Issuu on Google+

FLACSO

Secretaría General

Revoluciones Horizontales

Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

Adolfo Álvaro Martín


FLACSO SecretarĂ­a General AdriĂĄn Bonilla Soria, Secretario General FLACSO

000.0 G000g

Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmÊrica Latina y Espaùa. -­-­ 1ª. ed. -­-­ San JosÊ, C.R. : FLACSO, 2013. 247 p. ; 21 x 15 cm. ISBN 000-­0000-­00-­000-­0

Impreso en San JosĂŠ, Costa Rica por Perspectiva Digital S.A. Setiembre 2013.

Las opiniones que se presentan en este trabajo, así como los anålisis e interpretacio-­ QHV TXH HQ pO FRQWLHQHQ VRQ UHVSRQVDELOLGDG H[FOXVLYD GH VXV DXWRUHV \ QR UHà HMDQ necesariamente los puntos de vista de FLACSO ni de las instituciones a las cuales se encuentran vinculados.

2


“Con Internet y las redes sociales el cambio no es solo de canal, también se está cambiando el poder, dándole más fuerza a los ciudadanos”. Joe Trippi (2011).

3


4


A mi esposa y a mi hijo, con todo cari単o.

5


6


ÍNDICE AGRADECIMIENTOS ....................................................................................................9 PRÓLOGO ....................................................................................................................... 11 INTRODUCCIÓN Un nuevo actor llama a la puerta. ................................................................................. 15 LA LLEGADA DE LAS TIC A LA POLÍTICA ........................................................ 19 1.1 Transformaciones sociales y nuevos paradigmas políticos. ........................... 21 1.2. TIC y regeneración democrática. ...................................................................... 24 1.3. Hackers: los nuevos activistas. ........................................................................... 36 1.4 Comunicaciones inalámbricas y movilización social. .................................... 41 NATIVOS DIGITALES, REDES SOCIALES Y POLÍTICA 2.0 ........................... 51 2.1. Los nativos digitales........................................................................................ 53 2.1.1. Teoría de los nativos digitales ................................................................. 53 2.1.2. Influencia de las TIC en los valores de los jóvenes.............................. 58 2.1.3. Nativos digitales y Redes Sociales .......................................................... 65 2.2 La llegada de la Web 2.0 ................................................................................. 69 2.2.1 La crisis de las “puntocom” ..................................................................... 69 2.2.2. La transformación producida por la Web 2.0 ...................................... 73 2.3 Nativos digitales y política ............................................................................. 84 2.3.1 Nuevas ideas y nuevas herramientas ..................................................... 84 2.3.2 Ciberactivismo y “Política 2.0” ............................................................... 93 2.3.3 Herramientas de la “Política 2.0” ......................................................... 101 CIBERACTIVISMO Y MOVILIZACIONES CIUDADANAS EN AMÉRICA LATINA Y ESPAÑA ........................................................................ 125 3.1. ESPAÑA: Del “¿quién ha sido? al “no nos representan”. ............................. 128 1. Las movilizaciones ciudadanas de marzo 2004 ....................................... 128 2. Las protestas contra la “Ley Sinde”. ............................................................ 136 3. El movimiento 15M...................................................................................... 140 3.2 ECUADOR: La “Rebelión de los Forajidos”. .................................................. 152 1. Antecedentes.................................................................................................. 152 2. Telefonía móvil e Internet en el Ecuador de los primeros años del siglo XXI ........................................................................ 153 3. La “Rebelión de los Forajidos” .................................................................... 155

7


4. Radio La Luna y el descrĂŠdito de los medios de comunicaciĂłn tradicionales ........................................................................ 159 5. El activismo “forajidoâ€?.................................................................................. 162 3.3 MÉXICO: Cuando el ciberactivismo hizo temblar los cuarteles electorales................................................................................................... 169 1. Uso de Internet y Redes Sociales en MĂŠxico ............................................ 169 2. Los antecedes del ciberactivismo en MĂŠxico: “#Internet-Necesarioâ€?................................................................................... 170 3. “#YoSoy132: “Somos estudiantes de la Ibero, no acarreados no porros..â€? .......................................................................... 172 t &MQBOPSBNBQPMĂ“UJDPBOUFMBTFMFDDJPOFT Presidenciales de 2012 .................................................................................. 172 t :P4PZ-BSFWVFMUBEFMPTOBUJWPT digitales mexicanos........................................................................................ 174 CONSIDERACIONES FINALES.............................................................................. 193 BIBLIOGRAFĂ?A ........................................................................................................... 207

8


AGRADECIMIENTOS Este libro es consecuencia de la tesis que realicé para obtener el grado de Doctor, centrada en indagar el desarrollo del ciberacti-­ vismo y el papel que en su expansión estaban teniendo los jóvenes QDFLGRV HQ ODV ~OWLPDV GpFDGDV GHO SDVDGR VLJOR 6X ÀQDOL]DFLyQ no hubiera sido posible sin el apoyo decidido de las siguientes per-­ sonas e instituciones, de las cuales he recibido valiosas y conti-­ nuadas aportaciones. A todos ellos deseo expresar mi más sincera gratitud. Mi especial reconocimiento y agradecimiento a la Facultad Lati-­ noamericana de Ciencias Sociales (FLACSO), tanto por el apoyo mostrado para la publicación de esta obra como en mis investiga-­ ciones sobre jóvenes y tecnología en Latinoamérica realizadas en los últimos años. A mi querido y admirado Adrián Bonilla Soria, Secretario Gene-­ ral de FLACSO, que me ha acompañado con sus consejos y apoyo desde mi época de doctorando, honrándome con sus comentarios críticos a este trabajo, con una cercanía y afecto por los que siem-­ pre le estaré agradecido. A Rafael Cortés Elvira, quien durante su periodo de rector de la Universidad Camilo José Cela, España, apoyó e incentivó mi acti-­ vidad docente e investigadora. Al Presidente Internacional de la Red Iberoamericana de Informá-­ tica Educativa (RIBIE), Miguel Ángel Vargas Hernández, por su apoyo decidido a mi labor investigadora en estos años, clave para poder llevar a cabo este proyecto.

9


Adolfo Álvaro Martín

A los profesores Carlos Castro, de la Universidad de Granada, Es-­ paña; Fermín Bouza, Manuel Sánchez de Diego y Rafael Rubio, de la Universidad Complutense de Madrid, España, por sus consejos y recomendaciones en mi tesis doctoral, que tan decisivos fueron para iniciar esta travesía. A mi amigo y profesor Carlos Plá Barniol, de quién tanto aprendo todos los días, y que me honra con su afecto y presencia. A mis queridos padres y a María Cristina Carrillo, profesora, in-­ vestigadora y compañera vital, cuya meticulosidad y rigurosidad en el trabajo han sido decisivas para la realización de este libro.

10


PRĂ“LOGO Las personas y la polĂ­tica es el eje vertebrador de “Movimientos Horizontalesâ€?, un libro que analiza el fenĂłmeno emergente de la participaciĂłn ciudadana en la polĂ­tica al margen de los actores tra-­ dicionales. Para ello, el autor ha escogido tres ejemplos acaecidos en AmĂŠrica Latina y EspaĂąa: La “rebeliĂłn de los forajidosâ€? que, en 2005, provocĂł la caĂ­da del gobierno de Lucio GutiĂŠrrez en Ecuador; el “15-­Mâ€? que, desde la Puerta del Sol de Madrid, se extendiĂł por toda EspaĂąa en 2011 y; el movimiento estudiantil “#YoSoy132â€? que, desde el campus de la Universidad Latinoamericana de MĂŠxi-­ co D.F., transformĂł la campaĂąa electoral de 2012. El autor sostiene que estas acciones ciudadanas tienen su origen en las transformaciones que vienen desarrollĂĄndose en nuestras sociedades desde hace aĂąos y que, por diversas razones, no han sido percibidas o tenidas en cuenta por los partidos polĂ­ticos tra-­ dicionales, lo que ha tenido como consecuencia una pĂŠrdida pro-­ JUHVLYDGHVXFDSDFLGDG GHLQĂ XHQFLDHQODVRFLHGDGDOQRSRGHU canalizar sus intereses y expectativas. A este respecto, en el libro VHOODPDODDWHQFLyQVREUHHOKHFKRGHTXHODGHVFRQĂ€DQ]D\DOHMD-­ miento progresivo de la ciudadanĂ­a con respecto a partidos y polĂ­-­ WLFRVQRVLJQLĂ€FDWDPELpQLQGLIHUHQFLDRGHVLQWHUpVKDFLDODDFWLYL-­ dad polĂ­tica. Mas al contrario, los ejemplos analizados en esta obra muestran que las personas sĂ­ estĂĄn interesadas en la vida polĂ­tica y, por ello, han desarrollado nuevas formas de visualizaciĂłn y pro-­ testa alternativas a los canales tradicionales, exigiendo una mayor participaciĂłn en la toma de decisiones respecto a los asuntos que les interesan. En este sentido, la actividad polĂ­tica de estos ciuda-­ danos no desea verse constreĂąida a depositar el voto en una urna cada cierto tiempo, sino que tambiĂŠn exigen una presencia activa y continuada para hacer oĂ­r la voz de los colectivos ciudadanos en los distintos ĂĄmbitos de la vida pĂşblica. 11


Adolfo Ă lvaro MartĂ­n

(O OLEUR SRQH GH PDQLĂ€HVWR TXH VL ELHQ HVWDV IRUPDV DXWyQRPDV de actividad polĂ­tica ciudadana han podido desarrollarse y difun-­ dirse gracias a las TIC, no es menos cierto que no es un activismo originado como consecuencia del nuevo “paradigma tecnolĂłgicoâ€?, pues mucho antes de la apariciĂłn o popularizaciĂłn de estas herra-­ mientas ya se habĂ­an comenzado a detectar y analizar las acciones polĂ­ticas desarrolladas por grupos ciudadanos autĂłnomos. La tec-­ nologĂ­a habrĂ­a sido el catalizador que ha permitido a estos colecti-­ vos articularse y actuar de forma diferente, logrando con ello una amplia legitimidad social que les permite llevar a cabo moviliza-­ ciones para la consecuciĂłn de sus objetivos. Esta distinciĂłn resulta necesaria pues, al albur de esta falsa iden-­ WLĂ€FDFLyQHQWUHPRYLPLHQWRVFLXGDGDQRV\XVRGHODWHFQRORJtDHO autor alerta que se estĂĄ tratado de desprestigiar o menospreciar a estos movimientos ciudadanos, bien reduciĂŠndolos a una moda pasajera consecuencia del desarrollo tecnolĂłgico bien tachĂĄndolos de “utĂłpicos ciberoptimistasâ€? que creen que el mundo puede cam-­ biarse por medio de un clic desde la computadora de su domicilio. Otro de los elementos nucleares de la obra, es la importancia que para el desarrollo y popularizaciĂłn de este nuevo activismo ciuda-­ dano estĂĄn teniendo las nuevas generaciones educadas en entornos digitales. Son jĂłvenes que han hecho del mundo virtual parte de su mundo real, lo que conlleva no solo una transformaciĂłn tecnolĂłgica sino tambiĂŠn cultural, que abarca todos los aspectos de sus vidas: desde la utilizaciĂłn de smartphones, descargas de mĂşsica o videos, compras “on lineâ€?, a subir y compartir videos en las redes sociales, etc. Por ello, no debe de extraĂąarnos que tambiĂŠn estĂŠn trasladan-­ do a su acciĂłn polĂ­tica estas formas de comportamiento. 3RUHOORORVHMHPSORVH[SXHVWRVHQHVWHOLEURSRQHQGHPDQLĂ€HVWR como estos jĂłvenes han orquestado nuevas formas de participaciĂłn ante el rechazo que les provocan los canales institucionales tradi-­ cionales, incapaces de atender sus demandas e intereses. Y, como 12


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

en cualquier otro aspecto de sus vidas, están utilizando la tecnolo-­ gía para la articulación, organización y ejecución de sus protestas. Podremos estar o no de acuerdo con el autor respecto a su tesis de que estos movimientos horizontales son un nuevo actor político que viene a quedarse entre nosotros. Pero, en todo caso, nos obliga UHÁH[LRQDU VREUH ODV WUDQVIRUPDFLRQHV TXH VH HVWiQ SURGXFLHQGR en el seno de nuestras sociedades, y en qué medida afectan a la democracia y a las formas en las que los ciudadanos demandan participar en la gestión de los asuntos públicos. Adrián Bonilla. Secretario General FLACSO

13


Adolfo Ă lvaro MartĂ­n

14


INTRODUCCIÓN Un nuevo actor llama a la puerta. En estos últimos años estamos asistiendo a la proliferación de ac-­ ciones ciudadanas en el ámbito de la política. Movilizaciones que surgen y se organizan de forma autónoma, que no parecen estar estructurados ni tener líderes, pero que son capaces de convocar a miles de personas y llevar a cabo sus protestas tanto en las calles como en Internet. Estas nuevas formas de actuación se alejan de las que en el pasa-­ do parecían reservadas a los ciudadanos en las democracias. Con ellas, las personas expresan su negativa a ser considerados como sujetos pasivos a los que solo se les convoca cada cierto tiempo a unas elecciones y que, posteriormente, se les aleja de las decisio-­ nes que afectan a sus derechos e intereses. Es importante destacar que nos encontramos ante un activismo político que no ha surgido con la aparición y popularización de las Tecnologías de la Información y la Comunicación (TIC). Este es un error que con demasiada frecuencia aparece a la hora de realizar su análisis, pues desde hace más de medio siglo que se viene ha-­ blando de incipientes formulas de acción política generadas desde colectivos ciudadanos. Lo que sí se ha producido gracias a las TIC, es la aparición de mo-­ vimientos horizontales capaces de articularse y actuar de forma totalmente diferente a los sujetos políticos existentes, que gozan de una gran legitimidad social y que, en poco tiempo, consiguen llevar a cabo grandes convocatorias para la consecución de sus ob-­ jetivos, como veremos en los ejemplos desarrollados en este libro en Ecuador, España y México. 15


Adolfo Álvaro Martín

A través de estos casos descubriremos la forma en que los ciuda-­ danos han hecho uso de la tecnología para alcanzar objetivos polí-­ ticos, comparando las modalidades y el contexto en que cada una de estas acciones se ha producido, así como el rápido aumento de ODLQÁXHQFLDGHOFLEHUDFWLYLVPRHQXQSHULRGRGHWLHPSRUHODWLYD-­ mente breve. Se han seleccionado ejemplos emblemáticos. De un lado, por la importancia que para el desarrollo del ciberactivismo tuvieron las movilizaciones ciudadanas llevadas a cabo en España y Ecuador en marzo de 2004 y mayo de 2005, respectivamente, donde la tec-­ nología jugó por primera vez un papel decisivo para la consecución de objetivos políticos. De otro, porque los movimientos 15M y #Yo-­ Soy132, han mostrado la pujanza de unas nuevas generaciones que gracias a sus habilidades en el uso de las TIC han sido capaces de articular acciones reivindicativas inéditas y exitosas. Podemos catalogarlas como revoluciones horizontales que, más allá de la consecución de un objetivo concreto, están generando una nueva actitud hacia la política en la que las personas adoptan una pos-­ tura activa ante las cuestiones que les interesan, organizándose y actuando contra situaciones que consideran injustas y para las que los actores tradicionales no han sido capaces de encontrar al-­ ternativa. Han irrumpido con fuerza en la política y pretenden quedarse. Es-­ tán cuestionando el status que ostentaban los políticos, los parti-­ dos y los sindicatos, a los que ya no reconocen su carácter de únicos intermediarios y que, como no podía ser de otra manera, han reac-­ cionado al ver en peligro su posición de centralidad trasladando una visión distorsionada de estos movimientos, bien acusándoles de ser un activismo “de sofá” propio de personas aisladas e insoli-­ darias bien tachándolo de movimiento utópico con pocas posibili-­ dades de cambiar una realidad compleja.

16


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

Como veremos, los ejemplos expuestos en esta obra desmienten SXQWRSRUSXQWRWDOHVGHVFDOLÀFDFLRQHVSRQLHQGRGHUHOLHYHODFRQ-­ vulsión que estos movimientos producen en quienes han ejercido el monopolio de la intermediación política, los cuales, ven con honda preocupación la existencia de nuevas vías de participación que no estån bajo su control directo, y que en estos momentos gozan de PiVUHSXWDFLyQ\ÀDELOLGDGTXHHOORVHQWUHORVFLXGDGDQRVHVSH-­ cialmente los mås jóvenes. Para ello, el libro se ha dividido en tres grandes capítulos: en el primero, se realiza un acercamiento teórico a las nuevas formas GHDFFLyQSROtWLFDSRUSDUWHGHORVFLXGDGDQRV\ODLQà XHQFLDTXH en su desarrollo tuvo la llegada de las TIC. En el segundo capítu-­ lo, se aborda la importancia que en este proceso estån teniendo las nuevas generaciones educadas en entornos digitales, grandes impulsores de estas revoluciones horizontales. El tercer capítulo, analiza los procesos acaecidos en Ecuador, Espaùa y MÊxico, como antes hemos detallado, cuyas conclusiones son presentadas al lec-­ tor en la última parte de la obra. Es cierto que debemos observar con preocupación la desilusión que cunde entre los ciudadanos con la democracia, y estar alerta ante quienes pueden estar buscando una rentabilidad política median-­ te la desestabilización de gobiernos e instituciones. Sin embargo, esta obra tambiÊn pretende reivindicar que no es en las revolucio-­ nes horizontales donde hay que buscar los peligros que acechan a la democracia, sino en la mala praxis y la incapacidad de los actores políticos tradicionales para representar los intereses de los ciudadanos y articular soluciones justas para los problemas de so-­ ciedades complejas.

17


18


CAPÍTULO I

LA LLEGADA DE LAS TIC A LA POLÍTICA


La llegada de las TIC a la PolĂ­tica

1.1 Transformaciones sociales y nuevos paradigmas políticos Las transformaciones que se han ido operando en las sociedades modernas a partir de la segunda mitad del pasado siglo XX no fueron percibidas e interpretadas de forma adecuada por la clase política, provocando un progresivo alejamiento de la ciudadanía y un creciente desprestigio de los actores políticos tradicionales. Bell (1973) analizó las consecuencias de dichas transformaciones, concluyendo que estos cambios estaban debilitando las relaciones sociales existentes, muy vinculadas a la propiedad, así como las es-­ tructuras de poder que hasta entonces se concentraban en peque-­ ùas Êlites y, sobre todo, la cultura burguesa que había propagado ORVSULQFLSLRVGHFRQWHQFLyQ\DSOD]DPLHQWRGHODVJUDWLÀFDFLRQHV /DVVRFLHGDGHVFRPHQ]DURQDYROYHUVHPiVà H[LEOHV\DXWyQRPDV lo que, según Garretón (1995), las volvió menos permeables a la LQà XHQFLDGHORVDFWRUHVSROtWLFRVWUDGLFLRQDOHVHQODFRQÀJXUDFLyQ de sus identidades y comportamientos. Benedicto y Reinares (1992), entienden que este distanciamien-­ to ciudadano estå profundamente relacionado con las carencias y obståculos que, cada vez con mås frecuencia, tienen los partidos políticos para actuar como transmisores de las demandas e inte-­ reses de los distintos sectores sociales. Esta merma en la capaci-­ GDGGHLQà XHQFLDSDUDFDQDOL]DULQWHUHVHV\OLGHUDUODPRYLOL]DFLyQ social es lo que en opinión de Bartolini y Mair (2001), conduce a XQDXPHQWRGHODYRODWLOLGDGHOHFWRUDOODFDtGDGHODDÀOLDFLyQ\ la perdida de reputación de los partidos políticos. Síntomas que, como veremos, se producen en Espaùa y MÊxico en los momentos de eclosión de los movimientos 15M y #YoSoy132. Rivas Leone (2002) indica que el agotamiento de la política y la democracia se constata al ver como las instituciones y la clase polí-­ tica han sido incapaces de vislumbrar el malestar ciudadano con el funcionamiento de la democracia, provocando una crisis que tiene 21


Adolfo Ă lvaro MartĂ­n

VXV SULQFLSDOHV H[SUHVLRQHV HQ OD GHVFRQĂ€DQ]D KDFLD ORV DFWRUHV polĂ­ticos tradicionales y, lo que considera mĂĄs grave, la ausencia de propuestas y alternativas que permitan la regeneraciĂłn del sis-­ WHPD1RGXGDHQDĂ€UPDUTXHHVWHGHFOLYHVXSRQHXQDFULVLVGHOD democracia, y que la incapacidad para recuperar la credibilidad y funcionalidad del sistema pudiera dar paso a propuestas incompa-­ tibles con los principios democrĂĄticos. A pesar de todo, es importante resaltar que las transformaciones que se han ido generando en las sociedades modernas no han te-­ nido como consecuencia un desinterĂŠs ciudadano hacia la polĂ­ti-­ ca. Barnes y Kaase (1979) detectaron, de un lado, un incremento cuantitativo de la participaciĂłn polĂ­tica tradicional y, de otro, la apariciĂłn de nuevas formas de acciĂłn polĂ­tica que iban mĂĄs allĂĄ de la militancia tradicional o la participaciĂłn en procesos electo-­ rales. Estas nuevas vĂ­as de activismo ciudadano no podĂ­an cata-­ logarse como acciones antisistema o de violencia polĂ­tica, pues FRPRVRVWLHQHQ.DDVH\0DUVK  VXLQWHQFLyQHVLQĂ XLU en el sistema pero no derrocarlo. Estas formas de acciĂłn polĂ­tica no convencional, como veremos mĂĄs adelante, abarcan un amplio espectro que pueden ir desde organizar una marcha de bicicletas por las calles para reclamar transporte menos contaminantes, lle-­ var a cabo “sentadasâ€? a la puerta de un organismo internacional R UHDOL]DU RFXSDFLRQHV GH HGLĂ€FLRV $GHPiV VHJ~Q HVWRV DXWRUHV (ob. cit: 137), ambas formas de acciĂłn polĂ­tica ciudadana no son excluyentes. Estos cambios han sido estudiados por autores como Inglehart (1977), Habermas (1987-­II) u Offe (1988), quienes coinciden en se-­ Ăąalar que esta situaciĂłn habrĂ­a dado lugar a “un nuevo paradigma SROtWLFRÂľHQHOTXHORVFRQĂ LFWRVVHOOHYDUiQDFDERPHGLDQWHQXH-­ vas formas de protesta que no tienen por que desarrollarse por los canales institucionales o parlamentarios tradicionales (Habermas, ob.cit.: 555), cuyos principales actores son los ciudadanos mĂĄs jĂł-­ 22


La llegada de las TIC a la Política

venes, que en muchos casos disponen de un mayor nivel educativo y, como veremos más adelante, también tecnológico. Al efecto, las movilizaciones de marzo de 2004 en España y mayo de 2005 en Ecuador, son ejemplos de acciones políticas no convencionales lle-­ vadas a cabo por los ciudadanos para conseguir objetivos políticos. Esta nueva actividad política ciudadana alejada de los actores tra-­ dicionales, encontró en la última década del pasado siglo XX un aliado insospechado en el desarrollo, popularización y extensión de las entonces denominadas “Nuevas Tecnologías”, fundamental-­ mente en telefonía móvil e Internet, que permitió el control perso-­ nal las comunicaciones y la creación de espacios de encuentro de carácter lúdico, profesional o reivindicativo Es por ello que, casi desde el primer momento, la utilización de las TIC en el ámbito de la política generó un intenso debate sobre las capacidades que estas herramientas podían otorgar a los ciudadanos para adoptar una posición más activa en la política. En América Latina y España, la participación ciudadana en la po-­ lítica ha ido en aumento a lo largo de la primera década del presen-­ te siglo, con una fuerza y relevancia que ha pasado un tanto des-­ apercibido pero que, como expondremos a lo largo de esta obra, ha sido pionera en muchos aspectos a nivel mundial. Analizaremos, de un lado, la forma en la que los ciudadanos latinoamericanos y españoles están utilizando las TIC en el ámbito de la política y, de otro, la capacidad de estas herramientas para conformar nuevas formas de organización e intervención para alcanzar objetivos po-­ líticos (Castells 1999).

23


Adolfo Ă lvaro MartĂ­n

1.2. TIC y regeneración democråtica. A lo largo del presente apartado, expondremos los principales hi-­ tos del debate propuesto en las postrimerías del pasado siglo XX y primeros aùos de la actual centuria. Las tesis que se abrieron paso con mås fuerza fueron las que de-­ fendían que las TIC transformarían algunos de los elementos fun-­ damentales que han caracterizado a las democracias representati-­ vas, al poner en marcha procesos que permitiesen la participación plena de los ciudadanos en las decisiones colectivas y el estableci-­ miento de canales de participación directa al margen de los actua-­ les intermediarios políticos (Cardenal y Battle 2006).. Con la generalización del uso de las TIC en los últimos aùos del SDVDGR VLJOR ;;  VH LGHQWLÀFy FRPR FLEHURSWLPLVWDV  D TXLHQHV consideraban a Internet como una oportunidad para la participa-­ ción ciudadana, gracias a su capacidad para contener y distribuir información y, sobre todo, por su aptitud para favorecer una co-­ PXQLFDFLyQ LQWHUDFWLYD HÀFD] *URVVPDQ  .DPDUFN \ 1\H 2002). Todo ello contribuiría a paliar la crisis de legitimidad que padecen los actores políticos tradicionales (Budge, 1996 y Borge, 2005). Frente a ellos se encontraban los ciberescÊpticos, quienes enfatizaban que en modo alguno el potencial tecnológico podría restar importancia a la cultura política de un país (Barber, 1998; Axford y Huggins, 2000). Uno de los precursores en el debate fue Martín Hagen (1997), que GHÀQLyOD´GHPRFUDFLDHOHFWUyQLFD¾FRPRDTXHOVLVWHPDSROtWLFRGH-­ mocråtico en el cual las computadoras y las redes se usan para llevar a cabo las funciones cruciales del proceso democråtico –como información, comunicación y toma de decisiones-­. Hagen era cons-­ ciente de que su anålisis estaba basado en una realidad social muy HVSHFtÀFD\SULYLOHJLDGDHQDTXHOODpSRFDODGHORV(VWDGRV8QLGRV por lo que advertía que los efectos de este modelo serían diferentes 24


La llegada de las TIC a la PolĂ­tica

en función de la cultura política y la accesibilidad que se tuviese a la tecnología. En este sentido, se pueden reconocer tres conceptos distintos sobre democracia electrónica: teledemocracia, ciberde-­ mocracia y democratización electrónica. Cada uno de ellos, como VHxDODQ2ULRO3UDWV\'HOÉODPR  GLÀHUHGHORVUHVWDQWHVHQ referencia a la tecnología por la que abogan, la preferencia por una concepción democråtica determinada (directa o representativa), la dimensión de participación política que es considerada vital para la democracia y la agenda política que se pretende perseguir. En todo caso, estos autores consideran que cada una de estas visiones comparte la creencia de que las diversas potencialidades de los nuevos medios pueden contribuir favorablemente en el proceso del sistema político. 1.-­ La teledemocracia nació en los aùos 70 del siglo pasado y fue ampliamente desarrollada en la dÊcada siguiente. Partía de la pre-­ misa de que la principal causa de la apatía y el desencanto del electorado se encontraban en el propio sistema político de la demo-­ cracia representativa. Sus seguidores consideraban que solo una forma de democracia fuerte o directa, podía ser capaz de generar political outputs que satisfarían las demandas de los ciudadanos. 8QR GH VXV SUHFXUVRUHV HV 7HG %HFNHU   TXH GLULJLy GRV proyectos en Hawai: el Hawaii Televote y el Honolulu Electronic Town Meeting. En el primero se ofreció a una muestra aleatoria de ciudadanos participar en una encuesta telefónica. Pero esta en-­ cuesta tenía la particularidad de que, con caråcter previo, los par-­ ticipantes habían recibido un dossier con los problemas y cuestio-­ nes que debían resolver. Asimismo, se incitaba a los seleccionados a debatir esos temas con su familia y conocidos antes de realizar HO´WHOHYRWR¾(OVHJXQGRSUR\HFWRGH%HFNHUFRPELQDEDSURJUDPDV de televisión sobre asuntos públicos con la posibilidad de emitir una respuesta ciudadana. Los espectadores podían realizar sus llamadas y emitir sus respuestas durante la emisión del programa RDVXÀQDOL]DFLyQ6HOOHJyDFRPELQDUODWHOHYLVLyQFRQORVPHGLRV 25


Adolfo Ă lvaro MartĂ­n

LPSUHVRVSDUDIDFLOLWDUODLQIRUPDFLyQ%HFNHUWDPELpQVHUHĂ€ULy y tomĂł como ejemplo el proyecto que en 1977 pusieron en marcha Warner Communications y Anax Cable en Columbus (Ohio, Es-­ tados Unidos) llamado QUBE. Este proyecto se diseùó como un servicio de informaciĂłn interactiva mediante el cual sus suscrip-­ tores podĂ­an ir de compras, efectuar operaciones bancarias, o res-­ ponder a encuestas de opiniĂłn. Esta tecnologĂ­a estuvo disponible durante tres aĂąos y permitiĂł un servicio de reuniĂłn electrĂłnica de ciudadanos en la que se debatĂ­an problemas de la comunidad. Sin embargo, como seĂąala Mestre PĂŠrez (2005) el proyecto tuvo que cancelarse por falta de rentabilidad, entre otras razones, ya que solo el 20% de los abonados usaron las posibilidades interactivas. Otros autores que abogaron por las posibilidades de la teledemo-­ FUDFLDKDQVLGR7RĂ HU  (W]LRQL  \%HQMDPtQ%DUEHU (1984). El primero consideraba que las antiguas limitaciones en el campo de las comunicaciones no se interponen ya en el camino de una democracia directa, de forma que utilizando ordenadores avanzados, satĂŠlites, telĂŠfonos, televisiĂłn por cable y otros medios, la ciudadanĂ­a puede empezar a tomar muchas de sus propias de-­ cisiones polĂ­ticas. Por su parte, Etzioni, desde su pionero proyecto “Minervaâ€? de los aĂąos 70, realizĂł diversos ensayos mediante reu-­ niones electrĂłnicas y programas de televisiĂłn. Por Ăşltimo, Benja-­ mĂ­n Barber propugnaba un fortalecimiento de la sociedad civil por medio de las telecomunicaciones y las nuevas tecnologĂ­as. La popularidad de la teledemocracia tuvo una importante crisis DĂ€QDOHVGHORVDxRVGHOSDVDGRVLJOR;;FXDQGRVHHYLGHQFLy que la televisiĂłn por cable no permitĂ­a a los ciudadanos tener ma-­ yor participaciĂłn polĂ­tica. No obstante, a principios de la dĂŠcada siguiente, gracias a la campaĂąa a la presidencia de los Estados Unidos de Ross Perot, el debate resurgiĂł con fuerza alimentado por los nuevos avances tecnolĂłgicos en los medios de comunicaciĂłn y sus nuevos formatos (call-­in shows). 26


La llegada de las TIC a la PolĂ­tica

2.-­ Hagen (ob.cit.) considera que el concepto ciberdemocracia fue consecuencia directa de la evoluciĂłn de las redes informĂĄticas y de las experiencias de sus primeros usuarios. Tuvo su desarrollo en la costa oeste americana, donde una mezcla de culturas hip-­ SLH\\XSSLH %DUEURRN\&DPHURQ GLRRULJHQDXQD´FODVH virtualâ€? que vivĂ­a y trabajaba entre la Universidad de Stanford y Silicon Valley, cuyos sueĂąos eran la existencia de una verdadera democracia (mediante el gobierno directo de los ciudadanos) y la riqueza material. La ciberdemocracia se desarrollĂł en dos ramas; una mĂĄs conservadora y liberal, centrada en la importancia del libre mercado y el capitalismo, cuyo principal baluarte fue la Fun-­ daciĂłn para el Progreso y la Libertad (PFF). Y otra, con una voca-­ ciĂłn mucho mĂĄs comunitaria, que tuvo a Howard Rheingold como principal valedor. 3.-­ La democratizaciĂłn electrĂłnica, segĂşn Hagen, no comparte la idea de establecer formas directas de democracia, pues lo que plantea es la mejora de la democracia representativa. Los defen-­ sores de la democracia electrĂłnica consideraban que la apatĂ­a y el distanciamiento de los ciudadanos respecto a sus gobiernos no eran consecuencia del sistema polĂ­tico representativo, sino la con-­ secuencia de imperfecciones y disfunciones del mismo que debĂ­an ser subsanados. Ejemplo relevante de este proceso fue “Electronic Town Meetingsâ€? (70  TXH IDFLOLWy HO IHHGEDFN HQWUH YRWDQWHV \ UHSUHVHQWDQWHV mostrando que lo importante no radicaba en el hecho del voto sino en todo el proceso de toma de decisiones (Abramson, Arterton y Orren, 1998). /DGHPRFUDWL]DFLyQHOHFWUyQLFDDĂ€UPDTXHODVUHGHVGHRUGHQDGR-­ res son una herramienta valiosa para el fortalecimiento de la so-­ ciedad civil, puesto que los grupos interesados en un tema concreto pueden movilizarse con bajo costo de transacciĂłn y organizaciĂłn %RQFKHN  27


Adolfo Ă lvaro MartĂ­n

En cualquier caso, Hagen cree que las TIC crearån nuevos y mejo-­ res canales de comunicación e información entre los ciudadanos y sus representantes políticos; servirån como un modelo alternativo al poder de los medios de comunicación para realizar los ajustes necesarios en el sistema representativo o en las posibles nuevas IRUPDVGHGHPRFUDFLDGLUHFWD\ÀQDOPHQWHLQFUHPHQWDUiQODSDU-­ ticipación política y el fortalecimiento del sistema democråtico. Bimber (1998) opta por una vía diferente al considerar que la Red producirå una aceleración de los cambios en el pluralismo de la sociedad, donde los grupos centrados en intereses concretos apa-­ recen y se transforman de forma veloz, y su existencia cada vez necesita menos de las estructuras públicas privadas o públicas tradicionales preexistentes. La teoría del pluralismo acelerado que detalla el autor tiene dos razonamientos fundamentales: por un lado, el incremento de los à XMRV GH LQIRUPDFLyQ \ FRPXQLFDFLyQ QR PRGLÀFDUi OD OyJLFD GHO pluralismo, puesto que la red no alterarå el hecho de que la ma-­ yoría de la gente sea altamente selectiva respecto a los temas po-­ líticos que le interesan, y no supondrå por sí misma una mayor motivación para involucrarse en política. Por otro lado, aunque es cierto que gracias a la Red la información discurre con menos obs-­ tåculos y permite las movilizaciones de las bases, contribuyendo con ello al desarrollo de los grupos centrados en intereses concre-­ tos. Esta situación traerå consigo un escenario en el que los temas de interÊs cambien de forma veloz como consecuencia del ritmo de movilización y respuesta a los grupos, obligando a los gobernantes a tener muy en cuenta a estos colectivos, los cuales no serån muy numerosos, tendrån poca estabilidad, y escasa relación con las ins-­ tituciones establecidas de corte tradicional. Bimber estima que Internet tendrå grandes efectos en la vida po-­ lítica, contribuirå a la descentralización del control de la comuni-­ cación reservado hasta ahora a los medios, y permitirå a los ciu-­ 28


La llegada de las TIC a la PolĂ­tica

dadanos interesados en la polĂ­tica disponer de distintos canales para tomar sus decisiones, provenientes tanto de los gabinetes de FRPXQLFDFLyQGHORVPHGLRVGHFRPXQLFDFLyQFRPRGHORVĂ XMRVTXH corren por Internet. Es de destacar que alerte sobre el peligro de que tambiĂŠn en la Red “el medio sea el mensajeâ€?. Clift (1998) considera que aunque la tecnologĂ­a es neutral, la for-­ ma en que sea usada por los ciudadanos puede suponer una impor-­ tante contribuciĂłn para una democracia mejorada. Reconoce que las redes informativas proporcionan el potencial necesario para aumentar el conocimiento sobre las elecciones y las posturas de ORVFDQGLGDWRVSHURQRFUHHTXHHVWRVHDHOSULQFLSDOEHQHĂ€FLRGH la aplicaciĂłn de las TIC a la polĂ­tica. Es en la posibilidad de que mĂĄs gente sea capaz de escuchar y ser escuchada donde radicarĂĄ HO PD\RU EHQHĂ€FLR SDUD OD VRFLHGDG SXHV ORV FLXGDGDQRV SRGUiQ SDUWLFLSDUHQODFRQĂ€JXUDFLyQGHODDJHQGDSROtWLFD\DXPHQWDUVX contribuciĂłn para la resoluciĂłn de los problemas. El aspecto mĂĄs democrĂĄtico de Internet radica en que permite a los ciudadanos or-­ ganizarse y comunicarse en grupos, y que estos nuevos entornos de libre asociaciĂłn y asamblearismo, permitirĂĄn disponer de nuevas oportunidades para la participaciĂłn polĂ­tica. No obstante incorpora algunas limitaciones a la utilizaciĂłn de las 7,&SXHVDĂ€UPDTXH,QWHUQHWVHUiXQDEXHQDKHUUDPLHQWDSDUD realizar actos enĂŠrgicos de corta duraciĂłn, pero alberga serias du-­ das sobre su efectividad para actuaciones a mĂĄs largo plazo. Asi-­ mismo, es muy escĂŠptico sobre las posibilidades reales de alcanzar consensos por medio de debates en la Red. (Q XQD OtQHD VLPLODU VH PDQLĂ€HVWD &DVWHOOV   TXH SDUWLHQ-­ do de la idea del informacionalismo como un modo de desarrollo caracterizado por la acciĂłn del conocimiento sobre sĂ­ mismo como principal fuente de productividad, apunta a la capacidad que las nuevas tecnologĂ­as tendrĂĄn para penetrar en todas las actividades humanas y, por ende, a la convergencia creciente de las TIC y las 29


Adolfo Ă lvaro MartĂ­n

industrias de la microelectrĂłnica, las telecomunicaciones y la in-­ formĂĄtica, englobadas como sistemas de informaciĂłn. La irrupciĂłn de Internet en el campo de la comunicaciĂłn social harĂĄ posible la conformaciĂłn de una estructura material, que facilitarĂĄ la conso-­ lidaciĂłn de un tipo de organizaciĂłn social basada en un modelo UHWLFXODU (VWR Ă H[LELOL]DUi MHUDUTXtDV \ UHODFLRQHV FRQIRUPDQGR la “sociedad redâ€? que permitirĂ­a interconectar a todo el planeta. Castells hace menciĂłn a las posibilidades que ofrecen las TIC para (i) incrementar la participaciĂłn polĂ­tica y la comunicaciĂłn horizon-­ tal entre los ciudadanos, facilitando la difusiĂłn y recuperaciĂłn de la informaciĂłn, y (ii) ofrecer oportunidades de interacciĂłn y debate en un foro electrĂłnico autĂłnomo sorteando el control de los medios. Considera que Internet serĂĄ muy Ăştil en el desarrollo de la polĂ­tica simbĂłlica y la movilizaciĂłn en torno a causas “no polĂ­ticasâ€?, para FRQ HOOR DFWXDU VREUH HO SURFHVR SROtWLFR H LQĂ XLU HQ ORV JHVWRUHV polĂ­ticos. Considera que esta forma de movilizaciĂłn orientada a te-­ mas concretos obtiene cada vez mĂĄs legitimidad en las sociedades, \GLVSRQHGHPiVLQĂ XHQFLDSDUDFRQGLFLRQDUODVUHJODV\UHVXOWD-­ dos de la competiciĂłn polĂ­tica formal. Sin embargo, Castells manifestaba una serie de reservas sobre la democracia electrĂłnica puesto que: ‡ 3RUXQODGRWHPtDTXHVLVXUJtDFRPRXQLQVWUXPHQWRGHGH-­ bate, representaciĂłn y decisiĂłn importante, crearĂ­a “una nue-­ va forma de democracia atenienseâ€?, donde una minorĂ­a culta y rica tuviese plena capacidad de acceso y disfrute a estas herramientas de informaciĂłn y participaciĂłn, que relegarĂ­an a grandes bolsas de poblaciĂłn desconectadas del nuevo nĂşcleo democrĂĄtico. ‡ 3RURWURODGRWDPELpQDOHUWDGHTXHODYRODWLOLGDGGHOPHGLR podrĂ­a acentuar la prevalencia de la polĂ­tica como espectĂĄ-­ culo, con sus modas y mitos, que provocarĂ­a una individua-­ 30


La llegada de las TIC a la Política

lización de la política y la sociedad que pondría en peligro la integración, el consenso y las instituciones. En cuanto al papel de las TIC ante los problemas de la democra-­ cia, Subirats (2002) considera que sus posibilidades de utilización son múltiples, aunque distingue entre las que trabajan desde la lógica interna del actual sistema de democracia representativa, y aquellas que encauzan Internet como herramienta para articular nuevas formas de gobierno y democracia: 1. En primer lugar, analiza los usos de las TIC que sin cuestionar el modelo existente, tan solo buscan la mejora de la prestación de los servicios públicos (por ejemplo, el pago de los impues-­ tos). Se entiende que lo que falla son los mecanismos de infor-­ mación a disposición del ciudadano para que pueda ejercer de manera más completa sus posibilidades de elección y disponga de más poder en sus relaciones con las burocracias. 2. Como segunda opción, nos encontraríamos ante una visión que iría más allá de lo anterior, no contentándose con una mejora de prestación de servicios públicos, pues buscaría reforzar la legitimidad de las instituciones de gobierno. En este sentido, destaca las diversas actuaciones de los partidos políticos para mejorar los canales de información con los militantes y la ad-­ hesión de simpatizantes y votantes. En general, la informa-­ ción es unidireccional y, en caso de existir interacción, siempre permanece en manos del partido el control del medio y la de-­ cisión sobre la oportunidad o no de tener en cuenta la opinión ajena. Las TIC se utilizan como una herramienta que permite una mejor adaptabilidad del sistema político a un entorno mu-­ tante, pero sin que ello suponga cambio de paradigma. 3. Como tercera opción, el autor localiza los ejemplos de los co-­ lectivos ciudadanos que se movilizan por temas concretos, que rechazan que las instituciones políticas ocupen el vértice o 31


Adolfo Álvaro Martín

centro de la ciudadanía y, sobre todo, elucubra sobre las posi-­ bilidades de avanzar hacia formas de democracia directa hasta hoy inexploradas, que contengan los mecanismos que asegu-­ ren la deliberación y permitan canalizar opiniones y debates KDFLDWRPDGHGHFLVLRQHVSUDJPiWLFDV\HÀFLHQWHV GHPRFUDFLD postparlamentaria). Es evidente que desde el desarrollo de Internet y la aparición de la World Wide Web (www) en los últimos años del pasado siglo XX, ha existido un interés creciente por indagar y conocer las posibili-­ dades de las TIC para fomentar un mayor pluralismo en la socie-­ dad, así como su capacidad para permitir la aparición de grupos interesados en temas concretos cuya existencia ya no dependerá de las estructuras públicas y tradicionales preexistentes. Estos grupos se desarrollarán rápidamente a principios del pre-­ sente siglo, con una creciente capacidad de mediatización de la agenda política. Partal (2004) los denominará como “no-­media”, VLHQGRHMHPSORVVLJQLÀFDWLYRVIndymedia, Liberinfo o Nodo50: ‡ Indymedia (http://www.indymedia.org) apareció en noviembre de 1999 a raíz de las movilizaciones del denominado Día de Ac-­ ción Global contra la cumbre de la “Ronda del Milenio” orga-­ nizada por la Organización Mundial del Comercio en Seattle (Estados Unidos). Indymedia es el resultado de la cooperación HQWUH DFWLYLVWDV WHFQROyJLFRV KDFNHUV  \ DFWLYLVWDV WUDGLFLRQD-­ les, que permite la creación del IMC (Independent Media Cen-­ ter). Este sirve para cubrir las protestas de Seattle creando un espacio de publicación abierta y coordinada de distintos medios independientes y alternativos con el objeto de romper el con-­ trol informativo de los medios tradicionales. Indymedia Seattle aprovechó las innovaciones tecnológicas introducidas por el len-­ guaje de programación PHP, permitiendo la publicación abierta e interactiva en Internet, y la organización y coordinación de las redes sociales que lideraron las protestas. Indymedia permitió 32


La llegada de las TIC a la PolĂ­tica

que los propios activistas informaran directamente de los acon-­ tecimientos de la denominada “batalla de Seattleâ€?, contribuyen-­ do decisivamente al ĂŠxito de la movilizaciĂłn y su repercusiĂłn a nivel mundial (El PaĂ­s, 01/12/1999). A partir de ese momento, comenzaron a aparecer nuevos nodos de Indymedia ligados a las protestas denominadas “altermundistasâ€? en las ciudades donde se fueron celebrando cumbres de instituciones interna-­ cionales. Tuvo especial relevancia su actividad en las movili-­ zaciones contra la reuniĂłn del G-­8 en GĂŠnova en julio de 2001, que pusieron frente a la opiniĂłn pĂşblica mundial la fuerza de un movimiento antiglobalizaciĂłn, comunicado y organizado por ,QWHUQHWFHQWUDGRHQSURWHVWDVVLPEyOLFDVTXHUHĂ HMDQORVWLHP-­ pos y los espacios de los adalides de la globalizaciĂłn, utilizando sus mismos cauces de comunicaciĂłn con la sociedad: los medios de informativos, en donde una imagen vale mĂĄs que mil ponen-­ cias (Castells, 2001). La organizaciĂłn interna de los distintos colectivos y de la propia red global es horizontal, las decisiones se toman por consenso y las responsabilidades se distribuyen segĂşn las tareas que cada activista decide realizar. Indymedia es una herramienta de par-­ WLFLSDFLyQ TXH KX\H GH OD Ă€JXUD GHO UHFHSWRU FRPR HVSHFWDGRU pasivo, y propone que actĂşe difundiendo las visiones de la reali-­ GDGTXHFXHVWLRQDQHOVLVWHPDYLJHQWH :LQLN  ‡ Liberinfo, fue la primera experiencia espaĂąola de una agencia de noticias para los colectivos sociales. Fue creada por un grupo catalĂĄn de profesionales vinculados a los medios de comunica-­ ciĂłn que tenĂ­an como objetivo dar apoyo y relevancia social a los denominados “movimientos antiglobalizaciĂłnâ€?. Su nacimiento tuvo lugar en marzo de 2002, coincidiendo con la celebraciĂłn en Barcelona de la Cumbre de Jefes de Estado y de Gobierno de la UniĂłn Europea. Liberinfo se constituyĂł en la encargada de la distribuciĂłn de las notas de prensa de “la campaĂąa contra la Eu-­ ropa del Capitalâ€?. AdemĂĄs, se constituyĂł como un espacio de do-­ 33


Adolfo Ă lvaro MartĂ­n

cumentaciĂłn y herramienta virtual para que las organizaciones publicasen comunicados y convocatorias, asĂ­ como para difundir DFFLRQHVGLUHFWDVFRPR´RNXSDFLRQHVÂľGHHGLĂ€FLRVSRUGLVWLQWRV colectivos. Dentro de su web podĂ­a registrase cualquier asocia-­ ciĂłn o grupo que predicase la transformaciĂłn social, con expresa exclusiĂłn de los partidos polĂ­ticos tradicionales. Su sede se ins-­ talĂł en una de las salas del Centre de Treball i DocumentaciĂł, en el barrio barcelonĂŠs de Gracia, suministrando informaciĂłn no solo a medios de comunicaciĂłn de diversos paĂ­ses, sino tam-­ biĂŠn a cualquier particular en su direcciĂłn Liberinfo.net (El PeriĂłdico de CataluĂąa, 15/04/2003). Liberinfo se organizaba en torno a una web donde redes de colectivos y de personas se or-­ ganizaban, debatĂ­an y actuaban con la intenciĂłn de cambiar el orden establecido de nuestra sociedad desde una actitud crĂ­ti-­ ca, de izquierdas y radicalmente combativa y transformadora. Sin embargo, su desarrollo posterior no fue el esperado por sus creadores, siendo integrada posteriormente en otros proyectos (Casablancas, 2005). ‡ 1RGR(http://info.nodo50.org/), naciĂł en 1994 como una BBS (Bulletin Board System) del “Foro 50 aĂąos bastanâ€?, para la crea-­ ciĂłn y coordinaciĂłn de acciones reivindicativas contra las reu-­ niones que mantuvieron en Madrid en ese aĂąo el Fondo Moneta-­ rio Internacional y el Banco Mundial. En 1996 pasĂł a Internet, GHĂ€QLpQGRVH FRPR XQ WHUULWRULR YLUWXDO SDUD ORV PRYLPLHQWRV sociales y la acciĂłn polĂ­tica en Internet. En una entrevista a *XVWDYR5RLJPLHPEURGH1RGRHVWHDĂ€UPDEDTXH´,QWHUQHW KDEHQHĂ€FLDGRDORVPRYLPLHQWRVVRFLDOHVGHXQDIRUPDFODUD (‌) lo importante es poder contar con redes de activistas coor-­ dinados a nivel mundial, poder organizar Foros como el de GĂŠ-­ nova, ese tipo de cosas son las que importanâ€?. (El inconformis-­ ta digital, 2004). Nodo 50 mantuvo una importante actividad GXUDQWH ODV PRYLOL]DFLRQHV FRQWUD OD *XHUUD GH ,UDN \ HQ ODV movilizaciones del 13 de marzo de 2004. 34


La llegada de las TIC a la Política

Bennet (2003) entiende que los medios digitales, y muy especial-­ mente Internet, han permitido crear una nueva forma de política global, que facilita la implantación de extensas redes de política en las que los activistas pueden resolver con sutileza problemas de identidad colectiva, que antaño hubieran impedido el desarrollo de estos movimientos. El éxito de las estrategias de comunicación en red en muchas campañas informativas y movilizaciones (como fue el caso de Seattle, Génova, Porto Alegre o Barcelona), parece KDEHU SURGXFLGR VXÀFLHQWH LQQRYDFLyQ \ FRQRFLPLHQWRV SDUD TXH sigan surgiendo organizaciones a pesar de su caos organizativo y su cambio dinámico. Concluye Bennet que la red dinámica se con-­ vierte en la unidad analítica de los demás niveles (organizativo, individual, político) de la manera más coherente. Castells (2009) dio un valor muy importante a la capacidad que In-­ ternet tuvo para congregar a centenares de organizaciones y miles de activistas particulares en estos movimientos contra la globali-­ zación, entendiendo que sus prácticas en red van más allá de la FRRUGLQDFLyQGHDFFLRQHV\GHODSURYHFKDPLHQWRGHODÁH[LELOLGDG en redes descentralizadas de activistas, pues las conexiones en red basadas en Internet son decisivas a nivel estratégico, organizati-­ vo y normativo. Entiende que Indymedia ha permitido agrupar a cientos de centros de medios, algunos temporales y otros perma-­ nentes, que han proporcionado a los activistas recursos para crear y organizar su propio material y posibilidades de difundirlo, bien por la red, bien por una malla de emisoras de radio y televisión co-­ munitarias. Las redes de información y comunicación organizadas HQWRUQRD,QG\PHGLDVHUtDQODH[SUHVLyQPiVVLJQLÀFDWLYDGHHVD capacidad de contraprogramación frente a la oferta de los grandes medios tradicionales.

35


Adolfo Ă lvaro MartĂ­n

1.3. Hackers: los nuevos activistas. 6WHYHQ /HY\ VLW~D ORV LQLFLRV GH OD FXOWXUD KDFNHU D SULPHURV GH los aĂąos sesenta del pasado siglo, momento en el que el Instituto de TecnologĂ­a de Massachusetts (MIT) adquiriĂł una computadora PDP-­1 (que en aquella ĂŠpoca se consideraban minicomputadoras pese a tener el tamaĂąo de un armario). El Club de TecnologĂ­a de Trenes a Escala del MIT desarrollĂł en torno a esta programadora una cultura en la que, por primera vez, se adoptĂł el termino “hac-­ NHUÂľ /HY\  (VWRVSULPHURVKDFNHUVGHO&OXEGH7HFQRORJtDGH7UHQHVGHO0,7 se convirtieron mĂĄs adelante en el nĂşcleo del Laboratorio de Inteli-­ JHQFLD$UWLĂ€FLDO ,$ \SURSDJDURQVXLQĂ XHQFLDDWUDYpVGHODUHG ARPA (red de computadoras transcontinental de alta velocidad) desarrollada por el Departamento de Defensa de los Estados Uni-­ dos. Gracias a ARPA, estos investigadores pudieron intercambiar informaciĂłn a una velocidad sin precedentes, poniendo en contacto DKDFNHUVGHWRGRHOPXQGRGHVFXEULpQGRVHFRPRXQDFROHFWLYLGDG unida en red. (Raymond, 2004). Al contrario de la imagen difundida por los medios de comunica-­ FLyQ GH PDVDV ORV KDFNHUV QR VRQ DGROHVFHQWHV LUUHVSRQVDEOHV R enemigos del orden pĂşblico. Para los primeros que empezaron a llamarse de ese modo entre si en el MIT, lo esencial era que hacĂ­an algo radicalmente diferente de los demĂĄs tĂŠcnicos y profesores, sus creaciones fueron el inicio de una larga serie de innovaciones que han ido desde las computadoras personales a la arquitectura de Internet, la criptografĂ­a o la idea del cĂłdigo abierto (Levy, 1984). /DGHĂ€QLFLyQPiVSRSXODUPHQWHDFHSWDGDHVODUHDOL]DGDSRU5D-­ \PRQG   HQ OD TXH GHĂ€QH DO KDFNHU FRPR XQD SHUVRQD TXH disfruta explorando los detalles de sistemas programables y la po-­ sibilidad de extender sus capacidades, a diferencia de la mayorĂ­a GHORVXVXDULRVTXHSUHĂ€HUHQDSUHQGHUVRORORPtQLPRQHFHVDULR 36


La llegada de las TIC a la PolĂ­tica

(VWRV KDFNHUV SURJUDPDQ FRQ HQWXVLDVPR 5D\PRQG LQGLFD TXH LQFOXVR REVHVLYDPHQWH  \ SUHĂ€HUHQ SURJUDPDU D WHRUL]DU DFHUFD GHODSURJUDPDFLyQ3DUDORVKDFNHUVHVPHMRUVHUGHVFULWRFRPR XQKDFNHUSRURWURVTXHGHVFULELUVHDXQRPLVPRGHHVDPDQHUD 5D\PRQG LEtG QRVDGYLHUWHGHTXHORVKDFNHUVQRGHEHQVHUFRQ-­ fundidos con los entrometidos maliciosos que intentan descubrir informaciĂłn sensible violando la protecciĂłn de ordenadores y redes SULYDGDV(QHVWHFDVRQRVHQFRQWUDUtDPRVDQWH´FUDFNHUVÂľ (OĂ€QODQGpV3HNND+LPDQHQHQVXREUD/DpWLFD+DFNHUGHODxR 2002, sitĂşa los elementos mĂĄs relevantes de la ĂŠtica de unas perso-­ nas para las cuales, por encima del trabajo y del dinero se encuen-­ tra su relaciĂłn con las redes que forman parte de la sociedad red, y que denomina nĂŠtica o ĂŠtica de la red. “En el centro de nuestra era tecnolĂłgica se hallan unas per-­ VRQDVTXHVHDXWRGHQRPLQDQKDFNHUV6HGHĂ€QHQDVtPLVPRV como personas que se dedican a programar de manera apa-­ sionada y creen que es un deber para ellos compartir la infor-­ maciĂłn y elaborar software gratuito. No hay que confundirlos FRQORVFUDFNHUVORVXVXDULRVGHVWUXFWLYRVFX\RREMHWLYRHVHO GHFUHDUYLUXVHLQWURGXFLUVHHQRWURVVLVWHPDVXQKDFNHUHV un experto o un entusiasta de cualquier tipo que puede dedi-­ FDUVHRQRDODLQIRUPiWLFD(QHVWHVHQWLGRODpWLFDKDFNHUHV una nueva moral que desafĂ­a la ĂŠtica protestante del trabajo, tal como la expuso hace casi un siglo Max Weber en su obra clĂĄsica La ĂŠtica protestante y el espĂ­ritu del capitalismo, y que estĂĄ fundada en la laboriosidad diligente, la aceptaciĂłn de la rutina, el valor del dinero y la preocupaciĂłn por la cuenta de resultados. Frente a la moral presentada por Weber, la ĂŠtica GHOWUDEDMRSDUDHOKDFNHUVHIXQGDHQHOYDORUGHODFUHDWLYL-­ dad, y consiste en combinar la pasiĂłn con la libertad. El dinero GHMDGHVHUXQYDORUHQVtPLVPR\HOEHQHĂ€FLRVHFLIUDHQPH-­ 37


Adolfo Ă lvaro MartĂ­n

tas como el valor social y el libre acceso, la transparencia y la franqueza.â€? (Himanen, 2002:2) La relaciĂłn con Internet se convierte en un elemento esencial en el que personajes como Mitch Kapor y John Perry Barlow, dieron los primeros pasos en demandar para el ciberespacio libertad de expresiĂłn y derecho a la privacidad, creando en el aĂąo 1990 junto a John Gilmore la Electronic Frontier Foundation (EFF), organiza-­ FLyQVLQiQLPRGHOXFURFRQVHGHHQ6DQ)UDQFLVFR 86$ FX\RĂ€Q es la defensa de la libertad de expresiĂłn, privacidad, innovaciĂłn y derechos de los consumidores. Destaca entre sus mayores logros el haberse opuesto con ĂŠxito a normas restrictivas del gobierno norteamericano como la denominada “Communication Decency Actâ€? del aĂąo 1997, que pretendĂ­a la instauraciĂłn de un Ăłrgano ad-­ ministrativo de control en Internet. Entre las actuaciones que la ())UHDOL]yVHHQFXHQWUDODFRQVWUXFFLyQGHO'(6&UDFNHUFRQHO que se demostrĂł que los mĂŠtodos de encriptaciĂłn usados hasta la fecha eran incapaces de garantizar el secreto y la inviolabilidad de las comunicaciones por Internet, exigiendo que los gobiernos y empresas garantizasen los derechos de los ciudadanos en la Red. (VWDFDSDFLGDGGHDFFLyQGHORVKDFNHUVHVLQVHSDUDEOHGHODUHYR-­ luciĂłn en las tecnologĂ­as digitales que, como seĂąala Juris (2008), ha permitido a estos activistas utilizar sus avanzados conocimientos tecnolĂłgicos para crear prĂĄcticas concretas que suponen la recep-­ ciĂłn, interpretaciĂłn y transmisiĂłn de informaciĂłn a los diferentes nodos de la red, combinando cĂłdigos, compartiendo informaciĂłn sobre proyectos, movilizaciones, estrategias y tĂĄcticas a travĂŠs de las redes de comunicaciĂłn global. Estos nuevos activistas tie-­ nen como referencia el concepto de “desobediencia civil electrĂłni-­ caâ€? acuĂąado en 1994 por el colectivo Critical Art Ensemble (CAE) que, ese mismo aĂąo publicarĂ­an The Electronic Disturbance, y, dos aĂąos despuĂŠs, Electronic Civil Disobedience and Other Unpopular Ideas, los cuales, llevaron a cabo un estudio sobre de las posibili-­ 38


La llegada de las TIC a la PolĂ­tica

dades de trasladar las protestas callejeras a Internet mediante un anålisis de sus tåcticas, y de las alteraciones in situ y de la infraes-­ tructura urbana, así como de las posibilidades de trasladarlas a la infraestructura de Internet. 'HQQLQJ  FODVLÀFDORVSRVLEOHVXVRVGH,QWHUQHWFRPRKHUUD-­ PLHQWDSDUDLQà XLUHQODSROtWLFDHQDFWLYLVPRGLJLWDOKDFNWLYLV-­ mo y ciberterrorismo: ‡ (ODFWLYLVPRGLJLWDO surge con el uso de Internet en función de una causa u objetivo. Las operaciones en esta årea incluyen la búsqueda e intercambio de información, el establecimiento GHHVSDFLRV\IRURVGHGHEDWHDVtFRPRODSODQLÀFDFLyQ\FRRUGL-­ nación de actividades. ‡ (Ohacktivismo o desobediencia civil electrónica (electronic ci-­ YLOGLVREHGLHQFH FRPELQDUtDHODFWLYLVPRFRQHOKDFNLQJDF-­ WLYLGDGTXH7LP-RUGDQGHÀQLyFRPRODDFFLyQGLUHFWDGHXQD muchedumbre virtual (Mass Virtual Direct Action) que pro-­ longa y acompaùa al activismo político no violento de la vida real (Jordan, 2002). Sus actuaciones abarcarían objetivos en la Red con la intención de distorsionar las operaciones normales pero no causar daùos serios: como las sentadas y bloqueos de SiJLQDV YLUWXDOVLWLQVYLUWXDOEORFNDGHV HOHQYtRDXWRPiWLFR y masivo de correos electrónicos con el efecto de bombas (email ERPEV RDOWHUDUORVFRQWHQLGRVGHXQDSiJLQDZHE KDFNLQJ  entre otros. La desobediencia civil electrónica es para Urroz OsÊs (2005), un tipo de acción directa legítima, no violenta, que tiene por objeto hacer presión sobre una institución involucrada en acciones poco Êticas o criminales, una expresión extraparlamentaria de net-­ac-­ ciones en apoyo de objetivos que apelan al espíritu de los derechos y libertades individuales, la conversión electrónica de la sentada tradicional o de la manifestación de protesta. La razón por la que 39


Adolfo Ă lvaro MartĂ­n

se convierte en virtual estriba en su parcela de efectividad, pues en un momento en el que la Red funciona como realidad virtual y herramienta fundamental para cualquier gobierno o instituciĂłn y HOSRGHUDGTXLHUHODIRUPDGHXQĂ XMRQyPDGDHOHFWUyQLFRODLQ-­ WHUUXSFLyQGHHVHĂ XMRHVORTXHSURGXFHPD\RUGDxR/RVSURSXO-­ sores de la desobediencia civil electrĂłnica, tomarĂ­an ejemplo de la WUDGLFLyQGHDFFLyQGLUHFWDSDFtĂ€FD\GHVREHGLHQFLDFLYLOXWLOL]DQ-­ GRWiFWLFDVGHLQĂ€OWUDFLyQ\EORTXHR WUHVVSDVV\EORFNDGH GHHVWRV movimientos. La desobediencia civil electrĂłnica, como una forma de acciĂłn masiva directa, electrĂłnica y descentralizada, utiliza el bloqueo y las sentadas virtuales. Al contrario que un participan-­ te en una acciĂłn de desobediencia civil tradicional, el agente de la desobediencia civil electrĂłnica puede participar en bloqueos y sentadas virtuales desde su casa, desde el trabajo, la universidad o cualquier otro punto de acceso a la red. En este sentido, debe destacarse la actividad del colectivo Elec-­ WURQLF'LVWXUEDQFH7KHDWHU ('7 IRUPDGRHQWRUQRDODVĂ€JXUDV de Ricardo DomĂ­nguez, Brett Stalbaum, Stefan Wray y Carmin .DUDVLF KD VLGR FRQVLGHUDGR XQ SLRQHUR GHO KDFNWLYLVPR ²IRUPD de acciĂłn pĂşblica desarrollada en los espacios de comunicaciĂłn y las redes electrĂłnicas-­ e impulsor del concepto de desobediencia civil electrĂłnica, (La Vanguardia, 8/11/2002). Uno de sus teĂłricos, Wray (s/f), seĂąalaba que hasta 1998 la Desobediencia Civil Elec-­ trĂłnica era poco mĂĄs que una teorĂ­a sin demostrar pero que, tras la masacre de Acteal en Chiapas, Internet pasa a adoptar la con-­ diciĂłn de medio de comunicaciĂłn y ĂĄmbito para la acciĂłn directa. Se abre el camino, segĂşn Wray a un proceso que comenzarĂ­a con la Desobediencia Civil ElectrĂłnica para ir avanzando a un posterior HVWDGLRGHQRPLQDGR´$FWLYLGDG+DFNHU3ROLWL]DGDÂľ\Ă€QDOPHQWH a la “Resistencia a una Guerra Futuraâ€?. Con cada una de estas fases (que ĂŠl denomina trasgresiones) la actividad en torno a la infraestructura de Internet se aleja cada vez mĂĄs del modelo de ODHVIHUDS~EOLFDDFHUFiQGRVHDXQWHUULWRULRPiVFRQĂ LFWLYRFDVL una zona de guerra. 40


La llegada de las TIC a la PolĂ­tica

&DVWHOOV  FRQVLGHUDTXHORVKDFNHUVKDQVLGRIXQGDPHQWDOHV HQ HO GHVDUUROOR GH ,QWHUQHW FLWDQGR FRPR HMHPSOR D ORV KDFNHUV que diseùaron los protocolos de Internet, a Ralph Tomlinson que inventó el correo electrónico en 1970 para uso de los primeros in-­ WHUQDXWDVRDORVKDFNHUVTXHLQYHQWDURQHOPyGHP7RGRVHOORV habrían creado la base tecnológica de Internet y, aunque algunos GHHOORVVHKDEUtDQEHQHÀFLDGRHFRQyPLFDPHQWHGHHOORFRPRHP-­ presarios o altos dirigentes de corporaciones tecnológicas, todos ellos obtuvieron mediante estas pråcticas de innovación coopera-­ tiva, el reconocimiento como tal de toda la comunidad global de KDFNHUVFRQYLUWLpQGRVHHQIXHQWHHVHQFLDOGHLQQRYDFLyQHQODHUD de la información. Y al igual que Richard Stallman en los aùos ochenta del pasado siglo XX constituyó la Free Software Foun-­ dation para defender la libertad de acceso a los códigos de UNIX cuando la multinacional AT&T trató de imponer sus derechos de propiedad sobre UNIX (el sistema operativo mås avanzado de su WLHPSR  ORV QXHYRV KDFNHUV SROtWLFRV DSURYHFKDQ ODV UHGHV DXWR-­ gestionadas en Internet y las comunicaciones inalåmbricas para liberar al activismo de las limitaciones impuestas a su expresión por el control empresarial de las redes de comunicación. 1.4 Comunicaciones inalåmbricas y movilización social. Las campaùas de movilización en Internet se han producido desde los inicios de la Red. Como hemos detallado anteriormente, mu-­ FKRVGHVXVSULPHURVXVXDULRV\FUHDGRUHVHVWDEDQLQà XHQFLDGRV por los movimientos sociales de la Êpoca y utilizaron la reciÊn na-­ cida red para intercambiar información o difundir mensajes rei-­ vindicativos. Urrutia (2003), apunta que los movimientos de valores (medio am-­ biente, ecologismo, mujeres, derechos humanos) estån primando sobre las protestas antaùo usuales (vinculadas generalmente a la política) por lo que para captar individuos interesados en dichas causas, hay que apelar a sus valores o sentimientos, y es aquí 41


Adolfo Álvaro Martín

donde Internet se revela como un potente canal en el que la varie-­ dad de sus usuarios hace que estos conecten fácilmente con otros con sus mismos intereses o ideales, permitiendo la organización de colectivos en torno a unos principios comunes. Arquilla y Ronfeldt fueron los primeros que aplicaron la teoría de ODVRFLHGDGUHGDOPXQGRGHORVFRQÁLFWRVVRFLDOHV'HVGHVXWUDEDMR en la Rand Corporation (un centro de investigación especializado en cuestiones militares y con sede en Santa Mónica, Estados Uni-­ dos), introdujeron el concepto de “social netwar”, un nuevo modo GHFRQÁLFWRGRQGHVHXVDQIRUPDVGHRUJDQL]DFLyQHQUHGHV\HVWUD-­ tégicas en las que la tecnología juega un papel fundamental. Los protagonistas son organizaciones dispersas, grupos e individuos que se comunican, coordinan y realizan sus actividades de forma interconectada, muchas veces sin línea de mando centralizada. Consideran que actualmente la forma emergente de organización es la red, ya que gracias a las nuevas tecnologías es posible conec-­ tar y coordinar acciones de una forma desconocida hasta la fecha. Por ello, quien domine esta forma organizativa de red se situará en una posición de ventaja (Arquilla y Ronfeldt, 2000: 5). (O FDPELR HQ OD QDWXUDOH]D GH ORV FRQÁLFWRV JHQHUDGR SRU OD UH-­ volución informacional (Arquilla y Ronfeldt, 2003), estaría permi-­ tiendo a las formas de organización en red tener una ventaja sobre estructuras más jerárquicas de organización, puesto que el poder estaría trasladándose hacia actores que pueden estructurarse en redes constituidas por una pluralidad de nodos interconectados. Estas redes no suelen tener una dirección visible, lo que les per-­ PLWHVHUPX\iJLOHV\ÁH[LEOHVDODKRUDGHDFWXDUHQIXQFLyQGHODV circunstancias y las debilidades que detecten en el adversario. En su toma de decisiones buscarán alcanzar unos acuerdos mínimos entre sus miembros más relevantes, consenso que no tiene por qué extenderse a todos los nodos. Al no existir una cabeza visible, les es sencillo articularse para ejecutar una acción, llevarla a cabo y, posteriormente, desaparecer. 42


La llegada de las TIC a la PolĂ­tica

Arquilla y Ronfeldt (ibíd.) establecen cinco niveles de anålisis de las redes: 1. Nivel organizacional: relativo a como estå construida la red. 2. Nivel discursivo: que establece las razones de existencia de la red. 3. Nivel doctrinal: sobre las estrategias y mÊtodos de colabora-­ ción. 4. Nivel tecnológico: referido a los sistemas informåticos utiliza-­ dos. 5. Nivel social: focalizado en los vínculos personales que garanti-­ ]DQODOHDOWDG\FRQÀDQ]DGHVXVPLHPEURV A nivel de la organización, se ha encontrado que en las luchas que han tenido cierto Êxito, las organizaciones y sujetos han estado agrupados como una telaraùa irregular, con varios centros y una extendida periferia, siendo los nodos los puntos de intersección de los hilos. En este modelo, no hay una jerarquía obvia. La elimina-­ FLyQRSpUGLGDGHXQRRYDULRVGHORVQRGRVQRWLHQHSRUTXHVLJQLÀ-­ car la de toda la red. El liderazgo sigue teniendo importancia, pero no hay mando único, sino, a veces, múltiple y coordinado. En el nivel discursivo se encontrarå la metodología para explicar los objetivos de la lucha. El objetivo es llegar al corazón y a la men-­ te tanto de los miembros de la red como del exterior. Estas redes no dejan de ser formas de organización y, por ello, solo pueden PDQWHQHUVHXQLGDVSRUORVGLVFXUVRVTXHUHà HMHQODVH[SHULHQFLDV y valores de sus miembros. Un discurso convincente ayuda a man-­ WHQHUMXQWDDODJHQWHHQXQDUHGTXHSRUVXHVWUXFWXUD\à XLGH] QRSXHGHHYLWDUODVGHVHUFLRQHV(OGLVFXUVRHÀFD]WDPELpQFUHD puentes entre distintas redes y puede generar la percepción de que el movimiento estå avanzando y ganando.

