PG, R) 7.00 David Att’s Planet Earth. (PG, R, CC) 8.00 48 Hours. (M, R, CC) 9.00 48 Hours. (M, R, CC) 10.00 Forensics. (M, R) 11.00 48 Hours. (M, R, CC) 12.00 MOVIE: True Justice: Blood Alley. (M, R) (2012) 2.00 RPM. (R, CC) 3.00 Motor Racing. Formula 1. Race 13. Italian Grand Prix. Replay. 4.00 Operation Repo. (PG, R) 4.30 Whacked Out Sports. (PG, R) 5.00 The Doctors. (M, R, CC)

ELEVEN 6.00 Toasted TV. 6.05 Matt Hatter Chronicles. (R) 6.30 Pokémon. (R) 7.00 Mako: Island Of Secrets. (C, R, CC) 7.30 Kuu Kuu Harajuku. (C, CC) 8.00 Totally Wild. (C, CC) 8.30 Scope. (C, CC) 9.05 The Loop. (PG) 11.35 The Bachelor Aust. (R, CC) 1.35 To Be Advised. 4.05 New Girl. (PG, R) 4.30 Becker. (PG, R, CC) 5.30 Frasier. (PG, R) 6.30 MOVIE: Shark Tale. (R, CC) (2004) Will Smith. 8.15 Have You Been Paying Attention? (M, R, CC) Hosted by Tom Gleisner. 9.15 MOVIE: Jackass: The Movie. (MA15+, R) (2002) A group of daredevils performs stunts. Johnny Knoxville, Bam Margera. 11.10 The Loop. (PG, R) 1.40 Dating Naked. (M, R) 3.40 Frasier. (PG, R) 4.30 Becker. (PG, R, CC) 5.30 Shopping. (R)

6.00 WorldWatch. 11.50 Cycling. UCI Mountain Bike World Championships. Cross-Country. 4.20 Don’t Tell My Mother… (PG, R) 5.10 Jungletown. (PG, R) 6.00 Brooklyn Nine-Nine. (PG, R, CC) 6.50 Daria. (PG, R) 7.40 Ali G: Remixed. (M) 8.30 MOVIE: The Devil’s Double. (MA15+, R, CC) (2011) 10.30 Cycling. Vuelta a España. Stage 20. 2.00 What Would Diplo Do? (PG, R) 2.30 France 24. 3.00 Thai News. 3.30 Bangla News. 4.00 Punjabi News. 4.30 Sri Lankan Sinhalese News. 5.00 Late Programs.

SBS FOOD 6.00 Morning Programs. 11.00 Cupcake Wars. (PG, R) 12.00 Giada Entertains. (R) 12.30 Secret Meat Business. (R) 3.30 Mystery Diners. (PG, R) 4.00 Good Eats. (R) 4.30 Kelsey’s Essentials. (R) 5.00 Chrissy Teigen’s Hungry Special. (PG, R) 5.30 Food: Fact Or Fiction. (R) 6.00 Mystery Diners. (PG, R) 6.30 People Of The Vines. (PG, R) 7.30 Iron Chef America. (R) 8.30 Mystery Diners. (PG, R) 9.30 Celebrity Food Fight. (PG, R) 10.30 Secret Meat Business. (R) 12.00 Late Programs.

NITV 6.00 Morning Programs. 1.00 MOVIE: Shorts. (2009) 3.00 On The Road. (PG) 4.00 UnderExposed. 4.30 Colour Theory. 5.00 NITV On The Road: Barunga Festival. 6.00 Maori TV’s Native Affairs. 6.30 Rainbow Serpent. (PG) 7.00 City Slickers Rodeo. 7.30 Hardwood. 8.00 Men Don’t Cry. (PG) 8.30 Hard Rock Medical. (PG) 9.00 Mohawk Girls. 9.30 Noah’s Arc. (M) 10.00 On The Edge. (PG) 10.30 Love Patrol. (PG) 11.00 On The Road. (PG) 12.00 Volumz. (PG)

CLASSIFICATIONS: (P) For preschoolers (C) Children’s programs (G) General viewing (PG) Parental guidance (M) Mature audiences (MA15+) Mature audiences only (AV15+) Extreme violence. (R) Repeat (CC) Closed Captions. Please Note: Listings are correct at the time of print and are subject to late change by networks.

Unlocking dreams & opening more doors

s"UYINGs3ELLINGs2ESIDENTIAL,ANDs6ACANT,AND s2URAL,ANDs#OMMERCIAL0REMISESs3UBDIVISIONS

WOODKELL PTY LTD LIC NO. 15 86373

Ph

6882 1133

Suite 6, 173 Darling St admin@oranaconveyancing.com.au

Pat McGuire Photography

THURS 7.30 PM SHANE RILEY FRIDAY 7.30PM SHANE SAFFY SATURDAY 2PM – 6PM VINYL SATURDAY 7.30PM KIM MACRAE

VINYL SATURDAYS 2PM-6PM Bring a record & get a FREE drink!* *Tap Beer / house wine / soft drink

SEDAN SPECIAL Old Bank Music Shop 234 Macquarie St, Dubbo Ph: 02 6885 5665 Monday – Friday: 9am - 5:30pm Saturday: 9am – 12pm

Inc WHEN YOU PRESENT GST THIS VOUCHER

7 SEATER SPECIAL

253

$

Inc WHEN YOU PRESENT GST THIS VOUCHER

MUSO’S NIGHT

Every Tuesday from 7.30pm Dubbo’s BEST Craft Beer selection

Old Bank Restaurant Open Mon – Sat, Midday – Late

232 Macquarie St | Phone: 6884 7728


50

September 7-13, 2017 Dubbo Photo News

TV+

Sunday September 10 ABC

PRIME7

NINE

WIN

Dubbo’s TV Guide

SBS

6.00 Rage. (PG, CC) 7.00 Weekend Breakfast. (CC) 9.00 Insiders. (CC) 10.00 Offsiders. (CC) 10.30 The World This Week. (R, CC) 11.00 Compass. (PG, R, CC) 11.30 Songs Of Praise. (R, CC) 12.00 Landline. (CC) 1.00 Gardening Australia. (R, CC) 1.30 The Checkout. (PG, R, CC) 2.00 Shetland. (M, R, CC) 3.00 Doc Martin. (PG, R, CC) 3.45 The Mix. (R, CC) 4.15 Australian Story. (R, CC) 4.45 Father Brown. (PG, R, CC) (Final) 5.30 Hard Quiz. (PG, R, CC)

6.00 Home Shopping. (R) 7.00 Weekend Sunrise. (CC) 10.00 The Morning Show: Weekend. (PG, CC) 12.00 To Be Advised. 3.30 Better Homes And Gardens. (R, CC) Joh, Tara and Jason help a family. 4.30 Luxury Escapes. (PG, CC) Hosted by Shane Jolley. 5.00 Seven News At 5. (CC) 5.30 Sydney Weekender. (CC)

6.00 PAW Patrol. (R, CC) 6.30 Dora The Explorer. (R, CC) 7.00 Weekend Today. (CC) 10.00 Sports Sunday. (PG, CC) 11.00 NRL Sunday Footy Show. (PG, CC) 1.00 Full Cycle. (CC) 1.30 Surfing. (CC) World League. Corona Open J-Bay. Highlights. 2.30 The Block. (PG, R, CC) 3.30 Rugby League. (CC) NRL. First Elimination Final. Cronulla Sharks v North Queensland Cowboys.

6.00 Forces Of Nature With Brian Cox: The Pale Blue Dot. (R, CC) Part 4 of 4. 7.00 ABC News. (CC) Coverage of news, sport and weather. 7.40 Grand Designs: House Of The Year. (CC) Part 2 of 4. Kevin McCloud looks at properties that push the boundaries of design. 8.30 Sherlock: The Abominable Bride. (M, CC) Holmes and Watson investigate claims a ghostly bride has committed murder from beyond the grave. 10.00 Scott & Bailey. (M, R, CC) Part 3 of 3. As the team makes a significant breakthrough in the case, Rachel’s position as acting DI is jeopardised. 10.45 Top Of The Lake. (M, R, CC) (Final) Robin worries about Tui having a baby alone. 11.45 Silent Witness. (M, R, CC) A man is found dead in his car.

6.00 Seven News. (CC) 7.00 Little Big Shots. (PG, CC) Performances include an archer, goat milker, knife thrower and assistant, a multilinguist, Frisbee trickster and a guitarist. 8.00 Sunday Night. (CC) 9.00 I Am Heath Ledger. (M, CC) Friends and family of the late actor and artist Heath Ledger remember his life and career, revealing how his artistic nature and expression set him apart, vaulted him to stardom and endeared him to the world. 11.00 Women Who Kill. (M, R, CC) Part 1 of 2. Meet female killers and discover what drove them to commit their crimes and how they feel about their actions, including a woman who, despite being convicted of pushing her husband to his death, continues to maintain her innocence.

6.00 Nine News. (CC) 7.00 The Block. (PG, CC) Judges Neale Whittaker, Shaynna Blaze and Darren Palmer arrive to score the rooms. 8.30 60 Minutes. (CC) Current affairs program, investigating, analysing and uncovering the issues affecting all Australians. Featuring reports from Liz Hayes, Tara Brown, Allison Langdon, Charles Wooley and Ross Coulthart. 9.30 Murder Calls: Kelly Hodge. (M, R, CC) Takes a look at the murder of Melbourne sex worker Kelly Hodge. 10.30 See No Evil: The Vanishing Nurse. (M, CC) Takes a look at how the disappearance of a nursing student was solved with the help of surveillance footage. 11.35 House. (M, R, CC) Vogler forces House to treat a politician who became violently ill at a high-level campaign fundraiser.

6.00 Family Feud: Sunday. (CC) Two families try to win big prizes by guessing the most popular responses to a survey of the public. 6.30 The Sunday Project. (CC) A look at the day’s news. 7.30 Australian Survivor. (CC) Castaways who had previously flown under the radar find themselves with targets on their backs. 9.00 MOVIE: Kingsman: The Secret Service. (MA15+, R, CC) (2014) A troubled young man must prove his mettle after he is recruited into a secret British spy organisation. Colin Firth, Samuel L Jackson, Taron Egerton. 11.35 48 Hours: NCIS: NCIS – One Of Their Own. (M, R, CC) Follows an NCIS investigation into the execution-style murder of two people, one of them a US Navy sailor.

6.30 SBS World News. (CC) 7.30 The Other Pompeii: Life And Death In Herculaneum. (PG, R, CC) Professor Wallace-Hadrill explores what life was like in the ancient town of Herculaneum. 8.40 Soundtracks: Songs That Defined History: September 11th. (M, CC) (New Series) Explores the music tied to some of the most iconic moments in history, beginning with September 11, 2001. While tracks like New York State of Mind and We Are Family fostered a sense of camaraderie, it was country music that took centre stage. 10.20 Elvis And The Girl From Vienna. (CC) A look at Elvis Presley from the point-ofview of his secretary, Trude Forsher. 11.30 The Last Secrets Of 9/11. (PG, R, CC) Follows the work to identify the remains of people who perished in the World Trade Center attack on 9/11.

12.45 Rage. (MA15+) 2.15 Sherlock: The Abominable Bride. (M, R, CC) 3.45 Scott & Bailey. (M, R, CC) 4.30 The Bill. (PG, R, CC) 5.00 Insiders. (R, CC)

12.00 Cosmetic Coffee. (M) Takes a look at cosmetic surgery, featuring prominent Melbourne plastic surgeon Dr Daniel Lanzer. 12.30 Home Shopping. (R) 5.30 Sunrise. (CC) News, sport and weather.

12.30 Full Cycle. (R, CC) 1.00 Getaway. (PG, R, CC) 1.30 The Avengers. (PG, R) 2.30 Global Shop. 3.00 The Baron. (PG, R) 4.00 Good Morning America: Sunday. (CC) 5.00 News Early Edition. (CC) 5.30 Today. (CC)

12.35 48 Hours: NCIS: NCIS – Body Of Evidence. (M, R, CC) A young mother vanishes. 1.30 Home Shopping. (R) 4.30 CBS This Morning. (CC) Morning news and talk show.

12.25 Confronting ISIS. (M, R, CC) 2.30 Obama At War. (M, R, CC) 3.30 Obama: Eight Years Of Power. (M, R, CC) 4.40 Tango Underpants. (R, CC) 4.55 SBS Flashback. (PG, R, CC) 5.00 CGTN English News. (CC) 5.15 NHK World English News. (CC) 5.30 Deutsche Welle. (CC)

ABC2

7TWO

6.00 Children’s Programs. 6.05 Fireman Sam. (R, CC) 6.15 Octonauts. (R, CC) 6.25 Peter Rabbit. (R, CC) 6.35 Ben And Holly. (R, CC) 6.50 Shaun The Sheep. (R) 7.00 Spicks And Specks. (R, CC) 7.30 River Monsters. (PG, R, CC) 8.20 The Checkout. (PG, R, CC) 8.30 MOVIE: Fahrenheit 9/11. (M, R, CC) (2004) 10.30 Secret Life Of The Human Pups. 11.10 Louis Theroux: The City Addicted To Crystal Meth. 12.10 That ’70s Show. 2.50 News Update. 2.55 Close. 5.00 Children’s Programs.

ABC ME 6.00 Children’s Programs. 5.30 News To Me Featurettes. 5.35 Grojband. (R, CC) 6.00 Camp Lakebottom. (R, CC) 6.10 Slugterra. (R, CC) 6.35 Make It Pop! (R) 7.00 Nippers. (R, CC) 7.25 Trip For Biscuits. (PG, R, CC) 7.35 Deadly 60. (R, CC) 8.05 Backstage. (R, CC) 8.30 Dance Academy. (R, CC) 8.55 The Haunting Hour. (PG, R, CC) 9.15 Annoying Orange. (R, CC) 9.30 Rage. (PG, R) 2.00 Close. 5.00 Arthur. (R, CC) 5.25 Sally Bollywood. (R, CC) 5.35 Almost Naked Animals. (R, CC) 5.45 Children’s Programs.

ABC NEWS 6.00 Morning Programs. 1.00 News. 1.30 The Mix. (R, CC) 2.00 News. 2.30 The Breakfast Couch. (R) 3.00 News. 3.30 Landline. (R, CC) 4.00 News. 4.30 One Plus One. (R, CC) 5.00 News. 5.30 Compass. (PG, R, CC) 6.00 ABC News. 6.30 Planet America. (R, CC) 7.00 ABC News. 7.30 The House With Annabel Crabb. (R, CC) 8.00 Insiders. (R, CC) 9.00 ABC News. 9.30 One Plus One. (R, CC) 10.00 News. 10.30 The Drum Weekly. (R) 11.00 News. (CC) 11.30 The Mix. (R, CC) 12.00 Late Programs.

9GO!

6.00 Morning Programs. 12.00 Home And Away Catch-Up. (PG, R, CC) 2.00 Harry’s Practice. (R, CC) 3.00 Adam’s Pasta Pilgrimage. (R, CC) 3.30 New Zealand On A Plate. (R, CC) 4.00 Intolerant Cooks. (PG) 4.30 Escape To The Country. (R) 5.30 One Foot In The Grave. (PG, R, CC) 7.00 Border Security: Int. (PG, R, CC) 8.00 Border Security. (PG, R, CC) 8.30 Air Crash Investigation. (PG, R) 10.30 Border Security: Int. (PG, R, CC) 11.30 Escape To The Country. (R) 12.30 Late Programs.

7MATE

6.00 Children’s Programs. 8.00 ScoobyDoo! Spooky Games. (PG, R) 8.30 Children’s Programs. 5.00 MOVIE: The NeverEnding Story. (1984) 7.00 MOVIE: Alvin And The Chipmunks: The Squeakquel. (R, CC) (2009) 8.45 MOVIE: Jumper. (M, R, CC) (2008) 10.30 MOVIE: Sabotage. (MA15+, R, CC) (2014) 12.40 Adult Swim. (M) 1.10 The Venture Bros. (MA15+) 1.40 Step Dave. (M, R, CC) 2.30 Yo-Kai. (PG, R) 3.00 Yu-Gi-Oh! (PG, R) 3.30 Children’s Programs.

9GEM

6.00 Morning Programs. 7.30 Shopping. (R) 9.30 Adventure Angler. (PG) 10.00 AFL Game Day. (CC) 11.30 What Went Down. (PG, R) 12.00 Fishing The Wild. (PG, R) 12.30 Hook, Line And Sinker. (PG) 1.30 Speed With Guy Martin. (PG, R) 2.30 What Went Down. (PG, R) 3.30 Seinfeld. (PG, R, CC) 6.30 MOVIE: Spider-Man 2. (PG, R, CC) (2004) 9.00 MOVIE: The Bourne Supremacy. (M, R, CC) (2004) Matt Damon. 11.10 Hardcore Pawn. (M, R) 12.20 Late Programs.

