Issuu on Google+

NUMMER två TVÅTUSENelva

ÄNTLIGEN EN SOLOPLATTA FRÅN

Christoffer Lundquist VINN! BILJETTER TILL

MISS LI PÅ SIDAN 46 VI HAR SNIFFAT RUNT I

barcelona


Snygg, smart och musikintresserad Spotify Premium ingår i 6 månader 2) ZTE Blade Lyssna på Spotify med en av marknadens tunnaste smartphones. Både prisvärd och funktionell.

128 kr/mån ) 1

+ 295 kr kontant Telia Mobil Max 25 med Mobilsurf i 24 mån Minsta totalkostnad under bindningstiden 3 617 kr

Välkommen till Telias butiker i Dalarna ABONNEMANG 1) ZTE Blade

Telia Mobil Max 25 med mobilsurf

BINDN.-TID 24 mån

Fast mån.avgift ABONNEMANG

Fast mån.avgift under bindn.tiden TELEFON

TOTAL MÅN.AVGIFT

98 kr

30 kr

128 kr

+

Kontant TELEFON

Engångsavgift ABONNEMANG

295 kr

250 kr

=

MINSTA TOT.KOSTNAD UNDER BINDNINGSTIDEN

PRIS FÖR TELEFON UTAN ABONNEMANG

3 617 kr

1 695 kr

Telia Mobil Max 25 med Mobilsurf: Erbjudandet gäller t.o.m. 25/3 2011. Vid minst 24 mån bindning och för privatpersoner mellan 18-25 år eller som studerar heltid vid Universitet eller Högskola. Månadsavgift 98 kr. kr, 0 kr/min till mobila nummer inom Telia, 0,49 kr/min till övriga operatörer och fasta nätet, Öppningsavgift 0,99. 0 kr/sms upp till 5 000 st därefter 0,69 kr/sms, 1,69 kr/mms inom Sverige, Engångsavgift 250 kr. All datatrafik i Sverige ingår utom trafiktyperna IP-telefoni eller att dela och ladda ner filer, vilka inte är tillgängliga i detta erbjudande. Telia förbehåller sig rätten att begränsa överföringshastigheten till 120 kbit/s om användandet överstiger 1 GB/månad. 2) Spotify Premium: 0 kr/mån de första 6 mån på Spotify Premium därefter ordinarie pris 99 kr/mån. Avslutar du tjänsten övergår ditt Spotify Premium till Spotify Free. Erbjudandet gäller vid tecknande av privat Telia mobilabonnemang med mobilsurf inkluderat vid 24 mån bindning. Engångsavgift 0 kr (värde 250 kr) på telia.se


Big Mac

Lektion 1.

Vill du ha en?

Nej

Jo, det vill du.

Ja


INNEHร…LL & REDAKTIONEN

17

13

20

PETER THELIN 9'6lOMDUH  SHWHU#QROOWYDVH

I DETTA NUMMER

LEDARE

6 Motor 8 Aktuellt 10Vimmel 13 barcelona 17 alex & felix 20 stรถten 22 Vimmel 24 christoffer lundquist 28 Inredning 30 Skรถnhet 32 Linn Lรถwes 34 Ryan Garrison 36 Musik 38Spel 40Film/TV 42Korsord 44Krรถnika 46Tรคvling & Serie 47 Upptรคck!

NU Gร–R VI NYAVWRUDVDWVQLQJDUSnGLQ IDYRULWWLGQLQJ1ROOWYn9LKDUDQVWlOOWGHQ HPLQHQWDIRWRJUDIHQ5\DQ*DUULVRQI|U DWWO\IWDYnUDWLQQHKnOOLWLGQLQJHQWLOOlQQX K|JUHK|MGHU9LNRPPHUGHVVXWRPIUnQRFK PHGXWJnYDQGHQPDMLnUDWWXW|YHUYnU WLGLJDUHGLVWULEXWLRQYLDWLGQLQJVVWlOOLKHOD 'DODUQDlYHQVNLFNDXW1ROOWYnLEUHYOnGDQWLOO DOODKXVKnOOL)DOXQRFK%RUOlQJHNRPPXQ (QLYnUD|JRQULNWLJWVWDUNH[SDQVLRQDY SURGXNWHQI|UGHMVRPOlVDUHGnYnUXSSODJD NRPPHU|NDUHMlOWRFKEOLPHUOlWWWLOOJlQJOLJ 'HWWDNRPPHUlYHQDWWVWlUNDRVV\WWHUOLJDUH VRPPHGLDYDOI|UGLJVRPDQQRQV|U 9LQ|MHURVVLQWHEDUDPHGGHVVDVDWVQLQJDU VnNODUW9LKDUPHUJUHMHUSnJnQJI|UDWWEOL HQUROLJDUHRFKVWDUNDUHWLGQLQJL'DODUQD +nOO|JRQHQ|SSQD 1XN|UYLVnGHWU\NHU I DETTA NUMMEREHO\VHUYLHQVDOLJ EODQGQLQJDYUHSRUWDJHVnVRPPRWRUDNWXHOOW YLPPHOUHVDYLQWHUVSRUWDUWLVWLQUHGQLQJ VN|QKHWNU|QLNRUPXVLNVSHOร€OPNRUVRUG SU\ODUWLSVRFKHQIDQWDVWLVNWlYOLQJVRPGX KLWWDUSnVLGDQ(QKHOGHOPHGDQGUDRUG 7UHYOLJOlVQLQJRFKKDGHWVnJRWWWLOOVYL V\QVLJHQGHQPDUV

24

PATRICK EKBLOM 5HGDNW|U)RUPJLYDUH  SDWULFN#QROOWYDVH

RYAN GARRISON )RWRJUDI  U\DQ#QROOWYDVH

CATRIN THELIN $GPLQLVWUDWLRQ  FDWULQ#QROOWYDVH

ANNA WAHLBร„CK 6NULEHQW  DQQD#QROOWYDVH

andreas andersson 9LPPHOIRWRJUDI  DQGUHDV#QROOWYDVH

omslagsbilden )2725\DQ*DUULVRQ02'(//(ULFD Grafisk form: 3DWULFN(NEORP ansvarig utgivare:3HWHU7KHOLQ Utgivare: 0HGLDSURGXFHQWHUQDL'DODUQD$% Tryck: 0LWW0HGLD3ULQW$% Periodicitet: QUnU Upplaga:H[QU Distribution: 9LDWLGQLQJVVWlOOL'DODUQD Kontakt: UHGDNWLRQHQ#QROOWYDVH Adress: 1ROOWYn.XSROHQ%RUOlQJH

KRISTOFER Tร…QVIST )LOP 79  NULVWRIHU#QROOWYDVH



LINN Lร–WES .U|QLN|U

FREDRIK B NILSSON 0XVLNVNULEHQW

ANDERS LUNDQUIST 0XVLNVNULEHQW

KRISTIAN GIDLUND .U|QLN|U

THORD DANIEL HEDENGREN 6SHOVNULEHQW

1ROOWYnDQVYDUDUHMI|ULQVlQWPDWHULDORFKI|UEHKnOOHU VLJUlWWHQDWWUHGLJHUD(IWHUWU\FNlUI|UEMXGHWXWDQ WLOOVWnQG&LWHUDJlUQDPHQDQJHNlOODQ 7LGQLQJHQWU\FNVSnPLOM|YlQOLJWSDSSHU


! E D A R E T UPPDA + Tatuering + 50-talskläder av Emmy Design

Välkomna! 023-639 39 • Åsgatan 43 Falun

Du försvinner inte i mängden

Utbildningar inom Data & IT, Ekonomi, samhälle & turism, Idrott & hälsa, Kultur, medier & design, Språk, Teknik, Undervisning och Vård, omsorg & medicin.

www.du.se


MOTOR

Bilnyheter från världens alla hörn! $Y-HQQ\1LOVVRQ‹&13$%

FORD STÄMMER FERRARI

GULT ÄR FULT

'HWlULQWHOlWWDWWVHVNLOOQDGSnHQSLFNXSRFKHQ)RUPHOELO7MDGHWW\FNHULDOODIDOO)RUGVRP KDUVWlPW)HUUDULHIWHUDWWLWDOLHQDUQDGUDJLWQ\WWDDYQDPQHWSnGHUDVVWRUVlOMDQGHSLFNXS) ,KHODnUKDUPRGHOOHQYDULWGHQPHVWVnOGDELOHQL86$RFKPHGYlUVWDNRQNXUUHQWHQ'RGJH 5DPLKDVRUQD VRPlJVDY)LDWNRQFHUQHQ YLOOPDQGlUI|UVWRSSDLWDOLHQDUQDHIWHUVRPGHUDV YDUXPlUNHQK|URFKKlSQDNDQI|UYl[ODV)HUUDULVYDUDUJHQRPDWWKlYGDDWWLPRGHOOQDPQHW V\IWDUWLOODWW,WDOLHQVRPQDWLRQI\OOHUnUPHQYlOMHUlQGnDWWNU\SDWLOONRUVHWRFKVNULYHUQXXW )HUUDUL)WK,WDOLD

9HPVNXOOHLQWHEOL|YHUO\FNOLJRPGHWSnWUHWWLRnUVGDJHQVWRGHQNQDOOJXO/H[XV/)$Sn JDUDJHXSSIDUWHQ"6YDUHWlUGHQERUWVNlPGDKRWHOODUYWDJHUVNDQ3DULV+LOWRQ3RMNYlQQHQWLOOLND QDWWNOXEEVlJDUHQ&\:DLWVYLOOH|YHUUDVND3DULVGDJHQWLOOlUDPHQVWMlUQDQKDGHVDQQHUOLJHQ VYnUWDWWG|OMDVLWWPLVVQ|MHµ*XOWlUGHWYlUVWDMDJYHWµXWEUDVWHQXUVLQQLJ+LOWRQ7XUQRJI|U SRMNYlQQHQYDUDOOWHWWVNlPWRFKUXQWK|UQHWVWRGHQVSOLWWHUQ\SlUOYLW/H[XV/)$WLOOHWWYlUGH DYFDPLOMRQHU9DGKlQGHGnPHGGHQJXODVXSHUVSRUWELOHQ"'HWYLVDGHVLJKHOWVRQLNDDWW QDWWNOXEEVlJDUHQlYHQKDGHN|SWHQSUHVHQWWLOOVLJVMlOY

KÄNDISTÄT REKLAM

”LADDAD” SKYLT

'HWKDUDOOWLGYDULWSRSXOlUWDWWDQOLWDGLYHUVHROLNDNlQGLVDUVRPNRVWDUPXOWXPQlUGHWlUGDJV I|UDWWLQWURGXFHUDHQELOPRGHOOSnPDUNQDGHQ5HQDXOWYLOOJLYHWYLVLQWHNlQQDVLJXWDQI|URFKKDU GlUI|UVODJLWSnµVWRUDWUXPPDQµRFKWDJLWKMlOSDYNlQGLVDUVRPIRWEROOVSURIIVHW7KLHUU\+HQU\ VnQJHUVNDQ5LKDQQDRFKEXUOHVNDUWLVWHQ'LWD9RQ7HVVH,GHQVYLQG\UDÀOPVQXWWHQInUYLI|OMDPHG 5LKDQQDXQGHULQVSHOQLQJHQDYKHQQHVQ\DPXVLNYLGHR6 0RFK7KLHUU\+HQU\QlUKDQEHV|NHU 'LWD9RQ7HHVHHQµYDQOLJµGDJSnMREEHWDOOWLMDNWHQSnDWWI|UV|NDWDUHGDSnYDGVORJDQµ9D9D 9RRP"µEHW\GHU$OOWDYVO|MDVLVOXWHWDYUHNODPHQRFKVYDUHWlUJLYHWYLV5HQDXOW&OLR

5XQWRPLYnUWEOnJXODODQGUXOODUWRWDOWHOELODUHQI|JDOLWHQVLIIUDNDQW\FNDVPHQWURWVGHWWD YlOMHUQX7UDÀNYHUNHWDWWLQWURGXFHUDHWWKHOWQ\WWYlJPlUNHHQSDUNHULQJVVN\OWVWULNWUHVHUYHUDG I|UHOELODUbQVnOlQJHKDUDQV|NQLQJDUQDI|UDWWInVlWWDXSSVN\OWHQYDULWInRFKGHWlUHQEDUW SULYDWSHUVRQHUVRPYLVDWLQWUHVVH0HQSDUNHULQJVSODWVHUQDlUG\UDULNWLJWG\UD5XQW NRVWDUGHWDWWGUDLQHOWLOOODGGVWROSDUQDRFKGHWlUlQVnOlQJHRNODUWYHPVRPVNDSU|MVDI|U NDODVHW7UDÀNYHUNHWXSSOHYHULQWHDWWGHWlUGRPVRPKDUEHWDOQLQJVDQVYDUHWXWDQW\FNHUDWWQnJRQ DQQDQVNDEHWDOD)|UYnQDQGH"1HMLQWHDOOV

Säsongen närmar sig sakta... Längst till vänster: Lindstrands Jacka Mojave

ABSS C AB Tig er 80 0XC Tiger

:90:1 102 9 0:990:94.99 ABS 94 uta utan AB



Lindstrands nya skinnställ Z-Two Piece

7495:-

REA pågår för fullt! Kanonpriser på utgående kläder, crosskläder, hjälmar etc. Se vår web www.motobikers.se

3795:Halvarssons Jacka Hermes

4495:-

Kvarng.1, Borlänge (Romme S.Ind.omr). Månd-fred 9.30-18. Stängt lörd juli-sept.