43


Adolfo Ă lvaro MartĂ­n

En el campo doctrinal, las redes tratan de organizarse sin una Ă€JXUDFHQWUDOFRPROtGHU3XHGHQWHQHUYDULRVGLULJHQWHVTXHXWL-­ lizarĂĄn mecanismos para consensuar decisiones. Por otro lado, estas redes usarĂĄn estrategias y tĂĄcticas de “swarmingâ€? (concen-­ traciĂłn en enjambre), que permite que mĂşltiples y pequeĂąos nodos que habitualmente estĂĄn dispersos actĂşen coordinada y simultĂĄ-­ neamente sobre un blanco en particular, para luego dispersarse nuevamente en preparaciĂłn de la siguiente operaciĂłn. Estas tĂĄcticas de swarming fueron desarrolladas en las moviliza-­ FLRQHVOOHYDGDVDFDERDĂ€QDOHVGHORVDxRVGHOSDVDGRVLJORXX y primeros aĂąos del presente siglo XXI en ciudades como Seattle, GĂŠnova o CancĂşn, para protestar contra el Banco Mundial o la OrganizaciĂłn Mundial del Comercio. Pero, ademĂĄs, el swarming tambiĂŠn comenzĂł a demostrar su efectividad en las acciones desa-­ rrolladas por Internet, como fue el caso de la CampaĂąa Mundial contra las Minas Terrestres, que en muy poco tiempo consiguiĂł generar una red muy poderosa para presionar a los paĂ­ses produc-­ tores y vendedores de estas armas de guerra. En cuanto al aspecto tecnolĂłgico, las acciones realizadas en aque-­ OORV DxRV GHPRVWUDURQ TXH HO WHQHU VRĂ€VWLFDGD WHFQRORJtD SXHGH ser una ventaja importante, pero no es determinante. La difusiĂłn de informaciĂłn puede realizarse mediante una mezcla de tecno-­ ORJtDV GH DOWD \ EDMD VRĂ€VWLFDFLyQ FRQ PpWRGRV QXHYRV R YLHMRV Los mensajeros humanos y las reuniones cara a cara pueden ser todavĂ­a esenciales. En el ejemplo de la batalla contra el proyec-­ to ICBG-­Maya en Chiapas en 2001, las comunidades indĂ­genas fueron informadas del proyecto por mensajeros que se desplaza-­ ron de comunidad a comunidad a pie llevando a cabo reuniones y asambleas comunitarias. No obstante, gracias a la tecnologĂ­a se consiguiĂł difundir a nivel internacional el discurso elaborado por las redes y organizaciones indĂ­genas y mestizas, consiguiendo au-­ mentar la visibilidad del problema y el apoyo a su causa. 44


La llegada de las TIC a la PolĂ­tica

En el nivel social, por Ăşltimo, el funcionamiento pleno de una red depende del grado de conocimiento mutuo e interconectividad que tengan sus integrantes. Los vĂ­nculos personales, muchas veces basados en la amistad y la experiencia compartida, ayudan a ga-­ UDQWL]DU FRQĂ€DQ]D \ OHDOWDG (Q HVWH SXQWR $UTXLOOD \ 5RQIHOGW seĂąalan al Ejercito Zapatista de LiberaciĂłn Nacional (EZLN) como ejemplo, pues sus miembros han sido elegidos por las comunida-­ des para formar parte de la guerrilla armada. Sin embargo, en otras situaciones, bastarĂ­a con que un grupo pequeĂąo construya un apoyo social relevante para poderse enfrentar a fuerzas mĂĄs SRGHURVDV6LUYDFRPRHMHPSOROD'LUHFW$FWLRQ1HWZRUN '$1  grupo de activistas surgidos a partir de las protestas contra la reu-­ niĂłn de la OrganizaciĂłn Mundial del Comercio en Seattle en 1999, FX\DSULQFLSDOFDUDFWHUtVWLFDHUDHOXVRGHJUXSRVGHDĂ€QLGDGSDUD llevar a cabo sus acciones. En el ĂĄmbito urbano, estas acciones de “netwarâ€? tambiĂŠn se han desarrollado con notable ĂŠxito, como los movimientos a favor del uso de las bicicletas que comenzaron a desarrollarse en diversas ciudades de Estados Unidos y Europa. Su forma de actuar consiste HQFRQYHUJHUXQGtDGHODVHPDQDSDUDSHUWXUEDUHOWUiĂ€FRDORODU-­ go de una ruta elegida en ese momento en funciĂłn de quiĂŠn sea el ciclista que estĂŠ en cabeza. Las tĂĄcticas de acciĂłn durante el paseo pueden consistir en taponar cruces, dividirse en pequeĂąos grupos SDUDUDOHQWL]DUHOWUiĂ€FRRDJUXSDUVHHQHQMDPEUHDOUHGHGRUGHXQ vehĂ­culo que circule en solitario. Las primeras acciones se llevaron a cabo en los aĂąos 90 del pasado siglo en Los Ă ngeles en torno al colectivo Critical Mass, y sus acciones se han ido extendiendo a otras ciudades. (El Mundo, 2011). SegĂşn indicaba la UniĂłn Internacional de Telecomunicaciones (ITU, 2004), en el periodo transcurrido entre 1991 y 1995, la pro-­ SRUFLyQGHPyYLOHVHQUHODFLyQDWHOpIRQRVĂ€MRVSDVyGHHQHO aĂąo 1991, a 1:8 en el aĂąo 1995. Este desarrollo ha sido aĂşn mĂĄs 45


Adolfo Ă lvaro MartĂ­n

vertiginoso en los primeros aĂąos del presente siglo, de forma que en el aĂąo 2003 el nĂşmero de lĂ­neas de telefonĂ­a mĂłvil superaron D ODV GH WHOHIRQtD Ă€MD (O 606 IDFLOLWD XQD IRUPD HFRQyPLFD GH generar una esfera comunicativa propia y un medio prĂĄctico para coordinar actividades, por lo general, de carĂĄcter lĂşdico. Dentro de ORV606GHVWDFDQORVPHQVDMHVHQFDGHQD PHQVDMHVGHWH[WRVĂ€MRV HLQPRGLĂ€FDEOHVTXHFLUFXODQGHXQPyYLODRWUR (VWRVPHQVDMHV constituyen la forma mas cristalizada de conducta colectiva ligada a los mensajes de textos. Este crecimiento de las comunicaciones inalĂĄmbricas ha permi-­ tido a los ciudadanos controlar de forma individual sus propias FRPXQLFDFLRQHV GDQGR OXJDU D IHQyPHQRV FRPR ORV Ă DVK PREV donde las personas hacen suyas las nuevas tecnologĂ­as y las uti-­ lizan como medio para generar espacios de encuentro, lĂşdicos o reivindicativos. (Q FXDQWR D ORV RUtJHQHV GHO WpUPLQR ´à DVK PREÂľ XQ SULPHU UH-­ IHUHQWHORWHQGUtDPRVHQVXUHODWRGHĂ€FFLyQ)ODVK&URZGHVFULWR SRU/DUU\1LYHQHQ6HWUDWDGHXQDKLVWRULDGHFLHQFLDĂ€FFLyQ futurista en la que la ciencia ha conseguido crear transportadores instantĂĄneos muy baratos que permiten trasladar a las personas a cualquier lugar de la Tierra en milĂŠsimas de segundo, permitiendo que millones de personas puedan aparecer al mismo tiempo en un lugar donde se estuviese produciendo cualquier evento de interĂŠs. Prieto (2004), considera que los orĂ­genes de estas actuaciones esta-­ UtDQHQHOPRYLPLHQWRVLWXDFLRQLVWDGHĂ€QDOHVGHORVDxRVGHOVL-­ glo pasado, que promovĂ­a el cambio social por medio de acciones de resistencia civil, activa y cotidiana, que cuestionasen las certezas bĂĄsicas de la sociedad. Pero serĂĄ Rheingold (2002) quiĂŠn utilizarĂĄ HO FRQFHSWR ´VPDUW PREVÂľ SDUD GHĂ€QLU D XQD PXOWLWXG LQWHOLJHQ-­ te, que forma grupos grandes o pequeĂąos, y que fusiona la acciĂłn colectiva social, polĂ­tica y econĂłmica. El elemento diferencial se encuentra en la utilizaciĂłn de los medios de comunicaciĂłn mĂłviles e Internet para informarse y coordinar acciones. 46


La llegada de las TIC a la PolĂ­tica

Rheingold tambiĂŠn subraya que estas nuevas prĂĄcticas sociales y culturales, deslumbran pero tambiĂŠn asustan a los medios de comunicaciĂłn tradicionales, pues con ellas pierden el monopolio sobre el entretenimiento, la informaciĂłn y la comunicaciĂłn que hasta hacĂ­a poco gestionaban casi de forma exclusiva. QuizĂĄs por HOORGHVGHVXVRUtJHQHVODVĂ DVKPRGVKDQUHFLELGRLPSRUWDQWHV crĂ­ticas provenientes de los medios de comunicaciĂłn tradicionales, TXHOOHJDURQDFDOLĂ&#x20AC;FDUODVFRPRHQWUHWHQLPLHQWRSDUDMyYHQHVULFRV \DEXUULGRVTXHQRWHQtDQQDGDPHMRUTXHKDFHU 1HZ<RUN7LPHV  (Q(VSDxD0RQ]y  FRQVLGHUyTXHORVĂ DVKPREQR aportaban ninguna novedad, pues acciones masivas de carĂĄcter absurdo ya existĂ­an hace aĂąos, e incluso las equiparaba con chiqui-­ lladas propias de la infancia. /DSRSXODUL]DFLyQGHOWpUPLQRĂ DVKPREVVHGHEHD6HDQ6DYDJH TXHHQVXEORJFKHHVHELNLQLFRPXWLOL]yHVWHWpUPLQRDOUHIHULUTXH los neoyorquinos estaban usando el email para coordinar encuen-­ tros multitudinarios en lugares pĂşblicos, los cuales, se disolvĂ­an SRFRWLHPSRGHVSXpV/RVĂ DVKPRGVSDVDQDFRQYHUWLUVHHQXQD expresiĂłn social colectiva de carĂĄcter espontĂĄneo, breve, simple \ O~GLFD SHUPLWLGD SRU OD LQVWDQWDQHLGDG \ Ă XLGH] GH ,QWHUQHW Las convocatorias se realizan por medio de una pĂĄgina web, sms o emails para asistir a una reuniĂłn en un lugar pĂşblico en una hora y fecha determinada, precisando la acciĂłn a realizar y su duraciĂłn. /DDFFLyQWLHQHFRPRĂ&#x20AC;QDOLGDGSURYRFDUODVRUSUHVD\RFXULRVLGDG entre los transeĂşntes del lugar (Prieto, ob. cit). (O SULPHU Ă DVK PRE FRQ p[LWR DFDHFLy HQ HO DxR  HQ 1XHYD <RUN GRQGH PiV  SHUVRQDV IXHURQ D ORV DOPDFHQHV 0DF\Â?V D comprar una â&#x20AC;&#x153;alfombra del amorâ&#x20AC;? (Savage 2003b). RĂĄpidamente, ORVĂ DVKPREVVHSXVLHURQGHPRGDSRUWRGRHOPXQGROOHJDQGRD Europa el 23 de julio de 2003, cuando un grupo de entre 200 y 300 personas fueron a una importante librerĂ­a de la ciudad de Roma preguntando por un libro de un autor inexistente. En EspaĂąa, el 47


Adolfo Ă lvaro MartĂ­n

SULPHUĂ DVKPREWXYROXJDUHQ%DUFHORQDHOGHRFWXEUHGH entorno a la estatua de CristĂłbal ColĂłn, y consistĂ­a en situarse en la base del monumento con el brazo en alto y apuntando con el dedo Ă­ndice hacĂ­a el mar para, un poco despuĂŠs, ponerse a gritar â&#x20AC;&#x153;ÂĄQue vienen los indios!â&#x20AC;?. El acto no resultĂł como los convocan-­ tes habĂ­an previsto, puesto que su participaciĂłn fue muy escasa (La Vanguardia, 2010). Posteriormente, decenas de actos de ĂŠste tipo se han ido organizando por todo el mundo y, pese a ser en la DFWXDOLGDGXWLOL]DGRSRUODVHPSUHVDVGHPDUNHWLQJFRPRHVWUDWH-­ gia comercial, aĂşn mantienen el interĂŠs de miles de internautas que esperan nuevas convocatorias (El PaĂ­s, 14/02/2011). Y aun-­ que estas acciones relĂĄmpago estĂĄn llevadas a cabo por redes con FRQH[LRQHVGpELOHV&DPDFKR  FRQVLGHUDTXHORVĂ DVKPREV son mucho mĂĄs que lo que pretenden mostrar los medios de comu-­ QLFDFLyQ FRQ VXV DQiOLVLV VXSHUĂ&#x20AC;FLDOHV SXHVWR TXH OD H[KLELFLyQ del lado absurdo o anecdĂłtico es una llamada de atenciĂłn sobre el ritmo frenĂŠtico de la sociedad contemporĂĄnea en la que no hay WLHPSR SDUD OD UHĂ H[LyQ \ Vt PXFKD SDVLYLGDG GH OD FLXGDGDQtD ante temas sensibles. En otro ĂĄmbito, Castells et ĂĄl. (2006), seĂąalan que la comunicaciĂłn inalĂĄmbrica ofrece canales independientes de comunicaciĂłn de persona a persona, que otorgan mucha credibilidad a los mensajes recibidos pues provienen de fuentes conocidas. Por ello, a medi-­ da que se han ido extendiendo por el mundo las distintas formas de comunicaciĂłn inalĂĄmbrica, mayor ha sido su utilizaciĂłn en las protestas para dar voz al descontento de la poblaciĂłn y movilizar-­ VH XWLOL]DQGR HO QRYHGRVR VLVWHPD GH ORV Ă DVK PREV ODV FXDOHV han tenido una enorme relevancia en determinadas decisiones po-­ lĂ­ticas y gubernamentales, como ocurriĂł en el derrocamiento de Estrada en Filipinas y la victoria electoral de Roh Moo-­Hyun en Corea del Sur.

48


La llegada de las TIC a la PolĂ­tica

Â&#x2021; Derrocamiento del Presidente Estrada en Filipinas (2001): En octubre de 2000, Estrada fue acusado de recibir 80 millones de dĂłlares procedentes de sobornos y uso ilĂ­cito de fondos pĂş-­ blicos. Ello provocĂł que su vicepresidenta, Gloria Macapagal, dimitiese de su gabinete e iniciase una campaĂąa para provocar su destituciĂłn. En un ambiente enrarecido por atentados terro-­ ristas y por todo tipo de maniobras de Estrada para evitar su procesamiento (El PaĂ­s, 21/01/2001), el movimiento denomina-­ do People Power II encabezado por Macapagal, logrĂł movilizar a los ciudadanos de Manila por medio del envĂ­o de mensajes de texto a los telĂŠfonos celulares, en los que se difundĂ­a informa-­ ciĂłn sobre la corrupciĂłn de Estrada y se convocaba a las movi-­ lizaciones contra el intento de dejar sin efecto su procesamien-­ to (Court, 2001). Es de destacar, por una parte, que durante ODVSURWHVWDVVHUHFRJLHURQYtD606H,QWHUQHWĂ&#x20AC;UPDV electrĂłnicas en apoyo a la impugnaciĂłn de Estrada y, por otra parte, que gran nĂşmero de los mensajes de texto y comentarios en Internet durante aquellos dĂ­as, incidieron en desacreditar la imagen de Estrada por medio de burlas y chistes (Bagalawis, 2001). Â&#x2021; El poder de Nosamo (2002): Roh Moo-­Hyun se alzĂł con la victo-­ ria en las elecciones presidenciales de Corea del Sur en diciem-­ bre del 2002. Parte esencial de su ĂŠxito provino de la capacidad de un grupo de apoyo en Internet llamado Nosamo (gente que ama a Roh), que alcanzĂł la cifra de 80.000 miembros, fue capaz de recaudar mĂĄs de siete millones de dĂłlares mediante donacio-­ nes vĂ­a Internet, y consiguiĂł movilizar a miles de simpatizantes a los actos de campaĂąa mediante mensajes de texto. Su ĂŠxito fue tan rotundo que la web del candidato tuvo una media de medio millĂłn de visitas diarias (Hachiglan y Wu, 2003). Uno de los elementos mĂĄs destacables de esta acci��łn consistiĂł en que, por un lado, se llevĂł a cabo una campaĂąa en Internet prolonga-­ da en el tiempo para proveer de las redes polĂ­ticas esenciales 49


Adolfo Ă lvaro MartĂ­n

\SRURWUDSDUWHVHUHDOL]yXQDHĂ&#x20AC;FD]XWLOL]DFLyQGHOWHOpIRQR mĂłvil para movilizar a un importante colectivo de votantes jĂł-­ YHQHVHOGtDGHODVHOHFFLRQHVORTXHSXGRWHQHUXQHIHFWRGHĂ&#x20AC;-­ QLWLYRHQHOUHVXOWDGRĂ&#x20AC;QDO )XOIRUG 

50


CAPÍTULO II

NATIVOS DIGITALES, REDES SOCIALES <32/Ì7,&$


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

Durante los primeros aĂąos de este siglo, comenzĂł a notarse la in-­ Ă XHQFLDGHODVSULPHUDVJHQHUDFLRQHVGHFLXGDGDQRVTXHKDEtDQ crecido y se habĂ­an educado en contacto con el cambio tecnolĂłgico producido a lo largo de la dĂŠcada anterior, los cuĂĄles, manifestaban destrezas superiores en el uso de estas tecnologĂ­as respecto a sus mayores. El advenimiento de estas generaciones coincidiĂł con el cambio provocado por la llegada de la denominada â&#x20AC;&#x153;Web 2.0â&#x20AC;?, que permitiĂł el desarrollo de nuevas herramientas tecnolĂłgicas, que, en muchos casos, fueron impulsadas por estos jĂłvenes educados en la era digital. En el ĂĄmbito de la polĂ­tica, estas herramientas han permitido el desarrollo de nuevos modos de activismo, dan-­ GROXJDUDODGHQRPLQDGD´3ROtWLFDÂľSRSXODUL]DGDSRU%DUDN Obama en las elecciones presidenciales americanas de 2008. En este capĂ­tulo se analizan diversos hitos en la aplicaciĂłn de estas herramientas a la movilizaciĂłn y participaciĂłn polĂ­tica ciudadana. 2.1. Los nativos digitales 2.1.1. TeorĂ­a de los nativos digitales En su obra Generations, Culture and Society, Edmuns y Turner  GHĂ&#x20AC;QHQHOFRQFHSWRGHJHQHUDFLyQFRPRXQJUXSRGHHGDG que llega a tener relevancia social al constituirse con una iden-­ WLGDGFXOWXUDO/DVJHQHUDFLRQHVVHFRQĂ&#x20AC;JXUDUtDQQRVRORSRUVHU un grupo de individuos nacidos en un momento determinado, sino tambiĂŠn por la capacidad que tengan para crear una identidad compartida a partir de elementos sociales y culturales que les dife-­ rencien de las anteriores por sus gustos, creencias y orientaciones. Osgerby (2004: 159) sitĂşa a los jĂłvenes como epicentro de la re-­ voluciĂłn de la informaciĂłn al considerarlos el nivel cero de la era digital. Ellos ocuparĂ­an un nuevo espacio cultural y serĂ­an los fun-­ dadores de la NaciĂłn Digital. Gracias a las habilidades adquiridas al vivir en un entorno digital, dispondrĂ­an de un estatus privilegia-­ do en su relaciĂłn con los adultos, pues sus conocimientos y destre-­ zas con la tecnologĂ­a serĂ­an superiores a los de sus progenitores y 53


Adolfo Ă lvaro MartĂ­n

PDHVWURV$GHPiVODLQĂ XHQFLDGHODWHFQRORJtDVHKDEUtDH[WHQGL-­ do a sus relaciones sociales, que, en muchos casos, se establecerĂ­an y fortalecerĂ­an a travĂŠs de los entornos virtuales. Este creciente uso de la tecnologĂ­a digital estĂĄ propiciando la HPHUJHQFLDGHQXHYRVFRQFHSWRVSDUDGHĂ&#x20AC;QLUDHVWDJHQHUDFLyQGH jĂłvenes, tales como â&#x20AC;&#x153;GeneraciĂłn Digitalâ&#x20AC;? (Mehlman, 2003), â&#x20AC;&#x153;Gene-­ UDFLyQ1LQWHQGRÂľ %HFN\:LGH R´&\EHUNLGVÂľ +ROORZD\\ Valentine, 2003). Estos jĂłvenes consideran a las nuevas tecnolo-­ gĂ­as como algo propio que les acerca a los otros, y, en consecuencia, se apropian de ellas a travĂŠs del uso cotidiano, que mayoritaria-­ mente es de ocio. Nos encontrarĂ­amos ante un cambio de actitud frente a las nuevas tecnologĂ­as, derivado del hecho de que para la generaciĂłn de adultos anterior los instrumentos digitales consti-­ tuĂ­an una novedad y representaban la vanguardia digital, mien-­ tras que para los jĂłvenes de hoy estos aparatos son parte de su vida diaria. Tal como destaca Feixa (2003), los niĂąos de hoy son la primera generaciĂłn que llegarĂĄ a la mayorĂ­a de edad en la era digital. Lo relevante no es su acceso habitual a las nuevas tecnologĂ­as o que dispongan de gran destreza en su uso, lo esencial radicarĂ­a en la IRUPDHQTXHHVWDVQXHYDVWHFQRORJtDVKDEUtDQFRQĂ&#x20AC;JXUDGRVXYL-­ siĂłn de la vida y el mundo. El concepto de generaciĂłn al que se UHĂ&#x20AC;HUH)HL[DSRQHHQYDORUODLPSRUWDQFLDGHOSDVRGHXQDFXOWXUD analĂłgica basada en la escritura a una cultura digital basada en ODLPDJHQFRQĂ&#x20AC;JXUDGDSRUXQDFFHVRXQLYHUVDODODVQXHYDVWHF-­ nologĂ­as de la informaciĂłn y la comunicaciĂłn, la superaciĂłn de los lĂ­mites tradicionales entre los sexos, y un proceso de globalizaciĂłn cultural. Desde una perspectiva similar, Tapscott (1998) postula que la ac-­ tual generaciĂłn de niĂąos y jĂłvenes es la primera que ha sido edu-­ cada en la cultura digital, y por ello se les denomina â&#x20AC;&#x153;generaciĂłn redâ&#x20AC;?, â&#x20AC;&#x153;@â&#x20AC;? o â&#x20AC;&#x153;digitalâ&#x20AC;?, pues estos niĂąos saben mĂĄs que sus padres 54


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

sobre una innovaciĂłn decisiva para la sociedad. EstarĂ­amos en la contraposiciĂłn de dos generaciones diferenciadas por la tecnologĂ­a (televisiĂłn frente a Internet). Los â&#x20AC;&#x153;baby boomersâ&#x20AC;? fueron la gene-­ raciĂłn de la televisiĂłn, un medio pasivo, por el contrario, sus hijos IRUPDQSDUWHGHOD´JHQHUDFLyQ,QWHUQHWÂľGRQGHODUHGVHFRQĂ&#x20AC;JX-­ rarĂ­a como un medio democrĂĄtico e interactivo. 3UHQVN\   IXH TXLpQ SURSXVR OD GHQRPLQDFLyQ ´QDWLYRV GL-­ JLWDOHVÂľ SDUD GHĂ&#x20AC;QLU D ORV MyYHQHV QDFLGRV D SDUWLU GH OD GpFDGD de los 80 del pasado siglo XX, que estĂĄ creciendo inmersa en las TIC; desarrollĂĄndose entre computadoras, videojuegos y todo tipo de artilugios digitales, que forman parte indispensable de su vida FRWLGLDQD3UHQVN\HVWDEOHFLyODVFDUDFWHUtVWLFDVGHORVQDWLYRVGL-­ gitales en contraposiciĂłn a quienes habĂ­an adoptado la tecnologĂ­a mĂĄs tarde, denominados â&#x20AC;&#x153;inmigrantes digitalesâ&#x20AC;?, de forma que: Â&#x2021; /RVQDWLYRVGLJLWDOHVUHFLEHQ\GLVWULEX\HQODLQIRUPDFLyQGH forma rĂĄpida, disfrutan de los procesos multitarea paralelos \IXQFLRQDQPiVHĂ&#x20AC;FLHQWHPHQWHFXDQGRORKDFHQHQUHG Â&#x2021; /RV LQPLJUDQWHV GLJLWDOHV FRQWLQ~DQ WHQLHQGR HVWUXFWXUDV mentales â&#x20AC;&#x153;paso a pasoâ&#x20AC;?, basando su aprendizaje en el enlace con conocimientos previamente adquiridos, y su actuaciĂłn estĂĄ basada en el anĂĄlisis deductivo. $xRVGHVSXpV3UHQVN\  FRQFUHWDUtDHVWDVGLIHUHQFLDVHQODV siguientes ĂĄreas: a. Los nativos digitales comunican de una forma diferente; no comprenden que todavĂ­a se continĂşe utilizando el papel, consideran el mail asincrĂłnico, reconocen a sus interlocuto-­ UHVSRUQLFNQDPHV HOQRPEUHUHDOQRHVUHOHYDQWH \FUHDQ lenguajes paralelos para expresar sensaciones. b. Los nativos digitales gustan de los formatos audiovisuales \ODVZHEFDPVSUHĂ&#x20AC;HUHQORVEORJVDORVHPDLOV

55


Adolfo Ă lvaro MartĂ­n

c. La compra y venta en la red es algo natural para ellos, buscando en espacios como eBay lo que necesitan, incluso el dinero. d. Gustan del intercambio entre iguales, por ello utilizan redes de intercambio P2P (peer to peer), donde sus orde-­ nadores son a la vez clientes y servidores, pidiendo datos (clientes) y sirviÊndoles a terceros (servidores). De ahí la proliferación de aplicaciones que utilizan esta manera de FRPXQLFDFLyQFRPR.D]DDH0XOHR6N\SH e. Han encontrado nuevas herramientas para la creación, FRPRODVZHEV\ODVDQLPDFLRQHVHQà DVKRPDVKXSV DSOL-­ caciones que usan y combinan datos, presentaciones y fun-­ cionalidades procedentes de una o mås fuentes). f.

Modelan su propia identidad en la red, se coordinan online con otras personas.

g. Los encuentros personales ya no son obligatoriamente pre-­ senciales para los nativos digitales, sino que utilizan los recursos para coincidir sin estar en el mismo sitio. Ello les permite, ademĂĄs, disponer de destrezas para evaluar la UHSXWDFLyQODFRQĂ&#x20AC;DQ]D\ODFUHGLELOLGDGGHORWURLQWHUOR-­ cutor. h. Son defensores del cĂłdigo abierto y el software libre. A este respecto, BegoĂąa Gros (2004) elaborĂł una recopilaciĂłn de los diez cambios mĂĄs importantes de los nativos digitales: Â&#x2021; 3URFHVDQODLQIRUPDFLyQDPiVYHORFLGDGTXHODVJHQHUDFLR-­ nes anteriores. Â&#x2021; 'LVSRQHQGHJUDQFDSDFLGDGSDUDSURFHVDUHQSDUDOHOR/DV PXOWLWDVN PXOWLWDUHDV  FRQOOHYDQ XQD DWHQFLyQ GLYHUVLĂ&#x20AC;FD-­ da que puede tornarse menos intensa cuando se centra en un Ăşnico aspecto. 56


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

Â&#x2021; 3DUDORVQDWLYRVGLJLWDOHVHOWH[WRLOXVWUDODLPDJHQODFRP-­ plementa, y no viceversa. Â&#x2021; /RVKLSHUWH[WRVHQODQDYHJDFLyQSRU,QWHUQHWSHUPLWHQD estos jĂłvenes organizar la informaciĂłn de una manera dis-­ tinta a la de la escritura, rompiendo con la linealidad en el acceso a la informaciĂłn. Â&#x2021; /RVQDWLYRVGLJLWDOHVHVWiQFUHFLHQGRHQXQPXQGRFRQHFWDGR sincrĂłnica y anacrĂłnicamente, lo que les permite recopilar informaciĂłn y relacionarse con otros. Â&#x2021; %XVFDQ\GHVHDQXQDLQPHGLDWH]HQVXUHODFLyQFRQORWHFQR-­ lĂłgico. Â&#x2021; 3DUHFHQSRVHHUXQDPD\RUFDSDFLGDGGHUHVROXFLyQGHSUR-­ blemas. Â&#x2021; %XVFDQHQODWHFQRORJtDXQIHHGEDFNFRQVWDQWHEDVDGRHQOD recompensa inmediata por sus acciones. Â&#x2021; 7LHQHQXQDYLVLyQSRVLWLYDGHODWHFQRORJtDSXHVWRTXHKDQ crecido utilizĂĄndola y no les resulta extraĂąa. Palfrey y Gasser (2008) seĂąalaron una nueva distinciĂłn en cuanto al uso e interacciĂłn de las personas con los nuevos medios y la tecnologĂ­a: el â&#x20AC;&#x153;nacido digitalmenteâ&#x20AC;? (Born Digital) y el que â&#x20AC;&#x153;vive digitalmenteâ&#x20AC;? (Live Digital). Los autores establecen que la brecha digital no se produce por una cuestiĂłn generacional, puesto que muchos de los que por su rango de edad podrĂ­an ser considera-­ dos nativos digitales no viven digitalmente y, sin embargo, otras personas que pertenecen por edad a generaciones anteriores a los aĂąos 80 del pasado siglo XX, sĂ­ viven digitalmente. Esta diferen-­ ciaciĂłn les hace proponer una nueva categorĂ­a, en la que ademĂĄs de los â&#x20AC;&#x153;nativos digitalesâ&#x20AC;? y los â&#x20AC;&#x153;inmigrantes digitalesâ&#x20AC;?, nos encon-­ trarĂ­amos con los â&#x20AC;&#x153;colonos digitalesâ&#x20AC;? (Digital Settlers):

57


Adolfo Álvaro Martín

1. Los nativos digitales son las personas nacidas dentro de lo que se conoce como era digital (a partir de 1980), con acce-­ so a las tecnologías de redes digitales, que comparten una FXOWXUDJOREDOFRP~QTXHQRVHGHÀQHSRUODpSRFDVLQRSRU ciertos atributos y experiencias relacionadas con el modo en el cual interactúan con las tecnologías de la informa-­ ción, con la información misma y con otras personas e ins-­ tituciones. 2. Los colonos digitales son personas nacidas antes del inicio de la era digital, pero que pueden interactuar con dispositi-­ vos y tecnologías propias de dicha era y que además saben utilizarlos sin ningún problema. 3. Los inmigrantes digitales, también nacieron antes de la era digital, pero a diferencia de los colonos digitales son re-­ nuentes al uso de las nuevas tecnologías, por lo que siguen SUHÀULHQGRXWLOL]DUKHUUDPLHQWDV\GLVSRVLWLYRVWUDGLFLRQD-­ les como teléfonos, la televisión o la radio. Los jóvenes, fascinados por Internet, el teléfono celular y los vi-­ deojuegos, han encontrado en estas tecnologías un medio extraor-­ dinario de relación, comunicación, aprendizaje, satisfacción de la curiosidad, ocio y diversión. Poco a poco, esto conlleva que las TIC se conviertan en un elemento importante e imprescindible en sus vidas (Machargo y otros, 2003). ,QÁXHQFLDGHODV7,&HQORVYDORUHVGHORVMyYHQHV El impacto de Internet y las nuevas tecnologías ha generado un nuevo paradigma tecnoeconómico denominado sociedad red (Cas-­ tells, 1998b). Este nuevo paradigma no solo ha condicionado las formas de hacer negocios y transmitir conocimientos en la socie-­ dad posmoderna, sino que también ha establecido nuevos modos de relación y de comunicación entre los seres humanos, alterando profundamente los mecanismos y medios de interacción social. En 58


Nativos Digitales, Redes Sociales y Política 2.0

este nuevo paradigma, los jóvenes se convierten en actores esen-­ FLDOHVSRUVXÁH[LELOLGDG\DGDSWDFLyQDORVFRQWLQXRVFDPELRVGH la sociedad red. /DUHDSURSLDFLyQGHVLJQLÀFDGRVUHDOL]DGDSRUORVMyYHQHVDSDUWLU de las construcciones culturales tiene su expresión en los ámbitos éticos, políticos, artísticos, y en la producción de conocimiento. Los medios de comunicación, las redes de información, las industrias culturales, los procesos de consumo y la presencia en el espacio virtual son fundamentales en la producción de las subjetividades contemporáneas (Marín y Muñoz, 2002). La relación entre jóvenes y tecnología es vista desde dos posiciones radicalmente contrapuestas: una de carácter pesimista, encabeza-­ da por Neil Postman (1994), quien considera que los medios elec-­ trónicos han acabado con un modelo de infancia simbólico y lineal creado por los medios impresos: “Al introducir el ordenador personal en el aula, rompemos una tregua de 400 años entre el espíritu gregario y la franqueza propiciados por la oralidad y la introspección y el aislamiento propiciados por la palabra escrita. La oralidad recalca el apren-­ dizaje en grupo, la cooperación y un sentido de responsabilidad social (...) Ahora llega el ordenador, alzando de nuevo la ban-­ dera del aprendizaje en privado y la resolución individual de los problemas. ¿La difusión del uso de ordenadores en el aula anulará de una vez por todas las pretensiones del habla comu-­ nicativa? ¿Elevará el ordenador el egocentrismo a la categoría de virtud?” (Postman, 1994: 30-­31). En el otro extremo encontraríamos a Tapscott (1998: 30) que, si bien reconoce que como consecuencia de la tecnología mediatica digital (caso de los juegos en red), las fronteras entre la infancia y la edad adulta se vuelven cada vez más difusas, considera que este hecho es un elemento positivo de fortalecimiento de los más 59


Adolfo Ă lvaro MartĂ­n

jĂłvenes, porque los miembros de la que denomina â&#x20AC;&#x153;Generacion-­Nâ&#x20AC;?, estarĂ­an dejando a un lado los medios unidireccionales y centra-­ OL]DGRVSDUDFRQĂ&#x20AC;JXUDUVXSURSLRGHVWLQRHQEXVFDGHXQPXQGR mejor. Bajo esta premisa, los jĂłvenes establecen una relaciĂłn natural con las nuevas tecnologĂ­as, en contraposiciĂłn con el mundo de los adul-­ tos para los que la irrupciĂłn de la tecnologĂ­a digital ha sido un acontecimiento sobrevenido y hostil. â&#x20AC;&#x153;Tienen unas herramientas nuevas y poderosas para inda-­ JDUDQDOL]DUH[SUHVDUVHLQĂ XLU\MXJDU3RVHHQXQDPR-­ vilidad sin precedentes. Contraen el planeta de forma que sus padres nunca podĂ­an imaginar. A diferencia de la TV, que se ideĂł para ellos, ahora son los actores del mundo di-­ gitalâ&#x20AC;? (Tapscott, 1998: 3). (QHVWHVHQWLGR5XVKNRII  FRQVLGHUDTXHDGHPiVGHXQ fenĂłmeno tecnolĂłgico o mediĂĄtico, Internet es un fenĂłmeno social que permite a los jĂłvenes ser creadores de nuevos espacios cultu-­ rales, al haberse liberado de la pasividad de los canales lineales y disponer de nuevas destrezas a la hora de procesar y utilizar la informaciĂłn. )UHQWHDHVWDVSRVWXUDVFRQWUDSXHVWDV%XFNLQJKDP  FRQVL-­ dera que los niĂąos han alcanzado una posiciĂłn privilegiada como consumidores, y aunque las fronteras entre niĂąos y adultos se ha-­ yan debilitado en algunos casos, considera que en otros aspectos han aumentado de forma considerable. Los mismos adultos que han otorgado a los jĂłvenes un nuevo estatus econĂłmico y social son los que pretenden someterlos a mayor vigilancia y control. Igual-­ mente, considera que los avances tecnolĂłgicos no tienen por quĂŠ constituir en sĂ­ mismos nuevos riesgos u oportunidades para los jĂłvenes, pues deben ser analizados a la luz de otros cambios como los polĂ­ticos, culturales y en las prĂĄcticas sociales que regulan y GHĂ&#x20AC;QHQ OD LQIDQFLD DVt FRPR HQ ODV UHDOLGDGHV FRWLGLDQDV GH ORV 60


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

niĂąos y jĂłvenes. Advierte, igualmente, del peligro de exagerar la importancia de estos cambios tecnolĂłgicos al analizarlos de forma aislada y fuera del contexto social en el que se producen. El aspecto lĂşdico ha resultado esencial para la participaciĂłn de los nativos digitales en la cultura digital. Como seĂąalĂł The Economist (2005), una de las caracterĂ­sticas de los nativos digitales ha sido que empezaron a utilizar los videojuegos en su infancia, crecieron jugando con ellos, y siguen utilizĂĄndolos al llegar a la edad adul-­ ta, al considerarlos una forma de entretenimiento similar a ver pelĂ­culas u oir mĂşsica. Esta circunstancia ya fue seĂąalada por De .HUFKNRYH  TXHUHVDOWyODFDSDFLGDGTXHWHQtDQORVMXH-­ gos en la cultura digital para introducir a los niĂąos en el uso diario de la tecnologĂ­a. 3UHQVN\GDJUDQUHOHYDQFLDDODOOHJDGDGHODV7,&DODHGXFDFLyQ y seĂąala que para muchos jĂłvenes nativos digitales â&#x20AC;&#x153;comparada con sus vidas extraescolares que destilan tecnologĂ­a, el aula tra-­ dicional es un lugar sombrĂ­oâ&#x20AC;? (2008:40). Indica que durante gran parte de la historia, muchos de los niĂąos crecieron en la oscuridad intelectual, rodeados de leyendas, historias y miedos. Esto cambiĂł a mediados del siglo XX, con la llegada de la televisiĂłn, que les aso-­ mĂł a la realidad que existĂ­a mĂĄs allĂĄ de sus barrios o pueblos. Con la escuela se habrĂ­a producido un proceso similar, durante mucho tiempo fue la luz que permitĂ­a a los niĂąos y niĂąas abrirse al exte-­ rior, la escuela tenĂ­a como uno de sus mayores objetivos el sacar al mayor nĂşmero de niĂąos posible de la oscuridad para introducirlos en el saber y el anĂĄlisis crĂ­tico. El autor considera que, hoy en dĂ­a, la tecnologĂ­a permite a los ni-­ Ăąos en los paĂ­ses desarrollados conocer casi cualquier cosa que les LQWHUHVHJUDFLDVD*RRJOH:LNLSHGLD\PLOORQHVGHVLWLRVGHUHIH-­ rencia que estĂĄn a su entera disposiciĂłn. Se desarrollan viendo el mundo a travĂŠs del brillo del tubo de la televisiĂłn, de la pantalla del cine, animaciones interactivas de la pantalla del ordenador, la 61


Adolfo Ă lvaro MartĂ­n

pantalla del telĂŠfono mĂłvil, y las pantallas de las consolas y siste-­ mas portĂĄtiles. Estos niĂąos se enseĂąan unos a otros y asĂ­ partici-­ pan activamente con tanta frecuencia como les es posible, de forma global, gracias a la mensajerĂ­a instantĂĄnea, correos electrĂłnicos y llamadas telefĂłnicas. Igualmente, gracias a Internet, pueden par-­ ticipar en debates y actividades creativas, sociales y comunitarias de todo tipo. Sin embargo, cuando estos niĂąos llegan a la escuela, se les obliga a que dejen de utilizar las conexiones que forman parte de su vida extramuros de los colegios, en vez de utilizarlas para encontrar informaciĂłn, estructurarla y aprender. Como con-­ secuencia, los estudiantes de hoy en dĂ­a se aburren en las escuelas al tener que sufrir la imposiciĂłn de una enseĂąanza encorsetada en moldes, que no tiene en cuenta las caracterĂ­sticas de cada alumno, convirtiĂŠndose la escuela en un expendedor de tĂ­tulos acadĂŠmicos que les ayudarĂĄn en su futuro profesional. Sin embargo, fuera de la escuela, estos mismos chicos y chicas aprenden y se interesan por el conocimiento en muchos otros lugares y actividades. Este proceso englobarĂ­a su actividad en los blogs y las redes sociales; el tiempo que pasan creando videos y subiĂŠndolos a YouTube; la exploraciĂłn en mundos en lĂ­nea como Club Penguin o Second Life, HLQFOXVRRWUDVPXFKDVDFWLYLGDGHVTXHQRĂ&#x20AC;JXUDQHQORVSODQHVGH estudios, que realizan fuera de la escuela. 3UHQVN\FUHHTXHKD\TXHGDUODRSRUWXQLGDGGHTXHORVHVWXGLDQ-­ tes puedan utilizar la tecnologĂ­a en la escuela, y para ello es im-­ prescindible que los profesores dominen herramientas y tĂŠcnicas como los videojuegos, los blogs o los motores de bĂşsqueda. Entien-­ de que con este proceso los alumnos se implicarĂĄn mucho mĂĄs y obtendrĂĄn mejores resultados. Entiende que el profesor alcanzarĂĄ un papel mucho mĂĄs relevante al ser quien explique, provea el contexto, interprete el sentido y evalĂşe. De esta forma se podrĂĄ comprender a donde quieren ir los chicos y chicas en el futuro y, lo PiVLPSRUWDQWHD\XGDUOHVDFRQVHJXLUOR3DUDHOORĂ&#x20AC;MDXQDVHULH de principios que deberĂ­an de seguir los directores de las escuelas: 62


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

I.

Reconocer a los estudiantes un peso relevante a la hora de opinar sobre la política de la escuela en materia del uso de la tecnología. Convocar reuniones que incluyan a los profe-­ sores, alumnos, padres y expertos en tecnología para esta-­ blecer políticas escolares sobre el uso de las TIC.

II.

Dirigir su esfuerzo a eliminar el aburrimiento que genera la escuela en los alumnos mediante la adopción de las me-­ didas adecuadas.

III.

Hablar cada dĂ­a con 2 Ăł 4 alumnos diferentes sobre su aprendizaje.

IV.

Llevar a cabo un proceso de implantaciĂłn de un modelo de â&#x20AC;&#x153;autoenseĂąanza orientadaâ&#x20AC;?, que suprima las actividades inĂştiles.

V.

Promover el uso de la tecnologĂ­a, impartiendo clases de programaciĂłn, robĂłtica, colaboraciĂłn a larga distancia y DGHODQWRVFLHQWtĂ&#x20AC;FRV

VI.

Permitir a los estudiantes que compartan las prĂĄcticas y UHVXOWDGRV PiV HĂ&#x20AC;FDFHV GH VX HVFXHOD FRQ HO PXQGR YtD YouTube.

(VWDQXHYDRULHQWDFLyQGHODHVFXHODODGHVDUUROOy3UHQVN\ E  en un artĂ­culo titulado Programming is the new Literacy, donde seĂąala que la nociĂłn de alfabetizaciĂłn en el siglo XXI irĂĄ mĂĄs allĂĄ del lenguaje hablado y escrito, e incluirĂĄ a una panoplia de habili-­ dades que suele agruparse bajo el tĂŠrmino â&#x20AC;&#x153;multimediaâ&#x20AC;? (ser capaz de comprender y crear mensajes, comunicaciones y obras que se contengan o se creen con elementos visuales, orales y tĂĄctiles asĂ­ como con palabras). Apunta a que importantes colectivos consi-­ derarĂĄn que la nueva alfabetizaciĂłn debe incorporar la interacti-­ vidad, juegos y otros factores. Este hecho provocarĂĄ que la Ăşnica competencia que distinguirĂĄ a una persona formada de las demĂĄs, serĂĄ la alfabetizaciĂłn de la programaciĂłn, habilidad que permitirĂĄ a un individuo dominar la tecnologĂ­a y utilizarla a su antojo. 63


Adolfo Ă lvaro MartĂ­n

Esta alfabetizaciĂłn se detectarĂ­a en los niĂąos y jĂłvenes actuales, que comienzan utilizando el lenguaje HTML de las pĂĄginas web, para mĂĄs adelante familiarizarse con otros lenguajes como el XML \HO3+3HLQFOXVRORVPiVDYDQ]DGRVFRQKHUUDPLHQWDVJUiĂ&#x20AC;FDV o el C++ para la creaciĂłn de videojuegos. La demostraciĂłn empĂ­rica GHHVWDFDSDFLWDFLyQGHORVPiVMyYHQHVVHJ~Q3UHQVN\VHREVHUYD cada dĂ­a cuando se recurre a personas jĂłvenes (hijos, estudiantes, empleados) para que programen por nosotros. Estos jĂłvenes serĂĄn ORVTXHFRQĂ&#x20AC;JXUDUiQOD´WULEXGHHVFULEDQRVÂľGHOVLJORXXI por su capacidad para programar, lo que les llevarĂĄ a ser la ĂŠlite intelec-­ tual del futuro. Esta situaciĂłn plantea un futuro difĂ­cil para todos aquellos que no programen y, por tanto, no puedan adaptarse a los cada vez mĂĄs complejos equipos que habrĂĄ en los puestos de trabajo, hogares o espacios pĂşblicos. AdemĂĄs, este nuevo proceso de alfabetizaciĂłn tambiĂŠn generarĂĄ cambios, al permitir que cualquier persona con capacidad de programaciĂłn pueda inventar nuevas herramientas para resolver los problemas. Considera que dentro de poco mĂĄs de treinta aĂąos, un paĂ­s como Estados Unidos no serĂĄ mĂĄs competiti-­ vo porque su poblaciĂłn pueda leer, lo que le harĂĄ competitivo serĂĄ que sus ciudadanos sean capaces de manejar las mĂĄquinas mĂĄs complejas a su antojo. Como seĂąala Merino (2010), la tecnologĂ­a estĂĄ permitiendo a los jĂł-­ venes tener un estatus diferenciado, bien sea entre ellos, donde se establece un elemento de prestigio en funciĂłn de los aparatos que poseen, bien con respecto a los adultos, quienes por su mentalidad DQDOyJLFDWLHQHQGLĂ&#x20AC;FXOWDGHVDODKRUDGHODXWLOL]DFLyQGHGLFKRV aparatos. AdemĂĄs las TIC estĂĄn permitiendo a los jĂłvenes dispo-­ ner de nuevas formas de movilidad virtual que complementan a las tradicionales como el telĂŠfono, los viajes, o los encuentros con los amigos, que les permiten explorar nuevos mundos y conocer e interactuar con otras personas que no estan en su entorno cercano. 64


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

Por Ăşltimo, Merino seĂąala que la tecnologĂ­a es un agente ordena-­ dor de primer orden de la vida cotidiana de los jĂłvenes: â&#x20AC;&#x153;(â&#x20AC;Ś) las nuevas tecnologĂ­as no solo abren el abanico de nue-­ vos espacios y tiempos virtuales, sino que se insertan en los domĂŠsticos provocando una reestructuraciĂłn de los mismos. Hoy en dĂ­a, por ejemplo, los jĂłvenes al salir de la escuela o el instituto quedan con sus amigos para charlar por Messenger o Tuenti (â&#x20AC;Ś)â&#x20AC;? (Merino 2010: 217). 2.1.3. Nativos digitales y Redes Sociales La amplitud y forma de uso de las redes sociales por parte de los nativos digitales ha sido objeto de diversos estudios en EspaĂąa y AmĂŠrica Latina. Al respecto, llaman la atenciĂłn las conclusiones del realizado por SĂĄnchez BurĂłn y FernĂĄndez MartĂ­n (2010), que seĂąalan: a)-­ La utilizaciĂłn de las redes sociales estĂĄ muy extendido entre la poblaciĂłn adolescente, llegando a un 78% de la muestra analizada los que reconocen utilizarlas. b)-­ Las chicas utilizan mĂĄs las redes sociales (81,6%) que sus com-­ paĂąeros varones (74,4%). c)-­ La fĂłrmula mayoritaria de conocimiento de las redes sociales ha sido mediante el â&#x20AC;&#x153;boca-­oidoâ&#x20AC;? (93% de los encuestados). Destaca igualmente que en la mayorĂ­a de los casos los adolescentes son usuarios de las redes sociales desde hace menos de 3 aĂąos. d)-­ El uso de redes sociales se estĂĄ convirtiendo en la herramienta favorita para los adolescentes y jĂłvenes en EspaĂąa, y estĂĄ desban-­ cando a otras aplicaciones como el Messenger. e)-­ La red social favorita es Tuenti (80%), aunque el detalle del es-­ tudio por comunidades autĂłnomas seĂąala alguna variaciĂłn, como HQHOFDVRGH&DWDOXxDGRQGHODUHGIDYRULWDHV)DFHERRN   /RVDGROHVFHQWHVQRVXHOHQOLPLWDUODLQFRUSRUDFLyQGHVXSHUĂ&#x20AC;OD 65


Adolfo Ă lvaro MartĂ­n

una Ăşnica red social, sino que un nĂşmero importante de ellos dis-­ SRQHQGHSHUĂ&#x20AC;OHVHQGRVUHGHV   f)-­ En cuanto a la frecuencia de uso de las redes sociales, un 39% de los adolescentes reconocen utilizarla â&#x20AC;&#x153;varias veces al dĂ­aâ&#x20AC;?. Las chicas acceden a las redes con mĂĄs frecuencia que los chicos. g)-­ El motivo mĂĄs frecuente para el uso de las redes sociales es mantener el contacto con los amigos (80%), seguido a mucha dis-­ tancia por el deseo de mantener contacto con gente con la que se SHUGLy OD UHODFLyQ (VWDV DĂ&#x20AC;UPDFLRQHV VHJ~Q ORV DXWRUHV GHO HV-­ WXGLRGHPRVWUDUtDQODĂ&#x20AC;QDOLGDGUHODFLRQDOGHHVWHWLSRGHKHUUD-­ mientas. f)-­ En cuanto a los contactos que mantienen los adolescentes en ODVUHGHVVRFLDOHVXQUHVSRQGHTXHPDQWLHQHHQVXVSHUĂ&#x20AC;OHV mĂĄs de 100 contactos, que los autores achacan a la tendencia exis-­ tente en esas edades de formar grandes grupos de amigos. Estos FRQWDFWRVUHĂ&#x20AC;HUHQDDPLJRVFRQORVTXHVHPDQWLHQHXQDUHODFLyQ frecuente externa a las redes sociales, asĂ­ como a conocidos que residen fuera de la localidad. g)-­ Resulta interesante comprobar los resultados del estudio res-­ pecto a uno de los principales miedos que aducen los padres de los adolescentes respecto de las redes sociales, que no es otro que el riesgo de que estas herramientas sirvan de canal de acceso por parte de desconocidos a sus hijos. Los adolescentes encuestados re-­ conocieron que mantienen muy poco contacto con extraĂąos, apenas un 6,8% del total y, lo mĂĄs importante, solo un 8% de los que ha-­ bĂ­an reconocido tener desconocidos entre sus amigos en las redes habĂ­an quedado alguna vez con ellos. h)-­ Respecto a otro de los miedos expresados por padres y educa-­ GRUHVUHVSHFWRGHOXVRGHODVUHGHVVRFLDOHVVXLQĂ XHQFLDHQHOUHQ-­ dimiento escolar, el estudio seĂąala que no existe ninguna relaciĂłn entre su grado de utilizaciĂłn y el rendimiento escolar. 66


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

i)-­ El uso de las redes sociales no afecta a la sociabilidad de los adolescentes. El estudio seĂąala que sus actividades favoritas estĂĄn situadas fuera de la mesa del ordenador, tales como â&#x20AC;&#x153;salir con ami-­ gosâ&#x20AC;? (80,2%), â&#x20AC;&#x153;hacer deporteâ&#x20AC;? (40,8%) o â&#x20AC;&#x153;ir al cineâ&#x20AC;? (21,5%). j)-­ Donde las redes sociales sĂ­ estĂĄn provocando cambios en los hĂĄbitos de los adolescentes es en sus actividades dentro del hogar, SXHVSUHĂ&#x20AC;HUHQXWLOL]DUHVWDVKHUUDPLHQWDVDYHUODWHOHYLVLyQ N )LQDOPHQWHHOHVWXGLRVHxDODTXHODXWLOL]DFLyQGHODVUHGHVVR-­ FLDOHVQRWLHQHLQĂ XHQFLDUHOHYDQWHVREUHODVUHODFLRQHVVRFLDOHVGH los adolescentes, mĂĄs bien al contrario: ellos perciben su uso como una herramienta que permite mejorarlas o dinamizarlas. Posteriormente, en el estudio comparativo del uso de redes sociales en EspaĂąa y AmĂŠrica Latina (SĂĄnchez BurĂłn y Ă lvaro, 2011), en el que tuvo una participaciĂłn relevante FLACSO se pudo constatar: a)-­ La elevada utilizaciĂłn de las redes sociales en todos los paĂ­ses analizados, siendo Ecuador donde el uso es mĂĄs intensivo (94,3%) y EspaĂąa donde su uso es menor (79,4%), pese a su incremento en mĂĄs de un punto respecto al estudio del aĂąo anterior. E 6HFRQĂ&#x20AC;UPDTXHHOPpWRGRPiVXWLOL]DGRSDUDTXHORVDGROHV-­ centes tengan conocimiento de las redes sociales es la informaciĂłn transmitida por su cĂ­rculo de relaciĂłn mĂĄs Ă­ntimo. F (QODPD\RUtDGHORVSDtVHVODUHGVRFLDOIDYRULWDHV)DFHERRN con la excepciĂłn de EspaĂąa donde Tuenti es la red favorita de los DGROHVFHQWHVFRQĂ&#x20AC;UPDQGRODWHQGHQFLDGHVWDFDGDHQHVWXGLRVDQ-­ teriores. d)-­ El grado de utilizaciĂłn de las redes sociales es elevado, puesto que mĂĄs del 40% de los adolescentes consultados lo hacen mĂĄs de una vez al dĂ­a (en lĂ­nea con lo indicado en el estudio del aĂąo an-­ terior), siendo tambiĂŠn interesante resaltar que es habitual entre los chicos y chicas tener abiertas las redes sociales mientras estĂĄn conectados a Internet. 67


Adolfo Ă lvaro MartĂ­n

H 6HFRQĂ&#x20AC;UPDODWHQGHQFLDGHTXHODSULQFLSDOPRWLYDFLyQSDUD el uso de las redes sociales es mantener contacto con aquellas per-­ sonas que ven habitualmente, seguida por el deseo de mantener relaciĂłn con personas a las que no ven de manera habitual. f)-­ Las acciones mĂĄs frecuentes en su uso de las redes sociales son FROJDUIRWRJUDItDV\FRPHQWDUODVORTXHFRQĂ&#x20AC;UPDUtDTXHVXDFHUFD-­ miento a estas herramientas se produce desde un punto de vista lĂşdico y de relaciĂłn con los demĂĄs. g)-­ En cuanto a su percepciĂłn de peligro en el uso de las redes sociales, existen distintos grados segĂşn los paĂ­ses analizados, des-­ tacando que en EspaĂąa y en Ecuador es donde menos conciencia existe sobre los peligros de su uso y, quizĂĄs por ello, donde menos estrategias de protecciĂłn de la privacidad se utilizan. Por el con-­ trario, los adolescentes mexicanos, argentinos y colombianos son quienes mayor concienciaciĂłn tienen al respecto. No obstante, sĂ­ parece acreditado que los adolescentes actĂşan con prudencia pues-­ to que en el caso de EspaĂąa, no supera el 10% el nĂşmero de ellos que han reconocido haberse citado con un desconocido a travĂŠs de las redes sociales. h)-­ Finalmente, y en consonancia con anteriores estudios, los ado-­ lescentes de todos los paĂ­ses perciben que la relaciĂłn que mantie-­ nen con las redes sociales es muy saludable. No consideran que PHGLDWLFHRFRQGLFLRQHVXFDSDFLGDGGHUHODFLyQVRFLDO\SUHĂ&#x20AC;HUHQ el trato personal al virtual. (O HVWXGLR Ă&#x20AC;QDOL]D FRQ XQD UHFRPHQGDFLyQ D SDGUHV HGXFDGRUHV y poderes pĂşblicos, en el sentido de que la extensiĂłn en el uso, y la cada vez mĂĄs temprana incorporaciĂłn de los adolescentes a las UHGHVVRFLDOHVGHEHUiQLPSOLFDUXQDUHĂ H[LyQVREUHODQHFHVLGDG de introducir en el sistema educativo acciones para incorporarlas al aprendizaje. Con ello se conseguirĂ­a un uso responsable de las mismas, asĂ­ como familiarizar a los padres con ellas e instruirles en estrategias para minimizar posibles riesgos de uso, especial-­ mente entre los mĂĄs jĂłvenes. 68


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

(VWRV UHVXOWDGRV FRQĂ&#x20AC;UPDUtDQ OR LQGLFDGR SRU 3DOIUH\ \ *DVVHU (2008: 61), en el sentido de que las redes sociales estĂĄn permi-­ tiendo a los jĂłvenes conectados compartir con sus amigos no solo contenidos multimedia como vĂ­deos, fotografĂ­as, o hipervĂ­nculos, sino tambiĂŠn compartir noticias en tiempo real y comunicarse en-­ tre ellos. AsĂ­mismo, estos resultados parecerĂ­an desmentir ciertos temores difundidos sobre las redes sociales en los entornos fami-­ liares de los nativos digitales, que considerarĂ­an a las redes socia-­ les como un potencial peligro para los jĂłvenes. MĂĄs al contrario, el estudio muestra que los adolescentes parecen actuar de forma mucho mĂĄs consecuente y prudente de lo que sus progenitores, fa-­ miliares y educadores consideran. Esta alarma, tal y como hemos visto en apartados anteriores, tendrĂ­a mĂĄs que ver con el desco-­ nocimiento de las generaciones adultas con estas plataformas y VXVGLĂ&#x20AC;FXOWDGHVSDUDDGDSWDUVHDXQHQWRUQRWHFQROyJLFRTXHHVWRV jĂłvenes utilizan con toda normalidad. /DOOHJDGDGHOD:HE 2.2.1 La crisis de las â&#x20AC;&#x153;puntocomâ&#x20AC;? Si bien lo que hoy conocemos como â&#x20AC;&#x153;Webâ&#x20AC;? (abreviatura de World Wide Web) tuvo sus antecedentes en los aĂąos 60 del pasado si-­ glo XX con la apariciĂłn de los primeros navegadores de texto, su nacimiento comenzĂł a gestarse en el aĂąo 1989 en el Consejo Eu-­ ropeo para la InvestigaciĂłn Nuclear (en adelante CERN), cuan-­ do un grupo de fĂ­sicos encabezados por Tim Berners-­Lee crearon HO OHQJXDMH +70/ +LSHUWH[WR 0DUNXS /DQJXDJH  8Q DxR GHV-­ puĂŠs, Berners-­Lee utilizarĂ­a un ordenador NexTcube como primer servidor web del mundo y crearĂ­a el primer navegador. El gran avance de Berners-­Lee fue unir hipertexto e Internet. AdemĂĄs, y a diferencia de lo existente hasta aquel momento, la Web no tenĂ­a propietario, lo que permitĂ­a desarrollar servidores independientes y aĂąadir todo tipo de extensiones sin restricciĂłn alguna. Su ĂŠxi-­ WRGHĂ&#x20AC;QLWLYRFRPHQ]DUtDDSDUWLUGHODxRIHFKDHQHOTXHHO 69


Adolfo Álvaro Martín

CERN anunció que la web sería gratuita para todos. El hecho de que pudiese publicarse información por cualquier persona y que esta estuviese al alcance de quien tuviese una computadora y una línea de teléfono, generó una rápida popularización de la Web, que de inmediato atrajo el interés del sector empresarial y dio lugar DOWpUPLQR´EXUEXMDFRPµTXHUHÀHUHDODJUDQFRUULHQWHGHHVSH-­ culaciones bursátiles desarrollada entre los años 1997 y 2000, en la que las bolsas occidentales tuvieron un enorme incremento de valor debido a la popularidad de las empresas basadas en Internet y que fueron conocidas como “puntocom”. Para comprender como se produjeron los hechos debemos remon-­ tarnos al año 1994, cuando se producen dos acontecimientos que resultarán cruciales para lo que posteriormente sucederá: a. Dos estudiantes de la Universidad de Stanford, David Filo y Jerry Yang, crearon un directorio para catalogar los sitios más interesantes de la Web. Ese proyecto fue bautizado por sus creadores en marzo de 1995 con el nombre de “Yahoo!”. La empresa recibiría tan solo un mes después una importante inyección de fondos de Sequoia Capital, un inversor que había patrocinado a Apple, Atari, Oracle o Cisco Systems, lo que per-­ mitió a Yahoo! cotizar en Bolsa tan solo un año después de su lanzamiento (Nafría, 2007). b.  0DUF $QGUHHVVHQ \ -LP &ODUN FUHDURQ HQ  OD HPSUHVD Netscape Communication, la cual desarrollaría el navegador Netscape Navigator, que en muy poco tiempo se convertiría en el navegador preferido por la mayoría de los usuarios de Internet de la época. El camino marcado por estas empresas no tardó en ser imitado por muchas otras compañías, generando una corriente especulativa en la que la cotización de los títulos se disparaba en el mercado de empresas tecnológicas Nasdaq, en un entorno en el que cerca de 70


Nativos Digitales, Redes Sociales y Política 2.0

60.000 nuevas empresas puntocom comenzaron su andadura en el año 1999. En los años siguientes, las empresas puntocom alcanzaron sus ma-­ yores cotas de crecimiento, aunque ya se empezaron a levantar las primeras voces que alertaban sobre esta situación: “(…) A lo largo de 1998 las acciones de las empresas de In-­ ternet que cotizaban en Wall Street se revalorizaron enorme-­ mente. Durante estas dos primeras semanas de 1999 el love affair que viven estas compañías con los inversores no solo se mantiene sino que ha aumentado su intensidad, a pesar de que ayer, 12 de enero, casi todos los títulos perdieron valor. Los analistas se esfuerzan por entender este fenómeno. Du-­ rante los doce meses de 1998 las acciones de America Online, Yahoo! y Amazon.com multiplicaron por cuatro su valor. El gran capital ha apostado de forma decidida por Internet in-­ cluso a pesar de que muchas empresas todavía no registran ganancias. El índice del Nasdaq, mercado donde cotizan la mayor parte de las empresas de informática y nuevas tecnologías, ha pasado en un año de 1.357,09 dólares a los 2.396,30 dólares con que cerró ayer la sesión. La duda sobre la exagerada valoración de estas compañías asalta a todos los analistas, y la respuesta ofrecida suele refe-­ rirse al enorme potencial que a largo plazo tienen estas empre-­ sas. El caso de Amazon.com es posiblemente el más espectacu-­ lar y representativo de este fenómeno. Esta tienda de Internet (libros, música, películas y regalos), a la que ya me referí en la anterior crónica, sigue perdiendo mucho dinero a pesar de sus enormes ventas (250 millones de dólares en el cuarto trimestre de 1998) debido fundamentalmente a sus inversiones en mar-­ NHWLQJ \ D ODV HPSUHVDV TXH KD FRPSUDGR (VWDV LQYHUVLRQHV 71


Adolfo Álvaro Martín

son las que le han permitido construir en menos de cuatro años XQDGHODVPDUFDVPiVSRGHURVDVHQ,QWHUQHW « <ÀQDOPHQWH el buscador Yahoo!, principal portal de Internet, que también el lunes anunció un acuerdo con IBM para incluir enlaces di-­ rectos desde la línea de ordenadores Aptiva, vio como sus ac-­ ciones aumentaban 71 dólares para situarse en 415 dólares. Ayer cayeron 19 dólares, pero hoy podrían volver a recuperar terreno después del anuncio de los positivos resultados del cuarto trimestres de 1998, que han superado las expectativas. Con unos ingresos de 76,4 millones de dólares, las ganancias de Yahoo! en los últimos tres meses del año han sido de 25 mi-­ llones de dólares (…)”. Nafria (1999). Tal era el éxito de las puntocom que en enero del año 2000, 17 de ORVDQXQFLDQWHVTXHHVFRJLHURQODÀQDOGHOD6XSHU%RZOSDUD proyectar sus anuncios televisivos a una audiencia de 130 millones de telespectadores fueron empresas de Internet. Algunas de estas compañías pagaron algo más de dos millones de dólares por un anuncio de 30 segundos (ABC, 11/03/2000). Este proceso alcanzó su punto más álgido cuando el proveedor de Internet AOL adquirió la compañía Time Warner en enero de 2000 por doscientos mil millones de dólares, lo que provocó que el Nasdaq alcanzase su máximo histórico de 5132,52 puntos el 10 de marzo de 2000. Sin embargo, a partir del lunes 13 de marzo de 2000 se produjo un cambio de tendencia que provocó la caída en picado del Nasdaq, con un descenso de un nueve por ciento en apenas seis días, que generó perdidas multimillonarias para las empresas tecnológicas. El Nasdaq perdería un 60% de su valor en los doce meses siguientes (El País, 2001). A partir del año 2001, la gran mayoría de las empresas puntocom FHVDURQHQVXDFWLYLGDGDOQRVHUFDSDFHVGHJHQHUDUEHQHÀFLRV\ agotar los recursos derivados del capital-­riesgo. Esta situación se vio agravada como consecuencia de los atentados del 11 de sep-­ 72


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

tiembre de 2001 en Estados Unidos, provocando que el Ă­ndice Nas-­ daq cayese hasta los 1.108 puntos en octubre de 2002. (El Mundo, 2002; El PaĂ­s, 2002). 6HJ~Q 7LP 2Â?5HLOO\   HO HVWDOOLGR GH OD EXUEXMD WHFQROyJLFD marcĂł un momento crucial para la Web, pues a partir de ese mo-­ mento (2001-­2002) los contenidos de los servicios online de refe-­ rencia pasaron a ser creados por los propios usuarios en vez de por plantillas profesionalizadas, lo que facilitĂł la participaciĂłn de los usuarios en la generaciĂłn del output de los servicios, abriendo el camino a la interacciĂłn en comunidades. /DWUDQVIRUPDFLyQSURGXFLGDSRUOD:HE La primera persona que hablĂł de Web 1.0 y Web 2.0 fue Darcy DiNucci que, en un artĂ­culo de 1999 titulado Fragmented Future, seĂąalaba que pese al ĂŠxito y difusiĂłn de la Web, ĂŠsta no era mĂĄs que un prototipo al que la industria se estaba preparando para desarrollar en el futuro todas sus posibilidades. Esta nueva web (Web 2.0) ya no se asociarĂ­a exclusivamente con el ordenador, sino que serĂ­a posible acceder a ella a travĂŠs de mĂşltiples combina-­ ciones. DiNucci anunciaba asĂ­ una versiĂłn mejorada de la Web y algunos de los rasgos que la caracterizarĂ­an aĂąos mĂĄs tarde. La popularizaciĂłn del concepto de Web 2.0 comenzĂł con una se-­ siĂłn de â&#x20AC;&#x153;lluvia de ideasâ&#x20AC;? realizada entre Oâ&#x20AC;&#x2122;Reilly y MediaLive In-­ ternational en 2004. De aquella reuniĂłn concluyeron que pese al derrumbe de las puntocom, la Web continuaba siendo una herra-­ mienta importantĂ­sima en la que regularmente aparecĂ­an sitios que incorporaban novedosas aplicaciones. Este hecho les hizo con-­ siderar que comenzaba a surgir algo distinto que por el momento QR WHQtD QRPEUH  KDVWD TXH HQ  HO SURSLR 7LP 2Â?5HLOO\ OR bautizĂł como â&#x20AC;&#x153;Web 2.0â&#x20AC;? en un artĂ­culo titulado What is Web 2.0: Design Patterns and Business Models for the Next Generation of Software. En este artĂ­culo, Oâ&#x20AC;&#x2122;Reilly estableciĂł 7 principios que es-­ tarĂ­an presentes en la Web 2.0: 73


Adolfo Ă lvaro MartĂ­n

1. La Web como plataforma: entendida como un sistema de prin-­ cipios y prĂĄcticas que conforman un verdadero sistema solar de sitios que muestran algunos o todos esos principios. La Web ya no serĂĄ Ăşnicamente un sitio para divulgar informa-­ ciĂłn, ahora tambiĂŠn serĂĄ una herramienta para compartirla. Las aplicaciones que operan en la Web pueden ser combinadas cuando las organizaciones hacen disponibles sus datos a tra-­ vĂŠs de API (Application Programming Interfaces) que siguen estĂĄndares y protocolos. 2. Aprovechando la inteligencia colectiva: Es una de las aplicacio-­ nes mĂĄs importantes de la Web 2.0, que en el ĂĄmbito de la par-­ ticipaciĂłn polĂ­tica de los ciudadanos tendrĂĄ un gran desarrollo, ya que permite a los usuarios del sitio contribuir en la crea-­ FLyQGHVXVFRQWHQLGRV(OHMHPSORPiVHYLGHQWHHV:LNLSHGLD una enciclopedia online, cuyo valor aumenta a medida que los usuarios contribuyen aportando nuevos artĂ­culos o actualizan-­ do los ya existentes. 3. Los datos son el siguiente Intel Inside2Â?5HLOO\HQWLHQGHTXH al igual que el valor de un ordenador viene relacionado con su microprocesador, el ĂŠxito de la aplicaciĂłn Web 2.0 estarĂĄ deter-­ minado por los datos que contiene y que pone a disposiciĂłn de los usuarios gracias al formato XML, un lenguaje que permite representar y compartir datos en la Web. El formato XML mĂĄs popular es el RSS (Really Simple Syndication), que permite compartir contenidos, incluso sin necesidad de un navegador. 4. (OĂ&#x20AC;QGHOFLFORGHODVDFWXDOL]DFLRQHVGHYHUVLRQHVGHOVRIWZDUH: 8QDGHODVFDUDFWHUtVWLFDVTXHGHĂ&#x20AC;QHQDOVRIWZDUHGHHVWDQXH-­ va ĂŠpoca es que se entrega como un servicio, no como un pro-­ ducto. Las aplicaciones de software se ejecutan a travĂŠs de la propia web, de forma que el usuario podrĂĄ descargarse la ver-­ siĂłn actualizada de la aplicaciĂłn. 74