7FLIX

6.00 Morning Programs. 8.00 Key Of David. (PG) 8.30 TV Shop. 10.00 Avengers. (PG, R) 11.00 MOVIE: Second Fiddle. (R, CC) (1957) 12.30 Garden Gurus. (R, CC) 1.00 Getaway. (PG, R, CC) 1.30 MOVIE: The Good Guys And The Bad Guys. (PG, R, CC) (1969) 3.30 MOVIE: A Distant Trumpet. (PG, R, CC) (1964) 6.00 Secret Dealers. (PG, CC) 7.00 The Good Life. (R) 8.20 MOVIE: Moonraker. (PG, R, CC) (1979) Roger Moore. 10.55 The Closer. (M, R, CC) 11.55 The Good Life. (R) 12.35 Late Programs.

9LIFE

6.00 Morning Programs. 9.30 Gamer’s Guide To Pretty Much Everything. (PG, R) 10.00 Girl Meets World. (R, CC) 11.15 Restaurant Revolution. (PG, R, CC) 1.30 800 Words. (PG, R, CC) 3.30 Diff’rent Strokes. (R) 4.30 Who’s The Boss? (PG, R, CC) 5.00 Married With Children. (PG, R) 6.00 Just Shoot Me! (PG, R, CC) 6.30 The Nanny. (PG, R) 7.00 Big Bang. (PG, R, CC) 8.30 MOVIE: Notting Hill. (M, R, CC) (1999) Julia Roberts. 11.00 Big Bang. (PG, R, CC) 11.50 Bad Teacher. (M) 12.15 Late Programs.

6.00 Morning Programs. 11.30 House Hunters. (R) 12.30 House Hunters Int. (R) 1.30 Restoring Charleston. (R) 2.30 Masters Of Flip. (R) 3.30 Island Hunters. (R) 4.30 Selling New York. (PG, R) 5.30 Extreme Homes. (R) 6.30 First Time Flippers. (PG) 7.30 House Hunters Reno. (R) 8.30 Zombie House Flipping. (PG) (Series return) 9.30 Ready, Set, Reno. (PG) (New Series) 10.00 Ready, Set, Reno. 10.30 Listed Sisters. (R) 11.30 House Hunters Int. (R) 12.00 Late Programs.

6.00 Mass. (CC) 6.30 Hillsong. (CC) 7.00 Fishing Aust. (R) 7.30 My Market Kitchen. (R, CC) 8.00 Good Chef Bad Chef. (R, CC) 8.30 Everyday Gourmet With Justine Schofield. (R, CC) 9.00 What’s Up Down Under. (R, CC) 9.30 Studio 10: Sunday. (PG, CC) 12.00 Alive And Cooking. (R, CC) 12.30 The Doctors. (PG, R, CC) 1.30 Weekend Feast. (R, CC) 2.30 Australian Survivor. (PG, R, CC) 3.30 The 48 Hour Destination. (CC) 4.00 RPM. (CC) 5.00 TEN Eyewitness News. (CC)

ONE

6.00 Tennis. (CC) US Open. Women’s final. 9.00 French News. 9.30 Soccer. (CC) EPL. Manchester City v Liverpool. Replay. 12.00 Arabic News. 12.30 Turkish News. 1.00 Motorcycle Racing. (CC) Australian Superbike Championship. Round 6. From Sydney Motorsport Park. 3.00 The Bowls Show. (CC) 4.00 FIFA World Cup 2018 Magazine. (CC) 4.30 Cycling. (CC) Vuelta a España. Stage 20. Highlights. 4.55 Small Business Secrets. (CC) 5.30 SAS Origins: A Secret History. (CC)

SBS VICELAND

6.00 Shopping. (R) 8.00 Rugby Union. (CC) Rugby Championship. Round 3. Australia v South Africa. Replay. 10.45 Australian Survivor. (PG, R, CC) 1.30 World Sport. (R) 2.00 4x4 Adventures. (R, CC) 3.00 Healthy Homes Aust. (R, CC) 3.30 Fishing. IFS Championship. Replay. 4.00 Reel Action. (R) 4.30 Escape Fishing. (R, CC) 5.00 What’s Up Down Under. (R, CC) 5.30 iFish. 6.00 Cheers. (PG, R) 6.30 Scorpion. (PG, CC) 7.30 Australian Survivor. (R, CC) 9.00 Cops: Adults Only. (PG, R, CC) 9.30 Motorcycle Racing. MotoGP. Race 13. San Marino Grand Prix. From Misano World Circuit Marco Simoncelli, Misano Adriatico, Italy. 11.00 Undercover Boss. (PG, R) 12.00 Megastructures Breakdown. (PG, R) 1.00 World Sport. 1.30 RPM. (R, CC) 2.30 Whitewater Rafting. (CC) Avon Descent. Highlights. 3.30 Cheers. (PG, R) 4.00 Late Programs.

ELEVEN 6.00 Toasted TV. 6.05 MOVIE: Pokémon The Movie: Volcanion And The Mechanical Marvel. (R) (2016) 7.35 Treasure Island. 8.05 Victorious. (R) 8.30 Sanjay And Craig. (R) 9.00 TMNT. (R) 10.00 Random & Whacky. (C, CC) 10.30 TMNT. (R) 11.00 Family Ties. (PG, R) 12.00 Cristela. (PG, R) 12.30 Angel From Hell. (PG, R) 1.00 Neighbours. (R, CC) 3.30 Becker. (PG, R, CC) 4.30 Frasier. (PG, R) 6.30 Futurama. (PG, R, CC) 7.30 The Simpsons. The animated misadventures of a nuclear family. 9.00 MOVIE: Blades Of Glory. (M, R) (2007) Two rival ice skaters team up. Will Ferrell, Jon Heder. 11.00 Frasier. (PG, R) 12.00 Family Ties. (PG, R) 1.00 TMNT. (R) 2.30 Frasier. (PG, R) 3.00 Pokémon. (R) 3.30 TMNT. (R) 5.00 Shopping. (R)

6.00 WorldWatch. 9.00 PopAsia. (PG) 10.00 WorldWatch. 12.00 News. (R) 12.55 Cycling. UCI Mountain Bike World Championships. Downhill. 4.55 Big Cats Of The Gulf. (PG, R) 5.20 SBS On-Demand Staff Picks. 5.25 Batman. (PG, R) 6.25 Vs Arashi. (PG) 7.20 If You Are The One. (PG) 8.30 Ninja Warrior Sweden. (R) 9.25 Pornocracy. 11.00 What Would Diplo Do? (M, R) 1.10 Cycling. Vuelta a España. Final stage. 5.00 Korean News. 5.30 Indonesian News.

SBS FOOD 6.00 Secret Meat Business. (R) 9.30 People Of The Vines. (PG, R) 10.30 Iron Chef America. (R) 11.30 Mystery Diners. (PG, R) 12.30 Celebrity Food Fight. (R) 1.00 Secret Meat Business. (R) 3.35 Mystery Diners. (PG, R) 4.00 People Of The Vines. (PG, R) 5.00 Iron Chef America. (R) 6.00 Mystery Diners. (PG, R) 6.30 Iron Chef Gauntlet. (PG, R) 7.30 Worst Cooks In America. (PG, R) 8.30 Mystery Diners. (PG, R) 9.30 Celebrity Food Fight. (PG, R) 10.30 Secret Meat Business. (R) 1.30 Late Programs.

NITV 6.00 Morning Programs. 11.30 City Slickers Rodeo. (R) 12.00 Hardwood. (R) 12.30 Men Don’t Cry. (PG, R) 1.00 On The Road. (PG, R) 2.00 Rugby Sevens. South Australian Finals. Highlights. 2.30 The Best Of Koori Knockout. (R) 3.30 AFL: Dreamtime Footy. (R) 5.00 Te Kaea. 5.30 The Point Review. (R) 6.00 Matauranga. (R) 6.30 Sacred Ground. (PG, R) 7.30 First Australians. (PG, R) 8.30 The Ground We Won. 10.10 Pacific Warriors. (PG, R) 11.50 Walking With Us. (R) 12.00 Volumz. (PG, R)

CLASSIFICATIONS: (P) For preschoolers (C) Children’s programs (G) General viewing (PG) Parental guidance (M) Mature audiences (MA15+) Mature audiences only (AV15+) Extreme violence. (R) Repeat (CC) Closed Captions. Please Note: Listings are correct at the time of print and are subject to late change by networks.

Hear the difference rence YOUR LOCAL INDEPENDENT DENT HEARING CENTRE 3 3 3 3

NEW

Qualified Audiologist with 25 years experience

customers receive 5 bottles

Private Clients Welcome Trial aids with full money back guarantee

FREE

Free follow up consults for testing and aid adjustments

FREE HEARING AIDS & SERVICE

for eligible Pensioners & Veterans

WORKCOVER NSW APPROVED

PENSIONER HAIRCUT: MEN $12 WOMEN $20

FULL HEAD COLOUR+CUT+TREATMENT+BLOWDRY $85 1/2 HEAD FOILS+CUT+TREATMENT+BLOWDRY $85

So don’t wait and pamper yourself!

2/43 Macquarie St Harmony Centre, Opp. Priceline

www.dubbohearingcentre.com.au

SAM: 02 6884 7777

Enjoy Neverfail Springwater delivered directly to your door.

Call us now on

6884 3004

* On initial delivery. Neverfail Springwater limited is a wholly-owned. Subsidary of Coca-Cola amatil. Neverfail is a registered trademark of The Coca-Cola Company.


51

Dubbo Photo News September 7-13, 2017

TV+

Monday September 11 ABC

PRIME7

NINE

6.00 News. (CC) 9.00 ABC News. (CC) 10.00 Back Roads. (PG, R, CC) (Final) 10.30 Todd Sampson’s Life On The Line. (PG, R, CC) 11.00 Grand Designs: House Of The Year. (R, CC) 12.00 ABC News At Noon. (CC) 1.00 Landline. (R, CC) 2.00 Parliament Question Time. (CC) 3.00 Home Fires. (PG, R, CC) 3.45 Eggheads. (R, CC) 4.15 Pointless. (R, CC) 5.00 ABC News: Early Edition. (CC) 5.30 The Drum. (CC)

6.00 9.00 11.30 12.00 2.00

Sunrise. (CC) The Morning Show. (PG, CC) Seven Morning News. (CC) To Be Advised. The Daily Edition. (CC) The hottest issues from the day’s news. 3.00 The Chase. (R, CC) Hosted by Bradley Walsh. 4.00 Seven News At 4. (CC) 5.00 The Chase Australia. (CC) Hosted by Andrew O’Keefe.

6.00 9.00 11.30 12.00 1.00

6.00 The Checkout: Snack Size. (PG, CC) A look at consumer affairs. 6.10 Grand Designs. (R, CC) Hosted by Kevin McCloud. 7.00 ABC News. (CC) Coverage of news, sport and weather. 7.30 7.30. (CC) Presented by Leigh Sales. 8.00 Australian Story. (CC) Australians tell personal stories. 8.30 Four Corners. (CC) Investigative journalism program, presented by Sarah Ferguson. 9.15 Media Watch. (PG, CC) Takes a look at a range of issues affecting media consumers. 9.35 Q&A. (CC) Hosted by Tony Jones. 10.40 Lateline. (R, CC) Hosted by Emma Alberici. 11.10 The Business. (R, CC) 11.30 Richard Flanagan: Life After Death. (MA15+, R, CC)

6.00 PRIME7 News. (CC) 6.30 PRIME7 News @ 6:30. (CC) 7.00 Home And Away. (PG, CC) A murderer may be after Robbo. Mason and Beth’s friendship is tested by the news she is a patient. 7.30 Highway Patrol. (PG, CC) A dangerous driver cops an earful when she is caught going over the speed limit. 8.30 Little Boy Blue. (M, CC) Part 1 of 2. A 11-year-old Liverpool boy is killed by a local gang member while walking home from soccer practice. 10.30 Britain’s Secrets: Parenting. (M, CC) Part 3 of 4. Anne Robinson tackles parenting and takes a look at some of the radically different approaches available. 11.45 Quantico. (M, CC) The team reexamines their personal connections, or more accurately, the lack thereof. 1.00 Home Shopping. (R) 5.30 Sunrise. (CC) David Koch and Samantha Armytage present the news, sport and weather, with business and finance updates.

12.35 1.25 2.25 2.55 4.20 5.05

Humans. (M, R, CC) Parliament Question Time. (CC) Anatomy. (PG, R, CC) Rage. (MA15+) Murder, She Wrote. (PG, R, CC) The Bill. (PG, R, CC)

ABC2 6.00 Children’s Programs. 6.15 Octonauts. (R, CC) 6.25 Peter Rabbit. (R, CC) 6.35 Ben And Holly. (R, CC) 6.50 Shaun The Sheep. (R) 7.00 Spicks And Specks. (PG, R, CC) 7.30 Dirty Jobs. (M, R, CC) 8.20 The Checkout. (PG, R, CC) 8.30 Louis Theroux: Law & Disorder In Lagos. (M, R, CC) 9.30 Ross Kemp: Extreme World. (MA15+, CC) (Series return) 10.15 MOVIE: Fahrenheit 9/11. (M, R, CC) (2004) 12.15 Next Stop Hollywood. 1.15 Dirty Jobs. 2.05 News Update. 2.10 Close. 5.00 Children’s Programs.

ABC ME 6.00 Children’s Programs. 5.30 Break The Future. (R) 5.35 Grojband. (R, CC) 6.00 Camp Lakebottom. (PG, R, CC) 6.10 Slugterra. (R, CC) 6.35 Make It Pop! (R) 7.00 Horrible Histories. (PG, R, CC) 7.30 Deadly 60. (R, CC) 8.00 BtN Newsbreak. (CC) 8.05 Backstage. (R, CC) 8.30 Dance Academy. (R, CC) 8.55 The Haunting Hour. (PG, R, CC) 9.15 Annoying Orange. (R, CC) 9.30 Rage. (PG, R) 10.30 Close. 5.00 Arthur. (R, CC) 5.25 Sally Bollywood. (R, CC) 5.35 Children’s Programs.

ABC NEWS 6.00 News. (CC) 9.00 News. (CC) 2.00 Parliament. (CC) 3.15 News. 6.00 ABC News National. 6.30 Drum. (R, CC) 7.00 The Business. 9.00 ABC News National. 9.30 Lateline. (CC) 10.00 The World. 11.00 News. (CC) 11.30 7.30. (R, CC) 12.00 News. 12.30 Drum. (R, CC) 1.00 Al Jazeera. 2.00 BBC Global. 2.30 7.30. (R, CC) 3.00 BBC Global. 3.30 Drum. (R, CC) 4.00 Al Jazeera. 5.00 Outside Source. 5.30 Lateline. (R, CC)

Today. (CC) Today Extra. (PG, CC) Morning News. (CC) The Ellen DeGeneres Show. (PG, CC) Extra. (CC) Entertainment news program. The Block. (PG, R, CC) Hosted by Scott Cam. News Now. (CC) Afternoon News. (CC) Millionaire Hot Seat. (CC)

6.00 Tennis. (CC) US Open. Men’s final. 10.00 Greek News. 10.30 German News. 11.00 Spanish News. 12.00 Arabic News. 12.30 Turkish News. 1.00 Al Jazeera News. (CC) 2.00 Celtic Woman: Destiny. (R, CC) 3.30 Off The Record. (R, CC) 4.00 The Supervet: Bionic Stories. (PG, R, CC) 5.00 Cycling. (CC) Vuelta a España. Final stage. Highlights. 5.30 Letters And Numbers. (R, CC)

6.00 Nine News. (CC) 7.00 A Current Affair. (CC) 7.30 The Block. (PG, CC) Two contestants call a body corporate meeting, in hope of saving themselves from being eliminated. 8.40 This Time Next Year. (PG, CC) Follows people with inspirational stories. Includes a woman who wants to thank the paramedics who saved her life, a coal miner who dreams of becoming a country musician, and a colourful character who is hunting for gold. 9.55 An Hour To Save Your Life. (M, R, CC) Medics fight to save the lives of an injured motorcyclist and a stabbing victim. 11.15 Botched. (M, CC) Paul follows a hunch and orders more tests for a woman with a botched nose and discovers shocking news.