‡€¤€Û††ÛƒƒÛÝÛwww.motobikers.se


3HUVRQOLJVHUYLFH %RUO¦QJH

)µUV£OMDUH 6DPXHO:¦IRUV 

)µUV£OMDUH 3HU%DXHU 

)DOXQ

)µUV£OMDUH 0DWWLDV&DUOJUHQ 

)µUV£OMDUH 3¦U%¦OWHU 

7R\RWD&HQWHU 'DODUQD

%RUO¦QJH *MXWDUJDWDQ 7HO

ZZZWR\RWDFHQWHUVH

)µUV£OMDUH &KULVWRɫHU6DODQGHU 

)µUV£OMQLQJVFKHI -RDFKLP-RKDQVVRQ 

)µUV£OMQLQJVFKHI 2VNDU0HOOEHUJ 

)DOXQ =HWWHUJUHQVY£J 7HO

˜SSHWWLGHU 0¤Q)UH /µU 6µQ


AKTUELLT

dalarnas museum MARSVECKA 9. 6SRUWORYVDNWLYLWHWHUI|UVNROOHGLJD0nQGDJRQVGDJ ONSDAG 2 MARS µ0lUNOLJDYLNLQJDWLGDGUlNWVSlQQHQLGHQPHGHOWLGDNYLQQRGUlNWHQµ $UNHRORJ)UHGULN6DQGEHUJ .RQVWQlU0DULD%DFNPDQSUHVHQWHUDUµ0LJUHUDQGH0XVHXPHWW SURMHFWPHGIRNXVSnPXVHHWVRPRIIHQWOLJSODWVµ LÖRDAG 5 MARS 5HSULV.RPRFKYLUNDPRUPRUVUXWRU7DJlUQDPHGÀND, VDPDUEHWHPHG)DOX+HPVO|MGVI|UHQLQJ SÖNDAG 6 MARS )DPLOMHV|QGDJ9LYLUNDU )UnQnU

CLOSE UP RHAPSODY ,nUÀUDU5REHUW:HOOVnUVRP DUWLVW9DGSDVVDUGnElWWUHlQDWWWD PHGKHOD5KDSVRG\,Q5RFNFLUNXVHQ SnWXUQpLHWWFLUNXVWlOW'HWEOLU HQOnQJRFKULNVWlFNDQGHWXUQpLHWW WlOWVRPU\PPHUEHV|NDUH 0HGSUHPLlUL)DONHQEHUJGHQ VWDUWDU5REHUW:HOOVVLQIDQWDVWLVND VKRZRFKWXUQp5KDSVRG\,Q 5RFN²&ORVH8S*lVWDUWLVWHU lU/D*D\OLD)UD]LHU*HLU5|QQLQJ -|UJHQ0|UQElFN9RFDOHWWHVPHG ÁHUD²DOODXSSEDFNDGHDY5KDSVRG\ /RXQJH2UFKHVWUD%LOMHWWHU ZZZWLFQHWVHYLD $7*RFK7LFQHWRPEXG 6-ZZZVMVH XSSOHYHOVHUHOOHULQlUPDVWH6- 5HVHEXWLNVDPWKRVORNDODRPEXG VHSWHPEHUODQGDUWXUQpQL %RUOlQJHSn&LUNXVSODWVHQ ZZZQRMHWVH (OHFWULF%R\V

'HWQ\DnUHWUXOODUSnOLNDIRUWVRPYDQOLJWRFKVQDUWlUYnUHQKlUlYHQRP GHWNlQQVOnQJWWLOOGHVV3HDFH /RYHOLJJHUGRFNLQWHSnODWVLGDQ

ARRANGEMANG BANDSLÄPPSNYHETER 'HQMDQXDULVOlSSWHYLEODQGDQQDW+nNDQ+HOOVWU|P+RROD%DQGRROD%DQG /RRSWURRS5RFNHUV'RFWRU0LGQLJKWDQGWKH0HUF\&XOWRFK6lNHUW3nDOOD KMlUWDQVGDJKDGHYLYnUWWUDGLWLRQVHQOLJDVOlSSRFKNXQGHSUHVHQWHUD0LPLNU\ WLOOVRPPDUHQVIHVWLYDO7RWDOWKDUKHODEDQGVOlSSWVVHGDQVHQDVWHQXPUHW

TISDAG 8 MARS 0DOPRFKPHWDOOHUL)DOXQRFKLYlUOGHQ%HUJLQJHQM|U/HLI/|IEHUJ ONSDAG 9 MARS 8QGHUMRUGLVNDWH[WLOLHU$UNHRORJ(YD&DUOVVRQ 3LRQMlUHUVRPEHIRONDGH1RUUODQGRFK'DODUQDHIWHULVWLGHQ $UNHRORJHUQD+HOHQDRFK.MHO.QXWVVRQIUnQ8SSVDOD

PEACE & LOVE HAVANNA 3HDFH /RYHYLOOVSULGDVnP\FNHWIUHGRFKNlUOHNVRPP|MOLJWRFKHIWHU WLGLJDUHSURMHNWL&KLOH7H[DVRFK.LQDKDUQXWXUHQNRPPLWWLOO.XED $UUDQJHPDQJHWRUGQDVWLOOVDPPDQVPHGVNLYERODJHW1DWLRQDORFKlJHUUXP GHQPDUVXQGHUQDPQHW3HDFH /RYH+DYDQQDLKXYXGVWDGHQ+DYDQQD $UWLVWHUlUQnJUDDY.XEDVVW|UVWDDNWHUVDPWVYHQVNDDNWHUQD7LPEXNWX /RRSWURRS5RFNHUVRFK7KH%DERRQ6KRZ

LÖRDAG 12 MARS 0RGHOOWHFNQLQJ²NURNL SÖNDAG 13 MARS (QJOLPWDY$IULND7UDGLWLRQHUPXVLNVnQJRFKPDWNXOWXU

GARAGET AVESTA 9nUHQVNRQVHUWHUSn*DUDJHWL $YHVWDGUDUVWUD[LJnQJ IHEUXDULlUGHWSUHPLlUPHG (OHFWULF%R\V PDUV6WDFLH&ROOLQV DSULO7KH5HYHUHQG3H\WRQ·V%LJ 'DPQ%DQG DSULO2WLV*LEEV PDM5RIIH:LNVWU|P PDM7UHDGVWRQH KWWSEORJNXOWXUJDUDJHWVH

TISDAG 15 MARS .RQVHUWPHG%ULR7ULR-HQQ\2OVVRQ&KDUORWWH5LFKDUGVHQ,QJHEMRUJ .ORYKROW0XVLNDY:ROIUDP.RHWVLHURFK(ZD]HQ ONSDAG 16 MARS 6WLFNFDIpPHG)DOX+HPVO|MGVI|UHQLQJ 9lUOGVDUYVVWDGHQ)DOXQ$QWLNYDULH(ULN$UUKpQ )LOGU6XVDQQH+HOGW&DVVHO´.XOWXUWXULVPRFKPDOPEU\WQLQJVLGDYLG VLGDµ,VDPDUEHWHPHG)RONXQLYHUVLWHW ONSDAG 23 MARS 0LQDWLRnUSn'DODUQDVPXVHXP%LWUlGDQGHODQGVDQWLNYDULH$QQD %M|UNPDQ 1\DU|QRPHQJDPPDOJUXYDNULQJERNHQRP)DOX*UXYD0XVHLFKHI 'DQLHOV6YHQ2OVVRQKDUDYVOXWDWVLQWLGVRPPXVHLFKHISn*UXYPXVHHWPHG HWWERNSURMHNWNULQJJUXYDQ+DQNRPPHUXWLIUnQERNHQDWWEHUlWWDQ\DU|Q RPJUXYDQRFKQnJRWRPKXUGHWYDULWDWWDUEHWDL*UXYPXVHHW+DQVNDlYHQ JHIXQGHULQJDUSnKXUJUXYDQNDQXWYHFNODVLIUDPWLGHQ LÖRDAG 26 MARS 0RGHOOWHFNQLQJ²NURNL TISDAG 29 MARS .RQVHUWPHG0XVLNNRQVHUYDWRULHW ONSDAG 30 MARS µ(QGDOPnOQLQJRFKHQNRQVHUYDWRUWUlIIDVµ3DSSHUVNRQVHUYDWRU$QQ 2ODQGHU

SING- AND SONGWRITING COMPETITION FÖR UNGA 7LGDSULONO3ODWV/XGYLND -D]]NOXEESnUHVWDXUDQJ*DOOHULDQ 6LVWDDQPlOQLQJVGDJPDUV 9LQQDUHQInUHQKHPOLJVXPPD SHQJDU0HULQIRUPDWLRQKLWWDUGXSn ZZZOXGYLNDMD]]VH

%UXQR/LOMHIRUVL'HWYLOGDVULNH,VLQERN'HWYLOGDVULNHVNULYHU%UXQR /LOMHIRUV´(QPDQKDUXSSOHYWQnJRWKDQKDUVHWWQnJRWRFKKDQYLOOPHG ROMHIlUJHQVKMlOSInIUDPGHQYHUNOLJKHWVRPJULSLWKRQRPInIUDPNUDIWHQLGHW XSSOHYGDKDQKDUQnJRWDWWVlJDPlQQLVNRUQDRFKKDQI|UV|NHUNRPPDPHG GHW´I|UO|VDQGHRUGHWµVRPOlUIRONDWWVHµ ²2FKKDQKDUOlUWPLJDWWVHYHUNOLJHQVHVlJHU,QJHU/LOMHIRUVUHJLVV|URFK VNnGHVSHODUHVRPKlUJ|UHQSHUVRQOLJEHWUDNWHOVHNULQJQnJUDPnOQLQJDUDY %UXQR/LOMHIRUV TORSDAG 31 MARS /XQFKNRQVHUWPHG)DOX'DQVRFKPXVLNVNROD

)RWR-HDQHWWH$QGHUVVRQ TURNÉPREMIÄR MED MISS LI 31 MARS 0LVV/LLQOHGHUWXUQpSUHPLlUL%RUOlQJHGHQPDUV(IWHUHWWnUPHGIRNXV SnOnWVNULYDQGHVDPWÁLWLJWXWODQGVWXUQHUDQGHLEODQGDQQDW86$)UDQNULNH 7\VNODQGRFK%HOJLHQlU0LVV/LlQWOLJHQDNWXHOOPHGHWWQ\WWDOEXP0HGGHW Q\DDOEXPHWLQOHGHUKRQYnUWXUQpQGHQPDUVLVLQJDPODKHPVWDG%RUOlQJH 6HVLGDQI|UFKDQVDWWYLQQDELOMHWWHUWLOOVSHOQLQJHQ

PEACE & LOVE FOUNDATION ANTIVÅLDSTIPENDIUM 6YHQVNDVW|OGVN\GGVI|UHQLQJHQ66)GHODULVDPDUEHWHPHG3HDFH /RYHRFK (IWHUO\VWXWHWWDQWLYnOGVVWLSHQGLXPSnNURQRUXQGHU3HDFH /RYH IHVWLYDOHQL%RUOlQJHLVRPPDU6WLSHQGLHWJnUWLOOGHQJ\PQDVLHNODVVL6YHULJH VRPNRPPHUSnGHQElVWDLGpQI|UHQNDPSDQMVRPVNDI|UHE\JJDYnOGPHOODQ XQJD3ULVHWGHODVXWDY(IWHUO\VWVSURJUDPOHGDUH+DVVH$UR PEACE & LOVE I SKOLAN 6HGDQQnJUDYHFNRUWLOOEDNDKDU3HDFH /RYH)RXQGDWLRQVWDUWDWHWW VNROFRDFKSURMHNWLHQIMlUGHNODVVLnUVNXUVLHWWVDPDUEHWHPHG7MlUQDVNRODQ $QOHGQLQJHQlUDWWPnQJDHOHYHUEHK|YHUH[WUDVW|GRFKFRDFKQLQJLVNRODQ I|UDWWInHQEUDJUXQGLVDPKlOOHW 6NROFRDFKHUQDlUGHI|UVWD3HDFH /RYH)RXQGDWLRQDPEDVVDG|UHUQDVRP JHQRPJnWWNXUVHQ9lUOGVELOGHURFKLQWHUQDWLRQHOODUHODWLRQHUSn+|JVNRODQ 'DODUQD+|JVNROHNXUVHQKDUWDJLWVIUDPLVDPDUEHWHPHG3HDFH /RYH )RXQGDWLRQRFK+|JVNRODQ'DODUQD BLOGGANDE VOLONTÄRER )|UUDnUHWVNLFNDGHYLXWWYnYRORQWlUHUWLOO6\GDPHULNDRFK$IULNDRFKGHW KlUnUHWKDU3HDFH /RYH)RXQGDWLRQVMlOYNODUWVNLFNDWXWWYnQ\DIDQWDVWLVND YRORQWlUHU7LQQLFHDUEHWHSnIULWLGVFHQWUHWL%ROLYLDVDPW$QQDVDUEHWHI|U PlQVNOLJDUlWWLJKHWHUL*KDQD)|OMGHUDVDUEHWHRFKWDQNDUSn3HDFH /RYH )RXQGDWLRQVKHPVLGDZZZSHDFHDQGORYHIRXQGDWLRQQX