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

5. Modelos de programación ligeros: Las aplicaciones de la Web 2.0 se desarrollan gracias a que las herramientas para crear-­ las y los datos que contienen interactúan de manera simple con muchas aplicaciones distintas. JavaScript, Python, Ruby on Rails, Perl, y PHP son lenguajes y plataformas comunes de programación sobre las cuales se construyen muchas aplicacio-­ nes de la Web 2.0. 6. El software no limitado a un solo dispositivo: El software crea-­ do para no estar circunscrito a un solo dispositivo proporcio-­ narå mejores prestaciones, y la Web 2.0 no se limitarå a la plataforma de un ordenador personal, por lo que los usuarios podrån visualizan påginas web o interactuar con las aplica-­ ciones desde nuevos dispositivos como los telÊfonos móviles, FRQVRODVGHMXHJR\UHSURGXFWRUHVGH032�5HLOO\GDXQJUDQ valor a estas utilidades, gracias a las cuales espera que se pro-­ duzcan importantes cambios por la capacidad de incorporar innumerables dispositivos a las nuevas plataformas. Estos FDPELRVSRUHMHPSORSHUPLWLUiQHOGHVDUUROORGHORVà DVKPRE o nuevas formas de activismo político ciudadano. 7. Experiencias enriquecedoras del usuario/a2�5HLOO\FRQVLGHUD que el potencial de la Web para proporcionar una gama com-­ pleta de aplicaciones no tuvo Êxito masivo hasta que Google introdujo Gmail y Google Maps, aplicaciones Êstas que fueron bautizadas con el nombre de AJAX (Asyncrhonous Javascript and XML). Pronostica, ademås, la llegada de nuevas aplicacio-­ nes en los próximos aùos, que generaran oportunidades para que se efectúe un cambio en el liderazgo de las principales apli-­ caciones de la plataforma anterior. Cormode y Krishnamurthy (2008), consideran que las diferencias entre la Web 1.0 y la Web 2.0 se basan en tres aspectos funda-­ mentales:

75


Adolfo Ă lvaro MartĂ­n

Â&#x2021; La tecnologĂ­a: En la Web 1.0 la mayorĂ­a de usuarios eran me-­ ros consumidores de contenidos. En la Web 2.0, gracias a las herramientas existentes para generar contenidos, el usuario juega el doble papel de creador y consumidor de los mismos. Este hecho, segĂşn los autores, otorga una â&#x20AC;&#x153;naturaleza demo-­ FUiWLFDÂľ D OD :HE  TXH VH HMHPSOLĂ&#x20AC;FDUtD SRU ODV FUHDFLRQHV del gran nĂşmero de grupos especializados que pueden cambiar el contenido de cualquier tipo (texto, audio, vĂ­deo), etiquetarlo, comentarlo y enlazarlo. Citan como una de las innovaciones mĂĄs populares a los mashups, una aplicaciĂłn que permite uti-­ lizar, combinar o presentar contenidos en formas novedosas. Se experimenta con mashups utilizando una interfaz de pro-­ JUDPDFLyQGHDSOLFDFLRQHVR$3,HQ<RX7XEH*RRJOHR)OLFNU entre otras. Â&#x2021; La estructura: El diseĂąo de una pĂĄgina en la Web 1.0 estaba estructurado de una forma jerĂĄrquica, con una portada que lle-­ va a subpĂĄginas distintas, aumentada por enlaces cruzados y las funciones de bĂşsqueda. La Web 2.0 tiene una estructura mĂĄs parecida a la de las redes sociales: dispone de herramien-­ tas que la hacen compatible con otras aplicaciones y el entorno debe ser dinĂĄmico y en constante evoluciĂłn para incentivar el interĂŠs por parte de los usuarios. Â&#x2021; La sociologĂ­a: Mediante una comparativa entre los sitios Web 1.0 y Web 2.0 mĂĄs populares se pueden analizar una serie de GDWRVUHOHYDQWHVVREUHHOSHUĂ&#x20AC;OGHXVXDULRFRPRODHGDGJXV-­ WRVDĂ&#x20AC;FLRQHVHQWRUQRJHRJUiĂ&#x20AC;FRVLSDUDLQWHJUDUVHHQXQDUHG social se dan de alta o acceden mediante solicitud de amistad, grupos o suscripciones, el uso que hacen de las redes, el impac-­ WRODIUHFXHQFLDODĂ&#x20AC;QDOLGDG\HQGHĂ&#x20AC;QLWLYDHOJUDGR\WLSRGH conectividad de una red social. Los autores deD este estudio OOHJDQDODFRQFOXVLyQTXHORVVLWLRV:HE )DFHERRN<RX7X-­ EH )OLFNU /LYH-RXUQDO \ 0\6SDFH  VXSHUDQ DPSOLDPHQWH HQ capacidad para interactuar a los sitios Web 1.0. 76


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

Este anĂĄlisis de Cormode y Krishnamurthy, ha constituido un re-­ ferente muy importante a la hora de anticipar el ĂŠxito de las redes sociales en los Ăşltimos aĂąos, al seĂąalar las actitudes y valores rela-­ cionados con la participaciĂłn, cercanĂ­a y el diĂĄlogo directo, que en el ĂĄmbito de la polĂ­tica darĂ­an lugar al concepto PolĂ­tica 2.0. Fumero (2006) seĂąala que para comprender la Web 2.0 debe par-­ tirse de una modelizaciĂłn previa tratando de no perder ningĂşn HOHPHQWR GH OR TXH VH PDQLĂ&#x20AC;HVWD FRPR XQD UHDOLGDG GLYHUVD \ compleja. Y para ello recurre al el modelo de complejidad deno-­ PLQDGR2,73TXHUHĂ&#x20AC;HUHDORVFXDWURHOHPHQWRV RGLPHQVLRQHV D considerar en una situaciĂłn de complejidad: lLa OrganizaciĂłn (O), que considerarĂĄ la estructura funcional y orgĂĄnica de la empresa, estructuras de poder, circuitos de decisiĂłn, etc.; los Individuos (I), que englobarĂ­a al resto de personas no consideradas en la Organi-­ zaciĂłn; la TecnologĂ­a (T), que comprende los propios objetos tecno-­ lĂłgicos, los mĂŠtodos, tĂŠcnicas y a los propios tĂŠcnicos; y los Procesos de negocio(P), que representarĂĄn la actividad de la empresa. Considera que este modelo permite ubicar a la Web 2.0 dentro de algo mucho mĂĄs grande, denominado â&#x20AC;&#x153;Nuevo Entorno Tecnosocialâ&#x20AC;? (NET), en el que las redes sociales se constituyen como principio y/o estructura organizativa, donde los nativos digitales se incorporan HQODVRUJDQL]DFLRQHV\PHUFDGRVGHFRQVXPR\Ă&#x20AC;QDOPHQWHFRQOD FRQIRUPDFLyQ\GHQVLĂ&#x20AC;FDFLyQGHOD5HG8QLYHUVDO'LJLWDOFRPRLQ-­ fraestructura infotecnolĂłgica. Este hecho ha provocado que la Web 2.0 irrumpiese con fuerza en los medios de comunicaciĂłn tanto en los generalistas como los especializados, con una proliferaciĂłn de referencias positivas a Internet inĂŠditas en aquel momento. Este entorno favorable estĂĄ provocando que cada vez haya mĂĄs gente que vive un porcentaje mayor de su tiempo en lo que SĂĄez Vacas (2005) ha denominado la â&#x20AC;&#x153;infociudadâ&#x20AC;?, un espacio informa-­ cional donde los humanos de sociedades desarrolladas, mediante WHUPLQDOHVFRQERWRQHVWHFODVSDQWDOODVFRQWUDVHxDVHLGHQWLĂ&#x20AC;FD-­ 77


Adolfo Ă lvaro MartĂ­n

dores varios, se comunican y realizan una parte creciente de sus actividades habituales y otras muchas nuevas, convertidas en se-­ Ăąales, sĂ­mbolos, lenguajes y procesos inmateriales, soportados por una potente infraestructura tecnolĂłgica de arquitectura reticular. Con ello, las personas y las empresas estĂĄn trasladando sus acti-­ vidades al mundo digital, no limitĂĄndose a procesos econĂłmicos, administrativos o comerciales, pues tambiĂŠn se estĂĄ produciendo en las relaciones humanas y en el ocio. El resultado de este proceso es que a medida que aumenta el grado de digitalizaciĂłn social, una parte de los ciudadanos va emigrando hacia la condiciĂłn de â&#x20AC;&#x153;info-­ ciudadanosâ&#x20AC;?, mientras que otra parte se mantiene mĂĄs resistente a ello o no acepta esa emigraciĂłn-­transformaciĂłn (Fumero y SĂĄez Vacas, 2006). A la vista de lo expuesto, la evoluciĂłn de la Web hacia formas cola-­ borativas ha constituido un valor positivo y diferencial en la Socie-­ dad de la InformaciĂłn, contribuyendo a enriquecer la interacciĂłn del usuario con las herramientas y sus contenidos. Sin embargo, han surgido voces discordantes sobre el presente de la Web 2.0., pues aunque desde gran parte de los medios de comunicaciĂłn y las agencias de relaciones pĂşblicas de las compaùías tecnolĂłgicas se insista en las bondades de las nuevas herramientas y cĂłmo su uso mejorarĂĄ la vida cotidiana de las personas, no deberĂ­a olvidarse que existe un negocio que gira alrededor de la obsolescencia pla-­ QLĂ&#x20AC;FDGD\GHODUHFUHDFLyQFRQVWDQWHGHSURGXFWRV\DSOLFDFLRQHV en la que una parte importante de la industria estĂĄ implicada en asegurarse mercados cautivos. En este entorno, el consumidor / ciudadano pierde capacidad de elecciĂłn, al ser continuamente lle-­ vado a realizar interpretaciones simplistas y exultantes sobre las tecnologĂ­as, pues las mejores tecnologĂ­as y usos para el bien pĂşbli-­ FRQRVLHPSUHFRQVWLWX\HQODVPHMRUHVSDUDHOEHQHĂ&#x20AC;FLRHPSUHVD-­ ULDO .XNOLQVNL  Soderqvist y Bard (2003), seĂąalan que estamos pasando del ca-­ pitalismo al â&#x20AC;&#x153;informacionalismoâ&#x20AC;?, un nuevo paradigma cuya clase 78


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

GRPLQDQWH HV OD ´QHWRFUDFLDÂľ TXH XWLOL]D HQ VX SURSLR EHQHĂ&#x20AC;FLR los elementos clĂĄsicos de la burguesĂ­a: la identidad individual, la responsabilidad social, la democracia representativa, el proceso legislativo, el sistema bancario o los mercados de valores. Y como nos encontramos en un entorno en el que disponemos de una gran cantidad de datos pero carecemos de una visiĂłn general, no dis-­ ponemos de una perspectiva para entender lo que nos pasa como sociedad polĂ­tica, quedando en manos de esta nueva ĂŠlite que nos impondrĂ­a su punto de vista. La netocracia nos colmarĂĄ de infor-­ maciĂłn sabiendo que, como nuestro tiempo es cada vez menor, de-­ jaremos que ellos mismos la interpreten y la transformen en cono-­ cimiento fĂĄcilmente digerible. La sobreabundancia de informaciĂłn serĂ­a uno de los efectos contraproducentes de esta era tecnolĂłgica donde Internet es la estrella. Esta idea del exceso de informaciĂłn ya fue expuesta a principios del aĂąo 2000 por Alfons Cornella, quiĂŠn creĂł el termino â&#x20AC;&#x153;infoxica-­ ciĂłnâ&#x20AC;? para referirse a la fascinaciĂłn por la informaciĂłn excesiva (y PXFKDVYHFHVVXSHUĂ XD TXHUHFLELPRVORVFLXGDGDQRV(VWHH[FHVR de informaciĂłn, de intoxicaciĂłn informacional, hace que se dispon-­ ga de mĂĄs datos de los que se pueden procesar, y como consecuen-­ cia de ello surge un problema que no es de Ă­ndole tecnolĂłgica sino de orden cultural y/o sociolĂłgico. Un problema basado en la angus-­ tia de disponer de mĂĄs informaciĂłn de la que se puede manejar que, ademĂĄs, no puede ser controlada por mucha tecnologĂ­a que se genere para manejar ese exceso. Y por muy Ăştil que pueda resul-­ tar la Web 2.0 respecto a conocimientos, eventos, noticias o redes sociales, continuarĂĄ habiendo un punto en el que el individuo no SRVHHUiORVĂ&#x20AC;OWURVFRJQLWLYRVRWHFQROyJLFRVSDUDKDFHUIUHQWHDOD diversidad y a la cantidad de estĂ­mulos. En consecuencia, Soderqvist y Bard nos seĂąalan que las personas solo actĂşan y evalĂşan la realidad desde la percepciĂłn de lo que se recibe desde los grandes medios, lejos del pequeĂąo entorno (el Ăşnico del que se puede obtener una impresiĂłn directa) en el que 79


Adolfo Ă lvaro MartĂ­n

ODVSURSLDVSHUVRQDVYLYHQ´1RVFUHDPRVĂ&#x20AC;FFLRQHV\PRGHORVVLP-­ SOLĂ&#x20AC;FDGRVGHFyPRIXQFLRQDHOPXQGR  YLYLPRVXQDFUyQLFD\ perpetua falta de informaciĂłnâ&#x20AC;? (2003: 4). Nada indica que las apli-­ caciones Web 2.0 contribuyan a prevenir esa indigencia informa-­ tiva. A priori, la funcionalidad de Google, las etiquetas y el XML, entre otras tecnologĂ­as, pueden contribuir a cierto orden, aunque en muchos casos es la ilusiĂłn de un orden de los grandes nodos, relegando a la invisibilidad a los pequeĂąos emisores crĂ­ticos. En la netocracia no existen representaciones mediĂĄticas del poder porque estĂĄ directamente en ella. No son los actores polĂ­ticos los que deciden las acciones en democracia, puesto que los polĂ­ticos son meros productores, los votantes consumidores y los medios de comunicaciĂłn se han apropiado del papel de guardianes en la are-­ na polĂ­tica. (VWD QXHYD pOLWH KD VLGR GHĂ&#x20AC;QLGD SRU .URNHU   FRPR ´FODVH virtualâ&#x20AC;?, y estarĂ­a compuesta por aquellas personas que proponen excluir del escenario cualquier visiĂłn que no sea eufĂłrica con res-­ pecto al uso de las nuevas tecnologĂ­as y a la consolidaciĂłn de una VRFLHGDGWHFQROyJLFDVLQPiVREMHWLYRTXHHOEHQHĂ&#x20AC;FLRHFRQyPLFR\ la acumulaciĂłn de poder: â&#x20AC;&#x153;En contra de la justicia econĂłmica, la clase virtual practica una mezcla de capitalismo predatorio y dedicadas racionaliza-­ ciones tecnocrĂĄticas para devastar las preocupaciones sociales por el empleo, mediante apremiantes demandas de reestructu-­ raciĂłn de la economĂ­a, de polĂ­ticas pĂşblicas de ajustes laborales \GHUHGXFFLyQGHOGpĂ&#x20AC;FLWGHVWLQDGDVWRGDVDODPi[LPDUHQWD-­ ELOLGDGÂľ .URNHU  â&#x20AC;&#x153;En esta mitologĂ­a de la nueva frontera tecnolĂłgica, la sociedad contemporĂĄnea o bien estĂĄ equipada para recorrer a toda velo-­ cidad los carriles principales de la autopista de la informaciĂłn o bien deja simplemente de existir como miembro activo de la tecno-­utopĂ­a. Como claman triunfalmente los directores gene-­ 80


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

rales y asesores especializados de la clase virtual: te adaptas o HUHVKRPEUHPXHUWRÂľ .URNHU  (VWDV LGHDV FUtWLFDV OOHYDQ D .XNOLQVNL RE FLW  D SODQWHDUVH HO concepto de la serendipia, que hace referencia a descubrimientos no previstos a partir de la mĂşltiple bĂşsqueda y combinaciĂłn de IXHQWHVGHLQIRUPDFLyQ/DSDODEUDVHUHQGLSLDVLJQLĂ&#x20AC;FD´DFFLGHQ-­ te afortunado que lleva hacia un descubrimientoâ&#x20AC;?. La capacidad de computaciĂłn y combinaciĂłn de grandes volĂşmenes de informa-­ ciĂłn favorece la serendipia. Es casi un sinĂłnimo de la coincidencia (Green, 2004). Se hacen valiosos descubrimientos mientras se ma-­ nipula informaciĂłn en bĂşsqueda de alguna otra cosa. El ciudadano debe tambiĂŠn tener la capacidad de enfrentarse con informaciĂłn no prevista, y el concepto de serendipia le ayudarĂĄ a fortalecer la construcciĂłn de su imaginario ante las cosas, pues el incremento de la velocidad en el acceso y el procesamiento de la informaciĂłn QRKDFHDODVSHUVRQDVQHFHVDULDPHQWHPiVHĂ&#x20AC;FLHQWHV0XFKDVYH-­ FHVODVLGHDVĂ X\HQHQ´IRUPDWRSRVWÂľSURPRYLHQGRSHQVDPLHQWRV efĂ­meros, como esloganes, que tienen fecha de caducidad y que van dirigidos a pĂşblicos carentes de tiempo de atenciĂłn que, por ende, QR GLVSRQHQ GH FDSDFLGDG SDUD OD UHĂ H[LyQ PDGXUD 6H YLYH VH consume y se piensa en formato beta, un tipo de pensamiento de FRUWRDOFDQFHTXHGLĂ&#x20AC;FXOWDGLVWLQJXLUHQWUHFRQRFLPLHQWR\UXLGR Sunstein seĂąala que la libertad â&#x20AC;&#x153;no solo consiste en satisfacer las preferencias, sino tambiĂŠn en la oportunidad de tener preferencias y creencias formadas en condiciones decentes, (...) formadas tras KDEHUHVWDGRH[SXHVWRVDXQDFDQWLGDGVXĂ&#x20AC;FLHQWHGHLQIRUPDFLyQ y tambiĂŠn a una cantidad adecuadamente amplia y variada de opciones.â&#x20AC;? (2003: 56). Para ello considera imprescindible que â&#x20AC;&#x153;un sistema de libertad de expresiĂłn que funcione bien debe contar con que: 1) Los individuos deben entrar en contacto con materia-­ les que no deben haber elegido previamente. Los encuentros no SODQLĂ&#x20AC;FDGRV\VLQFLWDSUHYLDVRQSULPRUGLDOHVSDUDODGHPRFUDFLD en sĂ­ misma. 2) Una sociedad heterogĂŠnea que no comparte expe-­ 81


Adolfo Ă lvaro MartĂ­n

ULHQFLDVWHQGUiPiVGLĂ&#x20AC;FXOWDGHVSDUDHQIUHQWDUVHDORVSUREOHPDV sociales.â&#x20AC;? (Sunstein: 2003: 20). /DIDOWDGHWLHPSRGHORVFLXGDGDQRVSDUDXQDUHĂ H[LyQPDGXUD genera un entorno en el que predominan ideas de corto alcance, donde los bullshitters (charlatanes) encuentran un caldo de cultivo LGHDOSDUDVXGHVDUUROOR6HJ~Q)UDQNIXUW  XQRGHORVUDVJRV mĂĄs destacados de nuestra cultura es la gran cantidad de bullshit que se da en ella, a los que todos contribuimos de una forma u otra, sin apenas darnos cuenta. El bullshit solo propone palabras o acciones pretenciosas sin ningĂşn deseo de contrastarse con la YHUGDGSURYRFDQGRXQLPSRUWDQWHGHWHULRURGHODFRQĂ&#x20AC;DQ]DHQORV grupos de poder (polĂ­ticos, funcionarios, periodistas, eclesiĂĄsticos, empresarios, medios, etc.). El bullshit â&#x20AC;&#x153;no se inventa para inculcar al oyente una falsa creencia acerca de un estado de cosas, sino que su intenciĂłn principal es presentarle a ĂŠste una falsa impresiĂłn de lo que pasa por la mente del hablanteâ&#x20AC;? (2006: 23). En relaciĂłn al papel que juegan los bullshitters, es interesante analizar la parodia de deliberaciĂłn que promueven estos actores, fortaleciendo escenarios y foros que no se escuchan mutuamente, pero que les permiten crear y liderar opiniĂłn pĂşblica aĂşn a pesar GHVXHVFDVDĂ&#x20AC;DELOLGDGORTXHSHUPLWHSURSDJDU\DPSOLDUHUURUHV FRJQLWLYRVHQODVRFLHGDG(QGHĂ&#x20AC;QLWLYDHOEXOOVKLWSXHGHGDxDUOD nociĂłn de escritura colectiva, pues la ausencia de toda conexiĂłn VLJQLĂ&#x20AC;FDWLYD HQWUH ODV RSLQLRQHV GH XQD SHUVRQD \ VX SHUFHSFLyQ de la realidad serĂĄ todavĂ­a mĂĄs grave para alguien que crea en su responsabilidad, como agente moral consciente, para valorar acon-­ tecimientos y condiciones en cualquier parte del mundo (Sunstein, 2006). Carr (2005) continĂşa esta lĂ­nea de opiniĂłn y considera que la ma-­ yorĂ­a de las herramientas de la Web 2.0 solo sirven para crear FRPXQLGDGHV\H[SHULHQFLDVGHSURGXFFLyQQRSURIHVLRQDOSRFRĂ&#x20AC;D-­ bles, que no aportan calidad alguna a nivel de contenidos. Llega 82


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

cuestionar uno de los pilares de la Web 2.0, al preguntarse si sus efectos prĂĄcticos sobre la cultura y la sociedad podrĂ­an ser perjudi-­ FLDOHVHQYH]GHEHQHĂ&#x20AC;FLRVRVWDO\FRPRDSXQWDODFUHHQFLDJHQHUDO 3RQH FRPR HMHPSOR OD :LNLSHGLD D OD TXH DFXVD GH LPSHUIHFWD FXDMDGDGHGHIHFWRV\SRUHQGHSRFRFRQĂ&#x20AC;DEOH/D:LNLSHGLDQR serĂ­a mĂĄs que un espacio de escritura con libertad editorial y una LQWHOLJHQWHHVWUDWHJLDPHULWRFUiWLFDGHHGLFLyQĂ&#x20AC;QDO )LQDOPHQWH.HHQ  PDQLĂ&#x20AC;HVWDXQDSURIXQGDFUtWLFDKDFLDODV consecuencias de la escritura masiva que propone la Web 2.0. La base de su anĂĄlisis se encuentra en la acusaciĂłn de que solo profe-­ sionales y editores tendrĂ­an la capacidad de producir, seleccionar informaci��łn y emitir contenidos en la industria cultural. El culto a lo amateur que se vive hoy en la red, asĂ­ como la producciĂłn masiva de contenidos resultante, perpetĂşa un nuevo ciclo de des-­ informaciĂłn que distorsiona y corrompe la conversaciĂłn cĂ­vica: â&#x20AC;&#x153;La UHYROXFLyQ:HEHVWiOOHYiQGRQRVDXQDVXSHUĂ&#x20AC;FLDOREVHUYDFLyQ de la realidad mĂĄs que a un profundo anĂĄlisis, a una estridente opiniĂłn mĂĄs que a un juicio de calidad. Un caos que oculta la in-­ formaciĂłn Ăştilâ&#x20AC;? (2007: 23). Keen hace un detallado relato de malas prĂĄcticas en el uso de las herramientas de escritura colaborativa y cuestiona la ĂŠtica de la Web 2.0. 6LQHPEDUJRFRPRVHxDOD.XNOLQVNL REFLW HOGHEDWHVHUtDPiV apropiado si se llevase a cabo sin tanta fascinaciĂłn o alarmismo. Ni los editores son los protectores de nuestra cultura (argumento segĂşn el cual si una persona se pone a producir sin revisiĂłn edito-­ rial la calidad decaerĂ­a estrepitosamente), ni los contenidos de la Web 2.0 son la revoluciĂłn mediĂĄtica que liberarĂĄ a los ciudadanos de los intermediarios, construyendo mejores sociedades. Considera incorrecto juzgar a toda la producciĂłn Web 2.0 como amateur, pues se trata de una plataforma en la que conviven mĂşltiples modelos de producciĂłn. Es cierto que existe mucho bullshit, asĂ­ como peli-­ grosas formas de narcisismo digital que fragmenta el consumo de 83


Adolfo Ă lvaro MartĂ­n

ideas, con internautas que se enlazan mutuamente segĂşn sus opi-­ niones concordantes, lo que fragmenta la cultura comunitaria en individuos aislados que crean una subcultura local sin relaciĂłn con otras ideas. Como hemos indicado antes, la realidad es cambiante, diversa, y estĂĄ imbuida por los valores culturales del momento. 3RUHVWRHVTXHFXDOTXLHUVLVWHPDVLPSOHGHFODVLĂ&#x20AC;FDFLyQRHGLFLyQ genera problemas de comprensiĂłn cultural y falta de sintonĂ­a con ODFRQĂ&#x20AC;JXUDFLyQGHODSURSLDQDWXUDOH]DGHODVFRVDV6HxDOD:HLQ-­ berger (2007: 147): â&#x20AC;&#x153;El conocimiento no estĂĄ en nuestra cabeza, sino entre nosotros. Emerge desde el pensamiento pĂşblico y social, porque la conversaciĂłn y el conocimiento social derivado de ella QXQFDĂ&#x20AC;QDOL]DÂľ&RQHVDOyJLFDGHODFRQYLYHQFLDGHYDULRVPRGH-­ los de producciĂłn-­, tanto el profesional de los medios de comuni-­ caciĂłn tradicional como el nuevo de las herramientas de escritura FRODERUDWLYDSXHGHQFRQYLYLU\UHFRQĂ&#x20AC;JXUDUVHPXWXDPHQWHSDUD evolucionar hacia nuevas prĂĄcticas sociales. 2.3 Nativos digitales y polĂ­tica 2.3.1 Nuevas ideas y nuevas herramientas -XDQ )UHLUH   DĂ&#x20AC;UPD HQ VX EORJ QyPDGD TXH OD WHFQRORJtD estĂĄ permitiendo eliminar las barreras que impiden el intercambio de ideas y opiniones en las sociedades contemporĂĄneas, a lo que denomina â&#x20AC;&#x153;conversaciĂłnâ&#x20AC;?. Y estas â&#x20AC;&#x153;conversacionesâ&#x20AC;? constituyen la esencia de la democracia que existiĂł hace siglos en algunas partes GHO PXQGR TXH VH SHUGLy D FDXVD GHO FUHFLPLHQWR GHPRJUiĂ&#x20AC;FR \ el desarrollo de las agregaciones urbanas, y que tuvo como con-­ secuencia la ausencia de comunicaciĂłn tradicional y la apariciĂłn de los medios de masas. La tecnologĂ­a habrĂ­a permitido recuperar esa participaciĂłn ciudadana gracias a las herramientas de la Web TXHDOHMDQDOFLXGDGDQRGHODĂ&#x20AC;JXUDSDVLYDGHFRQVXPLGRU\ espectador. Varela (2006) seĂąala que para que las herramientas tecnolĂłgicas puedan salir de la deliberaciĂłn y convertirse en polĂ­tica real, es 84


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

necesario que los ciudadanos superen las prĂĄcticas tradicionales impuestos por los agentes polĂ­ticos. Opina que gracias a los blogs, los medios sociales y las redes, se produce un impulso de la demo-­ cracia que permite abandonar el concepto de sĂşbdito y se recupera el de ciudadano: â&#x20AC;&#x153;La ciberpolĂ­tica necesita no solo cambiar la cul-­ tura de la polĂ­tica y encontrar una estrategia de implicaciĂłn real SDUD VHU ~WLO VLQR TXH WDPELpQ GHEH VHU FDSD] GH GHĂ&#x20AC;QLU HO FRQ-­ junto de valores e intereses que puedan conformar un bien pĂşblico compartido por sus practicantes y ser capaz de atraer al resto de ciudadanosâ&#x20AC;?. Esta decisiĂłn de recuperar la palabra y la acciĂłn por parte de los ciudadanos, ya fue augurada por John Perry Barlow en su Decla-­ raciĂłn de Independencia del Ciberespacio de 1996: â&#x20AC;&#x153;Gobiernos del Mundo Industrial (â&#x20AC;Ś) vengo del ciberespacio, el nuevo hogar de la Mente (â&#x20AC;Ś). Vosotros no tenĂŠis sobera-­ nĂ­a sobre nosotros. No estĂĄis involucrados en nuestra gran conversaciĂłn. Estamos creando un mundo donde cualquiera en cualquier lugar pueda expresar sus creencias, no importa lo singulares que sean, sin miedo de ser forzado al silencio o la conformidad. Vuestros conceptos de propiedad, expresiĂłn, identidad, movimiento y contexto no se aplican para nosotrosâ&#x20AC;?. Esta declaraciĂłn de principios ha servido de base de acciĂłn para muchos de los movimientos que hoy nos resultan familiares, como el surgido a favor del copyleft, que plantea superar el concepto eli-­ tista de la cultura, para hacerla mĂĄs participativa y permitir a los ciudadanos trabajar colectivamente y dar a conocer otras fuentes GHH[SUHVLyQWDO\FRPRORGHĂ&#x20AC;HQGHQORVPLHPEURVGHODFRPXQL-­ dad Linux y el Software Abierto. Sin embargo, Freire (ob. cit.) cree que no debemos caer en el opti-­ PLVPRLUUHĂ H[LYRDODKRUDGHFRQVLGHUDUHOSRGHUGHODEORJRVIHUD y de las redes sociales digitales. En primer lugar debemos com-­ prender su topologĂ­a y su estructura para, despuĂŠs, aplicar la teo-­ 85


Adolfo Ă lvaro MartĂ­n

UtD\UHVXOWDGRV(VWDUHĂ H[LyQQRVSHUPLWLUiFRQRFHUODVGLIHUHQ-­ cias entre las redes analĂłgicas y las digitales, pues estas Ăşltimas parecen presentar una tipologĂ­a de escala donde importa tanto el Q~PHURGHHQODFHVGHXQEORJFRPRODFDSDFLGDGGHLQĂ XHQFLDGH HVWRVHQODFHVHQRWURVQRGRV$OUHVSHFWR\VREUHODLQĂ XHQFLDGH la blogosfera, alerta que su comportamiento puede caer en un pro-­ ceso de endogamia y exageraciĂłn. Aunque el mundo de los blogs pueda ser muy relevante en cuanto a la calidad, ya que los blogue-­ URVSXHGHQVHUQRGRVPX\DFWLYRVHLQĂ X\HQWHVTXHVHUHODFLRQDQ FRQRWURVQRGRVLQĂ X\HQWHVGHQWUR\IXHUDGHODEORJRVIHUDQRHV menos cierto que siguen siendo un fenĂłmeno limitado en cuanto a la cantidad de enlaces que provocan en la red. Freire achaca el ĂŠxito de la blogosfera y las redes sociales a que siguen el modelo de â&#x20AC;&#x153;red libre escalaâ&#x20AC;? (a diferencia de otras redes, esta muestra una distribuciĂłn de grado de ley de potencia libre de escala) y presentan caracterĂ­sticas del experimento small world (de bĂşsqueda de personas muy conectadas). Estas dos caracterĂ­sti-­ cas les permiten contraponerse a las redes jerĂĄrquicas tradiciona-­ les de las sociedades predigitales y constituyen la causa por la que, aunque el nĂşmero de blogueros y de lectores de sus blogs es relati-­ YDPHQWHSHTXHxRVXFDSDFLGDGGHLQĂ XHQFLDVRFLDO\UHSHUFXVLyQ mediĂĄtica es creciente. La capacidad de disponer de enlaces muy LQĂ X\HQWHVHVORTXHSHUPLWHDODEORJRVIHUDGLVSRQHUGHXQDUHG FRQXQDLQĂ XHQFLDPX\VXSHULRUDODTXHVXWDPDxRSRGUtDKDFHU suponer. Esta capacidad de la blogosfera, bien en su globalidad bien en las mĂşltiples redes de blogs organizadas temporalmente para objetivos concretos, nos acercarĂ­a al concepto de â&#x20AC;&#x153;micropode-­ res en el mundo hiperpolarâ&#x20AC;? de MoisĂŠs NaĂ­m. 1DtP  SRQHGHPDQLĂ&#x20AC;HVWRODSUROLIHUDFLyQGHPLFURSRGHUHV que estĂĄn siendo capaces de restringir la autonomĂ­a y capacidad de maniobra de los megapoderes tradicionales. Cree que hemos pasado del mundo bipolar engendrado en la Guerra FrĂ­a, a una apariencia de lo que denomina â&#x20AC;&#x153;unipolaridadâ&#x20AC;? surgida tras la caĂ­-­ 86


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

da del muro de BerlĂ­n, que en realidad es un mundo multipolar donde juegan numerosas potencias de gran tamaĂąo (como Estados Unidos o la UniĂłn Europea) y actĂşan miles de poderes menores (corporaciones industriales, ONG, grupos terroristas y ciudadanos individuales o pequeĂąos grupos organizados en red). Esta tenden-­ cia, donde unos actores logran concentrar con mucha rapidez una enorme fuerza, y los megapoderes tradicionales ven continuamen-­ te contestada su hegemonĂ­a, es visible en todas las facetas de la vida humana. El poder es mĂĄs efĂ­mero que nunca y muy difĂ­cil de ejercer, por lo que la inestabilidad serĂĄ una de las caracterĂ­sticas de esta nueva ĂŠpoca: â&#x20AC;&#x153;Un mundo asĂ­ ofrece muchas oportunidades para lo pequeĂąo, ya sea un paĂ­s, una nueva empresa o un individuo con talento. Pero dichas oportunidades surgen a costa de algo, y en este caso el precio es la estabilidad. Independientemente de que XQRSUHĂ&#x20AC;HUDD'DYLGRD*ROLDWODFRPSOHMDUHODFLyQGHPHJDSRGH-­ res y micropotencias engendra un mundo mĂĄs volĂĄtil y divididoâ&#x20AC;?. El desarrollo de la Web 2.0 y las distintas herramientas de ci-­ beractivismo que se han implementado gracias a sus utilidades, han generado un debate sobre las oportunidades que supondrĂ­a la pluralidad de formas como blogs, foros o redes sociales, que da-­ rĂĄn la oportunidad de que puedan visibilizarse muchos pĂşblicos marginados. Dentro de esta nueva corriente de ciberoptimistas encontrarĂ­amos a Dahlgren (2005), quien considera que Internet extiende y pluraliza la esfera pĂşblica en un buen nĂşmero de vĂ­as \IDFLOLWDXQDJUDQKHWHURJHQHLGDGFRPXQLFDWLYD%HQNOHU   cree, ademĂĄs, que Internet genera fuentes de informaciĂłn propia, lo que posibilita compartir conocimientos y experiencias que conso-­ lidan una esfera pĂşblica digital. En este sentido, Friedland, Hove y Rojas (2006) consideran que las formas de comunicaciĂłn en red facilitarĂĄn la conexiĂłn entre nodos diversos, por lo que Internet proveerĂĄ de medios que favorecerĂĄn la democracia deliberativa, al permitir que pĂşblicos subalternos encuentren espacios comparti-­ dos (Simone, 2008). 87


Adolfo Ă lvaro MartĂ­n

Por otro lado, el uso de Internet como dispositivo para la actua-­ ciĂłn polĂ­tica ha generado otro debate sobre el alcance del espacio digital que, incluso, estarĂ­a provocando un cambio en la propia na-­ turaleza de las movilizaciones. Se establecerĂ­a una nueva relaciĂłn entre los coordinadores de la protesta y los activistas individuales, quienes cada vez mĂĄs usan sus propias redes polĂ­ticas para convo-­ car a la acciĂłn. En este contexto las convocatorias serĂ­an promovi-­ GDVSRUUHGHVGHFRQĂ&#x20AC;DQ]DFRPRRFXUULyFRQODVPDQLIHVWDFLRQHV FRQWUD OD JXHUUD GH ,UDN HQ  JHQHUDQGR QXHYDV IRUPDV GH movilizaciĂłn que serĂ­an mĂĄs descentralizas y cada vez menos so-­ metidas a los actores polĂ­ticos tradicionales. Como consecuencia, VXUJLUtDXQQXHYRWLSRGHDFWLYLVWDVFRQXQDLGHQWLĂ&#x20AC;FDFLyQSROtWLFD Ă H[LEOH\XQLGRVDWUDYpVGHUHGHVFRQPHQRUHVWHQVLRQHVLGHROy-­ gicas (Bennett et al., 2008). Este nuevo modelo de protesta, segĂşn Sampedro Blanco (2005), estarĂ­a originado a partir de estilos de vida en comĂşn y en el que la forma de movilizarse tendrĂ­a que ver mĂĄs con aspectos expresivos que sustantivos y en los que, en bas-­ tantes ocasiones, mĂĄs que el cambio social se estarĂ­a buscando la visibilizaciĂłn, la necesidad de ser tenidos en cuenta. Frente a ellos se alzarĂ­an los ciberpesimistas, como el caso de Galston (2003), que frente a quienes ensalzan las posibilidades de Internet para permitir nuevas formas de comunicaciĂłn, alerta del riesgo de que pueda terminar siendo un conjunto de islas de comunicaciĂłn polĂ­tica donde llegarĂ­an a formarse ciberguetos. En esta misma lĂ­nea (Steiner, 2005), denuncia que dentro de la Red siempre se va a producir la exclusiĂłn de los grupos que sean con-­ trarios a los valores dominantes. En cuanto a las nuevas formas de activismo que podrĂ­an estarse generando gracias a Internet, Tilly (2004) y Tarrow (2005) interpretan que estas redes de ac-­ tivismo a travĂŠs de Internet pueden parecer impresionantes en escala, alcance y rapidez de la movilizaciĂłn, pero alertan de que VXVUHVXOWDGRV\HIHFWRVĂ&#x20AC;QDOHVSRGUtDQVHUPX\OLPLWDGRVGHELGR D VX FDUiFWHU H[SUHVLYR \ D OD LGHQWLĂ&#x20AC;FDFLyQ SROtWLFD Ă H[LEOH TXH 88


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

opera a travĂŠs de canales de comunicaciĂłn personal. Denuncian TXHHVWDVLWXDFLyQWUDHUtDHOĂ&#x20AC;QGHODDFFLyQFROHFWLYDFRPRKDVWD ahora la habĂ­amos conocido, que serĂ­a sustituida por individuos que se unen en momentos concretos, y de forma esporĂĄdica y varia-­ ble, para expresar sus preferencias polĂ­ticas, sociales y culturales. (QORV~OWLPRVDxRVGRVĂ&#x20AC;JXUDVKDQGHVWDFDGRSRUHQFLPDGHODV demĂĄs en su posiciĂłn escĂŠptica: Malcolm Gladwell y Evgeny Moro-­ ]RY*ODGZHOOSXEOLFyHQHQ7KH1HZ<RUNHUXQDUWLFXORGRQ-­ de llamaba â&#x20AC;&#x153;evangelistasâ&#x20AC;? a los defensores de las redes sociales y PLQXVYDORUDEDODLQĂ XHQFLDTXHWXYR7ZLWWHUHQODVUHYXHOWDVTXH WXYLHURQOXJDUHQHQ,UiQ$Ă&#x20AC;UPDTXHDXQTXHUHGHVVRFLDOHV FRPR)DFHERRNR7ZLWWHUVRQXQDJUDQIXHQWHGHQXHYDVLGHDVH informaciĂłn, el activismo asociado a las mismas se construye alre-­ dedor de lazos dĂŠbiles y, estos, rara vez conducen a un activismo de alto riesgo. Considera que si las redes sociales son efectivas para aumentar la participaciĂłn polĂ­tica, lo es solo porque disminuyen el nivel de motivaciĂłn que se requiere para participar: ´ ÂŤ  HO DFWLYLVPR GH )DFHERRN WLHQH p[LWR QR PRWLYDQGR D OD JHQWHDKDFHUXQVDFULĂ&#x20AC;FLRUHDOVLQRPRWLYiQGRORVDKDFHUFR-­ VDVTXHODJHQWHKDFHFXDQGRQRHVWiVXĂ&#x20AC;FLHQWHPHQWHPRWLYDGR SDUDKDFHUXQYHUGDGHURVDFULĂ&#x20AC;FLRÂľ Gladwell apunta otra distinciĂłn entre lo que ĂŠl considera activis-­ mo tradicional y el generado por las redes sociales: el activismo tradicional se basaba en lazos fuertes en estructura y carĂĄcter, con XQD MHUDUTXtD GHĂ&#x20AC;QLGD /DV UHGHV VRFLDOHV QR HVWiQ FRQWURODGDV por una sola autoridad central y los lazos que unen a las perso-­ nas del grupo son dĂŠbiles. Ello provoca que las redes sociales no estĂŠn preparadas para adoptar decisiones difĂ­ciles sobre tĂĄctica o estrategia, pues todos tienen el mismo poder y deben actuar por consenso. Incluso, cuando las revueltas en TĂşnez y Egipto estaban en pleno apogeo, Gladwell publicaba el 2 de febrero en The New <RUNHU 89


Adolfo Ă lvaro MartĂ­n

â&#x20AC;&#x153;(â&#x20AC;Ś) la gente ha estado protestando y derrocando gobiernos GHVGHPXFKRDQWHVGHODLQYHQFLyQGH)DFHERRN ÂŤ 5HFRUGH-­ mos que los franceses tomaron la Bastilla sin la ayuda de Twit-­ ter y que los bolcheviques tomaron el Palacio de Invierno sin WRPDUVHIRWRV\SXEOLFDUODVHQ)DFHERRNÂľ En esta misma lĂ­nea se encuentra Evgeny Morozov, periodista de origen bielorruso, que en enero de 2011 publicĂł The Net Delusion: 7KH'DUN6LGHRI,QWHUQHW)UHHGRPREUDTXHWXYRODPDODVXHUWH de ser publicado semanas antes de las movilizaciones que provo-­ caron los derrocamientos de los gobiernos en Egipto y TĂşnez, lo cual, ha puesto en entredicho gran parte de su contenido. En The Net Delusion rechaza lo que considera nociĂłn de poder liberador de las nuevas tecnologĂ­as y apunta que a menudo su efecto es el contrario. Denuncia que las redes sociales ni han hecho ni harĂĄn ninguna revoluciĂłn por sĂ­ mismas, alertando sobre la visiĂłn inge-­ nua de Internet que solo percibe su potencial liberador ignorando su lado oscuro, pues las TIC tambiĂŠn ofrecen nuevas posibilidades GH FRQWURO VRFLDO \ SXHGHQ UHIRU]DU GLFWDGXUDV PiV VRĂ&#x20AC;VWLFDGDV (QVXREUDVHUHĂ&#x20AC;HUHDODVPRYLOL]DFLRQHVGH,UiQHQGRQGH rebate que fuese la â&#x20AC;&#x153;RevoluciĂłn Twitterâ&#x20AC;?, indicando que segĂşn sus datos solo habĂ­a 60 cuentas activas de esta red durante el periodo de las revueltas. Finalmente, seĂąala que ese mismo software que tanta euforia provoca en los paĂ­ses occidentales, estĂĄ siendo utili-­ zado contra los jĂłvenes ciberactivistas en China o Rusia, poniendo como ejemplos que el gobierno ruso proporciona todo tipo de entre-­ WHQLPLHQWRJUDWLVHQ,QWHUQHWFRQODĂ&#x20AC;QDOLGDGGHGHVSROLWL]DUDOD juventud. En EspaĂąa, Albert Batlle es una de las voces mĂĄs representati-­ YDVGHODVSRVLFLRQHVFLEHUHVFpSWLFDV$Ă&#x20AC;UPDTXHODVWHRUtDVPiV optimistas se vienen abajo â&#x20AC;&#x153;en cuanto introducimos el supuesto de que la informaciĂłn es costosa y de que Internet no elimina los costes de obtener informaciĂłn polĂ­ticaâ&#x20AC;?, para llegar a la conclusiĂłn de que â&#x20AC;&#x153;las TIC no aumentan las capacidades comunicativas de los 90


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

individuos ni su interĂŠs por la polĂ­tica. Los principales usuarios de informaciĂłn polĂ­tica en Internet serĂĄn aquellos para quienes la inversiĂłn en la obtenciĂłn de una informaciĂłn costosa sea rentable: los individuos politizados y los intermediarios polĂ­ticosâ&#x20AC;? (Batlle, 2004). )UHQWH D HVWRV ~OWLPRV DUJXPHQWRV HO SURIHVRU GH OD 1HZ <RUN 8QLYHUVLW\ &OD\ 6KLUN\   VHxDOD TXH DO VHU OD VRFLDELOLGDG una de las caracterĂ­sticas fundamentales de los seres humanos, que se muestra en casi todas las facetas de nuestra vida como cau-­ sa y efecto de nuestras acciones, cualquier cambio que afecte a la forma en que funcionan y se forman los grupos tendrĂĄ consecuen-­ cias profundas para nuestras actividades cotidianas, desde el co-­ mercio al gobierno, pasando por los medios de comunicaciĂłn. Con las nuevas tecnologĂ­as, los costes de crear un grupo o unirse a uno ya existente prĂĄcticamente se han eliminado en la Ăşltima dĂŠcada, lo que permite que hoy podamos compartir, cooperar y empren-­ der acciones colectivas fuera de las instituciones y organizaciones tradicionales mucho mĂĄs exitosamente. Las barreras que existĂ­an para las acciones en grupo han desaparecido, y sin esas barreras las personas son libres para explorar nuevos modos de reunirse y hacer cosas. Con la red social, es posible llevar a cabo acciones por parte de grupos poco estructurados que actĂşan sin direcciĂłn y sin ODPRWLYDFLyQGHOEHQHĂ&#x20AC;FLR'HĂ&#x20AC;HQGHTXHKHUUDPLHQWDVFRPR)D-­ FHERRNR7ZLWWHUD\XGDQDORVFLXGDGDQRVTXHYLYHQHQUHJtPHQHV represivos a transmitir noticias reales, eludiendo la censura de los JRELHUQRVORTXHVLJQLĂ&#x20AC;FDHOĂ&#x20AC;QGHOFRQWUROGHODVQRWLFLDVGHDUULED hacia abajo, y por tanto un cambio en la naturaleza de la polĂ­tica 6KLUN\  Desde 2009 ha mantenido una polĂŠmica con Morozov, quien le ha llegado a acusar de ser â&#x20AC;&#x153;el hombre mĂĄs responsable de la confusiĂłn intelectual sobre el papel polĂ­tico de Internetâ&#x20AC;? (Morozov, 2009). En UHVSXHVWD6KLUN\VHxDODORVSXQWRVGpELOHVGHORVDUJXPHQWRVGH Morozov al seĂąalar que las redes sociales constituyen una nueva 91


Adolfo Ă lvaro MartĂ­n

dinĂĄmica dentro de la protesta polĂ­tica que altera de forma subs-­ tancial la lucha entre insurgentes y estados, pues si un pequeĂąo grupo estĂĄ dispuesto a movilizarse contra un rĂŠgimen, en caso de que las autoridades traten de silenciar o censurar a estos activis-­ tas las redes sociales habrĂĄn facilitado antes informaciĂłn sobre lo que ocurre a otros ciudadanos que en un primer momento no se unieron al grupo y que, como consecuencia de la acciĂłn represora, podrĂ­an unirse a nuevas protestas. Ello conlleva que un estado puede reaccionar contra los activistas e, incluso, censurar o limitar el uso de Internet, pero asumirĂĄ un importante coste polĂ­tico que puede llevarle a su plena deslegitimaciĂłn. Frente a las crĂ­ticas de 0RUR]RYVREUHODSRFDHĂ&#x20AC;FDFLDGHODVUHGHVVRFLDOHVHQ,UiQR0RO-­ GDYLD6KLUN\ VHxDODTXHODVQXHYDVKHUUDPLHQWDVVtGLHURQDORV ciudadanos nuevas capacidades para la organizaciĂłn y la acciĂłn, aunque les faltĂł convicciĂłn para conseguir el apoyo del resto de la SREODFLyQSRUORTXHODDFFLyQUHSUHVRUDGHOJRELHUQRĂ&#x20AC;QDOPHQWH tuvo ĂŠxito. En el caso de IrĂĄn, niega los datos de Morozov, e indica que en las protestas de 2009, Twitter actuĂł como complemento de los telĂŠfonos mĂłviles, de forma que la red social era la puerta de acceso a la atenciĂłn internacional de los hechos, y la telefonĂ­a el instrumento que facilitaba a los ciberactivistas enviarse mensajes, fotos o videos. La tecnologĂ­a permitiĂł difundir la informaciĂłn sobre el descontento general de forma exitosa, manteniendo la coordina-­ ciĂłn de los activistas incluso cuando el gobierno puso trabas al uso de Internet. Finalmente, destaca que en ambos caso, las revuel-­ tas nacieron de grupos pequeĂąos, formados por jĂłvenes con buena educaciĂłn, que gracias a la tecnologĂ­a consiguieron expandir las SURWHVWDVHQWUHDPSOLDVFDSDVGHODSREODFLyQ 6KLUN\E  Castells (2008) considera que las redes permiten la generaciĂłn de nuevos espacios para la coordinaciĂłn de la acciĂłn colectiva y la interconexiĂłn de diferentes movimientos sociales y grupos de la sociedad civil, como consecuencia de la evoluciĂłn hacia â&#x20AC;&#x153;movimien-­

92


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

tos sociales en redâ&#x20AC;?, basados en coaliciones que se constituyen en WRUQRDYDORUHV\SUR\HFWRV$Ă&#x20AC;UPDTXH,QWHUQHWHVODHVWUXFWXUD RUJDQL]DWLYD\HOLQVWUXPHQWRGHFRPXQLFDFLyQTXHSHUPLWHODĂ H-­ xibilidad y la temporalidad de la movilizaciĂłn, sin perder la coor-­ dinaciĂłn y la capacidad de enfoque de esa movilizaciĂłn. Respecto a las redes, cree que estas comunidades se constituyen cada vez mĂĄs como plataformas para la politizaciĂłn de demandas, que genera niveles de interacciĂłn muy fuertes. &LEHUDFWLYLVPR\´3ROtWLFDÂľ Respecto al concepto ciberactivismo, MartĂ­n Granados (2003) con-­ sideraba que es una tĂŠcnica de movilizaciĂłn que permitirĂ­a al ciu-­ dadano incrementar su participaciĂłn en las decisiones polĂ­ticas, mediante la creaciĂłn de canales alternativos de informaciĂłn para la creaciĂłn de eventos como manifestaciones o actos de protesta. 6LQHPEDUJR'DYLGGH8JDUWHGDUiXQJLURDHVWHFRQFHSWRDOGHĂ&#x20AC;-­ nir el ciberactivismo no como una tĂŠcnica sino como una estrategia: â&#x20AC;&#x153;Hacemos ciberactivismo cuando publicamos en la red â&#x20AC;&#x201C;en un blog o en un foro-­ buscando que los que lo lee avisen a otro â&#x20AC;&#x201C;en-­ lazando en sus propios blogs o recomendĂĄndoles la lectura por otros medios-­ o cuando enviamos un email o un SMS a otras personas con la esperanza de que lo reenvĂ­en a su lista de con-­ tactosâ&#x20AC;? (De Ugarte, 2007). Los ciudadanos convertidos en ciberactivistas, utilizan Internet y la blogsfera para difundir su discurso y poner a disposiciĂłn de los ciudadanos herramientas que les otorguen visibilidad y poder. El ciberactivista, segĂşn De Ugarte, forma parte de un proceso por el que la sociedad pasarĂ­a de organizarse en redes jerĂĄrquicas des-­ centralizadas a ordenarse en redes distribuidas igualitarias. â&#x20AC;&#x153;La potencia de las redes distribuidas solo pueden aprovecharla plenamente quienes creen en un mundo de poder distribuido \HQXQPXQGRDVtHOFRQĂ LFWRLQIRUPDWLYRDGRSWDODIRUPDGH 93


Adolfo Ă lvaro MartĂ­n

un swarming en el que los nodos van sincronizando mensajes hasta acabar propiciando un cambio en la agenda pĂşblica. Y, en el lĂ­mite, la movilizaciĂłn espontĂĄnea y masiva en las calles: la ciberturbaâ&#x20AC;? De Ugarte (ob. cit.). El concepto de ciberturba estĂĄ asociado a las tecnologĂ­as de la in-­ IRUPDFLyQ\ODFRPXQLFDFLyQFRQĂ&#x20AC;QHVSROtWLFRVRVRFLDOHVDXQTXH en los primeros momentos estuvo solapado con el concepto de mob RĂ DVKPRE'H 8JDUWH FUHH TXH HV OD FRQVHFXHQFLDOyJLFD GH XQ proceso de discusiĂłn social llevado a cabo por medios electrĂłnicos de comunicaciĂłn, que culmina con la movilizaciĂłn en la calle. El proceso tendrĂ­a una clara divisiĂłn entre la fase deliberativa y la de convocatoria y movilizaciĂłn en la calle. La primera suele ser amplia y no tiene visibilidad en los medios tradicionales de comu-­ nicaciĂłn. En los primeros aĂąos el proceso deliberativo se articulĂł en torno a los blogs como herramienta para la conversaciĂłn, sin embargo la tendencia es a que las redes sociales tengan cada vez un peso mayor en esta fase. Las ciberturbas nacen y generan la movilizaciĂłn desde la periferia de las redes informativas y, por consiguiente, no tienen un organizador responsable y estable con HOTXHHVFHQLĂ&#x20AC;FDUXQDFXHUGRRQHJRFLDFLyQ Los disturbios acaecidos en Francia en noviembre de 2005 (El Mundo, 2005), exponen claramente como la guerrilla en red surgiĂł espontĂĄneamente a partir de la repercusiĂłn social de los primeros HQIUHQWDPLHQWRV6HJHQHUDURQLQĂ&#x20AC;QLGDGGHQRGRVGHVGHEORJVLQ-­ terconectados entre sĂ­, que establecieron un canal de comunicaciĂłn donde convivieron elementos propios del swarming (blogs, mĂłvi-­ les, acumulaciĂłn rĂĄpida de conocimiento tĂŠcnico por conexiĂłn de nodos) con la ausencia de un discurso elaborado y una estrategia de poder (la reivindicaciĂłn no fue capaz de articular mĂĄs allĂĄ de la H[LJHQFLDGHGLVFXOSDVS~EOLFDVGH6DUNR]\ 'H8JDUWHFRQVLGHUD que las revueltas de noviembre en Francia constituyeron un swar-­ ming a escala nacional, que aunque se diluyĂł con rapidez, acreditĂł 94


Nativos Digitales, Redes Sociales y Política 2.0

una capacidad asombrosa para desarrollar un guerrilla urbana ba-­ sada en experiencias compartidas. En España, además de las movilizaciones del 13-­M a las que hare-­ mos referencia en el Capítulo III, podemos señalar como ejemplos de ciberturbas la celebración del “macrobotellón” convocado por Internet (El País, 2006) o el “Movimiento por una vivienda digna” (El Mundo, 2006). De Ugarte (ob. cit.), considera que hay dos formas de estrategia en el ciberactivismo: la primera, basada en la lógica de campaña y más próxima al activismo tradicional, que pretende construir y difundir una idea, así como proponer acciones. La segunda, bus-­ ca generar un debate social cuyas consecuencias pueden ser im-­ previsibles y que tendrá que desembocar en una ciberturba o en un nuevo consenso social. Esta segunda estrategia debe tener en consideración el hecho de que las ciberturbas son “reactivas”, es decir, suelen aparecer como respuesta a hechos traumáticos crea-­ dos o mal gestionados por las autoridades. Por tanto resultarán imprescindibles la transparencia y la accesibilidad a la informa-­ FLyQDÀQGHEXVFDUODDGKHVLyQDODFDPSDxDGHOPD\RUQ~PHUR de personas, y ello exigirá ser muy meticulosos con los siguientes elementos: a. La documentación: facilitando toda la información posible y los argumentos a favor y en contra de la propuesta. b. El discurso: teniendo en cuenta que se dispondrá de muy poco tiempo y oportunidades para convencer. Debe ser breve, com-­ prensible y alejado de proclamas incendiarias. c. 'HEHQSODQWHDUVHREMHWLYRVDOFDQ]DEOHVDÀQGHQRGHVLQFHQWL-­ var a quienes se hayan movilizado con la propuesta. d. Tiene que existir un diseño de herramientas que permita a cualquier persona reproducirlas en su cluster, red social o blog sin mediación de terceros. Pueden utilizarse enlaces, emails o banners. 95


Adolfo Ă lvaro MartĂ­n

e. La visibilidad no debe descuidarse, para ello pueden utilizarse EORJVRUHGHVVRFLDOHV FDVRGHO0DQLĂ&#x20AC;HVWRFRQWUDOD´/H\6LQ-­ deâ&#x20AC;? del que hablaremos en el capĂ­tulo siguiente). En este modelo de campaĂąa, son los propios ciudadanos moviliza-­ dos los agentes activos que trasladan la informaciĂłn a sus cono-­ cidos y redes sociales personales. Cada nodo aportarĂĄ en funciĂłn de sus posibilidades para visibilizar la campaĂąa, lo que permitirĂĄ crear un poderoso medio de comunicaciĂłn y de acciĂłn colectiva. El ciberactivismo se aprovecha del valor que aportan los indivi-­ duos conectados que aportan ideas y expresan libremente sus opi-­ niones. AlcĂĄntara (2008) seĂąala que cuanta mĂĄs gente participe en el molde que se desea utilizar, mayor serĂĄ la satisfacciĂłn con el resultado obtenido. El auge del ciberactivismo en los Ăşltimos aĂąos ha sido exponencial y de carĂĄcter global, como ha sido el caso de Anonymous, un colec-­ tivo surgido del foro 4chan a principios de 2004, que declara traba-­ jar por la transparencia, la libertad de expresiĂłn y los derechos hu-­ manos. Han hecho de la ocultaciĂłn de sus rostros un emblema, no WLHQHQOtGHUHVQLSRUWDYRFHVRĂ&#x20AC;FLDOHV\HQWUHVXVDFFLRQHVPiVGHV-­ WDFDGDVHVWiQORVDWDTXHVDZHEVRĂ&#x20AC;FLDOHVGHJRELHUQRVHPSUHVDV SDUWLGRVSROtWLFRVHLQVWLWXFLRQHVĂ&#x20AC;QDQFLHUDV'HVGHVXVLQLFLRVVXV miembros (los Anons) empezaron a utilizar en sus manifestaciones ODPiVFDUDGH*X\)DZNHVSRSXODUL]DGDHQODQRYHOD9GH9HQ-­ detta. Su ĂŠxito comenzĂł a raĂ­z de sus ataques y manifestaciones contra la denominada â&#x20AC;&#x153;Iglesia de la CienciologĂ­aâ&#x20AC;? en 2008. (OFRQFHSWRGH3ROtWLFDUHĂ&#x20AC;HUHDODDSOLFDFLyQGHORVEORJV\ODV redes sociales al mundo de la polĂ­tica, cuyos principios seĂąala Del Moral, (2006): 1.

La democracia es un diĂĄlogo.

2.

Desde hace 50 aùos, los políticos se han acostumbrado a comu-­ nicar a travÊs de los medios de masas. 96


Nativos Digitales, Redes Sociales y Política 2.0

3.

La utilización de estos medios de masas ha impuesto un mo-­ delo dominante de comunicación vertical: impersonal, largo, homogéneo y unidireccional.

4.

Cada nuevo medio genera sus propias reglas de comunicación. En los años setenta, Nixon, Chaban-­Delmas y Miterrand se han dado cuenta de ello: los tres han perdido elecciones por no utilizar correctamente la televisión. Con Internet pasaría algo similar.

5.

El juego político consiste en enviar información de un punto a una audiencia. Es el modelo de comunicación tradicional, que sigue los principios del telégrafo: un emisor envía un mensaje DXQUHFHSWRUFRQODHVSHUDQ]DGHLQÁXLUOH

6.

En la Red, se produce una situación inédita: el receptor ignora el mensaje, tiene el control de lo que quiere escuchar y no hará caso salvo que tenga la impresión de que el emisor se dirige a él como individuo.

7.

Internet promete un sistema de información abierto que per-­ mite a todos contrastar la información con otras fuentes.

8.

El medio Internet permite hablar a todos dirigiéndose de ma-­ nera personal a cada uno.

9.

Una regla básica de la comunicación política es mantener el control del mensaje.

10. Pero ya no es posible controlar el mensaje. 11. Las técnicas clásicas de la comunicación política (gestión de la información, comunicación televisiva, relaciones públicas) empiezan a sufrir ya la presión de los nuevos medios. 12. Utilizando la Red no evitamos a los medios sino que los multi-­ plicamos. Cada internauta se convierte en una posible fuente de opinión. 97


Adolfo Ă lvaro MartĂ­n

13. MĂĄs importante que Internet son las comunidades que Inter-­ net estructura. En esta realidad radican al mismo tiempo la fuerza y la complejidad del medio. 14. Los polĂ­ticos tienen razones para tener miedo a Internet si no son capaces de integrar la interactividad y las reglas del me-­ dio. 15. La Red permite afrontar el tipo de diĂĄlogo al que la democra-­ cia representativa aspiraba desde siempre. 16. Los individuos pueden ahora encontrar medios para hacerse oĂ­r. Es lo que se conoce como â&#x20AC;&#x153;vigilancia activaâ&#x20AC;?.  /DSROtWLFDHQODHGDGGHOD5HGVLJQLĂ&#x20AC;FDTXHODJHQWHVHKDFH mĂĄs organizada e inteligente colectivamente. 19. La red facilita el acceso a la informaciĂłn y el paso a la acciĂłn. 20. Si los ciudadanos empiezan a participar en este nuevo medio, Internet harĂĄ germinar las condiciones de una nueva prĂĄctica democrĂĄtica. La PolĂ­tica 2.0 se hizo popular en 2008 con la campaĂąa electoral GH%DUDFN2EDPDHQODTXHHOPDUNHWLQJYLUDO\HOXVRGHVLWLRV como YouTube marcaron de forma espectacular la campaĂąa del candidato demĂłcrata a la presidencia de los Estados Unidos. Oba-­ ma generĂł un movimiento de simpatĂ­a y apoyo sin parangĂłn en muchos aĂąos. â&#x20AC;&#x153;El dĂ­a 4 de noviembre de 2008, Obama hizo historia. Se con-­ virtiĂł en el primer presidente afroamericano de Estados Uni-­ dos, superando todos los obstĂĄculos polĂ­ticos en un paĂ­s con un historial de esclavitud y racismo (â&#x20AC;Ś)AdemĂĄs, consiguiĂł que millones de personas volvieran a creer en la democracia, movi-­ lizĂł a la juventud y a las minorĂ­as como nunca antes se habĂ­a visto, logrĂł un incremento de mĂĄs de 42 millones en el registro de votantes respecto a 2004 y consiguiĂł un nivel de participa-­ 98


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

ciĂłn extraordinario(â&#x20AC;Ś) Obama fue ademĂĄs el primer candidato demĂłcrata que desde Jimmy Carter en 1976 conseguĂ­a mĂĄs del 50% del voto popular (â&#x20AC;Ś)La campaĂąa de Obama demostrĂł que XQQXHYRWLSRGHSROtWLFDEDVDGDHQIRPHQWDUODFRQĂ&#x20AC;DQ]D\HO HQWXVLDVPRHQOXJDUGHLQGXFLUGHVFRQĂ&#x20AC;DQ]D\PLHGRSXHGH triunfar en determinadas condicionesâ&#x20AC;? (Castells, 2009: 524-­ 526). Si bien es cierto que las herramientas web desarrolladas para la campaĂąa electoral de Obama se basaron en las realizadas en 2004 SDUD HO FDQGLGDWR +RZDUG 'HDQ 6H\ \ &DVWHOOV   -HQNLQV 2008), la cantidad de voluntarios con ellas movilizados, la consecu-­ ciĂłn de votos conseguidos por medio de las mismas y los niveles de informaciĂłn puntual a los que en todo momento han tenido acceso los organizadores no habĂ­an tenido precedentes hasta aquel mo-­ mento. El equipo de Obama contĂł con una autĂŠntica plataforma tecnolĂłgica exclusivamente diseĂąada para el activismo online, a partir de la cual los ciberactivistas pudieron crear, gestionar y pu-­ blicar campaĂąas de apoyo, recaudaciones especiales de donativos y promociones. Obama logrĂł obtener una recaudaciĂłn record gracias a la red de mĂĄs de 150 millones de dĂłlares (EL MUNDO, 2008) y, tuvo la enorme habilidad de ganarse a los nativos digitales me-­ GLDQWHHOXVRGH)DFHERRNR7ZLWWHU Castells (ob. cit.), seĂąala que el ĂŠxito de su campaĂąa tuvo como elemento clave a su capacidad para incorporar a nuevos actores polĂ­ticos y estimular su participaciĂłn activa, generando nuevas WiFWLFDVGHPRYLOL]DFLyQGHYRWDQWHVDWUDYpVGH0\%DUDFN2EDPD com (15 millones de miembros), donde existĂ­a un apartado dedica-­ do exclusivamente a buscar el apoyo de jĂłvenes simpatizantes que quisieran adquirir habilidades organizativas y de liderazgo para ponerlas en prĂĄctica llamada Obama Organizing Fellows. Obama tambiĂŠn hizo un uso novedoso de las redes sociales para la movilizaciĂłn polĂ­tica, estando presente en 15 redes sociales, entre 99


Adolfo Ă lvaro MartĂ­n

HOODV)DFHERRN0\6SDFH<RX7XEH)OLFNUR7ZLWWHUORTXHOHSHU-­ mitiĂł ganarse el apoyo activo de los nativos digitales: â&#x20AC;&#x153;Por ejemplo, Obama tenĂ­a mĂĄs de tres millones de amigos en )DFHERRNSHURVXVVHJXLGRUHVTXHHVWDEDQIDPLOLDUL]DGRVFRQ )DFHERRN XWLOL]DURQ HVWD KHUUDPLHQWD SDUD HQFRQWUDU IRUPDV creativas para difundir el mensaje de apoyo a su candidatu-­ UD 0iV GH  SHUVRQDV VH XQLHURQ DO JUXSR Â?8Q PLOOyQ FRQ 2EDPDÂ? HQ )DFHERRN +DEtD JUXSRV GH )DFHERRN D IDYRU de Obama por casi todas las universidades de los Estados Uni-­ dosâ&#x20AC;?. (Lutz, 2009: 9). Este uso de las nuevas herramientas de la â&#x20AC;&#x153;PolĂ­tica 2.0â&#x20AC;? dio a Oba-­ ma una posiciĂłn privilegiada con respecto a los votantes mĂĄs jĂł-­ venes, aquellos nativos digitales que ya estaban acostumbrados al uso de Internet, blogs o redes sociales. Von Drehle (2008) seĂąa-­ laba que los votantes jĂłvenes consiguieron aumentar en un 135% OD SDUWLFLSDFLyQ HQ ODV SULPDULDV SUHĂ&#x20AC;ULHQGR D 2EDPD IUHQWH D cualquier otro candidato en una relaciĂłn de 4 a 1. El hecho de que Obama incorporase a su campaĂąa a nativos digitales como Chris +XJKHV FRIXQGDGRUGH)DFHERRN TXHGLVHxyODZHE0\%DUDFN2-­ bama.com o Hans Riemer, que coordinĂł la iniciativa del voto joven, permitiĂł que el sitio de Obama en la red social tuviera 773.000 visitas Ăşnicas en su primer mes de existencia (Schartz, 2007). Como seĂąala Cosme DamiĂĄn en TICbeat, tras la victoria electoral de Obama en 2008, la popularizaciĂłn de la denominada â&#x20AC;&#x153;PolĂ­tica 2.0â&#x20AC;? ha llevado a que en distintos procesos electorales, partidos y candidatos hayan tratado de imitar este modelo. Sin embargo, es-­ tas prĂĄcticas estarĂ­an chocando con la â&#x20AC;&#x153;inercia de los partidos (â&#x20AC;Ś) acostumbrados a reducir al mĂ­nimo el riesgo en su exposiciĂłn a los mediosâ&#x20AC;?, y realiza el siguiente anĂĄlisis del uso de las herramientas de la â&#x20AC;&#x153;PolĂ­tica 2.0â&#x20AC;? por parte de los actores polĂ­ticos tradicionales: ´'HVGHODySWLFDWUDGLFLRQDO¢SDUDTXpTXHUUtDXQSHUĂ&#x20AC;OHQ)D-­ FHERRN XQ GLSXWDGR HOHFWR" ÂŤ  SDUD PXFKRV SROtWLFRV WHQHU 100


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

XQDOLVWDGH DPLJRV HQ )DFHERRN WLHQH HO PLVPR YDORU TXH HO pĂşblico en los mĂ­tines, es decir, el de un decorado humano (â&#x20AC;Ś) ÂżY para quĂŠ querrĂ­a captar seguidores en redes sociales una RUJDQL]DFLyQ TXH \D FXHQWD FRQ DĂ&#x20AC;OLDGRV \ FRQ YRWDQWHV" (V evidente que sus seguidores mĂĄs activos no corren el riesgo de transfuguismo ideolĂłgico. MĂĄs allĂĄ de una expresiĂłn de fuerza y del recuento de adeptos, resulta difĂ­cil de argumentar una apuesta por este canal (â&#x20AC;Ś)â&#x20AC;? (DamiĂĄn, 2010). (VWDVUHĂ H[LRQHVPXHVWUDQTXHORVDFWRUHVSROtWLFRVWUDGLFLRQDOHV parecen seguir instalados en la utilizaciĂłn de las nuevas herra-­ mientas de la PolĂ­tica 2.0 Ăşnicamente como arma electoral, como ya ocurriĂł en el pasado con el uso de las webs, tal y como vimos en el capĂ­tulo II de esta tesis. Sin embargo, alejados de los centros de poder, los ciudadanos vie-­ QHQKDFLHQGRVHQWLUVXLQĂ XHQFLDDWUDYpVGHODVKHUUDPLHQWDVGH la PolĂ­tica 2.0, rompiendo el discurso unidireccional que hasta hace poco tiempo habĂ­an impuesto los actores polĂ­ticos tradicionales. +HUUDPLHQWDVGHOD´3ROtWLFDÂľ La evoluciĂłn de la Web 2.0 desde el aĂąo 2003 permitiĂł el desarro-­ llo de nuevas herramientas que fueron ganando importancia en el ĂĄmbito de la participaciĂłn ciudadana en la polĂ­tica. La deno-­ PLQDGD EORJRVIHUD SHUPLWLy HO Ă RUHFLPLHQWR GH XQD H[SHULHQFLD compartida de la cultura de la interacciĂłn a travĂŠs de los blogs, PRGHORVLPSOLĂ&#x20AC;FDGRGHSiJLQDZHEQDFLGRSDUDIDFLOLWDUODSXEOL-­ caciĂłn, en el que el post o envĂ­o es la unidad bĂĄsica. El post es un WH[WRGHORQJLWXGYDULDEOHFRQVXWtWXOR\VXSURSLRHQODFH OLQN  acompaĂąado de la fecha y hora de su publicaciĂłn. Los post pueden agruparse por categorĂ­as temĂĄticas escogidas por el autor. De esta forma, en el blog aparecerĂĄn los post mas recientes arriba, y el res-­ to por orden cronolĂłgico inverso. Estos post permiten a los lectores aĂąadir comentarios que aparecerĂĄn a continuaciĂłn del texto. Esta estructura repetitiva hace que los sistemas de publicaciĂłn de los 101