6.00 WIN News. (CC) 6.30 The Project. (CC) Join the hosts for a look at the day’s news, events and hot topics. 7.30 Australian Survivor. (CC) The fallout from one of the most dramatic Tribal Councils of the season sends shockwaves through one tribe. 8.40 Have You Been Paying Attention? (M, CC) Guests include Jane Kennedy, Mick Molloy, Susie Youssef, Ed Kavalee and Sam Pang. 9.40 Life In Pieces. (PG, CC) Colleen turns to Tim for help with an embarrassing ailment. Heather gets jealous when her friends want to include Jen in their mothers’ group. Joan asks her family to read a draft of her book. 10.10 To Be Advised. 11.00 The Project. (R, CC)

6.00 River Cottage Australia. (CC) Paul West gets some much needed advice. 6.30 SBS World News. (CC) 7.30 The Obesity Myth: Eating Your Feelings. (PG, CC) Part 2 of 3. Follows the continuing struggles of a group of patients as they go through a weightloss program. 8.35 London’s Super Tunnel: Tunnels Under The Thames. (R, CC) Part 2 of 3. A continued look at the construction of a new underground railway in London called Crossrail. 9.40 24 Hours In Emergency: Carpe Diem. (M, CC) A 34-year-old is airlifted to St George’s after crashing into another cyclist during a charity bike ride. 10.35 SBS World News Late Edition. (CC) 11.05 The World Game. (CC) 11.35 Ouro: Amazon Gold. (MA15+) (New Series)

12.10 Law & Order. (M, R, CC) 1.05 Anger Management. (M, R, CC) 1.30 TV Shop: Home Shopping. 2.00 Extra. (R, CC) 2.30 Global Shop. 3.00 Skippy The Bush Kangaroo. (R) 3.30 Good Morning America. (CC) 5.00 News. (CC) 5.30 Today. (CC)

12.00 WIN’s All Australian News. (CC) 1.00 48 Hours: Gone. (M, CC) A look at the murder of Michelle Warner. 2.00 Home Shopping. (R) 4.30 CBS This Morning. (CC) Morning news and talk show.

12.35 Ouro: Amazon Gold. (MA15+) 1.35 Salamander. (M, R) 4.25 Food Lovers’ Guide To Australia. (R, CC) 5.00 CGTN English News. (CC) 5.15 NHK World English News. (CC) 5.30 Deutsche Welle English News. (CC)

3.00 4.00 5.00

9GO!

6.00 Morning Programs. 9.00 Million Dollar Minute. (R, CC) 9.30 NBC Today. (CC) 10.30 NBC Press. (R, CC) 11.30 Adam’s Pasta Pilgrimage. (R, CC) 12.00 Air Crash Investigation. (PG, R) 2.00 One Foot In The Grave. (PG, R, CC) 3.30 60 Minute Makeover. (PG, R) 4.30 Escape To The Country. (R) 6.30 Bargain Hunt. (R) 7.30 Doc Martin. (PG, R, CC) 8.30 Lewis. (M, R, CC) 10.30 Cold Feet. (M, R, CC) 11.30 Bargain Hunt. (R) 12.30 Late Programs.

ONE

6.00 Children’s Programs. 11.00 Friends. (PG, R, CC) 12.00 Dawson’s Creek. (PG, R, CC) 1.00 Airplane Repo. (PG, R) 2.00 Children’s Programs. 6.00 Regular Show. (PG, R) 6.30 Adv Time. (PG, R) 7.00 The Middle. (PG, R, CC) 7.30 Science Of Stupid. (M, CC) 8.00 Top Gear. (PG, R, CC) 9.10 MOVIE: Rambo: First Blood Part II. (M, R) (1985) 11.00 Cold Water Cowboys. (M) 12.00 Container Wars. (PG, R) 12.30 Adv Time. (PG, R) 1.00 Regular Show. (PG, R) 1.30 Ben 10. (PG, R) 2.00 Children’s Programs.

7MATE

9GEM

6.00 Morning Programs. 10.30 NFL. NFL. Week 1. Dallas Cowboys v New York Giants. 2.00 American Hoggers. (M, R) 3.00 Blokesworld. (PG, R) 3.30 What Went Down. (PG, R) 4.00 Cajun Pawn Stars. (PG, R) 5.00 Swamp People. (PG, R) 6.00 American Pickers. (PG, R) 7.00 Pawn Stars. (PG, CC) 8.30 Storage Wars. (M) 9.00 Storage Wars. (PG) 9.30 Storage Wars Canada. (M) 10.00 Baggage Battles. (PG, R) 11.00 Barter Kings. (PG, R) 12.00 Late Programs.

7FLIX

6.00 Morning Programs. 12.10 MOVIE: The Passionate Stranger. (PG, R, CC) (1957) 2.05 Secret Dealers. (PG, R, CC) 3.05 Upstairs Downstairs. (PG, R) 4.15 Heartbeat. (PG, R) 5.20 Are You Being Served? (PG, R) 6.00 Friends. (PG, R, CC) 7.00 As Time Goes By. (R) 7.30 The Hunt. (PG, R, CC) 8.40 MOVIE: The Suspicions Of Mr Whicher: The Murder At Road Hill House. (PG, R, CC) (2011) 10.40 Killer On The Line. (M, R, CC) 11.40 Footy Classified. (M, CC) 12.35 Late Programs.

9LIFE

6.00 Morning Programs. 12.00 Grey’s Anatomy. (M, R, CC) 2.00 Marvel’s Agents Of S.H.I.E.L.D. (M, R, CC) 3.00 Home And Away. (PG, R, CC) 3.30 Trophy Wife. (PG, R) 4.00 Black-ish. (PG, R) 4.30 Bewitched. (R, CC) 5.00 I Dream Of Jeannie. (R, CC) 5.30 Just Shoot Me! (PG, R, CC) 6.00 Married With Children. (PG, R) 6.30 The Nanny. (PG, R) 7.30 Big Bang. (PG, R, CC) 9.00 MOVIE: Entourage. (MA15+, CC) (2015) 11.05 MOVIE: United 93. (M, R) (2006) 1.20 Late Programs.

SBS

6.00 Ent. Tonight. (PG, R, CC) 6.30 Family Feud. (R, CC) 7.00 WIN News. (R, CC) 8.00 The Bold And The Beautiful. (PG, R, CC) 8.30 Studio 10. (PG, CC) 12.00 Dr Phil. (PG, R, CC) 1.00 Australian Survivor. (R, CC) 2.30 Ben’s Menu. (R, CC) 3.00 Judge Judy. (PG, CC) 3.30 Alive And Cooking. (CC) 4.00 Everyday Gourmet With Justine Schofield. (R, CC) 4.30 The Bold And The Beautiful. (PG, CC) 5.00 TEN Eyewitness News. (CC)

1.30

7TWO

WIN

Dubbo’s TV Guide

6.00 Morning Programs. 10.30 Zombie House Flipping. (PG, R) 11.30 Listed Sisters. (R) 12.30 Postcards. (PG, R, CC) 1.00 First Time Flippers. (PG, R) 2.00 House Hunters Reno. (R) 3.00 The Block Sky High. (PG, R, CC) 4.00 Come Dine With Me UK. (PG, R) 5.00 House Hunters Int. (R) 7.00 House Hunters. 7.30 Mary Queen Of Shops. (M) 8.40 Masters Of Flip. (R) 9.40 Million Dollar Listing San Francisco. (M) 10.40 Million Dollar Listing Miami. (PG, R) 11.40 House Hunters Int. (R) 12.10 Late Programs.

SBS VICELAND

6.00 Shopping. (R) 8.00 RPM. (R, CC) 9.00 iFish. (R, CC) 9.30 Monster Jam. (R) 10.30 Megastructures Breakdown. (PG, R) 11.30 Cheers. (PG, R) 12.00 WIN News. (R, CC) 1.00 Nash Bridges. (M, R) 2.00 Matlock. (M, R) 3.00 Jake And The Fatman. (PG, R) 4.00 Scorpion. (PG, R, CC) 6.00 Hogan’s Heroes. (R) 6.30 M*A*S*H. (PG, R) 7.30 Hawaii Five-0. (M, R, CC) 8.30 MOVIE: Underground: The Julian Assange Story. (M, R, CC) (2012) The story of WikiLeaks founder Julian Assange. Alex Williams. 10.30 The Last Man On Earth. (M) 11.30 Matlock. (M, R) 12.30 Motorcycle Racing. MotoGP. Race 13. San Marino Grand Prix. Replay. 2.00 Numb3rs. (M, R, CC) 3.00 Jake And The Fatman. (PG, R) 4.00 Nash Bridges. (M, R) 5.00 The Doctors. (M, R, CC)

ELEVEN 6.00 Toasted TV. 6.05 Matt Hatter Chronicles. (R) 6.30 Transformers: Robots In Disguise. (R) 7.05 Pokémon. (R) 7.35 Blazing Team. (R) 8.00 Totally Wild. (C, R, CC) 8.35 Pound Puppies. (R) 9.00 Super Wings. (R) 9.30 Crocamole. (P, R, CC) 10.00 Touched By An Angel. (PG, R) 11.00 Frasier. (PG, R) 11.30 New Girl. (PG, R) 12.00 Good Wife. (M, R, CC) 1.00 WIN News. (R, CC) 2.00 Rush. (M, R, CC) 3.00 The Grinder. (PG, R) 3.30 King Of Queens. (PG, R) 4.00 Malcolm. (PG, R, CC) 4.30 Becker. (PG, R, CC) 5.30 Raymond. (R, CC) 6.00 Family Feud. (CC) 6.30 Neighbours. (CC) 7.00 Malcolm. (PG, R, CC) 7.30 Fresh Off The Boat. (PG) 8.00 Rules Of Engagement. (PG, R) 8.30 MOVIE: Kate & Leopold. (PG, R) (2001) Meg Ryan, Hugh Jackman. 11.00 Raymond. (R, CC) 11.30 James Corden. (M) 12.30 King Of Queens. (PG, R) 1.00 Late Programs.

6.00 WorldWatch. 12.00 MOVIE: Whisky With Vodka. (M, R) (2009) 1.55 SBS On-Demand Staff Picks. (R) 2.00 Commando School. (M, R, CC) 3.00 Cities Of Gold. (PG, R) 3.35 Vs Arashi. (PG, R) 4.35 Fameless. (PG, R) 5.00 News. (R) 5.30 If You Are The One. (R) 6.30 MythBusters. (PG, R, CC) 7.30 The Feed. 8.00 South Park. (M, R) 8.30 MOVIE: Saturday Night Fever. (MA15+, R, CC) (1977) 10.40 MOVIE: Streets Of Fire. (M, R) (1984) 12.25 Desus And Mero. (M, R) 12.55 Late Programs.

SBS FOOD 6.00 Morning Programs. 1.30 Iron Chef Gauntlet. (PG, R) 2.30 Secret Meat Business. (R) 3.00 Andy & Ben Eat The World. (R) 3.30 Giada Entertains. (R) 4.00 Surfing The Menu. (PG, R) 4.30 Good Eats. (R) 5.00 Kelsey’s Essentials. (R) 5.30 Burgers, Brew & ‘Que. (R) 6.00 Reza’s African Kitchen. (New Series) 6.30 Bizarre Foods. (PG, R) 7.30 Follow Donal To Europe. (R) 8.30 Celebrity Food Fight. (PG) 9.30 Mystery Diners. (PG, R) 10.30 Late Programs.

NITV 6.00 Morning Programs. 1.10 Pacific Warriors. (PG, R) 2.50 Walking With Us. (R) 3.00 Aussie Bush Tales. (R) 3.15 Tales Of Tatonka. (R) 3.30 Inuk. (R) 4.00 Cities Of Gold. (PG, R) 4.30 Kagagi. (PG, R) 5.00 Tangaroa. (R) 5.30 Cafe Niugini. (PG, R) 6.00 Surviving. (R) 6.30 The Prophets. (PG, R) 7.00 Our Stories. (R) 7.20 Walking With Us. (R) 7.25 News. 7.30 Jersey Strong. (New Series) 8.00 Rodeo Road. (PG, R) 9.00 The Point. 9.30 Get Your Fish On. (R) 10.00 Pro Bull Riding. 11.00 Late Programs.

CLASSIFICATIONS: (P) For preschoolers (C) Children’s programs (G) General viewing (PG) Parental guidance (M) Mature audiences (MA15+) Mature audiences only (AV15+) Extreme violence. (R) Repeat (CC) Closed Captions. Please Note: Listings are correct at the time of print and are subject to late change by networks.

BEST SMOKO SPECIAL IN DUBBO FOR THE WORKING MAN PRESENT THIS VOUCHER TO RECEIVE:

• Body Piercing • Tattooing • Waxing • Nails & more!

HAMBURGER WITH THE LOT & CHIPS OR CHICKEN BURGER & CHIPS

$

12.50

M^]lFbed[Zk

WITH ANY 600ML COCA-COLA VARIETIES +/Ob\mhkbZLmk^^m%P^lm=n[[h

/11+0122 >QIBK>L,)L>IM>F;>K+)*0

6PRRWK

6x4 DIGITAL PRINTS

11¢ EVERYDAY

. VIP Club memb ers only. Conditions Apply

– Š œ œ Š  Ž

Angela Ferguson Remedial Massage Therapist

25 Bultje St, Dubbo

Ph: 6884 3334

Level 3 - Oliver House, Church St

www.smoothmassage.com.au 5HFRJQLVHGE\PRVWKHDOWKIXQGV‡+,&$36 ()7326DYDLODEOH

‘You’re in good hands’

0419 992 540

233 Cobra Street

6826 8800


52

September 7-13, 2017 Dubbo Photo News

TV+

Tuesday September 12 ABC

PRIME7

NINE

6.00 News Breakfast. (CC) 9.00 ABC News. (CC) 10.00 Four Corners. (R, CC) 10.45 Media Watch. (PG, R, CC) 11.00 Grand Designs. (R, CC) 12.00 ABC News At Noon. (CC) 1.00 Desert War. (PG, R, CC) 2.00 Parliament Question Time. (CC) 3.00 Home Fires. (PG, R, CC) 3.45 Eggheads. (R, CC) 4.15 Pointless. (R, CC) 5.00 ABC News: Early Edition. (CC) 5.30 The Drum. (CC)

6.00 9.00 11.30 12.00 2.00

Sunrise. (CC) The Morning Show. (PG, CC) Seven Morning News. (CC) To Be Advised. The Daily Edition. (CC) The hottest issues from the day’s news. 3.00 The Chase. (R, CC) Hosted by Bradley Walsh. 4.00 Seven News At 4. (CC) 5.00 The Chase Australia. (CC) Hosted by Andrew O’Keefe.

6.00 9.00 11.30 12.00 1.00

6.00 Short Cuts To Glory: Recipes. (CC) Hosted by Matt Okine. 6.10 Grand Designs. (R, CC) Hosted by Kevin McCloud. 7.00 ABC News. (CC) Coverage of news, sport and weather. 7.30 7.30. (CC) Presented by Leigh Sales. 8.00 The House With Annabel Crabb. (CC) (Final) Hosted by Annabel Crabb. 8.30 Catalyst: Heartbeat – The Miracle Inside You. (CC) Dr Nikki Stamp, one of 11 female heart surgeons in Australia, takes a look at the organ. 9.30 Inside London Fire Brigade. (M, CC) Part 1 of 3. The heroic firefighters who risked life and limb during the Grenfell Tower tragedy speak out. 10.15 Lateline. (R, CC) Hosted by Emma Alberici. 10.45 The Business. (R, CC) 11.05 Q&A. (R, CC) Hosted by Tony Jones.

6.00 PRIME7 News. (CC) 6.30 PRIME7 News @ 6:30. (CC) 7.00 Home And Away. (PG, CC) VJ may have uncovered Coco’s secret. Kat tries to persuade Robbo to keep searching for his identity. 7.30 First Dates Australia. (PG, CC) (Series return) Singles in search of love are brought together at a restaurant for a blind first date. 8.40 800 Words. (PG, CC) (Series return) Weld mounts operation search and rescue for Ike, Zac and Steve. Jan goes into labour. 9.40 Hospital. (PG, CC) (New Series) Goes behind the scenes at a hospital, documenting how the staff ensure the patients get the care they need. 10.55 The Catch. (M, CC) The team digs deep into Margot’s past. 11.55 Mistresses. (M, CC)

12.10 Parliament Question Time. (CC) Coverage of Question Time. 1.10 Inside London Fire Brigade. (M, R, CC) 2.00 Rage. (MA15+) 4.20 Murder, She Wrote. (PG, R, CC) 5.05 The Bill. (PG, R, CC)

1.00 Home Shopping. (R) 5.30 Sunrise. (CC) David Koch and Samantha Armytage present the news, sport and weather, with business and finance updates.

ABC2

6.00 France 24 English News. (CC) 6.30 Al Jazeera. (CC) 7.00 BBC News. (CC) 7.30 Italian News. 8.10 Filipino News. 8.40 French News. 9.30 Greek News. 10.30 German News. 11.00 Spanish News. 12.00 Arabic News. 12.30 Turkish News. 1.00 PBS NewsHour. (CC) 2.00 Celtic Woman: Fan Favourites. (R, CC) 3.00 My Restaurant In India. (PG, R, CC) 3.30 The First Night Of Television. (PG, R, CC) 4.35 Wild Italy. (R, CC) 5.30 Letters And Numbers. (R, CC)

6.00 Nine News. (CC) 7.00 A Current Affair. (CC) 7.30 The Block. (PG, CC) Two contestants race to get their master suite and kitchen finished to avoid being eliminated. 8.40 The Big Bang Theory. (PG, CC) Sheldon collaborates on projects with Leonard and Howard, as well as Amy, on the same day. 9.10 Kath & Kim. (PG, R, CC) Sharon enlists her boastful boyfriend Mark for her netball team. Kim has doubts about Brett’s manliness. 10.20 2 Broke Girls. (M, CC) The girls embark on a road trip to Los Angeles with Han at the wheel so Max can win back Randy. 11.20 Robbie Williams: Live In Tallinn. (M, R, CC) A performance by Robbie Williams.