ÖVRIGT PEACE & LOVE SÖKER PERFORMANCE! 9LV|NHUDUWLVWHUVRPV\VVODUPHGSHUIRUPDQFHWLOOVRPPDUHQVIHVWLYDObUGX VMlOYVXJHQHOOHUNlQQHUGXWLOOQnJRWVRPVNXOOHSDVVDVRPSHUIRUPDQFHDNW" 0DLODGnWLOOLQIR#SHDFHDQGORYHQX

ZZZGDODUQDVPXVHXPVH

67,*$5(*)$/81/g50c17,6)5( 216'$*$5g33(77,//




11/3 Abba temakväll 16/3 200kvadrat tält byggs för 3 veckors maxat nöje. 17-19/3Svenska skid spelen med live uppträdande varje dag. Missa inte detta! 25/3 Dj Roderio Lopez 26/3 Dj Rogerio Lopez Nyhet! Söndags brunch varje saöndag mellan 12-16.

Öppet tider:

Lunch: Måndag-Fredag 11.00- 14.00 Restaurang/Lounge/Club: Onsdag 14.00-02.00 Torsdag 14.00-22.oo Fredag, Lördag 14.00-02.00 Söndag 12.00-22.00

www.Victuscella.se


VIMMEL

magasinet i falun 2011•02•05

5DGLRNDQDOHQ%DQGLW5RFNN|UGHHQKHMGXQGUDGHIHVWPHGEODQGDQQDW-RKQRVVLSnVFHQHQ)RWR$QGUHDV$QGHUVVRQ

etage I falun 2010•02•12

1ROOWYnVHJQDNU|QLN|U/LQQ/|ZHVYDUHQDYWMHMHUQDVRPDQRUGQDGH'DODUQDVHJQDEORJJIHVW 9LYDUVnNODUWGlURFKWLWWDGHWLOOSDUW\W)RWR$QGUHDV$QGHUVVRQ

NYFIKEN PÅ FLER VIMMELBILDER? KLICKA DIG HIT...

WWW.NOLLTVA.SE




g331,1*6(5%-8'$1'( 6(/(&7('67</(+$5b17/,*(16/$*,7833'g55$51$7,//(11<%87,. 3c6/$**$7$1,)$/81 .8&.(/,.$1$6)'/2.$/  9b/.200(1$77),5$5g331,1*(10('266 ),1$g331,1*6(5%-8'$1'(1)(%58$5,0c1$'87

%87,.(1b5)<//'0('1<+(7(5)5c1 (67(5(/(125$Â&#x2021;6$,177523(= -803(5)$%5,.(1Â&#x2021;&8/785(Â&#x2021;02152: 0(/0(//,Â&#x2021;69($Â&#x2021;'5'(1,00)/

$-/$-. %/21' %,-28;%<86 &$5,1:(67(5 &2&26 &8/785( '5'(1,0

(67(5(/(125$ ,'$6-g67('7 *$11, +817(5 +80$1,7< -2+$11$1 -803(5)$%5,.(1

/$'<628/ /,36< /,6(6$1'$+/ 0%<0 0(/0(//, 0,1,080 02'675g0

02152: 5870)/ 6$,177523(= 6(6681 61($.<)2; 69($ 6:(',6++$6%((16

6(/(&7('67</(

Bragegallerian, Borlänge 0243-828 02 och Slaggatan, Falun 023-132 30

ZZZVHOHFWHGVW\OHFRP


BARCELONA

Bar cel ona

Vi har sniffat runt stan som en pyrenesisk fårhund.

8I\X JSXS(ERMIP+VE]

DET ÄR MIN FÖRSTA KVÄLLL5DYDORFKGHWlUVWU|PDYEURWW,NRQWUDVWWLOOGHQ VWHDULQOMXVI|UVHGGDNDPSHQPRWP|UNUHWXQGHUHWWK|VWNYlOOVDYEURWWL6YHULJHVnlUGHWKlU RPUnGHWJDQVNDDYVODSSQDWLQI|USUREOHPHW5XWQlWHWDYP|UNDJUlQGHUI|UEOLUP|UNDVWlPQLQJHQ IRUWVlWWHUVOlSSDXWVLQVWDWLVNDHQHUJLKRURUQDIRUWVlWWHUKXVWODRFKI|UXWRPSnGHQYDQOLJWYLV K\IVDWXSSO\VWD5DPEODGHO5DYDORFKGHVVSURPLQHQWDLQYnQDUH´*DW%RWHURµVnNDQPDQLQWH XUVNLOMDQnJRQVlUVNLOGVNLOOQDGLDWPRVIlULVWDGHQVPHVWQDWXUOLJDQDWWOLJDGHVWLQDWLRQ I LÄGENHETEN VI BEFINNERRVVlUYLERUWVNlPGDPHGP|MOLJKHWHU.QDUNYLVDUVLJWLOOJlQJOLJW SnG|UUNQDFNQLQJVODVKKHPI|UVlOMQLQJVEDVLV0DQNDQVWLFNDKXYXGHWXUI|QVWUHWRFKYLVVODXSSHWW Q\LPPLJUHUDWIQDVNLIDOOPDQEHK|YHUKMlOSPHGDWWlWDXSSVLQWDNHDZD\ZRN 6QDFNDUPDQPHGUlWWNDQDGLFNQHUHSnJDWDQNDQPDQVYHSDDEVLQWKHlQGDWLOOJU\QLQJHQ3OXV DWWGHWPRWKXQJHUQÀQQVHQJDQVNDVZHHWLQGLHUSnDQGUDVLGDQWRUJHWVRPDOGULJYHUNDVWlQJD 0DQNDQOXJQWSnVWnDWWYLEHÀQQHURVVYLGVPXWVHQVHSLFHQWUXPYLGVWRUPHQV|JDLGHQPRGHUQD PHWURSROHQVEDNVLGDRFKGlUI|UYLONHWlUIDOOHWLGHÁHVWDHXURSHLVNDVWlGHUYLGVMlOYDNlUQDQDY VWDGHQVDOWHUQDWLYDNXOWXUOLY ELEKTRICITETEN KOMMER TILLBAKA. *O|GODPSRUQDVOnVSnLJHQ/RNDOLQYnQDUQDKlQJHU LJlQJPXWWUDUKlQJHUOLWHPHURFKIRUWVlWWHUPXWWUDVHNXQGHUVHQDUHI|UVYLQQHUDOOWOMXV

nWHULJHQ(WWLURQLVNWMXEHOEULQQHUDY6DNHURFK WLQJE|UMDUEOLOLWH5HF VSDQVNVNUlFNÀOP  5DYDOEHÀQQHUVLJLVLWWQDWXUOLJDWLOOVWnQG KÄNSLAN AV FARAQnUHQK|JVSlQQLQJ VQLYnQlUPDQJnURPNULQJLGHWPXPODQGH P|UNUHWRFKVRPPHGDOODQ|MHVSDUNVNDUX VHOOHUKnOOHUGXEDUDKlQGHUQDSnUlFNHWlU GXK\IVDWVlNHU0HQlQGnVnOlQJHGXLQWHlU QnJRQVODJVGURJHOOHUVH[WXULVWVnNDQVNHGX VNDEHJUlQVDGLWWNULQJVWU|YDQGHL5DYDOWLOO GDJWLG 'XNRPPHUVQDEEWNXQQDVlUVNLOMDGHWUH NDWHJRULHUDY%DUFHORQLQVVRPÀQQVRFKLQJHQ DYGHPI|UÁ\WWDUVLJLHQVDPKHW'HWlUSRMNDU PHGV|WDÁLFNRUÁLFNRUPHGV|WDSRMNDU SRMNDUHOOHUÁLFNRUPHGV|WDKXQGDURFKVn GnJlQJPHGSRMNDUVRPLQWHlUVSHFLHOOWV|WD

DOOV7LOORFKPHGXQGHUGDJWLGlUJUlQGHUQD YDWWNRSSVXWÁlFNDGHPHGVPnJUXSSHUDY ELVWUDRFKEHVYLNQDPlQVRPVYlURFKVSRWWDU PRWI|UELSDVVHUDQGH'HWlUVRPDWWKHOD WLGHQI|UV|NDWUlQJDVLJIUDPI|UEL´%ULFNHUV .LFNHUVµ MITT I ETT, I|UPLWWRWUlQDGH|JDJDQVND EUXWDOWKDIIDQGHRFKJHQRPV|NQLQJDYHQQRUG DIULNDQVÀFNRUVDPODUMDJHQRUPWPRGRFK QlUPDUPLJ'MDPLOVRPVWnURFKU|NHURFK VSRWWDUXWDQI|UHWWEDNJDWVEDJHUL HWWEDJHUL PHGLQWHPLQGUHHQWUH-DFN9HJDVOLNQDQGH VSHOPDVNLQHULVLQPlUNOLJDRFKKRSWUlQJGD LQWHUL|U 

>>>

Barcelona–Deportivo fr. 2.995:–/person

FC Barcelona–Deportivo La Coruña, Camp Nou, 15 maj 2011. I priset ingår matchbiljett, tre nätter på 3-stjärnigt centralt hotell (del i dblrum). Flyg tillkommer. Med res. för prisändringar samt slutförs.

Stora Torget, Falun 023-934 34 Vardag 9–18, lördag 10–14 www.resia.se/falun




BARCELONA ²+HM'MDPLO9DGlUGHWGHWDUIUnQGHQGlUNLOOHQ" ²'HWlUEDUDVNLW+DQVlOMHULQJHQWLQJ ²9DUI|UMXVWKRQRP"$OODKlURPNULQJVlOMHUMXQnJRW ²+DQlUQ\$OODQ\DInUSUREOHPPHGSROLVHQ ²6nGHYLVDUEDUDYHPVRPEHVWlPPHU")nUGXRFKGLQDSRODUHRFNVn SUREOHP" 'MDPLOVHUEHVW|UWXW ²-DJVlOMHULQJHQWLQJ9LVlOMHULQWHQnWVNLW9LMREEDUKlULQQH KDQSHNDUSn EDJHULHWPLQLNDVLQRW I|UKRQRP KDQSHNDUSnJUXSSHQVlOGVWDGHOWDJDUH  ²0HQQLlUKlUIDVWEDJHULHWlUVWlQJW-DJWURGGHQLYDUHWWJlQJ²YDUI|UJnU QLLQWHWLOOQnQEDUHOOHUVn" ²9DGJ|UGXPHGGLQDYlQQHU"*DWDQlURNI|URVV

SÅ NÄRA EUROPA ATT MAN ÄVEN EN DIMMIG DAG SER TILL SPANIEN OCH GIBRALTAR.