Adolfo Ă lvaro MartĂ­n

blogs sean muy sencillos, facilitando su uso y su difusiĂłn (Cervera, 2006: 13). a)-­ Los blogs En cuanto a los orĂ­genes de los blogs, se reconoce a Justin Hall como uno de los primeros bloggers o blogueros pues en 1994, mien-­ tras era estudiante en la Universidad de Swarthmore, escribirĂ­a algo similar a un blog personal. Sin embargo, el tĂŠrmino â&#x20AC;&#x153;Weblogâ&#x20AC;? fue acuĂąado por Jorn Barger (1997) en su website Robot Wisdom, \KDFtDUHIHUHQFLDDODOLVWDGHHQODFHV OLQNV TXHORFDOL]DEDHQVXV investigaciones por Internet. La forma corta â&#x20AC;&#x153;blogâ&#x20AC;?, fue acuĂąada por Peter Merholz, quiĂŠn dividiĂł la palabra weblog en la frase â&#x20AC;&#x153;we blogâ&#x20AC;? en la barra lateral de su blog peterme.com. AsĂ­ relataba este acontecimiento el propio Merholz en un post de 2002: â&#x20AC;&#x153; Siempre me han gustado las palabras. Yo era uno de esos chicos que corrĂ­an a los diccionarios para buscar palabras que no sabĂ­a. Me encantaban los juegos de palabras anagramas, crucigramas, crosTIC doble, etc.; y encontraba las etimologĂ­as especialmente divertidas -­ ÂżCuĂĄles fueron los componentes de una palabra? ÂżCĂłmo una palabra ha llegado a ser lo que es? La OHFWXUDGHODHYROXFLyQGHXQDSDODEUDYHUFyPRHOVLJQLĂ&#x20AC;FDGR cambiĂł las horas extras, me llevaba a preguntarme cĂłmo los lexicĂłgrafos lo habĂ­an descubierto. Como tal, es raro experimentar cĂłmo mi amor por las palabras y juegos de palabras en realidad ha tenido un impacto. En al-­ gĂşn momento de abril o mayo de 1999 (no puedo decir a ciencia cierta cuando exactamente lo hizo), pus, en la barra lateral de mi pĂĄgina de inicio: para lo que vale, he decidido pronunciar la palabra â&#x20AC;&#x153;weblogâ&#x20AC;? como wee-­blog. O blog â&#x20AC;&#x153;. (Merholtz, 2002). La popularidad en el uso de los blogs fue consecuencia del desarro-­ llo de la Web 2.0, de forma que si en 1997 sitios como Xanga.com apenas tenĂ­an 100 blogs, en 2005 contaba con mĂĄs de cincuenta PLOORQHV(VWHFUHFLPLHQWRH[SRQHQFLDOWLHQHVXMXVWLĂ&#x20AC;FDFLyQVHJ~Q 102


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

Cervera (ob. cit.) en tres acontecimientos como fueron los ataques WHUURULVWDVGHOGHVHSWLHPEUHGHODLQYDVLyQGH,UDNSRU fuerzas de la OTAN y las elecciones presidenciales estadouniden-­ ses (estos dos Ăşltimos en 2004) que provocaron una polarizaciĂłn de la vida polĂ­tica dentro y fuera de los Estados Unidos, y que die-­ ron lugar al nacimiento de los â&#x20AC;&#x153;warblogsâ&#x20AC;?: blogs que apoyaban las acciones del gobierno norteamericano, que en muchos casos eran escritos por militares que participaron en la campaĂąa bĂŠlica. Del lado contrario, se desarrollĂł una fuerte actividad contra los â&#x20AC;&#x153;war-­ blogsâ&#x20AC;? por medio de organizaciones como MoveOn.org, una entidad centrada en Internet y estructurada por seguidores y simpatizan-­ tes del partido demĂłcrata, que desarrollaban su actividad por me-­ dio de blogs polĂ­ticos y enlaces. En el proceso de elecciĂłn de candi-­ datos en las presidenciales de Estados Unidos de 2004 comenzaron apoyando a Howard Dean, para posteriormente involucrarse en la campaĂąa electoral de John Kerry frente a George Bush. Durante HVHSHULRGRHOHFWRUDODGHPiVORVEORJVVHFRQĂ&#x20AC;UPDURQFRPRXQD herramienta polĂ­tica a considerar, pues fue la primera vez que la introducciĂłn de cuestiones en la agenda polĂ­tica de los candidatos se llevĂł a cabo desde fuera de los medios de comunicaciĂłn tradicio-­ nales, como el caso de la campaĂąa puesta en marcha por veteranos de guerra de Vietnam contra Kerry (El PaĂ­s, 2004). En este punto es importante resaltar la obra de Armstrong y Mou-­ litsas (2006) Crashing the Gate, donde plantean el nacimiento en los Estados Unidos de una nueva fuerza polĂ­tica, los denominados netroots, grupos de base articulados en torno a la Red. Desde el partido demĂłcrata se planeaba introducir los netroots como una nueva forma de plantar cara a los movimientos de base conserva-­ dores, denominados grassroots. La actitud de estos netroots fue muy activa y beligerante, dando lugar a las mĂĄs curiosas interpre-­ taciones en los medios de comunicaciĂłn en todo el mundo, como la GHXQFROXPQLVWDHQ7KH1HZ<RUN7LPHV  TXHVHUHIHUtDD Moulitsas, creador del blog DailyKos en estos tĂŠrminos: 103


Adolfo Ă lvaro MartĂ­n

â&#x20AC;&#x153;(â&#x20AC;Ś) se sienta ante su ordenador y da Ăłrdenes a sus seguidores, escuadrones de rabiosos corderos dispuestos a descargar su ve-­ neno sobre quienes se les crucen. AsĂ­ es como cree haberse con-­ vertido en una fuerza muy poderosa ante la que todo el mundo tendrĂ­a que arrodillarseâ&#x20AC;?. En EspaĂąa, el diario El PaĂ­s (2006) continuaba con esa visiĂłn ra-­ dical al seĂąalar: â&#x20AC;&#x153;(â&#x20AC;Ś) El disparo de salida para que la ciberbase demĂłcrata asal-­ WDUDHOSDUWLGRORGLHURQDĂ&#x20AC;QDOHVGHIHEUHUR0DUNRV0RXOLWVDV Zuniga, un ex militar californiano de 35 aĂąos dedicado a la alta tecnologĂ­a, y Jerome Armstrong, un empresario de 42 -­apoda-­ do The Blogfather por los que le seĂąalan como la cabeza de la 0DĂ&#x20AC;D GH ORV EORJV FRQ OD SXEOLFDFLyQ GH &UDVKLQJ WKH *DWH (Entrar sin permiso), subtitulado bases tradicionales, bases digitales y el ascenso del poder popular en la polĂ­tica: ÂŤEsta-­ mos en el comienzo de un cambio total del Partido DemĂłcra-­ ta, dirigido por outsiders comprometidos con el progresismoÂť (â&#x20AC;Ś.) Armstrong, creador de un blog pionero en 2001: MyDD. com (My DirectDemocracy), trabajĂł con Joe Trippi, que lanzĂł al ciberespacio a Dean, y ahora es consultor; entre sus clien-­ WHVHVWi0DUN:DUQHUHOKRPEUHTXHTXLHUHJDQDUOHD+LOODU\ Clinton la nominaciĂłn. Armstrong cree que los ciberactivistas se consideran cada vez mĂĄs ÂŤaccionistas de una empresa lla-­ mada Partido DemĂłcrataÂť, y que ÂŤya es hora de pedirle cuentas al Consejo de AdministraciĂłnÂť. Es difĂ­cil saber el nĂşmero de la ciberbase militante, pero se calcula entre cinco y siete millones de personas (â&#x20AC;Ś)â&#x20AC;?. Como podemos observar, la prensa tradicional quedĂł bastante sor-­ prendida ante este movimiento, no siendo capaz de comprender esta nueva forma de ciberactivismo que se estaba gestando, y que tan importante serĂ­a para la estrategia de Obama para ganar las primarias demĂłcratas de 2008 y, posteriormente, para alcanzar 104


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

la victoria en las presidenciales del aùo siguiente. Estos ciberac-­ tivistas no estån bajo el control de una persona o grupo dentro de la organización demócrata, son bloggers que se autodenominan progresistas, que manifestaron su hartazgo por la incapacidad de-­ mócrata para obtener una victoria ante George Bush y, contraria-­ mente a lo pretendido por los medios tradicionales, no hacían del radicalismo su bandera política. Estas redes ni siquiera podían considerarse homogÊneas políticamente, su nexo de unión es la crítica a las políticas republicanas y la búsqueda de formulas para acabar con ellas. Henry Farrell (2006), considera que los netroots y los lectores de sus blogs no se corresponden con lo que muchos teóricos de la de-­ mocracia han estado esperando respecto a las capacidades de las TIC para dinamizar diferentes formas de participación política y la capacidad de la red como medio para revitalizar la democracia. Por ejemplo, contrariamente a lo previsto por Putnam (2002), los netroots han resultado un claro ejemplo de cómo Internet puede incentivar nuevas formas de generar argumentos y la cooperación social entre individuos y grupos, haciendo que las personas se com-­ SURPHWDQ PiV FRQ VX VRFLHGDG (Q HVWH PLVPR VHQWLGR %HQNOHU (2006) sostiene que la tecnología ha convertido en algo sencillo y barato distintos tipos de cooperación, lo que permite a estos nue-­ vos ciberactivistas ser el primer paso en cambios muy importantes en la relación entre tecnología y política. Farrell (ob. cit.) considera que todos estos cambios tendrån impli-­ caciones muy importantes para los partidos políticos, pues si hasta hace muy poco la agenda política era establecida por las Êlites de altos funcionarios de los partidos, representantes electos y medios de comunicación tradicionales, esta capacidad se irå viendo mer-­ mada poco a poco por la acción de un conjunto mucho mås amplio de actores que utilizarån las nuevas capacidades tecnológicas para LQà XLUHQODGLVFXVLyQSROtWLFD*UDFLDVDKHUUDPLHQWDVFRPR,QWHU-­ net, blogs (e incluso redes sociales), se podrån reunir personas de 105


Adolfo Ă lvaro MartĂ­n

RUtJHQHVLGHROyJLFRVGLIHUHQWHVSDUDLGHQWLĂ&#x20AC;FDUSXQWRVGHLQWHUpV comĂşn y para construir una acciĂłn conjunta. La importancia de los blogs fue en aumento a partir de ese mo-­ PHQWR\FRPRVHxDOD(VFRODU  VXLQĂ XHQFLDQRSXHGHHVWDU sometida a la misma medida que la de los medios de comunicaciĂłn FRQYHQFLRQDOHVSXHVODEORJRVIHUDDFW~DFRPRDOWDYR]\FRPRĂ&#x20AC;O-­ tro, de forma que es capaz de seleccionar aquella informaciĂłn que genera interĂŠs y multiplicar su impacto. Cita el ejemplo del blo-­ guero barcelonĂŠs Barcepundit que, en 2004, fue capaz de poner en evidencia al periĂłdico El PaĂ­s a raĂ­z de una campaĂąa publicitaria VREUHHOVN\OLQHGH1XHYD<RUN/DFRQVHFXHQFLDHVTXHHOGLDULR de Prisa se vio en la obligaciĂłn de publicar en su ediciĂłn de papel un editorial disculpĂĄndose por su desafortunada acciĂłn (El PaĂ­s, 2004). En EspaĂąa, segĂşn Escolar (Ob.cit.), fue David de Ugarte el prime-­ ro en fundar una comunidad de blogs organizada sobre una idea polĂ­tica, llamada losliberales.org, que tuvo una efĂ­mera vida por las desavenencias entre sus fundadores, pero que sirviĂł de guĂ­a para los posteriores portales sindicados de blogs como redliberal. FRPRUJDQL]DGDSRU'DQLHO5RGUtJXH]TXHMXVWLĂ&#x20AC;FDEDGHHVWDPD-­ nera la creaciĂłn de este proyecto: â&#x20AC;&#x153;(â&#x20AC;Ś) Hace cuatro aĂąos, tras la derrota del PP de Rajoy, escribĂ­ dos artĂ­culos sobre los cambios que debĂ­a hacer el PP de cara a ganar estas Ăşltimas elecciones que tambiĂŠn han perdido. No me hicieron mucho caso, la verdad, ni tampoco es que lo espera-­ se. AdemĂĄs, no es que estuviera demasiado claro que hubiesen logrado ganar siguiendo mis consejos, tan amables e interesa-­ dos (uno, que cobra sus columnas). Pero yo decidĂ­ hacerme caso a mĂ­ mismo, por una vez, y montĂŠ Red Liberal ese mismo mes de marzo de 2004. (â&#x20AC;Ś) Notaba entonces cĂłmo la derecha empe-­ zaba a movilizarse en Internet. Creo que no lleguĂŠ a imaginar hasta dĂłnde iba a llegar la marea que empezaba a levantarse 106


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

entonces, dentro y fuera de la red. Cuatro aĂąos despuĂŠs existen redes de blogs, sitios web, laboratorios de ideas, plataformas de movilizaciĂłn ciudadana y asociaciones de todo tipo dispuestas a dar la batalla a la hegemonĂ­a de la izquierda en la batalla de las ideas.â&#x20AC;? (Rodriguez Herrera, 2008). En Ecuador, la eclosiĂłn de los blogs coincidiĂł con la â&#x20AC;&#x153;revoluciĂłn de los forajidosâ&#x20AC;? en 2005 y, como veremos en el capĂ­tulo III, per-­ mitieron a los â&#x20AC;&#x153;forajidosâ&#x20AC;? crear espacios autĂłnomos de expresiĂłn que ayudaron a superar el mutismo o informaciĂłn sesgada de la mayorĂ­a de los medios tradicionales (especialmente televisiĂłn). $VLPLVPR ORV EORJV IXHURQ XQ LQVWUXPHQWR HĂ&#x20AC;FD] HQ OD GLIXVLyQ LQWHUQDFLRQDOGHOFRQĂ LFWRDPSOLDQGRHOHFRGHODVSURWHVWDV\HO menoscabo de la imagen de Lucio GutiĂŠrrez. b)-­ Las redes sociales Cuando De Ugarte (Ob. cit.) hablaba de practicar el ciberactivismo por medio de Internet y los blogs, poco podĂ­a imaginar que justo en aquel tiempo estaban comenzando a popularizarse y a expan-­ dirse a nivel mundial las redes sociales: una herramienta que muy pronto se convertirĂ­a en esencial para el ciberactivismo y las movi-­ lizaciones ciudadanas. Las redes sociales en Internet surgieron a mediados de los aĂąos 90 del pasado siglo XX con Classmates.com (1995) y SixDegrees.com  TXHSHUPLWtDQFUHDUSHUĂ&#x20AC;OHV\OLVWDVGHDPLJRVDVXVXVXD-­ rios. En el aĂąo 2002 apareciĂł Friendster.com dedicado a buscar pareja a personas, y que se diferenciaba de otros sitios por el hecho de que los contactos se producĂ­an a travĂŠs de â&#x20AC;&#x153;amigos de amigosâ&#x20AC;? y no entre desconocidos. Su ĂŠxito fue inmediato, llegando a obtener millones de usuarios en muy poco tiempo (El Mundo, 2003). Para entender el ĂŠxito de las redes, Watts (2003) llevĂł a cabo un estudio sobre las redes sociales para analizar de quĂŠ modo se aso-­ cian los comportamientos individuales para dar lugar a un com-­ 107


Adolfo Ă lvaro MartĂ­n

portamiento colectivo, teniendo en cuenta que los sistemas com-­ plejos son mucho mĂĄs que la suma de sus diversas partes: â&#x20AC;&#x153;(â&#x20AC;Ś) En vez de pensar en las redes como entidades que evolu-­ cionan, los analistas de redes han tendido de hecho a tratarlas como una materializaciĂłn congelada de esas fuerzas. Y en vez de entender las redes como meros conductos a travĂŠs de los FXDOHVODLQĂ XHQFLDVHSURSDJDVHJ~QVXVSURSLDVUHJODVKDQ tratado a las propias redes como una representaciĂłn directa GH OD LQĂ XHQFLD ÂŤ  ,PSOtFLWD HQ OD DSUR[LPDFLyQ D ODV UH-­ des desde el concepto de centralidad) estĂĄ la asunciĂłn de que las redes que parecen ser distribuidas, no lo son realmente (â&#x20AC;Ś) Pero, ÂżQuĂŠ pasa si no hay un centro? ÂżQuĂŠ si hay muchos â&#x20AC;&#x153;centrosâ&#x20AC;? no necesariamente coordinados ni incluso del â&#x20AC;&#x153;mis-­ mo ladoâ&#x20AC;?? ÂżQuĂŠ pasa si las innovaciones importantes no se ge-­ neran en el nĂşcleo sino en la periferia donde los capos gestores de informaciĂłn estĂĄn demasiado ocupados para mirar? ÂżQuĂŠ pasa si pequeĂąos sucesos repercuten a travĂŠs de oscuros lu-­ gares por casualidad y encuentros fortuitos, disparando una multitud de decisiones individuales, cada una de ellas tomada VLQXQDSODQLĂ&#x20AC;FDFLyQWUDVGHVL\FRQYLUWLpQGRVHSRUDJUHJD-­ ciĂłn en un suceso no anticipable por nadie, ni siquiera los pro-­ pios actores? En estos casos, la centralidad en la red de los individuos o cualquier centralidad de cualquier tipo, nos dirĂĄn poco sobre el resultado, porque el centro emerge como consecuencia del propio sucesoâ&#x20AC;?. Las investigaciones de Watts vinieron precedidas por los traba-­ jos de varios matemĂĄticos como ErdĂłs y RĂŠnyi que, entre los aĂąos 1959 y 1961, analizaron en una serie de artĂ­culos el umbral entre el aislamiento y la conectividad. Uno de los descubrimientos mĂĄs VLJQLĂ&#x20AC;FDWLYRVGHHVWRVLQYHVWLJDGRUHVHVTXHHQXQJUDIRDOHDWRULR (conjunto de nodos unidos por enlaces) la conectividad aumenta de 108


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

forma espectacular al incorporar mĂĄs nodos al componente central de una red. Tal conectividad global no se desarrolla de manera regular, sino que crece incontrolablemente una vez que se ha so-­ brepasado determinado umbral. 3RVWHULRUPHQWH0LOJUDP  SHUĂ&#x20AC;OyODKLSyWHVLVGHPXQGRSH-­ queĂąo, que establece que es posible tener contacto con cualquier persona del mundo a travĂŠs de amigos realizando unos pocos pa-­ sos. Para ello, llevĂł a cabo el experimento de repartir una serie de cartas al azar en Boston y Omaha que tenĂ­an como destinatario a un corredor de bolsa en Massachusetts. La Ăşnica informaciĂłn disponible era el nombre, la ubicaciĂłn genĂŠrica (sin direcciones concretas) y la ocupaciĂłn del destinatario. El objetivo para los que iniciaron la cadena era sencillo: entregar a quien ellos creyeran que podĂ­a estar ligado al destinatario, siempre que se cumpliera la condiciĂłn de tratarse de personas que conociesen directamente. Los receptores deberĂ­an hacer lo mismo y la cadena seguirĂ­a hasta que el destinatario fuera localizado. Lo interesante fue comprobar que, contrariamente a lo que creĂ­an, no eran necesarios cientos de pasos para llegar al destinatario, el promedio se situĂł entre 5 y 7 intermediarios. Milgram demostrĂł que era posible que en 5,2 pasos de media, pudieran conectarse dos personas desconocidas, y que los caminos que alcanzaban el objetivo pasaban por unos pocos nodos esenciales de la red. Granovetter (1973) realizĂł un estudio sobre dos comunidades que se movilizaban frente las consecuencias del crecimiento urbano. De este estudio emergĂ­a la idea de que la coordinaciĂłn social de-­ pendĂ­a, a la hora de la verdad, no tanto de vĂ­nculos fuertes como las relaciones familiares, de amistad o de cuadrilla, sino de los vĂ­n-­ culos dĂŠbiles establecidos con anterioridad con otros actores con los que hasta entonces habĂ­an tenido poco o ningĂşn contacto. Si bien Granovetter no realizĂł su investigaciĂłn en entornos virtuales, sus conceptos son aplicables a la hora de analizar las conexiones 109


Adolfo Ă lvaro MartĂ­n

que se generan en los espacios digitales. Los lazos dĂŠbiles son co-­ nexiones con las que no tenemos gran interactividad, pero forman parte de la red y resultan fundamentales para el enriquecimien-­ to mutuo. Los lazos fuertes poseen mayor motivaciĂłn en brindar asistencia, estĂĄn disponibles mĂĄs fĂĄcilmente y generan redes de FRQĂ&#x20AC;DQ]D3HURODLPSRUWDQFLDGHORVOD]RVGpELOHVUDGLFDHQTXH favorecen redes menos estructuradas y permiten transportar in-­ IRUPDFLyQHLGHDVSRUIXHUDGHOFtUFXORVRFLDOSURPRYLHQGRXQĂ XMR de circulaciĂłn que facilita la movilidad. Watts (ob. cit.) revisa todas estas teorĂ­as y considera que los vĂ­n-­ culos fuertes, por reproducir la uniĂłn local, llevan a una fragmen-­ taciĂłn total, en cambio, los vĂ­nculos dĂŠbiles, contrariamente a lo que se habĂ­a sostenido, no solo no crean alienaciĂłn en el individuo sino que son indispensables para las oportunidades individuales y para su integraciĂłn en las comunidades. Finalmente, BarabĂ si (2009), fĂ­sico rumano y experto internacio-­ nal en teorĂ­a de redes, descubriĂł la propiedad de las redes de esca-­ la libre, basada en que la estructura y evoluciĂłn de las redes son inseparables, pues se encuentran en constante cambio debido a la llegada de nuevos nodos y la creaciĂłn de nuevas conexiones. De esta manera, los nodos altamente conectados crecen mĂĄs rĂĄpido generando una distribuciĂłn de grado de tipo exponencial. De Ugarte (2006), realiza una aplicaciĂłn prĂĄctica de estas teorĂ­as utilizando como ejemplos las revueltas francesas de noviembre de 2005 y el â&#x20AC;&#x153;macrobotellĂłnâ&#x20AC;? llevado a cabo en varias ciudades espa-­ Ăąolas en 2006: En cuanto a las revueltas francesas: los tres blogueros que fueron el origen de las protestas no se encontraban en el centro de la blo-­ gosfera francĂłfona, mĂĄs bien eran tres usuarios de 14, 16 y 18 aĂąos con pocos conocimientos y que utilizaban habitualmente la red con Ă&#x20AC;QHVO~GLFRV(VWRVMyYHQHVQRVHFRQRFtDQHQWUHVtSHURFRQVLJXLH-­ ron que desde la periferia de la red se movilizase a todo un paĂ­s, demostrando la gran capacidad de las nuevas herramientas para 110


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

generar un swarming que hizo que miles de jĂłvenes se enfrentasen a la policĂ­a, utilizando el conocimiento acumulado y difundido en la blogosfera, y aprovechĂĄndose de la capacidad de autoorganiza-­ ciĂłn de las redes formadas en la calle mediante mĂłviles. De esta forma, estos jĂłvenes franceses utilizaban por la noche el mĂłvil, y por el dĂ­a los blogs. El mĂłvil se convirtiĂł en la herramienta de coordinaciĂłn en la acciĂłn y, el blog, en la herramienta de extensiĂłn y aprendizaje de las experiencias nocturnas. La experiencia de-­ mostrĂł que la multiplicaciĂłn de blogs interconectados fue capaz de articular un medio de comunicaciĂłn alternativo, pese a originarse de forma tosca y en la periferia de la red. Respecto al â&#x20AC;&#x153;macrobotellĂłnâ&#x20AC;? ocurrido en EspaĂąa, De Ugarte seĂąala que fueron convocados miles de jĂłvenes por medio de SMS, correos electrĂłnicos, foros y una nueva herramienta conocida como space. Estos spaces son webs que agrupan un conjunto de servicios como blog, ĂĄlbum de fotos, Messenger, emails, videos, chats y foros, que permiten a cada usuario crear su propio portal personal. Estos jĂłvenes fueron capaces de movilizarse sin necesidad de recurrir a grandes conectores, consiguiendo que una acciĂłn nacida de las redes distribuidas fuese capaz de generar sus propios centros de informaciĂłn para cada acciĂłn. No es de extraĂąar, por tanto, que el uso de las redes sociales se haya incrementado de forma espectacular en todo el mundo; En el aĂąo 2010, alcanzaba la cifra de 940 millones de usuarios, segĂşn el estudio elaborado por Insite Consulting (www.insiteconsulting. com) que, ademĂĄs, subrayaba que el 72% de estos usuarios lo eran de mĂĄs de una red social. En cuanto a preferencias en aquel mo-­ PHQWR HQ SULPHU OXJDU VH VLXDEDV )DFHERRN FRQ XQ  GH ORV usuarios, seguido de Myspace (20%) y Twitter (17%). Tan solo dos aĂąos despuĂŠs, en 2012, segĂşn el estudio elaborado por Globalwe-­ ELQGH[ODVFLIUDVVHKDQPXOWLSOLFDGRGHIRUPDTXHVROR)DFHERRN tiene 650 millones de usuarios, lo que supone el 40% del total a nivel mundial. 111


Adolfo Ă lvaro MartĂ­n

El estudio de Globalwebindex muestra otros elementos destaca-­ bles dentro del uso de las redes sociales en 2012; a)-­Los usuarios de las redes sociales se vuelven mĂĄs pasivos. Se detecta un aumento en el nĂşmero de usuarios que utilizan las redes para seguir la vida de personajes pĂşblicos o de organiza-­ ciones, y desciende el nĂşmero de mensajes a amigos. b)-­ La importancia de los mercados emergentes en el crecimien-­ to de las redes sociales, caso de Brasil o India. c)-­ Pese a la extensiĂłn de las redes sociales a nivel mundial, los usos son diferentes en cada paĂ­s. Por ello, aumenta el interĂŠs de las marcas y las empresas en conocer estas tendencias en las redes sociales. En cuanto a AmĂŠrica Latina, las redes sociales cada vez ocupan un papel mĂĄs importante y asĂ­, el estudio publicado por Comscore en diciembre de 2012, seĂąala que cinco de los diez mercados mĂĄs DĂ&#x20AC;QHVDODVUHGHVVRFLDOHVHQHOPXQGRHVWiQXELFDGRVHQHVWHWH-­ rritorio, dado que los internautas latinoamericanos pasan el 56% de su tiempo online en estos sitios. Este informe, seĂąala que Fa-­ FHERRNHVODUHGIDYRULWDVHJXLGDGH/LQNHGLQTXHKDGHVSOD]DGR a Twitter a la tercera posiciĂłn. Por su parte, el informe publicado por Pingdom en enero de 2013 seĂąala que el 10,6% de los 2.400 millones de usuarios de Internet que habĂ­a en el mundo en 2012 eran latinoamericanos. Este dado supone que Internet tiene en la regiĂłn una penetraciĂłn del 42,9%, aĂşn inferior a Estados Unidos (78,6%) y Europa (63,2%), pero por encima de mercados emergen-­ tes como los asiĂĄticos (tan solo un 27,5%), lo que da muestra del enorme potencial de desarrollo de las TIC que se estĂĄ llevando en esta parte de AmĂŠrica. Este desarrollo de las redes sociales ha permitido su utilizaciĂłn para llevar a cabo acciones de ciberactivismo, puesto que como se-­ Ăąala JosĂŠ RodrĂ­guez en su blog Observatori de ciberpolitica, en un post de 9 de diciembre de 2010. 112


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

´)DFHERRNKDGHPRFUDWL]DGR\UHGXFLGRORVFRVWHVSDUDHQWUDUD VHUDFWLYRHQODUHG7ZLWWHU\)DFHERRNKDQVXSXHVWRXQFDP-­ ELR \D QR HQ OD GLĂ&#x20AC;FXOWDG WHFQROyJLFD VLQR HQ OD GHGLFDFLyQ Mantener un blog y escribir un artĂ­culo requiere un tiempo y una dedicaciĂłn, una constancia y un esfuerzo. Actualizar el SHUĂ&#x20AC;OGHO)DFHERRNVXELUXQDIRWRRKDFHUXQSDUGHWZLWHD-­ das a priori requiere mucho menos. Eso ha permitido que el ciberactivista compartiera un nuevo espacio con el militante puro y duro, que no puede ni quiere destinar mucho tiempo al activismo en la red. Aparece conceptos como el â&#x20AC;&#x153;low-­activismâ&#x20AC;?, activismo de baja intensidad en la red, donde se repite la â&#x20AC;&#x153;con-­ signa del dĂ­aâ&#x20AC;?, se aplaude al propio o se critica al extraĂąo con XQDVRODHQWUDGDHQ)DFHERRNÂľ En el ĂĄmbito internacional, las redes sociales han tenido una po-­ siciĂłn relevante como herramienta de ciberactivismo en las revo-­ luciones de 2011 en Egipto, Libia o TĂşnez. En el caso de TĂşnez, OD PRYLOL]DFLyQ GH ORV QDWLYRV GLJLWDOHV YtD )DFHERRN IXH PX\ importante. Estos jĂłvenes fueron la gran mayorĂ­a del 18% de la poblaciĂłn que tenĂ­a cuenta en esta red social, que resultĂł una he-­ rramienta formidable en las movilizaciones que culminaron con HO GHUURFDPLHQWR GHO UpJLPHQ *DUWRQ $VK   DĂ&#x20AC;UPy TXH OD audiencia televisiva de TĂşnez se informĂł de las movilizaciones por medio de la cadena Al Yazira, la cual, citaba habitualmente como IXHQWHGHVXVLQIRUPDFLRQHVDSiJLQDVGH)DFHERRN\<RX7XEH'H forma, que nuevamente, como ya ocurriera anteriormente en IrĂĄn y Moldavia, los medios tradicionales recurrieron a los ciberactivis-­ tas para saltar el bloqueo informativo impuesto por el gobierno de %HQ$Ot3HURDGHPiV)DFHERRNIXHXWLOL]DGRSRUQXPHURVRVFLEH-­ ractivistas de otros paĂ­ses (especialmente en el mundo ĂĄrabe) para ampliar la repercusiĂłn de las protestas, de forma que, en paĂ­ses como Marruecos, muchos jĂłvenes sustituyeron sus iconos en sus pĂĄginas personales por la bandera tunecina o un corazĂłn con las banderas de Marruecos y TĂşnez, en una expresiĂłn de entusiasmo 113


Adolfo Ă lvaro MartĂ­n

SRUHOp[LWRGHODUHYXHOWDLQĂ X\HQGRHQVXFtUFXORGHFRQWDFWRVHQ ODUHGH[SDQGLHQGRODLPSRUWDQFLDGHORTXHRFXUUtDHLQĂ X\HQGR en sus opiniones pĂşblicas y gobiernos. Estos ciberactivistas ĂĄrabes han sido capaces de utilizar las re-­ des sociales para salvar los bloqueos informativos ordenados por los gobiernos de sus paĂ­ses, permitiendo que la opiniĂłn pĂşblica mundial conociese las graves violaciones de los derechos humanos llevadas a cabo, por ejemplo, por los gobiernos de Egipto e IrĂĄn. (QHVWHVHQWLGRKDGHVWDFDGRODĂ&#x20AC;JXUDGHOHJLSFLR$DODP:DVVHI quien bajo el falso nombre de Ahmad Sherif, ha llevado a cabo 2007 vĂ­deos que ha difundido en la Red para denunciar las tor-­ turas que las fuerzas de seguridad realizaban a los opositores al gobierno, y alertaba a la comunidad internacional del alto grado de corrupciĂłn de un rĂŠgimen que, por aquellas ĂŠpocas, formaba parte de la Internacional Socialista y gozaba del apoyo de los paĂ­-­ ses occidentales. Aalam nunca revelo su identidad, pero ello no le impidiĂł mantener una estrecha relaciĂłn con otros ciberactivistas en su lucha por la libertad y la democracia en Egipto. Las claves de su popularidad han residido en su capacidad para incorporar en sus videos el humor y la sĂĄtira. El 5 de enero de 2011, Aalam crearĂ­a un video que rĂĄpidamente fue difundido por YouTube, y que serĂ­a el precursor de la revoluciĂłn que el 11 de febrero de 2011 DFDEDUtDFRQHOJRELHUQRGH+RVQL0XEDUDN(QXQDHQWUHYLVWDTXH concediĂł a Lali Sandiumenge en 2007, y que esta publicarĂ­a en su blog guerreros del teclado, Aalam seĂąalaba: Sobre el papel de la blogosfera: â&#x20AC;&#x153;Creo que representa en primer lugar una gran esperanza. Alguien en algĂşn sitio estĂĄ expre-­ sando sus puntos de vista con libertad y estas opiniones no las destruyen ni los medios locales ni la censura, esta es la princi-­ pal revoluciĂłn. La prensa suele ignorar lo que pasa, pero ahora ya no pueden controlarlo todo, porque ahora los medios ameri-­ canos y europeos estĂĄn hablando de la blogosfera. La BBC emi-­ tiĂł un documental con Hossam Hamalawy [bloguero y perio-­ 114


Nativos Digitales, Redes Sociales y Política 2.0

dista] que fue importante, porque se llamo “Egipto, un estado policial”. Fue una victoria de los blogs y muestra su impacto: no se trata de cuántos blogueros hay sino del impacto que causan. Y esto es fascinante, porque produces un video de 30 segundos y estos 30 segundos cambian la percepción que el mundo tiene de este país y muestra cómo es. Por lo tanto, tenemos que pen-­ sar en términos de simbolismo y no de números, porque vivi-­ mos en una sociedad de la información, y la información que se difunde tiene un enorme poder. Comprendimos que se trataba de una guerra de información y que la información conseguiría gradualmente cambiar la situación en casa. Esa es la razón por la que intentamos llegar al mundo exterior, hemos entendido cuán importante es para nosotros la prensa extranjera y libre, y usamos todas estas herramientas a nuestro favor, para nues-­ tra labor, nuestra gente y nuestro futuro”. Sobre sus vídeos. “Mis vídeos van sobre los problemas diarios en Egipto y, en primer lugar, sobre la libertad de expresión, todos buscan crear libertad de expresión. Un día me dije a mí mismo: vamos a imaginar que Egipto es un país libre como cualquier otro en el que puedes decir lo que te de la gana. ¿Cómo sería? Escribí canciones criticando al presidente y su entorno, los mi-­ nistros, el Partido Nacional Democrático, etc., como si eso no supusiera ningún peligro para mí o para mi familia, solo ima-­ ginando que Egipto era un país libre. No quería denunciar sino que quería ser satírico. Me gusta la sátira porque crea distan-­ cia y humor, parece casi como si no te importara, aunque por supuesto que me importa y me importa tanto que me afectó hacer los vídeos; para mí ver a los egipcios, a mi gente, oprimi-­ dos hasta este punto y ser parte de esta opresión es físicamente insoportable. Así que intenté sacar fuerzas para reírme, porque mientras ríes quizá todavía queda esperanza”. Sobre la importancia de Youtube para el activismo: “Al parecer ha funcionado, porque los vídeos han recibido bastante aten-­ 115


Adolfo Ă lvaro MartĂ­n

ciĂłn, algunos han sido vistos muchas veces, unas 60.000. En conjunto, he hecho unos 30 vĂ­deos y han conseguido 500.000 vi-­ VLWDVXQQ~PHURTXHQLVLTXLHUDOOHJRDHQWHQGHUVLJQLĂ&#x20AC;FDTXH tienen una audiencia ĂĄraboparlante compuesta por egipcios que viven aquĂ­ y egipcios de la diĂĄspora. Youtube estĂĄ reunien-­ do a egipcios que estĂĄn en el exterior, y creo que ellos pueden hacer algo por el paĂ­s, porque han estado en contacto con otros tipos de vida y de polĂ­ticas y no les han hecho un lavado de ce-­ rebro como a nosotrosâ&#x20AC;?. Sobre el poder de Internet para favorecer el cambio social: â&#x20AC;&#x153;La razĂłn por la que hago vĂ­deos es porque los vĂ­deos son muy efectivos en una sociedad donde hay un 50% o mĂĄs de analfa-­ betismo. Pero sĂ­ puedes llegar a estas personas que no saben leer ni escribir con un vĂ­deo, o mandar un par de mensajes y, especialmente, puedes crear diĂĄlogos e introducir temas de de-­ bate sobre los que piensa todo el mundo pero nadie se atreve a discutir. He empezado una nueva campaĂąa para introducir los vĂ­deos en la calle a travĂŠs del mĂłvil. Estoy todavĂ­a a medias, y es complicado, pero espero lograrlo, porque aunque solo una parte reducida de los egipcios tienen acceso a Internet casi todo el mundo tiene un mĂłvil. El impacto pude ser mucho mayor. He empezado una campaĂąa de tres spots: uno va sobre el amor libre y el sexo; el segundo es sobre la libertad de expresiĂłn, y el tercero abordarĂĄ la libertad de religiĂłn. Siempre hablamos de los mismos temas: ser diferente, ser plurales, ser diversos y ser capaces de vivir juntos, eso es algo que una dictadura destruye, porque te acostumbras a un gobernante y a solo una verdad e incluso cuando estĂĄs en la oposiciĂłn te comportas igual que el dictador. Todo el mundo dice que ahora en Egipto la Ăşnica opo-­ siciĂłn son los Hermanos Musulmanes, y no creo que los Herma-­ nos Musulmanes puedan prometer a la sociedad egipcia nada mejor respecto a la censura y el control, quizĂĄ serĂĄn mejores en algunas cosas pero no creo que sea una mejor soluciĂłn respecto 116


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

a la libertad. Es muy importante entender que la alternativa D 0XEDUDN QR SXHGH VHU DOJR TXH VH SDUH]FD D 0XEDUDN /D razĂłn por la que hice estos spots es para enviar la idea que po-­ demos ser diferentes y vivir juntos. Parece una idea muy bĂĄsica en paĂ­ses occidentales, pero no es tan bĂĄsica en Egipto, inclu-­ so los egipcios que parecen occidentalizados viven en muchas contradicciones y eso pasa porque vivimos en una dictadura y nos han lavado el cerebro, nos han destruido, hemos perdido nuestra humanidad y ya no sabemos ni lo que esâ&#x20AC;?. En IrĂĄn, Mousavi 1388, fue el principal ciberactivista conocido in-­ ternacionalmente gracias a sus vĂ­deos en YouTube sobre la â&#x20AC;&#x153;marea verde iranĂ­â&#x20AC;?. Por ĂŠl tuvimos conocimiento de la gravedad y violen-­ cia de la represiĂłn en IrĂĄn contra los opositores al rĂŠgimen que de-­ nunciaban el fraude en las elecciones presidenciales. Especialmen-­ WHLPSRUWDQWHIXHVXYtGHR´)UHH0\/DQG²,UDQÂ?V9RLG(OHFWLRQÂľ ampliamente difundido por los blogueros internacionalmente, (20 Minutos, 2009; Netoraton 3.0, 2009). Los ciberactivistas iranĂ­es supieron hacer frente a las limitaciones que el gobierno iranĂ­ im-­ puso en Internet mediante la restricciĂłn en el uso de la banda ancha, y tan solo entre los dĂ­as 16 y 17 de junio de 2009 subieron 3.000 vĂ­deos a YouTube sobre las protestas. Cifra que alcanzĂł los DĂ&#x20AC;QDOHVGHPHV'HHVWDIRUPDORVFLEHUDFWLYLVWDVURP-­ pieron el bloqueo informativo generado por el gobierno de Ahma-­ dineyad, que restringiĂł los movimientos de los corresponsales de prensa internacionales, que en muchas ocasiones utilizaron las imĂĄgenes de los enfrentamientos y las detenciones grabadas con mĂłviles por los ciberactivistas para uso de los medios de comuni-­ caciĂłn tradicionales. ( RTVE, 2009b). Anonymous ha sido el otro gran valedor de las capacidades de You-­ Tube para el ciberactivismo. AsĂ­ ocurriĂł en enero de 2008 con el denominado Proyecto Chanology, que consistiĂł en una manipula-­ ciĂłn de un vĂ­deo producido por la denominada Iglesia de la Cien-­ ciologĂ­a, con el objetivo de denunciar lo que a su entender eran 117


Adolfo Ă lvaro MartĂ­n

actos de explotaciĂłn econĂłmica por parte de esta entidad, asĂ­ como para reivindicar el derecho a la libertad de expresiĂłn en la Red, derivado de la reclamaciĂłn que harĂ­a la Iglesia de la CienciologĂ­a ante Google (The Times, 2008). En 2009, Anonymous llevĂł a cabo otra acciĂłn en protesta por la retirada de vĂ­deos musicales de YouTube (BBC, 2009). Para ello comenzaron a subir a Youtube diversos videos de contenido porno-­ JUiĂ&#x20AC;FR EDMR QRPEUHV GH IDPRVDV FHOHEULGDGHV DGROHVFHQWHV FRPR Hannah Montana o los Jonas Brothers. /DGHIHQVDGH:LNLOHDNV\GHVXIXQGDGRU-XOLDQ$VVDQJHKDVLGR ODDFFLyQPiVPHGLiWLFD\FRQRFLGDGH$QRQ\PRXV:LNLOHDNVFR-­ menzĂł a difundir cables secretos de la diplomacia norteamericana HQQRYLHPEUHGH&DVLLQPHGLDWDPHQWH:LNLOHDNVFRPHQ]yD sufrir ataques que pretendĂ­an impedir estas revelaciones, lo que le llevĂł a solicitar ayuda a la comunidad internauta de todo el mun-­ do. El 6 de diciembre de 2010, Anonymous llevĂł a cabo un ataque contra la pĂĄgina web del banco PostFinance, que habĂ­a anunciado el bloqueo de las cuentas de Assange en Suiza. Posteriormente, Anonymous atacĂł PayPal por la negativa de esta entidad a gestio-­ QDUODVGRQDFLRQHVD:LNLOHDNV,QFOXVROOHJDURQDFROJDUHQ<RX-­ Tube un vĂ­deo dirigido al gobierno de Estados Unidos en el que explicaban sus objetivos: â&#x20AC;&#x153;En la ĂŠpoca actual, el acceso a Internet se ha convertido en un derecho fundamental. Como cualquier otro derecho fundamental, creemos que es un error violarlo (â&#x20AC;Ś) Cen-­ surar el contenido es perjudicial para vosotros. Las restricciones injustas que imponĂŠis no tendrĂĄn ningĂşn ĂŠxito y solo reforzarĂĄn nuestra convicciĂłn para desobedecer y rebelarnos contra vuestra tiranĂ­aâ&#x20AC;? (PĂşblico, 2010). En 2009, Twitter obtuvo fama internacional como arma de cibe-­ ractivismo en las revueltas acaecidas en IrĂĄn y Moldavia tras sus procesos electorales:

118


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

En IrĂĄn, las denuncias de la oposiciĂłn relativas a graves irregula-­ ridades en el recuento de los votos, provocaron importantes movi-­ lizaciones conocidas como â&#x20AC;&#x153;la marea verdeâ&#x20AC;?, en la que Twitter fue utilizada por ciberactivistas iranĂ­es para narrar en tiempo real lo ocurrido durante las manifestaciones. Usando el hashtag (cadena de caracteres) #iranelection, se enviaban mensajes animĂĄndose a acudir a las marchas, dĂĄndose advertencias sobre el proceder de la policĂ­a (â&#x20AC;&#x153;no lleves coche, te estarĂĄn esperando cuando vuelvas por ĂŠlâ&#x20AC;?) o como arma para dejar sin efecto la contrainformaciĂłn de los PHGLRVRĂ&#x20AC;FLDOHVGHOJRELHUQRLUDQt ´DOHUWDODPDUFKDDIDYRUGH Musavi se mantieneâ&#x20AC;?). Gracias a esta herramienta, el conocimien-­ to a nivel global de lo que estaba ocurriendo en IrĂĄn fue en aumen-­ to pues, en apenas 4 dĂ­as, desde el 15 al 18 de junio, hubo mĂĄs de un millĂłn de post en Twitter sobre IrĂĄn. En este caso, al igual que ocurriĂł con los vĂ­deos en YouTube, los ciberactivistas encontraron otra herramienta formidable para superar el bloqueo informativo del gobierno de Ahmadineyad. (20 Minutos, 2009b). Twitter marcĂł el comienzo de una nueva revoluciĂłn en 2009 en Moldavia, un paĂ­s con muy poco desarrollo tecnolĂłgico que, para sorpresa de muchos, se convirtiĂł en herramienta esencial para los ciberactivistas que, con el hashtag #pman (abreviatura de la Plaza Marii Adunari Nacional de Chisinau, la capital de Moldavia) con-­ siguieron reunir a miles de jĂłvenes que protestaban por las irregu-­ laridades en el recuento de votos de las elecciones parlamentarias (PĂşblico 2009). Las revueltas en Moldavia se articularon en torno a los jĂłvenes, que al contrario de la mayorĂ­a de la poblaciĂłn adulta, sĂ­ tenĂ­an contacto y utilizaban las redes sociales e Internet. Como VHxDOy7KH1HZ<RUN7LPHV ´/DPDUHDGHMyYHQHVUHĂ HMDODSURIXQGDEUHFKDJHQHUDFLRQDO que se ha desarrollado en Moldavia, y los manifestantes usa-­ ron herramientas de su generaciĂłn (â&#x20AC;Ś), ademĂĄs de mensajes GHWH[WRXWLOL]DURQ)DFHERRN\7ZLWWHUODUHGGHPHQVDMHUtD social. Los manifestantes han creado su propia etiqueta de 119


Adolfo Ă lvaro MartĂ­n

bĂşsqueda en Twitter, animando a los moldavos a unirse e im-­ pulsando eventos en este pequeĂąo ex estado soviĂŠtico a una lista de Twitter de temas nuevos populares, para que la gente GH WRGR HO PXQGR SXHGD VHJXLUOHV OD SLVWDÂľ 7KH 1HZ <RUN Times, 2009). Su ĂŠxito provocĂł que, incluso ciberescĂŠpticos como Evgeny Moro-­ zov, reconociesen el valor de esta herramienta en un artĂ­culo pu-­ blicado en la revista Foreign Policy, en el que seĂąalaba: â&#x20AC;&#x153;Si usted me hubiera preguntado sobre las perspectivas de una revoluciĂłn Twitter impulsada en un paĂ­s de baja tecnolo-­ gĂ­a como Moldavia hace una semana, mi respuesta habrĂ­a sido SUREDEOHPHQWH XQ FXDOLĂ&#x20AC;FDGR ´QRÂľ +R\ VLQ HPEDUJR \D QR estoy tan seguro. Si se molestĂł en comprobar las discusiones mĂĄs populares en Twitter en las Ăşltimas 48 horas, es posible que se haya topado con una amenaza extraĂąa en los mensajes marcados con una etiqueta â&#x20AC;&#x153;# pmanâ&#x20AC;? (â&#x20AC;Ś) Los comentarios en Twitter estĂĄn apareciendo a un ritmo sin precedentes -­ He es-­ WDGRYLHQGRHOĂ XMRGH7ZLWWHUHQORV~OWLPRVPLQXWRV\YHR mas de 200 nuevos mensajes de Twitter marcados con â&#x20AC;&#x153;pmanâ&#x20AC;?, casi todos ellos en rumano, con solo uno o dos en InglĂŠs (â&#x20AC;Ś). Es probable que sea demasiado pronto para decir si la revolu-­ ciĂłn de Twitter en Moldavia tendrĂĄ ĂŠxito, pero sin duda serĂ­a un error no tener en cuenta el papel que Twitter y otras re-­ des sociales han jugado en la movilizaciĂłn y, mĂĄs aĂşn, en la informaciĂłn sobre las protestas. Por supuesto, ayuda el que los jĂłvenes moldavos estĂŠn hastiados y cansados del gobierno comunista (durante mucho tiempo el Ăşnico en Europa) y puede haber algunas razones para estar preocupados por irregulari-­ dades en la votaciĂłn, pero, en general, las protestas en Chisi-­ nau, sin duda, presentan un interesante caso de estudio que HVSHURTXHODVLQVWLWXFLRQHVDFDGpPLFDVFRPR+DUYDUG%HUN-­ man Center y los otros se tomen la molestia de examinar en detalle.â&#x20AC;? (Morozov, 2009b). 120


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

5HVXOWDQXQWDQWRFRQWUDGLFWRULDVHVWDVDĂ&#x20AC;UPDFLRQHVFRQORVDOH-­ gatos que el propio Morozov realizarĂ­a en su obra The Net De-­ lusion (2011), que ademĂĄs, tuvo la mala fortuna de ver la luz a primeros de enero de este aĂąo, tan solo unas semanas antes del GHUURFDPLHQWR GH 0XEDUDN GRQGH ODV UHGHV VRFLDOHV KDQ MXJDGR un papel decisivo. QuizĂĄs por estas contradicciones, el propio Mo-­ rozov se viĂł obligado a cambiar su discurso, reconociendo el poder GH ODV UHGHV VRFLDOHV DO VHxDODU TXH HO IDOOR GH 0XEDUDN IXH QR controlarlas a tiempo: ´6L0XEDUDNKXELHUDVLGRXQSRFRPiVDXWRULWDULR\KXELHUD apretado como se debe las tuercas de la web, entonces la revo-­ luciĂłn de las redes sociales habrĂ­a fracasadoâ&#x20AC;? (La NaciĂłn, 2011). En el caso de Moldavia, Morozov no fue capaz de comprender que las redes sociales llevaron a cabo el mismo trabajo que en 2007 realizaron los blogs en las revueltas francesas. En este paĂ­s caucĂĄ-­ sico, la mecha del estallido social partiĂł de un nodo situado en un extremo de la red; otra vez un nativo digital, en este caso la joven Natalia Morar, mandĂł un mensaje por medio de Twitter despuĂŠs GHXQDUHXQLyQGHYDULRVDPLJRVHQXQDFDIHWHUtDFRQODĂ&#x20AC;QDOLGDG de organizar una acciĂłn para protestar contra lo que consideraban era un fraude en el proceso electoral que llevarĂ­a a la victoria de los comunistas. Al igual que en Francia en 2007, Monar y sus amigos quedaron sorprendidos por la capacidad de las redes sociales para convocar a miles de jĂłvenes para denunciar el fraude electoral: â&#x20AC;&#x153;No solo subestimamos el poder de Twitter e Internet, ademĂĄs subestimamos el enfado entre los jĂłvenes por las polĂ­ticas gu-­ bernamentales y el fraude electoralâ&#x20AC;? (The Guardian, 2009). Otro ejemplo reseĂąable de cĂłmo Twitter estĂĄ sirviendo para reali-­ zar acciones de ciberactivismo es el llevado a cabo por la disidente cubana Yoani SĂĄnchez, quien no puede ver su cuenta por la cen-­ sura en la isla y se ve obligada a tuitear a ciegas desde su mĂłvil, recibiendo posteriormente los mensajes de miles de ciberactivistas 121


Adolfo Ă lvaro MartĂ­n

por medio de memorias USB o CD que le hacen llegar amigos y conocidos (El PaĂ­s, 2011c). En su tweet de 26 de marzo de 2010, Yoani contaba a sus miles de seguidores en esta red social su des-­ esperaciĂłn ante la censura de las autoridades castristas: â&#x20AC;&#x153;Twittear a ciegas es desesperante. No puedo leer los DM ni ponerme a seguir a otros. Al menos existe este canal para emi-­ tirâ&#x20AC;? (@yoanisanchez) Ello no ha impedido a Yoani haber realizado mĂĄs de 7.000 tweets y tener mĂĄs de 173.000 seguidores en esta red social, habiĂŠndo-­ VHFRQYHUWLGRHQODFLEHUDFWLYLVWDFXEDQDPiVIDPRVDHLQĂ X\HQWH TXHFRQVXWHVWLPRQLRJUiĂ&#x20AC;FR\HVFULWRHVWiSRQLHQGRYR]HLPDJHQ a las graves violaciones de los derechos humanos que se llevan a cabo en Cuba en los Ăşltimos aĂąos, lo que le ha hecho acreedora a numerosos premios, incluido el ser reconocida como una de las 100 SHUVRQDVPiVLQĂ X\HQWHVSRUODUHYLVWD7LPHHQ,PSUHVLR-­ nantes han sido sus tweets en los que narraba los actos cometidos por la policĂ­a castrista, como el de la detenciĂłn de Gillermo Fari-­ Ăąas el 27 de enero: â&#x20AC;&#x153;#cuba #GY Guillermo FariĂąas detenido en 3ra unidad de po-­ licĂ­a de Sta Clara, todavĂ­a tiene el mĂłvil encima y lo pueden llamar al +5352415709â&#x20AC;? (@yoanisanchez) Yoani ha puesto en valor de forma internacional la lucha de las de-­ nominadas â&#x20AC;&#x153;Damas de Blancoâ&#x20AC;?, que de forma heroica llevan aĂąos GHVDĂ&#x20AC;DQGRDODGLFWDGXUDFDVWULVWDTXHQRKDGXGDGRHQXWLOL]DU contra ellas todos los medios a su alcance para silenciar su voz. Este tweet de 17 de abril de 2010 es revelador de los mĂŠtodos uti-­ lizados contra las â&#x20AC;&#x153;Damas de Blancoâ&#x20AC;?. â&#x20AC;&#x153;24 Damas de Blanco en casa de Laura. Pollan. Acto de repu-­ dio. Calle cerrada totalmenteâ&#x20AC;?. (@yoanisanchez)

122


Nativos Digitales, Redes Sociales y PolĂ­tica 2.0

La importancia de Yoani Sanchez le ha granjeado muchos enemi-­ gos dentro y fuera de Cuba. A pesar de ello, ha conseguido ser una de las voces mĂĄs autorizadas sobre la realidad cubana, que gracias a Twitter ha conseguido que se conozca internacionalmente la rea-­ lidad que trata de ocultar el rĂŠgimen castrista. $Ă&#x20AC;QDOHVGHODxRFXDQGRODZHEGH:LNLOHDNVIXHLQXWLOL]DGD por la empresa que gestionaba sus DNS, los ciberactivistas de todo el mundo difundieron en segundos a travĂŠs de Twitter las nuevas direcciones, tal y como indica Eduardo Febbro (2010) en el blog RebeliĂłn.org: â&#x20AC;&#x153;(â&#x20AC;Ś) Anonymous perdiĂł sus dos plataformas virtuales de FRQYRFDWRULD OD FXHQWD ´2SHUDWLRQ 3D\EDFNÂľ HQ )DFHERRN \ â&#x20AC;&#x153;Anon_operationâ&#x20AC;? en Twitter, ambas suspendidas el miĂŠrcoles pasado. Pero una cuenta se abriĂł luego en Twitter (http://twit-­ ter.com/anonops) cuyo volumen de mensajes demuestra el eco que han tenido las iniciativas de Anonymous. Con el escĂĄnda-­ OR:LNLOHDNV\ORVVDEXHVRVGHOJORERDFHFKDQGRD-XOLDQ$V-­ sange, la insurrecciĂłn numĂŠrica se hizo una identidad sĂłlida. Quienes creĂ­an que estos ciberactivistas eran una cofradĂ­a de delirantes sin conexiĂłn con otra realidad que no fuera la de las computadoras descubrieron la pertinencia de una causa y la HĂ&#x20AC;FDFLDFRQTXHOHVIXHSRVLEOHGHIHQGHUOD No obstante, Anonymous delinea una corriente nueva en el mundo de la ciberdisidencia. Su envoltorio ideolĂłgico seĂąala una evoluciĂłn con respecto a quien ha sido el â&#x20AC;&#x153;padre de los SLUDWDVÂľ HO LQLFLDGRU GH XQD LGHD VHQFLOOD SHUR WHQD] +DNLP Bey. Bey, cuyo verdadero nombre es Lamborn Wilson, es un HVFULWRUSRpWLFR\PLOLWDQWHTXHVHDXWRGHĂ&#x20AC;QHFRPRXQ´DQDU-­ quista ontologistaâ&#x20AC;?. Bey teorizĂł las famosas TAZ, Zonas AutĂł-­ nomas Temporarias (Temporary Autonomous Zone en inglĂŠs) cuya misiĂłn es aparecer y desaparecer â&#x20AC;&#x153;para escapar mejor a los agrimensores del Estadoâ&#x20AC;?. Para Bay, la TAZ es una â&#x20AC;&#x153;in-­ 123


Adolfo Ă lvaro MartĂ­n

surrecciĂłn fuera del tiempo y de la historia, una tĂĄctica de la desapariciĂłnâ&#x20AC;?. Con ese principio funcionaron muchos piratas LQIRUPiWLFRVKDFNHUVFLEHUUHEHOGHV\KDELWDQWHVGHODFLEHU-­ cultura.â&#x20AC;? (VWDDFFLyQFRRUGLQDGDGHFLEHUDFWLYLVPRSHUPLWLyD:LNLOHDNVVHU clonado en 507 sitios en la Red, haciendo imposible que la acciĂłn de boicot retirase los documentos de Internet. Con las nuevas di-­ recciones difundidas por Twitter se estableciĂł un sistema deno-­ minado â&#x20AC;&#x153;mirrorsâ&#x20AC;?, que hace imposible el bloqueo de la difusiĂłn de informaciĂłn a travĂŠs de Internet, al imposibilitar la localizaciĂłn de la fuente (20minutos.es, 2010). Pero ha sido a partir del aĂąo 2011 cuando Twitter ha alcanzado su mĂĄxima relevancia como herramienta de movilizaciĂłn para los ciberactivistas en las revoluciones producidas en Egipto, Libia y TĂşnez. En todos los casos, Twitter ha ayudado en la organizaciĂłn de los activistas y servido para dar resonancia internacional a sus DFFLRQHV,QFOXVRFXDQGRHOGHSXHVWRSUHVLGHQWHHJLSFLR0XEDUDN ordenĂł a los proveedores de Internet â&#x20AC;&#x153;desenchufar el paĂ­sâ&#x20AC;?, cibe-­ ractivistas de todo el mundo ayudaron a los egipcios a saltarse la desconexiĂłn e, incluso, Twitter y Google crearon un sistema que permitiĂł a los ciberactivistas egipcios tuitear mediante una llama-­ da telefĂłnica local. Twitter tambiĂŠn ha sido el instrumento para dar visibilidad al con-­ Ă LFWRGH&RVWDGH0DUĂ&#x20AC;ORFXUULGRWUDVODVHOHFFLRQHVGHQRYLHPEUH de 2010. Nuevamente nativos digitales, jĂłvenes ciberactivistas, consiguieron evitar las restricciones en el uso de Internet impues-­ tas por su gobierno y, gracias al microblogging, consiguieron orga-­ nizarse en sus protestas y darlas a conocer de forma internacional. Miles de estos jĂłvenes fueron narrando por esta red todos y cada uno de los episodios violentos, convirtiĂŠndose en la Ăşnica fuente de informaciĂłn no controlada por las autoridades de este paĂ­s. (El PaĂ­s 2011d). 124


CAPÍTULO III

CIBERACTIVISMO Y MOVILIZACIONES CIUDADANAS EN AMÉRICA LATINA Y ESPAÑA


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

Como veremos a lo largo de este capĂ­tulo, en un periodo de poco mĂĄs de ocho aĂąos, se han producido en AmĂŠrica Latina y EspaĂąa algunas de las mĂĄs importantes movilizaciones ciudadanas a nivel global y, en todas ellas las TIC han tenido un sobresaliente papel que, cada vez, ha sido mĂĄs decisivo para la difusiĂłn y ĂŠxito de estas acciones polĂ­ticas. En todos ellos observaremos como los ciudadanos, ante la incapa-­ cidad de los actores polĂ­ticos tradicionales para responder a sus demandas y defender sus derechos en momentos concretos, se or-­ ganizan y actĂşan de forma autĂłnoma, aprovechando las posibili-­ dades que la tecnologĂ­a brindaba en cada momento para obtener y compartir informaciĂłn, comunicarse, construir su identidad y llevar a cabo sus acciones. Del â&#x20AC;&#x153;ÂżquiĂŠn ha sido?â&#x20AC;?, que gritaban los ciudadanos espaĂąoles tras el brutal atentado de 2004, al â&#x20AC;&#x153;Somos estudiantes de la Ibero, no acarreados, no porrosâ&#x20AC;?, que orgullosamente reivindicaban los es-­ tudiantes mexicanos en 2012 , ha habido un vertiginoso proceso de desarrollo del ciberactivismo en el que los ciudadanos, con un protagonismo creciente de los mĂĄs jĂłvenes, han forzado a los acto-­ res polĂ­ticos tradicionales a abandonar su posiciĂłn nuclear en el te-­ rreno polĂ­tico ante la irrupciĂłn de estas revoluciones horizontales. En el caso espaĂąol, analizaremos las movilizaciones de marzo de 2004, las protestas contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? de 2009-­2010 y el movi-­ PLHQWR0(Q(FXDGRUQRVĂ&#x20AC;MDUHPRVHQODOODPDGD´5HYROXFLyQ de los Forajidosâ&#x20AC;? que acabĂł con el presidente Lucio GutiĂŠrrez y, en MĂŠxico, la movilizaciĂłn de #InternetNecesario y el movimiento #YoSoy132.