6.00 WIN News. (CC) 6.30 The Project. (CC) 7.30 Shark Tank. (CC) A panel of business people is pitched innovations, including a personalised biscuit business. 8.30 NCIS. (M, R, CC) A photographer disappears prior to providing testimony at an army court-martial. 9.30 NCIS. (M, R, CC) Director Vance gives DiNozzo a special assignment to bring home an admiral’s daughter, who has gone partying, from Paris. However, he turns to the team for help after he becomes the prime suspect in a murder investigation after stumbling across a crime scene. 10.30 NCIS: Los Angeles. (M, R, CC) The team is called in to assess if the computer system which controls Russia’s missile arsenal is at risk. 11.30 WIN’s All Australian News. (CC)

6.00 River Cottage Australia. (CC) Paul West bravely takes his food truck out for its first test run at the local farmers markets. 6.30 SBS World News. (CC) 7.30 Great American Railroad Journeys: Santa Fe, New Mexico, To The Grand Canyon. (PG, CC) Michael Portillo continues his North American adventure with a visit to New Mexico and Arizona. 8.30 Insight. (CC) Journalist Jenny Brockie drives a discussion that examines a single topic, bringing together in one forum people with personal experience on an issue as well as experts and those with strong opinions. 9.30 Dateline. (CC) 10.00 SBS World News Late Edition. (CC) 10.30 Valkyrien. (M) Ravn finds himself facing questions from family, friends and media sceptical of his claims.

1.45 Nine Presents. (R, CC) 2.00 Extra. (R, CC) 2.30 Global Shop. 3.00 Skippy The Bush Kangaroo. (R) 3.30 Good Morning America. (CC) 5.00 News Early Edition. (CC) 5.30 Today. (CC)

12.30 The Project. (R, CC) A look at the day’s news. 1.30 48 Hours: The Millionaire, The Model And The Hitman. (M, R, CC) 2.30 Home Shopping. (R) 4.30 CBS This Morning. (CC)

12.20 MOVIE: The Solitude Of Prime Numbers. (M, R) (2010) 2.30 MOVIE: Tied. (M, R) (2013) 4.00 Great British Railway Journeys. (PG, R, CC) 4.30 Soccer. (CC) UEFA Champions League. Matchday 1.

1.30 2.00 3.00 4.00 5.00

ABC ME 6.00 Children’s Programs. 5.30 Science Time. (R) 5.35 Grojband. (R, CC) 6.00 Camp Lakebottom. (R, CC) 6.10 Slugterra. (R, CC) 6.35 Make It Pop! (R) 7.00 Horrible Histories. (R, CC) 7.30 Deadly 60. (R, CC) 8.00 BtN Newsbreak. (CC) 8.05 Backstage. (R, CC) 8.30 Dance Academy. (R, CC) 8.55 The Haunting Hour. (PG, R, CC) 9.15 Annoying Orange. (R, CC) 9.30 Rage. (PG, R) 10.30 Close. 5.00 Arthur. (R, CC) 5.25 Sally Bollywood. (R, CC) 5.35 Children’s Programs.

ABC NEWS 6.00 News. (CC) 9.00 News. (CC) 2.00 Parliament. (CC) 3.15 News. 6.00 ABC News National. 6.30 Drum. (R, CC) 7.00 The Business. 9.00 ABC News National. 9.30 Lateline. (CC) 10.00 The World. 11.00 News. (CC) 11.30 7.30. (R, CC) 12.00 News. 12.30 Drum. (R, CC) 1.00 Al Jazeera. 2.00 BBC Global. 2.30 7.30. (R, CC) 3.00 BBC Global. 3.30 Drum. (R, CC) 4.00 Al Jazeera. 5.00 Outside Source. 5.30 Lateline. (R, CC)

9GO!

6.00 Morning Programs. 9.00 Million Dollar Minute. (R, CC) 9.30 NBC Today. (R, CC) 12.00 New Zealand On A Plate. (R, CC) 12.30 Intolerant Cooks. (PG, R) 1.00 Mr Selfridge. (PG, R, CC) 2.15 Million Dollar Minute. (R, CC) 2.45 Animal Rescue. (R, CC) 3.15 To Be Advised. 4.30 Escape To The Country. (R) 6.30 Bargain Hunt. (R) 7.30 Martin Clunes: Horsepower. (PG, R) 8.30 Prime Suspect. (M, R, CC) 10.30 SCU. (PG, R, CC) 11.00 Bargain Hunt. (R) 12.00 Late Programs.

6.00 Children’s Programs. 11.00 Friends. (PG, R, CC) 12.00 Dawson’s Creek. (PG, R, CC) 1.00 Airplane Repo. (PG, R) 2.00 Children’s Programs. 6.00 Regular Show. (PG, R) 6.30 Adv Time. (PG, R) 7.00 The Middle. (PG, R, CC) 8.30 MOVIE: Austin Powers: Goldmember. (M, R, CC) (2002) 10.30 Balls Of Steel Australia. (MA15+, R) 11.30 Two And A Half Men. (PG, R, CC) 12.00 Container Wars. (PG, R) 12.30 Adv Time. (PG, R) 1.00 Regular Show. (PG, R) 1.30 Ben 10. (PG, R) 2.00 Children’s Programs.

7MATE

9GEM

6.00 Morning Programs. 11.00 Starsky & Hutch. (PG, R) 12.00 S.W.A.T. (PG, R) 1.00 Pawn Stars. (PG, R, CC) 1.30 What Went Down. (PG, R) 2.30 Swamp People. (PG, R) 3.30 American Pickers. (PG, R) 4.30 Pawn Stars. (PG, R, CC) 5.00 Cement Heads. (PG) 6.00 American Pickers. (PG, R) 7.00 Pawn Stars. (PG, CC) 7.30 Highway Patrol. (PG, R, CC) 8.30 Towies. (PG) 9.00 Highway Thru Hell USA. (M, R) 10.00 MOVIE: The Rock. (MA15+, R, CC) (1996) 12.45 Late Programs.

6.00 Morning Programs. 8.00 Ellen DeGeneres. (PG, R, CC) 9.00 TV Shop. (R) 9.30 Danoz. 10.30 Harry. (PG, CC) 11.30 As Time Goes By. (R) 12.00 MOVIE: The Likely Lads. (PG, R) (1976) 1.55 The Hunt. (PG, R, CC) 3.05 Upstairs Downstairs. (PG, R) 4.15 Heartbeat. (PG, R) 5.20 Are You Being Served? (PG, R) 6.00 Friends. (PG, R, CC) 7.00 As Time Goes By. (R) 7.30 RLPA Players’ Champion Awards. 8.40 Midsomer Murders. (M, R, CC) 10.50 Hurricane 360. (PG, R, CC) 12.00 Late Programs.

7FLIX

9LIFE

6.00 Morning Programs. 9.00 Spit It Out. (R, CC) 10.00 James Robison. (PG) 10.30 Travel Oz. (PG, R, CC) 12.00 Grey’s Anatomy. (M, R, CC) 2.00 Marvel’s Agents Of S.H.I.E.L.D. (M, R, CC) 3.00 Home And Away. (PG, R, CC) 3.30 Trophy Wife. (PG, R) 4.00 Black-ish. (PG, R) 4.30 Bewitched. (R, CC) 5.00 I Dream Of Jeannie. (R, CC) 5.30 Just Shoot Me! (PG, R, CC) 6.00 Married With Children. (PG, R) 6.30 The Nanny. (PG, R) 7.30 Big Bang. (PG, R, CC) 11.00 Blindspot. (M, R, CC) 12.00 Late Programs.

SBS

6.00 Ent. Tonight. (PG, R, CC) 6.30 Family Feud. (R, CC) 7.00 WIN News. (R, CC) 8.00 The Bold And The Beautiful. (PG, R, CC) 8.30 Studio 10. (PG, CC) 12.00 Dr Phil. (PG, R, CC) 1.00 Shark Tank. (PG, R, CC) 2.00 My Market Kitchen. (R, CC) 2.30 Ben’s Menu. (R, CC) 3.00 Judge Judy. (PG, CC) 3.30 Alive And Cooking. (CC) 4.00 Everyday Gourmet With Justine Schofield. (R, CC) 4.30 The Bold And The Beautiful. (PG, CC) 5.00 TEN Eyewitness News. (CC)

7TWO

6.00 Children’s Programs. 6.05 Fireman Sam. (R, CC) 6.15 Octonauts. (R, CC) 6.25 Peter Rabbit. (R, CC) 6.35 Ben And Holly. (R, CC) 6.50 Shaun The Sheep. (R) 7.00 Spicks And Specks. (R, CC) 7.30 Dirty Jobs. (M, R, CC) 8.20 Hard Quiz. (PG, R, CC) 8.50 Anthony Bourdain: Parts Unknown. (PG, CC) 9.35 The Traffickers. (M, CC) 10.15 Ross Kemp: Extreme World. (MA15+, R, CC) 11.05 Banged Up Abroad. 11.50 That ’70s Show. 2.10 Dirty Jobs. 3.00 News Update. 3.05 Close. 5.00 Children’s Programs.

Today. (CC) Today Extra. (PG, CC) Morning News. (CC) The Ellen DeGeneres Show. (PG, CC) Extra. (CC) Entertainment news program. Hot In Cleveland. (PG, R, CC) The Block. (PG, R, CC) News Now. (CC) Afternoon News. (CC) Millionaire Hot Seat. (CC)

WIN

Dubbo’s TV Guide

6.00 Morning Programs. 12.00 Ready, Set, Reno. (PG, R) 12.30 Ready, Set, Reno. (R) 1.00 Masters Of Flip. (R) 2.00 Million Dollar Listing San Francisco. (M, R) 3.00 The Block Sky High. (PG, R, CC) 4.00 Come Dine With Me UK. (PG, R) 5.00 Beachfront Bargain Hunt. (R) 6.00 House Hunters Int. (R) 7.00 House Hunters. 7.30 Botched. (M, R, CC) 8.30 The Real Housewives Of Cheshire. (M) 9.30 Ladies Of London. (PG) 10.30 My Big Fat Gypsy Fortune. (M) 11.30 House Hunters Int. (R) 12.00 Late Programs.

ONE

SBS VICELAND

6.00 Shopping. (R) 8.00 Extreme Fisherman. (R) 9.00 Reel Action. (R) 9.30 Jake And The Fatman. (PG, R) 10.30 Hogan’s Heroes. (R) 11.00 M*A*S*H. (PG, R) 12.00 WIN News. (R, CC) 1.00 Nash Bridges. (M, R) (Final) 2.00 Matlock. (M, R) 3.00 Jake And The Fatman. (PG, R) 4.00 Scorpion. (PG, R, CC) 6.00 Hogan’s Heroes. (R) 6.30 M*A*S*H. (PG, R) 7.30 48 Hours: The Dog Trainer, The Heiress And The Bodyguard. (M, R, CC) 9.30 VF Confidential: The Runaway Doctor. (MA15+, R) A look at the story of Dr Mark Weinberger. 10.30 Cops: Adults Only. (PG, R) 11.30 Matlock. (M, R) 12.30 Shopping. (R) 2.00 Jake And The Fatman. (PG, R) 3.00 Nash Bridges. (M, R) 4.00 Cops: AO. (PG, R) 5.00 The Doctors. (M, R, CC)

ELEVEN 6.00 Toasted TV. 6.05 Matt Hatter Chronicles. (R) 6.30 Transformers: Robots In Disguise. (R) 7.05 Pokémon. (R) 7.35 Blazing Team. (R) 8.00 Totally Wild. (C, CC) 8.35 Pound Puppies. (R) 9.00 Super Wings. (R) 9.30 Crocamole. (P, R, CC) 10.00 Touched By An Angel. (PG, R) 11.00 Frasier. (PG, R) 11.30 New Girl. (PG, R) 12.00 Good Wife. (M, R, CC) 1.00 WIN News. (R, CC) 2.00 Rush. (M, R, CC) 3.00 The Grinder. (PG, R) 3.30 King Of Queens. (PG, R) 4.00 Malcolm. (PG, R, CC) 4.30 Becker. (PG, R, CC) 5.30 Raymond. (PG, R, CC) 6.00 Family Feud. (CC) 6.30 Neighbours. (CC) 7.00 Malcolm. (PG, R, CC) 7.30 Fresh Off The Boat. (PG) 8.00 Rules Of Engagement. (PG, R) 8.30 MOVIE: Lara Croft Tomb Raider: The Cradle Of Life. (M, R) (2003) Angelina Jolie, Gerard Butler. 10.50 Raymond. (PG, R, CC) 11.20 James Corden. (PG, R) 12.20 Late Programs.

6.00 WorldWatch. 12.00 MOVIE: The Moon Child. (M, R) (2011) 1.55 Baz’s Extreme Worlds. (M, R) 3.00 Cities Of Gold. (PG, R) 3.35 The Feed. (R) 4.05 Mario Batali’s Moltissimo. (M) 4.35 Brain Games. (R) 5.05 Motherboard. (PG, R) 5.30 If You Are The One. (R) 6.35 MythBusters. (PG, R, CC) 7.30 The Feed. 8.00 Adam Ruins Everything. (M) 8.30 Tattoo Age. 9.25 Jungletown. (M) 10.15 The Mindy Project. (Series return) 10.40 American Boyband. (M) (Final) 11.10 Late Programs.

SBS FOOD 6.00 Morning Programs. 1.00 Mystery Diners. (PG, R) 1.30 Adam Richman’s Fandemonium. (PG, R) 2.00 Bizarre Foods. (PG, R) 3.00 Andy & Ben Eat The World. (R) 3.30 Giada Entertains. (R) 4.00 The Fearless Chef. (PG, R) 5.00 Kelsey’s Essentials. (R) 5.30 Burgers, Brew & ‘Que. (R) 6.00 Reza’s African Kitchen. 6.30 Bizarre Foods. (PG, R) 7.30 Secret Eats With Adam Richman. (R) 8.30 People Of The Vines. 9.30 Mystery Diners. (PG, R) 10.30 Late Programs.

NITV 6.00 Morning Programs. 1.30 Around The 44. (R) 2.30 Surviving. (R) 3.00 Aussie Bush Tales. (R) 3.15 Tales Of Tatonka. (R) 3.30 Inuk. (R) 4.00 Cities Of Gold. (PG, R) 4.30 Kagagi. (PG, R) 5.00 Tangaroa. (PG, R) 5.30 Cafe Niugini. (R) 6.00 Campfire. (PG, R) 6.30 One With Nature. (PG, R) 7.00 Our Stories. 7.20 Uncle Gundi. (R) 7.25 News. 7.30 The Other Side. (M) 8.00 UnderExposed. (R) 9.00 The Point. 9.30 AFL: Dreamtime Footy. 11.00 Rose Against The Odds. (R) 12.00 Volumz. (PG, R)

CLASSIFICATIONS: (P) For preschoolers (C) Children’s programs (G) General viewing (PG) Parental guidance (M) Mature audiences (MA15+) Mature audiences only (AV15+) Extreme violence. (R) Repeat (CC) Closed Captions. Please Note: Listings are correct at the time of print and are subject to late change by networks.