JAG GÖR EN GESTPRWHQQnJRWUREXVWRFKGRPLQHUDQGHJUXSS SURVWLWXHUDGHVRPYLVHGDQYLDQOlQGHLRPUnGHWJHQDVW|URQPlUNWHVRP OHMRQNXQJHQEODQGGHROLNDOXGHUJUXSSHUQD ²*DWDQYHUNDUYDUDRNI|UGHPRFNVn+DUQLQnJRWPHGGHPDWWJ|UD" ²'HÀQQVGlUI|UGLJI|UHQJHOVPlQ2PYLYLOOEHWDODVnYHWYLElWWUHVWlOOHQ DJAMIL OCH HANS GELIKARlUVRP|YHUYl[WDWRQnULQJDU²RFKGXlU VlNHUWLVlNUDUHI|UYDUQlUGXVWU|YDUJHQRP5DYDOlQLYDOIULI|URUW1nJUD VRPLEODQGWHUVLJOLNDVNUlFNLQMDJDQGHlUGHVRPlUXWHRFKJnUPHGVLQD KXQGDU'HWlUHQDQQRUOXQGDV\PELRVPHOODQKXQGRFKKXVVHL%DUFHORQD *HQRPKHODYHFNDQYLlUGlUVnlUDOODKXQGDUWRWDOWVWU|POLQMHIRUPDGHRFK GHVVlJDUHlUVRPWDJQDXUHQVnQGlUEDUQERNPDQGU|PGHPDUGU|PPDUDY QlUPDQYDUOLWHQ VI HAR PARKERAT OSS YLGHQOLWHQVN\GGDGYLNDY3DUF*XHOOQlU'DYHHQ PHGHOnOGHUVPDQPHGELEOLRWHNDULVNWXWVHHQGHI|UI|UVWDJnQJHQNRPPHUWLOO YnUNlQQHGRP+DQGUDVI|UELRVVDYHQJLJDQWLVNKXQGYDUVQDPQYLLQWHNDQ XWWDOD ²+DQlUHQS\UHQHVLVNInUKXQGI|UNODUDU'DYHPHGQDVDOU|VWRFK NDQDGHQVLVNGLDOHNW'DYHYLVDUVLJYDUDGMSnHQUDGLRVWDWLRQRFKlYHQRP KDQVU|VWlUI|JDDWWUDKHUDQGHVnlUKDQVO|IWHRPVNRWVNIRONSRSRFKMDSDQVN LQGLHJDQVNDORFNDQGH ²bUKDQWYnVSUnNLJIUnJDU$JQHV ²9LVVWKDQlUWUlQDGEnGHSnNDWDODQVNDRFKHQJHOVND ²+DQVHUOLWHPDJLVNXWQlVWDQVRPRPKDQLQWHYDUSnULNWLJWSnSHNDU %HQMDPLQ+DQKDUHQSRlQJKXQGHQKDUHQOHMRQPDQRFKlUVNUlPPDQGHQRJ VnGlUSRNHPRQVNWSHUIHNW-DJEOLUOLWHUlGG ²+DQNDQIDNWLVNWJ|UDHQGHOPDJLVNDWULFNV VI BER OM BEVIS. 'DYHWDUVNUDPODQGHXWVLQDQ\FNODUXUÀFNDQRFK SODFHUDUGHPYDUVDPWSn*XDGLVXWPHMVODGHVWHQEURµ6HSnGHWKlUµ+DQ K|MHUVLQD|JRQEU\QNRQVSLUDWRULVNW+DQJHUHWWNRPPDQGRWLOOVLQSUDNWIXOOD KXQGRFKNDQVNHSnJUXQGDY3DUF*XHOOVI|UnOGUDGHOXIWRFKGHQJULSDQGH HIIHNWIXOOKHWHQLGHWNDWDODQVNDSDQRUDPDWHOOHUNDQVNHSnJUXQGDYDQGUD IDNWRUHUVnWURUMDJDWWYLDOODI|UYlQWDGHDWWQ\FNODUQDVNXOOHJnXSSLU|N HOOHUnWPLQVWRQHDWWInUKXQGHQVNXOOHInGHPDWWH[SORGHUDLHQVWRUHOGEROO ,VWlOOHWInQJDUKDQGHPOLWHNOXPSLJWPHGVLQDKXJJWlQGHURFKOlJJHUGHPL 'DYHVXWVWUlFNWDKDQG9DGGHWYDUVRPYDUPDJLVNW".DQVNHDWW'DYHNXQGH VlJDµKlPWDµSnNDWDODQVND9LEU\GGHRVVLDOODIDOOLQWHRPDWWK|UDKDQV UDGLRVKRZ DAVES BIROLLL3DUF*XHOOI|OMVRPHGHOEDUWDYHWWV|WWSDU'HQWUHGMH NDWHJRULQIRONL%DUFHORQDYLEHVNUHYWLGLJDUH'LPLWULRFK&DSSDKDU NRPPLWKLWIUnQ0RVNYD'LPLWULlUKlUI|UDWWJnSn6RQDURFK&DSSDI|U DWWJnSn3ULPDYHUDVWDGHQVWYnVWRUDPXVLNIHVWLYDOHUXQGHUVRPPDUHQ 9LlUKlUI|U3ULPDYHUD PHQHIWHUDWW'LPLWULPHGVLQEUXWQDHQJHOVND UDEEODUXSSDUWLVWHUQDSn6RQDUK|MGSXQNWHQSnGHQHOHNWURQLVNDPXVLNHQV NDOHQGHUHUEMXGHUYLKRQRPDWWE\WDELOMHWWHU 9LI|UV|NHUInKRQRPDWW I|UVWnVNLOOQDGHQPHOODQµ%HDFK+RXVHµRFKµ3HDFKHVµI|UKRQRPOnWHU GHWH[DNWOLNDGDQW0HGDQ&DSSDInUPLQDNDPUDWHUDWWVYLPPDPHGKHQQHV HQF\NORSHGLVNDNXQVNDSRP3LWFKIRUNLQGLHVnVNU\WHU'LPLWULRPVLWW GXEVWHSI|UVWnQG-DJIUnJDUKRQRPLIDOOKDQIXQQLWQnJRWWUHYOLJWVWlOOHVRP VSHODUPXVLNPHGP\FNHWEDVL%DUFHORQDRFKKDQQlPQHUHQNOXEENYlOO Sn5D]]PDWD]] DODUPNORFNRUULQJHUVnVQDUWKDQQlPQHUVWDGHQV|NlQGD µVXSHUNOXEEµRFKHQVHQDUHXQGHUV|NQLQJYLVDUDWWNYlOOHQKDQQlPQWlU OLNDWUnNLJVRPGHDQGUD5D]]EHJLYHQKHWHUQD )|UXWRP6RQDUYHUNDUVWDGHQV HOHNWURQLVNDPXVLNVFHQOLJJDLHWWGMXSWVRYDQGHLGH (QDUPDY5DYDOVODE\ULQWKYDUVQDPQMDJDOGULJULNWLJWKDGHI|UVWnQGSn DWWOlJJDSnPLQQHW PHQRPGXJnUXWJHQRPVLGRG|UUHQSn/D&HQWUDO VWDGHQVElVWDERNKDQGHOVnlUGXGlU lUKHPPDSODQWLOOHQHQGDNRPPHUVLHOO YHUNVDPKHW(WWJDPPDOWJDUDJHVRPWUDQVIRUPHUDWVWLOOHQWHFKQRKRXVHRFK GXEVWHSVNLYDIIlU'HWlUHJHQWOLJHQVLHVWDWLGI|UGHÁHVWDVSDQMRUHUPHQLQQH LEXWLNHQVnInULQQHKDYDUHQRFKKDQVYLQ\ONRPSLVORNDOHQDWWYLEUHUDPHG VNLYVSHODUQD JAG BLÄDDRAREODQGVNLYRUQDWLOOVGHPL[DULQHQOnW MDJWURUDWW MDJ NlQQHULJHQRFKMDJVHUPLQFKDQVDWWNRQYHUVHUDPHGGHP ²'HWKlUlUOnWnWWDIUnQGHWGlUREVN\UDVNLYERODJHWVDQGUDVNLYDIUnQ IDVWKDQDQYlQG HUHQQ\SVHXGRQ\P+DQVRPKDUEXWLNHQWLWWDUSnPLJVRPRPMDJNOLYLWUDNW LQLWDOHWRFKWURWWDWW%XLOG0H8S%XWWHUFXSYDU%HDWOHV+DQI|UV|ND lQGnYDUDOLWHHQWXVLDVWLVN ²1LKDUP\FNHWHQJHOVNDRFKDPHULNDQVNDVNLYRUKlU+DUQLQnJRQVHNWLRQ I|U%DUFHODQVNPXVLN" ²9LKDUOLWHIUnQQnJUDVPnVNLYERODJKlU0HQGHWÀQQVQRJOLNDP\FNHWIUnQ 6YHULJH+DQWDUXSSHQWROYDIUnQHWW6WRFNKROPVEDVHUDWVNLYERODJVRPEHYLV ²*HULQWHHQIHVWLYDOVRP6RQDU%DUFHORQDVHOHNWURQLVNDPXVLNVFHQHQ H[WUHPWVWLPXOHUDQGHHIIHNW" ²3UREOHPHWlUDWWGDQVPXVLNHQKlUIRUWIDUDQGHlUVRPSn,EL]D'HWlU IRUWIDUDQGHµVXSHUNOXEEDUµ6WlOOHQDERNDUEDUDVWRUDGMV9lUGHO|VDGMV'HW ÀQQVI|UP\FNHWSHQJDUDWWI|UORUD ²6nYDUWJnUMDJQlUMDJYLOOK|UD$UPDQG9DQ+HOGHQ" ²0HQGHWÀQQVDOOWLGSDUW\VPHGEUDGMV3URGXFHQWHUlULQWHVSHFLHOOWEUDKlU PHQGMVlUIDNWLVNWGHW'XEHK|YHUEDUDYHWDYDUWGXVNDJnIDVWVOnUKDQYDUSn KDQJHUPLJQnJUDLQYHFNODGHYlJEHVNULYQLQJDUWLOOHQIHVWLHQRPE\JJGODJHU ORNDOLHQI|URUWVHQDUHVDPPDNYlOO+DQDYVOXWDUPHGGHQORYDQGHOHGWUnGHQ DWWMDJµLQWHVNDNRPPDLQQDQNORFNDQI\UDµ-DJYlOMHUDWWLQWHI|OMDXSSKDQV KMlOSVDPPDLQEMXGDQ MÄRKER NI ATTLPLQSVHXGRVRFLDODJXLGHWLOOGHQNDWDODQVNDKXYXGVWDGHQ VnlUQlVWDQLQJHQDYPLQDQ\DYlQQHUI|GGDRFKXSSYl[WDLRPUnGHW6QDUDUH lQDWWIUlPOLQJDUDWWUDKHUDUYDUDQGUDVVlOOVNDSVnNDQGHWQnODVIDVWVRP EHURHQGHDY%DUFHORQDVNRVPRSROLWLVNDVDPPDQVlWWQLQJ²YLONHW|SSQDUXSS WLOOHWWUHVRQHPDQJRPYDGGHWULNWLJD%DUFHORQDHJHQWOLJHQlUI|UQnJRW ,HQDUWLNHOLHQJHOVND7KH2EVHUYHUEHUlWWDGHGHHQKLVWRULDRPHQWULR JUDIÀWLNRQVWQlUHUVRPKDUYLVVODWUXQWEODQGVWDGHQVLQQHVWlOOHQRFKWlFNW