127


Adolfo Álvaro Martín

3.1. ESPAÑA: Del “¿quién ha sido? al “no nos representan”.  /DVPRYLOL]DFLRQHVFLXGDGDQDVGHPDU]R El 11 de marzo de 2004 se produjeron en Madrid varias explosiones que causaron 191 muertos y 1.927 heridos graves entre los viajeros de varios trenes de cercanías que circulaban por las estaciones de El Pozo, Santa Eugenia y Atocha. La brutalidad de la acción crimi-­ nal provocó el caos en la ciudad, paralizando el servicio de metro y ferrocarril, suspendiendo la actividad de los colegios de la zona y GHELHQGRVHUGHVDORMDGRVHGLÀFLRV\FHQWURVS~EOLFRVSRUIDOVRVDYL-­ sos de bomba (El País, 11/03/2004). Las líneas de telefonía móvil, que en un primer momento permitieron a varios testigos informar de lo que estaba ocurriendo, se colapsaron rápidamente ante la avalancha de llamadas de ciudadanos que trataban de contactar con sus familiares y amigos tras los atentados. La situación llegó a ser tan dramática que los portavoces de las principales opera-­ doras, recomendaron a sus clientes la utilización de mensajes de WH[WRDÀQGHJDUDQWL]DUODFREHUWXUDHQODV]RQDVPiVDIHFWDGDV (El Mundo, 11/03/2004). Desde el primer momento, todas las miradas se volvieron hacia la banda terrorista ETA como principal sospechosa de la autoría de los atentados. Como veremos a continuación, a los pocos minu-­ tos de producirse las explosiones, políticos de todo signo, medios de comunicación y la inmensa mayoría de la ciudadanía hablaban abiertamente de la autoría de ETA. Esta creencia no estaba caren-­ te de fundamento puesto que a lo largo de los años, la banda te-­ rrorista había perpetrado atentados con gran número de muertos y heridos entre la población civil, bien en ataques a viviendas bien por la detonación de bombas en centros comerciales y cafeterías. (Fonoteca Cadena SER, Ibíd.). Sin embargo, cuando se habla de esos días de la denominada “re-­ vuelta de los móviles” (Campo Vidal, 2004), se aduce que el go-­ bierno de José María Aznar, desde el primer momento, trató de 128


Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

engañar a la ciudadanía para obtener réditos políticos de los aten-­ tados (Castells, 2009: 458). Esta acusación se sustentaría, en unos casos, en el hecho de que el Gobierno atribuyó la autoría a ETA sin tener prueba alguna (Castells 2009; De Ugarte, 2004) y, en otros, porque desde primeras horas el Ejecutivo tendría pruebas que apuntaban a Al Qaeda y no a ETA (Rodríguez, 2004; Campo Vidal, 2004; Sampedro Blanco, 2005). Se han señalado como causas del éxito del intento de manipulación en las primeras horas que, por una parte, ciudadanos y políticos estaban demasiado abrumados por la brutalidad de la acción (Cas-­ tells, 2009: 459) y, por otra, que los medios de comunicación con-­ vencionales habían tenido un comportamiento discutible al haber difundido informaciones interesadas, erróneas o falsas (Sampedro Blanco y López García 2004: 115; Campo Vidal 2004: 66; De Ugar-­ te 2004: 51; Castells 2009: 458). Respecto a la imputación de la autoría de los atentados a ETA el día 11 de marzo, desde primeras horas de la mañana, políticos de todo signo ya apuntaron a esta organización terrorista como la principal sospechosa (José Luis Rodríguez Zapatero, a las 8,50 ho-­ ras en la cadena SER). Y como el propio archivo sonoro de la cade-­ na SER acredita; políticos, periodistas, miembros de organizacio-­ nes sociales, tuvieron muy en cuenta los antecedentes de intentos fallidos de atentado por parte de ETA para imputarle la autoría durante el 11 de marzo de 2004 (boletín de la cadena SER de las 12,45 horas del día 11 de marzo). Respecto a si el Gobierno tuvo indicios o pruebas de la autoría islamista de los atentados desde las primeras horas debemos in-­ dicar que quedó acreditado en la Comisión de Investigación del Congreso de los Diputados, que los mandos policiales manifesta-­ ron una alarmante falta de coordinación a la hora de transmitir información sobre los explosivos utilizados en los atentados, lo que provocó errores en los datos trasladados a los responsables políti-­ 129


Adolfo Ă lvaro MartĂ­n

cos (ComisiĂłn de InvestigaciĂłn, sesiones de 7 y 14 de julio 2004, pp 80-­81 y 61-­64, respectivamente). Y asĂ­ lo expuso el diputado JanĂŠ I Guasch en la ComisiĂłn de InvestigaciĂłn del 11-­M, que relatĂł como a las 14,00 horas del dĂ­a de los atentados, miembros de Conver-­ gencia i UniĂł hablaron con mandos de la policĂ­a con los que tenĂ­an UHODFLyQTXLHQHVKDEUtDQFRQĂ&#x20AC;UPDGRDHVDVKRUDVTXHODDXWRUD era ETA. (ComisiĂłn de InvestigaciĂłn, sesiĂłn 14 de julio, p. 63). Respecto a la existencia de indicios o pruebas que vinculasen a Al Qaeda con los atentados en cancillerĂ­as extranjeras y medios de comunicaciĂłn internacionales, es relevante indicar que en las primeras horas del dĂ­a 11 de marzo las cancillerĂ­as extranjeras no parecen disponer de dato alguno que apuntase a la pista islamista, tal y como se desprende de la fonoteca de la cadena SER que, en su informaciĂłn econĂłmica de las 19,50 horas, informaba que las SpUGLGDVHQOD%ROVDGH1XHYD<RUNVHKDEtDQPRGHUDGRWUDVHO desmentido del Portavoz de la Casa Blanca sobre la existencia de prueba alguna de la autorĂ­a de los atentados por parte de Al Qae-­ da. Igualmente, la fonoteca de la cadena SER permite conocer que ningĂşn corresponsal en el extranjero aportĂł dato o indicio sobre la autorĂ­a islamista en aquellas primeras horas tras el atentado (in-­ formativo de las 14,00 horas; entrevista a corresponsal del Daily 0LUURU GH ODV  KRUDV   /R TXH Vt UHĂ HMDURQ DOJXQRV PHGLRV de comunicaciĂłn extranjeros fueron las declaraciones de Arnaldo Otegi realizadas en San Sebastian a las 10,30 horas del dĂ­a 11 de marzo, en la que negĂł la autorĂ­a de ETA y apuntĂł a â&#x20AC;&#x153;sectores de la resistencia ĂĄrabeâ&#x20AC;? como responsables de los asesinatos (BBC News, 11/03/2004). Sin embargo, en la noche de aquel dĂ­a 11 de marzo ya se habĂ­a instalado en una parte importante de la ciudadanĂ­a espaĂąola la creencia de que el Ejecutivo no era transparente y que habĂ­a mani-­ pulado la informaciĂłn sobre la autorĂ­a del atentado. A ello contri-­ EX\yGHIRUPDGHĂ&#x20AC;QLWLYDHOSDSHOGHVHPSHxDGRSRUODFDGHQD6(5 que a las 21,22 horas de ese dĂ­a, dio la noticia de la reivindicaciĂłn 130


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

del atentado por las Brigadas Abu Hafs al Masriel pese a que des-­ de el primer momento tuvo nula credibilidad para los investigado-­ res (CESID, 2004 y Carmon, 2004). Y, sobre todo, por la noticia difundida por la cadena SER en su informativo de las 22,00 horas del 11 de marzo, donde se infor-­ maba que â&#x20AC;&#x153;tres fuentes distintas de la lucha antiterrorista han FRQĂ&#x20AC;UPDGRDODFDGHQD6(5TXHHQHOSULPHUYDJyQGHOWUHQTXH explotaba antes de llegar a Atocha iba un terrorista suicida, Inte-­ ULRUQRORFRQĂ&#x20AC;UPDÂľ&RQHVWDLQIRUPDFLyQDODVGHODPDxD-­ na, tambiĂŠn abriĂł su informativo el dĂ­a 12 de marzo el periodista ,xDNL*DELORQGR /RVVRQLGRVGHODO0GH 11 de marzo, 06,00-­07,00 12 de marzo). AĂąos despuĂŠs, y ante las pruebas que acreditaban que aquella informaciĂłn era falsa (Comi-­ VLyQGH,QYHVWLJDFLyQVHVLyQMXOLRS HOSHULRGLVWD,xDNL Gabilondo tendrĂ­a que pedir disculpas por ello. (Periodista Digital, 6/11/2007). Es indudable que la cadena SER se convirtiĂł desde la noche del 11 de marzo en el principal catalizador de informaciones y opinio-­ QHVTXHSRQtDQHQWHODGHMXLFLRODDFFLyQGHO*RELHUQRLQĂ X\HQGR entre la ciudadanĂ­a mĂĄs prĂłxima a las posiciones polĂ­ticas de iz-­ quierdas, que siempre han manifestado una gran sintonĂ­a con este medio de comunicaciĂłn del grupo PRISA, al que tambiĂŠn pertene-­ FHHOGLDULR(O3DtV 3HULRGLVWD'LJLWDO(O&RQĂ&#x20AC;GHQFLDO Digital, 20/10/2010). De hecho, a partir de la informaciĂłn del terrorista suicida, la cade-­ na SER comienza a realizar una vinculaciĂłn entre la participaciĂłn HQOD*XHUUDGH,UDN\HOSHOLJURGHVHUREMHWRGHDWHQWDGRVLVODPLV-­ tas (Los sonidos del 11 al 14 M de 2004. 22.00-­23.00 11 de marzo). De esta forma, el encuadre se situarĂ­a no tanto en el origen isla-­ mista de los atentados sino en que el Gobierno estĂĄ ocultando in-­ formaciĂłn o no dice la verdad, y la lectura polĂ­tica de los atentados lleva a la culpabilizaciĂłn del Ejecutivo de JosĂŠ MarĂ­a Aznar por KDEHUDSR\DGRODJXHUUDHQ,UDN &DVWHOOV  131


Adolfo Ă lvaro MartĂ­n

AdemĂĄs, la posiciĂłn del Gobierno se vio rĂĄpidamente debilitada por la rigidez de los actores gubernamentales, que no fueron ca-­ SDFHVGHĂ H[LELOL]DUVXHQFXDGUHGHORVDWHQWDGRVDPHGLGDTXHVH conocĂ­an nuevas noticias (Olmeda, 2005: 25). 7RGRV ORV HOHPHQWRV QDUUDGRV FRQĂ X\HURQ OD WDUGH GHO GtD  GH marzo durante las manifestaciones convocadas por el Gobierno, iniciĂĄndose un proceso de comunicaciĂłn alternativa (Castells 2009:468) en el que los ciudadanos comenzaron a expresar su des-­ FRQĂ&#x20AC;DQ]DDQWHODYHUVLyQRĂ&#x20AC;FLDO\DUHFODPDUFRQRFHUORTXHHVWDED pasando al grito de â&#x20AC;&#x153;ÂżQuiĂŠn ha sido?â&#x20AC;? (El PaĂ­s, 27/03/2004). Esta insatisfacciĂłn con lo que estaba ocurriendo provocĂł que pequeĂąos grupos se organizasen de forma alternativa, especialmente en Madrid y Barcelona, realizando esa misma noche del dĂ­a 12 cace-­ roladas y concentraciones espontĂĄneas ante las sedes del Partido Popular (Sampedro Blanco, 2005). Estas primeras protestas fueron difundidas en el programa A vivir que son dos dĂ­as de la cadena SER del dĂ­a 13 de marzo, donde Fer-­ nando Delgado seĂąalĂł que el clamor de las manifestaciones del dĂ­a anterior habĂ­a sido la pregunta â&#x20AC;&#x153;ÂżQuiĂŠn ha sido?â&#x20AC;? (Los sonidos del 11 al 14 M de 2004. 9,00-­10,00 13 de marzo, 2004). Nuevamente podemos comprobar que, al igual que pasĂł el dĂ­a 11 por la noche, la cadena SER se adelantĂł con un encuadre distinto que permitirĂ­a situar las causas de las movilizaciones del 13 por la tarde en el â&#x20AC;&#x153;descontento espontĂĄneoâ&#x20AC;? de la ciudadanĂ­a expresado en las mani-­ festaciones del dĂ­a 12. Sobre el origen de las movilizaciones producidas en la tarde del dĂ­a GHPDU]RTXHQRROYLGHPRVHUDODMRUQDGDGHUHĂ H[LyQSUHYLD a las elecciones, hay quiĂŠn las sitĂşa en los movimientos sociales y, otros en entornos cercanos al PSOE (Doval AvendaĂąo, 2009: 273). Con independencia de quien haya sido la persona creadora del SMS, resulta indiscutible que la cadena SER jugarĂ­a un papel esencial para su ĂŠxito preparando el terreno, pues en su progra-­ maciĂłn de la maĂąana del dĂ­a 13 se volviĂł a repetir que â&#x20AC;&#x153;hay dos 132


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

preguntas sin respuesta: por quĂŠ y quiĂŠn ha sidoâ&#x20AC;?(Los sonidos del 11 al 14 M de 2004. 9,00-­10,00 y 15,00-­16,00 horas, 13 de marzo, 2004). Y si bien compartimos la opiniĂłn de CaĂąada (2004), respecto a que el ĂŠxito de la convocatoria radicĂł en la funcionalidad de los telĂŠfo-­ nos mĂłviles para poder mandar muchos SMS convirtiendo a cada usuario en un nodo difusor, no es menos cierto que esta convo-­ catoria no es fruto espontĂĄneo de ciudadanos anĂłnimos, sino que surgiĂł de sectores movilizados polĂ­ticamente con contactos en los medios de comunicaciĂłn que dispusieron desde el primer momento de su cobertura para ampliar su difusiĂłn. Como acredita Doval AvendaĂąo (ob. cit: 232), entre los primeros asistentes a la convo-­ catoria (entre 50 y 100 personas en palabras de Javier Torres de la cadena SER), ya habĂ­a una importante representaciĂłn de perio-­ distas que comenzaron a mandar informaciĂłn a sus redacciones, asegurando la rĂĄpida presencia de sus medios de comunicaciĂłn en las concentraciones. La cadena SER volviĂł a resultar esencial en la difusiĂłn de las mo-­ vilizaciones, cuando a las 18,30 horas interrumpiĂł su programa es-­ trella Carrusel Deportivo, para conectar en directo con la sede del Partido Popular en Madrid, e informar que a esas horas ya habĂ­a una muchedumbre de 3.000 Ăł 4.000 personas, gritando consignas como â&#x20AC;&#x153;ÂżQuiĂŠn ha sido?â&#x20AC;?. (Los sonidos del 11 al 14 M de 2004. 18,00-­ 19,00 horas, 13 de marzo de 2004). La difusiĂłn de la convocatoria por la Cadena SER permitiĂł un es-­ pectacular aumento de asistentes, al fomentar que se reprodujesen las movilizaciones ante las distintas sedes del Partido Popular. Como seĂąala CaĂąada (ob. cit.), la radio (broadcast) se convirtiĂł en HO DPSOLĂ&#x20AC;FDGRU GH ORV PyYLOHV UHG  JHQHUDQGR XQD UHWURDOLPHQ-­ taciĂłn entre ambos, de forma que a medida que crecĂ­a el nĂşmero de manifestantes, mĂĄs intenso era el mensaje que se retransmitĂ­a por radio y mĂĄs gente se unĂ­a a las protestas y mandaba mensajes. 133


Adolfo Ă lvaro MartĂ­n

/DLPSRUWDQFLDGHOD&DGHQD6HUVHJ~QPDQLĂ&#x20AC;HVWD3RQWL6RUULEHV (2004) tambiĂŠn se produjo en Internet, pues su web multiplicĂł por cuatro el nĂşmero de visitantes durante el dĂ­a 11 de marzo y, en los dĂ­as siguientes, la cifra de visitas diarias superĂł los 200.000, lo que suponĂ­a el doble de la media de visitas a la web de la emisora en aquel aĂąo. A la hora de analizar el papel que Internet y los blogs tuvieron en los acontecimientos producidos entre el 11 y el 14 de marzo de 2004, debe resaltarse el importante aumento en el uso de Internet (EGM, 2004). Este incremento, segĂşn declarĂł MartĂ­ Crespo, redac-­ tor de Vilaweb a Pont i Sorribes (ob. cit.), fue consecuencia de que los internautas buscaron en la red un complemento a la informa-­ FLyQTXHĂ XtDSRUORVPHGLRVWUDGLFLRQDOHV â&#x20AC;&#x153;la mayorĂ­a de los usuarios, segĂşn los datos que ofrece la lectu-­ ra de visitas a las webs, primero se informaron a travĂŠs de los medios convencionales (televisiĂłn y radio) y despuĂŠs buscaron en Internet complementar y enriquecer la informaciĂłn. AsĂ­, en el caso de la disyuntiva de la autorĂ­a de la masacre del 11-­M, el internauta intentĂł buscar su propia realidad, contrastando y analizando el contenido de las diferentes fuentes (de medios convencionales o no) en Internetâ&#x20AC;?. Respecto a los blogs, GarcĂ­a (2004) seĂąala que, mientras los me-­ dios de comunicaciĂłn tradicional tuvieron su mayor difusiĂłn el dĂ­a de los atentados, los blogs mantuvieron una audiencia estable a lo largo de los cuatro dĂ­as. Doval AvendaĂąo (2009) considera que HO0VLJQLĂ&#x20AC;FyXQD´SUXHEDGHIXHJRTXHUHYHOyVXVJUDQGH]DV y limitaciones: supuso un nuevo mĂŠtodo de compartir una expe-­ riencia traumĂĄtica para la ciudadanĂ­a y por otra parte revelĂł que, QRSRUHOORVHHVWiPHMRULQIRUPDGRÂľ(VWDDĂ&#x20AC;UPDFLyQVHEDVDHQ que la mayorĂ­a de los blogueros entrevistados acudieron de for-­ ma mayoritaria a los medios de comunicaciĂłn tradicionales para informar y opinar sobre lo que estaba ocurriendo y, solo en casos 134


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

muy puntuales, se proporcionĂł informaciĂłn paralela a la ofrecida SRUORVPHGLRVWUDGLFLRQDOHVRVHUHDOL]DURQWHVWLPRQLRVJUiĂ&#x20AC;FRVR informaciĂłn a pie de calle. Doval AvendaĂąo realizĂł una serie de entrevistas a los principales EORJXHURVHVSDxROHVDFWLYRVHQDTXHOODVIHFKDVUHVXOWDQGRVLJQLĂ&#x20AC;-­ cativa la opiniĂłn de JosĂŠ Luis Orihuela, autor del blog eCuaderno: â&#x20AC;&#x153;Los blogs y los foros fueron una gran vĂĄlvula de escape, todo el mundo tenĂ­a opiniones, teorĂ­as y anĂĄlisis, aunque francamente poca informaciĂłn. Sirvieron para que la sociedad civil se expre-­ sara y movilizara, como cauce de comunicaciĂłn alternativo y como una salvaguardia pĂşblica de que la informaciĂłn relevante podrĂ­a circular por canales distintos de los medios tradiciona-­ lesâ&#x20AC;?. (IbĂ­d, 205) Puede observarse la imagen idealizada que aquellos blogueros te-­ nĂ­an de lo ocurrido pues, como hemos indicado anteriormente, la informaciĂłn relevante que mayoritariamente se transmitiĂł por los blogs y foros fue la que previamente aparecĂ­a en los medios de co-­ municaciĂłn tradicionales. En este sentido debe tenerse en cuenta que, en 2004, el uso de los blogs era incipiente en EspaĂąa, y que su popularizaciĂłn se producirĂ­a a partir del aĂąo siguiente (El Mundo, 2005c). Finalmente, respecto a las webs alternativas o â&#x20AC;&#x153;no-­mediaâ&#x20AC;?, Pont i Sorribes (ob.cit.) seĂąala que Inydimedia.org, contrastant.net o la-­ haine.org tuvieron un importante ĂŠxito entre los dĂ­as 11 al 14 de marzo de 2004, como catalizadores de informaciĂłn y opiniĂłn de los internautas: â&#x20AC;&#x153;Los portales de contra-­informaciĂłn (â&#x20AC;Ś) canalizaron la comuni-­ caciĂłn interpersonal hasta convertirla en un diĂĄlogo de alcance colectivo. Fueron (sobre todo la contra-­informaciĂłn) plataformas de expresiĂłn de los movimientos ciudadanos y de la izquierda social. A travĂŠs de estos medios se difundĂ­an y debatĂ­an las no-­ 135


Adolfo Ă lvaro MartĂ­n

ticias de los grandes medios espaĂąoles, pero tambiĂŠn de otros mĂĄs lejanos para el gran pĂşblico (por ejemplo, la prensa y las televisiones internacionales). Se constituyeron asĂ­ espacios de discusiĂłn habilitados para el intercambio de opiniones persona-­ les que, en Ăşltima instancia, cobraron una dimensiĂłn colectiva y contribuyeron a la formaciĂłn acelerada de la opiniĂłn pĂşblicaâ&#x20AC;?. (Sampedro Blanco y LĂłpez GarcĂ­a, 2005: 130). De lo anterior, podemos deducir que al igual que en el caso de los blogs, estas webs se nutrieron principalmente de las informaciones que iban difundiendo los medios de comunicaciĂłn tradicionales. Y, al estar la mayorĂ­a de sus usuarios en el entorno de izquierda po-­ lĂ­tica, sin duda las informaciones y opiniones que la Cadena SER IXHGDQGRDORODUJRGHHVRVGtDVWXYRHQWRGRVHOORVXQDLQĂ XHQFLD capital. Finalmente indicar que, si bien en aquellos acontecimientos los blogs y las webs alternativas continuaban nutriĂŠndose de informa-­ ciones provenientes de los medios tradicionales, comenzaban ya a plasmar uno de los elementos esenciales que ha dado valor a estas herramientas en el futuro, que es la capacidad que tendrĂĄn para LQĂ XLU\JHQHUDURSLQLyQSDUDFRQHOORLQĂ XLUHQODDJHQGDSROtWLFD

2.

Las protestas contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;?.

En noviembre de 2009 el Gobierno presenta el anteproyecto de la â&#x20AC;&#x153;Ley de EconomĂ­a Sostenibleâ&#x20AC;? que, en principio, parecĂ­a tener como objetivo propiciar un cambio de modelo productivo en Espa-­ Ăąa como consecuencia de la aguda crisis en la que habĂ­a entrado EspaĂąa. A Ăşltima hora se incorporĂł por el Ministerio de Cultu-­ ra una disposiciĂłn que ha pasado a ser conocida como Ley Sinde (en referencia al apellido de la ministra del ramo Ă ngeles GonzĂĄ-­ lez Sinde), que permite el cierre administrativo de pĂĄginas Web sin previa autorizaciĂłn judicial. Ello produjo una reacciĂłn entre 136


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

los internautas espaĂąoles que en pocas horas, y gracias al uso de Twitter, blogs y redes sociales, se movilizaron de manera masiva al considerar que esta norma afectaba al libre ejercicio de los de-­ rechos de expresiĂłn, informaciĂłn y acceso a la cultura a travĂŠs de Internet. Uno de los ciberactivistas que mĂĄs relevancia tuvo en este periodo fue Enrique Dans, que consiguiĂł que su post de de-­ nuncia de lo que luego serĂ­a conocido como â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? tuviese 942 enlaces en los primeros dĂ­as de la protesta (ABC, 2009). (OSULPHUSDVRGHODSURWHVWDIXHODHODERUDFLyQGHXQ0DQLĂ&#x20AC;HVWR de forma colaborativa por un grupo de internautas en la tarde del dĂ­a 2 de diciembre de 2009, usando la herramienta en beta Google Wave (hoy desaparecida), y esa misma tarde comenzĂł a difundirse SRU ODV UHGHV VRFLDOHV  0LQXWRV F  (O ´0DQLĂ&#x20AC;HVWRÂľ WXYR GHVGHHOSULPHUGtDSiJLQDHQ)DFHERRN\VHFRQYLUWLyHQXQDGH las principales herramientas con las que miles de jĂłvenes cibe-­ ractivistas manifestaron su rechazo, alcanzando en el primer dĂ­a 50.000 adhesiones a la protesta. Esta pĂĄgina, ademĂĄs, sirviĂł para difundir las convocatorias y noticias sobre la reuniĂłn de los inter-­ nautas con la Ministra de Cultura (El PaĂ­s, 2009c). Posteriormen-­ te, en 2010, durante el debate del proyecto de ley en el Congreso en diciembre de 2010. La pĂĄgina mĂĄs popular fue â&#x20AC;&#x153;Somos mĂĄs de 1.000.000 contra la ley anti-­descargas, Sinde dimisiĂłnâ&#x20AC;?, al que se unieron mĂĄs de 300.000 personas, y que se difundiĂł rĂĄpidamente por todo tipo de redes sociales y blogs (Medina, 2010). 7ZLWWHUFRPHQ]yDVHUXWLOL]DGDGHIRUPDHĂ&#x20AC;FD]SRUORVFLEHUDFWL-­ vistas espaĂąoles en las protestas contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? en diciem-­ bre de 2009 (20minutos.es, 2011 y El PaĂ­s, 2011c). Sin embargo, no es hasta el momento en el que el Gobierno de JosĂŠ Luis RodrĂ­guez Zapatero aprueba el proyecto de ley de EconomĂ­a Sostenible en marzo de 2010, cuando los ciberactivistas se movilizan otra vez, y cuando Twitter comienza a adquirir verdadera relevancia (El PaĂ­s, 2010). En diciembre de 2010 el proyecto de ley llega al Congreso de los Diputados para ser aprobado por la CĂĄmara, y Twitter se 137


Adolfo Ă lvaro MartĂ­n

convierte en la herramienta principal de difusiĂłn de las protestas y las informaciones de los ciberactivistas contra la ley. En Twitter, los ciberactivistas dieron a conocer la etiqueta â&#x20AC;&#x153;Sindegateâ&#x20AC;?, que acabĂł convirtiĂŠndose en el apodo con el que se bautizĂł al proyecto de ley (El PaĂ­s, 2010b), lo que convirtiĂł a las movilizaciones contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? en trending topic o tema del momento. (El Mundo 2010; La Vanguardia, 2010b y 20minutos.es, 2010b). El ciberactivismo consiguiĂł apuntarse un ĂŠxito sin precedentes en EspaĂąa, al forzar una reuniĂłn con el Ministerio de Cultura gracias a las movilizaciones realizadas en Internet y las redes sociales en contra la denominada â&#x20AC;&#x153;Ley Sindeâ&#x20AC;?. JesĂşs Encinar lo cuenta asĂ­ en su blog en un post del dĂ­a 3 de diciembre de 2009: â&#x20AC;&#x153;Ayer por la tarde tenĂ­a bastantes llamadas perdidas de un nĂşmero oculto. No respondo a llamadas de ocultos ni nĂşmeros que no conozco. A las 20h me dejaron un mensaje escueto de ÂŤle llamamos del Ministerio de Cultura, por favor llĂĄmenosÂť. Me invitaron a una reuniĂłn hoy en el Ministerio, la persona con la que hablĂŠ no supo decirme la agenda, los invitados ni el tema, aunque me lo podĂ­a imaginar: una reuniĂłn para hablar de la nueva legislaciĂłn que el gobierno quiere introducir y el Mani-­ Ă&#x20AC;HVWR HQ GHIHQVD GH ORV GHUHFKRV IXQGDPHQWDOHV GH ,QWHUQHW que muchos blogs han recogido. â&#x20AC;&#x153; Las fotos de la reuniĂłn con la ministra GonzĂĄlez-­Sinde colgadas en )OLFNUSRU(QFLQDUIXHURQUHSURGXFLGDVFDVLGHIRUPDLQPHGLDWD por multitud de medios de comunicaciĂłn tradicionales, que se vie-­ ron relegados a meros difusores de las noticias difundidas por los ciberactivistas. (ABC, El Mundo, La Vanguardia, 2009 y El PaĂ­s 2009b). (QGHĂ&#x20AC;QLWLYDVLJXLHQGRD)UHLUH REFLW ODLQĂ XHQFLDHQOD5HG de la blogosfera en las movilizaciones contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? se pro-­ dujo de dos formas diferentes que son complementarias y actĂşan de forma simultĂĄnea: por un lado, activando los enlaces dĂŠbiles 138


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

que permitieron conexiones de â&#x20AC;&#x153;larga distanciaâ&#x20AC;?, y por otro, acti-­ YDQGRXQQ~PHURSHTXHxRGHHQODFHVFRQXQDJUDQLQĂ XHQFLDHQ otros nodos de la red que, a su vez, fueron muy relevantes tanto en el mundo virtual como en el mundo fĂ­sico. Esto permitiĂł a la blogosfera, aĂşn contando con elementos limitados, tener una ca-­ SDFLGDGGHLQĂ XHQFLDPX\HOHYDGDVREUHODVpOLWHVSROtWLFDVKDVWD el punto de forzarles a sentarse en una mesa de negociaciĂłn. La movilizaciĂłn contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? tuvo un gran impacto entre ORV´QDWLYRVGLJLWDOHVÂľFRPRUHĂ HMyHOHVWXGLROOHYDGRDFDERDORV pocos meses de las mismas (Ă lvaro y SĂĄnchez-­BurĂłn, 2010) que, DGHPiVSXVRGHPDQLĂ&#x20AC;HVWRYDULDVWHQGHQFLDVTXHIXHURQFRQĂ&#x20AC;U-­ madas posteriormente por el movimiento 15M: 1. Por primera vez, se tuvo la percepciĂłn de la utilidad de Inter-­ net y las redes sociales para la movilizaciĂłn polĂ­tica, puesto que el 80% de los universitarios considerĂł que las moviliza-­ ciones nacidas en la Red fueron un ĂŠxito. 2. AdemĂĄs, la gran mayorĂ­a de los jĂłvenes universitarios consi-­ derĂł que las protestas contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? mostraron la im-­ SRUWDQWHGH,QWHUQHWSDUDSRGHULQĂ XLUHQODDJHQGDSROtWLFD 3. /DV PRYLOL]DFLRQHV VLJQLĂ&#x20AC;FDURQ XQ GHVSOD]DPLHQWR GH ORV medios de comunicaciĂłn e informaciĂłn tradicionales de su centralidad en el manejo de la informaciĂłn: los jĂłvenes acti-­ vistas utilizaron Internet y la televisiĂłn como canales prin-­ cipales para informarse y comunicarse sobre las protestas, desplazando a medios tradicionales como la prensa o la ra-­ dio. Incluso, en el caso de los activistas varones, Internet desbancĂł a la televisiĂłn como primer medio de comunicaciĂłn e informaciĂłn en las protestas. 4. Un 70% de los universitarios seĂąalaron que la presiĂłn de los internautas obligĂł al gobierno espaĂąol a hacer cambios en la ley, dando con ello carta de naturaleza a la fuerza de los movimientos ciudadanos como actores polĂ­ticos emergentes. 139


Adolfo Ă lvaro MartĂ­n

$ OD YLVWD GH ODV FRQFOXVLRQHV GHO HVWXGLR SRGHPRV DĂ&#x20AC;UPDU TXH ODV PRYLOL]DFLRQHV FRQWUD OD ´/H\ 6LQGHÂľ VLJQLĂ&#x20AC;FDURQ XQ DQWHV \ un despuĂŠs en el ciberactivismo en EspaĂąa. A diferencia de las protestas del 2004, los medios de comunicaciĂłn tradicional apenas tuvieron importancia a la hora de la movilizaciĂłn ciudadana, viĂŠn-­ GRVH UHOHJDGRV D PHURV DPSOLĂ&#x20AC;FDGRUHV GH OR TXH VH GHVDUUROODED y difundĂ­a online. Igualmente, los actores polĂ­ticos tradicionales quedaron totalmente excluidos de este proceso, siendo desplazados de su centralidad a la hora de elaborar la agenda polĂ­tica por un PRYLPLHQWRFLXGDGDQRJHVWDGRGHVGHHOHQWRUQRWHFQROyJLFRFRQĂ&#x20AC;-­ gurado por colectivos heterogĂŠneos que, sin embargo, tenĂ­an claro un objetivo polĂ­tico que, al menos parcialmente, fue conseguido. Los ciudadanos pudieron percibir que gracias a las herramientas tecnolĂłgicas podĂ­an visibilizarse y difundir sus propuestas sin de-­ pender de los medios de comunicaciĂłn, que Internet y las redes VRFLDOHV OHV SHUPLWtDQ FRRUGLQDUVH \ OOHYDU D FDER DFFLRQHV HĂ&#x20AC;FD-­ ces en defensa de sus intereses y que, por primera vez, podĂ­an SDUWLFLSDUHQODFRQĂ&#x20AC;JXUDFLyQGHODDJHQGDSROtWLFDVLQGHSHQGHU GHORVDFWRUHVSROtWLFRVWUDGLFLRQDOHV8QFRQMXQWRGHUHĂ H[LRQHV\ enseĂąanzas que poco tiempo despuĂŠs desarrollarĂ­a con gran ĂŠxito el movimiento 15M.

 (OPRYLPLHQWR0 1. CronologĂ­a. Los orĂ­genes de lo que popularmente se ha venido en llamar el â&#x20AC;&#x153;15Mâ&#x20AC;?, tiene sus antecedentes en las movilizaciones contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;?, concretamente en la campaĂąa iniciada contra los partidos SROtWLFRV SRU PHGLR GHO KDVKWDJ QROHVYRWHV FRQ OD Ă&#x20AC;QDOLGDG GH castigar en las elecciones municipales y autonĂłmicas de mayo de 2011 a los que permitieron la aprobaciĂłn de la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;?. Esta movilizaciĂłn vĂ­a Twitter expresĂł una nueva clave de protesta ge-­ 140


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

neral contra todo partido que en algĂşn momento hace algo que disgusta a colectivos de ciudadanos. (El Mundo, 2011). AsĂ­, cuando comenzaron las movilizaciones del movimiento 15-­M en mayo de 2011, el slogan #NoLesVotes volviĂł a difundirse a toda velocidad a travĂŠs de Twitter por todo el paĂ­s (antena3.com, 2011), consiguiendo alcanzar repercusiĂłn internacional (The Washington Post, 2011). En estos primeros pasos tuvo una gran importancia â&#x20AC;&#x153;Democracia 5HDO<DÂľ '5< TXHVHJ~Q7RUHW  VHFRQĂ&#x20AC;JXUyFRPR un â&#x20AC;&#x153;movimiento auto-­organizado y posmediaâ&#x20AC;? que se habĂ­a inspi-­ rado â&#x20AC;&#x153;en las revueltas ĂĄrabes e islandesaâ&#x20AC;?, y que se organizĂł a traves de las redes sociales mĂĄs utilizadas en EspaĂąa (Twitter, Youtube y Tuenti) para difundir sus propuestas y generar empa-­ tĂ­a hacia la movilizaciĂłn que querĂ­an plantear. Esta ausencia de HVWUXFWXUDIRUPDORIĂ LQHQROHVLPSLGLyFRQYRFDUXQDPRYLOL]DFLyQ FLXGDGDQDFRQHOĂ&#x20AC;QGHPDQLIHVWDUVXSURWHVWDFRQWUDORVSDUWLGRV tradicionales en las elecciones autonĂłmicas y municipales del 22 de mayo de 2011 (ExpansiĂłn, 2011). El ĂŠxito de DRY serĂ­a absoluto, al convocar a travĂŠs de las redes sociales a miles de ciudadanos, especialmente jĂłvenes, que se con-­ centrarĂ­an en cincuenta ciudades de EspaĂąa exigiendo â&#x20AC;&#x153;un cambio de rumbo y un futuro dignoâ&#x20AC;? (El PaĂ­s, 2011e). En este punto se hace necesario hacer una referencia al libro â&#x20AC;&#x153;ÂĄIn-­ dignaos!â&#x20AC;? de StĂŠphane Hessel y la relevancia que tal obra pudo tener en las movilizaciones de aquellos dĂ­as. Carlos Taibo (2011: 44), uno de los impulsores del movimiento 15M, es taxativo a este respecto: â&#x20AC;&#x153;Salta a la vista que la abrumadora mayorĂ­a de las personas que, desde mediados de mayo de 2011, han ocupado plazas y calles no lo han hecho porque les haya iluminado la lectura del brevĂ­simo libro de Hessel(â&#x20AC;Ś)â&#x20AC;?. 141


Adolfo Ă lvaro MartĂ­n

Y, sin embargo, no puede negarse el valor simbĂłlico que tuvo la obra de Hessel, pues los activistas que acudieron a las acampadas y movilizaciones fueron conocidos popularmente como â&#x20AC;&#x153;indigna-­ GRVÂľHKLFLHURQGHHVWHFDOLĂ&#x20AC;FDWLYRDOLJXDOTXHRFXUULyHQ(FXDGRU con â&#x20AC;&#x153;los forajidosâ&#x20AC;?, un signo de identidad que les permitiĂł identi-­ Ă&#x20AC;FDUVH\GDUSUR\HFFLyQDVXVSURWHVWDVHQWUHODRSLQLyQS~EOLFD A partir de esa fecha, los â&#x20AC;&#x153;indignadosâ&#x20AC;? iniciaron acampadas y ac-­ ciones en distintas ciudades espaĂąolas, en las que resultĂł decisivo para su ĂŠxito el uso que de Twitter hicieron los ciberactivistas, y que provocĂł que los medios internacionales comparasen este hecho con lo ocurrido en las manifestaciones llevadas a cabo en Egipto (BBC.com, 2011). El dĂ­a 15 de mayo de 2011, apenas una semana antes de las elec-­ ciones municipales y autonĂłmicas en las que el derechista Partido Popular (PP) era el mĂĄximo favorito, DRY convocĂł a travĂŠs de las redes sociales manifestaciones por todo el paĂ­s, reuniĂłn que fue es-­ pecialmente numerosa en Madrid y que acabĂł con incidentes entre ORV PDQLIHVWDQWHV \ OD SROLFtD $ OD Ă&#x20AC;QDOL]DFLyQ GH OD FRQFHQWUD-­ ciĂłn en la capital de EspaĂąa, varias decenas de jĂłvenes decidieron acampar en la Puerta del Sol para continuar con las protestas has-­ ta el dĂ­a de las elecciones municipales y autonĂłmicas, difundiendo la acciĂłn por medio de Twitter con el hastag #acampadasol. El 17 de mayo a primera hora de la maĂąana, la policĂ­a desalojĂł a los acampados en la Puerta del Sol. Sin embargo, esa misma tarde, miles de â&#x20AC;&#x153;indignadosâ&#x20AC;? volvieron a ocupar la plaza e inicia-­ ron una nueva acampada mĂĄs multitudinaria (EL PAĂ?S, 2011f). Se organizaron asambleas dentro del campamento, y comenzaron su actividad diversas comisiones que se ocupaban de temas que iban desde la infraestructura a la comunicaciĂłn. Las acampadas se extendieron a otras ciudades espaĂąolas, como Barcelona, donde los â&#x20AC;&#x153;indignadosâ&#x20AC;? se instalaron en la Plaza de CataluĂąa. (PĂşblico, 2011). 142


Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

El 18 de mayo, la Junta Electoral de Madrid desautorizó la concen-­ tración prevista para esa tarde, lo que no arredró a miles de ciu-­ dadanos que decidieron acercarse a la Puerta del Sol para mostrar su apoyo a los acampados durante los dos siguientes días (Público, 2011b). La tensión fue en aumento a lo largo del día 20 de mayo, último de la campaña electoral, ya que desde sectores próximos al PP se acu-­ saba a los “indignados” de estar siendo agitados por los socialis-­ tas para impedir la victoria de los populares en las elecciones del domingo (ABC, 2011). A ello respondieron desde la acampada en la Puerta del Sol desvinculandose del proceso electoral mediante una original acción denominada “grito mudo”, llevada a cabo unos minutos antes del inicio de la jornada electoral, como muestra de su rechazo a los partidos políticos (Público, 2011c). Según una encuesta publicada por el diario El País (2011g), un 66% de los encuestados manifestó simpatía por el “Movimiento 15-­M”, el 81% pensaba que los indignados tienen razón y, el 84% consideraba que este movimiento trata de los problemas que afec-­ tan directamente a los ciudadanos. El Movimiento 15-­M también consiguió introducir en la agenda política el debate sobre la trans-­ formación de las formas de representación y decisión. Así lo ve Manuel Castells en un artículo en el diario La Vanguardia del 18 de junio de 2011: “Un sistema tan descentralizado y plural de deliberación y de-­ cisión se apoya para funcionar en dos condiciones clave. Por un lado, el respeto y la tolerancia (….) Por otro lado, siempre están las redes de Internet como estructura de apoyo y comu-­ nicación para informar, para debatir, para pedir solidaridad y auxilio en momentos duros.(…) Es un desafío radical, aunque no violento, al orden social, y hay conciencia de las consecuen-­ cias.”

143


Adolfo Ă lvaro MartĂ­n

El dĂ­a 22 de mayo de 2011, el derechista PP consiguiĂł una gran victoria en las elecciones municipales y autonĂłmicas espaĂąolas, superando en diez puntos al PSOE (El PaĂ­s, 2011h). Los acam-­ pados en la Puerta del Sol no realizaron valoraciĂłn alguna de los UHVXOWDGRVSXHVVHJ~QDĂ&#x20AC;UPDURQORVSDUWLGRVTXHVHSUHVHQWDEDQ no los representan y, por ello, los resultados de las elecciones no WHQtDQYDORUDOJXQR3HVHDKDEHUĂ&#x20AC;QDOL]DGRODFDPSDxDHOHFWRUDO el movimiento 15-­M decidiĂł continuar con sus campamentos una semana mĂĄs para reclamar una democracia real y, posteriormen-­ te, decidir en asamblea cuales serĂ­an los siguientes pasos a dar (El PaĂ­s, 2011i). En los dĂ­as siguientes fue haciendo mella el cansancio entre los acampados y aparecieron las primeras divergencias entre los di-­ versos colectivos aglutinados en el movimiento. El 27 de mayo se produjo el desalojo de los â&#x20AC;&#x153;indignadosâ&#x20AC;? en Barcelona y, tras diver-­ sas reuniones, la acampada de Madrid se levantĂł el dĂ­a 12 de junio de 2011 (PĂşblico, 2011d). Un repliegue tĂĄctico que, en opiniĂłn de Taibo (ob.cit: 110) buscaba garantizar la supervivencia del 15M: â&#x20AC;&#x153;(â&#x20AC;Ś) el trĂĄnsito del recinto del espectĂĄculo mediĂĄtico al mĂĄs modesto de la acciĂłn localâ&#x20AC;Ś.parecĂ­a deslizar el movimiento hacia una tarea mĂĄs difĂ­cil y menos vistosa, al tiempo que, en sentido contrario, reducĂ­a los riesgos de la burocratizaciĂłn y los intentos de coparlo desde fuera(â&#x20AC;Ś)â&#x20AC;? (O OHYDQWDPLHQWR GH ODV DFDPSDGDV QR VLJQLĂ&#x20AC;Fy HO Ă&#x20AC;Q GHO 0 pues, en los meses siguientes, continuaron realizĂĄndose asam-­ bleas y concentraciones por toda EspaĂąa, aunque con un respal-­ do ciudadano menor al de las primeras semanas. En este proceso GHGHVJDVWHLQĂ X\HURQORVHQIUHQWDPLHQWRVLQWHUQRVHQHOVHQRGH â&#x20AC;&#x153;Democracia Real Yaâ&#x20AC;? (DRY), el mĂĄs relevante de los colectivos del Movimiento 15-­M, como consecuencia del intento de algunos de sus miembros de constituir una asociaciĂłn para â&#x20AC;&#x153;ejercer una presiĂłn coordinada sobre las institucionesâ&#x20AC;? y â&#x20AC;&#x153;recuperar el espĂ­ritu 144


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

original del 15-­Mâ&#x20AC;?. Los impulsores de esta asociaciĂłn, Fabio GĂĄn-­ dara, Carlos Paredes o Pablo Gallego, habĂ­an sido portavoces re-­ conocidos del colectivo durante las acampadas de la Puerta de Sol en 2011, pretendĂ­an dar a esta asociaciĂłn una estructura horizon-­ tal, donde la asamblea siguiese siendo el Ăłrgano decisorio (PĂşblico, 2012). Este hecho dio lugar a un importante cisma dentro de DRY, que estuvo relacionado con el control de las cuentas de Twitter y )DFHERRN (O0XQGR  Finalmente, el nodo madrileĂąo de DRY anunciĂł a primeros de mayo la expulsiĂłn de los cinco patrocinadores de la asociaciĂłn, al entender que habĂ­an seguido una â&#x20AC;&#x153;clara estrategia mediĂĄtica con el objetivo de aprovecharse del movimiento 15Mâ&#x20AC;? (Democracia Real Ya Madrid, 2012). Estos hechos generaron mucha preocupa-­ ciĂłn dentro del movimiento 15M por sus posibles consecuencias cara a la ciudadanĂ­a, que podrĂ­a empezar a alejarse ante estas muestras de divisiĂłn interna (PĂşblico 2012b). De hecho, la encuesta realizada por el diario EL PAĂ?S (2012) a los pocos dĂ­as de los sucesos narrados, mostraba un descenso en el apoyo a las propuestas del movimiento 15M de mĂĄs de 10 pun-­ tos (del 81% al 68%), asĂ­ como una visiĂłn menos optimista de los ciudadanos respecto a las posibilidades del 15M como catalizador para la regeneraciĂłn democrĂĄtica. Este declive parece haberse detenido en los Ăşltimos meses del aĂąo 2012 con el ĂŠxito que el 15M estĂĄ teniendo en su lucha contra los desahucios de viviendas de ciudadanos que, por culpa de la crisis y el paro, no estĂĄn pudiendo hacer frente al pago de las hipotecas o los alquileres. La Plataforma de Afectados por la Hipoteca (PAH) ha estado desde el primer momento apoyando al Movimiento 15M, permitiendo llevar a cabo importantes y mediĂĄticas acciones de paralizaciones de desahucios, ayudando a las familias a obtener soluciones dignas como condonaciones de pago o consecuciĂłn de alquileres sociales (PĂşblico, 2012c). 145


Adolfo Álvaro Martín

Finalmente, otro factor que está revitalizando la acción del 15M ha sido el aumento de la desafección ciudadana en España a lo largo del año 2012, muy vinculada a los graves escándalos de co-­ rrupción detectados en la clase política española que, incluso están salpicando al entorno de la familia real. En este sentido, la descon-­ ÀDQ]DFLXGDGDQDKDFLDORVSROtWLFRVDXPHQWyHQDFRWDVQXQ-­ ca alcanzadas en España durante la democracia, convirtiendo en uno de los tres principales problemas del país (El Mundo, 2012b). En cuanto a la familia real española, que durante décadas gozó de una gran popularidad, los escándalos que han salpicado al Rey y a su familia le han llevado a perder 26 puntos de apoyo ciudadano en apenas un año, reabriendo el debate sobre la viabilidad o no de la institución (El Mundo, 2013). 2. &LEHUDFWLYLVPR\0 Para entender lo que ha supuesto el 15M, debemos acudir a lo dicho por Castells el 27 de mayo de 2011 en la acampada de los “in-­ dignados” en Barcelona (Vilaweb, 2011). En una acción de apoyo a los acampados, Castells recordó que el control de la comunicación y de la información han formado parte del ejercicio del poder, dan-­ GRDODSROtWLFDXQDFRQÀJXUDFLyQHVHQFLDOPHQWHPHGLiWLFD$ÀUPD que la transformación de los procesos de comunicación derivada del cambio tecnológico ha propiciado la mutación de un sistema dominado por la “comunicación de masas” a otro en el que gracias a Internet y las redes móviles prevalece la “autocomunicación de masas”, donde cada persona puede emitir sus propios mensajes, seleccionar los mensajes que desea recibir u organizar sus redes de comunicación. Este nuevo entorno ha permitido organizar redes horizontales de comunicación interactivas que llegan a la sociedad por personas o grupos que no están representados en las institu-­ FLRQHV&RQVLGHUD&DVWHOOVTXHHO0HVXQFODURUHÁHMRGHHVWH proceso en el que, la indignación ciudadana sube a la red donde genera debate e iniciativas, para después volver a las calles y ge-­ nerar una interacción entre el espacio urbano y el espacio virtual, 146


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

TXHSURYRFDXQFDPELRHQODVUHODFLRQHVGHSRGHUDOLQĂ XLUHQODV mentes de las personas, que descubren que no se encuentran solas, lo que les hace ser mĂĄs fuertes y perder el miedo. De esta forma, se pueden encarar las importantes transformaciones de un sistema democrĂĄtico que hoy en dĂ­a cada vez se encuentra mĂĄs alejado de las demandas e intereses ciudadanos. El Instituto Universitario de InvestigaciĂłn en BiocomputaciĂłn y Sistemas Complejos (BIFI) de la Universidad de Zaragoza (2011) realizĂł un anĂĄlisis sobre el uso de las redes sociales en el 15M en el periodo comprendido entre el 25 de abril y el 26 de mayo de 2011, a partir de 70 palabras claves relacionadas con el Movimiento, que permitiĂł detectar mĂĄs de medio millĂłn de mensajes provenientes de 87.569 usuarios. Del mismo podemos destacar: 1. El informe detecta que el proceso de maduraciĂłn de la protesta no es ni lento ni lineal, pues se produce de forma abrupta, consiguiendo en menos de 6 dĂ­as aglutinar a todo HOFROHFWLYR(VWHKHFKRFRQĂ&#x20AC;UPDTXHHVXQPRYLPLHQWRHV-­ pontĂĄneo, que en modo alguno podĂ­a estar manipulado o creado con la intenciĂłn de incidir en el resultado de las elec-­ ciones municipales y autonĂłmicas espaĂąolas del 22 de mayo de 2011, como desde el entorno del PP tratĂł de hacer creer. 2. (OXVRGHODVUHGHVVRFLDOHVSRUHOPRYLPLHQWR0FRQĂ&#x20AC;U-­ mĂł que no es necesario enviar mensajes a muchos contac-­ tos para garantizar la informaciĂłn de todo el colectivo. Su SURFHVRGH DXWRRUJDQL]DFLyQSHUPLWtD TXH FRQKDFHUĂ XLU la informaciĂłn por determinados nodos (hubs), ĂŠsta podĂ­a alcanzar todo el sistema. 3. Antes del inicio de la acampada en la Puerta del Sol en Ma-­ drid la red estaba poco cohesionada, pero a partir del dĂ­a 15 de mayo, los grupos crecen muy rĂĄpidamente en nĂşmero y actividad. 147


Adolfo Ă lvaro MartĂ­n

La actividad del 15M en Internet y las redes sociales permitiĂł de-­ sarrollar herramientas que fueron muy Ăştiles a la hora de difundir las acciones y las propuestas del Movimiento: o   Tomalaplaza.net. Un sitio web que hospedaba a las webs de las diferentes acampadas existentes en EspaĂąa. Su sistema auto-­organizativo y descentralizado permitiĂł un desarrollo propio en el que, mediante este sistema multiblog cualquier ciudadano podĂ­a estar informado de lo que estaba pasando aunque no pudiesen acercarse por las acampadas. o   democraciarealya.es. La web del colectivo mĂĄs importante del movimiento 15M, que con el tiempo se ha convertido en la principal referencia de sus acciones. o   N-­1. Una herramienta que ha permitido crear redes sociales a las asambleas de barrio o acampadas. Estas redes utilizan software libre y han permitido llevar desde la gestiĂłn orga-­ nizativa a la difusiĂłn de noticias y acciones. N-­1 pretende apartarse del modelo 2.0, ofreciendo una alternativa a redes VRFLDOHVFRPHUFLDOHVFRPR)DFHERRNR7ZLWWHU o   Stopdesahucios. Una herramienta creada para poder identi-­ Ă&#x20AC;FDUORFDOL]DU\VHJXLUODHYROXFLyQGHORVGHVDKXFLRVTXHVH producĂ­an en EspaĂąa, permitiendo el inicio de acciones a los distintos colectivos. TambiĂŠn utiliza software libre. o   Propongo. Herramienta creada con la intenciĂłn de desarro-­ llar las distintas propuestas del movimiento 15M. Con ella se ha tratado de superar la crĂ­tica a la lentitud de la toma de decisiones de las asambleas, que en mucho casos desincenti-­ vaban la participaciĂłn ciudadana. Mediante esta herramien-­ ta, tambiĂŠn basada en software libre, cualquier ciudadano puede proponer acciones y darlas a conocer por medio de la UHGFRQODĂ&#x20AC;QDOLGDGGHTXHVHDQDQDOL]DGDV\DSR\DGDVSRU el colectivo. 148


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

o   Oiga.me. Se denomina como herramienta de lobby ciudada-­ no, que permite el envĂ­o de emails o faxes por Internet, y que esta a disposiciĂłn de cualquier ciudadano sin necesidad de que se encuentre previamente organizado. A travĂŠs de ella se han realizado acciones de denuncia contra diversas orga-­ nizaciones. o   15october.net. NaciĂł para articular la primera movilizaciĂłn de carĂĄcter global del movimiento 15M, que tuvo lugar el 15 de octubre de 2011. o   Democracia4punto0. Es una iniciativa que pretende el desa-­ rrollo de nuevas formas tecnopolĂ­ticas de participaciĂłn, como por ejemplo, los sistemas de votaciĂłn telemĂĄtica. /DVUHGHVVRFLDOHVPiVSRSXODUHVHQ(VSDxDFRPR)DFHERRN<RX-­ Tube o Tuenti, son las que han tenido un papel esencial en la ac-­ tividad del 15M. Como ya vimos, DRY iniciĂł su actividad a travĂŠs de ellas, y los â&#x20AC;&#x153;indignadosâ&#x20AC;? hicieron un uso continuo de las mismas durante todo el periodo de las acampadas: â&#x20AC;&#x153;(â&#x20AC;Ś)Los participantes de las diferentes localidades crearon eventos locales y grupos promotores para organizar la ma-­ nifestaciĂłn. TambiĂŠn crearon espacios particulares de orga-­ QL]DFLyQHQUHGFRQVXVFRUUHVSRQGLHQWHVSHUĂ&#x20AC;OHVHQ7ZLWWHU \ JUXSRVHYHQWR HQ )DFHERRN (VWR IDFLOLWy OD SDUWLFLSDFLyQ abierta y activa en espacios de trabajo online, ademĂĄs ayudĂł a las personas que se conocĂ­an solo en Internet a encontrarse presencialmente en las asamblea locales. Ese proceso hibridĂł e interconectĂł las posibilidades de cyberterritorio y del geote-­ rritorio. AsĂ­ aprovechamos todo el tiempo que pasamos online para organizar las capacidades, habilidades y recursos para crear ese acontecimiento distribuido.â&#x20AC;? (Toret, ob.cit: 54). Sin duda, DRY elaborĂł un verdadero manual de ciberactivismo, KDFLHQGRXQXVRPX\HĂ&#x20AC;FD]GHWRGDVODVXWLOLGDGHVTXH,QWHUQHW\ 149


Adolfo Ă lvaro MartĂ­n

las redes sociales permitĂ­an, para con ello romper con el silencio con el que los medios de comunicaciĂłn tradicional habĂ­an castiga-­ do a la movilizaciĂłn gestada desde DRY: â&#x20AC;&#x153;(â&#x20AC;Ś)Los miles de mensajes, mails, vĂ­deos, la intensa exten-­ VLyQHQ)DFHERRN\YDULRVGtDVGH7UHQGLQJ7RSLFHQ7ZLWWHU (#15malacalle, #15mpasalo, #alacalle15m, #tomalacalle o #15mmani) no nos hicieron atravesar el cerco mediĂĄtico. Nues-­ tra repercusiĂłn en la escena de la red habĂ­a sido innegable, al mismo tiempo que los grandes periĂłdicos, radios y televisiones nos habĂ­an ignorado.â&#x20AC;? (Toret, ob.cit: 57-­58). Twitter se encumbrĂł a lo mĂĄs alto durante las acampadas del mo-­ vimiento 15-­M, esta red social estaba en pleno desarrollo en 2011 HQ (VSDxD \ VH FRQYLUWLy HQ OD PiV HĂ&#x20AC;FD] GH ODV KHUUDPLHQWDV para compartir informaciĂłn, acudir a las concentraciones e, inclu-­ so, permitir crear una identidad propia sobre el 15M entre toda la ciudadanĂ­a: â&#x20AC;&#x153;(â&#x20AC;Ś)PodrĂ­amos decir que las webs tomalaplaza.net y ta-­ quethesquare.net han sido el germen de una arquitectura lĂł-­ gica de extensiĂłn internacional de este movimiento. Pero fue HOLQFUHtEOHĂ XMRHQ7ZLWWHU\ORVVWUHDPLQJVGHODVSOD]DVOR que hizo a la ÂŤSpanish RevolutionÂť convertirse en tema del momento, al centrar la atenciĂłn de personas de todo el mundo que se vieron afectadas por la impresiĂłn de esas formas de toma del espacio pĂşblico y de irrupciĂłn social(â&#x20AC;Ś). ÂŤ (Q 7ZLWWHU ORV SHUĂ&#x20AC;OHV PiV LPSRUWDQWHV GHO PRYLPLHQWR son el de @democraciareal con mĂĄs de 118.000 seguidores, @ acampadasol con mĂĄs de 67.000 y @acampadabcn con mĂĄs de (Q)DFHERRN'HPRFUDFLD5HDO<DWLHQHPiV seguidores.â&#x20AC;? (Toret, ob.cit: 62). El movimiento 15M ha supuesto la madurez de la utilizaciĂłn po-­ OtWLFDGHODVUHGHVVRFLDOHV'HXQODGRFRQĂ&#x20AC;UPDQGRODVFDSDFLGD-­ des que ya habĂ­an anunciado durante las movilizaciones contra la 150


Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

“Ley Sinde”, al llevar la protesta ciudadana autónoma al centro de la agenda política en mitad de una campaña electoral. De otro, al relegar a un carácter marginal a los actores políticos tradicionales, frente al carácter reivindicativo y de creación de nuevos espacios de debate y acción política de los movimientos ciudadanos autóno-­ mos. El uso de las redes sociales en el movimiento 15M mostró que la comunicación ya no pertenece en exclusiva a los grandes medios tradicionales. Las movilizaciones contra la “Ley Sinde”, como vi-­ mos, anticiparon lo que el 15M demostró: los “nativos digitales” están desarrollando nuevas formas de socialización gracias a los entornos tecnológicos, y estas habilidades les hacen usar Internet y las redes sociales para informarse y comunicarse, por lo que cada YH]GHSHQGHQPHQRVGHODLQIRUPDFLyQÀOWUDGDSRUODVJUDQGHVFRU-­ poraciones de comunicación que, como consecuencia de ella, pier-­ GHQFDSDFLGDGGHLQÁXHQFLDHQODSROtWLFD

151


Adolfo Ă lvaro MartĂ­n

(&8$'25/D´5HEHOLyQGHORV)RUDMLGRVÂľ 1. Antecedentes Como seĂąala Larrea (2004:23), en los primeros aĂąos de la dĂŠcada de los noventa del pasado siglo se produjo el agotamiento del â&#x20AC;&#x153;boom petroleroâ&#x20AC;? en el Ecuador, lo que llevĂł a los sucesivos gobiernos a poner en marcha polĂ­ticas de ajuste estructural y aumento de las exportaciones en consonancia con lo reclamado por el denominado Consenso de Washington. Estas polĂ­ticas tuvieron unos resultados insatisfactorios pues, en el aĂąo 1998, el ingreso por habitante ape-­ nas superaba en un 5% al del aĂąo 1980. En este contexto se produce una caĂ­da en los precios del petrĂł-­ leo que, junto a los efectos de El NiĂąo (1998) y la inestabilidad Ă&#x20AC;QDQFLHUDLQWHUQDFLRQDOSURYRFDURQXQDJUDYHFULVLVTXHWUDMROD TXLHEUDGHOVLVWHPDĂ&#x20AC;QDQFLHURQDFLRQDO\XQDXPHQWRGHOGHVHP-­ pleo y la pobreza, propiciando una rĂĄpida devaluaciĂłn del sucre, la FDtGDGHORVVDODULRV\HODXPHQWRGHODLQĂ DFLyQ$QWHHOULHVJRGH colapso inminente, en enero del aĂąo 2000, el Presidente Mahuad decretĂł la dolarizaciĂłn en un intento de estabilizar la economĂ­a y conseguir la recuperaciĂłn mediante la inversiĂłn extranjera en el sector petrolĂ­fero. Mahuad y sus sucesores, Gustavo Noboa y Lucio *XWLpUUH]FUH\HURQTXHODVGLYLVDVGHOSHWUyOHRODDXVWHULGDGĂ&#x20AC;V-­ FDOODFRQWHQFLyQGHODLQĂ DFLyQ\XQRVWLSRVGHLQWHUpVFRQWURODGRV permitirĂ­an generar un ambiente de estabilidad que consiguiese la reactivaciĂłn econĂłmica (Larrea ob. cit.:27). Sin embargo, estas me-­ didas no fueron capaces de frenar la crisis ni de evitar la tremenda sangrĂ­a de la emigraciĂłn que, en el periodo comprendido entre los aĂąos 1999 y 2007 provocĂł la salida de mĂĄs 950.000 ecuatorianos, el equivalente al 7% de la poblaciĂłn total del paĂ­s. (Flacso Ecua-­ dor:2008). La incapacidad de los distintos gobiernos para hacer frente a la crisis econĂłmica desencadenĂł una enorme convulsiĂłn polĂ­tica y so-­ 152


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

cial que fue el caldo de cultivo adecuado para un desgaste acelera-­ do de la clase polĂ­tica ecuatoriana, marcada por la corrupciĂłn y el alejamiento con los problemas de la sociedad. Esta desafecciĂłn se extendiĂł a gran parte de los medios de comunicaciĂłn tradicionales, TXHIUDFDVDURQHQODODERUGHĂ&#x20AC;VFDOL]DFLyQGHODDFFLyQSROtWLFD\ que eran vistos como simples eslabones de transmisiĂłn de los inte-­ reses oligĂĄrquicos de los sectores que habĂ­an dominado el Ecuador GHVGHHOĂ&#x20AC;QGHOD&RORQLD Estos antecedentes sirven para contextualizar el movimiento de descontento social que provocĂł el derrocamiento del Presidente Lucio GutiĂŠrrez el 20 de abril de 2005 en el que, como analizare-­ mos, el ciberactivismo se manifestĂł por primera vez en el Ecuador. La utilizaciĂłn de la tecnologĂ­a por aquellos activistas constituyĂł XQHOHPHQWRQRYHGRVRTXHLQĂ X\yHQODUiSLGDHLQWHQVDPRYLOL-­ zaciĂłn social que sorprendiĂł al gobierno de GutiĂŠrrez. Igualmente, puso al descubierto la estrategia de ocultaciĂłn de las protestas or-­ questada por los principales medios de comunicaciĂłn, desplazĂĄn-­ doles de su centralidad en la conformaciĂłn de la agenda polĂ­tica de forma hasta entonces desconocida en el paĂ­s. 2. TelefonĂ­a mĂłvil e Internet en el Ecuador de los prime-­ ros aĂąos del siglo XXI. El desarrollo de la telefonĂ­a mĂłvil en el Ecuador tuvo un notable desarrollo en los primeros aĂąos del presente siglo. Los datos de la Superintendencia de Telecomunicaciones (SUPERTEL) muestran que si a principios del aĂąo 2001 apenas se superaban los quinientos mil abonados, en los aĂąos venideros se producirĂ­a un vertiginoso incremento en el nĂşmero de usuarios de celulares, que hizo que en abril de 2005 hubiese mĂĄs de cuatro millones de abonados en terri-­ torio ecuatoriano. Estos datos muestran una tasa de penetraciĂłn de 47,3 lĂ­neas activas de telefonĂ­a mĂłvil por cada 100 habitantes en 2005, que segĂşn los datos elaborados por la SecretarĂ­a General de la Comunidad Andina (2012), situaban a Ecuador en esta fecha 153


Adolfo Ă lvaro MartĂ­n

como el segundo paĂ­s con mayor crecimiento en el uso de celulares de la Comunidad Andina. Respecto al nĂşmero de usuarios de telefonĂ­a mĂłvil en el Ecuador, los datos de la SUPERTEL resultan taxativos en cuanto a su po-­ pularidad entre los ecuatorianos, pues si en 2001 se contabilizaron DERQDGRVDĂ&#x20AC;QDOHVGHVHKDEtDQVREUHSDVDGRORVVHLV millones. Internet estuvo disponible en el Ecuador desde el aĂąo 1991 por medio de ECUANEX, nodo de la CorporaciĂłn Interinstitucional de ComunicaciĂłn ElectrĂłnica Intercom. En cuanto al nivel de su pe-­ netraciĂłn en los primeros aĂąos de este siglo, existe discrepancias en funciĂłn de las fuentes utilizadas: Si acudimos a los datos del Consejo Nacional de Telecomunica-­ FLRQHV &21$7(/ HVWHRUJDQLVPRĂ&#x20AC;MDHQXQODWDVDGHSH-­ netraciĂłn de Internet en el Ecuador en el 2005, en funciĂłn de sus datos sobre usuarios y cuentas de Internet. En cuanto al total de usuarios de Internet, el CONATEL indica que si en el aĂąo 2001 existĂ­an un total de 327.711 usuarios, esta cifra habĂ­a aumenta-­ do en el aĂąo 2005 hasta 1.135.200 usuarios. Respecto al nĂşme-­ ro de cuentas en Internet, los datos de este organismo seĂąalaban que en el aĂąo 2001 alcanzaban un total de 85.630, que pasarĂ­an a ser 137.326 cuentas en el 2005. Debe mencionarse que los datos del CONALTEL consideraban que cada lĂ­nea era utilizada por 30 usuarios. Por su parte, la Superintendencia de Telecomunicaciones (SUP-­ TEL) reducĂ­a el nĂşmero de usuarios de Internet en 2001 a 85.630, que aumentaban considerablemente en los aĂąos siguientes hasta alcanzar los 514.020 en el aĂąo 2005. En cuanto al nĂşmero total de cuentas de Internet (Dial-­up y corporativas), sus datos son idĂŠn-­ ticos a los de el CONATEL con la salvedad que establece tan solo XVXDULRVSRUFXHQWDPRWLYRSRUHOFXDOOD6837(/Ă&#x20AC;MDODSHQH-­ traciĂłn de Internet en el Ecuador en 2005 en un 4%, la mitad que el CONATEL. 154


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

En ambos casos, no se tuvo en consideraciĂłn la utilizaciĂłn que de Internet se realizaba desde espacios pĂşblicos como locutorios o cybercafĂŠs, de gran popularidad en las zonas urbanas, lo que sin duda limita sensiblemente la exactitud de los datos de ambos organismos. Un estudio posterior realizado por Santa Fe Associates Interna-­ tional para la CorporaciĂłn de PromociĂłn EconĂłmica CONQuito en 2007, que sĂ­ tomaba en consideraciĂłn la utilizaciĂłn de Internet por medio de cibercafĂŠs y locutorios, elevaba la tasa de penetraciĂłn en 2005 hasta un 13,5%. (Q FXDQWR DO SHUĂ&#x20AC;O GHO LQWHUQDXWD HFXDWRULDQR HQ  pVWH VH-­ rĂ­a un joven de entre 20 y 35 aĂąos, de estrato social medio o alto, que mayoritariamente comenzĂł a utilizar Internet a partir del aĂąo 2002, que se conectaba alrededor de una hora diaria, dedicando el tiempo a navegar por Internet, enviar y recibir emails y chatear (CarriĂłn, 2006). $ODYLVWDGHORH[SXHVWRSRGHPRVDĂ&#x20AC;UPDUTXHHQIHFKDHQ la que tiene lugar la â&#x20AC;&#x153;RebeliĂłn de los Forajidosâ&#x20AC;?, la telefonĂ­a mĂłvil se encontraba en plena expansiĂłn en el Ecuador, especialmente en los grandes centros urbanos mientras que, en el caso de Internet, su tasa de penetraciĂłn en aquel momento aĂşn era relativamente EDMD(VWRVGDWRVVRQVLJQLĂ&#x20AC;FDWLYRVDODKRUDGHYDORUDUHODFWLYLV-­ mo ciudadano durante aquellos dĂ­as, ayudĂĄndonos a comprender la forma que los â&#x20AC;&#x153;forajidosâ&#x20AC;? utilizaron la tecnologĂ­a y, muy espe-­ cialmente, para valorar en su justa medida la importancia de las acciones de ciberactivismo llevadas a cabo.

3. /D´5HEHOLyQGHORV)RUDMLGRV¾ El 8 de diciembre de 2004 la mayoría legislativa que apoyaba al presidente GutiÊrrez, mediante una resolución que fue tildada de inconstitucional, aprobó la reorganización de la Corte Superior de 155


Adolfo Álvaro Martín

Justicia, que fue conocida popularmente como la “Pichi Corte” (El Universo, 2005). Será esta nueva Corte Suprema de Justicia la que el 31 de marzo de 2005 anuló los juicios abiertos contra los ex presidentes Abdalá Bucarám y Gustavo Noboa. Como consecuen-­ cia de esta decisión, el primero regresaría al Ecuador desde su exi-­ lio en Panamá el 2 de abril y, al día siguiente, lo haría el segundo desde República Dominicana. (EL Universo, 2005b). La llegada del expresidente Bucarám a Guayaquil, en medio de la euforia de sus seguidores, tuvo una cobertura mediática sin pre-­ cedentes en el Ecuador (TC Televisión, 2005). En su discurso en el Parque Centenario, Abdalá agradeció públicamente a Omar Quin-­ tana (presidente del Congreso) por apoyar su regreso al Ecuador, a “Pichi” Castro (Presidente de la Corte Suprema) por enfrentarse al “sicariato” judicial y, al Presidente Lucio Gutiérrez por su actitud democrática. (Hoy, 2005). Como señala Carlos de la Torre (2005: 108), el regreso de Abdalá %XFDUDPPDUFDUtDGHIRUPDGHÀQLWLYDHOIXWXURSROtWLFRGHO/XFLR Gutiérrez: “ (…) El retorno del temido “líder de los pobres” también des-­ pertó las viejas pesadillas sobre la falta de buenos modales y cultura de Bucaram, a tal punto que cada vez se vio más a Gutiérrez como un pobre imitador de su estilo. El grito “que se vaya Bucaram y también su edecán” ilustran cómo Buca-­ ram sintetizó el resentimiento de muchos de quienes salieron a las calles para protestar en contra del gobierno de su ex-­ede-­ cán(…)”. El rechazo fue especialmente importante en Quito, donde comen-­ zaron manifestaciones espontáneas el día 4 de abril, con gritos de “Lucio corrupto, alcahuete de Bucaram” o “que se vaya a Panamá, que se lleve a Abdalá”. (El Universo, 2005c). Este malestar ciuda-­ dano provocó que el día 5 de abril la Asamblea de Quito (confor-­ mada por organizaciones sociales y políticas de la capital), con el respaldo de los alcaldes y prefectos del Azuay, Tungurahua, Coto-­ 156


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

paxi, Imbabura, Carchi y varios cantones de la Sierra, acordasen convocar una â&#x20AC;&#x153;paralizaciĂłn nacionalâ&#x20AC;? para el dĂ­a 13 de abril. Poste-­ riormente, varios miles de personas se dirigieron al Congreso Na-­ cional para exigir la destituciĂłn del presidente de la â&#x20AC;&#x153;Pichi Corteâ&#x20AC;?. Se produjeron momentos de tensiĂłn dentro y fuera del hemiciclo, que provocaron la clausura de la sesiĂłn (Hoy, 2005b). El dĂ­a 13 de abril se llevĂł a cabo la protesta con un ĂŠxito desigual, en medio de fuertes enfrentamientos entre manifestantes y policĂ­a (El Universo, 2005d). El discreto apoyo a la movilizaciĂłn era con-­ secuencia, de un lado, en que los ciudadanos no se sintieron repre-­ sentados por una convocatoria realizada por actores polĂ­ticos a los que no consideraban capaces de resolver las crecientes demandas populares y, de otro, en que las demandas populares iban mĂĄs allĂĄ de la resoluciĂłn del problema de la Corte Suprema de Justicia y exigĂ­an la salida del presidente y de todos los polĂ­ticos (RamĂ­rez, 2005:43). El relativo fracaso del paro envalentonĂł al presidente GutiĂŠrrez que, ese mismo dĂ­a, manifestĂł: â&#x20AC;&#x153;Creo que ha ganado este inmenso paĂ­s real, profundo, trabaja-­ dor y ha perdido ese minĂşsculo paĂ­s polĂ­tico que, de espaldas al SXHEOR\HQJDxiQGRORHQVXEHQHĂ&#x20AC;FLRSHUVRQDOLQWHQWySDUDOL-­ zar Quito y Pichinchaâ&#x20AC;? (BBC, 2005) Craso error de Lucio GutiĂŠrrez que, esa misma noche, se enfrentĂł a la convocatoria ciudadana realizada desde radio La Luna, en la que miles de personas llevaron a cabo la â&#x20AC;&#x153;Marcha de las Cacerolas VacĂ­asâ&#x20AC;? desde la Tribuna de la Shyris hasta la sede de la Corte Suprema de Justicia (El Mercurio, 2005). Posteriormente, varios cientos de esos manifestantes se congregaron frente a la casa del presidente en el barrio de El BatĂĄn. Al dĂ­a siguiente, en el pro-­ grama que cada jueves realizaba en la Radio Nacional del Estado, /XFLR*XWLpUUH]FDOLĂ&#x20AC;FyFRPR´GRVRWUHVIRUDMLGRVÂľDTXLHQHVSUR-­ testaron frente a su domicilio (La Hora, 2005). 157


Adolfo Álvaro Martín

Nuevamente, desde radio La Luna, los ciudadanos reaccionaron FRQWUD ODV GHVFDOLÀFDFLRQHV GHO Pi[LPR PDQGDWDULR GH OD 5HS~-­ blica; “(…) Esa misma tarde, radio La Luna continuó con sus micró-­ fonos abiertos y entre las llamadas que recibió destacó la de una mujer adulta que dijo: ‘yo también soy forajida….’. Esta OODPDGDOHGLRLGHQWLÀFDFLyQDODSURWHVWD¶«WRGRVVRPRVIRUD-­ jidos’ sería la consigna y la auto-­representación colectiva que perduraría en los días siguientes. Luego de esta intervención, la mayoría de las miles de llamadas que recibió la radio esa semana iniciaban con esta ‘tarjeta de presentación’: ‘soy el/la forajido/a..con cédula de identidad (…)” (Ramírez ob.cit. : 52). El día 15 de abril, ante el incremento de las protestas, Lucio Gutié-­ rrez proclamó el estado de emergencia en el Distrito Metropolitano de Quito. Sin embargo, esta decisión no solo no calmó la situación sino que incitó aún más a la movilización por todos los barrios de la capital, en la que los ciudadanos con cacerolas y tablas llevaron a cabo el denominado “tablazo” (El Universo, 2005e). Al día siguiente, y previo cese de la Corte Suprema de Justicia, Gutiérrez se vio obligado a levantar el estado de emergencia ante la alarma que a nivel internacional había producido la adopción de las medidas extraordinarias, y en un intento desesperado de calmar una situación política desbordada en la que arreciaban las expresiones populares de repudio contra el presidente. (Hoy, 2005c). Las movilizaciones ciudadanas continuaron en los dos días siguientes y culminaron en la masiva concentración que tuvo lu-­ gar la noche del día 19 de abril en el parque de La Carolina de la capital, en la que se exigió la revocatoria de Lucio Gutiérrez con carácter inmediato (Ramírez ob.cit. : 59). A lo largo de la noche se produjeron violentos choques entre las fuerzas del orden y los manifestantes, que trajeron como consecuencia el fallecimiento del periodista Julio García (El Universo, 2005f). 158


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

El desenlace se produjo el dĂ­a 20 de abril, en un ambiente de mĂĄxima tensiĂłn tras los disturbios acaecidos en la noche anterior. Durante los dĂ­as anteriores, la protesta se habĂ­a extendido por amplias capas de la poblaciĂłn quiteĂąa, sin distinciĂłn de estratos VRFLDOHV\HOORUHVXOWyGHĂ&#x20AC;QLWLYRHQORVDFRQWHFLPLHQWRVTXHVHGH-­ sarrollaron aquel dĂ­a que comenzĂł con el bloqueo de los accesos a la capital por parte de los manifestantes. Los enfrentamientos se produjeron con especial dureza en distintos puntos de la ciudad de Quito, no solo entre manifestantes y policĂ­a, sino tambiĂŠn con gru-­ pos que apoyaban al presidente GutiĂŠrrez. Sin embargo, la presiĂłn de la ciudadanĂ­a desbordĂł los dispositivos de seguridad existen-­ tes, tomando a mediodĂ­a el Congreso Nacional y, dirigiĂŠndose pos-­ teriormente, hacia el Palacio Presidencial. (El Universo, 2005g). Apenas dos horas mas tarde, sin respaldo internacional ni de las Fuerzas Armadas, Lucio GutiĂŠrrez abandonĂł el Palacio de Caron-­ delet, posiblemente oculto en un automĂłvil, hasta la residencia del embajador de Brasil de donde saliĂł para el exilio el dĂ­a 23 de abril de 2005. (HOY, 23/IV/2005). Pero el abandono del poder de Lucio GutiĂŠrrez no aplacĂł los ĂĄnimos GHPXFKRVGHORVPDQLIHVWDQWHVTXHFRPRDĂ&#x20AC;UPD5DPtUH] REFLW 62), llevaron a cabo la toma del aeropuerto para impedir la salida GH*XWLpUUH]\ODRFXSDFLyQGHOHGLĂ&#x20AC;FLRGH&,(63$/GRQGHVHLED a posesionar al nuevo Presidente del Ecuador, poniendo de mani-­ Ă&#x20AC;HVWRTXHORVDFRQWHFLPLHQWRVGHDTXHOORVGtDVKDEtDQVXSXHVWRXQ cuestionamiento global de los actores polĂ­ticos ecuatorianos.