Western Plains windows & glass

3 for $360 CHEESE & BACON PIE + COKE CAN VARIETY $5

WHITE, WHOLEMEAL OR GRAIN SLICED BREAD $1.29

Bradnam’s windows Shower screens Mirrors Security doors All glass replacement Wardrobe doors Commercial shop fronts FREE MEASURE & QUOTE

6884 8818

OR 1300 0 GLASS 113a Darling Street, Dubbo | Phone: 02 6884 5454 | www.villagebakerycafe.com.au | facebook.com/villagebakerycafedubbo

23 Douglas Mawson Dr, DUBBO rhonda@wpwg.com.au


53

Dubbo Photo News September 7-13, 2017

TV+

Wednesday September 13 ABC

PRIME7

6.00 News Breakfast. (CC) 9.00 ABC News. (CC) 10.00 Q&A. (R, CC) 11.05 Grand Designs. (R, CC) 12.00 ABC News At Noon. (CC) 12.30 National Press Club Address. (CC) 1.30 The House With Annabel Crabb. (R, CC) (Final) 2.00 Parliament Question Time. (CC) 3.00 Home Fires. (PG, R, CC) 3.45 Eggheads. (R, CC) 4.15 Pointless. (R, CC) 5.00 ABC News: Early Edition. (CC) 5.30 The Drum. (CC)

6.00 9.00 11.30 12.00

6.00 Short Cuts To Glory: Recipes. (CC) 6.10 Grand Designs. (R, CC) Hosted by Kevin McCloud. 7.00 ABC News. (CC) Coverage of news, sport and weather. 7.30 7.30. (CC) Presented by Leigh Sales. 8.00 Hard Quiz. (PG, CC) Presented by Tom Gleeson. 8.30 Gruen. (CC) (Series return) Wil Anderson, Russel Howcroft and Todd Sampson analyse the advertising industry and consumerism. 9.10 Get Krack!n. (MA15+, CC) An A-List pop superstar joins the Kates. 9.35 The Edge Of The Bush. (M, CC) Part 1 of 5. 9.50 Adam Hills: The Last Leg. (M, R, CC) UK-based panel show. 10.30 Lateline. (R, CC) 11.00 The Business. (R, CC) 11.15 Four Corners. (R, CC) 12.05 Media Watch. (PG, R, CC) 12.20 Parliament Question Time. (CC) 1.20 National Press Club Address. (R, CC) 2.20 Adam Hills: The Last Leg. (M, R, CC) 3.00 Rage. (MA15+) 4.20 Murder, She Wrote. (PG, R, CC) 5.05 The Bill. (PG, R, CC)

ABC2

NINE

Sunrise. (CC) The Morning Show. (PG, CC) Seven Morning News. (CC) MOVIE: Seduced. (M, CC) (2016) Elisabeth Röhm. The Daily Edition. (CC) The hottest issues from the day’s news. The Chase. (R, CC) Hosted by Bradley Walsh. Seven News At 4. (CC) The Chase Australia. (CC)

6.00 Ent. Tonight. (PG, R, CC) 6.30 Family Feud. (R, CC) 7.00 WIN News. (R, CC) 8.00 The Bold And The Beautiful. (PG, R, CC) 8.30 Studio 10. (PG, CC) 12.00 Dr Phil. (PG, R, CC) 1.00 The Bachelor Australia. (R, CC) 2.30 Ben’s Menu. (R, CC) 3.00 Judge Judy. (PG, CC) 3.30 Alive And Cooking. (CC) 4.00 Everyday Gourmet With Justine Schofield. (R, CC) 4.30 The Bold And The Beautiful. (PG, CC) 5.00 TEN Eyewitness News. (CC)

6.00 Soccer. (CC) UEFA Champions League. Matchday 1. Continued. 7.00 BBC News. (CC) 7.30 Italian News. 8.10 Filipino News. 8.40 French News. 9.30 Greek News. 10.30 German News. 11.00 Spanish News. 12.00 Arabic News. 12.30 Turkish News. 1.00 PBS NewsHour. (CC) 1.55 Who Do You Think You Are? (R, CC) 3.00 Dateline. (R, CC) 3.30 Insight. (R, CC) 4.30 Wild Venice. (R, CC) 5.30 Letters And Numbers. (R, CC)

6.00 PRIME7 News. (CC) 6.30 PRIME7 News @ 6:30. (CC) 7.00 Home And Away. (PG, CC) Hunter and Olivia’s business venture threatens to put undue pressure on their relationship. 7.30 Border Security: Australia’s Front Line. (PG, CC) Border Force officers patrolling the Kimberley coast encounter several vessels that may pose a threat. 8.00 The Force: Behind The Line. (PG, CC) Police are on the lookout for a target who has skipped bail and avoided the authorities the night before. 8.30 Criminal Minds. (M, CC) The team investigates when several young men and women are victims of disfiguring acid attacks. 10.30 Chicago Fire. (M, CC) Stella tries to help a sick street kid. 11.30 Motive. (M, CC) Angie is worried about Paula.

6.00 Nine News. (CC) 7.00 A Current Affair. (CC) 7.30 The Block. (PG, CC) Two contestants are working around the clock to avoid being eliminated from the competition. 8.40 Doctor Doctor. (CC) Penny’s sister causes havoc when she visits Whyhope to defend Meryl against corruption charges. 9.40 Embarrassing Bodies Revisits. (M, CC) Doctors Christian Jessen, Pixie McKenna and Dawn Harper catch up with some of the show’s most memorable patients, with a focus on people seeking help in the wake of surgical procedures gone wrong. 10.40 Chicago Med. (M, CC) Dr Reese is contacted for help by a troubled teen in a psychiatric facility. 11.40 The Closer. (M, R, CC) An Iranian businessman is murdered.

6.00 WIN News. (CC) 6.30 The Project. (CC) Join the hosts for a look at the day’s news, events and hot topics. 7.30 The Bachelor Australia. (CC) After hometown visits last week, Matty’s feelings escalate for the remaining three women. With the finale around the corner, he can only choose two of these women to meet his family. Hosted by Osher Günsberg. 8.30 MOVIE: The Martian. (M, CC) (2015) An astronaut believed to be dead after his crew were forced to abandon their expedition prematurely, has to rely on his ingenuity to survive in the planet’s hostile conditions. Matt Damon, Jessica Chastain, Kristen Wiig. 11.20 WIN’s All Australian News. (CC)

6.00 River Cottage Australia. (CC) After ironing out some of the issues with the food van, Paul decides to drive it over the mountains to the city. 6.30 SBS World News. (CC) 7.30 Extreme Railway Journeys: Congo’s Jungle Railway. (PG, CC) Part 2 of 3. Chris Tarrant explores some of the world’s most “extreme” railway lines. 8.30 Look Me In The Eye. (PG, CC) Host Ray Martin explores what happens when two estranged people come face-to-face. 9.30 The Good Fight. (M, CC) A local pastor needs help with a legal matter that threatens to ruin his legacy. 10.25 The Handmaid’s Tale. (MA15+, CC) Offred remembers the unconventional beginnings of her relationship with her husband. 11.30 SBS World News Late Edition. (CC)

12.30 Home Shopping. (R) 5.30 Sunrise. (CC) David Koch and Samantha Armytage present the news, sport and weather, with business and finance updates.

12.35 20/20. (CC) 1.30 Postcards. (PG, CC) 2.00 Extra. (R, CC) 2.30 Global Shop. 3.00 Skippy The Bush Kangaroo. (R) 3.30 Good Morning America. (CC) 5.00 News Early Edition. (CC) 5.30 Today. (CC)

12.20 The Project. (R, CC) A look at the day’s news. 1.20 48 Hours: Fall From Grace. (M, R, CC) A look at the death of Bethany Deaton. 2.30 Home Shopping. (R) 4.30 CBS This Morning. (CC)

12.00 MOVIE: Theeb. (2014) 1.50 MOVIE: Things We Do For Love. (M, R) (2013) 3.35 Trawlermen: The Catch. (M, R, CC) 4.30 Food Lovers’ Guide To Australia. (R, CC) 5.00 CGTN English News. (CC) 5.15 NHK World English News. (CC) 5.30 Deutsche Welle. (CC)

3.00 4.00 5.00

7TWO

6.00 Children’s Programs. 6.05 Fireman Sam. (R, CC) 6.15 Octonauts. (R, CC) 6.25 Peter Rabbit. (R, CC) 6.35 Ben And Holly. (R, CC) 6.50 Shaun The Sheep. (R) 7.00 Spicks And Specks. (R, CC) 7.30 Dirty Jobs. (M, R, CC) 8.20 Life At 9. (PG, R, CC) 9.20 The Lie Detective. (M, CC) 10.00 Head First. (M, R, CC) 10.50 Catfish: The TV Show. 11.30 Tattoo Tales. 12.00 Wild Things With Dom Monaghan. 12.55 Dirty Jobs. 1.40 News Update. 1.45 Close. 5.00 Children’s Programs.

ABC ME 6.00 Children’s Programs. 11.00 Being Spanish. (R, CC) 11.35 Children’s Programs. 5.35 Grojband. (R, CC) 6.00 Camp Lakebottom. (R, CC) 6.10 Slugterra. (R, CC) 6.35 Make It Pop! (R) 7.00 Horrible Histories. (PG, R, CC) 7.30 Deadly 60. (R, CC) 8.00 BtN Newsbreak. (CC) 8.05 Backstage. (R, CC) 8.30 Dance Academy. (R, CC) 8.55 The Haunting Hour. (PG, R, CC) 9.15 Annoying Orange. (R, CC) 9.30 Rage. (PG, R) 10.30 Close. 5.00 Arthur. (R, CC) 5.25 Sally Bollywood. (R, CC) 5.35 Children’s Programs.

ABC NEWS 6.00 News. (CC) 9.00 News. (CC) 12.30 Press Club. (CC) 1.30 News. (CC) 2.00 Parliament. (CC) 3.15 News. 6.00 ABC News National. 6.30 Drum. (R, CC) 7.00 The Business. 9.00 ABC News National. 9.30 Lateline. (CC) 10.00 The World. 11.00 News. (CC) 11.30 7.30. (R, CC) 12.00 News. 12.30 Drum. (R, CC) 1.00 Al Jazeera. 2.00 BBC Global. 2.30 7.30. (R, CC) 3.00 BBC Global. 3.30 Drum. (R, CC) 4.00 Al Jazeera. 5.00 Outside Source. 5.30 Lateline. (R, CC)

SBS

Today. (CC) Today Extra. (PG, CC) Morning News. (CC) The Ellen DeGeneres Show. (PG, CC) Extra. (CC) Entertainment news program. Hot In Cleveland. (PG, R, CC) The Block. (PG, R, CC) News Now. (CC) Afternoon News. (CC) Millionaire Hot Seat. (CC)

2.00

6.00 9.00 11.30 12.00 1.00

WIN

Dubbo’s TV Guide

1.30 2.00 3.00 4.00 5.00

9GO!

6.00 Morning Programs. 8.00 Jay’s Jungle. (P, R, CC) 8.30 Harry’s Practice. (R, CC) 9.00 Million Dollar Minute. (R, CC) 9.30 NBC Today. (R, CC) 12.00 The Great Outdoors. (R, CC) 2.15 Million Dollar Minute. (R, CC) 2.45 Animal Rescue. (R, CC) 3.15 To Be Advised. 4.30 Escape To The Country. (R) 6.30 Bargain Hunt. (R) 7.30 Vicar Of Dibley. (PG, R, CC) 8.30 The Inspector Lynley Mysteries. (M, R, CC) 10.30 The Border. (PG, R) 11.30 Bargain Hunt. (R) 12.30 Late Programs.

7MATE

ONE

6.00 Children’s Programs. 11.00 Friends. (PG, R, CC) 12.00 Dawson’s Creek. (PG, R, CC) 1.00 Airplane Repo. (PG, R) 2.00 Children’s Programs. 6.00 Regular Show. (PG, R) 6.30 Adv Time. (PG, R) 7.00 The Middle. (PG, R, CC) 7.30 RBT. (PG, R, CC) 8.00 Police Ten 7. (M, CC) 8.30 MOVIE: Survivor. (M, CC) (2015) 10.30 Fugitive: Black Ops. (MA15+, R, CC) 11.30 Two And A Half Men. (PG, R, CC) 12.00 Container Wars. (PG, R) 12.30 Adv Time. (PG, R) 1.00 Children’s Programs.

9GEM

6.00 Morning Programs. 10.00 A Football Life. (PG, R) 11.00 Starsky & Hutch. (PG, R) 12.00 Charlie’s Angels. (PG, R) 1.30 Cement Heads. (PG, R) 2.30 American Pickers. (PG, R) 3.30 Pawn Stars. (PG, R, CC) 4.00 Grilled. (PG, R) 5.00 MythBusters. (PG, R, CC) 6.00 American Pickers. (PG, R) 7.00 Pawn Stars. (PG, CC) 7.30 Cajun Pawn Stars. (PG) 8.30 American Restoration. (PG) 9.30 American Pickers. (PG, R) 10.30 Ax Men. (M) (Series return) 11.30 Hardcore Pawn. (M, R) 12.00 Late Programs.

7FLIX

6.00 Morning Programs. 9.00 TV Shop. (R) 10.30 Harry. (PG, CC) 11.30 As Time Goes By. (R) 12.00 MOVIE: Devil Girl From Mars. (PG, R, CC) (1954) 1.35 The Hairy Bikers: Mums Know Best. (PG, R) 2.55 This Farming Life. (PG) (New Series) 4.15 Heartbeat. (PG, R) 5.20 Are You Being Served? (PG, R) 6.00 Friends. (PG, R, CC) 7.00 As Time Goes By. (R) 7.30 Call The Midwife. (M, R) 8.45 Agatha Christie’s Poirot. (PG, R) 9.55 Silent Witness. (MA15+, R) 11.00 To Be Advised. 12.10 Late Programs.

9LIFE

6.00 Morning Programs. 12.00 Grey’s Anatomy. (M, R, CC) 2.00 Marvel’s Agents Of S.H.I.E.L.D. (M, R, CC) 3.00 Home And Away. (PG, R, CC) 3.30 Trophy Wife. (PG, R) 4.00 Black-ish. (PG, R) 4.30 Bewitched. (R, CC) 5.00 I Dream Of Jeannie. (R, CC) 5.30 Just Shoot Me! (PG, R, CC) 6.00 Married With Children. (PG, R) 6.30 The Nanny. (PG, R) 7.30 Castle. (M, R, CC) 8.30 Big Bang. (PG, R, CC) 11.00 The Goldbergs. (PG, R, CC) 11.50 MOVIE: The Making Of A Hollywood Madam. (M, R, CC) (1996) 2.00 Late Programs.

6.00 Morning Programs. 9.30 House Hunters Int. (R) 10.30 House Hunters. (R) 11.00 Food Fighters. (PG, R) 12.00 Botched. (M, R, CC) 1.00 House Hunters Int Reno. (R) 2.00 Island Hunters. (R) 3.00 The Block Sky High. (PG, R, CC) 4.00 Come Dine With Me UK. (PG, R) 5.00 Masters Of Flip. (R) 6.00 House Hunters Int. (R) 7.00 House Hunters. 7.30 Fixer Upper. (PG, R) 8.30 Flip Or Flop. (R) 9.30 Million Dollar Listing NY. (M) 10.30 Selling New York. (PG) 11.30 House Hunters Int. (R) 12.00 Late Programs.

SBS VICELAND

6.00 Shopping. (R) 8.00 Snap Happy. (R) 8.30 Merv Hughes Fishing. (R) 9.00 Fishing Edge. (R, CC) 9.30 Jake And The Fatman. (PG, R) 10.30 Hogan’s Heroes. (R) 11.00 M*A*S*H. (PG, R) 12.00 WIN News. (R, CC) 1.00 Nash Bridges. (M, R) 2.00 Matlock. (M, R) 3.00 Jake And The Fatman. (PG, R) 4.00 Scorpion. (PG, R, CC) 6.00 Hogan’s Heroes. (R) 6.30 M*A*S*H. (PG, R) 7.30 David Attenborough’s Planet Earth. (PG, R, CC) 8.30 Undercover Boss. (PG) (Final) Meet CEO John Carona. 9.30 Shark Tank. (R, CC) 10.30 Ripper Street. (M) 11.35 Numb3rs. (M, R, CC) 12.30 Shopping. (R) 2.00 Jake And The Fatman. (PG, R) 3.00 Matlock. (M, R) 4.00 Nash Bridges. (M, R) 5.00 The Doctors. (M, R, CC)

ELEVEN 6.00 Toasted TV. 6.05 Matt Hatter Chronicles. (R) 6.30 Transformers: Robots In Disguise. (R) 7.05 Pokémon. (R) 7.35 Blazing Team. (R) 8.00 Totally Wild. (C, CC) 8.35 Pound Puppies. (R) 9.00 Super Wings. (R) 9.30 Crocamole. (P, R, CC) 10.00 Touched By An Angel. (PG, R) 11.00 Frasier. (PG, R) 11.30 New Girl. (PG, R) 12.00 Good Wife. (M, R, CC) 1.00 WIN News. (R, CC) 2.00 Rush. (M, R, CC) 3.00 The Grinder. (PG, R) 3.30 King Of Queens. (PG, R) 4.00 Malcolm. (PG, R, CC) 4.30 Becker. (PG, R, CC) 5.30 Raymond. (PG, R, CC) 6.00 Family Feud. (CC) 6.30 Neighbours. (CC) 7.00 Malcolm. (PG, R, CC) 7.30 Fresh Off The Boat. (PG) 8.00 Rules Of Engagement. (PG, R, CC) 8.30 Futurama. (PG, R, CC) 10.00 Bob’s Burgers. (M) 10.30 Bob’s Burgers. (PG, R) 11.00 Duckman. (M, R) 11.30 James Corden. (M, R) 12.30 King Of Queens. (PG, R) 1.00 Late Programs.

6.00 WorldWatch. 12.00 Miniseries: Vargas: Neptune’s Thunder. (M, R) 1.35 Black Market: Dispatches. (M, R) 2.05 Baz’s Extreme Worlds. (M, R) 2.35 Rivals. (M, R) 3.05 Cities Of Gold. (PG, R) (Final) 3.40 The Feed. (R) 4.10 Cyberwar. (PG, R) 4.35 Brain Games. (R) 5.00 News. (R) 5.30 If You Are The One. (R) 6.35 MythBusters. (PG, R, CC) 7.35 The Feed. 8.05 News. 8.30 MOVIE: Attack On Titan: Part 1. (2015) 10.20 MOVIE: The Ruins. (MA15+, R) (2008) 12.00 Late Programs.