BARCELONA GHPPHGDQWLWXULVWVORJDQV²GHQ KXYXGVDNOLJDSRlQJHQlUW\GOLJHQDWW NRPPXQHQYlQGHUVLJWLOOHQVSHFLHOO W\SDYWXULVWRFKIUlWHUV|QGHU NlUQDQDYVWDGHQVNXOWXULGHQ SURFHVVHQ0HQYDGVRPlUYLNWLJDVW KlUlUEXGElUDUHQVQDUDUHlQ EXGVNDSHW²WYnDYGHWUHlUIDNWLVNW UHODWLYWQ\LQÁ\WWDGHIUnQ3DULV'HWlU JDQVNDDQPlUNQLQJVYlUWDWWGHHIWHU I\UDIHPnULVWDGHQNlQQHUVnQW GHOlJDUVNDSYLONHWMDJlYHQPlUNHU IUnQGHPMDJP|WHU,QWHJUDWLRQHQ JnUVQDEEWRFKLQLWLDWLRQVSURYHW YHUNDUHQGDVWYDUDEDVHUDWSnDWWLW\G lUGX%DUFHORQDQRJDWWYDUDKlU" NÄR JAG ÅKT DÄRIFRÅNIUnJDGH MDJHQEHNDQW$QXVLDVRPWLGLJDUH YDUHQDY%DUFHORQDVDOODLQÁ\WWDGH RPKHQQHVWLGGlU ²'HWYHUNDULDOODIDOOVRPGHWlU XQJHIlUOLNDPnQJDLQÁ\WWDGHVRP µULNWLJDµORNDOLQYnQDUH%DUFHORQD DWWUDKHUDUHQVSHFLHOOWW\SDY PlQQLVNRUJHQHUHOOWlUGHYlOGLJW ODLGEDFNRFKlOVNDUDWWKDNXODOOD GHJRGDHJHQVNDSHUGXRFNVnÀQQHU LORNDOLQYnQDUQD'HVHUYlOGLJW EUDXWRFKHQSURPHQDGUXQWVWDQ lUHQIHVWI|U|JRQHQ8QGHUPLQ I|UVWDWLGL%DUFHORQDÀFNMDJHQ XWVNlOOQLQJDYHQJDPPDOGDPI|U DWWMDJSUDWDGHVSDQVNDLVWlOOHWI|U NDWDODQVND0HQLGHWVWRUDKHODlU IRONYlOGLJWWLOOP|WHVJnHQGHRFKMDJ WURUDWWUHJHOQlUDWWPDQVNDJ|UD HWWI|UV|NPHGHQRFKDQQDQJORVD LEnGHNDWDODQVNDRFKVSDQVNDVnlU PDQKHOWRN ATT KRITISERA BARCELONAI|U DWWGHWLOOnWHUWLRGXVVLQ WVKLUWEXWLNHUI|UWXULVWHURFKQlVWDQ OLNDPnQJDKDOYULVLJDWDSDVEDUHU OlQJVPHGGHQ|NlQWVQXVNLJD /D5DPEODlUOLNDOlWWVRPO|MOLJW *RGDEHV|NDUHVHUWLOODWWKDJRGD EHV|NRFKDWWJUlYDXWVLQHJHQ QLFKHYLGVLGDQDYGHJOREDOLVHUDGH JDWRUQDLFHQWUDOD%DUFHORQDlUOlWW 6KRSSLQJVXJQDNDQI|UV|NDKLWWD /H6ZLQJ &DOOHGHO'RFWRU'RX  KXQJULJDVNDÀQQD%LRFHQWHU 3LQWRU)RUWXQ\ NRQVWIDQVKLWWDU LQVSLUHUDQGHPRGHUQDYHUNSn $QJHOV%DUFHORQD &3LQWRU)RUWXQ\  RFK$'1*DOHULD &(QULF *UDQDGRV 6NHMWDUHVNDGHÀQLWLYW WLOOGHWPRGHUQDNRQVWPXVHHW 0$&%$3ODFD­QJHOV GXKLWWDU GHQVMXNDVWHVDPOLQJE|FNHUVWRUD VRPVPnRFKJUDÀVNDRFKOLWHI|U JUDÀVNDSnGHQWLGLJDUHQlPQGD/D &HQWUDO ÁHUDROLNDDGUHVVHUÀQQHU GXSnZZZODFHQWUDOFRP RFK VNlJJLJDW\SHUNDQJHVLJKlQnWVLQ IRONPXVLNVOXVWDPHGHQJRG|OSn EDUHQ9LQLO R  &0DWLOGH 9LNDY IUnQGHQLQULWDGHUXWWHQSUDWDPHG PlQQLVNRUPHGIlUJSnKlQGHUQD HOOHUPRMLWRVSnOlSSDUQDRFKGX NRPPHUHQNHOWKDPQDQnJRQVWDQV YlUWDWWPLQQDV'HWlUEDUDVnGHWlU

Gatukonsten 0\QGLJKHWHUQDVQHGVODJPRWXW|YDQ GHWRFKGHQJDQVNDXSSVYlOOGD PDUNQDGHQDYJUDIÀWLNRQVWQlUHUVRP VlOMHUVLQDSULQWVI|UXWSUHVVDUSULVHU LVWDGHQVJDOOHULRUKDUQHGJUDGHUDW %DUFHORQDVHQJnQJVnYLEUHUDQGH JDWXNRQVWNXOWXUbQGRFNlUGH ÁHVWDXUEDQDYlJJDUQDVPHWDGH PHGVSUD\IlUJRFKGHWGXVVLQWDOHW ULYQLQJVRPUnGHQUXQWRPLVWDGHQ IXQJHUDUVRPJUDIÀWLPDJQHWHU5LSR lUI|GGDPHULNDQERVDWWL%DUFHORQD RFKHQDYVWDGHQVÀQDVWHEHWRQJXW VP\FNDUH  

BESKRIV DIN PERSONLIGA RELATION TILL STADEN BARCELONA. ²-DJKDUYDULWKlULXQJHIlUVMXnU RFKYLÁ\WWDGHVDPPDQSnULNWLJWI|U IHPnUVHGDQ+RQNDQYDUDMREELJ LEODQGPHQKRQYHWYHUNOLJHQKXU PDQKDUNXO GRAFFITKONSTNÄRER FUNGERAR SOM SOCIALA KRITIKER – VAD I ELLER MED STADEN GÖR DIG MISSNÖJD OCH VILKA PROBLEM TAR DU STÄLLNING TILL I DIN KONST? ²*HQWULÀNDWLRQlUDOOWLGEUD

BARCELONAS GATUKONST ANSES SOM BLAND DE BÄSTA I VÄRLDEN – VILKA ÄR STADENS BÄSTA AMBASSADÖRER? ²%DUFHORQDVJDWXNRQVW9$5ElVW LYlUOGHQ0HQGHWKDUlQGUDWVLJ VHGDQ-DJNRPPHURWYLYHODN WLJWDWWXWHOlPQDRFKJO|PPDQnJUD QDPQQXPHQQnJUDDYGHPVRPJ|U GHWEUDLVWDQLGDJlU$U\]*ULWR 6PDVK.HQRU6SDQN).RFK<HVN

OCH HUR ÄR DEN RÅDANDE KULTURSCENEN GENERELLT I BARCELONA ENLIGT DIG? ²'HWOnWHUÀQWLWHRULQPHQYHP KDUUnGWLOOGHW" VAR FINNS DITT FAVORITVERK BLAND STADENS GATUKONST? ²'HWlQGUDUVLJKHODWLGHQ

ÄR MYNDIGHETERNA TOLERANTA ÖVER FÖR VAD DU SYSSLAR MED? ²$EVROXWLQWHDOOV

7"$$*/"5*0/4.055"(/*/('e3)&-"%"-"3/" #FIPWFUBWWBDDJOBUJPOFSJOGzSSFTPS LBOWBSBWjMEJHUWBSJFSBOEFCFSPFOEF QlSFTNlMPDIMjOHEQlWJTUFMTFO 3JOHGzSSlEHJWOJOHPDIUJECPLOJOH 7a3%$ 7*)"3`7&/ &/53"-`,"3 4FjWFOzWFSEJUUHSVOETLZEEPDI )64&5 -*45"% *(%60 $ ,4aÞ XXXN WBSVUFJHPEUJEÞ JOBWBSE

ˆ:EGGMREXMSRIVJ}VVIWSVKVYRHWO]HHQQ ˆ-RX]K ˆ/SRHMXMSRWXIWXIVQIH)/+ ˆ,mPWSYRHIVW}ORMRKEV

LPOUBLU FSTF

7jMLPNOBUJMM-jLBSIVTFUÞ(ZMMFIFNTWjHFO#PSMjOHF…XXXMBLBSIVTFOTF…"MMUJETCFTUjMMOJOHTLFSQl




EN TIMMES SKIDÅKNING MED Klockan är prick nio och fyra tjejer ler mot solen medan de väntar in varandra vid Lommens lift. Det är lattemammorna som gör sig redo för latteturen, en helig timmes samvaro med ”vuxen” skidåkning och kaffe latte. Stämningen är uppsluppen och de pratar och skrattar i munnen på varandra. Temat är oftast detsamma – kaoset i stugan.

SKUM PÅ TOPPEN

– Det är helt underbart att bara kunna resa sig från frukostbordet och sticka iväg en stund med de andra mammorna, säger Jessika Petersson från Marstrand. De andra mammorna håller ivrigt med och en efter en beskriver de morgonens fadäser, medan de andra bubblar av skratt. IDÉN ÄR LIKA ENKEL SOM GENIAL

Ett gäng familjer synkar sina semestrar för att sammanstråla i Kläppen en vecka varje vinter. Varannan dag träffas mammorna klockan nio för en timmes skidåkning och varannan dag träffas papporna. Skidåkningen rundas av med en kaffe latte i Toppstugan, innan de återvänder till sina familjer. – Det är inte så lätt att få tid för egen skidåkning när man har småbarn, det blir mest att hänga i barnbacken. Att få en stund med de andra mammorna på morgonen är guld värt, säger Lotta Renström från Borås och sätter skidglasögonen på plats.

FAVORITBACKARNA FÖR DAGEN – Det finns ju backar åt alla håll här, men jag gillar de snälla backarna bäst. Framför allt på morgonkvisten är de härligt krispiga och det blir mysig carving, säger Jessika Svensson, även hon från Marstrand. Sara från Kungälv har åkt mycket skidor genom åren, även om det varit sparsamt på sistone. – Det är min första gång i Kläppen och min favoritbacke blev direkt Trollfallet. Jag gillar när det brantar till sig så att man får jobba lite, säger hon och far iväg. De andra tar rygg på henne, fast i olika tempon. KRAVLÖST UMGÄNGE

Det märks att de trivs tillsammans. Umgänget är kravlöst, man hänger med på latteturen om man vill. De tar stolliften upp en sista gång tillsammans och Lotta utbrister med sin härliga Boråsdialekt: – Nu är det dags för latte, tjejer! De andra är genast med på noterna och stojande försvinner de in i Toppstugan och sjunker nöjda ner i var sin fåtölj vid brasan.

LATTEMAMMOR Lotta Renström, Jessika Petersson, Jessika Svensson och Sara Hellder njuter av dagens latte.

klappen.se


Alexander De La Torre & Felix Mobärg 7(;75REHUW*XVWDIVVRQ )272'DQLHO5|QQElFNRFK)HOL[0RElUJ

Två svenska killar som studerar på snowboardgymnasiet i Malung där de kombinerar sina studier med sin stora passion i livet; snowboardåkning.

cNDUH$OH[ GYMNASIET I MALUNG KDU JHQRPnUHQSURGXFHUDWPnQJD LQWHUQDWLRQHOODVQRZERDUGnNDUH EODQGDQQDW,QJPDU%DFNPDQ-RKDQ 2ORIVVRQ0DJQXV6WHUQHU+DPSXV 0RVHVVRQ6LPRQ$[RFK&KULV 6|UPDQ )HOL[RFK$OH[DQGHUI|UV|NHUQX JHQRPKnUWDUEHWHRFKGHGLNDWLRQ WLOOVSRUWHQXWYHFNODEnGHVLJVMlOYD RFKVLQnNQLQJSn6YHULJHVIUlPVWD SODWVHURPPDQYLOOULNWLJWEUDSn VQRZERDUG0DOXQJVVQRZERDUG J\PQDVLXPRFK.OlSSHQ6QRZSDUN 9LSDVVDGHSnDWWVWlOODQnJUD IUnJRUWLOO)HOL[RFK$OH[PLWWXQGHU EULQQDQGHVlVRQJ HUR KOMMER DET SIG ATT NI BÖRJADE ÅKA SNOWBOARD? )HOL[(QNRPSLVIDUVDW\FNWHDWWMDJ VNXOOHE|UMDnNDVQRZERDUGLVWlOOHW I|UVNLGRUYLGHQUHVDWLOODOSHUQD RFKMDJKDULQWHU|UWVNLGRUQDVHQ GHVV $OH[6nJQnJUDNLOODUL-lUIlOODV EDFNHL6WRFNKROPVRPnNWH VQRZERDUG'HWVnJNXOXWVnMDJ EHVOXWDGHPLJI|UDWWWHVWD VAD ÄR DET SOM GÖR SNOWBOARDÅKNING ROLIGARE ÄN TILL EXEMPEL SKIDÅKNING? )HOL[0HUNUHDWLYLWHW%lWWUHNlQVOD VHUElWWUHXW $OH[0\FNHWPHUYDULDWLRQ /HNIXOODUH6N|QDUHNlQVOD

HUR SER EN VANLIG VARDAG UT? )HOL[)UXNRVWNORFNDQLYlJ WLOOVNRODQL0DOXQJVHQVFKHPDODJG VQRZERDUGnNQLQJL.OlSSHQWLOOV NORFNDQ+HPODJDPLGGDJRFK VHQFKLOODKHPPDL0DOXQJ $OH[8SSWLOOIUXNRVWNORFNDQ VHQGLUHNWWLOO.OlSSHQI|UnNQLQJ IUDPWLOOVNORFNDQ6HQEXVVHQ KHPPHGI|UKRSSQLQJVYLVQnJUDQ\D WULFNLEDJDJHW HUR HAR SNOWBOARDGYMNASIET I MALUNG UTVECKLAT ER SOM SNOWBOARDÅKARE? )HOL[$OODHOHYHURFKNRPSLVDU KDUKMlOSWPLJLPLQXWYHFNOLQJRFK LQVSLUHUDUPLJYDUMHJnQJYLnNHU LKRSbYHQFRDFKHUQDKMlOSHURVV P\FNHWDWWXWYHFNODYnUnNQLQJSnHWW EUDVlWW $OH[8WYHFNODWPLJP\FNHWWDFN YDUHDWWPDQInUnNDVMXNWP\FNHW VQRZERDUGRFKFRDFKHUQDVWnUYLG KRSSHQRFKKMlOSHURVVÀQVOLSDYDUMH WULFN