4. Radio La Luna y el descrĂŠdito de los medios de comuni-­ caciĂłn tradicionales. Poco podĂ­a sospechar el presidente Lucio GutiĂŠrrez que al tildar como â&#x20AC;&#x153;forajidosâ&#x20AC;? a los ciudadanos que comenzaban a manifestar por las calles de Quito su rabia y hastĂ­o, estaba dando el primer paso para la creaciĂłn de un sĂ­mbolo que acarrearĂ­a su ruina po-­ 159


Adolfo Ă lvaro MartĂ­n

lĂ­tica. Los manifestantes no solo no se arredraron ante la ofensa VLQRTXHFRQYLUWLHQGRODGHVFDOLĂ&#x20AC;FDFLyQHQXQVLJQRGHLGHQWLGDG inundando a partir de ese momento las calles y automĂłviles con PHQVDMHV\VWHDFNHUVHQORVTXHVHSRGtDOHHUIUDVHVFRPR´6R\XQ feliz forajidoâ&#x20AC;? o â&#x20AC;&#x153;todos somos forajidosâ&#x20AC;?. (BBC, 2005b). Al igual que ocurriĂł en EspaĂąa a raĂ­z de las movilizaciones tras los atentados de marzo de 2004, aquellos â&#x20AC;&#x153;forajidosâ&#x20AC;? contaron con un extraordinario aliado en las ondas. Pero al contrario que en el caso espaĂąol, esta vez no se trataba de la capacidad de movilizaciĂłn ge-­ nerada por la primera cadena de radiodifusiĂłn, sino de una Ăşnica emisora: radio La Luna. 0RQW~IDU  H[SRQHFRQGHWDOOHORTXHVLJQLĂ&#x20AC;FDURQDTXHOORV ocho dĂ­as en los que la emisora tomĂł el pulso de la rabia ciudadana: â&#x20AC;&#x153;(â&#x20AC;Ś) Si asumir frontalmente el compromiso con la ciudadanĂ­a, bajo los principios de la libertad de expresiĂłn (para todos) y del derecho a la informaciĂłn y a la comunicaciĂłn es periodis-­ mo militante, entonces La Luna lo ejerciĂł y en grado sumo. Durante ocho largos dĂ­as, con sus noches, los micrĂłfonos abier-­ tos como nunca antes en la historia del paĂ­s (las experiencias de esta radio con Bucaram y Mahuad no llegaron a ese nivel GHLQWHQVLGDG\SDUWLFLSDFLyQ DPSOLĂ&#x20AC;FDURQODYR]GHPLOHVGH ciudadanos. Para contactarse telefĂłnicamente con la radio en esos dĂ­as habĂ­a que intentarlo varias veces, durante una, dos, tres..horas. Cuando la censura cortĂł telĂŠfonos (y lo hizo varias YHFHV  R OD GLĂ&#x20AC;FXOWDG GH FRQHFWDUVH VH WRUQy LPSRVLEOH KDEtD que acudir a sus estudios: en los periodos mĂĄs crĂ­ticos, la cola de gente para decir su palabra por un corto minuto implicaba una espera de horas. Cuando las fuerzas de choque gutierris-­ tas intentaron incendiar la radio, un cerco humano defendiĂł a la que consideraban suya (ÂĄquĂŠ diferente a aquellos cercos a canales para reclamarles por sus silencios y distorsiones!) esta es nuestra â&#x20AC;&#x2DC;casa comunalâ&#x20AC;&#x2122; dijeron muchos. â&#x20AC;&#x153;

160


Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

El espacio de libertad que fue capaz de generar radio La Luna, concedió a esta emisora un enorme aval de credibilidad en una ciudadanía ávida de medios libres donde expresarse sin cortapisas y escuchar las demandas de otros que, como ellos, eran sistemáti-­ camente silenciados por otros medios de comunicación. Por ello no es de extrañar que desde sus ondas se organizase la primera ca-­ cerolada contra Gutiérrez en la noche del día 13 de abril de 2005. “(…) Una llamada de una mujer quiteña expresaba su enojo y su frustración por los atropellos del régimen y la complicidad de las élites políticas dio forma al cacerolazo convocado para la noche del 13 en la Avenida de los Shyris. Más de 5.000 per-­ sonas acudieron. Durante 10 días las acciones se repitieron y se innovaron en diferentes puntos de la ciudad. No se pedía únicamente la reorganización de las Cortes: la consigna “que se vayan todos”, ya escuchada en la protesta argentina de 2001, incluía al presidente y a los legisladores. La vía institucional y partidocrática de acción política estaba clausurada. Las accio-­ nes emprendidas irían en más, todas en su contra “ (Ramírez, ob. cit.: 46). La rebelión de los forajidos expuso en toda su crudeza el descrédito generalizado de los medios de comunicación tradicionales, espe-­ cialmente de la televisión, que fueron vistos por los ciudadanos como meros instrumentos al servicio de intereses particulares, alejados de las demandas y necesidades de la sociedad. Esa rabia compartida era canalizada hacia radio La Luna, al que se conside-­ raba único medio creíble en aquellos momentos históricos: “…La gente llama a la radio para quejarse de la TV. Una seño-­ ra protesta porque los canales no cubren lo que está ocurriendo en Quito. Otra asegura que todos los noticieros –no hace distin-­ ciones-­ son unos vendidos. Un joven lo está viendo y comprende que no hay cómo creerles nada, se comunica con la radio y grita su indignación al mundo. Por eso, para que los inconformes gri-­ ten su indignación al mundo, radio La Luna, la del cacerolazo 161


Adolfo Ă lvaro MartĂ­n

quiteĂąo, mantiene abiertos los micrĂłfonos durante todo el dĂ­a. Y la gente no para de llamarâ&#x20AC;Śâ&#x20AC;? (RodrĂ­guez, 2005:43)

 (ODFWLYLVPR´IRUDMLGRÂľ En aquellos dĂ­as de abril, la tecnologĂ­a tuvo un papel relevante en las movilizaciones ciudadanas llevadas a cabo en Quito. Los jĂłve-­ nes â&#x20AC;&#x153;forajidosâ&#x20AC;? pusieron en marcha una red para la comunicaciĂłn polĂ­tica, la transmisiĂłn de mensajes y la coordinaciĂłn de acciones GHSURWHVWD/RVFHOXODUHVH,QWHUQHWIXHURQHĂ&#x20AC;FD]PHQWHXWLOL]DGRV para la confrontaciĂłn polĂ­tica. â&#x20AC;&#x153;(â&#x20AC;Ś) La infraestructura comunicativa de las auto-­convocato-­ rias cotidianas se completaba con las cadenas de llamadas y mensajes vĂ­a celular y con el uso activo del Internetâ&#x20AC;Śel correo electrĂłnico y el â&#x20AC;&#x2DC;boca a bocaâ&#x20AC;&#x2122;â&#x20AC;Ś.Una parte importante del acti-­ YLVPRGHHVRVGtDVIXHHQHIHFWRODĂ&#x20AC;JXUDGHOÂśUHSRUWHURUDGLDO improvisadoâ&#x20AC;&#x2122; que al informar a La Luna, a travĂŠs de llamadas desde su celular hacĂ­an saber al resto de los manifestantes del carĂĄcter genuinamente colectivo de sus acciones (â&#x20AC;Ś)â&#x20AC;? (RamĂ­rez ob.cit.: 54). /DFRQĂ&#x20AC;DQ]DHQTXHODLQIRUPDFLyQTXHWUDQVPLWtDQDTXHOORVUH-­ porteros improvisados era cierta, fue otro elemento sobresaliente en aquellas acciones ciudadanas. Los ciudadanos dotaron a estos activistas de una legitimidad social que convirtiĂł a sus redes de co-­ municaciĂłn personal en nodos de transmisiĂłn en vivo de lo que es-­ taba ocurriendo (â&#x20AC;&#x153;estĂĄn lanzando bombas lacrimĂłgenasâ&#x20AC;?) o de las consignas para llevar a cabo nuevas acciones (â&#x20AC;&#x153;un grupo que vaya DODHURSXHUWRÂľ 6HFRQĂ&#x20AC;JXUyXQFLEHUDFWLYLVPRFLXGDGDQRGHVFRQR-­ cido hasta aquel momento en el Ecuador , con dos ejes esenciales; 1Âş)-­ Sin duda el de mayor relevancia, fue la utilizaciĂłn de los ce-­ lulares por medio de llamadas de voz y sms para compartir infor-­ PDFLyQDXWRFRQYRFDUVHDODVSURWHVWDV\DPSOLĂ&#x20AC;FDUVXVHIHFWRVHQ torno a radio La Luna. Gracias a estas redes, basadas en la con-­ 162


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

Ă&#x20AC;DQ]DHQWUHHPLVRU\UHFHSWRUVHFRQVLJXLyTXHOD´FDFHURODGDÂľHO â&#x20AC;&#x153;reventĂłnâ&#x20AC;? o el â&#x20AC;&#x153;tablazoâ&#x20AC;? llegase a mĂĄs ciudadanos, especialmente los mĂĄs jĂłvenes. De esta forma, como seĂąala PazmiĂąo (2005), el uso del email y los mĂłviles, consiguieron no solo una mayor difu-­ siĂłn de las convocatorias llevadas a cabo desde radio La Luna, sino tambiĂŠn hacerlas mucho mĂĄs efectivas y decisivas para el derroca-­ miento de GutiĂŠrrez en apenas ocho dĂ­as. Este uso de la tecnologĂ­a como canal de comunicaciĂłn y moviliza-­ FLyQ WDPELpQ IXH PX\ HĂ&#x20AC;FD] SDUD KDFHU IUHQWH D ORV LQWHQWRV GH silenciar a radio La Luna, descarrilando con ello la estrategia de los seguidores de GutiĂŠrrez de dejar sin voz a los â&#x20AC;&#x153;forajidosâ&#x20AC;?. â&#x20AC;&#x153;â&#x20AC;Ścuando la guerra electrĂłnica del coronelato cortĂł su seĂąal durante varias horas, allĂ­ estuvieron nuevamente los celula-­ res, Internet, la comunicaciĂłn cara a cara y la solidaridad de RWUDVUDGLRVSDUDFRQWLQXDUFRQODDPSOLĂ&#x20AC;FDFLyQGHODYR]FLX-­ dadanaâ&#x20AC;? (Montufar, ob. cit.: 15). 2Âş)-­ Pero, ademĂĄs, la RebeliĂłn de los â&#x20AC;&#x153;forajidosâ&#x20AC;? trajo consigo la apariciĂłn del ciberactivismo en el Ecuador. Un activismo que, como veremos mĂĄs adelante, fue mĂĄs allĂĄ de la mera caja de reso-­ nancia de una emisora de radio. Los ciberactivistas â&#x20AC;&#x153;forajidosâ&#x20AC;? uti-­ lizaron la tecnologĂ­a para articular una estrategia que les permitiĂł DSURSLDUVHGHORVHVSDFLRVS~EOLFRVGHVDĂ&#x20AC;DUDOSRGHUHVWDEOHFLGR\ generar una agenda polĂ­tica propia en aquellos dĂ­as de abril. De esta manera, erosionaron como nunca se habĂ­a hecho a los me-­ dios tradicionales controlados por el poder polĂ­tico y econĂłmico, denunciando su encubrimiento de la realidad de las protestas y su intento de condicionar a la opiniĂłn pĂşblica, llevando a cabo un cuestionamiento de su legitimidad que solo pudo desarrollarse JUDFLDV D ODV FDSDFLGDGHV GH OD WHFQRORJtD FRPR LQVWUXPHQWR HĂ&#x20AC;-­ caz para transmitir mensajes, consignas y convocatorias (Saltos, ob.cit.) Castro (2005: 31) considera que los weblogs fueron herramientas PX\HĂ&#x20AC;FDFHVHQODVDFFLRQHVGHFLEHUDFWLYLVPROOHYDGDVDFDERGX-­ 163


Adolfo Ă lvaro MartĂ­n

rante aquellos dĂ­as, al facilitar a los â&#x20AC;&#x153;forajidosâ&#x20AC;? un espacio propio para expresar libremente sus opiniones. De entre ellas, podemos seĂąalar los siguientes; Â&#x2021; (O EORJ GH (GXDUGR $UFRV DOWFRP  $UFRV HV XQ UHFRQR-­ cido bloguero ecuatoriano que en 2005 residĂ­a en MĂŠxico. Ha-­ bĂ­a creado un blog en el aĂąo 2000 con contenidos orientados principalmente a temas tecnolĂłgicos. En la crisis de abril de 2005, abriĂł su bitĂĄcora para dar cobertura cotidiana de las mo-­ YLOL]DFLRQHVTXHVHHVWDEDQSURGXFLHQGRDPSOLĂ&#x20AC;FDQGRDQLYHO internacional los hechos de la RebeliĂłn de los â&#x20AC;&#x153;forajidosâ&#x20AC;?. En su SRVWGHGHDEULO$UFRVUHFDSLWXODORTXHVLJQLĂ&#x20AC;FDURQDTXHOORV dĂ­as; â&#x20AC;&#x153; (â&#x20AC;Ś)En ALT1040 se han hecho 44 post sobre la cobertura. AquĂ­ fue primer lugar donde se tratĂł el nulo interĂŠs de los medios ecuatorianos al problema, ALT1040 fue el Ăşnico medio que per-­ mitiĂł el periodismo participativo de verdad durante la crisis, y obteniendo reportes de primera mano de personas como Pedro Alvarado, aquĂ­ se emitieron opiniones y se reportaron noticias antes que nadie durante la cobertura, se buscaron y encontra-­ ron fuentes alternativas de noticias al respecto e inclusive se investigĂł contenido independiente para ponerlo a disposiciĂłn del resto (â&#x20AC;Ś)â&#x20AC;?. Â&#x2021; )RUDMLGRVRUJIXHRWURGHORVSULQFLSDOHVEORJVTXHUHDlizaron la cobertura. Creado por el colectivo Mingasocial ComunicaciĂłn, tenĂ­a como lema â&#x20AC;&#x153;Todos somos Forajidos. Nunca mĂĄs sin no-­ sotros, nosotros los ecuatorianos decidimos sobre nuestro pro-­ pio destino. Espacio de comunicaciĂłn alternativa.â&#x20AC;?. El bloguero (GXDUGR$UFRVVHUHĂ&#x20AC;HUHDHVWDELWiFRUDHQORVVLJXLHQWHVWpU-­ minos; â&#x20AC;&#x153;Otro medio de informaciĂłn independiente y ciudadano: Forajidos.org â&#x20AC;&#x201C; El sitio se mantiene con Xoops asĂ­ que un equipo con conocimientos tĂŠcnicos estĂĄ detrĂĄs. Desde 164


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

este sitio se emiten noticias, convocatorias y al parecer co-­ municaciĂłn sobre esta fuerza popular en Quitoâ&#x20AC;? (post 20/ IV/2005). Â&#x2021; &HURFXDWURQHW www.cerocuatro.net) fue otro blog muy ac-­ tivo en esos dĂ­as. Creado en 2003 por el bloguero ecuato-­ riano conocido como â&#x20AC;&#x153;Phantomâ&#x20AC;?, destacĂł por su capacidad para comunicar y difundir las protestas â&#x20AC;&#x153;forajidasâ&#x20AC;?. En su SRVW GH  GH DEULO  PDQLĂ&#x20AC;HVWD VX VRUSUHVD DQWH ODV potencialidades del ciberactivismo como canal de comuni-­ caciĂłn no tradicional; â&#x20AC;&#x153;(â&#x20AC;Ś) Y si algo hubo que me sorprendiĂłâ&#x20AC;Śfue la instantĂĄnea co-­ bertura a travĂŠs de medios de comunicaciĂłn no tradicionales. Casi todo fue igual a cuando AbdalĂĄ Bucaram cayĂł, pero esta vez la diferencia, en informaciĂłn, la marcĂł Internet. Y es que a parte de tener una buena seĂąal de radio La Luna vĂ­a Internet, tambiĂŠn se contĂł con varias fuentes (Forajidos.org, Ecuador In-­ mediato, Alt1040, L1-­1, El Manaba, Efecto Drago, Alex Vera, entre otros) que reportaban y replicaban los acontecimientos a medida que ĂŠstos iban pasando (â&#x20AC;Ś)â&#x20AC;?. QuizĂĄs como prueba de lo indicado por â&#x20AC;&#x153;Phantomâ&#x20AC;? en su blog, otras bitĂĄcoras de temĂĄtica en principio muy alejadas de la polĂ­tica, como el caso del blog El Manaba (elmanaba.blogspot.com), de con-­ tenido esencialmente erĂłtico, tambiĂŠn se unieron desde el primer momento a la cobertura de los acontecimientos y de rĂŠplica de las convocatorias y hechos que ocurrĂ­an. Gracias a esta actividad fue galardonado junto a otros bloggers ecuatorianos por la cobertura de la rebeliĂłn de los forajidos (Kevinhurlt, 30 junio 2005). Para acabar con este apartado, debemos hacer menciĂłn a un â&#x20AC;&#x153;no-­ mediaâ&#x20AC;? como Indymedia (ecuador.indymedia.org), muy activa en Ecuador durante la revuelta, donde periodistas independientes surtieron de noticias de lo que estaba sucediendo, estructurando un centro de prensa independiente para la cobertura internacional de lo ocurrido. 165


Adolfo Ă lvaro MartĂ­n

El â&#x20AC;&#x153;ciberactivismo forajidoâ&#x20AC;? tambiĂŠn tuvo episodios propios del ´KDFNWLYLVPRÂľFRPRODXWLOL]DFLyQGH´*RRJOHERPEVÂľHQODFHVTXH VHFUHDQFRQODĂ&#x20AC;QDOLGDGGHYLQFXODUDXQVLWLRSRUXQDIUDVHFODYH HOHYDQGRFRQHOORDUWLĂ&#x20AC;FLDOPHQWHHOVLWLRZHEHQORVUHVXOWDGRVGH bĂşsqueda de Google. Esta tĂŠcnica habĂ­a obtenido relevancia inter-­ nacional en 2003, gracias al blogger George Johnston, que vinculĂł la frase â&#x20AC;&#x153;miserable fracasadoâ&#x20AC;? con la biografĂ­a de George W. Bush. La clave del ĂŠxito de este tipo de actos radicaba en el hecho de que las bĂşsquedas en Google respondĂ­an a un algoritmo automĂĄtico, por el cual, cuantos mĂĄs enlaces a un sitio se produjesen, mejor SRVLFLyQWHQtDHQORVUHVXOWDGRV'HVGH*RRJOHKDPRGLĂ&#x20AC;FDGR los algoritmos de bĂşsqueda para impedir la repeticiĂłn de estas ac-­ tuaciones. (Google, 2007). En Ecuador ĂŠsta tĂŠcnica se utilizĂł contra Lucio GutiĂŠrrez apro-­ vechando la escasa capacitaciĂłn de los encargados del manteni-­ miento de la web de la Presidencia de la RepĂşblica, segĂşn relata el blogger Andrew: â&#x20AC;&#x153;(â&#x20AC;Ś) Esto, como era de esperarse, dio mas de un dolor de cabe-­ ]DDORVDOOHJDGRVD&DURQGHOHWGHORFXDOVR\WHVWLJRĂ&#x20AC;HOSRU-­ que al preguntarle a la persona encargada del mantenimiento de la pĂĄgina web de la Presidencia de la RepĂşblica su opiniĂłn acerca de este tema, era inminente que esta seĂąora no tenĂ­a ni la mĂĄs remota idea de cĂłmo fue posible este hecho. Por lo cual, la salida fĂĄcil que tomaron fue el borrar la pĂĄgina (â&#x20AC;Ś)â&#x20AC;?. (Ecua-­ dor estoy contigo, 9 de abril 2005). Esta acciĂłn fue promovida por el blog ecuatoriano â&#x20AC;&#x153;El Ecuador de Hoyâ&#x20AC;?, que realizĂł trece enlaces con la palabra â&#x20AC;&#x153;estupidezâ&#x20AC;? dirigida hacia la web de la Presidencia, a la que posteriormente se incor-­ poraron muchos otros blogs, tal y como seĂąala Ecuadorinmediato. com en su post de 10 de abril de 2005. â&#x20AC;&#x153;(â&#x20AC;Ś) La â&#x20AC;&#x2DC;bombaâ&#x20AC;&#x2122; logrĂł sus resultados en apenas un dĂ­a despuĂŠs de lanzada la idea. â&#x20AC;&#x2DC;El Ecuador de Hoyâ&#x20AC;&#x2122; empezĂł con la publica-­ 166


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

FLyQGHOLQNVFRQODSDODEUDHVWXSLGH]GLULJLGDKDFLDHOVLWLR de la Presidencia y luego vino la avalancha de la red de blogs ecuatorianos amigos que replicaron en sus sitios las ideas (â&#x20AC;Ś). Los blogs celebraron su reclamo en lĂ­nea y la Presidencia del Ecuador, ni apenas supo del asunto, puso en blanco la pĂĄgina en cuestiĂłn (â&#x20AC;Ś)â&#x20AC;?. Esta acciĂłn consiguiĂł coordinar al incipiente mundo de los blogs en el Ecuador, tanto a los ubicados dentro del paĂ­s como aque-­ llos radicados en el exterior, que entendieron la importancia de la apropiaciĂłn del espacio virtual como elemento simbĂłlico de pro-­ testa en un escenario novedoso â&#x20AC;&#x201C;como en aquellas ĂŠpocas suponĂ­a ,QWHUQHW TXH IXH XQ HĂ&#x20AC;FD] DPSOLĂ&#x20AC;FDGRU GH ODV SURWHVWDV TXH VH estaban produciendo en las calles del paĂ­s contra Lucio GutiĂŠrrez. $ODKRUDGHUHĂ H[LRQDUVREUHODLPSRUWDQFLDTXHODVDFFLRQHVGH ciberactivismo ciudadano tuvieron durante la â&#x20AC;&#x153;RebeliĂłn de los Fo-­ rajidosâ&#x20AC;?, no podemos perder de vista el hecho de que en 2005 las herramientas de la Web 2.0 se encontraban en sus primeras fases de desarrollo y que, como hemos detallado anteriormente, la pe-­ netraciĂłn de Internet en el Ecuador aĂşn era limitada. Por ello, si bien el â&#x20AC;&#x153;ciberactivismo forajidoâ&#x20AC;? fue seguidor en muchos casos de la iniciativas lideradas por radio La Luna, cometerĂ­amos un error VL OLPLWiVHPRV QXHVWUR DQiOLVLV D HVWD UHĂ H[LyQ SXHV VH HVWDUtD obviando dos elementos que resultan cruciales en este proceso; 1. &RPRYLPRVDQWHULRUPHQWHHOSHUĂ&#x20AC;OGHOXVXDULRGH,QWHU-­ net en Ecuador en 2005 estaba marcado por la juventud de sus miembros, por lo que podemos concluir que los â&#x20AC;&#x153;cibe-­ ractivistas forajidosâ&#x20AC;? crearon un camino para dar a conocer las protestas a un sector de la poblaciĂłn que habitualmente no es seguidor de los medios tradicionales de comunicaciĂłn y que, probablemente, sin este canal de hubiese tenido una movilizaciĂłn mucho mĂĄs limitada.

167


Adolfo Ă lvaro MartĂ­n

2.

La implicaciĂłn de estos â&#x20AC;&#x153;forajidosâ&#x20AC;? jĂłvenes en la revuelta experimentando con las potencialidades de herramientas como blogs, foros y webs para el debate, la denuncia y la movilizaciĂłn desde la complementariedad de la actuaciĂłn en las calles y en el mundo digital, constituyĂł un hecho insĂłlito no solo en el Ecuador sino tambiĂŠn en el resto de AmĂŠrica Latina.

Por ello resulta sorprendente el escaso interĂŠs que ha suscitado HODQiOLVLVGHORULJHQGHOFLEHUDFWLYLVPRHQ(FXDGRUVXVLQĂ XHQ-­ cias y desarrollo y es que, como acertadamente seĂąala Mendizabal (2011), solo puede hablarse de ciberactivismo en este paĂ­s a partir de las acciones ciudadanas desarrolladas durante las movilizacio-­ nes de abril de 2005 que conllevaron la deposiciĂłn del Gobierno de Lucio GutiĂŠrrez, pues fue en ese momento cuando los ciudadanos hicieron un uso intensivo de las tecnologĂ­as de la informaciĂłn y la comunicaciĂłn, tanto para movilizarse como para crear canales alternativos de informaciĂłn y debate, con tal intensidad que hasta ahora no se ha vuelto a repetir. â&#x20AC;&#x153;(â&#x20AC;Ś)Es claro indicar que el activismo y el ciberactivismo gene-­ UDGRDOĂ&#x20AC;QDOGHOSHUtRGRGH/XFLR*XWLpUUH]QRVHKDUHSHWLGR con la misma intensidad y creatividad no obstante aquĂŠl mo-­ vimiento que llevĂł a Correa al poder. Es decir, la intensidad activista no es comparable con dicho momento (2005) indepen-­ GLHQWHPHQWHGHORVFRQĂ LFWRVTXHDWUDYLHVDHOSDtVÂľ 0HQGL]D-­ bal, ob. cit.: 126). (QGHĂ&#x20AC;QLWLYDHOFLEHUDFWLYLVPRQDFLyHQHO(FXDGRUHQHOVHQRGH las movilizaciones contra Lucio GutiĂŠrrez, que eran fruto de la iniciativa de una ciudadanĂ­a desencantada con los partidos polĂ­ti-­ cos tradicionales, por lo que el â&#x20AC;&#x153;ciberactivismo forajidoâ&#x20AC;? no estuvo condicionado por las estrategias de las organizaciones polĂ­ticas en Internet que tienden a limitar sus capacidades a la propaganda y la bĂşsqueda del voto, lo que le permitiĂł ofrecer a los ecuatorianos, 168


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

especialmente los mås jóvenes, nuevas formas de organizarse polí-­ WLFDPHQWHDOPDUJHQGHORVDFWRUHVWUDGLFLRQDOHV\GHLQà XLUHQOD agenda política.

3.3 MĂ&#x2030;XICO: Cuando el ciberactivismo hizo temblar los cuarteles electorales. 1. Uso de Internet y Redes Sociales en MĂŠxico. Los estudios anuales que realiza la AsociaciĂłn Mexicana de In-­ ternet (AMIPCI) de los aĂąos 2011 y 2012 nos aportan datos muy relevantes sobre el uso de Internet y las Redes Sociales. En el co-­ rreVSRQGLHQWHDODxRVHUHDOL]DHOSHUĂ&#x20AC;OGHOLQWHUQDXWDPH[L-­ cano, que corresponderĂ­a a un varĂłn o mujer joven, menor 35 aĂąos y residente en zonas urbanas. En su estudio del 2012, la AMIPCI seĂąalaba que los internautas mexicanos habĂ­an doblado su nĂşmero desde el 2006, pasando de 20,2 a 40,6 millones de usuarios. Es destacable que tan solo en un aĂąo se duplicĂł el uso de Smartphones, que junto a los ordenadores se convertĂ­a en el principal dispositivo para conectarse a Internet. El tiempo promedio de conexiĂłn diario del internauta mexicano se incrementĂł en 2012 en 47 minutos mĂĄs que el aĂąo anterior, pa-­ sando a las 4 horas y 9 minutos. Las principales actividades de los internautas mexicanos eran la utilizaciĂłn del correo electrĂłnico y el uso de las redes sociales. En 2012, el 92% de los internautas mexicanos hacĂ­an uso de ellas segĂşn el estudio de la AMIPCI. En cuanto a la antigĂźedad, cerca de la mitad de ellos reconoce llevar tres o mas aĂąos haciendo uso GHHOODV/DVUHGHVVRFLDOHVSUHIHULGDVHUDQ)DFHERRNFRQXQ de los usuarios, seguidas de YouTube (60%) y Twitter (55%). Respecto a los internautas mĂĄs jĂłvenes, el estudio â&#x20AC;&#x153;GeneraciĂłn 2.0 2011. HĂĄbitos de uso de las redes sociales en los adolescentes de EspaĂąa y AmĂŠrica Latinaâ&#x20AC;? (SĂĄnchez BurĂłn y Ă lvaro, 2011), mues-­ 169


Adolfo Ă lvaro MartĂ­n

tra que los adolescentes y jĂłvenes mexicanos entre los 11 y 17 aĂąos TXHXVDQODVUHGHVVRFLDOHVDOFDQ]DHOVLHQGR)DFHERRNOD red social favorita para el 89%. AdemĂĄs, los adolescentes y jĂłvenes mexicanos reconocen que hacen uso de las redes sociales varias veces al dĂ­a, con un objetivo claramente relacional en el que el LQWHUFDPELRGHDUFKLYRVJUiĂ&#x20AC;FRV\ODFRQYHUVDFLyQFRQORVDPLJRV son las principales actividades para las que se hace uso de ellas. $ODYLVWDGHORVGDWRVH[SXHVWRVSRGHPRVDĂ&#x20AC;UPDUTXHHOXVRGH Internet y las redes sociales tenĂ­a un amplio grado de penetraciĂłn en MĂŠxico en 2012 entre los nativos digitales, lo que sin duda fa-­ FLOLWyODHĂ&#x20AC;FD]XWLOL]DFLyQGHHVWDVKHUUDPLHQWDVHQODVDFFLRQHVGH ciberactivismo llevadas a cabo por el movimiento #Yosoy132. 2. Los antecedentes del ciberactivismo en MĂŠxico: #Inter-­ netNecesario En MĂŠxico, al igual que ocurriĂł en EspaĂąa con las movilizacio-­ nes contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;?, podemos hablar de una acciĂłn de ci-­ beractivismo pionera que cambiĂł la percepciĂłn ciudadana sobre ODVSRVLELOLGDGHVGHHVWDVKHUUDPLHQWDVSDUDLQĂ XLUHQODSROtWLFD 1RV HVWDPRV UHĂ&#x20AC;ULHQGR D ODV PRYLOL]DFLRQHV FRQWUD OD VXELGD GH impuestos a Internet en otoĂąo de 2009. Este movimiento se desplegĂł en MĂŠxico en la segunda mitad de oc-­ tubre y los primeros dĂ­as de noviembre de 2009 contra la iniciativa para gravar los servicios de Internet con impuestos, que suscitĂł desde el primer momento un importante rechazo ante el riesgo de que ello provocase restricciones en cuanto al uso de Internet por razĂłn de renta (El Siglo de TorreĂłn, 2009). A raĂ­z de algunos twit-­ teros llamaran la atenciĂłn sobre el impuesto y lo que ĂŠste podĂ­a VLJQLĂ&#x20AC;FDUVHSXVRHQPDUFKD,QWHUQHW1HFHVDULRXQPRYLPLHQWR que aglutinĂł a miles de personas que, principalmente a travĂŠs de Twitter, pero tambiĂŠn por medio de otras redes sociales, empezĂł a organizarse y a presionar a los senadores mexicanos para conse-­ guir la retirada del impuesto. Para ello abrieron transmisiones vĂ­a 170


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

streaming de las discusiones legislativas, informaron sobre cĂłmo estaba la situaciĂłn de Internet en otros paĂ­ses y realizaron convo-­ catorias para la movilizaciĂłn, que no solo consiguieron captar la atenciĂłn de los polĂ­ticos y medios tradicionales de comunicaciĂłn en MĂŠxico, sino tambiĂŠn ampliaron la fuerza de su reivindicaciĂłn con la gran repercusiĂłn a nivel internacional (El PaĂ­s, 2009d). Alejandro Pisanty, uno de los impulsores de la iniciativa, seĂąa-­ la que pusieron la campaĂąa en marcha un lunes por la maĂąana de forma deliberada, pues creĂ­an que ello atraerĂ­a la atenciĂłn de profesionales, estudiantes y otros posibles interesados, que se en-­ contrarĂ­an en sus lugares de trabajo o estudio en un dĂ­a laborable. A la campaĂąa se incorporaron rĂĄpidamente personas desde los 17 hasta los 60 aĂąos, con gran diversidad de ocupaciones, ubicacio-­ nes, condiciones sociales y preferencias polĂ­ticas. Tan solo treinta y seis horas despuĂŠs del inicio de campaĂąa, hacia la media noche del segundo dĂ­a, #InternetNecesario fue por unas horas â&#x20AC;&#x153;Trending Topicâ&#x20AC;? de Twitter a nivel mundial. La cifra de emisores de mensa-­ jes alcanzĂł un total de 12.000 personas y las de mensajes emitidos OOHJyDDOĂ&#x20AC;QDOGHODVHPDQD 3LVDQW\

6X LQĂ XHQFLD DXPHQWy FXDQGR HO  GH RFWXEUH XQ JUXSR GH VH-­ nadores integrado por el Presidente de la ComisiĂłn de Ciencia y TecnologĂ­a del Senado de la RepĂşblica, Francisco Javier CastellĂłn, y los senadores Dante Delgado Ranauro y Carlos Sotelo, se reunie-­ ron con 50 twitteros, entre los que estaban ciudadanos de entre 17 hasta 60 aĂąos, que fue retransmitida en vivo vĂ­a Internet, con gran repercusiĂłn en las distintas redes sociales. (El Universal, 2009). Al dĂ­a siguiente, 23 de octubre de 2009, el periodista Mario Cam-­ pos realiza en su blog â&#x20AC;&#x153;Campos de Batallaâ&#x20AC;?, en el diario El Univer-­ sal, el siguiente anĂĄlisis de la reuniĂłn; â&#x20AC;&#x153;(â&#x20AC;Ś) Lo que empezĂł como un grupo de personas expresan-­ do su rechazo fue creciendo mediante el poder del reenvĂ­o hasta que adquiriĂł el carĂĄcter de noticia por el peso que 171


Adolfo Ă lvaro MartĂ­n

alcanzĂł en el conjunto de Twitter. Una vez que adquiriĂł ese estatus comenzĂł a saltar de redacciĂłn en redacciĂłn â&#x20AC;&#x201C;en unas mas, en otras menos-­ hasta que la demanda se conso-­ lidĂł como un hecho que saliĂł del ciberespacio a los canales tradicionales (â&#x20AC;Ś)â&#x20AC;?. Campos seĂąala la creciente capacidad de la sociedad para usar In-­ ternet para crear espacios comunes de encuentro, diĂĄlogo, buscar intereses comunes y plantear estrategias de acciĂłn: â&#x20AC;&#x153;(â&#x20AC;Ś) Lo que estĂĄ en juego en este movimiento no es el im-­ puesto del 3 por ciento. Honestamente creo que no es lo mĂĄs importante a estas alturas, sino la posibilidad de que una parte de los mexicanos venzan el cinismo y descubran que es posible que su voz se escuchada y que su opiniĂłn SXHGHLQĂ XLUHQODWRPDGHGHFLVLRQHV ÂŤ Âľ (VWD FDPSDxD FRQVLJXLy TXH HQ OD YRWDFLyQ Ă&#x20AC;QDO GHO 6HQDGR VH eximiĂł de la aplicaciĂłn del IEPS de 3% a las telecomunicaciones al acceso a Internet siempre que se cumplieran unas condiciones HVSHFtĂ&#x20AC;FDVTXHHQODSUiFWLFDEHQHĂ&#x20AC;FLDEDQDODJUDQPD\RUtDGH los internautas mexicanos (BBC, 2009b). 3. #YoSoy132: â&#x20AC;&#x153;Somos estudiantes de la Ibero, no acarrea-­ dos, no porros..â&#x20AC;? a. El panorama polĂ­tico ante las elecciones presidenciales GH MĂŠxico encarĂł las elecciones presidenciales de julio de 2012 en un clima de incertidumbre derivado de los problemas de desigualdad, inseguridad y perspectiva econĂłmica negativa que, segĂşn Mu-­ Ăąoz LĂłpez (2012), estaba afectando a la calidad de la democracia como consecuencia de la frustraciĂłn de la ciudadanĂ­a que no es-­ taba viendo cubiertas sus expectativas de cambio y que, por ello, mostraba un creciente distanciamiento de las instituciones y los partidos polĂ­ticos. 172


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

Este desencanto era consecuencia de la incapacidad mostrada por el PAN (Partido de AcciĂłn Nacional) para llevar a cabo la transi-­ ciĂłn democrĂĄtica que prometiĂł al llegar al poder en el aĂąo 2000 y que, segĂşn Meyer (2011), habĂ­a creado un estado de resignaciĂłn social que convirtiĂł al candidato del Partido Revolucionario Ins-­ titucional (PRI), Enrique PeĂąa Nieto, en el mĂĄximo favorito a las elecciones presidenciales no por sus capacidades para ilusionar a los mexicanos, sino por â&#x20AC;&#x153;la fatiga de un largo empeĂąo que no dio frutosâ&#x20AC;?. Debe tenerse en cuenta que ya en 2006, el entonces elegido Pre-­ sidente de la RepĂşblica Felipe CalderĂłn, asumiĂł el cargo tras un polĂŠmico proceso electoral que le otorgĂł la victoria por un exiguo margen, entre acusaciones de su contrincante AndrĂŠs Manuel LĂłpez Obrador de utilizaciĂłn del aparato del Estado a favor de CalderĂłn (El Universal, 2006). La etapa de gobierno de CalderĂłn no consiguiĂł resolver las principales demandas ciudadanas, espe-­ cialmente en economĂ­a y seguridad, como consecuencia del escaso crecimiento econĂłmico y de los elevados costes sociales derivados de las reformas emprendidas (CNNExpasiĂłn, 2011). En este senti-­ do, resultan reveladoras las palabras del escritor mexicano Elmer Mendoza; â&#x20AC;&#x153;(â&#x20AC;Ś)El presidente CalderĂłn y su equipo son gente que no conoce el paĂ­s que gobiernan, o no lo conocĂ­an. Ă&#x2030;l y su equi-­ po son un grupo de buenas personas, de buenas familias, pero MĂŠxico es un paĂ­s tan grande que las buenas personas de buenas familias se mueven en un territorio bastante li-­ mitado, igual las universidades en las que estudian, que QR WLHQHQ TXH YHU FRQ RWUDV UHJLRQHV RWURV SHUĂ&#x20AC;OHV RWUR tipo de personas. Ellos llegan ahĂ­ y quieren hacer la del Llanero Solitario y creen que pueden resolver este proble-­ ma. Lo que hacen es declarar la guerra a la delincuencia organizada pero luego lo Ăşnico que hicieron fue producir una situaciĂłn nueva, de pĂŠrdida de control, de pĂŠrdida de 173


Adolfo Ă lvaro MartĂ­n

vidas y que los ha llevado en estos cinco aĂąos a ningĂşn sitio (â&#x20AC;Ś)â&#x20AC;? (El PaĂ­s, 2011j). En efecto, la ofensiva iniciada por CalderĂłn contra los cĂĄrteles de ODGURJDKDEtDSURYRFDGRPiVGHPXHUWRVDĂ&#x20AC;QDOHVGH (AmĂŠricaeconomĂ­a, 2010), en una espiral de violencia que llegĂł hasta los Estados Unidos y que se cobrĂł la vida de varios miles de niĂąos muertos y huĂŠrfanos, segĂşn denunciĂł el Presidente de la Co-­ misiĂłn de Derechos Humanos del Distrito Federal, Luis GonzĂĄlez Plasencia (Proceso, 2011). El alto nivel de vĂ­ctimas que provocĂł la guerra contra los cĂĄrteles y la pĂŠsima polĂ­tica informativa sobre la victimas que ocasionĂł, tuvieron como consecuencia un incremento continuado de la reprobaciĂłn de la labor del presidente CalderĂłn que, en plena campaĂąa electoral, alcanzĂł su nivel mĂĄs alto con un 48% de ciudadanos que reprobaban su gestiĂłn (El Universal, 2012). 3DUDĂ&#x20AC;QDOL]DUHOFOLPDGHLQFHUWLGXPEUHFRQHOTXH0p[LFRDIURQWy las presidenciales de 2012 se vio incrementado ante el rechazo que la candidatura de PeĂąa Nieto provocĂł en distintos sectores, al que se acusĂł de ser un peligro para MĂŠxico; â&#x20AC;&#x153;(â&#x20AC;Ś) organizaciones sociales asĂ­ como mujeres abusadas sexualmente por policĂ­as, advirtieron sobre los riesgos para el paĂ­s en caso de que el priista Enrique PeĂąa Nieto gane las elecciones presidenciales de julio prĂłximo(â&#x20AC;Ś)â&#x20AC;?. (Proce-­ so, 2012). b. #YoSoy132: La revuelta de los nativos digitales mexica-­ nos. SegĂşn un estudio publicado por el Centro de Estudios Sociales y de OpiniĂłn PĂşblica de la CĂĄmara de Diputados (CESOP) al comienzo de la campaĂąa electoral, los jĂłvenes mexicanos entre 18 y 29 aĂąos llamados a votar en las elecciones de 2012 estaba compuesto por aproximadamente veintitrĂŠs millones de personas, equivalente al 174


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

29,5% del padrĂłn electoral, de los cuales, tres millones y medio estaban llamados a acudir a las urnas por primera vez. El estudio tambiĂŠn mostraba datos muy preocupantes sobre la desafecciĂłn de los jĂłvenes mexicanos con su clase polĂ­tica; Â&#x2021; (OPDQLIHVWDEDTXHODSROtWLFDOHVLQWHUHVDED´SRFRR nadaâ&#x20AC;?. Â&#x2021; /RVPH[LFDQRVMyYHQHVWLHQHQEDMDVWDVDVGHSDUWLFLSDFLyQHQ los procesos electorales, que en el caso de las celebradas en 2009, tuvo los mayores Ă­ndices de abstenciĂłn entre los 20 y los 29 aĂąos. De los datos del estudio podemos concluir que los jĂłvenes mexica-­ QRVPDQLIHVWDEDQXQDJUDQGHVFRQĂ&#x20AC;DQ]DKDFLDORVDFWRUHVSROtWL-­ cos tradicionales, pero no por ello dejaban de preocuparse por la situaciĂłn polĂ­tica del paĂ­s y por la democracia. Ello, nos permite comprender porquĂŠ el movimiento #YoSoy132 naciĂł en el entorno de estos jĂłvenes desencantados con lo que estaba ocurriendo en su paĂ­s. Fueron estos jĂłvenes los que el 11 de mayo de 2012, en el audito-­ rio â&#x20AC;&#x153;JosĂŠ SĂĄnchez VillaseĂąorâ&#x20AC;? del Campus Ciudad de MĂŠxico de la Universidad Iberoamericana, obligaron al candidato presidencial de la coaliciĂłn â&#x20AC;&#x153;Compromiso por MĂŠxicoâ&#x20AC;? (conformado por los par-­ tidos PRI y PVEM) Enrique PeĂąa Nieto, a dar explicaciones por sus comportamiento en el caso Atenco cuando era gobernador del Estado de MĂŠxico; â&#x20AC;&#x153;Antes de concluir, aunque ya lo habĂ­a hecho, voy a respon-­ der a este cuestionamiento sobre el tema de Atenco, hecho que ustedes conocieron, y que sin duda, dejĂł muy claro la Ă&#x20AC;UPHGHWHUPLQDFLyQGHOJRELHUQRGHKDFHUUHVSHWDUORVGH-­ rechos de la poblaciĂłn del estado de MĂŠxico, que cuando se vieron afectados por intereses particulares, tomĂŠ la deci-­ siĂłn de emplear el uso de la fuerza pĂşblica para restablecer 175


Adolfo Álvaro Martín

el orden y la paz, y que en el tema, lamentablemente hubo incidentes que fueron debidamente sancionados, y que los responsables de los hechos fueron consignados ante el po-­ der judicial, pero, reitero, fue una acción determinada per-­ sonalmente, que asumo personalmente, para restablecer el orden y la paz, en el legítimo derecho que tiene el Estado mexicano de hacer uso de la fuerza pública, como además debo decirlo, fue validado por la Suprema Corte de Justicia de la Nación” (El Financiero, 2012). Esta contestación provocó las iras de un importante grupo de estu-­ diantes presentes en el acto, lo que obligó a Peña Nieto a salir de la universidad protegido por la policía para evitar a los centenares de jóvenes que coreaban consignas en su contra (TeleSur, 2012). Los estudiantes publicaron en distintas redes sociales los videos de la protesta, ante el sesgo que en su opinión estaban dando de los hechos diversas cadenas televisivas (Televisa, 2012) y periódi-­ cos nacionales (El Sol de México, 2012), al señalar que la protesta no era una auténtica expresión de jóvenes universitarios y si un boicot político. Esta consigna del boicot fue también la utilizada por destacados representantes del PRI, como Pedro Joaquin Coldwell; “un puñado de jóvenes que no son representativos de la comunidad de la Ibero asumió una actitud de intolerancia respecto a los planteamientos que hacía nuestro candidato, y pues frente a eso, rescato la reacción de Peña Nieto, me gustó mucho (…)” (Vanguardia, 2012). Por su parte, como señala el Observatorio y Monitoreo Ciudadano de Medios (OMCIM), el senador Arturo Escobar, en una entrevista telefónica realizada por Cadena Tres, también insistió en la teoría del boicot llevado a cabo por elementos ajenos al mundo universi-­ tario: 176


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

â&#x20AC;&#x153;(â&#x20AC;Ś)hay un grupo ahĂ­ de, no quiero decir â&#x20AC;&#x2DC;jĂłvenesâ&#x20AC;&#x2122; por que ya estaban mayorcitos, cĂĄlculo de 30 a 35 aĂąos para arriba, incitando, era un grupo minoritario, no pasaba de 30 perso-­ nas incitando un poco a hacer escĂĄndalo, la cosa no pasĂł a PD\RUHVSHURVtKXERÂŤSDVDURQGHODSDVLyQGHODDĂ&#x20AC;FLyQ sobre otro candidato a los insultos y hubo un momento en que incluso hubo amagos de agresiĂłn fĂ­sica [...] yo estudiĂŠ en la Ibero, es una universidad plural donde se respeta ab-­ solutamente la diferencia de opiniĂłn, y estoy convencido de que aquellos que abanderaron o la mayorĂ­a de los que DEDQGRQDURQHVDSDUWHĂ&#x20AC;QDOGHODFWRQRVRQHVWXGLDQWHVGH la Ibero (â&#x20AC;Ś)â&#x20AC;? (OMCIM, 2012). Finalmente, el equipo de campaĂąa de PeĂąa Nieto lanzĂł un video el dĂ­a 13 de mayo (Proceso, 2012.b) difundido por diversos medios de comunicaciĂłn, en se trataba de dar una imagen de polĂ­tico valiente y, se claramente se acusaba a los estudiantes de la Ibero que pro-­ testaron de estar al servicio de intereses partidistas. (Tu.tv, 2012). En respuesta a esta campaĂąa, un grupo de 131 jĂłvenes universita-­ rios publicaron un video en Internet el dĂ­a 14 de mayo, en el mos-­ trando sus acreditaciones de la Universidad Iberoamericana, des-­ mentĂ­an con imĂĄgenes del acto las acusaciones de violencia contra PeĂąa Nieto, y reclamaban su derecho de replica frente a JoaquĂ­n &ROGZHOO$UWXUR(VFREDU\PHGLRVGHFRPXQLFDFLyQTXHFDOLĂ&#x20AC;FD-­ EDQ GH ´GXGRVD QHXWUDOLGDGÂľ DĂ&#x20AC;UPDQGR QR SHUWHQHFHU D SDUWLGR polĂ­tico alguno y defender el carĂĄcter estudiantil de la protesta. (YouTube, 2012). El video se difundiĂł de forma inmediata y masiva, alcanzando en DSHQDVXQDVHPDQDODVYLVLWDVVHJ~QLQGLFyHOEORJ*HHN Trainee Blog en su post del 18 de mayo de 2012. Igualmente, el video fue â&#x20AC;&#x153;Trending Topicâ&#x20AC;? a nivel mundial durante los dĂ­as 14 y 15 de mayo del 2012. (TWEEdotco, 2012).

177


Adolfo Ă lvaro MartĂ­n

/DUHVSXHVWDDHVWHYLGHRIXHXQDQXHYDDQGDQDGDGHGHVFDOLĂ&#x20AC;FD-­ ciones y crĂ­ticas contra estos jĂłvenes, especialmente, a travĂŠs de twitter, donde se les acusĂł desde estar al servicio de intereses de directivos de la Universidad, de realizar acciones de terrorismo e, incluso, se llegaron a las amenazas (Proceso, 2012b): â&#x20AC;&#x153;El usuario @PAUL0581 escribiĂł: Me conmoverĂ­an los 131 pendejos d la ibero que hicieron el video, si en lugar de la credencial, hubieran puesto sus NiUGH[GHFDOLĂ&#x20AC;FDFLRQHVÂľ Desde algunos medios, se acusĂł a estos jĂłvenes de estar al servicio de la izquierda para atacar al candidato del PRI Enrique PeĂąa Nieto, caso del periodista JosĂŠ Contreras; â&#x20AC;&#x153;(â&#x20AC;Ś)Se trata de un movimiento prefabricado por lĂ­deres de la izquierda partidista con la intenciĂłn de generar un nĂş-­ cleo de oposiciĂłn sistemĂĄtica a la candidatura del priista Enrique PeĂąa Nieto. De acuerdo con los datos recabados y FRQĂ&#x20AC;UPDGRVHQYDULDVIXHQWHVSRUHVWHUHSRUWHURHOSULQFL-­ pal orquestador de este movimiento fue el coordinador del DIA y ahora candidato del PRD al Senado, Manuel Cama-­ cho SolĂ­s. El primer objetivo era hacer ver mal a PeĂąa Nie-­ to durante su visita a la Universidad Iberoamericana(â&#x20AC;Ś)â&#x20AC;? (CrĂłnica, 2012). Pero quizĂĄs lo mĂĄs preocupante de las acciones contra este grupo de jĂłvenes universitarios vino de la mano del Presidente del Or-­ ganismo Nacional de JĂłvenes PriĂ­stas, Jorge Yazberth, en el que amenazaba a una de las 131 alumnas que participaron en el video (Homozapping, 2012): â&#x20AC;&#x153;@JorgeYazberth escribiĂł (14 de mayo): @palomarrazola SI, si ya te encontraremos a ti y todos tus compaĂąeros. Cuidado, no todo es libertad de expresiĂłn ;)â&#x20AC;? 178


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

SegĂşn denuncia esta publicaciĂłn, este y otro tuit de Jorge Yaz-­ berth fueron borrados posteriormente al comprobar la repercusiĂłn que tuvieron, con la intenciĂłn de evitar cualquier rastro. La respuesta contra esta campaĂąa lanzada contra los universita-­ rios de la Ibero se articulo por medio de las redes sociales a nivel nacional, donde naciĂł la frase â&#x20AC;&#x153;Yo soy el 132â&#x20AC;? como acto de solida-­ ULGDG\DSR\RIUHQWHDODVGHVFDOLĂ&#x20AC;FDFLRQHV\DPHQD]DVUHFLELGDV Al principio, universitarios de otros centros comenzaron a colgar videos en YouTube, pero casi inmediatamente se unieron miles de ciudadanos sin distinciĂłn de edad, clase social o tendencias, que fueron el origen de #YoSoy132 (Sinembargo, 2012). En este contexto, el dĂ­a 17 de mayo se emite en el programa de la SHULRGLVWD'HQLVH0DHUNHUHQ7HOHYLVDXQUHSRUWDMHWLWXODGR´XQ dĂ­a en campaĂąa con Enrique PeĂąa Nietoâ&#x20AC;?, en el se exhiben porta-­ das de periĂłdicos que acusaban a los alumnos de la Universidad Iberoamericana de preparar un boicot contra PeĂąa Nieto, y donde se puede escuchar al candidato y su portavoz David LĂłpez hablar de un informe que hace referencia a una estudiante, a la que citan como pro-­AMLO y de la cual dicen saber todo (Televisa, 2012b). Este video emitido por Televisa, muy especialmente lo referido a las investigaciones a una estudiante, aumentaron la indignaciĂłn y las protestas de los estudiantes, lo que provocĂł que el dĂ­a 18 de mayo #YoSoy132 diese su primera rueda de prensa (Ustream, 2012). El Movimiento declara que su nacimiento se produce como consecuencia de una â&#x20AC;&#x153;situaciĂłn nacional desastrosaâ&#x20AC;? derivada de la violencia que sacude a MĂŠxico, y como reacciĂłn a lo que conside-­ ran â&#x20AC;&#x153;coyuntura electoral manipuladaâ&#x20AC;? por la acciĂłn de los medios de comunicaciĂłn tradicionales. AdemĂĄs, se dieron a conocer sus los Principios Generales: Â&#x2021; Apartidista, negando vinculo con cualquier partido polĂ­tico. Â&#x2021; 3DFtĂ&#x20AC;FR, desaprobando de manera categĂłrica cualquier acto de violencia. 179


Adolfo Ă lvaro MartĂ­n

Â&#x2021; De base estudiantil, se entiende con esto que el estudiantado es catalizador del cambio social. Â&#x2021; Laico, desvinculĂĄndose de cualquier doctrina e instituciĂłn reli-­ giosa. Â&#x2021; Plural, porque los sectores sociales adherentes son parte esen-­ cial de movimiento, reconociendo un vinculo compartido de soli-­ daridad y unidad en lucha con otros movimientos, sin que esto VLJQLĂ&#x20AC;TXHTXHHOPRYLPLHQWRORVVXVWLWX\D Â&#x2021; De carĂĄcter social, ya que nuestras acciones inciden directa-­ mente en las formas de relaciĂłn entre individuos encaminadas a la construcciĂłn activa del bienestar comĂşn. Â&#x2021; De carĂĄcter polĂ­tico, de tal forma que se interesa en los asun-­ tos pĂşblicos y pretende desarrollar la participaciĂłn ciudadana, sin limitar ĂŠsta a la llamada clase polĂ­tica, que pretende ser la Ăşnica intĂŠrprete de los asuntos pĂşblicos del paĂ­s. Â&#x2021; Humanista, entendiendo que se busca revalorizar y desarro-­ OODUWRGDVODVFDSDFLGDGHVKXPDQDV\ODUHGHĂ&#x20AC;QLFLyQGHOFDUiF-­ ter ĂŠtico. Â&#x2021; AutĂłnomo, porque respeta y valora las decisiones de cada asamblea que lo integra sin que exista otra forma de participa-­ ciĂłn en el movimiento. Â&#x2021; De carĂĄcter permanenteSXHVWRTXHQXHVWURVĂ&#x20AC;QHVWUDVFLHQ-­ den la coyuntura electoral. Â&#x2021; Anti-­neoliberal, porque busca erradicar este injusto sistema econĂłmico, polĂ­tico y social. Posteriormente, miembros de #YoSoy132 provenientes de diver-­ sas universidades mexicanas realizaron una concentraciĂłn frente a las instalaciones de Televisa en contra de lo que denuncian como â&#x20AC;&#x153;manipulaciĂłn informativa de los mediosâ&#x20AC;?, exigiendo a la cadena televisiva que iniciase un diĂĄlogo con representantes del Movi-­ 180


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

miento. Se realiza una gran difusiĂłn de las protestas por medio de cuenta en Twitter @masde131 y los hashtags #MarchaYoSoy132 y #YoSoy132. (24 Horas, 2012). Pepe Flores, denunciĂł en el Blog ALT1040 que desde entornos prĂłximos al PRI se utilizaron cuentas controladas para saturar el KDVKWDJ<RVR\FRQODĂ&#x20AC;QDOLGDGGHHYLWDUTXHIXHVHWUHQGLQJ topic, asĂ­ como que se estaba utilizando el spam para evitar el se-­ guimiento en redes sociales de la protesta del dĂ­a 18 de mayo. Por ello, desde plataformas como Terra MĂŠxico o Ustream se dio cober-­ tura de la marcha, y distintos activistas compartieron imĂĄgenes de las mismas y dieron cobertura de lo que ocurrĂ­a (ALT1040, 2012). Para dĂ­a 23 de mayo, #YoSoy132 convoca una marcha a travĂŠs de las redes sociales contra Televisa en diversas ciudades mexicanas SRUPHGLRGHODVUHGHVVRFLDOHV(Q)DFHERRNVHSRGtDOHHUHOVL-­ guiente texto de convocatoria; â&#x20AC;&#x153;YoSoy132 EXIGE: La democratizaciĂłn de los medios de FRPXQLFDFLyQFRQHOĂ&#x20AC;QGHJDUDQWL]DULQIRUPDFLyQWUDQV-­ parente, plural, e imparcial para fomentar una conciencia y pensamiento crĂ­ticos. Representamos un sector consciente y cansado de este ses-­ go en la verdad. Lucharemos frontalmente contra la mani-­ pulaciĂłn, pues consideramos un insulto los preocupantes mecanismos de la polĂ­tica para generar matices de opiniĂłn cimentadas en la mentira y el engaĂąo. Somos un movimiento ciudadano, AJENO COMPLE-­ TAMENTE a cualquier movimiento partidista, y a toda expresiĂłn de rechazo o apoyo directo hacia cualquier candidato polĂ­tico (tal como la #marchaAntiEPN, o la #marchaProAMLO). Nuestro objetivo se enfoca en los me-­ dios informativos y su papel en un contexto democrĂĄtico.â&#x20AC;?

181


Adolfo Ă lvaro MartĂ­n

La convocatoria constituyĂł un ĂŠxito, tal y como reconocieron los medios de comunicaciĂłn tradicionales (Televisa, 2012c), los cuales, tambiĂŠn reconocieron la capacidad de movilizaciĂłn que #YoSoy132 habĂ­a logrado gracias a las redes sociales, que se colapsaron du-­ rante la celebraciĂłn de las marchas en las distintas ciudades mexi-­ canas: â&#x20AC;&#x153;Miles de jĂłvenes comprobaron ayer que las redes sociales representan el â&#x20AC;&#x2DC;quinto poderâ&#x20AC;&#x2122; como ellos las llaman. En dĂ­as SDVDGRVDWUDYpVGH7ZLWWHU\)DFHERRNODQ]DURQODFRQYR-­ catoria para que estudiantes de diferentes escuelas partici-­ paran en una movilizaciĂłn. Esperaban la asistencia de por lo menos 5 mil alumnos; sin embargo, la cifra se triplicĂłâ&#x20AC;?. (CrĂłnica.com, 2012b) â&#x20AC;&#x153;HabĂ­a cartulinas con alusiones a temas diversos (â&#x20AC;Ś). Mu-­ chas otras hacĂ­an alusiĂłn en sus pancartas al poder de las redes sociales, las cuales se saturaron. Resultaba casi im-­ posible poder acceder a Twitter y revisar la evoluciĂłn del hashtag #YoSoy132â&#x20AC;?. (El Economista, 2012). (OPRYLPLHQWR<R6R\FRQVLJXLyLQĂ XLUGHĂ&#x20AC;QLWLYDPHQWHHQOD agenda de la campaĂąa electoral con su demanda de que se llevasen a cabo debates electorales con la mĂĄxima difusiĂłn en los medios de comunicaciĂłn, lo que obligĂł a que Televisa emitiera el segundo de-­ bate de las elecciones travĂŠs del Canal 2 con cobertura nacional (El Siglo de TorreĂłn, 2012). Este hecho obligĂł a todos los candidatos a cambiar su estrategia, asumiendo la propuesta estudiantil, tal y como reconociĂł el candidato del PRI Enrique PeĂąa Prieto, princi-­ pal aspirante a la victoria; â&#x20AC;&#x153;Me he pronunciado por que no tengamos espacio o razĂłn TXHVXSRQJDTXHQRKXERODVXĂ&#x20AC;FLHQWHFREHUWXUD GHOGHED-­ te), por eso me he pronunciado por que se logre este propĂł-­ sito de tener la cadena nacional para el segundo debateâ&#x20AC;? (La Jornada Jalisco, 2012). 182


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

La principal consecuencia de la difusiĂłn a nivel nacional del se-­ gundo debate, celebrado el dĂ­a 10 de junio de 2012, fue que la au-­ diencia alcanzĂł los 22.6 puntos, mĂĄs del doble de los logrados por el primer debate celebrado el dĂ­a 6 de mayo que no supero los 10.4 puntos. (MĂŠxico CNN, 2012). /D FDSDFLGDG TXH <R6R\ HVWDED WHQLHQGR SDUD PRGLĂ&#x20AC;FDU OD agenda de la campaĂąa electoral provocĂ��, segĂşn denuncias de dis-­ tintos medios de comunicaciĂłn, que desde sectores cercanos al PRI se organizasen acciones desestabilizadoras tendentes a despresti-­ giar a los estudiantes, como el caso de GeneraciĂłn MX, un grupo que se tratĂł de hacer pasar como una escisiĂłn de #YoSoy132, y que, segĂşn denunciaron distintas redes sociales, estaba compuesto por activistas cercanos a PeĂąa Nieto, (Proceso, 2012c). Las amenazas a los miembros de #YoSoy132 fueron aumentando a medida que se hacĂ­a mĂĄs visible su presencia en la campaĂąa elec-­ toral y fue creciendo el nerviosismo en los cuarteles electorales; â&#x20AC;&#x153;Alan Alvarado, ingeniero en Sistemas Computacionales egre-­ sado del Instituto PolitĂŠcnico Nacional y actual residente en 5XVLDUHFLELyHVWHGtDXQFRUUHRHOHFWUyQLFRĂ&#x20AC;UPDGRSRU(OL]D Solis, quien se presenta como integrante del movimiento Gene-­ raciĂłn MX: â&#x20AC;&#x2DC;Compatriota. Sabemos que te encuentras estudiando en Rusia HQ OD HVFXHOD GH 6NRONRYR 4XH DGHPiV GH HOOR UHDOL]DV VRIW-­ ware para compaùías de paĂ­ses de Europa. Nosotros no que-­ remos intervenir en tu futuro y es por ello que pedimos de tu apoyo a este grupo que no siendo mas que un grupo de soporte y en contra al grupo #yosoy132, una vez unido a nuestro grupo tendrĂĄs apoyo econĂłmico por parte de la entidad de gobierno en donde por requisito te haremos llegar un formato que llenaras donde detallas tus gastos diarios y anexo a ello necesitamos tu IFE. ApĂłyanos y te apoyaremos, tu omisiĂłn a este llamado es falta a la patria y claro la patria te responderĂĄ en la misma formaâ&#x20AC;? (sic)â&#x20AC;&#x2122;. 183


Adolfo Ă lvaro MartĂ­n

Este mensaje ha sido enviado en forma personalizada a cuatro mexicanos residentes en Australia, asĂ­ como miembros de #Yo-­ soy132enelextranjero en Korea, Inglaterra y Brasil, advirtiĂł Alvarado en entrevista con Apro.â&#x20AC;? (Proceso, 2012c). La â&#x20AC;&#x153;guerra suciaâ&#x20AC;? contra #YoSoy132 continuĂł con un ataque de la web www.yosoy132.mx, donde un supuesto integrante del colec-­ tivo presentaba grabaciones que probarĂ­an la vinculaciĂłn con el candidato LĂłpez Obrador, lo que fue tajantemente rechazado por portavoces de los estudiantes (Proceso, 2012d). Esta estrategia se-­ rĂ­a una constante durante toda la campaĂąa y, como veremos mĂĄs DGHODQWHSXGRWHQHULQĂ XHQFLDDODKRUDGHIUHQDUHOGHVJDVWHGHO candidato PeĂąa Nieto. A pesar de estas campaĂąas de desprestigio y amenazas, a medi-­ da que la campaĂąa avanzaba fue mĂĄs perceptible la presencia e LQĂ XHQFLD GHO 0RYLPLHQWR <R6R\ TXH IXH FDSD] GH FRQYHQ-­ cer a tres de los cuatro principales candidatos presidenciales para participar en un debate sin la intervenciĂłn del Instituto Federal Electoral (IFE), responsable de organizar las elecciones en MĂŠxico. La convocatoria se realizĂł por medio de un video difundido en las redes sociales, en el cual, el portavoz de #YoSoy132 Alfredo Mata, convocaba a los internautas al debate que tendrĂ­a lugar el dĂ­a 19 de junio de 2012, a las 20 horas, en la sede de la ComisiĂłn de Dere-­ chos Humanos del Distrito Federal. (YouTube, 2012b). $OGHEDWHDFXGLHURQORVFDQGLGDWRV-RVHĂ&#x20AC;QD9i]TXH]0RWD 3DUWL-­ do de AcciĂłn Nacional, PAN), AndrĂŠs Manuel LĂłpez Obrador (Par-­ tido de la RevoluciĂłn DemocrĂĄtica, PRD) y Gabriel Quadri (Nueva Alianza, NA). El candidato del PRI, Enrique PeĂąa Nieto, declinĂł asistir a este tercer debate, aunque durante la celebraciĂłn del mis-­ mo hubo una silla vacĂ­a para ĂŠl y se leyeron las preguntas que se habĂ­an preparado para este candidato. El formato del debate consistiĂł en tres fases, cada una de ellas dirigida por un moderador distinto (MĂŠxico CNN, 2012b): 184


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

Â&#x2021; /DSULPHUDIDVHHVWXYRFHQWUDGDHQJUDQGHVWHPDVMXVWLFLD y seguridad, economĂ­a, salud, ciencia y tecnologĂ­a, ecologĂ­a y desarrollo sostenible, derechos humanos, educaciĂłn, medios de comunicaciĂłn, arte y cultura. Cada candidato respondiĂł a tres preguntas sobre estos temas que les formularon miembros del Movimiento #YoSoy132 de distintas universidades mexicanas. Â&#x2021; (OVHJXQGREORTXHVHFDUDFWHUL]ySRUXQGHEDWHDELHUWRGHORV candidatos en torno a dos temas que habĂ­an sido esenciales en las movilizaciones de #YoSoy132; la democratizaciĂłn de los me-­ dios y el combate a los monopolios. Â&#x2021; (QOD~OWLPDSDUWHGHOGHEDWHORVFDQGLGDWRVUHVSRQGLHURQDODV preguntas mĂĄs votadas que los internautas habĂ­an enviado. Aunque en un primer momento se dudĂł del impacto de este debate en la opiniĂłn pĂşblica al no ser retransmitido por los grandes cana-­ les de televisiĂłn nacional, la realidad fue que #YoSoy132 consiguiĂł hacer girar durante aquellos dĂ­as toda la campaĂąa en torno al ter-­ cer debate, lo que obligĂł a que otros medios de comunicaciĂłn tradi-­ cional, como el caso de Televisa, anunciasen pocas horas antes de su inicio que realizarĂ­an la transmisiĂłn en vivo del debate a travĂŠs de su web (El Economista, 2012b). La retransmisiĂłn del debate adoleciĂł de diversos fallos tĂŠcnicos en las pĂĄginas que lo transmitĂ­an por la misma seĂąal, lo que provocĂł que durante el mismo se generase el hashtag #DebateYoSoy132, donde muchos usuarios manifestaron su irritaciĂłn por esta situa-­ ciĂłn y, en algunos casos, llegaron a acusar al PRI de ser el cau-­ sante de los mismos (Zacatecas@nline, 2012). Al respecto de estos fallos tĂŠcnicos la empresa Google MĂŠxico, que proporcionĂł asesorĂ­a al debate, manifestĂł que las televisiones que solicitaron acceso a la seĂąal para transmitir en vivo no lo pudieron hacer por razones tĂŠcnicas, derivadas de que no disponĂ­an del equipo necesario para adaptar la emisiĂłn de un debate pensado en un formato para In-­ ternet a la seĂąal convencional de televisiĂłn. (La Jornada, 2012). 185


Adolfo Ă lvaro MartĂ­n

(QFXDOTXLHUFDVRSHVHDODVGLĂ&#x20AC;FXOWDGHVWpFQLFDV\ODVOLPLWDFLR-­ nes para la difusiĂłn, serĂ­a totalmente injusto y alejado de la rea-­ lidad seĂąalar que el debate organizado por #YoSoy132 no tuvo re-­ percusiĂłn en la campaĂąa electoral. Prueba de ello fue que todos los partidos polĂ­ticos felicitaron a los estudiantes por la celebraciĂłn del debate, incluido el PRI, que por boca de su portavoz Manilo Fabio Beltrones manifestĂł â&#x20AC;&#x153;que hay que felicitar la actitud madu-­ ra y democrĂĄtica que tuvieron los jĂłvenes en este eventoâ&#x20AC;?, y que VHYLRHQODREOLJDFLyQGHMXVWLĂ&#x20AC;FDUODDXVHQFLDGH3HxD1LHWRHQ el debate, alegando que la invitaciĂłn venĂ­a rodeada de actitudes hostiles que no garantizaban las condiciones de neutralidad para participar en el mismo (La Jornada, 2012b). La difusiĂłn del debate por YouTube supuso una autĂŠntica revolu-­ ciĂłn en MĂŠxico, donde 90.000 usuarios se suscribieron para poder seguir en vivo el mismo a travĂŠs de esta plataforma. Debe tener-­ se en cuenta, ademĂĄs, que varias de las conexiones se realizaron desde lugares pĂşblicos en distintas ciudades como el ZĂłcalo de Ciudad de MĂŠxico (The Narco News Bulletin, 2012). Uno de los as-­ pectos que mĂĄs se valorĂł del debate organizado por #YoSoy132 fue el enorme calado polĂ­tico de sus contenidos, lo que fue puesto en FRQWUDSRVLFLyQFRQODVXSHUĂ&#x20AC;FLDOLGDGGHOSULPHUGHEDWHHQHOTXH apareciĂł una modelo de playboy con vestido ceĂąido y pronunciado escote, fue la encargada de dar los turnos de palabra a los candi-­ datos (CNN MĂŠxico, 2012c). En cuanto al impacto de este tercer debate, si bien un estu-­ dio de la consultorĂ­a â&#x20AC;&#x153;Grupo Impacto Inteligente 360Âşâ&#x20AC;? seĂąalaba que solo cuatro de cada diez mexicanos estaba enterado de que se iba a celebrar un debate entre los candidatos organizado por #YoSoy132(gii360, 2012), lo cierto es que este interĂŠs fue en au-­ mento a medida que se acercaba su inicio y mĂĄs medios se su-­ maron a la emisiĂłn, lo que produjo el colapso de la Red durante el debate (La Jornada, 2012c) y una actividad en Twitter hasta aquel momento desconocida en la campaĂąa electoral mexicana, tal 186


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

y como seĂąala capitalsocialmexico.com en su post del 20 de junio de 2012: â&#x20AC;&#x153;(â&#x20AC;Ś)Al momento de la redacciĂłn de esta entrada, el has-­ htag #DebateYoSoy132 aĂşn se encuentra en los primeros lugares de la lista de trending topics de Twitter. Estoy escribiendo este texto 14 horas DESPUĂ&#x2030;S del inicio del de-­ bate que arrancĂł el martes a las 20:00 horas (â&#x20AC;Ś)Estamos hablando de casi 250 mil tuits sobre y alrededor del evento, GHDFXHUGRFRQHOVLWLR7RSV\WDOFRPRPXHVWUDODJUiĂ&#x20AC;FD Si bien la actividad es menor a la registrada en el segundo debate del IFE el volumen de mensajes enviados sobre el encuentro juvenil es para levantar mĂĄs de un par de cejas. Hay que recordar que el servicio Topsy sĂłlo toma en cuenta aquellos mensajes que contienen una liga o que han sido retuiteados y que no provienen de bots. Lo mĂĄs probable es que esa cifra de 250 mil tuits estĂŠ subrepresentada (â&#x20AC;Ś)â&#x20AC;? 3HURTXL]iVORPiVUHOHYDQWHGHHVWHGHEDWHYLQRXQDYH]Ă&#x20AC;QDOL]y pues como indicĂł Rodrigo Serrano, uno de los portavoces de #Yo-­ Soy132 que participĂł como moderador, en las primeras sesenta horas tras su celebraciĂłn, el video del evento habĂ­a tenido 840.000 visitas en YouTube, lo que a su entender suponĂ­a un ĂŠxito sin pre-­ cedentes al considerar que â&#x20AC;&#x153;un video en YouTube lo ven en prome-­ dio tres personas por cada reproducciĂłnâ&#x20AC;?. (Aristeguinoticias.com, 2012). Igualmente, la repercusiĂłn en los medios de comunicaciĂłn tradicionales fue excepcional, generando decenas de noticias, co-­ mentarios y artĂ­culos de opiniĂłn, que llevaron a la conclusiĂłn ge-­ neral de que el tercer debate no lo habĂ­a ganado ninguno de los candidatos presentes o ausentes, sino que â&#x20AC;&#x153;por su capacidad de convocatoria, fueron los jĂłvenes organizadores quienes resultaron triunfadores de la nocheâ&#x20AC;? (adnpolitico.com, 2012) 6L UHVXOWD UHOHYDQWH VLJQLĂ&#x20AC;FDU TXH OD FHOHEUDFLyQ GH HVWH GHEDWH aparte de haber sido pionero en MĂŠxico, posiblemente haya sido el 187


Adolfo Ă lvaro MartĂ­n

primero a nivel mundial organizado por un colectivo ciudadano con FDQGLGDWRVSUHVLGHQFLDOHV<R6R\IXHĂ&#x20AC;HODVXGHQXQFLDVREUH el comportamiento de los grandes medios de comunicaciĂłn en las campaĂąas electorales, y decidiĂł demostrar que es posible articular foros de debate distintos a los que hasta ahora habĂ­an impuesto ORV PHGLRV WUDGLFLRQDOHV /RV IDOORV WpFQLFRV \ ODV GLĂ&#x20AC;FXOWDGHV GH difusiĂłn no fueron muy distintas de las que suelen tener cualquier cadena de televisiĂłn cuando comienzan a implantarse y, prueba de ello, fue el importante conocimiento que de este debate tuvo la opiniĂłn pĂşblica mexicana y, lo mĂĄs relevante, su capacidad para PRGLĂ&#x20AC;FDU\FRQGLFLRQDUODDJHQGDSROtWLFD\GHFDPSDxDHOHFWRUDO El dĂ­a 1 de julio de 2012, durante la jornada electoral, #YoSoy132 tuvo mĂĄs de 3.000 observadores electorales para vigilar la pureza de los comicios, y denunciar irregularidades a travĂŠs del hashtag #tecachĂŠ132 (El Universal, 2012b). El resultado electoral dio la victoria al candidato PeĂąa Nieto, que obtuvo el 38,21% de los votos, mĂĄs de seis puntos por encima de LĂłpez Obrador, que quedĂł en segundo lugar con el 31,59% de los sufragios. Sin embargo, al igual que pasĂł en 2006, estos resultados estuvieron empaĂąados por las denuncias sobre compra de votos (El Universal, 2012b). #YoSoy132 rechazĂł los resultados electora-­ les al considerar que la jornada electoral â&#x20AC;&#x153;no se desarrollĂł en un ambiente de paz y legalidad, que en ella prevalecieron prĂĄcticas profundamente antidemocrĂĄticas, como la violencia de Estado, la compra y coacciĂłn del votoâ&#x20AC;Śel uso amaĂąado de las encuestas y otras prĂĄcticas ilĂ­citas que alteraron la esencia del sufragio libre, informado, razonado y crĂ­ticoâ&#x20AC;? (Proceso, 2012f). El 30 de agosto de 2012, el Tribunal Electoral del Poder Judicial de la FederaciĂłn (TEPJF) desestimo el recurso interpuesto por LĂłpez Obrador por VXSXHVWDFRPSUDGHYRWRVFRQĂ&#x20AC;UPDQGRORVUHVXOWDGRVHOHFWRUDOHV (Reforma, 2012).