SBS FOOD 6.00 Morning Programs. 1.00 Mystery Diners. (PG, R) 1.30 Adam Richman’s Fandemonium. (PG, R) 2.00 Bizarre Foods. (PG, R) 3.00 Andy & Ben Eat The World. (R) 3.30 Giada Entertains. (R) 4.00 The Fearless Chef. (PG, R) 5.00 Kelsey’s Essentials. (R) 5.30 Burgers, Brew & ‘Que. (R) 6.00 Reza’s African Kitchen. 6.30 Bizarre Foods. (PG, R) 7.30 No Reservations. (PG) 8.30 Celebrity Food Fight. (PG) 9.30 Mystery Diners. (PG, R) 10.30 Late Programs.

NITV 6.00 Morning Programs. 1.30 Rose Against The Odds. (PG, R) 2.30 Campfire. (PG, R) 3.00 Aussie Bush Tales. (R) 3.15 Tales Of Tatonka. (R) 3.30 Inuk. (R) 4.00 Cities Of Gold. (PG, R) 4.30 Kagagi. (PG, R) 5.00 Tangaroa. (PG, R) 5.30 Cafe Niugini. (R) 6.00 Our Footprint. (R) 6.30 Antonio Carluccio’s 6 Seasons. (R) 7.00 Our Stories. 7.20 A Time For Reflection. (PG, R) 7.25 News. (R) 7.30 Designing Africa. 9.00 The Point. 9.30 Over The Black Dot. 10.00 We Shall Remain. (PG, R) 11.30 Late Programs.

CLASSIFICATIONS: (P) For preschoolers (C) Children’s programs (G) General viewing (PG) Parental guidance (M) Mature audiences (MA15+) Mature audiences only (AV15+) Extreme violence. (R) Repeat (CC) Closed Captions. Please Note: Listings are correct at the time of print and are subject to late change by networks.

SOLUTIONS & ANSWERS

CROSSWORD TIME PUZZ882

PHOTO NEWS SUDOKU GRID614

Baker’s Dozen Trivia Test. 1. Five. 2. Chile. 3. Opera. 4. Glenn Miller. 5. Crystal. 6. Sir Edmund Hillary. 7. Psalm 119. 8. 1768-71. 9. Elephant, at 95 weeks. 10. Béarnaise sauce. 11. Whitney Houston, in 1985. The song was written for Janet Jackson, but she took a pass. It reached No.2 on the SUDOKU EXTRA

Australian singles chart. 12. Anna Meares. 13. “The Lady in Red”, by Chris de Burgh, 1986. The song, inspired by the first time de Burgh saw the woman who would become his wife, went global, topping the charts. In some coldhearted circles, however, the song made it to most-hated lists.

FIND THE WORDS solution 968 The highs and the lows GO FIGURE

Where on Google Earth: Dubbo City Toyota on the corner of Bourke and River Streets.

TRIVIA TEST ANSWERS #382 1 Bryce Courtenay, 2 1000, 3 Outlook, 4 Japan, 5 Powderfinger, 6 1982, 7 Queen, 8 acid, 9 Nambour, Queensland, 10 1991.

Matchmaker solution 186 Wind, wing, sing, sung, bung, bunk, busk, bust, gust.

WHO AM I? I am Australian cricketer Shaun Tait. PHOTO: REUTERS

problem solved!


54

September 7-13, 2017 Dubbo Photo News

TV+

Thursday September 14 ABC

PRIME7

NINE

6.00 News Breakfast. (CC) 9.00 ABC News. (CC) 10.00 Australian Story. (R, CC) 10.30 Todd Sampson’s Life On The Line. (PG, R, CC) (Final) 11.00 Grand Designs. (R, CC) 12.00 ABC News At Noon. (CC) 1.00 The Musketeers. (M, R, CC) 2.00 Parliament Question Time. (CC) 3.00 Home Fires. (PG, R, CC) 3.45 Eggheads. (R, CC) 4.15 Pointless. (R, CC) 5.00 ABC News: Early Edition. (CC) 5.30 The Drum. (CC)

6.00 9.00 11.30 12.00

6.00 The Checkout: Snack Size. (CC) 6.05 Grand Designs. (R, CC) 6.55 Clarke And Dawe: From The Archives. (CC) 7.00 ABC News. (CC) Coverage of news, sport and weather. 7.30 7.30. (CC) Presented by Leigh Sales. 8.00 Short Cuts To Glory: Matt Okine Vs Food. (CC) Matt Okine takes a look at comfort food. 8.30 Glitch. (M, CC) (Series return) James continues to help the Risen unravel the mystery of how and why they have returned. 9.30 The Detectives: Interrogation. (MA15+, CC) Part 2 of 3. 10.35 Lateline. (R, CC) 11.05 The Business. (R, CC) 11.20 QI. (R, CC) 11.50 The Agony Of Ecstasy: Opening Shot. (M, R, CC)

6.00 PRIME7 News. (CC) 6.30 PRIME7 News @ 6:30. (CC) 7.00 Home And Away. (PG, CC) Ash considers telling Tori of his developing feelings. 7.30 Kittens Makes You Laugh Out Loud. (PG, CC) Funny and cute moments featuring kittens. 8.30 World’s Deadliest Weather: Caught On Camera. (PG, CC) Stories of people caught in bad weather, including tourists fleeing for their lives from Hurricane Patricia. 9.30 Ramsay’s Costa Del Nightmares. (M, R, CC) Gordon Ramsay heads for Capbreton in south-west France to help the owners of the restaurant, Le Deck. 10.30 World’s Angriest. (PG, R, CC) Footage of neighbours losing their cool. 11.30 Royal Pains. (M, CC) Hank goes house hunting.

12.25 Parliament Question Time. (CC) 1.25 The Detectives: Interrogation. (MA15+, R, CC) 2.25 The Musketeers. (M, R, CC) 4.20 Murder, She Wrote. (PG, R, CC) 5.05 The Bill. (PG, R, CC)

12.30 Home Shopping. (R) 5.30 Sunrise. (CC) David Koch and Samantha Armytage present the news, sport and weather, with business and finance updates.

ABC2

2.00 3.00 4.00 5.00

Sunrise. (CC) The Morning Show. (PG, CC) Seven Morning News. (CC) MOVIE: Blood Crime. (M, R, CC) (2002) James Caan. The Daily Edition. (CC) The hottest issues from the day’s news. The Chase. (R, CC) Hosted by Bradley Walsh. Seven News At 4. (CC) The Chase Australia. (CC)

7TWO

6.00 Children’s Programs. 6.15 Octonauts. (R, CC) 6.25 Peter Rabbit. (R, CC) 6.35 Ben And Holly. (R, CC) 6.50 Shaun The Sheep. (R) 7.00 Spicks And Specks. (PG, R, CC) 7.30 Dirty Jobs. (PG, R, CC) 8.20 Gruen XL. (CC) (Series return) 9.00 The IT Crowd. (M, R, CC) 9.25 Live At The Apollo. (M, R, CC) 10.10 Broad City. (MA15+, R, CC) 10.35 Arrested Development. 12.05 Arrested Development. 1.10 Dirty Jobs. 2.05 River Monsters. 3.00 News Update. 3.05 Close. 5.00 Children’s Programs.

ABC ME

6.00 Shopping. (R) 7.00 Flushed. (C, CC) 7.30 The Wild Adventures Of Blinky Bill. (C, R, CC) 8.00 Jay’s Jungle. (P, R, CC) 8.30 Harry’s Practice. (R, CC) 9.00 Million Dollar Minute. (R, CC) 9.30 NBC Today. (R, CC) 12.00 Lovejoy. (PG, R) 2.15 Million Dollar Minute. (R, CC) 2.45 Animal Rescue. (R, CC) 3.15 To Be Advised. 4.30 Escape To The Country. (R) 6.30 Bargain Hunt. (R) 7.30 Father Brown. (PG, R, CC) 8.30 Murdoch Mysteries. (M, R) 11.30 Bargain Hunt. (R) 12.30 To Be Advised. 3.30 Late Programs.

6.00 Morning Programs. 12.00 Charlie’s Angels. (PG, R) 1.00 Grilled. (PG, R) 2.00 Ax Men. (M, R) 3.00 American Pickers. (PG, R) 4.00 Pawn Stars. (PG, R, CC) 4.30 American Restoration. (PG, R) 5.00 Full Metal Jousting. (PG, R) 6.00 American Pickers. (PG, R) 7.00 American Restoration. (PG, R) 7.30 Big Bang. (PG, R) 9.00 Family Guy. (M) 9.30 American Dad! (M, CC) 10.00 ScreenPLAY. (MA15+) 10.30 Family Guy. (M, R) 11.00 American Dad! (M, R) 11.30 Big Bang. (PG, R) 12.00 Late Programs.

6.00 News. (CC) 9.00 News. (CC) 2.00 Parliament. (CC) 3.15 News. 6.00 ABC News National. 6.30 Drum. (R, CC) 7.00 The Business. 9.00 ABC News National. 9.30 Lateline. (CC) 10.00 The World. 11.00 News. (CC) 11.30 7.30. (R, CC) 12.00 News. 12.30 Drum. (R, CC) 1.00 Al Jazeera. 2.00 BBC Global. 2.30 7.30. (R, CC) 3.00 BBC Global. 3.30 Drum. (R, CC) 4.00 Al Jazeera. 5.00 Outside Source. 5.30 Lateline. (R, CC)

6.00 France 24 English News. (CC) 6.30 Al Jazeera. (CC) 7.00 BBC News. (CC) 7.30 Italian News. 8.10 Filipino News. 8.40 French News. 9.30 Greek News. 10.30 German News. 11.00 Spanish News. 12.00 Arabic News. 12.30 Turkish News. 1.00 PBS NewsHour. (CC) 2.00 Poh’s Kitchen. (R, CC) 2.55 Nigella Feasts. (R, CC) 3.25 Angkor Wat’s Hidden Megacity. (PG, R, CC) 4.25 British Gardens In Time. (R, CC) 5.30 Letters And Numbers. (R, CC)

6.00 Nine News. (CC) 7.00 A Current Affair. (CC) 7.30 RBT. (PG, CC) Follows police units that operate random breath-test patrols around Australia. 8.30 The NRL Footy Show. (M, CC) Paul “Fatty” Vautin, Erin Molan, Beau Ryan and Darryl Brohman are joined by a panel of experts to discuss the latest rugby league news. Includes previews of upcoming matches, regular variety segments, and celebrity and musical guests. 10.30 World’s Funniest Videos Top 10 Countdown. (PG, CC) A countdown of the top 10 funniest slip-up and mistakerelated videos in the world. 11.30 The AFL Footy Show. (M, CC) Eddie McGuire and Rebecca Maddern provide the latest AFL news and match previews.

6.00 WIN News. (CC) 6.30 The Project. (CC) Join the hosts for a look at the day’s news. 7.30 The Bachelor Australia. (CC) (Final) The time has come for bachelor Matty to make one of the hardest decisions of his life. 9.00 The Wrong Girl. (CC) After a clip of Eric is leaked online, The Breakfast Bar is placed in the firing line as public outrage ignites. Lily begins to feel pangs of jealousy and insecurity when Jack is reunited with an ex-lover. 10.00 Blue Bloods. (M, R, CC) After a reporter dons NYPD gear for a ride-along with Jamie and Eddie, he gets targeted by a shooter. 11.00 Blue Bloods. (M, R, CC) Erin’s efforts to convict a slippery mob boss is muddled when her former informant provides him with an alibi.

6.00 River Cottage Australia. (CC) Paul West heads to Canberra. 6.30 SBS World News. (CC) 7.30 Great British Railway Journeys: Sudbury To Southend. (PG, CC) Michael Portillo travels from the market town of Sudbury in Suffolk to Southendon-Sea in Essex. 8.05 Gourmet Farmer. (PG, CC) As the restaurant’s opening day approaches, the forecast of snow and sleet threatens Matthew’s plans. 8.35 Secrets Of The Kitchen. (PG, CC) Part 2 of 3. With the summer holiday over, Britain prepares to head back to work and back to school. 9.40 Versailles. (MA15+, CC) Louis has Phillipe get close to the spy. 10.40 Outlander. (M, CC) Claire and Jamie call on Jamie’s grandsire. 11.50 SBS World News Late Edition. (CC)

1.00 Anger Management. (M, R, CC) 1.30 TV Shop: Home Shopping. (R) 2.00 Extra. (CC) 2.30 Global Shop. 3.00 Skippy The Bush Kangaroo. (R) 3.30 Good Morning America. (CC) 5.00 News Early Edition. (CC) 5.30 Today. (CC)

12.00 WIN’s All Australian News. (CC) 1.00 The Project. (R, CC) A look at the day’s news. 2.00 48 Hours: Murder In Aspen. (M, R, CC) 3.00 Home Shopping. (R) 4.30 CBS This Morning. (CC)

12.25 MOVIE: K-20: Legend Of The Mask. (M, R) (2008) 2.55 One Born Every Minute. (M, R, CC) 4.50 SBS Flashback. (PG, R, CC) 5.00 CGTN English News. (CC) 5.15 NHK World English News. (CC) 5.30 Deutsche Welle English News. (CC)

2.00 3.00 4.00 5.00

6.00 Children’s Programs. 11.00 Friends. (PG, R, CC) 12.00 Dawson’s Creek. (PG, R, CC) 1.00 Airplane Repo. (PG, R) 2.00 Children’s Programs. 6.00 Regular Show. (PG, R) 6.30 Adv Time. 7.00 The Middle. (PG, R, CC) 7.30 Big Bang. (PG, R, CC) 8.30 MOVIE: I Am Legend. (M, R, CC) (2007) 10.30 WWE Raw. (MA15+) 11.30 Two And A Half Men. (PG, R, CC) 12.00 Container Wars. (PG, R) 12.30 Adv Time. (R) 1.00 Regular Show. (PG, R) 1.30 Ben 10. (PG, R) 2.00 Pokémon. (R) 2.30 Children’s Programs.

6.00 Morning Programs. 9.00 TV Shop. (R) 10.30 Harry. (PG, CC) 11.30 As Time Goes By. (R) 12.00 MOVIE: No Limit. (R, CC) (1935) 1.35 The Hairy Bikers: Mums Know Best. (PG, R) 2.55 This Farming Life. (PG) 4.15 Heartbeat. (PG, R) 5.20 Are You Being Served? (PG, R) 6.00 Friends. (PG, R, CC) 7.00 As Time Goes By. (R) 7.30 David Attenborough’s Life In Cold Blood. (PG, R, CC) 8.40 MOVIE: Zodiac. (M, R, CC) (2007) Jake Gyllenhaal. 11.50 Rizzoli & Isles. (M, R, CC) 12.45 Late Programs.

9LIFE

6.00 Morning Programs. 10.00 James Robison. (PG) 10.30 Travel Oz. (PG, R, CC) 12.00 Grey’s Anatomy. (M, R, CC) 2.00 Marvel’s Agents Of S.H.I.E.L.D. (M, R, CC) 3.00 Home And Away. (PG, R, CC) 3.30 Trophy Wife. (PG, R) 4.00 Black-ish. (PG, R) 4.30 Bewitched. (R, CC) 5.00 I Dream Of Jeannie. (R, CC) 5.30 Just Shoot Me! (PG, R, CC) 6.00 Married With Children. (PG, R) 6.30 The Nanny. (PG, R) 7.30 Castle. (M, R, CC) 8.30 Criminal Minds. (M, R, CC) 11.30 The Blacklist. (M, R, CC) 12.30 Late Programs.

SBS

6.00 Ent. Tonight. (PG, R, CC) 6.30 Family Feud. (R, CC) 7.00 WIN News. (CC) 8.00 The Bold And The Beautiful. (PG, R, CC) 8.30 Studio 10. (PG, CC) 12.00 Dr Phil. (PG, R, CC) 1.00 The Bachelor Australia. (R, CC) 2.00 To Be Advised. 3.00 Judge Judy. (PG, CC) 3.30 Alive And Cooking. (CC) 4.00 Everyday Gourmet With Justine Schofield. (R, CC) 4.30 The Bold And The Beautiful. (PG, CC) 5.00 TEN Eyewitness News. (CC)

9GEM

7FLIX

ABC NEWS

Today. (CC) Today Extra. (PG, CC) Morning News. (CC) The Ellen DeGeneres Show. (PG, CC) Doctor Doctor. (R, CC) Penny’s sister causes havoc. The Block. (PG, R, CC) Hosted by Scott Cam. News Now. (CC) Afternoon News. (CC) Millionaire Hot Seat. (CC)

9GO!

7MATE

6.00 Children’s Programs. 5.30 News To Me Featurettes. 5.35 Grojband. (R, CC) 6.00 Camp Lakebottom. (R, CC) 6.10 Slugterra. (R, CC) 6.35 Make It Pop! (R) 7.00 Horrible Histories. (PG, R, CC) 7.30 Deadly 60. (R, CC) 8.00 BtN Newsbreak. (CC) 8.05 Backstage. (R, CC) 8.30 Dance Academy. (R, CC) 8.55 The Haunting Hour. (PG, R, CC) 9.15 Annoying Orange. (R, CC) 9.30 Rage. (PG, R) 10.30 Close. 5.00 Arthur. (R, CC) 5.25 Sally Bollywood. (R, CC) 5.35 Children’s Programs.