VAD HAR NI FÖR PLANER DENNA VINTER? )HOL[+DNXO $OH[)|UV|NDNRPPDXWL(XURSD RFKN|UDQnJUD775WlYOLQJDU HAR NI DRAGIT PÅ ER NÅGRA SKADOR UNDER ÅREN? )HOL[6WXNDGHI|WWHUEUXWHQD[HO $OH[%UXWHWQ\FNHOEHQVSULFND LD[HOQ HAR NI NÅGRA TIPS TILL YNGRE ÅKARE SOM VILL BLI BÄTTRE? )HOL[*HLQWHXSSlYHQRPGHWWDU HPRW/nWLQJHQDQQDQVlJDYDGGX NDQHOOHULQWHNDQJ|UD*|UGLQHJHQ JUHMRFKKDNXOVDPWLGLJW $OH[.|UVnP\FNHWVRPP|MOLJW RFKKDNXO/lUGLJDOOWIUnQ JUXQGHUQDLQQDQGXI|UV|NHUGLJSn VYnUDUHWULFN

5 snabba frågor SPORTDRYCK ELLER ENERGIDRYCK? $OH[(QHUJLGU\FN )HOL[(QHUJLGU\FN KLÄPPEN ELLER ÅRE? $OH[.OlSSHQ )HOL[.OlSSHQ FRONTSIDE ELLER BACKSIDE? $OH[)URQWVLGH )HOL[%nGD HOPP ELLER RAILS? $OH[%nGD )HOL[+RSS TÄVLA ELLER FILMA? $OH[7lYOD )HOL[)LOPD

VAD ÄR VIKTIGAST, SVÅRA TRICK ELLER STIL? )HOL[6WLO $OH[6WLO*|UPDQHWWWULFNXWDQ VWLONDQPDQOLNDJlUQDOnWDEOLDWW J|UDGHW«




cNDUH$OH[

Alexander De La Torre

cOGHUnU )|GHOVHRUW.XQJVlQJHQ %|UMDGHnND %UlGDOlQJG6DORPRQ6DQFKH] )DYRULWWULFN)URQWVLGH



cNDUH)HOL[

Felix Mobärg

cOGHUnU )|GHOVHRUW+HOVLQJERUJ %|UMDGHnND %UlGDOlQJG6DORPRQ'ULIW )DYRULWWULFN%6FUDLOJUDE


ICEKART

Gokart på is med tävlingsdubbade däck Vissa tider bokat för tävlingar framförallt fredagar och lördagar. Även Junior kart från ca 7 år. Ring för info!

syns du inte finns du inte!

SNÖSKOTRAR

Vi kan skyltar, kontakta oss för förslag.

Hyr Sälens sportigaste skotrar hos oss!

PLÅT- TRÄ- OCH PLASTSKYLTAR FASADSKYLTAR LJUS- OCH NEONSKYLTAR

Öppet

Priset

Alla dagar 10-17 Kvällsåkning på torsdagar och fredagar till kl 19

Hyrkart 7 minuter Senior 100:Junior 60:Tävling 300:- per person

FORDONSDEKOR UTSTÄLLNINGSMATERIAL 4-FÄRGSPRINT FLAGGOR OCH BANDEROLLER DEKALER

Plats

Kontakt

Säterjärn som ligger vid fjällvägen mellan Tandådalen och Hundfjället

070-645 48 85 www.icekart.nu

...OCH MYCKET MER

äÓ{·£xä näÊUÊwww.norling-skylt.se

SKA DU ÅKA TILL SÄLEN? PASSA PÅ ATT ÅKA LITE SKIDOR OCKSÅ.

SÄLEN FÖR FÖRÄLDRAR. OCKSÅ. När allt kommer omkring så är det väl bäst om alla får ha lite skoj på skidsemestern? I Stöten hittar du härlig skidåkning för de små men dessutom: Sälens högsta fallhöjd, två världscupklassade backar och nästan inga liftköer alls. Boka resa på www.stoten.se eller 0280-75000.


bigair-tävling sätter fart på stöten i sälens funpark ”Funpark” är ett ord som numera används flitigt i Stöten. Med ny parkansvarig kommer nya features och nya visioner. Ett steg som var högst nödvändigt för parkens framtid. 7(;71DWKDOLH%HPHUKROWRFK&DUO3HWWHUVVRQ )272&KULVWRIIHU7LOVWDP



Nu driver vi butiken i egen regi! Det betyder att du får personlig och engagerad service, mer lokalproducerat och massor av nya spännande produkter i butiken! Välkommen in! :]LUZRH:WLS(;.VJO)PUNVSV[[V



Anna & Mattias

€WWL[]HYQLKHN[PSS :pSLUI`


BIGAIR-TÄVLINGEN I STÖTEN KOMMER GÅ AV STAPELN DEN 26 MARS

²-REEHWVRPSDUNDQVYDULJL6W|WHQL6lOHQlUEnGHUROLJWRFKXWPDQDQGHVlJHU&DUO 3HWWHUVVRQVRPJlUQDRFKRIWDIDQWLVHUDURP)XQSDUNHQVIUDPWLG ATT PARKEN FINNSlURP|MOLJWDWWPLVVDQlUPDQVLWWHUPHGVROHQL|JRQHQRFK YlQWDUSnDWWInVWLJDDYVWROVOLIWHQSnWRSSHQ,GDJVOlJHWÀQQVGHWWLRNLFNDULYDULHUDQGH VWRUOHNDUER[DUUlFNHQVSLQHVRFKYLNWLJDVWDYDOOWRlQGOLJWP\FNHWnNJOlGMH EVENEMANG, TÄVLINGARRFKGHWGlUOLOODH[WUDL)XQSDUNHQKDUGRFNO\VWPHGVLQ IUnQYDURXQGHUGHQVHQDVWHWLGHQ1nJRWVRPSDUNDQVYDULJH&DUO3HWWHUVVRQYLOOI|UlQGUD ²-DJYLOOJlUQDGUDLJnQJOLWHWlYOLQJDURFKHYHQWVRPNDQORFNDKLWÁHUnNDUHWLOOSDUNHQ VlJHU&DUOVRPLQRPNRUWInUVLQ|QVNDQXSSI\OOG NU ÄR DET NÄMLIGENVSLNDWDWWGHWEOLUWlYOLQJL6W|WHQV)XQSDUNUHGDQGHQH PDUV7lYOLQJHQDUUDQJHUDVDY6W|WHQLVDPDUEHWHPHG6lOHQV,)RFK6YHQVND6NLGI|UEXQ GHW2FKGHWEOLULQWHYLONHQWlYOLQJVRPKHOVWXWDQHQ'0WlYOLQJL%LJ$LU,GpQEDNRPHWW '0lUNRUWRFKJRWWDWWSnHWWVDQVDWRFKVSRUWVOLJWVlWWEHYLVDYHPVRPlUElVWLOlQHW FÖR ATT ALLA VNDNXQQDGHOWDLWlYOLQJHQVnEOLUGHWHWWVnNDOODW|SSHW'0'nNDQDOOD YDUDPHGRFKWlYODRDYVHWWRPPDQNRPPHUIUnQ6PnODQG'DODUQDHOOHU'DQPDUN5HQW SUDNWLVNWLQQHElUGHWDWWRPGXERUL'DODUQDVnWlYODUGXRPWYnSDOOSODWVHULVDPPD WlYOLQJHQSODWVL'0RFKHQSODWVLGHQ|SSQDWlYOLQJHQ0HGDQGXVRPERULWLOOH[HPSHO 'DQPDUNEDUDWlYODURPHQSDOOSODWVLGHQ|SSQDWlYOLQJHQ I DEN KOMMANDE%LJ$LUWlYOLQJHQKRSSDUPDQHQGDVWLHWWKRSS'RFNÀQQVGHW SODQHUSnDWWLIUDPWLGHQDUUDQJHUDHQVORSHVW\OHWlYOLQJGlUPDQEODQGDUEnGHKRSSRFK UDLOV2FKI|UGHQVRPNlQQHUI|UDWW|YDOLWHLQQDQVMlOYDWlYOLQJHQVnE|UPDQVYlQJD I|UELGHQRPWDODGHRFKSRSXOlUD%LJ$LU%DJHQ'lUNDQPDQÀQVOLSDVLQDWULFNXWDQDWW ODQGDSnKnUGPDUN

FUNPARKEN NLFNDU UDLOV %LJ$LU%DJ 8SSO\VWMLEEDUHQD STÖTEN +|MG|YHUKDYHWPHWHU +|JVWDIDOOK|MGPHWHU 7RWDOSLVWOlQJGNP 7RWDOOLIWOlQJGNP /LIWNDSDFLWHWSHUVWLPPH $QWDOOLIWDUVW YDUDYVWVWROOLIWDU

$QWDOQHGIDUWHUVW 6YDUWDVW 5|GDVW %OnDVW *U|QDVW /lQJGVSnUNP RFKNP

%HO\VWOlQJGVSnUNP 5HVWDXUDQJHUVW %DUHUVW

SAMMA HELGSOM%LJ$LUWlYOLQJHQlUGHWlYHQ60LSXFNHOSLVWI|UVNLGOlUDUH0HG DQGUDRUGYDUEHUHGGDSnHQUROLJRFKKlQGHOVHULNKHOJL6W|WHQYHFND ²'HWNlQQVVRPDWWGHQKlUWlYOLQJHQlUHWWULNWLJEUDVWHJLUlWWULNWQLQJJlOODQGH)XQ SDUNHQVIUDPWLG1XKRSSDVYLEDUDDWWGHWNRPPHUP\FNHWIRONKLWEnGHVRPWlYODQGHQ RFKVRPSXEOLNDYVOXWDU&DUO3HWWHUVVRQ )|UDQPlODQRFKPHULQIRUPDWLRQRPWlYOLQJHQEHV|NZZZIDFHERRNFRPVWRWHQLVDOHQ




VIMMEL

harrys i sälen 2011•02•23

*U\PW|VSn+DUU\VRFKQ\DQDWWNOXEEHQ,&()RWR7RP6YHGLQ

NYFIKEN PÅ FLER VIMMELBILDER? KLICKA DIG HIT...