188


Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

Cabe reseĂąar que los resultados obtenidos por PeĂąa Nieto fueron inferiores a los que le vaticinaban la mayorĂ­a de las encuestas al inicio de la campaĂąa electoral en mayo de 2012: a)-­ La encuesta elaborada por Covarrubias Asociados para SDPnoticias entre los dĂ­as 13 y 16 de mayo, en pleno es-­ cĂĄndalo por lo ocurrido en la Universidad Iberoamericana y tras la celebraciĂłn del primer debate, mostraba una caĂ­da en la intenciĂłn de voto de PeĂąa Nieto de 6 puntos, pasando del 42% que tenĂ­a en abril al 36%. Esta encuesta, ademĂĄs, situaba como segundo al candidato LĂłpez Obrador. (SPD-­ noticias, 2012) E (VWDFDtGDHQODLQWHQFLyQGHYRWRVWDPELpQVHYLRUHĂ H-­ jada en la encuesta elaborada por MarĂ­a de las Heras entre los dĂ­as 10 y 13 de mayo, en la que el candidato PeĂąa Nieto se situaba con un 39% de los votos y LĂłpez Obrador con un 31%. Destaca en esta encuesta que, pese a la distancia en FXDQWRDLQWHQFLyQGHYRWRORVPH[LFDQRVGHVFRQĂ&#x20AC;DEDQGH la honestidad de los candidatos casi a la par. (Arestiguino-­ ticias.com, 2012b) F 'XUDQWHODFDPSDxDHOHFWRUDODSHQDVVHPRGLĂ&#x20AC;FyODLQ-­ tenciĂłn de voto que, segĂşn la encuesta elaborada por Cova-­ rrubias y Asociados para SDPnoticias (2012b) pues si bien PeĂąa Nieto acusĂł los sucesos de la Ibero y la irrupciĂłn en campaĂąa de #YoSoy132, la posterior â&#x20AC;&#x153;campaĂąa mediĂĄtica de â&#x20AC;&#x2DC;guerra suciaâ&#x20AC;&#x2122; del PRI y, sobre todo, del PAN contra An-­ drĂŠs Manuel regresaron las cosas a como estabanâ&#x20AC;?. Al dĂ­a siguiente de conocerse la resoluciĂłn del TEPJF, Rodrigo Se-­ rrano, uno de los responsables del video de los 131 alumnos de la Ibero e impulsor de #YoSoy132, publicĂł en Reforma (2012b) un DUWtFXORHQHOTXHUHDOL]DEDXQDVHULHGHUHĂ H[LRQHVVREUHHO0R-­ vimiento: 189


Adolfo Ă lvaro MartĂ­n

1. â&#x20AC;&#x153;Una protesta inteligente es aquella que es visible y genera HPSDWtD FRQ OD VRFLHGDG ²D Ă&#x20AC;Q GH FXHQWDV pVWH HV XQ PR-­ vimiento social-­. Interrumpir la vida de la ciudad no logra nada mĂĄs que enfurecer a los que alguna vez nos apoyaron. 2. <R6R\GHEHPDQWHQHUVHKRUL]RQWDO\Ă H[LEOHFRPSUHQ-­ der que la lucha social tiene muchas formas y todas son vĂĄli-­ das siempre y cuando se respeten los derechos de terceros y por tanto debe mantener la autonomĂ­a de cada cĂŠlula, pues cada cĂŠlula aporta desde su trinchera y su realidad. 3. SerĂ­a una gran pĂŠrdida para el paĂ­s que #YoSoy132 se atora-­ ra en lo electoral. La democracia debiera ir mĂĄs allĂĄ del voto y asĂ­ debemos asumirloâ&#x20AC;Ś.El problema, en mi opiniĂłn, no es Enrique PeĂąa Nieto, sino todo el sistema partidista que nos mantiene jugando el mismo juego siempreâ&#x20AC;Ś#YoSoy132 puede detonar un cambio mucho mĂĄs profundo. Los jĂłvenes debemos tomar la batuta de un MĂŠxico mĂĄs incluyente, de-­ mocrĂĄtico y justo(â&#x20AC;Ś)â&#x20AC;?. El artĂ­culo de Rodrigo Serrano resulta un necesario eslabĂłn para entender las capacidades de un activismo ciudadano que va mĂĄs allĂĄ de la mera lucha partidista. Muchos analistas consideraron que #YoSoy132 tan solo habĂ­a sido una expresiĂłn de descontento, cuando no un mero instrumento al servicio del candidato LĂłpez Obrador (La Jornada, 2012d, El imparcial, 2012, analĂ­tica.com, 2012). Creemos que dichos anĂĄlisis incurren en el error de tratar de explicar lo ocurrido bajo los parĂĄmetros de los actores polĂ­ticos WUDGLFLRQDOHVOLPLWDQGRD<R6R\DXQPHURDUWLĂ&#x20AC;FLRHOHFWRUDO al servicio de la pugna electoral entre candidatos. Sin embargo, como hemos visto, la realidad polĂ­tica mexicana estaba condiciona-­ da por el descontento ciudadano y el consiguiente distanciamiento de las instituciones y los partidos polĂ­ticos, y es aquĂ­ donde debe buscarse el origen de este colectivo. Tampoco apoya esta teorĂ­a el KHFKR GH TXH ODV HQFXHVWDV VHxDODVHQ OD SRFD FRQĂ&#x20AC;DQ]D TXH ORV 190


Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

ciudadanos tenían en la honestidad de los candidatos, con unos índices bajísimos para todos ellos. Por ello, #YoSoy132 dedicó gran parte de su esfuerzo a divulgar una crítica a un sistema político que –según denunciaron-­ impedía que en México hubiese una verdadera democracia. Su capacidad para movilizar a unos jóvenes que hasta entonces habían adop-­ tado una postura pasiva ante la política y que habitualmente se abstenían, constituyó una llamada de atención muy seria para el conjunto de las instituciones mexicanas que, caso de ser ignorada podría tener consecuencias muy graves para uno de los principales países de América y, por ende, para toda la región.

191


Adolfo Ă lvaro MartĂ­n

192


CONSIDERACIONES FINALES


Consideraciones Finales

1. CiudadanĂ­a y desafecciĂłn polĂ­tica. (O FDPELR WHFQROyJLFR TXH VH HVWi SURGXFLHQGR GHVGH Ă&#x20AC;QDOHV GHO pasado siglo XX estĂĄ transformando de forma radical nuestras vi-­ das. Ello ha provocado sentimientos contrapuestos, entre la fasci-­ naciĂłn y el temor, que se han trasladado a todos aquellos ĂĄmbitos de nuestras actividades cotidianas en las que las nuevas herra-­ mientas tecnolĂłgicas se han instalado con fuerza. La polĂ­tica no ha quedado al margen de ello. TelefonĂ­a mĂłvil, Internet, redes sociales, Web 2.0, son conceptos que han irrumpido en nuestras vidas de forma abrupta y, casi sin darnos tiempo a darles la bienvenida, ya han cambiado de modo radical nuestra forma de comunicarnos, relacionarlos y actuar. AdemĂĄs, este nuevo paradigma tecnolĂłgico ha generado una bre-­ cha entre quienes han nacido y educado rodeados de tecnologĂ­a y quienes han tenido que adaptarse a ella, que estĂĄ teniendo como FRQVHFXHQFLD PRGLĂ&#x20AC;FDFLRQHV GH JUDQ FDODGR HQ OD HGXFDFLyQ ODV relaciones sociales, el ĂĄmbito laboral y, como no, en la polĂ­tica. Esta transformaciĂłn tecnolĂłgica ha coincidido con los cambios que se estĂĄn produciendo en las sociedades modernas con la polĂ­tica, que estĂĄn poniendo en cuestiĂłn el papel nuclear que hasta ahora habĂ­an tenido los actores polĂ­ticos tradicionales. Las sociedades se han hecho mĂĄs complejas, con intereses diversos, y este proceso no supo o no pudo ser entendido por los partidos polĂ­ticos que, desde HO~OWLPRFXDUWRGHOSDVDGRVLJORFRPHQ]DURQDWHQHUGLĂ&#x20AC;FXOWDGHV para poder actuar como transmisores de los intereses y demandas ciudadanas. Esta situaciĂłn puede resultar paradĂłjica en AmĂŠrica Latina y Es-­ paĂąa, donde como consecuencia de largos periodos de dictaduras militares o regĂ­menes autoritarios, la lucha por los valores demo-­ crĂĄticos ha sido uno de los principales objetivos colectivos durante aĂąos. Y, sin embargo, tambiĂŠn en nuestros paĂ­ses se ha producido una insatisfacciĂłn con la polĂ­tica, que ha generado un malestar 195


Adolfo Ă lvaro MartĂ­n

creciente de la ciudadanĂ­a hacia los partidos, los polĂ­ticos y las ins-­ tituciones, a los que consideran incapaces de articular propuestas y alternativas para la regeneraciĂłn del sistema. Al margen de elementos coyunturales o circunstancias locales, esta insatisfacciĂłn con la polĂ­tica en paĂ­ses como Ecuador, EspaĂąa o MĂŠxico ha provocado que los ciudadanos comenzasen a diseĂąar QXHYDVIRUPDVGHDFFLyQTXHOHVSHUPLWLHVHQLQĂ XLUGHIRUPDDX-­ tĂłnoma en la toma de decisiones de los asuntos que les interesan y en la elaboraciĂłn de la agenda polĂ­tica. Un activismo vigoroso que se desarrolla en entornos variopintos como la ocupaciĂłn de inmuebles o campaĂąas contra organismos internacionales, en las que cada vez tienen una mayor importancia las generaciones mĂĄs jĂłvenes que rechazan los canales institucionales por incompeten-­ tes o cĂłmplices, y que fueron los que comenzaron a utilizar con mĂĄs HĂ&#x20AC;FDFLDODV7,&SDUDODDUWLFXODFLyQRUJDQL]DFLyQ\HMHFXFLyQGH sus acciones. AdemĂĄs, son estos ciudadanos mĂĄs jĂłvenes los que muestran un mayor desapego hacia los actores polĂ­ticos tradicionales. En Es-­ paĂąa, por ejemplo, la investigaciĂłn realizada entre los universi-­ tarios a raĂ­z de las movilizaciones contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? mostrĂł la bajĂ­sima tasa de pertenencia a partidos polĂ­ticos y sindicatos, asĂ­ como su creciente desafecciĂłn hacia la clase polĂ­tica entre los ran-­ JRVGHHGDGPiVMyYHQHV'DWRVTXHVHKDQLGRFRQĂ&#x20AC;UPDQGRSRUODV encuestas de opiniĂłn que regularmente se llevan a cabo por el go-­ bierno y medios de comunicaciĂłn, y que estĂĄ en la raĂ­z del ĂŠxito del movimiento 15M. Un proceso similar se ha producido en MĂŠxico, donde la decepciĂłn por los magros logros del proceso democrĂĄtico ha distanciado a los ciudadanos, con especial incidencia entre los mĂĄs jĂłvenes, de una clase polĂ­tica a la que consideran incapaz de resolver problemas como la violencia o las desigualdades sociales.  (Q GHĂ&#x20AC;QLWLYD OD VRFLHGDG KD FRPHQ]DGR D UHDFFLRQDU GH IRUPD autĂłnoma ante situaciones para las que ni las instituciones ni los 196


Consideraciones Finales

partidos políticos ofrecen salidas satisfactorias: Las manifestacio-­ nes ciudadanas en España ante las puertas de las sedes del PP tras los atentados de 2004, las protestas en las calles de Quito durante mayo de 2005, las acampadas que en mayo de 2011 se ex-­ tendieron desde las plazas españolas de forma global o el grito de los estudiantes mexicanos ante un proceso político frustrante en 2012, son consecuencia del hartazgo ciudadano ante graves hechos que afectaban a sus vidas y para los que no encontraron receptivi-­ dad y soluciones en los entornos institucionales. 2. La tecnología, un aliado imprescindible del éxito de las revoluciones horizontales. Si hay un hecho constante en las movilizaciones ciudadanas que hemos analizado, es que todas ellas se desarrollaron de forma ho-­ rizontal, sin liderazgos o usufructuarios, lo que las hizo explosivas e incontrolables para un sistema acostumbrado a amortiguar los FRQÁLFWRV JUDFLDV D XQD FRPSOHMD HVWUXFWXUD GH LQWHUPHGLDULRV H intereses. Estas revoluciones horizontales encontraron un aliado inesperado en las TIC como consecuencia de su desarrollo, popularización y extensión a nivel global, tal y como sucedió durante la “Rebelión de los Forajidos” ya que, de un lado, el uso de la telefonía móvil permitió a miles de ciudadanos quiteños actuar como nodos de di-­ fusión entre sus redes de contactos de lo que estaba ocurriendo en las calles y, de otro, por medio de Internet, consiguieron expandir ODUHSHUFXVLyQLQWHUQDFLRQDOGHOFRQÁLFWRSDUDHURVLRQDUORVDSR\RV de Lucio Gutiérrez en el exterior. También hemos visto como gran parte de las críticas a estas revo-­ luciones horizontales llevadas a cabo desde entornos próximos a los actores políticos tradicionales, han apuntado al uso de la tec-­ nología por estos movimientos, pretendiendo alegar que su exis-­ tencia es un eco más de la moda tecnológica en la que estamos sumidos. De esta forma, han tratado de caricaturizar el uso de las 197


Adolfo Álvaro Martín

redes sociales en la política transmitiendo una visión deformada del ciberactivista, que limitaría su acción a pulsar el botón de “me gusta” de una convocatoria realizada online. Resulta sorprendente que muchas de estas voces críticas que tachan de “utópicas” a las revoluciones horizontales, solo ofrezcan como alternativa mante-­ ner el status vigente, al que los ciudadanos están dando la espalda de forma cada vez más numerosa desde hace años. Lo cierto es que tras de estas críticas infundadas parece escon-­ derse el miedo a lo desconocido o a lo no controlable por los cauces tradicionales. Como hemos visto, las revoluciones horizontales no han surgido al albur de ninguna fascinación por la tecnología y, su uso, es consecuencia de las múltiples posibilidades que ofrece a los activistas. Sirva como ejemplo el uso que de la telefonía móvil, sms y emails hicieron miles de activistas en sus acciones de protesta en Madrid y Quito en 2004 y 2005, respectivamente, sin los cuales las movilizaciones no hubiesen obtenido la amplitud, contundencia y éxito que alcanzaron. La capacidad de comunicación que permitió aquella tecnología, además, resultó esencial para construir identi-­ dades (“todos somos forajidos”) y generar un discurso (“¿quién ha sido?”, “¡que se vayan todos!”). Igualmente podríamos decir respecto a los jóvenes universitarios mexicanos que decidieron responder a la campaña orquestada por partidarios de Peña Nieto en los medios de comunicación tradicio-­ nal para distorsionar los sucesos ocurridos en la Ibero. Aquel gru-­ po de universitarios no se limitó a colgar un video de denuncia en una red social. Comenzaron una campaña de activismo político en la que, primeramente, acudieron a uno de los principales canales de comunicación e información preferidos por estas generaciones (YouTube), para conseguir una rápida difusión de su protesta y, además, recibir el apoyo de miles de jóvenes que sentían y opina-­ ban de la misma manera. De esta forma eludieron la sensación de aislamiento y vulnerabilidad que podría haber producido esta campaña de desprestigio y fueron capaces de mostrar a la sociedad 198


Consideraciones Finales

una identidad propia que dio lugar a un movimiento ciudadano sin precedentes en MĂŠxico #YoSoy132. (QGHĂ&#x20AC;QLWLYDHQWRGRVHVWRVFDVRVKHPRVSRGLGRFRPSUREDUTXHOD aplicaciĂłn de la tecnologĂ­a en el activismo polĂ­tico exige una posi-­ ciĂłn activa, tanto para la difusiĂłn de la informaciĂłn y elaboraciĂłn GHOGHEDWHFRPRSDUDODSODQLĂ&#x20AC;FDFLyQ\HMHFXFLyQGHODVDFFLRQHV Por todo ello, las TIC han sido un aliado indispensable para el ĂŠxito de estas revoluciones horizontales, pues el uso innovador que de las mismas han realizado los ciberactivistas, ha permitido con-­ Ă&#x20AC;JXUDUVXLGHQWLGDGSROtWLFD\HVWDEOHFHUFDXFHVGHSDUWLFLSDFLyQ sin necesidad de recurrir a los partidos polĂ­ticos o las instituciones, SHUPLWLHQGRLQĂ XLUGHIRUPDGLUHFWD\HĂ&#x20AC;FD]HQODVGHFLVLRQHVTXH afectan a la comunidad. 3. Las TIC estĂĄn desplazando a los medios de comunica-­ ciĂłn tradicional como canales para la informaciĂłn y la comunicaciĂłn polĂ­tica. La tecnologĂ­a ha permitido a las personas tomar el control de sus comunicaciones, decidir con quiĂŠn quieren estar conectados, de quiĂŠn desean recibir informaciĂłn y cĂłmo construir sus redes socia-­ les, profesionales y polĂ­ticas. Especialmente activos en este aspecto estĂĄn siendo los â&#x20AC;&#x153;nativos digitalesâ&#x20AC;?, quienes utilizan de una forma mĂĄs intensa que otras generaciones Internet y las redes sociales para recibir y compartir informaciĂłn, lo que estĂĄ afectando al rol que hasta hace poco des-­ empeĂąaban los medios de comunicaciĂłn tradicionales, fundamen-­ talmente televisiĂłn, prensa escrita y radio. Hemos visto como en EspaĂąa, durante las protestas contra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;?, se constatĂł que los jĂłvenes estaban dando la espalda a los medios de comu-­ nicaciĂłn tradicionales, revelando el auge de Internet como canal preferente para estar al corriente de las movilizaciones, debatir y participar en las mismas. No es de extraĂąar que ya en 2008, el 199


Adolfo Ă lvaro MartĂ­n

HQWRQFHV FDQGLGDWR %DUDFN 2EDPD GHFLGLHVH WUDVODGDU HO FHQWUR de su campaĂąa electoral al mundo online para obtener los votos de las nuevas generaciones, dando la vuelta a los principios que KDVWD DTXHO PRPHQWR KDEtDQ LQIRUPDGR DO PDUNHWLQJ SROtWLFR \ que dieron origen a lo que se denominĂł â&#x20AC;&#x153;PolĂ­tica 2.0â&#x20AC;?. Son estos jĂłvenes educados en el mundo tecnolĂłgico los que han comenzado a disputar el control de la comunicaciĂłn y la informa-­ ciĂłn a los estados y grandes corporaciones. Han comprendido que HOXVRGHODV7,&OHVSHUPLWHYLVXDOL]DUFRQĂ LFWRVTXHGHRWUDPD-­ nera, apenas podrĂ­an tener repercusiĂłn en la opiniĂłn pĂşblica de-­ bido al control que sobre la informaciĂłn han ejercido los medios tradicionales. Estos canales alternativos permiten acabar con el aislamiento de las personas, que pueden percibir que hay otros muchos que tienen sus inquietudes y reivindicaciones, lo que faci-­ lita la difusiĂłn de las protestas y la adhesiĂłn a las acciones que se desarrollan en los entornos urbano y virtual. (QHOFDVRGH(FXDGRUUDGLR/D/XQDQRKXELHUDVLGRVXĂ&#x20AC;FLHQWH para contraprogramar a los grandes medios que eludĂ­an o mini-­ mizaban las protestas. Se pudo superar aquel â&#x20AC;&#x153;apagĂłn informa-­ tivoâ&#x20AC;? gracias a la decidida intervenciĂłn de redes descentralizadas de activistas que, principalmente por medio de sus telĂŠfonos mĂł-­ viles y en menor medida Internet, difundieron velozmente entre sus contactos las reivindicaciones ciudadanas y las convocatorias que realizaba la emisora, participando en la construcciĂłn de una identidad propia â&#x20AC;&#x201C;el forajido-­ con la cual se dio consistencia y ca-­ rĂĄcter colectivo a lo que hasta ese momento habĂ­an sido protestas de grupos dispersos. En EspaĂąa, hubiera sido impensable que una ministra se reunie-­ VHFRQFLXGDGDQRVSDUWLFXODUHVSDUDKDEODUGHODPRGLĂ&#x20AC;FDFLyQGH una ley si no hubiese sido por la enorme labor de informaciĂłn y comunicaciĂłn desarrollada desde Internet y las redes sociales por los ciberactivistas. Al igual que ocurrirĂ­a un aĂąo y medio despuĂŠs 200


Consideraciones Finales

con el movimiento 15M, los medios de comunicaciĂłn tradicional ignoraron en un principio las convocatorias y las movilizaciones. Y aquĂ­ fue donde se manifestĂł de forma mĂĄs notoria la capacidad que tienen estos jĂłvenes para utilizar nuevos canales de comunicaciĂłn, LQIRUPDFLyQ \ DFFLyQ SDUD GDU YLVLELOLGDG DO FRQĂ LFWR OR TXH OHV permitiĂł que decenas de miles de ciudadanos tuvieran conocimien-­ to de las acampadas, de las actividades que en su interior se reali-­ zaban, de las propuestas que se formulaban y, al igual que ocurriĂł en Ecuador, construyeran una identidad propia -­â&#x20AC;&#x153;indignadosâ&#x20AC;?-­ que resultĂł decisiva para el ĂŠxito de las movilizaciones por todo el paĂ­s. Los jĂłvenes integrantes de #YoSoy132 transformaron la agenda polĂ­tica de una campaĂąa electoral que parecĂ­a decidida, apartando del debate polĂ­tico cuestiones irrelevantes o simplemente sonro-­ jantes (como la apariciĂłn de playmates), obligando a los candida-­ tos a posicionarse sobre cuestiones concretas planteadas por los ciudadanos. AdemĂĄs, gracias a la gran reputaciĂłn social que con-­ siguieron, fueron capaces de discutir a las corporaciones que con-­ trolan los medios de comunicaciĂłn el monopolio de la comunicaciĂłn polĂ­tica en la campaĂąa electoral. Con una intensa actividad en las redes sociales, seĂąalaron el sesgo de la informaciĂłn que realizaban los medios tradicionales y lo alejado que estaban los debates en-­ tre candidatos de los problemas ciudadanos. Pero no limitaron sus habilidades tecnolĂłgicas a la denuncia estos hechos sino que tam-­ biĂŠn, en un hecho inĂŠdito en AmĂŠrica Latina y EspaĂąa, fueron ca-­ paces de organizar un debate entre candidatos fuera de los canales institucionales, donde se trataron los asuntos que los ciudadanos GHĂ&#x20AC;QLHURQHQIXQFLyQGHVXVLQWHUHVHV 4. /DFUHFLHQWHLQĂ XHQFLDSROtWLFDGHORVPRYLPLHQWRVFLX-­ dadanos. Los polĂ­ticos y los partidos han tenido sumo cuidado en tratar de LGHQWLĂ&#x20AC;FDUVH FRQ OD GHPRFUDFLD FRPR HVWUDWHJLD SDUD JDUDQWL]DU su posiciĂłn privilegiada en el sistema y preservar su superviven-­ 201


Adolfo Ă lvaro MartĂ­n

cia ante la posible irrupciĂłn de nuevos actores. Por ello, y aunque son habituales sus proclamas a favor de la sociedad civil, suelen recelar cuando no boicotear las iniciativas ciudadanas autĂłnomas TXHQRHVWpQHQVXHVIHUDGHLQĂ XHQFLDDQWHHOWHPRUGHTXHVXSR-­ pularizaciĂłn pueda desplazarlos de la centralidad que hasta ahora habĂ­an disfrutado. Pero si algo han mostrado las distintas acciones ciudadanas desde Seattle en 1999 es que, gracias a las TIC, cada vez disponen de mĂĄs y mejores herramientas para desarrollar una actividad au-­ tĂłnoma que permita llevar a cabo acciones polĂ­ticas combinando la presencia en los espacios fĂ­sico y virtual. La consecuencia de ello es mayor efectividad y relevancia de sus convocatorias y la consecuciĂłn de objetivos polĂ­ticos que, hasta no hace muchos aĂąos, hubieran sido impensables. En este sentido, lo ocurrido en EspaĂąa con las movilizaciones con-­ tra la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? en EspaĂąa y en MĂŠxico con las protestas de #InternetNecesario, resulta revelador a la hora de analizar el cre-­ FLHQWH SUHVWLJLR H LQĂ XHQFLD GH ORV PRYLPLHQWRV FLXGDGDQRV (Q ambos casos, los ciberactivistas consiguieron establecer un diĂĄlogo directo con las instituciones por fuera de los cauces institucionales habituales y sin la intermediaciĂłn de los actores polĂ­ticos tradicio-­ nales. /DFDSDFLGDGGHHVWDVDFFLRQHVSDUDLQĂ XLUHQODWRPDGHGHFLVLR-­ QHVSROtWLFDVREOLJDQGRDPRGLĂ&#x20AC;FDUODVQRUPDVREMHWRGHGHEDWH hicieron que la ciudadanĂ­a percibiese que estos movimientos ciu-­ dadanos ofrecĂ­an canales de participaciĂłn novedosos y efectivos, lo que les otorgĂł relevancia y legitimidad social, especialmente entre los mĂĄs jĂłvenes, lo que ha resultado decisivo en el rĂĄpido ĂŠxito de los movimientos 15M y #YoSoy132. Como colofĂłn de todo lo anteriormente relatado, estas protestas tambiĂŠn mostraron la capacidad para condicionar la agenda po-­ lĂ­tica, tal y como reconocerĂ­a el presidente del gobierno espaĂąol 202


Consideraciones Finales

JosĂŠ Luis RodrĂ­guez Zapatero, que paralizĂł la ejecuciĂłn de la â&#x20AC;&#x153;Ley Sindeâ&#x20AC;? por la presiĂłn de los ciberactivistas (El Mundo, 2011d). â&#x20AC;&#x153;PasĂł algo que ha estado mĂĄs o menos de forma exagerada en los medios de comunicaciĂłn. Ese reglamento, sin duda alguna, es un tema que ha sido objeto de innumerable de-­ bate y que es polĂŠmico, porque regular el desarrollo de la ley Sinde y garantizar la propiedad intelectual en la red tiene una gran contestaciĂłn. Hubo compaĂąeros del Consejo de Ministros y tambiĂŠn la propia manifestaciĂłn que uno advertĂ­a en la red esa noche y esa maĂąana, que ponĂ­an en cuestiĂłn que se aprobara ese reglamento estando un Go-­ bierno en funciones y a pesar de que se le habĂ­a comunica-­ do al PP. Visto el debate, fue decisiĂłn mĂ­aâ&#x20AC;? (PĂşblico, 2011e). Los movimientos 15M o #YoSoy132, compuestos mayoritariamen-­ te por jĂłvenes educados y formados en entornos tecnolĂłgicos, han dado un paso mĂĄs en este proceso y han conseguido traer al primer plano de la agenda polĂ­tica las carencias de la democracia y la insatisfacciĂłn existente con los partidos y los polĂ­ticos, eclipsando con sus propuestas unas campaĂąas electorales en las que no parti-­ cipaban y que no les interesaban. Desde las acampadas del 15M repartidas por las plazas de las ciu-­ dades espaĂąolas, se propuso un debate sobre la urgente necesidad de transformar la sociedad que eclipsĂł una campaĂąa electoral ca-­ rente de interĂŠs para muchos jĂłvenes. Se convocĂł a la ciudadanĂ­a a no resignarse a ser sujetos pasivos que acuden a las urnas para delegar la gestiĂłn de sus intereses y la defensa de sus derechos en terceros, y exigieron una mayor participaciĂłn en la decisiones que les afectan. Estas demandas estĂĄn teniendo un profundo calado en la opiniĂłn pĂşblica espaĂąola que, en los meses siguientes han LQWHUYHQLGRGHIRUPDGLUHFWDHQFRQĂ LFWRVFRQJUDQFDODGRVRFLDO como los desahucios de viviendas como consecuencia de la crisis econĂłmica, en la que los colectivos ciudadanos han puesto en mar-­ 203


Adolfo Ă lvaro MartĂ­n

FKDLQLFLDWLYDVSDUDSRQHUĂ&#x20AC;QDHVWDVLWXDFLyQ\JDUDQWL]DUXQDVR-­ luciĂłn justa para las miles de familias afectadas. Estas decididas acciones han obligado a los partidos polĂ­ticos a revisar la legisla-­ ciĂłn ante la presiĂłn ejercida por la iniciativa legislativa popular sobre desahucios, que ha estado respaldada con cerca de un millĂłn \PHGLRVGHĂ&#x20AC;UPDV (O0XQGRE  #YoSoy132 dio la vuelta a la campaĂąa electoral mexicana de 2012, poniendo en primer plano del debate polĂ­tico el descontento ciuda-­ dano y el debilitamiento de las instituciones y los partidos. Ade-­ mĂĄs, puso en evidencia la inoperatividad de unas campaĂąas elec-­ torales centradas en asuntos que no interesan a los ciudadanos, y la responsabilidad que en ello tenĂ­an unos medios de comunicaciĂłn Ăşnicamente interesados en apoyar a uno u otro candidato. Estos jĂłvenes activistas, segĂşn Adolfo Gilly, profesor de la Universidad 1DFLRQDO$XWyQRPDGH0p[LFRVRQHOUHĂ HMRGH´XQDQXHYDJHQH-­ raciĂłn que irrumpiĂł en la escena pĂşblica con beligerancia porque quieren cambiar ya al paĂ­sâ&#x20AC;? (La Jornada, 2012).  Riesgos y expectativas futuras de las revoluciones ho-­ rizontales Los casos expuestos han demostrado que las revoluciones horizon-­ tales estĂĄn provocando importantes transformaciones en la polĂ­tica contemporĂĄnea. Sin embargo, cabe interrogarse sobre la fortaleza estos procesos y hasta donde alcanza su capacidad para establecer cauces de participaciĂłn para los ciudadanos en la polĂ­tica. A nuestro entender, un riesgo para el futuro de estos movimien-­ tos radica en la tentaciĂłn de actuar con la lĂłgica de los actores polĂ­ticos tradicionales. Esta tentaciĂłn ha estado presente desde el momento en que el ĂŠxito acompaùó a los movimientos 15M o #Yo-­ Soy132 y, como ha ocurrido en EspaĂąa, puede tener como primera consecuencia la escisiĂłn de algunos de sus integrantes, que bus-­ quen aprovechar el plus de legitimidad social de estos colectivos para ocupar un espacio entre los sujetos polĂ­ticos tradicionales. 204


Consideraciones Finales

6LQ HPEDUJR DO PDUJHQ GH DFFLRQHV SHUVRQDOHV SRFR VLJQLĂ&#x20AC;FDWL-­ vas hasta la fecha, no consideramos factible que los movimientos sociales de carĂĄcter horizontal tiendan a convertirse en partidos polĂ­ticos tradicionales: De un lado, por las causas que propiciaron su origen, ya relatados, que sin duda provocarĂ­a el abandono de muchos de sus integrantes bien por convicciĂłn bien como resultado de las luchas de poder por el control de sus estructuras. De otro, porque convertirse en un actor tradicional mĂĄs les harĂ­a perder el atractivo que acercĂł a miles de ciudadanos a estos movimien-­ tos, especialmente entre los mĂĄs jĂłvenes, lo que revertirĂ­a en una rĂĄpida erosiĂłn de la legitimidad social obtenida y una pĂŠrdida de LQĂ XHQFLDSROtWLFD En todo caso, hasta la fecha, estos movimientos proclaman unos objetivos que poco o nada tienen que ver con los que buscan los actores polĂ­ticos tradicionales, por lo que este escaso interĂŠs en las dinĂĄmicas de las contiendas electorales y la ocupaciĂłn de los espacios de poder institucionales, tambiĂŠn parecen alejarlos de su transformaciĂłn en partido polĂ­tico clĂĄsico. Otro elemento a valorar serĂ­an las consecuencias que para la esta-­ bilidad de las democracias representativas tendrĂ­an estas revolu-­ ciones horizontales, y el subsiguiente riesgo de que la deslegitima-­ ciĂłn de los actuales intermediarios polĂ­ticos provoque procesos de inestabilidad y advenimiento de regĂ­menes autoritarios o dictato-­ riales. Sobre esto, como indicĂĄbamos al comienzo de este apartado, GHEHUtDPRV HYLWDU FDHU HQ OD WHQWDFLyQ GH LGHQWLĂ&#x20AC;FDU D OD SHUYL-­ vencia del actual modelo de partidos polĂ­ticos con la democracia y, sobre todo, de considerar que solo a travĂŠs de ellos es posible la construcciĂłn o regeneraciĂłn de la misma. Los movimientos ciudadanos han surgido como vĂ­a alternativa de participaciĂłn ante la incapacidad del actual sistema de partidos para servir de correa de transmisiĂłn de las demandas de socieda-­ des complejas con intereses diversos, asĂ­ como por la cada vez ma-­ 205


Adolfo Álvaro Martín

yor exigencia ciudadana de participar directamente en el proceso de toma de decisiones de los asuntos públicos. No creemos que esta dualidad sea un peligro para la democracia. Hay más riesgo en el hecho de continuar haciendo uso de meca-­ QLVPRV TXH VH KDQ UHYHODGR LQHÀFDFHV SDUD OD LQWHUORFXFLyQ FRQ la ciudadanía o la proliferación de conductas en las que prima el interés personal o del partido por parte de los políticos. Lo cierto es que la celeridad de los cambios nos hace ser prudentes sobre la evolución de estas formas de activismo ciudadano y, lo que sería más deseable, si con ello se consigue una mejora de nuestra democracia.

206


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

BIBLIOGRAFĂ?A ABRAMSON, J. ARTERTON, C. y ORREN, G. (1998). The Electronic Commowealth: The Impacto f New Media Technologies on Demo-­ FUDWLF3ROLWLF%DVLF%RRNV,QF AMSTRONG, J. y MOULITSAS, M. (2006). Crashing the gate: Netroots, Grassroots, and the Rise of People-­Powered PoliTIC. Los Ă ngeles, Chelsea Green. Ă LVARO, A. y SĂ NCHEZ-­BURĂ&#x201C;N, A. (2010). â&#x20AC;&#x153;Universitarios y PolĂ­tica 2.0â&#x20AC;? http://www.slideshare.net/ucjc/estudio-­completo-­universita-­ rios-­y-­poltica-­20 (Fecha Ăşltima consulta, 14/12/2012). ARQUILLA, J. y RONFELDT, D. (2000). Swarming. The Future of Con-­ Ă LFW6DQWD0yQLFD5$1' -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2003). Redes y guerras en red. El futuro del terrorismo, el crimen organizado y el activismo polĂ­tico. Ma-­ drid. Alianza Editorial. AXFORD B. y HUGGINS R. (2000). New media and politic. London. Sage. BAGALAWIS, J.E. (2001). â&#x20AC;&#x153;How IT helped topple a presidentâ&#x20AC;? http:// www.itworld.com/print/39120 (fecha Ăşltima visita 15/02/2011). %$5$%$6, $/   ´6FDOHIUHH 1HWZRUNV $ GHFDGH DQG EH\RQG Science 325, pp. 412-­413. BARBER, B. (1984). Strong democracy. Participatory Politic for a New $JH%HUNHOH\8QLYHUVLW\RI&DOLIRUQLD3UHVV -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(1998). Which technology and which democracy? Ponencia presentada a la conferencia Democracy and digital media del Mas-­ sachussetts Institute of Technology. http://web.mit.edu/m-­i-­t/arti-­ cles/barber.html (fecha Ăşltima consulta 28/02/2011). BARBROOK, R. y CAMERON, A. (1996). The Californian Ideology.http:// ZZZKUFZPLQDFXNWKHRU\FDOLIRUQLDQLGHRORJ\PDLQKWPO (fecha Ăşltima consulta 28/02/2011).

207


Adolfo Ă lvaro MartĂ­n

BARGER, J. (1997). http://www.wired.com/entertainment/theweb/ news/2007/12/blog_anniversary (fecha Ăşltima consulta 12/02/2011). BARNES, S.H. y KAASE, M. (1979). Political Action. Mass Participation in Five Western Democracies. California, Sage. BARLOW, J.P. (1996). A Declaration of the Independence of Cyberspace. https://projects.eff.org/~barlow/Declaration-­Final.html (Fecha Ăşlti-­ ma consulta, 1/03/2011). BARTOLINI, S. y MAIR, P. (2001). â&#x20AC;&#x2DC;Challenges to Contemporary Politi-­ cal Partiesâ&#x20AC;&#x2122;, in Larry Diamond and Richard Gunther (eds) Political 3DUWLHVDQG'HPRFUDF\%DOWLPRUH0'-RKQV+RSNLQV8QLYHUVLW\ 3UHVVSS%HUNHOH\8QLYHUVLW\RI&DOLIRUQLD3UHVV BATLLE, A. (2004). â&#x20AC;&#x153;La ilusiĂłn de la Ciberdemocraciaâ&#x20AC;?. El PAĂ?S, 1 de abril. http://www.elpais.com/articulo/semana/ilusion/ciberdemo-­ cracia/elpeputec/20040401elpciblse_4/Tes (fecha Ăşltima consulta, 15/04/2011). BUCKINGHAM, D. (2002). Crecer en la era de los medios electrĂłnicos. Tras la muerte de la infancia. Madrid. Morata. BECK, John C. y WADE, M. (2006). The Kids are alright: How the Gamer *HQHUDWLRQLV&KDQJLQJWKH:RUNSODFH+DUYDUG%XVLQHVV6FKRRO Press. %(&.(57  7HOHGHPRFUDF\%ULQJLQJSRZHUEDFNWRWKHSHRSOH The Futurist, pp. 6-­9. %(//'  7KH&RPLQJRI3RVW,QGXVWULDO6RFLHW\1HZ<RUN%DVLF %RRNV BENEDICTO, J. REINARES, F. (1995). Las transformaciones de lo poli-­ tico.Madrid: Alianza. %(1./(5<  7KH:HDOWKRI1HWZRUNV+RZ6RFLDO3URGXFWLRQ 7UDQVIRUP0DUNHWVDQG)UHHGRP1HZ+DYHQ/RQGRQ<DOH8QL-­ versity Press. BENNETT, W. L. (2003) â&#x20AC;&#x153;Communicating Global Activismâ&#x20AC;?. Information, Communication and Society 6 (2), pp. 143-­168.

208


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

BENNETT, W. L., BREUNIG, C. y GIVEN, T. (2008): â&#x20AC;&#x153;Communication and Political Mobilization: Digital Media and the Organization of Anti-­Iraq War Demostrations in the U.S.â&#x20AC;?, Political Communica-­ tion, 25: 3, pp. 269-­289 BIMBER, B. (1998). â&#x20AC;&#x153;The Internet and Political Transformation: Popu-­ lism, Community, and Accelerated Pluralism.â&#x20AC;? Polity, Volumen 31, nÂş 1, pp 130-­160. BONCHEK, M. (1995). â&#x20AC;&#x153;Grassroots in Cyberspace. Using Computer Net-­ ZRUNVWR)DFLOLWDWH3ROLWLFDO3DUWLFLSDWLRQÂľUG$QQXDO0HHWLQJ of the Midwest Political Science Association, 6 de abril, Chicago, Estados Unidos. BORGE, R. (2005) â&#x20AC;&#x153;La participaciĂłn electrĂłnica: estado de la cuestiĂłn y DSUR[LPDFLyQDVXFODVLĂ&#x20AC;FDFLyQÂľ,'35HYLVWDGH,QWHUQHW'HUHFKR y PolĂ­tica, nÂş 1. Universitat Oberta de Catalunya (UOC). BORGE, R. Y Ă LVARO, A. (2004). â&#x20AC;&#x153;Partidos polĂ­ticos e Internet en Espa-­ Ăąa: Âżherramientas de democratizaciĂłn o arma electoral?â&#x20AC;?. Ponencia presentada al VI Congreso Vasco de SociologĂ­a, Bilbao 26-­28 de febrero. CAMACHO, S. (2008). â&#x20AC;&#x153;Mob-­iĂŠndose por Madridâ&#x20AC;?. CrĂ­tica 3: Revista de Cultura Popular, nÂş 2. CAMPO VIDAL, M.(2004). â&#x20AC;&#x153;Noves Tecnologies i DinĂ mica Social. L`Exemple de la revolta dels mòbils (11-­14 de març de 2004)â&#x20AC;?. 5HYLVWD GÂ?8QLYHUVLWDWV 5HFHUFD L 6RFLHWDW GH OD ,QIRUPDFLy QÂ&#x17E;  http://www.gencat.cat/diue/doc_un/cis06_campovidal.pdf (fecha Ăşl-­ tima consulta 15/03/2011). CAMPOS, M. (2009). â&#x20AC;&#x153;ÂżQuĂŠ se juega el movimiento twittero?â&#x20AC;?, en Cam-­ pos de Batalla, 23 de octubre. http://blogs.eluniversal.com.mx/ wweblogs_detalle.php?p_fecha=2009-­10-­23&p_id_blog=92&p_id_ tema=9029 (fecha Ăşltima consulta, 25/06/2011). CAĂ&#x2018;ADA, J. (2004). â&#x20AC;&#x153;PĂĄsalo: redes y dispositivos en la vĂ­spera electoralâ&#x20AC;?. http://www.terremoto.net/x/archivos/000080.html (Fecha Ăşltima consulta, 11/03/2011).

209


Adolfo Ă lvaro MartĂ­n

CARDENAL, S.; BATLLE, A. (2006). ÂŤLa utopĂ­a virtual: una crĂ­tica al ciberoptimismo desde la teorĂ­a de la elecciĂłn racionalÂť [artĂ­culo en lĂ­nea]. IDP. Revista de Internet, Derecho y PolĂ­tica, nÂş 3. UOC. http://www.uoc.edu/idp/3/dt/esp/cardenal_batlle.pdf (fecha Ăşltima consulta 12/03/2011). CARMON, Y. (2004). â&#x20AC;&#x153;Madrid Bluff?â&#x20AC;?.http://old.nationalreview.com/ comment/carmon200403121251.asp (Fecha Ăşltima consulta 11/03/2011). CARR, N. (2005). The amorality of Web 2.0.http://www.roughtype.com/ archives/2005/10/the_amorality_o.php (Fecha Ăşltima consulta 14/09/2012). CARRIĂ&#x201C;N, H. (2006). â&#x20AC;&#x153;Mercado de Internet Ecuador 2006â&#x20AC;?. www.imagi-­ nar.org (Fecha Ăşltima consulta 22/12/2012). CASABLANCAS, D. (2005). Alterperiodisme. Els mitjans de comunica-­ ciĂłn i la nova solidaritat. Barcelona: FundaciĂłn Intermon Oxfam. CASTAĂ&#x2018;O, C. (2004). â&#x20AC;&#x153;Mujeres y Poder PolĂ­ticoâ&#x20AC;? en EL PAĂ?S, OpiniĂłn, 29 de mayo. CASTELLS, M. (1997). La PolĂ­tica informacional y la crisis de la demo-­ cracia; El Poder de la Identidad. La era de la informaciĂłn. Madrid, Alianza Editorial. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(1998a). La era de la informaciĂłn. Vol I: La sociedad red. Madrid: Alianza. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(1998b). La era de la informaciĂłn. Vol. II: El poder de la identidad. Madrid: Alianza    +DFNHUV FUDFNHUV VHJXULGDG \ OLEHUWDG /HFFLyQ inaugural del curso acadĂŠmico 2001-­2002, Universidat Oberta de Catalunya. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­ (2008). Discurso de apertura curso 2008/2009 Universitat Oberta de Catalunya. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­ (2009). ComunicaciĂłn y Poder. Madrid. Alianza Editorial.

210


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­ (2011). “Después de la acampada”, en LA VANGUAR-­ DIA, Opinión, 18 de junio. http://www.lavanguardia.com/opi-­ nion/20110618/54173451006/despues-­de-­la-­acampada.html (fecha última consulta, 25/06/2011). CASTELLS, M., FERNÁNDEZ-­ARDEVAL, M., LINCHUAN QUI, J. y SEY, A. (2006). Mobile Communication and Society. A Global Pers-­ SHFWLYH$3UR\HFWRIWKH$QQHQEHUJ5HVHDUFK1HWZRUNRQ,QWHUQD-­ tional Communication, Cambridge, Mass., MIT Press. CERVERA, J. (2006). “Teoría de los blogs”, en La blogosfera hispana: pioneros de la cultura digital, Cerezo, J.M. (comp.): pp. 11-­10, Ma-­ drid, Fundación France Telecom. CHANEY, E. (1971). “Women in Latin America PoliTIC: The Case of Peru and Chile”. PH.D. dissertation, University of Wisconsin. CHAVARRÍA, M.: (2003) “Los partidos no seducen a la juventud”. La Vanguardia, 8 de abril. CLIFT, S.: (1998). “Democracy is online”. On the Internet Magazine, marzo-­abril. CORNELLA, A. (2000). Cómo sobrevivir a la infoxicacion.http:www.info-­ nomia.com/img/pdf/sobrevivir_infoxicacion.pdf (fecha última con-­ sulta16/02/2011). COLEMAN, S. (2005) Direct representation. Towards a conversational democracy, London: Institute for Public Policy Research. CORMODE, G.; KRISHNAMURTHY, B. (2008). “Key differences between Web 1.0 and Web 2.0”. First Monday, Volumen 13, nº 6, 2 de junio. CORTES TERZI, A. (2006) Los partidos como tema de actualidad política. Asuntos Públicos.org, Informe nº 537 COURT, J.: (2001). “People Power II in the Philippines: The First e-­revo-­ lution? KWWSZZZRGLRUJXNUHVRXUFHVGRZQORDGSGI. (fecha última visita 15/02/2011). CRITICAL ART ENSEMBLE (1994). The Electronic Disturbance. New <RUN$XWRPHGLD

211


Adolfo Ă lvaro MartĂ­n

-­-­-­-­-­-­-­-­-­-­ (1996). Electronic Civil Disobedience: and Other Unpopular ,GHDV1HZ<RUN$XWRPHGLD DADER, J.L. (2003). â&#x20AC;&#x153;Ciberdemocracia y comunicaciĂłn polĂ­tica virtual: El futuro de la ciudadanĂ­a electrĂłnica tras la era de la televisiĂłnâ&#x20AC;?, en Berrocal, S. (coord.): ComunicaciĂłn polĂ­tica y nuevos medios. Barcelona, Ariel. DAMIAN, C. (2010). â&#x20AC;&#x153;PolĂ­tica 2.0 en EspaĂąa: mucha campaĂąa, poco Oba-­ maâ&#x20AC;?, en TICbeat, 30 de enero.http://www.ticbeat.com/analisis/poli-­ tica-­2-­0-­espana/ (fecha Ăşltima consulta, 05/05/2011). DALTON, R.J.; WATENBERG, M.P. (ed.) (2000). Parties without Parti-­ sans. Political Change in Advanced Industrial Democracies. Nueva <RUN2[IRUG8QLYHUVLW\3UHVV DAHLBERG, L. (2007). The Internet, deliberative, democracy, and power: radicalizing the public sphere, en International Journal of Media and Cultural PoliTIC, vol. 3, nÂş 1, pp. 147-­162. '$9,65  7KH:HERI3ROL7,&7KH,QWHUQHWÂ?VLPSDFWRQWKH$PH-­ ULFDQ3ROLWLFDO6\VWHP1HZ<RUN2[IRUG8QLYHUVLW\3UHVV '(11,1*'(  ´$FWLYLVP+DFNWLYLVPDQGF\EHUWHUURULVP7KH LQWHUQHWDVDWRROIRULQĂ XHQFLQJIRUHLJQSROLF\ÂľHQ$UTXLOOD-\ 5RQIHOGW') (G 1HWZRUNVDQG1HWZDUV7KH)XWXUHRI7HUURU Crime, and Militancy, Santa Monica, Rand, pp. 239-­288 DE KERKCHOVE, D. (1999). Inteligencias en conexiĂłn. Hacia una so-­ ciedad de la web. Barcelona, Gedisa. DE LA TORRE, C. (2005). â&#x20AC;&#x153;El regreso de AbdalĂĄâ&#x20AC;? en Iconos, Revista de Ciencias Sociales, septiembre, nÂş 23, Quito, Ecuador, Facultad La-­ tinoamericana de Ciencias Sociales. (pp 101-­108). DE UGARTE, D. (2004). Redes para ganar una guerra. Barcelona, Icaria. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2006). â&#x20AC;&#x153;El poder de las periferias en las redes distribui-­ dasâ&#x20AC;?.http://deugarte.com/el-­poder-­de-­las-­periferias-­en-­las-­redes-­ distribuidas (Fecha Ăşltima consulta, 30/01/2011).

212


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2007). El Poder de las Redes. http://lasindias.org/el-­po-­ der-­de-­las-­redes (Fecha Ăşltima consulta, 30/01/2011). DEL MORAL J.A. (2006). â&#x20AC;&#x153;Los principios de la polĂ­tica 2.0â&#x20AC;?, en Re-­ des Sociales, 21 de febrero. http://blogs.alianzo.com/redessocia-­ les/2006/02/21/los-­principios-­de-­la-­politica-­2-­0/ (fecha Ăşltima con-­ sulta, 21/03/2011). DINUCCI, D. (1999). â&#x20AC;&#x153;Fragmented Futureâ&#x20AC;?. Print 53(4):32 '29$/$9(1'$f2  ´/DLQĂ XHQFLDGHORVPHGLRVVRFLDOHVHQORV PHGLRV WUDGLFLRQDOHV HQ HO PDUFR GHO 7ZRVWHS Ă RZ \ HO DJHQGD settingâ&#x20AC;?. Tesis Doctoral. Universidad de Vigo. '89(5*(5 0   7KH SROLWLFDO 5ROH RI :RPHQ 1HZ <RUN UNESCO. ERDĂ&#x201C;S, P. y RĂ&#x2030;NYI, A. (1959). â&#x20AC;&#x153;On random graphsâ&#x20AC;?. Publicationes Mathematicae, nÂş 6, pp. 290-­297. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­ (1960). â&#x20AC;&#x153;On the evolution of random â&#x20AC;&#x153;, Publications of the Mathematical Institute of the Hungarian Academy of Scien-­ ces, nÂş 5, pp. 17-­61. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(1961). â&#x20AC;&#x153;On the strength and connectedness of a random graphâ&#x20AC;?, Acta Mathematica Scientia Hungary, nÂş 12, pp. 261-­267. ESCOLAR, I. (2006). â&#x20AC;&#x153;PolĂ­tica en Redâ&#x20AC;?, en La blogosfera hispana: pio-­ neros de la cultura digital, JosĂŠ MarĂ­a Cerezo (comp.), pp. 11-­20. Madrid, FundaciĂłn France Telecom EspaĂąa. ETZIONI, A.: (1983). â&#x20AC;&#x153;Teledemocracy. The Electronic Town Meetingâ&#x20AC;?. En Current, febrero. FARRELL, H. (2006). â&#x20AC;&#x153;Bloggers and Parties. Can the netroots reshape American democracy?â&#x20AC;?, en Boston Review, septiembre-­octubre. http://bostonreview.net/BR31.5/farrell.php (Fecha Ăşltima consulta 16/04/2011). FEBBRO, E. (2010). â&#x20AC;&#x153;No perdonamos, no olvidamosâ&#x20AC;?, en RebeliĂłn.org, 13 de diciembre. http://www.rebelion.org/noticia.php?id=118526

213


Adolfo Ă lvaro MartĂ­n

FEIXA, C. (2003). â&#x20AC;&#x153;GeneraciĂłn @. La adolescencia en la era digitalâ&#x20AC;?, en Cuadernos de pedagogĂ­a nÂş 320, pp. 52-­55. FERNANDEZ PONCELA, A.M. (1995). â&#x20AC;&#x153;Comportamiento electoral y ac-­ ceso de las mujeres a la ĂŠlite polĂ­ticaâ&#x20AC;?, en PolĂ­tica y Cultura, otoĂąo, nÂş 5, pp. 139-­158, MĂŠxico D.F. Universidad AutĂłnoma Metropolita-­ na-­Xochimilco. FRANKFURT, H. (2006). â&#x20AC;&#x153;On Bullshit. Sobre la manipulaciĂłn de la ver-­ dadâ&#x20AC;?. Barcelona. PaidĂłs, Contextos. )5,('/$1'/+29(7K\52-$6+  7KHQHWZRUNHGSXEOLF sphere, en Javnost-­The Public, vol. 13, pp 5-­26. FUMERO, A. y SĂ EZ VACAS, F. (2006). â&#x20AC;&#x153;Blogs. En la vanguardia de la nueva generaciĂłn webâ&#x20AC;?. NovĂĄtica, nÂş 183, Madrid. )8/)25'%  ´.RUHDÂ?VZHLUGZLUHGZRUOGÂľ)RUEHVGHMXOLR p. 92. GALSTON, W. A. (2003): If political fragmentation is the problem, is the ,QWHUQHW WKH VROXWLRQ" (Q ' 0 $QGHUVRQ  0 &RUQĂ&#x20AC;HOG HGV  The civic web: online poliTIC and democratic values. Lanham: 5RZPDQ /LWWOHĂ&#x20AC;HOGSS GARRETĂ&#x201C;N, M.A.: (1995) Hacia una nueva era polĂ­tica: estudio sobre las democratizaciones. Santiago de Chile, Fondo de Cultura Eco-­ nĂłmica. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2000) La sociedad en que vivi(re)mos. IntroducciĂłn so-­ ciolĂłgica al cambio de siglo. LOM ediciones. Santiago de Chile. *$5721$6+7  ´/DUHYROXFLyQWXQHFLQD7ZLWWHU\:LNLOHDNVÂľ EL PAĂ?S, 25 de enero, Tribuna. GLADWELL, M. (2010). â&#x20AC;&#x153;Small Change. Why the revolution will not be WZHHWHGÂľ 7KH 1HZ <RUNHU  GH RFWXEUH KWWSZZZQHZ\RUNHU com/reporting/2010/10/04/101004fa_fact_gladwell (fecha Ăşltima consulta, 08/05/2011).

214


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2011). â&#x20AC;&#x153;Does Egypt need Twitter?â&#x20AC;?. The New Yor-­ NHU  GH IHEUHURKWWSZZZQHZ\RUNHUFRPRQOLQHEORJVQHZV-­ GHVNGRHVHJ\SWQHHGWZLWWHUKWPO (fecha Ăşltima consulta, 08/05/2011). GONZĂ LEZ HERNĂ NDEZ, J.C.: (1997) Transformaciones orgĂĄnicas y funcionales de los partidos polĂ­ticos en la crisis del Estado del Bien-­ estar. Sistema nÂş 138, mayo. Madrid, pp. 93-­115. *5$129(77(5 0   ´7KH VWUHQJWK RI 3HDN WLHVÂľ HQ $PHULFDQ Journal of Sociology; vol 78, nÂş 6, pp. 1360-­1380. GREEN, D. (2004). The serendipity machine. A voyage of discovery through the unexpected world of computers. Allen & Unwin, Aus-­ tralia. GROS, B. (coord.) (2004). Pantallas, juegos y educaciĂłn. La alfabetizaciĂłn digital en la escuela. Bilbao: DesclĂŠe de Brouwer. GROSSMAN, L. K. (1995). The electronic republic. Reshaping democracy LQWKHLQIRUPDWLRQDJH1XHYD<RUN7ZHQWLHWK&HQWXU\)RXQG HABERMAS, J. (1987). La TeorĂ­a de la acciĂłn comunicativa. Madrid, Taurus, vol. I y II. HACHIGIAN, N. y WU, L.: (2003). â&#x20AC;&#x153;The Information Revolution in Asiaâ&#x20AC;? http://www.rand.org/content/dam/rand/pubs/monograph_reports/ MR1719/MR1719.ch2.pdf (fecha Ăşltima visita 15/02/2011). HAGEN, M.: (1997) â&#x20AC;&#x153;A typology of Electronic Democracyâ&#x20AC;?. http://www. uni-­giessen.de/fb03/vinci/labore/netz/hag_en.htm (fecha Ăşltima consulta 28/02/2011) +,0$1(13HNND  /DeWLFDGHOKDFNHU%DUFHORQD'HVWLQR +2//2:$<6DUDK/<*LOO9  &\EHUNLGV&KLOGUHQLQWKH,Q-­ formation Age. London, RoutledgeFalmer. INGLEHART, R. (1977). Silent Revolution: Changing Values and Politi-­ cal Styles among Western Publics. New Jersey, Princeton Univer-­ sity Press.

215


Adolfo Ă lvaro MartĂ­n

ITU (2003). â&#x20AC;&#x153;World telecommunication development report 2003: Access indicators for the information societyâ&#x20AC;?, capĂ­tulo 4. http://www.itu. int/ITUD/ict/publications/wtdr_03/material/Chap4_WTDR2003_E. pdf (fecha Ăşltima consulta 28/02/2011). -$48(77(-  :RPHQLQ3ROL7,&1HZ<RUN-RKQ:LOH\ 6RQV JENKINS, H. (2008). Convergence Culture. La cultura de la convergen-­ cia de los medios de comunicaciĂłn. Madrid: PaidĂłs ComunicaciĂłn. -25'$1-7  $&7,9,60'LUHFW$FWLRQ+DFNWLYLVPDQGWKH)X-­ WXUHRI6RFLHW\/RQGRQ5HDNWLRQ%RRNV -85,6-HIIUH\6  1HWZRUNLQJ)XWXUHVWKH0RYHPHQWV$JDLQVW &RUSRUDWH*OREDOL]DWLRQ'XUKDP1&'XNH8QLYHUVLW\3UHVV KAASE, M. y NEWTON, K. (1995). Beliefs in Government. Vol. V. Nueva <RUN2[IRUG8QLYHUVLW\3UHVV KAASE, M. y MARSH, A. (1979). â&#x20AC;&#x153;Political Action Repertory. Changes Over Time and a New Tipologyâ&#x20AC;?, en S.H. Barnes y M. Kaase (eds.), Political Action. Mass Participation in Five Western Democracies, California, Sage, pp 137-­166 KAMARCK, E. C. y NYE, J. Jr. (eds.) (2002). Governance.com. Democra-­ F\LQWKHLQIRUPDWLRQDJH:DVKLQJWRQ'&%URRNLQJV,QVWLWXWLRQ Press. .((1$  7KHFXOWRIDPDWHXU+RZWRGD\¡VLQWHUQHWLVNLOOLQJRXU FXOWXUH'RXEOH'D\&XUUHQF\1HZ<RUN KEY Jr, V.O. (1964). PoliTIC, Parties and Preassure Groups. 5 ed, New <RUN&URZHOO KROKER, A. (1998) â&#x20AC;&#x153;Capitalismo Virtualâ&#x20AC;?; en Aronowitz, S., Martinsons, B., Menser, M. (eds.). Tecnociencia y cibercultura. La interrelaciĂłn entre cultura, tecnologĂ­a y ciencia. Barcelona, PaidĂłs, pp. 195-­208 LARREA, C. (2004). Pobreza, DolarizaciĂłn y Crisis en el Ecuador. Quito-­ Ecuador: Ediciones ABYA-­YALA. /(9<6  +DFNHUV+HURHVRIWKH&RPSXWHU5HYROXWLRQ1HZ<RUN %DQWDP%RRNV

216


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

LIPSET, S.M. (1992). ÂŤAlgunos requisitos sociales de la democracia: de-­ sarrollo econĂłmico y legitimidad polĂ­ticaÂť. En: A. Batlle (ed.). Diez textos bĂĄsicos de Ciencia PolĂ­tica. Barcelona: Ariel. LĂ&#x201C;PEZ GARCĂ?A, G. (2004). â&#x20AC;&#x153;El 11-­M y el consumo de medios de comuni-­ caciĂłnâ&#x20AC;?.http://saladeprensa.org/art565.htm (fecha Ăşltima consulta, 11/03/2011). /87=0  7KH6RFLDO3XOSLW%DUDFN2EDPDÂ?V6RFLDO0HGLD7RRO-­ NLW(GHOPDO'LJLWDO3XEOLF$IIDLUVHQHUR MACHARGO J., LUJAN, I., LEĂ&#x201C;N M. E., LĂ&#x201C;PEZ, P. Y MARTĂ?N, M.A.  Âľ3HUFHSFLyQGHODLQĂ XHQFLDGHORUGHQDGRUGH,QWHUQHW\GH los videojuegos por los adolescentesâ&#x20AC;?. Anuario de FilosofĂ­a, Psicolo-­ gĂ­a y SociologĂ­a, nĂşmero 6, pp. 159-­172. MANIN, B.: (1998) Los principios del gobierno representativo, Madrid, Alianza Editorial. MARĂ?N, M. y MUĂ&#x2018;OZ, G. (2002). Secretos de Mutantes: MĂşsica y crea-­ ciĂłn en las culturas juveniles. BogotĂĄ: Siglo del Hombre Editores. MARTĂ?N GRANADOS, I. (2003). â&#x20AC;&#x153;Los actores polĂ­ticos e Internet. Retos y cambios en la PolĂ­tica Tradicionalâ&#x20AC;?. Ponencia presentada en el VI Congreso EspaĂąol de Ciencia PolĂ­tica y de la AdministraciĂłn (AECPA), 18-­20 septiembre. 0(',1$0  ´0LHQWUDVHQ)DFHERRNPXFKDVSiJLQDVVHPRYLOL-­ ]DQFRQWUDODOH\ÂľHQHVNXSFRPGLDULR(/3$Ă&#x152;6GHGLFLHPEUH KWWSHVNXSHOSDLVFRPEDFGDFIHD 3eea3f (fecha Ăşltima consulta, 07/04/2011). MEHLMAN, Bruce P. (2003) â&#x20AC;&#x153;ICT Literacy: Preparing the Digital Gene-­ ration for the Age of Innovationâ&#x20AC;?. Ponencia presentada en el ICT Summit, 24 agosto, Washington, D.C. MENDIZĂ BAL, I.R. (2011) Medios y Redes Sociales Digitales: Ciberacti-­ YLVPR\&RQĂ LFWLYLGDG3ROtWLFDHQ(FXDGRUHQ5HYLVWDGH&RPXQL-­ caciĂłn ComHumanitas, volumen 2, nÂş 1 (pp 107-­129). MERHOLZ, P. (2002). â&#x20AC;&#x153;Play With Your Wordsâ&#x20AC;?. En peterme.com http:// www.peterme.com/archives/00000205.html

217


Adolfo Álvaro Martín

MERINO, L. (2010). “Nativos Digitales: Una aproximación a la sociología tecnológica de los jóvenes”. Tesis Doctoral. Universidad del País Vasco. MESTRE PÉREZ, R. (2005) “Retos de la televisión interactiva”. Actas del III Congrés Internacional Comunicació i Realitat, pp. 673-­686, Barcelona, 20-­21 mayo. MEYER, L. (2011) “Estábamos mejor cuando estábamos peor?”, en Re-­ forma, 8 de diciembre. http://www.lorenzomeyer.com.mx/www/ lo_mas_reciente.php?id=530 (Fecha última consulta, 23/12/2012). MILGRAM, S.:(1967). “The small world problema”. Psychology Today, nº 1, pp. 61-­67. MONTÚFAR, F.C. (2005). Entre la crisis mediática y la ciudadanía co-­ municativa http://www.ciespal.net/ciespal/images/docu/produccio-­ nacademica/crisis%20meditica%20y%20ciudadania.pdf (Fecha úl-­ tima consulta, 21/12/2012). MONZÓ, Q.: (2003). “Nada nuevo bajo el Sol”. LA VANGUARDIA, 19 de octubre, Magazine. MOROZOV, E. (2009). “How dictators watch us on the web”. PROSPECT, 18 de Noviembre. KWWSZZZSURVSHFWPDJD]LQHFRXN how-­dictators-­watch-­us-­on-­the-­web/ (fecha última consulta, 30/03/2011).  E ´0ROGRYDV7ZLWWHU5HYROXWLRQµ)25(,*132/,-­ CY, 7 de abril.http://neteffect.foreignpolicy.com/posts/2009/04/07/ moldovas_twitter_revolution (fecha última consulta, 30/03/2011).    ´7KH 1HW 'HOXVLRQ 7KH 'DUN 6LGH RI ,QWHUQHW Freedom”. PublicAffairs. MUÑOZ LÓPEZ, F.J. (2012): “El Contexto Electoral del 2012”. http://www.e-­consulta.com/index.php?option=com_ N YLHZ LWHP LG (Fecha última consulta, 30/12/2012). NAFRÍA, I. (1999). “Wall Street e Internet: sigue el idilio”.http://blogs.la-­ vanguardia.com/cronica/1999/01/ (fecha última consulta 14 marzo 2001).

218


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

-­-­-­-­-­-­-­-­-­-­-­-­-­-­ (2007). Web 2.0: El usuario, el nuevo rey de Internet. Barcelo-­ na: Ediciones GestiĂłn. 1$,00  ´,OtFLWRFRPRHOFRQWUDEDQGRORVQDUFRWUDĂ&#x20AC;FDQWHV\OD piraterĂ­a desafĂ­an la economĂ­a globalâ&#x20AC;?. Madrid, Debate. NICHOLSON, J.: (2005). â&#x20AC;&#x153;FCJ-­030 Flash! Mobs in the Age of Mobile Con-­ nectivityâ&#x20AC;?. The Fibreculture Journal, nĂşmero 6.KWWSVL[Ă&#x20AC;EUHFXO-­ WXUHMRXUQDORUJIFMĂ DVKPREVLQWKHDJHRIPRELOHFRQQHFWL-­ vity/ (fecha Ăşltima consulta 25/02/2011). NIVEN, L. (1973), â&#x20AC;&#x153;Flash crowdâ&#x20AC;? en Three trips in time and space: origi-­ QDOQRYHOODVRIVFLHQFHĂ&#x20AC;FWLRQ1HZ<RUN+DZWKRUQ%RRNV NORRIS, P. (2001) Digital Divide. Cambridge: Cambridge University Press. OFFE, C. (1988). Partidos politicos y nuevos movimientos sociales. Ma-­ drid, Sistema. OLMEDA, J.A. (2005). Miedo o engaĂąo: el encuadramiento de los aten-­ tados terroristas del 11-­M en Madrid y la rendiciĂłn de cuentas electoral. Real Instituto Elcano de Estudios Internacionales y Es-­ tratĂŠgicos, Seguridad y Defensa. Madrid: Real Instituto Elcano de Estudios Internacionales y EstratĂŠgicos. ORIOL PRATS, J. y Del Ă LAMO, O. :(2003) â&#x20AC;&#x153;Democracia ElectrĂłnica: Concepto, Tipos y Posicionamientosâ&#x20AC;?. Revista Trimestral Latinoa-­ mericana y CaribeĂąa de Desarrollo Sustentable, nÂş 4. http://www. revistafuturos.info/futuros_4/democr_elect_1.htm (fecha Ăşltima consulta 28/02/2011) 2Â?5(,//< 7   ´:KDW LV :HE  GHVLJQÂľhttp://www.oreilly.com (fecha Ăşltima consulta 28/02%2011) OSGERBY, B. (2004). Youth Media. London: Routledge. PANEBIANCO, A.: (1990) Modelo de partido. Madrid, Alianza Editorial. PALFREY, J. y GASSER, U. (2008). â&#x20AC;&#x153;Born Digital: Understanding The )LUVW*HQHUDWLRQRI'LJLWDO1DWLYHVÂľ1HZ<RUN%DVLF%RRNV

219


Adolfo Ă lvaro MartĂ­n

PARDO KUKLINSKI, H.; COBO ROMANĂ?, C. (2007). Planeta Web 2.0. Inteligencia emocional o medios fast food. Grupo de Recerca GÂ?LQWHUDFFLRQVGLJLWDOV%DUFHORQD0p[LFR')8QLYHUVLWDWGH9LF Flacso MĂŠxico. PARTAL, V. y OTAMENDI, M. (2004). 11-­M. El periodisme en crisi. Bar-­ celona. Ara Llibres. PAZMIĂ&#x2018;O, C. (2005). La frĂĄgil legitimidad del prĂ­ncipe democrĂĄtico, en Ă?conos, Revista de Ciencias Sociales, nÂş 23. Flacso Ecuador. PEREZ, V. (2006). â&#x20AC;&#x153;ComunicaciĂłn PolĂ­tica en Internet. Algunas carac-­ terĂ­sticas de los Sitios Web de los partidos polĂ­ticos espaĂąolesâ&#x20AC;? en RazĂłn y Palabra, nÂş 51, junio-­julio. PISANTY, A. (2009). â&#x20AC;&#x153;InternetNecesario y el Senadoâ&#x20AC;?. 29 de octubre. http://pisanty.blogspot.com.es/2009_10_25_archive.html (fecha Ăşl-­ tima consulta 14 marzo 2001). PRENSKY, M. (2001). â&#x20AC;&#x2DC;Digital natives, Digital inmigrantsâ&#x20AC;&#x2122;. Revista On the Horizon vol. 9, nÂş 5, octubre. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2004). â&#x20AC;&#x2DC;The emerging online life of the digital native: what they do differently because of technology, and how they do itâ&#x20AC;&#x2122;.http:// ZZZPDUFSUHQVN\FRP (fecha Ăşltima consulta 17/02/2011). -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2008). â&#x20AC;&#x153;Turning on the lightsâ&#x20AC;?. Educational Leadership Ma-­ gazine, vol. 65, nÂş 6, marzo, pp. 40-­45. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2008b). â&#x20AC;&#x153;Programming is the new Literacyâ&#x20AC;?. Edutopia Ma-­ gazine, marzo. PRIETO-­MARTIN, P. (2006). (e) ParticipaciĂłn en el ĂĄmbito local: cami-­ nando hacia una democracia colaborativa. SololĂĄ (Guatemala). AsociaciĂłn Ciudades Kyosei, KWWSZZZFN\RVHLRUJGRFV H 3DUWL-­ cipacionEnElAmbitoLocal.CaminandoHaciaUnaDemocraciaCola-­ borativa.pdf (fecha Ăşltima consulta 16/03/2011) PRIETO, R.: (2004). â&#x20AC;&#x153;Flash Mobs, sorpresas a la vuelta de la esquinaâ&#x20AC;?. En ObservatorioDigital.net, nÂş 251, del 23 al 29 de enero de 2004. KWWSZZZREVHUYDWRULRGLJLWDOQHWEROKWPĂ DVK (fecha Ăşltima consulta 25/02/2011).