6.00 9.00 11.30 12.00 1.00

WIN

Dubbo’s TV Guide

6.00 Morning Programs. 9.30 House Hunters Int. (R) 10.30 House Hunters. (R) 12.00 Fixer Upper. (PG, R) 1.00 Million Dollar Listing NY. (M, R) 2.00 Flip Or Flop. (R) 3.00 The Block Sky High. (PG, R, CC) 4.00 Come Dine With Me UK. (PG, R) 5.00 House Hunters Reno. (R) 6.00 House Hunters Int. (R) 7.00 House Hunters. 7.30 The Road To Miss Universe Australia. 9.00 The Millionaire Matchmaker. (M) 10.00 Below Deck. (M) 11.00 The Real Housewives Of Orange County. (M) 12.00 Late Programs.

ONE 6.00 Shopping. (R) 8.00 Snap Happy. (R) 8.30 Merv Hughes Fishing. (PG, R) 9.00 iFish. (R, CC) 9.30 Jake And The Fatman. (PG, R) 10.30 Hogan’s Heroes. (R) 11.00 M*A*S*H. (PG, R) 12.00 WIN News. (R, CC) 1.00 Nash Bridges. (M, R) 2.00 Matlock. (M, R) 3.00 Jake And The Fatman. (PG, R) 4.00 Scorpion. (PG, R, CC) 6.00 Hogan’s Heroes. (R) 6.30 M*A*S*H. (PG, R) 7.30 Gold Coast Cops. (PG, R, CC) 8.30 Cops: Adults Only. (M, R) Follows police officers on patrol. 9.00 MOVIE: Delta Force II. (M, R) (1990) A special forces team pursues a drug lord. Chuck Norris. 11.20 Nash Bridges. (M, R) 12.20 Shopping. (R) 2.20 Cops: AO. (M, R) 2.50 Matlock. (M, R) 3.50 Jake And The Fatman. (PG, R) 4.50 Operation Repo. (PG, R) 5.50 World Sport. (R)

ELEVEN 6.00 Toasted TV. 6.05 Matt Hatter Chronicles. (R) 6.30 Transformers: Robots In Disguise. (R) 7.05 Pokémon. (R) 7.35 Blazing Team. (R) 8.00 Scope. (C, R, CC) 8.35 Pound Puppies. (R) 9.00 Super Wings. (R) 9.30 Crocamole. (P, R, CC) 10.00 Touched By An Angel. (PG, R) 11.00 Frasier. (PG, R) 11.30 New Girl. (PG, R) 12.00 Good Wife. (M, R, CC) 1.00 WIN News. (R, CC) 2.00 The Division. (M, R) 3.00 Raising Hope. (PG, R) 3.30 King Of Queens. (PG, R) 4.00 Malcolm. (PG, R, CC) 4.30 Becker. (PG, R, CC) 5.30 Raymond. (R, CC) 6.00 Family Feud. (CC) 6.30 Neighbours. (CC) 7.00 Malcolm. (PG, R, CC) 7.30 Fresh Off The Boat. (PG) 8.00 Rules Of Engagement. (PG, R, CC) 8.30 MOVIE: Playing It Cool. (M, R) (2014) Chris Evans, Michelle Monaghan. 10.30 Raymond. (R, CC) 11.00 Frasier. (PG, R) 11.30 James Corden. (M, R) 12.30 Late Programs.

SBS VICELAND 6.00 WorldWatch. 12.00 MOVIE: Lope. (M, R) (2010) 2.00 Baz’s Extreme Worlds. (M, R) 3.00 Dead Set On Life. (PG, R) 3.30 The Feed. (R) 4.00 Rivals. (PG, R) 4.30 Brain Games. (R) 5.00 News. (R) 5.30 If You Are The One. (R) 6.35 MythBusters. (PG, R, CC) 7.30 The Feed. 8.00 Full Frontal. (M) 8.30 States Of Undress. (M) 9.20 Rise. (M) (Final) 10.15 UEFA Champions League Highlights. 11.15 The Sarnos: A Life In Dirty Movies. (MA15+, R, CC) 12.45 News. 1.15 Late Programs.

SBS FOOD 6.00 Morning Programs. 1.00 Mystery Diners. (PG, R) 1.30 Adam Richman’s Fandemonium. (PG, R) 2.00 Bizarre Foods. (PG, R) 3.00 Andy & Ben Eat The World. (PG, R) 3.30 Giada At Home. (R) 4.00 The Fearless Chef. (PG, R) 5.00 Kelsey’s Essentials. (R) 5.30 Burgers, Brew & ‘Que. (R) 6.00 Reza’s African Kitchen. 6.30 Bizarre Foods. (PG, R) 7.30 Worst Cooks In America. (PG, R) 8.30 Bon Appetit! Gérard Depardieu’s Europe. (PG, R, CC) 9.30 Mystery Diners. (PG, R) 10.30 Late Programs.

NITV 6.00 Morning Programs. 2.00 Designing Africa. (R) 2.30 Our Footprint. (R) 3.00 Aussie Bush Tales. (R) 3.15 Tales Of Tatonka. (R) 3.30 Inuk. (R) 4.00 Cities Of Gold. (PG, R) 4.30 Kagagi. (PG, R) 5.00 Tangaroa. (R) 5.30 Cafe Niugini. (R) 6.00 Desperate Measures. (R) 6.30 Real Pasifik. (R) 7.00 Our Stories. 7.20 Reflections On Karrawirra Parri. (R) 7.25 News. 7.30 The Marngrook Footy Show. (R) 9.00 The Point. 9.30 MOVIE: The Dead Lands. (MA15+, R) (2014) 11.20 Late Programs.

CLASSIFICATIONS: (P) For preschoolers (C) Children’s programs (G) General viewing (PG) Parental guidance (M) Mature audiences (MA15+) Mature audiences only (AV15+) Extreme violence. (R) Repeat (CC) Closed Captions. Please Note: Listings are correct at the time of print and are subject to late change by networks.

ODDS, ENDS & INSPIRATION STRANGE BUT TRUE

z It was 17th-century French philosopher Rene Descartes who made the following sage observation: “If you would be a real seeker after truth, it is necessary that at least once in your life you doubt, as far as possible, all things.” z When you think of large tyre manufacturers, the companies that immediately spring to mind are probably Goodyear and Michelin. You might be surprised to learn, then, that the world’s largest manufacturer of tyres is actually Danish toy company The Lego Group. It’s true; they produce more tyres than any other manufacturer. (Just don’t try to put them on your car.) z The active ingredient in as-

pirin, acetylsalicylic acid, is derived from the bark of the willow tree.

z Those who study such things say that when buying beer at the bottle shop, men tend to get six-packs, while women are more likely to stock up with 12-packs. z In 2010, a man in Canada heard a strange sound coming from a dumpster in his neighbourhood. When he looked in, he was shocked to find a newborn baby. He rescued the infant, of course, and took it to the authorities. It was only later that he found out that he was the baby’s father. z Thought for the day: “Marriage is like higher education; as great as it is, it ain’t for everybody.” – Ray Charles

NOW HERE’S A TIP

clean the dryer itself, and don’t forget to wipe z “Put a family calendar down the inside drum inside your kitchen cabiwith a damp cloth. Don’t net to keep everyone on risk a dryer fire! track. You can list imporz “Need to chop nuts? tant dates/obligations/ Place them in a bag, and appointments there. We crush them with a biscuit colour code ours by usbaking tray. Just rock ing different highlighters back and forth over the z If you don’t regularly for each person, and we sealed bag. This really out your dryer clean keep it inside the cabinet works, and it’s kind of vents (i.e. vents that run by the coffeemaker, so fun, too.” – Y.L. to an outside wall), now’s Mum always looks at it.” the time to put it on your z Use aluminium foil to – contributed by W.S. cleaning schedule. Every line a small metal tray z “If you fill a small spray six months at a mini(like the kind that goes bottle with alcohol, you mum, but every three is in a toaster oven), which can use it to clean your better. Remove the dryer can then be used on the glasses. Use a soft cloth, vent hose and shake out grill. If I simmer onions not a paper towel, as to remove sand or dirt, in broth to go with my those leave lots of lint then run a vent brush to steak, this works really behind.” – D.P. loosen stuck-on lint. Use well because it doesn’t the wand attachment z Combine a few drops burn. The little pans are of a vacuum cleaner to just the right size! – C.C. of essential oils with a cup of either baking soda or cornflour. Sprinkle liberally on bare mattresses to give them a more pleasant smell. Let sit 10-15 minutes, then vacuum up. It’s particularly nice to use lavender.

...inspiringly local!


55

Dubbo bo Photo Newss September p 77-13, 13,, 2017

TELSTRA PREMIERSHIP â&#x20AC;&#x201C; RESULTS

1ST - JOSH BERNARD 2ND - PETER HYDE =3RD - KEV ENGELER =3RD - PHIL HANNAFORD =5TH - MICHAEL MESSNER =5TH - HELEN BEER 7TH - SHANE MEDLEY 8TH - TOSSER 9TH - SCOTT MCNAMARA

2017 TIPPING CHALLENGE THE CHALLENGE IS ON!

10TH - LUKE CROSS

All good things must come to an end

JOSH

By KEVIN ENGELER

This yearâ&#x20AC;&#x2122;s tipping competition could be likened to Might and Powerâ&#x20AC;&#x2122;s Caulfield Cup win back in the â&#x20AC;&#x153;Naughtiesâ&#x20AC;? â&#x20AC;&#x201C; the winner was never headed. Josh from the Macquarie Inn showed a clean set of plates to lead virtually all the way and bolt in! And whilst he has bragging rights for the next 12 months, I firmly believe the celebrations will not halt there. Josh is a true Melbourne Storm supporter and yes, while I could stop todayâ&#x20AC;&#x2122;s XPT from arriving at Dubbo Railway Station, even I would be hard pressed to stop the boys from down south. As I have said before, Melbourne are specials to win the competition. Those who like a bet should look at putting $20 of their hard-earned on the Storm to salute on grand final day, coupled with Cooper Cronk to be named as the Clive Churchill Medal winner. Whilst I am yet to check those odds, I reckon you can expect to get around $8. Make no bones about it, Cronk deserves to go out a winner. Forget him signing for a Sydney-based club next season, he will not play against his former club. I can see him taking up a media role with either Channel Nine or Fox. He has been a brilliant player and if not in the same era as JT, heâ&#x20AC;&#x2122;d be more celebrated than he is. Before having a look at the finals this week, Iâ&#x20AC;&#x2122;d like to reflect on 2017. What did I get right? Or wrong? Well I can be accused of putting an end to NSW in Origin. I thought they would wrap up the series in game 2. Wrong! Kev tipped them! I tipped Penrith to win the competition. Wrong! Theyâ&#x20AC;&#x2122;ll exit in week one of the finals. No Moylan, no hope in my opinion. I reckoned the Tigers would be more competitive. Wrong! They have had more coaches than Langleyâ&#x20AC;&#x2122;s this year. But I do see light at the end of the tunnelâ&#x20AC;Ś. Did I get anything right? Well Laurie Daleyâ&#x20AC;&#x2122;s sacking was one. Yes you read it here first! And whilst yet confirmed, Brad Fittler will be the man at the helm in 2018. My season lowlightsâ&#x20AC;Ś..the inconsistency of referees and the Bunker. Fair dinkum, Hitlerâ&#x20AC;&#x2122;s bunker made fewer mistakes. Other shockers include the situation at the Titans; the Blues capitulation, and the referees â&#x20AC;&#x201C; did I mention them? Season highlights â&#x20AC;&#x201C; the way clubs and indeed certain players have made seriously ill fans enjoy some happiness. The Tigersâ&#x20AC;&#x2122; win over Manly at Leichhardt was brilliant. Michael Morganâ&#x20AC;&#x2122;s emergence in the absence of JT is another. And Parramattaâ&#x20AC;&#x2122;s rise this season â&#x20AC;&#x201C; terrific stuff. I despise mid-season player moves, but Mitch Moses in particular is becoming one of the gameâ&#x20AC;&#x2122;s entertainers as such. Now for the finals. I expect all the favourites to salute. Melbourne will simply shut the Eels brilliance in the battle of 1 v 4. Like a boa constrictor, they will strangle the life out of the Eels. As I have stated in the past, numbers 1, 7 and 9 are the keysâ&#x20AC;Ś.. nobody has better players in those positions than the Storm. I can see the Roosters being too consistent for the Broncos, whilst Manly will end Panther hopes and Cronulla to do the same to the luckless Cowboys. Thanks to all those in our tipping competition for 2017. And if your team is still alive (unlike mine ad Geoff Mannâ&#x20AC;&#x2122;s) this season, all the best of luck. And I will leave you with thisâ&#x20AC;Śopinions are like backsidesâ&#x20AC;Śeveryone has one. God bless.

262

250 

PH: 6884 1955 KEV

   

PH: 1300 854 727 PHIL

248

248

PH: 6885 4433

PH: 6884 0008

MICHAEL

HELEN

246

246

PH: 1300 800 301

PH: 6841 2600

SHANE

THE TOSSER

240

216

PH: 6884 7554

PH: 6885 4433

SCOTT

GAME ON!

PETER

LUKE

212

198

PH: 0429 404 294

PH: 6882 2304


56

SPORT

September 7-13, 2017 Dubbo Photo News

Send your Sport news to Contact our Sports photographer geoff.mann@dubbophotonews.com.au mel.pocknall@dubbophotonews.com.au

Netball finals at Nita McGrath Courts GIRLS and women provide a colourful cascade as they ply their skills on the riverbank in north Dubbo each Saturday. This year the weather has been kind but with a cool change forecast for the weekend, the on-court action should be enough to keep bodies warm. Last week’s semi-final action across all grades and ages brought a premature end for some teams and this Saturday another lot will see their seasons cone to a close. Mel was out and about to capture the skills, excitement and atmosphere of finals fever. Good luck to everyone playing, officiating and serving this week.

Makaya Darcy, Millie Gooch, Deadly Dragonflies, Div 2

Ahlia Suckling, Kate Swain, Fusion Vixens, A Reserve

St Groovers versus Elysium


Dubbo Photo News September 7-13, 2017 SPORT

Dubbo RSL Gymnastic Competition By MORGAN WILLIAMS THERE was lots of enthusiasm and talent on show at the Dubbo RSL Gymnastic Competition on Saturday, August 26, when gymnastic students had their chance to shine in front of parents and friends.

57


58

September 7-13, 2017 Dubbo Photo News

SPORT

Junior rugby league semi finals THE Caltex Park complex showcased the very best in local league last Saturday, September 2, as teams from Nyngan, Narromine, Wellington, Warren and Dubbo battled to keep their season going for at least another week. As always there were cheers and tears surrounding the parade of talented youngsters and parents who dressed up in club colours to cre-

Under-12 Major. Warren v St Johns (Warren won). Touchie Paddy Haycock. St Johns Cale Slacksmith and Warren Fletcher Hunt.

ate a noisy and exciting environment. This week’s Preliminary Finals will determine which teams progress to the grand finals in all ages from Mod League to under-16s. Rumour has it there will be plenty of Nyngan Tigers in town to warm up for Sunday’s historic first Group XI grand final appearance by the team beside the Bigan.

Under-12 Elimination. South Dubbo v Nyngan.

Under-12 Major. Warren v St Johns. St Johns player; Josh Townsend scoring and Hugh Gibbons and Jake Reichett look on.

Under-11 Major Semi. Nyngan v St John’s Gold. Nyngan player Hunter ? and St Johns players Darby Haycock (legs) and Ollie Williams.

Under-14 Elimination. Wellington v St Johns (St Johns won 626). Wellington player? St Johns players; Joey Cant number 11, Ryan Boland number 10 and Brad Deveigne (black headgear).

Under-11 Major Semi. Nyngan v St John’s Gold (Nyngan won). Nyngan player Jack Finlay and St Johns players Ollie Williams and Bryce Foley.

Under-11 Major Semi. Nyngan v St John’s Gold. Nyngan player Harry ? and St Johns players Jodan Porter and Cooper Burris.

Under-11 Major Semi. Nyngan v St John’s Gold. Nyngan player Mason Ropey and St Johns player Jodan Porter.


59

Dubbo Photo News September 7-13, 2017 Spacecats snatch eggs from Magpies nest! PARKES set up a rerun of last year’s grand final against the CYMS Fishies in League Tag when they blasted their way into the Forbes Magpies’ haven to steal a points. In a dramatic last couple of minutes, reminiscent of the Spacecats’ tension-packed one-point extra time win over CYMS in the decider 12 months ago, Parkes scored a try for a 4-2 final score line. The win gives the Parkes girls a chance to defend their premiership. It was a heartache for the Forbes team which were within seconds of joining the Under 18s on grand final day. CYMS will start favourites in the first match on Grand Final day following their 22-0 demolition of Forbes in the major semi. A win could ignite a Fishies tri-fec- Spacecats’ speedster India Draper is all smiles after scoring the match-winning and only try in the ta with Reserve Grade (v Wellington) and preliminary final. Parkes looked like their season was over until the last minute four-pointer that Tim Ryan’s firsts drawn to play Nyngan. clinched their right to defend the title they won in spectacular fashion against CYMS last year.