WWW.NOLLTVA.SE

9LOOQLYDUDH[WUDILQNRPWLOOIHVWHQLYnUOLPRXVLQ

9LN|U(UPHGJOlGMH WU\JJWRFKVlNHUWGLWQLYLOO QlUQLYLOO




I|ULQIRZZZVDOHQKDUU\VSXEDUVH

PHG6YHULJHVVFKODJHUHOLW

6FKODJHUIUHGDJ

QDWWNOXEE

/LQGD%HQJW]LQJ0DJQXV&DUOVVRQ 1DQQH*U|QYDOO$QQHOLH5\GH 0DJQXV%lFNOXQG5LFKDUG+HUUH\ 0DWKLDV+ROPJUHQ-RKDQ%HFNHU RFK$QQD%RRN

HjgZYZdql`]Z]kl fa_`l%[dmZafl`]ogjd\

2VNDU/LQQURV +RIIPDHVWUR 'DQLHO$GDPV5D\ %URNHQGRRU 3HWWHU (0' -RKQRVVL

6lOHQVQ\DKHWDQDWWNOXEE

(SRVWLQIR#KRWHOEXJHOKRIVH



%RNQLQJRFKLQIRUPDWLRQ

ZZZKRWHOEXJHOKRIVH ‹$KOELQVIRWR UHNODP

DJHQGD

6SlQQDQGHVNDWWMDNW I|UDOODEDUQIDPLOMHU VRPERNDUERUGNO

%DUQHQV EXVLJD %JHOKRI

.OlXWGLJVMXQJ NDUDRNHRFKKD EXVNXOSnEDUQHQV U H [ [ J S \ I I DIWHUVNL PnQGDJ IUHGDJ

+DUU\V&OXE GDQVJROY '-VQDWWNOXEEDUWLVWEDQG

6|QGDJ

+DUU\VQDWWNOXEE ,&(QDWWNOXEEDUWLVWEDQG

/|UGDJ

+DUU\VVFKODJHUIUHGDJPHGDUWLVW ,&(QDWWNOXEEDUWLVWEDQG

)UHGDJ

 .DUDRNH DUWLVWGDQVJROY '-V ,&(QDWWNOXEEDUWLVWEDQG

7RUVGDJ

GDQVJROY '-V

&OXEWLVGDJ

PnQ IUH

%DUQHQVDIWHUVNL

1|MHnOGHUVJUlQVnU

PnQV|Q

+DUU\V3XE

WRUVGDJDU

%%4EXIIp

PnQV|Q

$ODFDUWH

PnQV|Q

+DSS\+DUU\DIWHUVNL

PnQV|Q

/XQFK

5HVWDXUDQJHQ


CHRISTOFFER LUNDQUIST




CHRISTOFFER LUNDQUIST

CHRISTOFFER GÖR SOLODEBUT 8I\X%RHIVW0YRHUYMWX *SXS4VIWWFMPHIV

I slutet av mars kommer den första soloplattan från Christoffer Lundquist. Han är kanske mest känd för allmänheten som sångare och basist i Brainpool. Parallellt med detta är han sedan ett decennium tillbaka en av landets mest eftertraktade producenter. Både indieband, kultartister som Edda Magnason och Helena Josefsson och Roxette/Per Gessle vallfärdar till hans Aerosol Grey Machine Studio på den skånska landsbygden för att få ta del av hans vintageutrustning, musikalitet och fingertoppskänsla som producent. Här berättar han för Nolltvå om soloalbumet, Brainpool, sin syn på lycka och fanatiska Roxettebeundrarinnor. FÖRSTA SOLOALBUMET! HUR GICK DET TILL? ²-DJVNULYHUDOOWLGOnWDURFKS\VVODUPHGPLQHJHQPXVLNPHQGHDYJ|UDQGH IDNWRUHUQDVRPJMRUGHDWWGHWWDEOHYYHUNOLJKHWYDUDWWMDJVW|WWHLKRSPHG WH[WI|UIDWWDUHQ0LFKDHO6D[HOOVnQJHUVNDQ+DQQD(NVWU|PRFKWUXPVODJDUHQ 1LNODV.LOHQVWDP3O|WVOLJWIDQQVHQLQUDPQLQJVRPJDYLQVSLUDWLRQDWWVNULYD OnWDUWLOOHWWDOEXPRFKJHQRPI|UDGHWKHODYlJHQ$WWI|UHVWlOODVLJPXVLNHQ PHGGHKlUPlQQLVNRUQDYDUDYJ|UDQGHI|UKHODSURMHNWHW-DJKDUVNULYLW PXVLNHQXQGHUHQLQWHQVLYSHULRGI|UUI|UUDVRPPDUHQRFKVHGDQKDU 0LFKDHO6D[HOOVNULYLWWH[WHUQDWLOOGHIlUGLJDOnWDUQD1nJRWVRPMDJlUHQRUPW LPSRQHUDGRFKOlWWKlSHQ|YHUlUDWWGHWNlQQVVnP\FNHWVRPPLQDHJQDRUG (OOHUVRPRUGVRPIDOOHUVLJKHOWQDWXUOLJDI|UPLJDWWVMXQJDRFKVRPSDVVDU PXVLNHQRHUK|UWYlO3URGXNWLRQHQlUKHOWXWDQSODQRFKULNWQLQJ-DJKDUHIWHU PnQJDnUVSURGXFHUDQGHDYDQGUDVPXVLN²GU\JWSODWWRU²QXQlUMDJJHWW PLJVMlOYFKDQVHQKHOWJnWWSnLQWXLWLRQRFKJMRUWYDGVRPNlQWVEUDLVWXQGHQ DET ÄR INTE SPECIELLT STRATEGISKT ATT ÅKA IVÄG PÅ VÄRLDSTURNÉ SOM GITARRIST MED ROXETTE SAMTIDIGT SOM MAN SLÄPPER SITT FÖRSTA SOLOALBUM. HUR TÄNKTE DU DÄR? ²6RP-RKQ/HQQRQVD²IDVWKDQKDUHJHQWOLJHQNQ\FNWFLWDWHWWURUMDJ²´/LIH ,V:KDW+DSSHQV7R<RX:KHQ<RX·UH%XV\0DNLQJ2WKHU3ODQVµ-DJKDUKLWWLOOV DOGULJO\FNDWVSODQHUDQnJRQWLQJLPLWWOLYVRPVHGDQKDUEOLYLWVRPMDJWlQNW RFKMDJKDUJHWWXSSVHGDQPnQJDnU9LONHWlUHQOlWWQDGHIWHUVRPMDJGlUPHG LQWHKDUQnJRQDQOHGQLQJDWWEOLIUXVWUHUDG|YHUGnOLJSODQHULQJHOOHUSODQHUVRP LQWHJnULOnVOlQJUH HUR SKULLE DU BESKRIVA DIG SJÄLV FÖR NÅGON SOM INTE KÄNNER DIG? JAG MENAR BÅDE PROFESSIONELLT OCH PRIVAT! ²(QKHOWRP|MOLJIUnJDRFKMDJNDQLQWHHQVI|UV|NDVYDUDSnGHQ-DJKDULQWH GHQEOHNDVWHDQLQJRPKXUMDJXSSIDWWDVHOOHUKXUMDJlUI|UGHQGHOHQ'XJHU VYDUHW´KDUJODV|JRQµ" VISST. DEN TÄNKER JAG SNO. DINA FÖRSTA ALLVARLIGA MUSIKMINNEN? ²1lUMDJYDUI\UDnUVSHODGHPLQPRVWHU+HOHQ7KH%HDWOHVI|UPLJ-DJ PLQQVGHWYlOGLJWOHYDQGHGHWYDUVRPDWWEOLGUDEEDGDYQnJRWRHUK|UWRFK XQGHUEDUWRFKVYnUnWNRPOLJWRFKnWUnYlUWRFKMDGXI|UVWnU-DJNXQGHLQWH I|UPLWWOLYEHJULSDKXUDOODGHVVDPDNDO|VDOMXGDOVWUDGHVRFKPLQQ\ÀNHQKHW YDUGHÀQLWLYWYlFNW6HGDQÀFNMDJLI\UDnUVSUHVHQWHQNDVVHWWEDQGVSHODUHDY PLQDI|UlOGUDURFKGHWWRJLQWHPnQJDYHFNRUI|UUlQMDJXSSWlFNWHDWWRPMDJ WRJPLQPDPPDVEDQGVSHODUHVDWWHSnPXVLNLGHQRFKVWlOOGHPLQHJHQEDQG VSHODUHSnLQVSHOQLQJEUHGYLGVSHODGHVHQEODQGQLQJDYGHWVRPNRPXUGHQ I|UVWDEDQGVSHODUHQRFKGHOMXGMDJnVWDGNRPVMlOYLQSnPLQHJHQEDQGVSHODUH 'HWYDU+(/7)$17$67,6.70LQDG|WWUDUKLWWDGHKlURPGDJHQHQVnGDQ NDVVHWWLHQJDUGHURE-DJVLWWHUI\UDnUJDPPDORFKVSHODUWUXPPRUSnHQ ODPSDWLOO%HDWOHVSODWWRULPLQXWHU'HWlUHWWXQGHUDWWPLQDI|UlOGUDULQWH OlPQDGHLQPLJSnI|UYDULQJQnJRQVWDQV VAD GJORDE DU MUSIKALISKT INNAN BRAINPOOL? ²-DJYDUPHGLHWWV\PIRQLURFNEDQGSnJ\PQDVLHW9LKHWWH/RV$YRFDGRVRFK VSHODGHOnQJDVYLWHULQVWUXPHQWDOPXVLN9LKDGHLQWHHQHQGDVSHOQLQJ0HQPHVW VDWWMDJI|UPLJVMlOYRFKVNUHYOnWDURFKVSHODGHLQGHPSnSRUWDVWXGLRHOOHU NDVVHWWGlFNPHGVRXQGRQVRXQG-DJKDURFNVnHWWI|UÁXWHWLHWWMD]]GDQVEDQG PHGQnJUDJ\PQDVLHNRPSLVDU9LVSHODGHSnEU|OORSRFKI|GHOVHGDJVIHVWHU RFKKDGHP\FNHWVSHOQLQJDUXQGHUHWWSDUnU-DJOlUGHPLJP\FNHWJHQRPDWW I|UV|NDIXVNDWLOOMD]]EDVJnQJDUXQGHUOnQJDJLJ KÄNDES DET SOM ATT BRAINPOOL VAR DEL AV EN SVENSK INDIEPOPVÅG? ²-DJXSSIDWWDGHDEVROXW%UDLQSRROVRPHQGHODYHQVYHQVN´LQGLHYnJµDWWGHW IDQQVHWWVDPPDQKDQJRFKHQWLOOK|ULJKHWGlUVRPYDUP\FNHWSRVLWLY TROR DU ATT FOLK SOM INTE ÄR I MUSIKBRANSCHEN HAR ETT GREPP OM VAD EN PRODUCENT GÖR? ².DQVNHLQWHGHWlUHQYDJWGHÀQLHUDG\UNHVUROO$OODSURGXFHQWHUDUEHWDUGHV VXWRPSnVLWWHJHWSHUVRQOLJDVlWWVnGHWlUVYnUWDWWEHVNULYDYDGGHWLQQHElU 'HWÀQQVVnPnQJDVlWWDWWQlUPDVLJXSSJLIWHQ.DQVNHNDQPDQEHVNULYD SURGXFHQWHQVRPGHQVRPKDU\WWHUVWDDQVYDUHWI|UGHQSURFHVVVRPOHGHU IUnQHQLGpHOOHUHQOnWWLOOHQIlUGLJLQVSHOQLQJGHQVRPI|UYlQWDVKDHQ|YHU EOLFNRFKHWWDQVYDUI|UKHOKHWHQ,ÀOPYlUOGHQEHW\GHUMXSURGXFHQWQnJRWKHOW DQQDWVnGHWWDlUOlWWI|UYLUUDW MINNS DU NÄR DU FÖRSTA GÅNGEN DRISTADE DIG ATT KALLA DIG ”PRODUCENT” OCH VAD SOM FÖRANLEDDE DET? ²1MDHGHWPLQQVMDJQRJLQWH-DJI|OOLQLUROOHQQlU%UDLQSRROVSHODGHLQ GHPRVlYHQRPMDJMXKDGHJMRUWP\FNHWSRUWDVWXGLRLQVSHOQLQJDUSnHJHQ KDQGWLGLJDUH

DU HAR PRODUCERAT ALLT FRÅN OKÄNDA BAND TILL BJÄSSAR SOM ULF LUNDELL OCH ROXETTE. ÄR TILLVÄGAGÅNGSSÄTTET UNGEFÄR DETSAMMA FÖR DIN DEL? ²-DDEVROXW,QJHQVNLOOQDGDOOV IDNWLVNW%XGJHWDUQDEUXNDUGRFN VNLOMDVLJHQDQLQJ HAR DU NÅGRA HJÄLTAR? ²0XVLNDOLVNDKMlOWDUKDUMDJ PnQJD0HQPLQDIUlPVWDKMlOWDU lUPlQQLVNRUVRPNDQOHYDVRP JRGDPlQQLVNRUWDDQVYDUI|UVLQD KDQGOLQJDULQWHEHODVWDDQGUDYDUD WROHUDQWDRFK|SSQDWLOOVLQQHW'HW lUHQOnQJWVW|UUHXWPDQLQJlQDWW J|UDHQVNLYDHOOHUWYn'DODL/DPD lUHQVWRUKMlOWHI|UPLJMDJKDUOlVW WUDYDUDYKDQVE|FNHURFKLQVSLUHUDWV RHUK|UWDYGHP FÖR EN UTOMSTÅENDE VERKAR DU VARA EN GODMODIG HERRE SOM ALLTID HAR NÄRA TILL SKRATT. NÄR BLIR DU ARG? OCH GRÅTER CLOWNEN NÅGON GÅNG I SIN ENSAMHET? ²1DWXUOLJWYLVEOLUMDJEnGHRFK0HQ MDJKnOOHUGHWJlUQDI|UPLJVMlOYHOOHU LQRPIDPLOMHQ1lUMDJNDQ0HQOLYHW lUHQIDQWDVWLVNP|MOLJKHWRFKMDJ |QVNDUOlUDPLJDWWLQWHIRNXVHUDSn GHVPnQHJDWLYDVDNHUVRPGUDEEDU PLJXWDQKHOOUHYDUDWDFNVDPI|UPLWW SULYLOHJLHUDGHOLY0HQGHWO\FNDVMDJ VnNODUWLQWHDOOWLGPHG