220


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

POSTMAN, N. (1994). TecnĂłpolis. La rendiciĂłn de la cultura a la tecno-­ logĂ­a. Barcelona. Circulo de lectores-­Galaxia Gutemberg.CĂ­rculo de lectores, Galaxia Gutenberg. PUTNAM, R. (2002). Solo en la bolera. Colapso y resurgimiento de la comunidad norteamericana, Madrid: Galaxia Gutemberg-­CĂ­rculo de lectores. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2003). El declive del capital social. Un estudio internacional sobre las sociedades y el sentido comunitario. Barcelona: Galaxia Gutenberg; CĂ­rculo de Lectores. 5$0Ă&#x152;5(=)  /DLQVXUUHFFLyQGHDEULOQRIXHVRORXQDĂ&#x20AC;HVWD4XL-­ to, Ediciones Abya-­Yala. 5$<021' (ULF 6   7KH 1HZ +DFNHUÂ?V 'LFWLRQDU\ &DPEULGJH MIT Press.   ´%UHYHKLVWRULDGHODFXOWXUDKDFNHUÂľ(Q,Q-­ WHUQHW+DFNHUV\6RIWZDUH/LEUH&DUORV*UDGLQ &RPS SS 44, Buenos Aires, Argentina: Editora Fantasma. RHEINGOLD, H.: (2002) Smart Mobs. The next social revolution. Cam-­ EULGJH%DVLF%RRNV RIVAS LEONE, J.M.: (2002) El desconcierto de la polĂ­tica: Los desafĂ­os de la polĂ­tica democrĂĄtica. Universidad de los Andes, Ediciones del Vicerrectorado AcadĂŠmico. RODRIGUEZ HERRERA, D. (2008) â&#x20AC;&#x153;Cuatro aĂąos de Red Liberalâ&#x20AC;?.http:// www.libertaddigital.com/opinion/daniel-­rodriguez-­herrera/cuatro-­ anos-­de-­red-­liberal-­42713/(Fecha Ăşltima consulta, 24 enero 2011). RODRĂ?GUEZ, P. (2004). 11-­M. Mentira de Estado (los tres dĂ­as que aca-­ baron con Aznar). Barcelona: Ediciones B. 586+.2))'  *HWEDFNLQWKHER[,QQRYDWLRQIURPLQVLGHRXW 1HZ<RUN&ROOLQV SĂ DABA, I., GORDO, A. (2008). Cultura digital y movimientos sociales. Madrid. Catarata.

221


Adolfo Ă lvaro MartĂ­n

SĂ EZ VACAS, F. (2005). â&#x20AC;&#x153;La blogosfera: un vigoroso superespacio de co-­ municaciĂłn en Internetâ&#x20AC;?, TELOS nÂş 64, julio-­septiembre. SAMPEDRO BLANCO, V.F. (2005). â&#x20AC;&#x153;La Red del 13-­M. A modo de prefa-­ cioâ&#x20AC;?. En 13M Multitudes online. V.F. Sampedro Blanco. Madrid: Los libros de la Catarata. SAMPEDRO BLANCO, V.F. y LĂ&#x201C;PEZ GARCĂ?A, G. (2005). â&#x20AC;&#x153;DeliberaciĂłn celĂŠrica desde la periferiaâ&#x20AC;?. En 13M Multitudes online. V.F. Sam-­ pedro Blanco, PĂĄg. 130. Madrid: Los libros de la Catarata. SALTOS, N. (2005). â&#x20AC;&#x153;La rebeliĂłn de abril de 2005 en Quito: Democracia sin Partidos: ÂżUna puerta a la refundaciĂłn de la RepĂşblica?â&#x20AC;?. En Ciencias Sociales, Revista de la Escuela de SociologĂ­a y Ciencias PolĂ­ticas. Universidad CentralDel Ecuador, pp 13-­28. SĂ NCHEZ BURĂ&#x201C;N, FERNĂ NDEZ MARTĂ?N, M. (2010). GeneraciĂłn 2.0 2010. HĂĄbitos de los adolescentes en el uso de las redes sociales. Estudio comparativo entre Comunidades AutĂłnomas. http://www. slideshare.net/ucjc/generacin-­20-­hbitos-­de-­los-­ad(fechaĂşltima con-­ sulta, 1/03/2011). SĂ NCHEZ BURĂ&#x201C;N, A. y Ă LVARO, A. (2011). GeneraciĂłn 2.0 2011. HĂĄbitos en el uso de redes sociales en los adolescentes de Espa-­ Ăąa y AmĂŠrica Latina.http://www.slideshare.net/ucjc/generacin-­ 20-­2011-­hbitos-­de-­usos-­de-­las-­redes-­sociales-­en-­los-­adolescentes-­ de-­espaa-­y-­amrica-­latina(Fecha Ăşltima consulta, 29/12/2012). 6$9$*(6  ´)ODVK0REV7DNH0DQKDWWDQÂľGHMXQLRhttp://www. FKHHVHELNLQLFRPĂ DVKPREVWDNHPDQKDWWDQPRUH 67(fecha Ăşltima consulta 25/02/2011). -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2003b). â&#x20AC;&#x153;Manhattan Flash Mob Photosâ&#x20AC;?, 17 de juniohttp:// ZZZFKHHVHELNLQLFRPPDQKDWWDQĂ DVKPRESKRWRV (fecha Ăşltima consulta 25/02/2011). SCHATZ, A. (2007). â&#x20AC;&#x153;Bo, Ur So Gr8. How a Young Tech Entrepreneur 7UDQVODWHG %DUDFN 2EDPD LQWR 7KH LGLRP RI )DFHERRNÂľ :$// STREET JOURNAL, 26 de mayo.

222


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

SEY, A. y CASTELLS, M.(2006). â&#x20AC;&#x153;De la polĂ­tica en los medios a la polĂ­tica en red: Internet y el proceso polĂ­ticoâ&#x20AC;?. En Castells, M. (ed.) La socie-­ dad red :una visiĂłn global, pp. 440-­483, Madrid: Alianza Editorial. SHIRKY, C. (2008): â&#x20AC;&#x153;Here comes Everybody: The Power of Organizing Without Organizations. Estados Unidos: Penguin Press HC. -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2009): â&#x20AC;&#x153;CĂłmo los medios sociales pueden hacer historiaâ&#x20AC;?http:// ZZZWHGFRPWDONVODQJVSDFOD\BVKLUN\BKRZBFHOOSKRQHVBWZLW-­ WHUBIDFHERRNBFDQBPDNHBKLVWRU\KWPO(fecha Ăşltima consulta, 19/05/2011). -­-­-­-­-­-­-­-­-­-­-­-­-­-­-­-­(2009b): â&#x20AC;&#x153;The net advantageâ&#x20AC;?. PROSPECT, 11 de diciembre. KWWSZZZSURVSHFWPDJD]LQHFRXNWKHQHWDGYDQWDJH (fecha Ăşltima consulta, 19/05/2011). 6,021( 0   0HGLDWHG 1HWZRUNV IRU 'HOLEHUDWLYH 'HPRFUDF\ Connecting Enclave and Shared Spheres. en Conference Papers -­-­ National Communication Association; pp. 1-­23. SODERQVIST, J. y BARD, A. (2003). La netocracia. El nuevo poder en la red y la vida despuĂŠs del capitalismo. Prentice Hall. Madrid. STEINER, L. (2005): â&#x20AC;&#x153;The feminist cable collective as public sphere acti-­ vityâ&#x20AC;?, Journalism, nÂş 6, pp. 314-­334. STRĂ&#x2DC;M, K. (2000). â&#x20AC;&#x153;Delegation and Accountability in Parliamentary De-­ mocraciesâ&#x20AC;?. European Journal of Political Research, 37. SUBIRATS J. (2002) â&#x20AC;&#x153;Los Problemas de una relaciĂłn inevitable. Innova-­ ciĂłn democrĂĄtica y TecnologĂ­as de la InformaciĂłn y la Comunica-­ ciĂłnâ&#x20AC;?. Democracia Web (paper nÂş 24) enero-­febrero. http://www.de-­ mocraciaweb.org/subirats.PDF (fecha Ăşltima consulta 04/12/2006) SUNSTEIN, C. (2003). RepĂşblica.com. Internet, democracia y libertad. Barcelona: PaidĂłs. TAIBO, C. (2011). El 15-­M en sesenta preguntas. Madrid: Los libros de la Catarata. TAPSCOTT, D. (1998). Creciendo en un entorno digital. La generaciĂłn Internet. BogotĂĄ: McGraw Hill.

223


Adolfo Ă lvaro MartĂ­n

7$552:6  7KHQHZWUDQVQDWLRQDODFWLYLVP1XHYD<RUN&DP-­ bridge University. TILLY, Ch. (2004): Social Movements, 1768-­2004. Boulder, Colo.: Para-­ digm Publishers. TOFFLER, A.: (1980). La tercera ola. Barcelona: Plaza & JanĂŠs. UNITED NATIONS AND AMERICAN SOCIETY FOR PUBLIC AD-­ 0,1,675$7,21  ´%HQFKPDUNLQJ(JRYHUQPHQW$*OREDO Perspectiveâ&#x20AC;?. http://unpan1.un.org/intradoc/groups/public/docu-­ ments/un/unpan021547.pdf (fecha de Ăşltima consulta 16/03/2011 URROZ OSĂ&#x2030;S, A.: (2005). â&#x20AC;&#x153;Arte y activismo de Internetâ&#x20AC;? http://www.edi-­ cionessimbioticas.info/Arte-­y-­activismo-­de-­Internet (fecha Ăşltima consulta 28/02/2011) URRUTIA, J. (2003). Aburrimiento, rebeldia y ciberturbas. Una aproxi-­ maciĂłn a la EconomĂ­a Desmercada. VALLESPĂ?N, F.: (2000) EL Futuro de la PolĂ­tica. Editorial Taurus. Ma-­ drid VARELA, J. (2006). â&#x20AC;&#x153;CiberpolĂ­tica para una mejor democraciaâ&#x20AC;?. Perio-­ distas 21, 14 de junio. http://periodistas21.blogspot.com/2006/06/ ciberpoltica-­para-­una-­mejor-­democracia.html(Fecha Ăşltima con-­ sulta, 21/01/2011). VERGE, T.: (2006) â&#x20AC;&#x153;ÂżCrisis de los partidos polĂ­ticos en EspaĂąa? Una revi-­ siĂłn crĂ­ticaâ&#x20AC;?, en Revista de Investigaciones PolĂ­ticas y SociolĂłgicas, Universidad de Santiago de Compostela, pp. 105-­127. VON DREHLE, D. (2008). â&#x20AC;&#x153;Why Young Voters Care Again and why their vote mattersâ&#x20AC;?. Time Magazine, febrero. WEINBERGER, D. (2007). Everything is miscellaneous. The power of the QHZGLJLWDOGLVRUGHU7LPHV%RRNV1HZ<RUN WINIK, M. (2004) â&#x20AC;&#x153;Nuevos medios para hacer medios: el caso Indymediaâ&#x20AC;?. (Q,QWHUQHW+DFNHUV\6RIWZDUH/LEUH&DUORV*UDGLQ &RPS SS 113-­123, Buenos Aires, Argentina: Editora Fantasma. WATT, D. J. (2003) Six degrees. The science of a connected age. W.W. Norton & Company

224


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

WRAY, S. (1999). “La desobediencia electrónica civil y la world wide web GHOKDFNWLYLVPR/DSROtWLFDH[WUDSDUODPHQWDULDGHDFFLyQGLUHFWD en la red”. http://www.aleph-­arts.org/pens/wray.html (fecha últi-­ ma consulta 28/02/2011).

Otras fuentes ABC (2009): “El tijeretazo en investigación desata una protesta sin pre-­ cedentes en Internet”, Actualidad, 7 de octubre.http://www.abc. es/hemeroteca/historico-­07-­10-­2009/abc/Tecnologia/el-­tijeretazo-­ en-­investigacion-­desata-­una-­protesta-­sin-­precedentes-­en-­inter-­ net_103465386179.html ABC (2009): “Decepción entre los gurús de la Red en España tras reunirse con Sinde”, Cultura, 3 de diciembre.http://www. abc.es/20091203/cultura-­/decepcion-­entre-­gurus-­espa-­ na-­200912031250.html ABC (2009): “La polémicas que colapsaron la Red en 2009”, Medios y Redes, 30 de diciembre.http://www.abc.es/hemeroteca/histori-­ co-­30-­12-­2009/abc/Medios_Redes/las-­polemicas-­que-­colapsaron-­la-­ red-­en-­2009_1132799626204.html ABC (2010): “Lecciones aprendidas de la burbuja puntocom diez años después”, Tecnología: 11 de marzo. ABC (2011): “Los ‘indignados’ se acantonan”. España: 20 de mayo. ADNPOLÍTICO.com (2012). “¿Quién ganó el debate presidencial #Yo-­ Soy132?”. 20 de junio.http://www.adnpolitico.com/2012/2012/06/20/ quien-­gano-­el-­debate-­presidencial-­yosoy132(fecha última consul-­ ta, 20/12/2012). ADSLzone.net: http://www.adslzone.net/ ANTENA3.com (2011): “El No les votes, que arrasa en Twitter llena portadas de diarios, también internacionales”. 18 de mayo.http:// www.antena3.com/especiales/noticias/elecciones-­autonomicas-­ municipales/les-­votes-­que-­nacio-­twitter-­llena-­portadas-­diarios-­ tambien-­internacionales_2011051500074.html(fecha última con-­ sulta, 30/05/2012).

225


Adolfo Álvaro Martín

ALT1040 (2005): “El costo de la cobertura de la crisis ecuatoriana”. 22 de abril.http://alt1040.com/2005/04/el-­costo-­de-­la-­cobertura-­de-­la-­ crisis-­ecuatoriana( Fecha última consulta 3 diciembre 2012). ALT1040 (2012). “#YoSoy132, la marcha universitaria en México”. 18 de mayo.http://alt1040.com/2012/05/yosoy132(fecha última visita, 20/ XII/2012). ANALÍTICA.com (2012): “Proceso eleccionario en México”. http://www. analitica.com/va/internacionales/opinion/2820637.asp AMÉRICAECONOMÍA (2010): “El panorama político en México rumbo a las elecciones de 2012”.http://www.americaeconomia.com/politica-­ sociedad/politica/panorama-­politico-­en-­mexico-­rumbo-­elecciones-­ del-­2012 AMIPCI (2011). Hábitos de los Usuarios de Internet en México. http:// www.slideshare.net/venturis/amipci-­hbitos-­de-­los-­usuarios-­de-­in-­ ternet-­en-­mxico-­2011(fecha última visita 23/12/2012). AMIPCI (2012). Hábitos de los Usuarios de Internet en México. http:// www.slideshare.net/brendatre/hbitos-­de-­los-­usuarios-­de-­internet-­ en-­mxico-­2012(fecha última visita 23/12/2012). ARISTEGUINOTICIAS.com (2012). “El #debate132 fue más visto que el del IFE: Rodrigo Serrano”. 22 de junio.http://aristeguinoticias. com/2206/post-­elecciones/el-­debate132-­fue-­mas-­visto-­que-­el-­del-­ ife-­rodrigo-­serrano/(fecha última consulta, 27/12/2012). ARISTEGUINOTICIAS.com (2012b). “AMLO a 8 puntos de Peña: encuesta María de las Heras”. 22 de junio.http://aristeguinoticias.com/2205/ post-­elecciones/amlo-­a-­8-­puntos-­de-­pena-­encuesta-­maria-­de-­las-­ heras/?utm_source=rss&utm_medium=rss&utm_campaign=amlo-­ a-­8-­puntos-­de-­pena-­encuesta-­maria-­de-­las-­heras(fecha última con-­ sulta, 27/12/2012). ATUREM LA GUERRA: http://www.fundacioperlapau.org/iraq/platafor-­ ma.htm BARCEPUNDIT: http://barcepundit.blogspot.com

226


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

BBC (2005): â&#x20AC;&#x153;MĂĄs protestas en Ecuadorâ&#x20AC;?. AmĂŠrica Latina, 14 d e a b ril.KWWSQH ZVEEFFRXNKLVS D QLVKOD W LQBD P HULFD  newsid_4443000/4443079.stm(fecha Ăşltima consulta, 16/12/2012). BBC (2005b): â&#x20AC;&#x153;Homenaje para los forajidosâ&#x20AC;?. Noticias, 24 de abril.http://news. EEFFRXNKLVSDQLVKODWLQBDPHULFDQHZVLGBVWP (Fecha Ăşltima consulta 16/12/2012). %%&   ´3RUQRJUDSKLF YLGHRV Ă RRG <RX7XEHÂľ 1HZV  GH PD\R KWWSQHZVEEFFRXNKLXNBQHZVVWP(fecha Ăşltima con-­ sulta, 16/05/2011). BBC (2009b). â&#x20AC;&#x153;Triunfo â&#x20AC;&#x2DC;twitteroâ&#x20AC;&#x2122; sobre los impuestosâ&#x20AC;?. Mundo, 2 noviem-­ bre.KWWSZZZEEFFRXNPXQGRSDUWLFLSHBB mexico_triunfo_twitter_impuestos_jrg.shtml(fecha Ăşltima consul-­ ta, 30/12/2012). BBC (2011): â&#x20AC;&#x153;Spanish Routh rally in Madrid echoes Egypt protestâ&#x20AC;?. 18 de mayo.KWWSZZZEEFFRXNQHZVZRUOGHXURSH(fecha Ăşltima consulta, 31/05/2011). BIFI (2011). â&#x20AC;&#x153;Estudio sobre el 15M en las redes socialesâ&#x20AC;?.KWWSPELĂ&#x20AC; es(fecha Ăşltima consulta, 27/12/2012). CADENA SER / Sonidos. http://www.cadenaser.com/static/espe-­ ciales/2005/sonidos11_14/dia11.html(fecha Ăşltima consulta 24/03/2011). CAPITALSOCIALMEXICO.com (2012). â&#x20AC;&#x153;Algunos datos sobre la activi-­ dad en Twitter del debate YoSoy132â&#x20AC;?. 20 de junio. http://capital-­ socialmexico.com/2012/06/20/algunos-­datos-­sobre-­la-­actividad-­en-­ twitter-­del-­debate-­de-­yosoy132/(fecha Ăşltima visita 23/12/2012). CEROCUATRO.net (2005). â&#x20AC;&#x153;Hasta que te fuiste; ÂĄincapaz! (peroâ&#x20AC;ŚÂży ahora?)â&#x20AC;?. 21 de abril. http://www.cerocuatro.net/blog/2005/04/21/ hasta-­que-­te-­fuiste-­incapaz-­pero-­y-­ahora-­2/(fecha Ăşltima visita 23/12/2012). CESID (2004). â&#x20AC;&#x153;ValoraciĂłn del presunto comunicado de Al Qaida reivindi-­ cando el atentado en Madridâ&#x20AC;?. Nota informativa, 12 de marzo

227


Adolfo Álvaro Martín

CESOP (2012). “Jóvenes Mexicanos en Procesos Electorales”.http:// cesop.blogspot.com.es/2012/05/jovenes-­mexicanos-­en-­procesos. html(fecha última visita 23/12/2012). CNNExpansión (2011). “Los claroscuros del sexenio de Calderón”. Economía, 1 de de abril. http://www.cnnexpansion.com/econo-­ mia/2011/08/30/los-­claroscuros-­del-­sexenio-­de-­calderon(fecha últi-­ ma visita 23/12/2012). CONQuito (2007). “Las Tecnologías de la Información y las Comunicacio-­ nes en la Competitividad de Quito”. http://www.imaginar.org/docs/ TIC_Quito_Competitividad.pdf(fecha última consulta, 27/12/2012). COMSCORE.com, www.comscore.com COMUNIDAD ANDINA (2012). “Comportamiento de la Telefonía Mó-­ vil 2005-­2011”. diarios, también internacionales”. 18 de mayo. http://estadisticas.comunidadandina.org/eportal/BusqSimple. aspx?bus=telefonia(fecha última consulta, 30/12/2012). CRÓNICA.com (2012). “Yo Soy 132; la mano que mece la cuna”. Opi-­ nión, 6 de junio.http://www.cronica.com.mx/notaOpinion.php?id_ nota=666578(fecha última consulta, 21/XII/2012). CRÓNICA.com (2012b). “Miles de universitarios del movimiento Yo soy 132 demandan cadena nacional para segundo debate; la directora delIPN da la bienvenida a reclamos juveniles”. Nacional , 24 de mayo http://www.cronica.com.mx/notas/2012/663595.html(fecha última consulta, 30/12/2012). &8(17$0( /$ 5('FRP   ´8VXDULRV GH )DFHERRN HQ (VSDxDµ Noticias, mayo 2010.http://www.cuentamelared.com/usuarios-­fa-­ FHERRNHVSDQDPD\R DEMOCRACIA REAL YA!http://www.democraciarealya.es/ DEMOCRACIA REAL YA! Madrid (2012). “Comunicado urgente de Democracia Real Ya Madrid a los medios de comunicación”, 4 de mayo.http://madrid.democraciarealya.es/2012/05/04/comunicado-­ urgente-­de-­democracia-­real-­ya-­madrid-­a-­los-­medios-­de-­comunica-­ cion/(Fecha última consulta 26/12/2012).

228


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

DEMOCRACIA4PUNTO0. demo4punto0.net ECUADOR ESTOY CONTIGO (2005). “El blog de Lucio Gutiérrez”. 9 de abril.http://andrew2377.blogspot.com.es/2005/04/el-­blog-­de-­lucio-­ gutierrez.html(Fecha última consulta 4/12/2012). ECUADORINMEDIATO.com(2005). “Presidente Gutiérrez no puede contra las ‘bombas Google’”. 10 de abril.http://www.ecuadorin-­ mediato.com/index.php?module=Noticias&func=news_user_ view&id=11996&umt=presidente_gutierrez_no_puede_contra_ bombas_google(Fecha última consulta 4/12/2012). ('8$5($6 %/2*http://eduarea.wordpress.com/2011/04/21/1177/(Fe-­ cha última consulta 25/04/2011). EGM (Febrero-­marzo 2004). AIMChttp://www.unoon.com/docs/inter-­ net104.pdf(Fecha última consulta, 11/03/2004). EL BLOG DE ENRIQUE DANS. http://www.enriquedans.com/2009/12/ PDQLÀHVWRHQGHIHQVDGHORVGHUHFKRVIXQGDPHQWDOHVHQLQWHUQHW html EL BLOG DE JESÚS ENCINAR. http://www.jesusencinar.com/2009/12/ reunion-­con-­la-­ministra-­de-­cultura.html EL BLOG DE JUSTIN HALL. http://blog.justinhall.com EL BLOG DE MARTÍN VARSAVSKY. KWWSVSDQLVKPDUWLQYDUVDYVN\ QHWWHFQRORJDDHLQWHUQHWHOH[LWRGHIDFHERRNKWPO EL CORREO (2010): “España se vuelca el 11 de marzo de 2004”, Vizca-­ ya: 11de marzo.http://www.elcorreo.com/vizcaya/multimedia/fotos/ ultimos/52592-­espana-­vuelca-­marzo-­2004-­0-­0.html(fecha última consulta 15/03/2011). EL ECONOMISTA (2012). “Marcha Yo soy 132 toma las calles de Mé-­ xico”. 24 mayo.http://eleconomista.com.mx/sociedad/2012/05/24/ marcha-­yo-­soy-­132-­toma-­las-­calles-­mexico(fecha última consulta, 20/XII/2012). EL ECONOMISTA (2012b). “Televisa, UAM e IMER transmitirán debate #YoSoy132”. 19 de junio.http://eleconomista.com.mx/ sociedad/2012/06/19/televisa-­uam-­e-­imer-­transmitiran-­debate-­ yosoy132(Fecha última consulta, 15/12/2012).

229


Adolfo Álvaro Martín

EL FINANCIERO(2012). “Atenco enciende los ánimos contra Peña en la Ibero”. 11 de mayo. EL INCONFORMISTA DIGITAL (2004). “Entrevista a Gustavo Roig, miembro de Nodo50”. Reportajes, 16 de febrero.http://www.elin-­ conformistadigital.com/modules.php?op=modload&name=News&f ile=article&sid=760(fecha última consulta 15/04/2011). EL IMPARCIAL (2012). “Los jóvenes de ‘YoSoy132’ impulsan la can-­ didatura de López Obrador”. Reportajes, 16 de febrero. http:// www.elimparcial.es/contenido/105850.html(fecha última consulta 15/12/2012). EL MERCURIO (2005): “Se dio marcha de cacerolas vacías”. Nacionales, 17 abril. (/081'2  ´/DFULVLVGHFRQÀDQ]DSURYRFDHOGHVSORPHGHO1DV-­ daq”, Suplemento Nuevo Mercado nº 135, 7 de julio. EL MUNDO (2003): “Amigos por catálogo”, Suplemento La Luna del Siglo XXI, 24 de octubre. http://www.elmundo.es/lalu-­ na/2003/240/1066835388.html(Fecha última consulta, 23/02/2011) EL MUNDO (2004): “La mañana de los móviles”, España: 11 de marzo. http://www.elmundo.es/elmundo/2004/03/11/espana/1079002257. html(fecha última consulta, 15/03/2011). EL MUNDO (2005): “Los disturbios en Francia, día a día”. Sociedad, 14 de noviembre. EL MUNDO (2005b): “Parlamentarios en la blogosfera”. Navegante, 27 de diciembre.http://www.elmundo.es/navegante/2005/12/26/esocie-­ dad/1135600102.html(Fecha última visita 9/01/2011). EL MUNDO (2005c). “2005, el año del boom de los blogs en España”. Suplemento Ariadn@, nº 258, 4 de diciembre.http://www.elmundo. es/suplementos/ariadna/2005/258/1133527923.html(Fecha última-­ consulta, 15/02/2011). EL MUNDO (2006). “Cargas policiales cierran en Madrid el primer año del movimiento por una vivienda digna”. Madrid, 25 de diciembre. El MUNDO (2006b). “El pelotazo de Youtube”. Navegante, 10 de oc-­ tubre.http://www.elmundo.es/navegante/2006/10/10/tecnolo-­ gia/1160493910.html(Fecha última consulta, 1/05/2011).

230


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

EL MUNDO (2006c). “Un video sobre el falso robo del escaño de ZP, nue-­ va estrella de la Red”. Navegante, 2 de octubre.http://www.elmun-­ do.es/navegante/2006/10/02/tecnologia/1159772576.html(Fecha úl-­ tima consulta, 1/05/2011). EL MUNDO (2008): “Obama rompe récords de recaudación”. Internacio-­ nal, 19 de octubre.http://www.elmundo.es/elmundo/2008/10/19/in-­ ternacional/1224422101.html(fecha última consulta, 12/04/2011). EL MUNDO (2008b): “La blogosfera se levanta contra la pornografía in-­ fantil en Internet”. Suplemento El Navegante, 21 de octubre.http:// www.elmundo.es/navegante/2008/10/20/tecnologia/1224492627.ht ml?a=34f8cdf2f6e560fe79d7e85567a926c3&t=1224506530(fecha última consulta, 12/04/2011). EL MUNDO (2009): “Cultura mantendrá el corte de Internet pese al rechazo de los internautas”. Suplemento El Navegante, 3 de di-­ ciembre.http://www.elmundo.es/elmundo/2009/12/03/navegan-­ te/1259828378.html(fecha última consulta, 15/05/2011). (/081'2  ´)DFHERRNVXSHUDORVPLOORQHVGHXVXDULRVµ6X-­ plemento El Navegante, 23 de julio.http://www.elmundo.es/elmun-­ do/2010/07/21/navegante/1279735734.html(fecha última consulta, 16/02/2011). EL MUNDO (2010b): “El Congreso tumba la Ley Sinde”. Tecnología, 21 de diciembre.http://www.elmundo.es/elmundo/2010/12/21/nave-­ gante/1292966844.html(fecha última consulta, 7/03/2011). EL MUNDO (2011): “32.000 ciclistas toman Manhattan”. Blogs, 1 de mayo.http://www.elmundo.es/blogs/elmundo/cronicasdesdeee uu/2011/05/01/32000-­ciclistas-­toman-­manhattan.html(fecha últi-­ ma consulta, 15/05/2011). EL MUNDO (2011b): “Murdoch vende Myspace por 24 millones de eu-­ ros, 16 veces menos de lo que pagó”, Suplemento El Navegante, 29 de junio.http://www.elmundo.es/elmundo/2011/06/29/navegan-­ te/1309371916.html(fecha última consulta, 30/06/2011).

231


Adolfo Ă lvaro MartĂ­n

EL MUNDO (2011c): â&#x20AC;&#x153;#NoLesVotes, mĂĄs allĂĄ de la Ley Sindeâ&#x20AC;?. El Ca-­ talejo, 25 de febrero.http://www.elmundo.es/blogs/elmundo/catale-­ jo/2011/02/25/nolesvotes-­mas-­alla-­de-­la-­ley-­sinde.html(fecha Ăşlti-­ ma consulta, 08/03/2011). EL MUNDO (2011d): â&#x20AC;&#x153;El Gobierno â&#x20AC;&#x2DC;parĂłâ&#x20AC;&#x2122; la â&#x20AC;&#x2DC;Ley Sindeâ&#x20AC;&#x2122; por temor a las redes socialesâ&#x20AC;?, Cultura, 12 de diciembre.http://www.elmundo.es/ accesible/elmundo/2011/12/12/cultura/1323680561.html(fecha Ăşlti-­ ma consulta, 30/12/2012). EL MUNDO (2012). â&#x20AC;&#x153;Guerra abierta en â&#x20AC;&#x2DC;Democracia Real Yaâ&#x20AC;&#x2122;, entre la divisiĂłn y la divisiĂłn y la crisis de crecimientoâ&#x20AC;?. Madrid, 23 de abril. (/ 081'2 E  ´/D GHVFRQĂ&#x20AC;DQ]D HQ ORV SROtWLFRV DOFDQ]D VX FRWD mĂĄs alta de la democraciaâ&#x20AC;?. Madrid, 8 de octubre. EL MUNDO (2013). â&#x20AC;&#x153;El Rey Juan Carlos cumple 75 aĂąos con su popula-­ ridad en tasas mĂ­nimasâ&#x20AC;?. Madrid, 5 de enero. EL MUNDO (2013b). â&#x20AC;&#x153;La iniciativa popular para la daciĂłn en pago recoge FDVLXQPLOOyQ\PHGLRGHĂ&#x20AC;UPDVÂľ9LYLHQGDGHIHEUHUR EL PAĂ?S (1999). â&#x20AC;&#x153;Unos 20.000 manifestantes desbordan a la policĂ­a y retrasan 5 horas la cumbre de la OMCâ&#x20AC;?, economĂ­a, 1 de diciembre. EL PAĂ?S (2001). â&#x20AC;&#x153;EL Nasdaq ha perdido un 60% en un aĂąo por el hundi-­ miento de las empresas de Internetâ&#x20AC;?, EconomĂ­a, 12 de marzo. EL PAĂ?S (2001). â&#x20AC;&#x153;Gloria Macapagal jura como presidenta de Filipinas tras la dimisiĂłn forzada de Estradaâ&#x20AC;?, Internacional, 21 de enero. EL PAĂ?S (2002). â&#x20AC;&#x153;La crisis tecnolĂłgica acorrala al Nasdaqâ&#x20AC;?, EconomĂ­a, 3 de septiembre. EL PAĂ?S (2004): â&#x20AC;&#x153;Los atentados siembran el caos en Madridâ&#x20AC;?, Madrid: 11 de marzo.http://www.elpais.com/articulo/espana/atentados/siem-­ bran/caos/Madrid/elpporesp/20040311elpepunac_3/Tes(fecha Ăşlti-­ ma consulta, 15/03/2011). EL PAĂ?S (2004): â&#x20AC;&#x153;Otegi niega que ETA sea la responsable de los atentados y apunta a la resistencia ĂĄrabeâ&#x20AC;?, EspaĂąa: 11 de marzo.http://www. elpais.com/articulo/espana/Otegi/niega/ETA/sea/responsable/aten-­ tados/apunta/resistencia/arabe/elpepuesp/20040311elpepunac_18/ Tes(fecha Ăşltima consulta 28/02/2011).

232


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

EL PAĂ?S (2004): â&#x20AC;&#x153;Veteranos contra Kerryâ&#x20AC;?. Internacional, 9 de agosto. EL PAĂ?S (2004): â&#x20AC;&#x153;EL PAĂ?S pide perdĂłn por una campaĂąa de promociĂłn de su ediciĂłn digitalâ&#x20AC;?, Portada, 17 septiembre. EL PAĂ?S (2005): â&#x20AC;&#x153;La indigestiĂłn de la crisisâ&#x20AC;?, Madrid: 13 de marzo. El PAĂ?S (2005): â&#x20AC;&#x153;Murdoch compra el portal de juegos IGN por 650 mi-­ llones de dĂłlaresâ&#x20AC;?, CiberpaĂ­s, 9 de septiembre.http://www.elpais. com/articulo/economia/Murdoch/compra/portal/juegos/IGN/650/ millones/dolares/elpportec/20050909elpepieco_10/Tes(Fecha Ăşlti-­ ma consulta, 7/05/2011). EL PAĂ?S (2006): â&#x20AC;&#x153;Madrid despliega a la policĂ­a en varias zonas de la ciu-­ dad para impedir el botellĂłnâ&#x20AC;?. EspaĂąa, 17 de marzo. EL PAĂ?S (2006b): â&#x20AC;&#x153;Los blogs radicales asaltan el Partido DemĂłcrataâ&#x20AC;?, In-­ ternacional, 2 de julio. (/ 3$Ă&#x152;6 F  ´)OLFNU HO VLWLR GH ODV IRWRVÂľ &LEHUSDtV  GH MX-­ nio.KWWSZZZHOSDLVFRPDUWLFXORUHG)OLFNUVLWLRIRWRV elpeputec/20060615elpcibenr_4/Tes(Fecha Ăşltima consulta, 22/04/2011). EL PAĂ?S (2006d): â&#x20AC;&#x153;El falso robo de la silla de Zapateroâ&#x20AC;?. CiberpaĂ­s, 1 de octubre.http://www.elpais.com/articulo/internet/falso/robo/silla/Za-­ patero/elpportec/20061001elpepunet_2/Tes(Fecha Ăşltima consulta, 1/05/2011). EL PAĂ?S (2009): â&#x20AC;&#x153;Los blogueros espaĂąoles, contra el tijeretazo a la in-­ vestigaciĂłnâ&#x20AC;?. CiberpaĂ­s, 8 de octubre. http://www.elpais.com/ articulo/tecnologia/blogueros/espanoles/tijeretazo/investiga-­ cion/elpepusoc/20091008elpeputec_7/Tes(Fecha Ăşltima consulta 7/04/2011). EL PAĂ?S (2009b): â&#x20AC;&#x153;ÂżUna palabra?: decepciĂłnâ&#x20AC;?. Cultura, 3 de diciem-­ bre.http://www.elpais.com/articulo/cultura/palabra/decepcion/ elpepucul/20091203elpepucul_1/Tes(fecha Ăşltima consulta, 17/04/2011).

233


Adolfo Ă lvaro MartĂ­n

EL PAĂ?S (2009c): â&#x20AC;&#x153;Redes sociales, catapultas para la movilizaciĂłnâ&#x20AC;?. Ciber-­ PaĂ­s, 4 de diciembre.http://www.elpais.com/articulo/cultura/Redes/ sociales/catapultas/movilizacion/elpepicul/20091204elpepicul_3/ Tes(fecha Ăşltima consulta, 7/05/2011). EL PAĂ?S (2009d). â&#x20AC;&#x153;La cruzada de Internet Necesarioâ&#x20AC;?. OpiniĂłn, 28 de octubre. http://elpais.com/elpais/2009/10/28/opinion/1256722739_850215. html(Fecha Ăşltima consulta, 17/12/2012). EL PAĂ?S (2010): â&#x20AC;&#x153;El Gobierno deja intacta la ley antidescargasâ&#x20AC;?. Ciber-­ PaĂ­s, 19 de marzo.http://www.elpais.com/articulo/sociedad/Gobier-­ no/deja/intacta/ley/antidescargas/elpepusoc/20100319elpepusoc_3/ Tes(fecha Ăşltima consulta 05/05/2011). (/ 3$Ă&#x152;6   ´(O Ă DVKPRE PiV WUDGLFLRQDOÂľ 6RFLHGDG  GH IHEUH-­ ro.http://www.elpais.com/articulo/sociedad/flashmob/tradicio-­ nal/elpepusoc/20110214elpepusoc_23/Tes(fecha Ăşltima consulta 1/03/2011). EL PAĂ?S (2011b). â&#x20AC;&#x153;Somos Anonymousâ&#x20AC;?. CiberPaĂ­s, 16 de enero.http:// www.elpais.com/articulo/reportajes/Somos/Anonymous/elpepusoc dmg/20110116elpdmgrep_1/Tes(fecha Ăşltima consulta 1/03/2011). EL PAĂ?S (2011c). â&#x20AC;&#x153;TwitterrevoluciĂłnâ&#x20AC;?. Sociedad, 13 de marzo.http://www. elpais.com/articulo/portada/Twitterrevolucion/elpepusoceps/20110 313elpepspor_8/Tes(fecha Ăşltima consulta, 7/05/2011). EL PAĂ?S (2011d). â&#x20AC;&#x153;En las @tripas de Twitterâ&#x20AC;?. TecnologĂ­a, 1 de mayo. EL PAĂ?S (2011e): â&#x20AC;&#x153;Los indignados salen a la calleâ&#x20AC;?. Portada, 16 de mayo. EL PAĂ?S (2011f): â&#x20AC;&#x153;El movimiento 15-­M crece en Madridâ&#x20AC;?. EspaĂąa, 18 de mayo. EL PAĂ?S (2011g): â&#x20AC;&#x153;Apoyo a la indignaciĂłn del 15-­Mâ&#x20AC;?. PolĂ­tica, 5 de junio.http://politica.elpais.com/politica/2011/06/05/actuali-­ dad/1307231940_787459.html(fecha Ăşltima consulta, 20/06/2011). EL PAĂ?S (2011h): â&#x20AC;&#x153;El PP barre a los socialistasâ&#x20AC;?. Portada, 23 de mayo. EL PAĂ?S (2011I). â&#x20AC;&#x153;El movimiento 15-­M se mantiene ajeno a los resulta-­ dosâ&#x20AC;?. PolĂ­tica, 22 de mayo.

234


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

EL PAĂ?S (2011j). â&#x20AC;&#x153;Entrevista a Elmer Mendoza: El gobierno de CalderĂłn ha llevado a MĂŠxico a una pĂŠrdida de control y de vidasâ&#x20AC;?. Cultura, 29 de septiembre. EL PAĂ?S (2012). â&#x20AC;&#x153;Menos apoyo al 15-­M un aĂąo despuĂŠsâ&#x20AC;?. PolĂ­tica, 12 de mayo. EL PERIODICO DE CATALUĂ&#x2018;A (2003). â&#x20AC;&#x153;Voces alternativas en BCNâ&#x20AC;?, Gran Barcelona, 15 de abril. EL SIGLO DE TORREĂ&#x201C;N (2009). â&#x20AC;&#x153;Impuesto reducirĂĄ el uso del Internet en MĂŠxicoâ&#x20AC;?.Finanzas, 15 de octubre.http://www.elsiglodetorreon. com.mx/noticia/469641.html(fecha Ăşltima consulta 20/12/2012). EL SIGLO DE TORREĂ&#x201C;N (2012). â&#x20AC;&#x153;Consigue #YoSoy132 debate en TV nacionalâ&#x20AC;?.Nacional, 29 de mayo.http://www.elsiglodetorreon.com. mx/noticia/746615.consigue-­yosoy132-­debate-­en-­tv-­nacional. html(fecha Ăşltima consulta 20/12/2012). EL SOL DE MĂ&#x2030;XICO (2012). â&#x20AC;&#x153;Intentan boicotear en la Ibero a PeĂąa Nieto â&#x20AC;?.MĂŠxico, 11 de mayo.http://www.oem.com.mx/oem/notas/ n2538119.htm(Fecha Ăşltima consulta 20/12/2012). EL UNIVERSAL (2006). â&#x20AC;&#x153;AMLO impugnarĂĄ resultadosâ&#x20AC;?. Portada, 7 de ju-­ lio.EL UNIVERSAL(2009). â&#x20AC;&#x153;Twitteros piden eliminar impuesto de 3%â&#x20AC;?. 22 de octubre. http://www.eluniversal.com.mx/notas/635172. html(fecha Ăşltima consulta, 21/12/2012).EL UNIVERSAL (2012). â&#x20AC;&#x153;En elecciones 2012 cayĂł popularidad de CalderĂłnâ&#x20AC;?. NaciĂłn, 26 de noviembre. EL UNIVERSAL (2012b). â&#x20AC;&#x153;PeĂąa Nieto gana presidencia mexicana pero denuncias empaĂąan triunfoâ&#x20AC;?. 7 de julio.http://www.eluniversal. com/internacional/elecciones-­en-­mexico/120707/pena-­nieto-­gana-­ presidencia-­mexicana-­pero-­denuncias-­empanan-­triunfo(fecha Ăşlti-­ ma consulta, 20/XII/2012) EL UNIVERSO (2005). â&#x20AC;&#x153;PRE inicia movilizaciones para defender a nueva CSJâ&#x20AC;?. PolĂ­tica, 11 de enero. (/81,9(562 E ´%XFDUDP1RERD\'DKLNSXHGHQUHWRUQDUSRU decisiĂłn de Castroâ&#x20AC;?. PolĂ­tica, 1 de abril.

235


Adolfo Ă lvaro MartĂ­n

EL UNIVERSO (2005c). â&#x20AC;&#x153;Protestas por los retornos ayer en Quitoâ&#x20AC;?. PolĂ­-­ tica, 5 abril. EL UNIVERSO (2005d). â&#x20AC;&#x153;Protestas contra GutiĂŠrrez parĂł parcialmente a Quitoâ&#x20AC;?.PolĂ­tica, 14 de abril. EL UNIVERSO (2005e). â&#x20AC;&#x153;GutiĂŠrrez declara estado de emergencia y di-­ suelve la Corte Supremaâ&#x20AC;?. PolĂ­tica, 15 de abril. EL UNIVERSO (2005f). â&#x20AC;&#x153;Sepultada victima de las protestasâ&#x20AC;?. PolĂ­tica, 22 de abril. EL UNIVERSO (2005g). â&#x20AC;&#x153;Quito viviĂł una jornada de furiaâ&#x20AC;?. PolĂ­tica, 20 de abril. EL UNIVERSAL (2012). â&#x20AC;&#x153;PeĂąa Nieto gana presidencia mexicana pero de-­ nuncias empaĂąan triunfoâ&#x20AC;?. Elecciones en MĂŠxico, 7 de julio.http:// www.eluniversal.com/internacional/elecciones-­en-­mexico/120707/ pena-­nieto-­gana-­presidencia-­mexicana-­pero-­denuncias-­empanan-­ triunfo(Fecha Ăşltima consulta, 19/12/2012). ESCOLAR.net, www.escolar.net EXPANSIĂ&#x201C;N (2011). â&#x20AC;&#x153;El movimiento #Nolesvotes busca su sitio de cara al 22-­Mâ&#x20AC;?. EconomĂ­a, 30 de marzo. http://www.expansion. com/2011/03/21/economia/politica/1300732584.html?a=b7f0c76e0 7c4b3a1ccddc101a3ca1b3c&t=1321274818(fecha Ăşltima consulta, 20/05/2011). EXPERIAN HITWISE, http://weblogs.hitwise.com/bill-­tancer/2006/07/ myspace_moves_into_1_position.html(Fecha Ăşltima consulta, 16/12/2010). )$&(%22.0DQLĂ&#x20AC;HVWR´(QGHIHQVDGHORVGHUHFKRVIXQGDPHQWDOHVHQ Internetâ&#x20AC;?.KWWSZZZIDFHERRNFRPJURXSSKS"JLG  FACEBOOK, â&#x20AC;&#x153;Somos mĂĄs de 1.000.000 contra la ley anti-­descar-­ gas. Sinde dimisiĂłn.KWWSHVHVIDFHERRNFRPSDJHV6RPRV mĂĄs-­de-­1000000-­contra-­la-­ley-­anti-­descargas-­Sinde-­dimi-­ siĂłn/110420342304079

236


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

FACEBOOK (2012). Convocatoria marcha 23 mayo 2012http://www. IDFHERRNFRPHYHQWV"QRW if_t=plan_mall_activity(fecha Ăşltima visita, 20/XII/2012). FLACSO Ecuador (2008). â&#x20AC;&#x153;Ecuador: La migraciĂłn internacional en ci-­ frasâ&#x20AC;?.http://es.scribd.com/doc/98272933/FLACSO-­ECUADOR-­ %E2%80%93-­Ecuador-­La-­migracion-­internacional-­en-­cifras-­ 1976-­2007(Fecha Ăşltima consulta, 19/11/2012). FRIENDSTER, www.friendster.com GEEK TRAINEE Blog (2012). â&#x20AC;&#x153;El hartazgo de las encuestas y del cer-­ co informativoâ&#x20AC;?.18 de mayoKWWSJHHNWUDLQHHEORJEORJVSRWFRP es/2012/05/el-­hartazgo-­de-­las-­encuestas-­y-­del.html (Fecha Ăşltima consulta, 14/12/2012). GII360 (2012). â&#x20AC;&#x153;Tercer Debate con el Movimiento #YoSoy132â&#x20AC;?. 21 de ju-­ nio.http://gii360.blogspot.com.es/2012/06/tercer-­debate-­con-­el-­mo-­ vimiento.html(fecha Ăşltima consulta, 19/12/2012). *22*/(:HEPDVWHU&HQWUDO%ORJ  ´$TXLFN:RUGDERXW*RRJOH-­ bombsâ&#x20AC;?.http://googlewebmastercentral.blogspot.com.es/2007/01/ TXLFNZRUGDERXWJRRJOHERPEVKWPO(Fecha Ăşltima consulta, 14/12/2012). GUERREROS DEL TECLADO,http://blogs.lavanguardia.com/guerreros-­ del-­teclado/2011/07/20/aalam-­wassef-­alias-­ahmad-­sherif/#more-­ 333(Fecha Ăşltima consulta, 21/07/2011). HOMOZAPPING (2012). â&#x20AC;&#x153;Somos mĂĄs de 131â&#x20AC;?. 15 de mayo.http://homo-­ zapping.com.mx/2012/05/somos-­mas-­de-­131/(fecha Ăşltima consul-­ ta, 21/XII/2012). HOY (2005). â&#x20AC;&#x153;AbdalĂĄ Bucaram: â&#x20AC;&#x2DC;Agradezco a mis tres presidentesâ&#x20AC;?. 3 de abril. HOY (2005b). â&#x20AC;&#x153;CaĂ­da y fuga de Lucio GutiĂŠrrez. El abril de los foraji-­ dosâ&#x20AC;?. 24 de noviembre. http://www.hoy.com.ec/especial/caidalucio/ caida1.htm(Fecha Ăşltima consulta, 18/12/2012). HOY (2005c). â&#x20AC;&#x153;GutiĂŠrrez levanta estado de emergenciaâ&#x20AC;?. 16 de abril.

237


Adolfo Álvaro Martín

HOY(2005d). “Sin respaldo de EEUU y con la ayuda de los militares, Lucio Gutiérrez fuga de Carondelet”. Suplemento Blanco y Negro, 23 de abril. IDEALISTA.com, http://www.idealista.com/pagina/portada INDIMEDIA, http://www.indimedia.org INSITE CONSULTING, http://www.insiteconsulting.com/ KEVINHURIT.blogspot.com (2005). “Premios a los mejores blogs de Ecuador”. 30 de junio.KWWSNHYLQKXUOWEORJVSRWFRPSUH-­ mios-­los-­mejores-­blogs-­de-­ecuador.html (Fecha última consulta, 4/12/2012). LA HORA(2005). “Gutiérrez tilda de forajidos a protagonistas del cacero-­ lazo”. País, 15 de abril. LA JORNADA (2012): “Los jóvenes ‘hicieron milagros con recursos limi-­ tados’ sostiene Google”. Elecciones 2012, 21 de junio. http://www. jornada.unam.mx/2012/06/21/politica/012n2pol(fecha última con-­ sulta, 02/01/2013). LA JORNADA (2012b): “PRI, PAN y PRD felicitan a #YoSoy132”. Elec-­ ciones 2012 21 de junio. http://www.jornada.unam.mx/2012/06/21/ politica/012n3pol(fecha última consulta, 02/01/2013). LA JORNADA (2012c). “Ejercen jóvenes su derecho de réplica ante trescandidatos”. Política, 20 de junio.http://www.jornada. unam.mx/2012/06/20/politica/002n1pol(fecha última consulta, 19/12/2012). LA JORNADA (2012d): “Presentan el libro #YoSoy132. Voces del movi-­ miento, que reúne 97 testimonios”. Política, 17 de noviembre.http:// www.jornada.unam.mx/2012/11/17/politica/015n1pol(fecha última consulta, 02/01/2013). LA JORNADA (2012e): “#YoSoy132, López Obrador y el miedo”. Opinión, 14 junio. reúne 97 testimonios”. Política, 17 de noviembre.http:// www.jornada.unam.mx/2012/06/14/opinion/022a2pol(fecha última consulta, 02/01/2013).

238


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

LA JORNADA JALISCO (2012): “Se pronuncia Peña Nieto a favor de di-­ fundir debate en cadena nacional”. Política, 1 de junio.http://www. lajornadajalisco.com.mx/2012/06/01/se-­pronuncia-­pena-­nieto-­a-­ favor-­de-­difundir-­debate-­en-­cadena-­nacional/(fecha última consul-­ ta,20/12/2012). LA NACIÓN.com (2011). “Ciberutópicos v. Ciberescépticos”. Debate, 13 de marzo,http://www.lanacion.com.ar/1356884-­ciberutopicos-­v-­ ciberescepticos(Fecha última consulta, 18/06/2011). /$9$1*8$5',$  ´(OKDFNWLYLVPR\ODGHVREHGLHQFLDFLYLOHOHF-­ trónica, a debate en el CCCB”, Tecnología, 8 de noviembre. LA VANGUARDIA (2006). “Una campaña contra la pobreza, detrás del simulacro de robo del escaño de Zapatero”. Política, 2 de octubre. LA

VANGUARDIA (2009): Fotoshttp://www.lavanguardia. com/20091203/53836919866/imagen-­de-­la-­reunion-­entre-­los-­in-­ WHUQDXWDV\JRQ]DOH]VLQGHLPDJHQGHMHVXVHQFLQDUHQVXÁLFNU html

LA VANGUARDIA (2010). “Se disparan las adhesiones a las movilizacio-­ nes de multitudes instantáneas”, Vida, 18 de enero. LA VANGUARDIA (2010b): “La Ley Sinde, rechazada en el Congreso por todos los grupos excepto el PSOE”.http://www.lavanguardia. com/politica/20101221/54091919361/la-­ley-­sinde-­rechazada-­en-­el-­ congreso-­por-­todos-­los-­grupos-­excepto-­el-­psoe.html(fecha última consulta, 08/03/2011). LIBERINFO, http://www.liberinfo.org MERODEANDO.com: http://www.merodeando.com/ MÉXICO CNN (2012): “#YoSoy132 y la cercanía de la elección impul-­ san ‘rating’de segundo debate”. Nacional, 11 de junio.http://mexico. cnn.com/nacional/2012/06/11/yosoy132-­y-­la-­cercania-­de-­la-­elec-­ cion-­impulsan-­rating-­de-­segundo-­debate(fecha última consulta, 19/12/2012).

239


Adolfo Ă lvaro MartĂ­n

MĂ&#x2030;XICO CNN (2012b): â&#x20AC;&#x153;#YoSoy132 organiza debate interactivo pero con difusiĂłn limitadaâ&#x20AC;?. 19 de junio.http://mexico.cnn.com/nacio-­ nal/2012/06/19/yosoy132-­organiza-­debate-­interactivo-­pero-­con-­di-­ fusion-­limitada (fecha Ăşltima consulta, 20/12/2012). MĂ&#x2030;XICO CNN (2012c): â&#x20AC;&#x153;La â&#x20AC;&#x2DC;playmateâ&#x20AC;&#x2122; que atrajo las miradas en el debate presidencialâ&#x20AC;?. 6 de mayo.http://mexico.cnn.com/nacio-­ nal/2012/05/06/de-­playmate-­a-­edecan-­del-­debate-­presidencial-­en-­ mexico(fecha Ăşltima consulta, 20/12/2012). MICROSIERVOS.com: http://www.microsiervos.com/ MINGASOCIAL COMUNICACIĂ&#x201C;N: www.mingasocial.netMoveOn.org: http://www.moveon.org/moveonbulletin/bulletin23s.html MOVIMIENTO 15-­M: http://movimiento15m.org/MySpace, www.myspa-­ ce.comN-­1. https://n-­1.cc/ NEW YORK TIMES (2003). â&#x20AC;&#x153;Ideas & Trends: Flash Mobs; Guess Some 3HRSOH'RQ¡W+DYH$Q\WKLQJ%HWWHUWR'RÂľ:HHNLQ5HYLHZGH agosto. NETORATĂ&#x201C;N 3.0, â&#x20AC;&#x153;La revuelta iranĂ­ se emite en Youtubeâ&#x20AC;?.http://www. netoraton.es/?p=5369(Fecha Ăşltima consulta, 24/12/2012). NĂ&#x201C;MADA: html

http://nomada.blogs.com/jfreire/2006/03/accin_poltica_t_2.

NUNCA MAIS: http://www.plataformanuncamais.org OBSERVATORI DE CIBERPOLITICA: http://www.joserodriguez.info/ bloc/?p=4070 OIGA.me. https://oiga.me/ OMCIM (2012): â&#x20AC;&#x153;Arturo Escobar: Quienes agredieron a PeĂąa Nieto no eran Estudiantes de la Iberoâ&#x20AC;?. 11 de mayo.http://elecciones2012mx. wordpress.com/2012/05/11/arturo-­escobar-­quienes-­agredieron-­a-­ pena-­nieto-­no-­eran-­estudiantes-­de-­la-­ibero/#more-­6734(fecha Ăşlti-­ ma consulta, 08/12/2012). PEROGRULLO.com, http://www.perogrullo.com/

240


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

PIXEL y DIXEL, www.pixelydixel.com PINGDOM (2013), “Internet 2012 in numbers”, http://royal.pingdom. com/2013/01/16/internet-­2012-­in-­numbers/(Fecha última consulta, 25/01/2013). PROCESO (2011). “Guerra de Calderón deja 4 mil niños muertos y 3 mil 700 huérfanos: CDHF”. Nacional, 24 de noviembre. PROCESO (2012). “EPN es un ‘peligro’ para el país, alertan atenquen-­ ses”. Comicios 2012, 3 de mayo. PROCESO (2012b). “Arremeten contra alumnos de la Ibero por abucheos a EPN”. Comicios 2012, 15 de mayo. PROCESO (2012c). “Exhiben a integrantes de #Generación MX por su cer-­ canía con EPN y la Coparmex”. Comicios 2012, 12 de junio.http:// www.proceso.com.mx/?p=310669(Fecha última consulta 30/12/12). PROCESO (2012d). “Amenaza Generación MX a #YoSoy132: les quitare-­ mos susu pasaporte””. Comicios 2012, 12 de junio.http://www.pro-­ ceso.com.mx/?p=310641(Fecha última consulta 30/12/12). PROCESO (2012e). “La peculiar ‘guerra sucia’ online contra #Yo-­ Soy132”.Comicios 2012, 18 de junio.http://www.proceso.com. mx/?p=311322(Fecha última consulta 30/12/12). PROCESO (2012f). “Repudia #YoSoy132 ‘imposición’ de EPN”. Comicios 2012, 4 de julio. http://www.proceso.com.mx/?p=313274(Fecha últi-­ ma consulta 30/12/12). PROCESO (2012g). “Difunde PRI video maquillado de EPN en la Ibero”. Comicios 2012, 13 de mayo. PROPONGO. http://propongo.tomalaplaza.net/ PÚBLICO (2009). “La oposición sigue llamando a la movilización en Mol-­ davia”. Internacional, 7 de abril. 3Ô%/,&2   ´&LEHUDWDTXHV SDUD GHIHQGHU :LNLOHDNVµ ,QWHUQDFLR-­ nal, 7 de diciembre. PÚBLICO (2011). “Los ‘indignados’ de Sol se organizan en comisiones”. España, 18 de mayo.

241


Adolfo Álvaro Martín

PÚBLICO (2011b). “No hay prohibición que pare a los indignados”. Espa-­ ña, 19 de mayo. 3Ô%/,&2 F ´0LOHVGHUHÁH[LRQHVLQXQGDQOD3XHUWDGHO6ROWUDVHO grito mudo”. España, 31 de mayo. PÚBLICO (2011d). “Cronología de la acampada ‘indignada’”. España, 21 de mayo. PÚBLICO (2011e). “Zapatero frenó la ‘ley Sinde’ por la presión de los internautas”. Cultura, 13 de diciembre.http://www.publico.es/cul-­ turas/411861/zapatero-­freno-­la-­ley-­sinde-­por-­la-­presion-­de-­los-­in-­ ternautas(Fecha última consulta, 30/12/2012). PÚBLICO (2012). “Los impulsores del 15M se constituyen como asocia-­ ción”. España, 22 de abril. PÚBLICO (2012b). “Democracia Real Ya ‘expulsa’ a cinco de sus miem-­ bros”. Madrid, 4 de mayo. PÚBLICO (2012c). “La lucha por la vivienda, el frente con más victorias del 15-­M”. España, 30 de abril. 15OCTOBER.NET. 15october.net RADIOCABLE.com, http://www.radiocable.com/ REBELIÓN.org: www.rebelion.org RED LIBERAL: www.redliberal.com RED PROGRESISTA: www.redprogresista.net REFORMA (2012). “Desestima TEPJF invalidez de elección”. 30 de agos-­ to. REFORMA (2012b). “Peligros y retos de #YoSoy132”. Editoriales, 31 de agosto. REVISTA LATITUDES (2011): http://revistalatitudes.org/2011/06/13/ neurosis-­nacional/raebrune/(Fecha última consulta 30/06/12). ROBOT WISDOM: www.robotwisdom.com

242


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en América Latina y España

RTVE (2009). “Unos 5.000 blogs se suman a la blogocampaña contra la por-­ nografía infantil en la Red”.http://www.rtve.es/noticias/20091119/ unos-­5000-­blogs-­suman-­blogocampana-­contra-­pornografia-­in-­ fantil-­red/301590.shtml(Fecha última consulta 9/05/2011). RTVE (2009b). “En Irán, la marea verde vuelve a salir a la calle de forma SDFtÀFDµhttp://www.rtve.es/alacarta/videos/programa/iran-­marea-­ YHUGHYXHOYHVDOLUFDOOHIRUPDSDFLÀFD(Fecha última con-­ sulta 9/05/2011). SDPnoticias.com (2012). “Se cierra la elección: Peña Nieto líder, AMLO se acerca, JVM se estanca”. 20 de mayohttp://www.sdpnoticias.com/ nacional/2012/05/20/se-­cierra-­la-­eleccion-­pena-­nieto-­lider-­amlo-­se-­ acerca-­jvm-­se-­estanca(Fecha última consulta 19/12/2012). SDPnoticias.com (2012b). “Encuesta Final Covarrubias y Asociados 2012: EPN 10 Puntos arriba de AMLO”. 26 de junio.http://www.sdpno-­ WLFLDVFRPQDFLRQDOHQFXHVWDÀQDOFRYDUUXELDV\DVR-­ ciados-­2012-­epn-­10-­puntos-­arriba-­de-­amlo(Fecha última consulta 19/12/2012). SINEMBARGO (2012). “Nace en la red movimiento de apoyo a estudian-­ tes de la Ibero amenazados por rechazar a EPN”. 13 de diciembre. http://www.sinembargo.mx/16-­05-­2012/235239(Fecha última con-­ sulta, 30/12/2012). SIX DEGREES.com; www.sixdegrees.com SOITU.es, http://www.soitu.es/ STOPDESAHUCIOS. http://stopdesahucios.tomalaplaza.net/ SUPERTEL: www.supertel.gob.ecTC Televisión (2005). http://youtu.be/_ N69OZ879V(fecha última consulta 22/11/2012). TELESUR (2012). “¿Cuál es el panorama a un mes de las elecciones?”. http://youtu.be/Vxr1cH2C1xM(Fecha última consulta, 21/12/2012). TELEVISA (2012). “Increpan a Peña Nieto en la Ibero”. 11 de mayo. http://noticierostelevisa.esmas.com/decision-­2012/noticias-­deci-­ sion-­2012/442523/increpan-­enrique-­pena-­nieto-­ibero(Fecha última consulta, 22/12/2012).

243


Adolfo Ă lvaro MartĂ­n

TELEVISA (2012b). â&#x20AC;&#x153;Un dĂ­a en campaĂąa con Enrique PeĂąa Nietoâ&#x20AC;?. 17 mayo.http://tvolucion.esmas.com/noticieros/punto-­de-­parti-­ da/173457/un-­da-­en-­campaa-­con-­enrique-­pea-­nieto/#(Fecha Ăşlti-­ ma consulta, 22/12/2012). TELEVISA (2012c). â&#x20AC;&#x153;Manifestaciones del Movimiento Yo soy 132â&#x20AC;?. 23 de mayo.http://www.televisa.com/canal-­de-­las-­estrellas/capitu-­ los/174225/manifestaciones-­del-­movimiento-­yo-­soy-­132/(fecha Ăşlti-­ ma visita, 20/XII/2012). TWEEdotco (2012). â&#x20AC;&#x153;131 Alumnos de la Ibero was popular on Twitterâ&#x20AC;?. http://www.twee.co/topics/131-­alumnos-­de-­la-­ibero (fecha Ăşltima consulta, 20/XII/2012) THE ECONOMIST (2005). â&#x20AC;&#x153;Video gaming: Chasing the dreamâ&#x20AC;?. 6 de agosto. THE GUARDIAN (2009). â&#x20AC;&#x153;Twitter revolution Moldovan activist goes LQWR KLGLQJÂľ :RUOG QHZV  GH DEULOKWWSZZZJXDUGLDQFRXN world/2009/apr/15/moldova-­activist-­hiding-­protests(Fecha Ăşltima consulta 21/04/2012). THE NARCO NEWS BULLETIN (2012). â&#x20AC;&#x153;The Medium was the Mes-­ sage in the#YoSoy132 Debate in Mexicoâ&#x20AC;?. 20 junio.http://www. narconews.com/Issue67/article4598.html(Fecha Ăşltima consulta 21/12/2012). THE NEW YORK TIMES (2006). â&#x20AC;&#x153; Respect must be paidâ&#x20AC;?. OpiniĂłn pages, GHMXQLRKWWSZZZQ\WLPHVFRPRSLQLRQEURRNV html(Fecha Ăşltima consulta 16/03/2011). THE NEW YORK TIMES (2009). â&#x20AC;&#x153;Protests in Moldova Explode, With Help of Twitterâ&#x20AC;?. Europe, 7 de abril.http://www.nytimes. com/2009/04/08/world/europe/08moldova.html?_r=1(Fecha Ăşltima consulta, 22/05/2011). THE TIMES (2008). â&#x20AC;&#x153;Scientology: the Anonymous protestorsâ&#x20AC;?. Life, 20 de junio.

244


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

THE WASHINGTON POST (2011): â&#x20AC;&#x153;Tens of thousands march in Spain WR SURWHVW DJDLQVW DXVWHULW\ PHDVXUHV %DQNV SROLWLFLDQVÂľ %XVL-­ ness 17 mayo.http://www.washingtonpost.com/business/tens-­of-­ thousands-­march-­in-­spain-­to-­protest-­against-­austerity-­measures-­ EDQNVSROLWLFLDQV$)2+*BVWRU\KWPO IHFKD ~OWLPD consulta 01/06/2011) 7,0(  ´:K\(YHU\RQHÂ?V7DOLNLQJDERXW7ZLWWHUÂľ%XVLQHVVGH marzo. TIME (2008). â&#x20AC;&#x153;The 2008 TIME 100â&#x20AC;?.http://www.time.com/time/spe-­ cials/2007/article/0,28804,1733748_1733756_1735878,00. html(Fecha Ăşltima consulta 14/02/2011). TWITTER. @yoanisanchez TU.tv (2012). â&#x20AC;&#x153;PeĂąa Nieto edita vĂ­deo de su visita a la IBEROâ&#x20AC;?. 13 mayo. http://tu.tv/videos/pena-­nieto-­edita-­video-­de-­su-­visita-­a-­la(fecha Ăşltima visita 20/XII/2012). 86$72'$<  ´)OLFNURILGHDRQDJDPLQJ3URMHFWOHGWR3KRWRZH-­ bsiteâ&#x20AC;?, En Tech Products, 27 de febrero. USTREAM(2012). â&#x20AC;&#x153;Conferencia de prensa de la asamblea ge-­ neral #yosoy132â&#x20AC;?. 18 de mayo.http://www.ustream.tv/ recorded/23403437(fecha Ăşltima visita, 20/XII/2012). VANGUARDIA (2012). â&#x20AC;&#x153;Fue un puĂąado de jĂłvenes los intolerantes en la Ibero:Coldwellâ&#x20AC;?. Nacional, 11 de mayo.http://www.vanguar-­ dia.com.mx/fueunpunadodejoveneslosintolerantesenlaiberocold-­ well-­1284876.html(Fecha Ăşltima visita, 29/12/2012). 20MINUTOS.es (2009): â&#x20AC;&#x153;La marea verde de IrĂĄn navega en Internetâ&#x20AC;?, In-­ ternacional, 16 de junio.http://www.20minutos.es/noticia/474324/0/ iran/twitter/internet/(fecha Ăşltima consulta 21/04/2011). 20MINUTOS.es (2009b): â&#x20AC;&#x153;YouTube recibe 3.000 vĂ­deos de protestas por las elecciones en IrĂĄn en 24 horasâ&#x20AC;?. Internacional, 18 de junio. http://www.20minutos.es/noticia/474638/0/iran/youtube/twitter/ (fecha Ăşltima consulta, 21/04/2011).

245


Adolfo Ă lvaro MartĂ­n

0,18726HV F ´(OPDQLĂ&#x20AC;HVWRTXHOOHJyVREUHXQDRODÂľ7HFQR-­ logĂ­a, 20:22 horas 2 de diciembre.http://www.20minutos.es/noti-­ FLDFUHDFLRQPDQLĂ&#x20AC;HVWRLQWHUQHW )HFKD ~OWLPD FRQVXOWD 27/04/2011). 0,18726HV  ´:LNLOHDNVVHFORQDYHFHVHQ,QWHUQHWSDUDQR desaparecerâ&#x20AC;?. TecnologĂ­a, 6 de diciembre.http://www.20minutos. HVQRWLFLDZLNLOHDNVDVVDQJHFORQDFLRQ IHFKD~OWLPDFRQ-­ sulta, 16/02/2011). 20MINUTOS.es (2010b): â&#x20AC;&#x153;El Congreso rechaza la Ley Sindeâ&#x20AC;?. TecnologĂ­a, 21 de diciembre.http://www.20minutos.es/noticia/909044/0/ley/sin-­ de/congreso/(fecha Ăşltima consulta, 8/03/2011). 20MINUTOS.es (2011): â&#x20AC;&#x153;La Ley Sinde de la A a la Zâ&#x20AC;?. TecnologĂ­a, 15 de febrero.http://www.20minutos.es/noticia/960438/0/claves/ley/sin-­ de/(fecha Ăşltima consulta, 1/04/2011). 24 HORAS (2012). â&#x20AC;&#x153; â&#x20AC;&#x2DC;Yo soy 132â&#x20AC;&#x2122;, convocan a marcha nacional el 23 de mayoâ&#x20AC;?. 18 mayo.http://www.24-­horas.mx/yo-­soy-­132-­convo-­ can-­a-­marcha-­nacional-­el-­23-­de-­mayo/(fecha Ăşltima consulta, 20/12/2012). VILAWEB (2011). â&#x20AC;&#x153;Manuel Castells: â&#x20AC;&#x2DC;Porucs de tot el mĂłn, uniu-­vos a la xar-­ xaâ&#x20AC;&#x2122;â&#x20AC;?.27 de mayo.http://www.vilaweb.cat/noticia/3891748/20110527/ manuel-­castells-­porucs-­mon-­uniu-­vos-­xarxa.html(Fecha Ăşltima vi-­ sita, 29/12/2012). YOUTUBE, â&#x20AC;&#x153;Egipto: CĂłmo lo hicimos cuando los medios no lo harĂ­an.â&#x20AC;?http://youtu.be/zcXRfYjD5DQ(fecha Ăşltima consulta 22/05/2011). <2878%( ´)UHH 0\ /DQG ² ,UDQÂ?V 9RLG (OHFWLRQÂľKWWS\RXWXEHQWX dJmmelM(fecha Ăşltima consulta 18/02/2011). YOUTUBE, â&#x20AC;&#x153;Anonymous, Mensaje a la iglesia de la cienciologĂ­a.â&#x20AC;?http:// youtu.be/gedu6t5ERGQ <2878%($QRQ\PRXV2SHUDWLRQ3D\EDFN:LNLOHDNV$FWD/DZV0HV-­ sage.http://youtu.be/ub4bPZy376Y

246


Revoluciones Horizontales Ciberactivismo y Movilizaciones Ciudadanas en AmĂŠrica Latina y EspaĂąa

YOUTUBE (2012). â&#x20AC;&#x153;131 alumnos de la Ibero respondenâ&#x20AC;?.http://www.you-­ WXEHFRPZDWFK"Y 3;ERF;V)N, IHDWXUH \RXWXEH )HFKD ~OWLPD visita 20/12/2012). YOUTUBE (2012b). â&#x20AC;&#x153;Debate #YoSoy132 Martes 19 de Junio 2012â&#x20AC;?.http:// \RXWXEH3*\XM4N IHFKD~OWLPDYLVLWD  XANGA.com: www.xanga.com ZACATECAS@nline (2012). â&#x20AC;&#x153;Miles siguen Debate#YoSoy132 pese a fa-­ llas tĂŠcnicasâ&#x20AC;?.http://zacatecasonline.com.mx/noticias/local/23624-­ debate-­fallas-­tecnicas.html(fecha Ăşltima consulta, 19/12/2012).

247


Revoluciones horizontales