Macquarie Raiders’ versatile tyro, Luke Gale will draw on some time he spent in first grade this season when he runs out for the Unders Grand Final against Forbes.

Was this the last time we see Parkes brilliant halffive-eighth Dennis Moran at Apex Oval? The mercurial Spacemen coach has won numerous awards and two premierships with Parkes.

The Spacecats recreate their grand final celebrations as India’s try steals the final from their twin towns’ rivals, Forbes.

Wellington Cowboys will ride in to town on Sunday, determined to take the Fred King Reserve Grade trophy south. Last year they won the Juniors and the brilliant Kotoni Staggs is now playing a lead role with the Brisbane Broncos 20s. This man, Kenny Everson will be one of a surfeit of stars CYMS will need to shut down if they’re to win back-to-back titles.

Tiger Shark – from the sand hills of Cronulla to the red soil of the western plains TWELVE months ago Stewart Mills was contemplating his rugby league future. He was celebrating the Sharks first NRL premiership after 49 years. He debuted in the NRL with Cronulla in 201, spent an injury-riddled couple of seasons in the beachside suburb and then signed on with the Broncos for the 2015 season. Stewart’s league career seemed over when chronic knee injuries forced him into premature retirement and back to his trade as an electrician. His passion for the game saw him pull on the boots with the Mount Pritchard Mounties in the NSWRL in 2015 but he

again gave the game away late last year with his knee problems refusing to go away. Nyngan President Glen Neill and his committee could not believe their luck when the former flyer answered an ad to captain-coach the Tigers in 2017. The rest is history. The man who will be handed the keys to the best little town on the Bogan if the Tigers hunt down the Fishies on Sunday could well have a “Tiger Shark” statue placed beside the famous Bogan Man sculpture that rises from the western dust by Monday!

The Ice Man returns Jimmy’s back on the job! AT the Group XI major semi-final two weeks ago CYMS second-rower Jackson Fletcher came from the field in agony, clutching his ribs. The call went out “where’s the ice”? Of the frozen water, rehabilitative kind, of course! In the well-oiled CYMS’ match-day machine, one of elder statesman Jimmy Ryan’s jobs is to ensure there is plenty of ice, plastic bags and tape so when his son, the Fishies coach looked around and there was none, the penny dropped. Jim was in Sydney recovering from major heart surgery and no-one had picked

up the job! Thankfully Jim will be back for the grand final although probably watching intently from the stand having ensured that someone has taken on his role. Welcome home Jim. Someone said boredom and pain have been your two biggest issues in the Jim’s rehabilitation following his unexpected visit to the doctors. I didn’t think PAIN was in Jim’s vocabulary!

Smithy smiles after spectacular splash! DUCKS veteran Peter Smith was has been like a watermelon this week, showing the pearly whites after claiming two wins and the lucky number. “Once the handicapper does a bit of adjusting this week there is no doubt the smile will be diminished and frowns returned next Sunday, publicity officer Judy Walsh laughed! “Matt Dover had a great swim in his heat of the 25 metre freestyle being a very close 19 seconds off his time to take out the monthly trophy sponsored for September by Morrison’s Family Eye Centre. “Dick Whiteford who was in town from Nyngan joined us in the pool. No doubt he’ll be back next Sunday to warm up for

the Tigers’ first Group XI grand final,” Judy said. Ducks Results Father’s Day, Sunday, September 3, 2017: 25 m freestyle: Tony Wall, Roger Mackay (2), Greg Jankowski (3), Peter Smith (4), Nicole Johnstone (5) 2 x 25 m Free/ Free: Tony Wall/ Peter Smith, Dick Whiteford/John Wherritt (2), Nicole Johnstone/ Matt Dover (3), Norm Bahr/ Greg Jankowski (4), Mel Giddings/ Roger Mackay (5) 25 Metre Breaststroke: Peter Smith, Nicole Johnstone (2), Roger Mackay (3), John Wherritt (4), Judy Walsh (5).


60

September 7-13, 2017 Dubbo Photo News

Josh takes the dosh!

Mark Coleman, Dallas Towney-Elmes, Kain Simpson, Callum Hosking, Logan Conway, Ben Carolan, Harrison Carlow, Charlie Kempston, Cal Giffin, Will Allen, Samuel Thompson, James Nelson, Greg Kennedy, Alex Ford, Ben Cook, Jayden Thorpe, Logan Monaghan, Mackenzie Brouff, Stephen Laing, Charlie Spora, Jackson Bayliss, Ethan Yeo (injured)

WHEN the Macquarie Inn signed up as a sponsor for this year’s competition, they chose a soccer goalkeeper as their lead man. Josh Bernard knows plenty! Unlike the unbeatable Winx who Hughie Bowman steers home over the top of all-comers, Josh proved to be a front-runner. According to Kevin Engeler, the man to whom I handed the reins during the season, “he was never going to be beaten!” Josh’s true colours are the purple, navy blue and white which dominate the Melbourne Storm guernsey but it is the smallest touch of gold embedded in the strip that is sparkling in the popular Macquarie Inn manager’s face these days! Well done everyone. Our special

thanks to Shane Medley who maintained his enthusiasm throughout a very difficult period. Our thoughts and plenty of dollars have gone into the rehabilitation fund for brother Ryan who remains in hospital in Sydney following a tragic accident during a Group XI reserve grade match in Wellington. Thanks to all who participated and put up with Kevvie’s taunts! We look forward to chasing Josh for the dosh in next year’s Photo News competition. Oh, by the way, save your money - don’t back the Dragons, unless you want to donate your hard-earned to Paul McGregor’s retirement fund! All the best, The Saint.

7

WEEKS FOR

$70 • • • • •

Gym Indoor Pool Group Fitness Sauna /Steam Room Start up Program

Includes full Membership benefits

commences 18th september *T’s & C’s Apply.

Rhinos to contest 17s Central West Rugby grand final WHEN the Dubbo Rhinos began their 25th anniversary season, club officials were determined to create a pathway for young players. Without a junior nursery to draw from and a heap of youngsters wanting to play, the club approached Giffin and Darryl Thompson to bring a group together. Six months later, the Rhinos have qualified for the under-17s Grand Final! “The team led the competition at the end of the first round but a few losses and injuries saw the boys qualify for the finals in fourth place. With wins against Mudgee 26-24 in the semi-final and then 29-26 against Orange City in last week’s final, the Rhinos earned the right to play off for the title against Nar-

romine Gorillas this Saturday,” Darryl reflected. “In a squad of 26, seven of the players had played with the Roos for more than one season and others were drawn in through mates. Some had never played union, so we are very excited with what has been achieved,” the proud said. “We play a Narromine team that has offered opportunities to kids from different communities so there are now more young ones getting an opportunity to spend time with their mates in a sport that will help them build friendships all over the world,” Darryl added. The Rhinos along with strong Dubbo Roos 13s and 15s teams head to Orange for the CWJRU premiership deciders on Saturday.

DAY

BIRTHDAY

MEMBERSHIP

Sale

DUBBO RSL AQUATIC AND HEALTH CLUB* www.rslhealthclub.com.au


61

Dubbo Photo News September 7-13, 2017

SPORT Golden Wheels - Dubbo riders are National Champions of Champions Send your Sport news to geoff.mann@dubbophotonews.com.au

DUBBO’S reputation as a road cycling Mecca was reinforced over the weekend on a cold and wet Apple Isle. Five locals flew to Tasmania with the NSW Blues and came home with gold and silver medals in their luggage. Our Dubbo riders hit out early with Haylee Fuller winning gold in the under-15 women’s Time Trial (TT) by a staggering 43 seconds. “This is an event that is usually won by a handful of seconds at most. It was the most dominating display of strength by Haylee so far. She is asserting her dominance in the discipline she can now call her own,” Dubbo Cycling president Matthew Gilbert enthused. Haylee’s win was backed up by Dylan Eather who won Gold in the under-15 men’s TT. “In a show of power in the race against the clock, Dylan claimed victory with a 15 second margin. Daniel Barber also put in a solid effort to finish fifth, just 22 seconds behind. It was a time that may equate to only a hundred metres, a great result,” Matt added. Kurt Eather was fifth in the under-17 men’s TT, missing out by just 20 seconds in a solid performance. Luke Ensor also had a great hit out preparing for the tough road race the following day while Zara Fuller, who rode as a club rider, smashed out a great time in her

first ever national level event. “On day two, Dylan took silver in a sprint finish and the consistent Danny Barber grabbed fifth in a brutal road race that resembled a mountain stage in a European tour. It was an extremely hilly course, and in the end only two bike lengths separated the tactical pair,” Matt said. Haylee etched her name in the record books, claiming a second gold medal in the road race. “Haylee had clear superiority to ride everyone off her wheel and take command of the race for a brace of gold medals.” According to the proud president, Zara Fuller was right, finishing strongly in the main pack in her race. “Zara is already confident with a year to go in the event. She has taken a lot out of this race and is not afraid to do the work and make it back next year.” Dubbo rider and the crowd favourite in Tasmania, Kurt Eather, sprinted in a manner befitting his new nickname “Road King” to win gold in the 17 men’s road race by half a wheel. “Luke dug deep to finish with the pack having spent quite some time doing work at the front in an extremely select field of Australia’s best under-17 road cyclist’s but the stunning finish by Kurt opened the eyes of road cy-

Sports editor

Sports photography

GEOFF MANN

MEL POCKNALL

Kurt Esther crosses the line first! cling officials,” according to Matt. Unfortunately the Criterium and other races were cancelled as a result of inclement weather on Sunday. Both Luke and Kurt had qualified for the final but did not get a chance to contest a medal and the unforgiving climate cost Haylee the chance to grab a famous hat-trick. The icing on the cake for the Dubbo Club came when Haylee Fuller and Dylan Eather were named “Champion of Champions”

for their respective under-15 Men and Women Divisions. “Kurt was unlucky not to come home with the champion of champion’s jersey for under 17 Men losing on a count back to a Queensland rider. Who knows, if the Criterium had gone ahead, we may have claimed the treble,” Matt smiled. These results are unparalleled in any in any club in Australia and highlight Dubbo Cycling’s status as a training ground for cycling excellence.

Matt was lavish in his praise for the local support team behind the Dubbo club. “Sponsors like Dubbo City Toyota and Club Dubbo and the amazing parents of all our riders is much appreciated. Our coaches Vaughn Eather and Gus Dawson generously devote long and attentive hours and continue to produce Australian Champions. They carry a proud tradition of cycling supremacy within the community,” Matt concluded.

Finals, finals everywhere but not a Saint in sight Steptember - clocking up I GET ribbed endlessly for supporting the 11-years in-a-row world record holding St George Dragons - just sayin’ - but when I look around the finals line ups at both local and national level, there is not a red V in to be seen! This weekend’s lineups: • Group XI Grand Finals at Caltex Park’s Apex Oval on Sunday - CYMS v Nyngan Tigers (first grade), Wellington v CYMS (reserve grade), Forbes and Macquarie (juniors) and

CYMS v Parkes, in a replay of last year’s nail-biting league tag decider • Group X Grand Finals - Orange CYMS/ Oberon Tigers, Lithgow Wolves/ Bathurst St Pats (First Division), CYMS/St Pats (U18s); Orange Hawks/ Bathurst St Pats (League Tag) • Castlereagh League Grand Finals at McGrane Oval Gilgandra on Sat - Gilgandra/Coonamble (firsts), Coonabarabran/Baradine (youth) and Dunedoo Swanettes v Warren

GET YOUR REPRINTS HERE Reprints of most photos you see in Dubbo Photo News and Dubbo Weekender are available to buy. Call 6885 4433 during office hours, or call in to our office at 89 Wingewarra Street.

Bulldogs (league tag) • Woodbridge Cup (Sun) - Trundle Boomers /Cargo Blue Heelers, Trundle/Manildra (Youth league), Grenfell/Eugowra (league tag) Central West Rugby Union Finals in Forbes • Forbes Platypii/Bathurst Bulldogs (winner v Orange Emus) • Western Plains Rugby Grand Finals in Walgett • Walgett Rams v Warren Pumas

metres for Cerebral Palsy MATT ELLIS is a CYMS cricketer and NSW Development Officer for Western NSW. He is also one of a team of cricket “tragics” who are literally stepping it out for charity. Matt, along with Matthew Taberner who looks after the Central Western group

and other part-time coaches, are pledging to walk at least 10,000 steps each day and find sponsors for their cause. If you see the sports mad young dad, put in a few dollars to assist him raise funds and increase awareness of Cerebral Palsy.

3D EXTRA

SESSIONS FROM THU 7 SEPT UNTIL WED 13 SEP IT (MA15+) THU FRI MON TUE: 11.00 2.00 3.00 4.00 6.00 7.30 8.30 SAT SUN: 11.00 2.00 3.00 6.00 7.30 8.30 WED: 11.00 2.00 3.00 4.00 6.00 8.30 THE HITMANS BODYGUARD (MA15+) DAILY: 10.30 1.00 6.00 8.50 AMERICAN MADE (MA15+) DAILY: 10.30 1.00 6.15 8.50 THE DARK TOWER (M) DAILY: 4.00PM ANNABELLE: CREATION (MA15+) THU FRI MON - WED: 12.30 8.50 SAT SUN: 8.50PM

HAMPSTEAD (PG) DAILY: 11.00 1.20 3.30 6.15 ADVANCE SCREENINGS

CAPTAIN UNDERPANTS (G) SAT SUN: 12.30 4.00 FAMILY FUN DAY

EMOJI MOVIE (G) SUN: 10.00AM SPECIAL EVENT • $20 TIX

DAVID GILMOUR: LIVE AT POMPEII (G) WED: 8.30PM

DUBBO PH: 6881 8600


62

September 7-13, 2017 Dubbo Photo News

SPORT

Grassroots sport colours our days AS we sprung into spring last weekend, the full spectrum of natural and synthetic colours was on display right across the west. Our junior league players went through their paces at Caltex Park’s Apex Oval while junior soccer, netball, AFL and hockey fields were kaleidoscopes as littlies through to teens and adults enjoyed the warm days. Junior rugby boys travelled to Bathurst for the preliminary finals and as a result, Rhinos U17s and Roos 13s and 15s 5s along with the

Gorillas from Narromine will be on the roads early again this Sat for the Central West Junior Rugby Union Grand Finals. There are lots of action photos and some snippets from around the sporting world inside Sport Core! Our photo shows a Nyngan Tiger cub trying to break free of his South Dubbo tackler in the Under 12s Elimination semi-final. Souths won 12-8 but that won’t stop the tigerish lad from dressing up for Sunday’s Group XI grand final. PHOTO: MEL POCKNALL


63

Dubbo Photo News September 7-13, 2017

SUPPORT THE FISHIES IN THE 2017 GROUP 11 GRAND FINALS

WHERE: CALTEX PARK WHEN: SUNDAY 10 SEPTEMBER LEAGUE TAG TO COMMENCE AT 10AM LEAGUE TAG

V’S

RESERVE GRADE

V’S

UNDER 18’S

V’S

FIRST GRADE

V’S

Celebrate another successful season by joining players and supporters at the Castlereagh Hotel on Sunday evening THANK YOU TO OUR SPONSORS

NORTHSIDE SANDWICH SHOP

ROSS HARRIS PAINTING

B & F CROGHAN


64

KIA'S SUPER

September 7-13, 2017 Dubbo Photo News

SEPTEMBER SALE

WE WON'T BE BEATE1 ON ANY WRITTEN QUOTES 2017 KIA RIO S

2017 KIA SPORTAGE

AVAILABLE IN MANUAL & AUTOMATIC!

IN AUTOMATIC!

FROM $17,490 DRIVE AWAY

FROM $32,990 DRIVE AWAY ALL COME WITH A

“SSTARTER R ACCESSO ORY PA ACK K”

(MATS, DASH MAT & CARGO TRAY)

VALUED OVER $300!!

FROM $19,990 DRIVE AWAY

2017 KIA CERATO WITH FREE AUTOMATIC ACROSS THE RANGE!

Bourke Street Dubbo Gill Farquhar: 0412 758 263 Ph: 02 6884 6444 sainsburyautomotive.com.au DUBBO’S LARGEST INDEPENDENTLY OWNED CAR DEALER

SAME DAY FINANCE AVAILABLE FROM $15,690 DRIVE AWAY

2017 KIA PICANTO S IN AUTOMATIC! s” “People Trust Sainsbur y’

ABN 23 087 943 600 MD:17302

Dubbo Photo News 07.09.2017  

Dubbo Photo News September 7-13, 2017

Read more
Read more
Similar to
Popular now
Just for you