DALAI LAMA ÄR EN STOR HJÄLTE FÖR MIG

DET FINNS MÅNGA LYCKOBÖCKER OCH MER ELLER MINDRE SERIÖSA BÖCKER OM ATT MAN KAN BOTA EXEMPELVIS CANCER MED POSITIVT TÄNKANDE. TROR DU ATT MAN KAN BESTÄMMA SIG FÖR ATT TÄNKA POSITIVT? ²5LNWLJWVnHQNHOWWURUMDJLQWHDWW GHWlUGHWUlFNHULQWHPHGDWWEDUD ´EHVWlPPDVLJµ'HWÀQQVRFNVn P\FNHWG\QJDLJHQUHQ|VWHUOlQGVN ÀORVRÀRFKOLYVnVNnGQLQJRPJMRUG RFKPLVVWRONDGWLOO\WOLJRFKNRUNDG YlVWHUOlQGVNNRUWVLNWLJHJRLVP0HQ MDJWURUGHÀQLWLYWSnWDQNHQVNUDIW RFKSnDWWYLLYnUNXOWXUXQGHUVNDW WDUGHQUDGLNDOW-DJlUKHOW|YHUW\JDG RPDWWPDQJHQRPPnOPHGYHWHQ WUlQLQJPHGLWDWLRQVWXGLHUHWFHWHUD NDQOlUDNlQQDVLWWPHGYHWDQGH P\FNHWLQJnHQGHRFKRFNVnWUlQD XSSGHGHODUVRPPDQW\FNHUI|U HQLUlWWULNWQLQJRFKPRWDUEHWDGH NlQVORUVRPI|UHQYLOVH-DJlUIXOOW |YHUW\JDGRPDWWGHQHJRFHQWULFLWHW YLDOODKDULQRPRVVJnUDWWPRWDU EHWDRFKGHQPHU|SSQDDOWUXLVWLVND VLGDQJnUDWWWUlQDXSS2FKDWWGHWWD OHGHUWLOOEDUDJRWWEnGHI|UHQVMlOY RFKI|UDQGUD

>>> 


CHRISTOFFER LUNDQUIST

%UDLQSRRO

BERÄTTA EN ANEKDOT OM FANATISKA ROXETTEFANS! ²-DJKDUEOLYLWEHNDQWPHGPnQJDDYGHWURJQDVWHIDQVHQGHVLVWDnUHQRFK EODQGDQQDWPHGHQW\VNDVRPÀUDGHVLQKXQGUDGHNRQVHUWXSSOHYHOVHPHG 5R[HWWH*HVVOH*\OOHQH7LGHUI|UQnJRWnUVHGDQ-DJKDUVSHODWHWWRWDOJnQJHU I|UKHQQHRFKUHVWHQDYGHWLQQHUVWDMlUQJlQJHW HWWSDUKXQGUDSHUVRQHU NDQVNH VRPDOOWLGVWnUOlQJVWIUDPDOOWLGVWnUXWDQI|UKRWHOOHWQlUYLNRPPHU GLWHIWHUVSHOQLQJHQlUSnSODWVXWDQI|UQlVWDKRWHOOQlVWDGDJ,11$1YL NRPPHUGLWRFKVWnUOlQJVWIUDPVHQDUHSnNYlOOHQVNRQVHUW'HlURWUROLJD 'HVRYHUDOOWLGLVLQDELODUHOOHUN|UKHODQlWWHUQDI|UDWWYDUDI|UVWSnSODWV QlVWDGDJ)|UVWW\FNWHMDJGHYDUKHOWELQGJDOQDPHQQXQlUMDJRFK|YULJD 5R[HWWHEDQGPHGOHPPDUKDUOlUWNlQQDGHPOLWHlUMDJVQDUDUHDYXQGVMXN'HW YHUNDUKXUNXOVRPKHOVWIDNWLVNW(QKREE\RFKHQKHOOLYVVWLORFKHQVWDUN JHPHQVNDS-DJIUnJDGHHQDYGHPYLGQnJRWWLOOIlOOHRPGHWLQWHEOHYWMDWLJWDWW O\VVQDRFKWLWWDSnVDPPDMlPUDNRQVHUWNYlOOHIWHUNYlOO+RQVYDUDGH´lUGHW WMDWLJWDWWVSHODVDPPDVDNNYlOOHIWHUNYlOONDQVNH"µ-DJKDUVlOODQNlQWPLJVn VDWWSnSODWV1DWXUOLJWYLVlUHQNRQVHUWHWWVDPDUEHWHPHOODQGHVRPVWnUSn VFHQHQRFKSXEOLNHQRFKXSSOHYHOVHQlUPLQVWOLNDLQWHQVLYHOOHUPHULQWHQVLY I|UGHPlQGHQlUI|UPLJ2FKMDJKDUMXVDQQHUOLJHQLQWHWUnNLJW9LYDUXWH RFKnWPLGGDJPHGHWWJlQJU\VNDIDQVLK|VWDVSnHQNURJL0RVNYD'HWYDU HQRUPWWUHYOLJW(QDYGHPKDGHPHGVLJWH[WLOIlUJRFKPnODGH´IURP5XVVLD ZLWKORYHµSnPLQVNMRUWD JAG HAR HAFT TUREN ATT UPPLEVA BRAINPOOL FRAMFÖRA ROCKOPERAN JUNK BÅDE MED SYMFONIORKESTER OCH SOM NEDTRIMMAT ROCKBAND OCH VAR LIKA IMPONERAD BÅDA GÅNGERNA. MEN SEDAN DESS HAR DEN TAGIT FLERA KLIV MOT ETT FAKTISKT MUSIKALUPPFÖRANDE. BERÄTTA! ²'HQKDUVDWWVXSSSnHQWHDWHUL/RV$QJHOHVXQGHUHWWSDUPnQDGHUI|UWYn nUVHGDQ'HQJLFNNDQVNHI|UHVWlOOQLQJDUHOOHUVn(QEULOMDQWDPHULNDQVN PXVLNWHDWHUUHJLVV|UVRPKHWHU6KDNLQD1D\IDFNKDUWDJLW-XQNXQGHUVLQD YLQJDURFKDUEHWDWPHGGHQLIHPVH[nU.ULQJKRQRPÀQQVSURGXFHQWHU RFKGLYHUVHPHGKMlOSDUHRFKGHDUEHWDUVWHQKnUWRFKP\FNHWOnQJVLNWLJWPHG HQRUPGHGLNDWLRQI|UDWW-XQNVNDQnGHVWRUDVFHQHUQDVnVPnQLQJRP'HWNDQ W\FNDVYHUNOLJKHWVIUlPPDQGHPHQHIWHUDWWKDnNW|YHUWLOO/$RFKVHWWGHUDV XSSVlWWQLQJWURUMDJIDNWLVNWDWWDOOWlUP|MOLJW'HQYDUKHOWHQNHOWDVEUD(IWHU XSSVlWWQLQJHQL/$NRP6KDNLQDWLOOPLQVWXGLRUXVWDGPHGHUIDUHQKHWHUQD IUnQXSSVlWWQLQJHQI|UDWWNRPSOHWWHUD-XQN'HELWDUDYKLVWRULHQVRPLQWH JLFNIUDPWLOOUlFNOLJWEUDRFKGHUROOHUUHODWLRQHURFKVNHHQGHQVRPLQWH I|UNODUDGHVWLOOUlFNOLJWEUDXUHWWVFHQLVNWSHUVSHNWLYVNXOOHXWYHFNODV9LDOOWVn %UDLQSRRORFK6KDNLQDVNUHYWLOOVDPPDQVHQGU\JKDOYWLPPHQ\PXVLNVRP LQIRJDGHVSnROLNDVWlOOHQLKLVWRULHQ-XVWQXSnJnUHQSURFHVVLULNWQLQJPRWHQ Q\XSSVlWWQLQJL6DQ)UDQVLVFR7UHPXVLNDOVNRODUL86$RFKHQL$XVWUDOLHQKDU EHWWRPUlWWLJKHWHUDWWInVlWWDXSSGHQ'HQKDURFNVn|YHUVDWWVWLOOVYHQVNDDY HQVYHQVNHQWXVLDVWVRPlULQEODQGDGLHQPXVLNDOXWELOGQLQJRFKMDJKRSSDVDWW GHVQDUWVNDNXQQDVlWWDXSSGHQI|UI|UVWDJnQJHQL6YHULJH1lUMDJI|UFLUND WLRnUVHGDQEHUlWWDGHI|UHQP\FNHWJRGYlQDWWYLVNXOOHVNULYDHQURFNRSHUD NRPGHWVSRQWDQDVYDUHW´YLOOGXOnQDHQVSDGH"µ$WWJUlYDPLQHJHQJUDYPHG DOOWVn'HWVNDKDQInlWDXSSQlUGHQVlWWVXSSSn%URDGZD\KDKD$OOYDUOLJW WDODWKDU-XQNYLVDWVLJKDHWWHJHWOLYGHQYl[HUOnQJVDPWRFKI|UJUHQDUVLJRFK KDUEOLYLWGHWPHVWOnQJOLYDGHHQVWDNDSURMHNWMDJKDUYDULWLQEODQGDGL FINNS BRAINPOOL? ²-DGn9LKDUMXVWVNULYLWI|UVWDOnWHQWLOOYnUQlVWDSODWWD´7KH'LIÀFXOW/DVW $OEXP%UDLQSRRO·V´'LYLQD&RPPHGLDµ/nWHQlUPLQXWHUOnQJPLQVWRFK KDQGODURPKXUYLVMlOYDJnULJHQRPRFKEHJnUDOODROLNDQLYnHUDYV\QGHUWLOOVYL VOXWJLOWLJWGHWInUQLK|UDQlUQLN|SHUSODWWDQ



KAN VI VÄNTA OSS FLER SOLOALBUM FRÅN DIG? ²-DGn1lVWDVNLYDlUUHGDQIlUGLJ VNULYHQlQHQJnQJPHGWH[WHUDY 0LFKDHO6D[HOO-DJWlQNHUVSHODLQ GHQLK|VW BÅDE DU, PER GESSLE OCH CLARENCE ÖFWERMAN KÄNNS SOM GANSKA LUGNA OCH BALANSERADE HERRAR SOM INTE LÅTER FRAMGÅNGAR STIGA ER ÅT HUVUDET. MEN UNDER ALLT ANAR JAG ETT STORT UNDERLIGGANDE DRIV OCH EN ENORM MÅLMEDVETENHET. VAD FÅR JAG FÖR BETYG SOM AMATÖRPSYKOLOG? ²'XInUKHOWNODUWEUDEHW\J IDNWLVNW9LlUQRJYlOGLJWGULYQDRFK PnOPHGYHWQD-DJKDUHQHQRUP GULYNUDIWYDGJlOOHUDWWJ|UDPXVLN RFKVNDSDI|UXWVlWWQLQJDUDWWJ|UD PXVLN)|UPLJlUUHVDQPnOHWGHWlU GHQNUHDWLYDSURFHVVHQVRPORFNDU RFKGULYHU1lUSODWWDQlUNODUWDSSDU MDJVQDEEWLQWUHVVHWRFKYLOOJ|UDPHU Q\PXVLN-DJKDURFNVnHQVWDUNGULIW DWWJ|UDUlWWI|UPLJDWWJ|UDVnDWW GHQVRPDQOLWDUPLJVNDNlQQDDWW KDQKRQLQWHEOLUEHVYLNHQ3HUlUMX KHOWRVWRSSEDUKDQYHUNDUKDRlQGOLJ HQHUJLRFKNUHDWLYLWHWVRPDOGULJ YHUNDUDOGULJWDVOXW JÄMFÖRT MED SÅDANA SOM CLARENCE OCH PER, SOM HÅLLIT PÅ SEDAN 70-TALET, ÄR DU ”THE NEW KID ON THE BLOCK”: UNG OCH LOVANDE. SAMTIDIGT ÄR DU VETERAN I INDIEPOPVÄRLDEN. HUR SER DU PÅ DIG SJÄLV? ²3UHFLVVnHQXQJRFKORYDQGH YHWHUDQ  KAN/VILL DU SKILJA PÅ ARBETE OCH FRITID? ²-DJYLOOLQJHWKHOOUHHIWHUPnQJD nUVNDQVNHDOOWI|ULQWHQVLYWDUEHWH 0HQMDJlULQWHEUDSnGHW-DJlU WLGVRSWLPLVWKDUVYnUWDWWVlJDQHM lUGnOLJSnDWWSODQHUDRFKVDNQDU KHOWI|UPnJDDWWNRPSURPLVVDPHG PLWWDUEHWH-DJJHUPLJDOGULJI|UUlQ

JAG HAR INGA DRÖMMAR OM RIKEDOMAR ELLER LYXLIV GHWlUVnEUDMDJW\FNHUGHWNDQEOLRFKGHWVSHODULQJHQUROORPEnGHWLGHQ EXGJHWHQRFKRUNHQWDUVOXWMDJPnVWHIRUWVlWWD'HWWDlUQnJRWMDJYHUNOLJHQ YLOOOlUDPLJDWWInElWWUHEDODQVL  VAD SKULLE DU GÖRA OM DU VAR EKONOMISKT OBEROENDE? ²%DUDDUEHWDQnJRWPLQGUHDQQDUVLQJHQVNLOOQDGDOOV-DJKDULQJDGU|PPDURP ULNHGRPDUHOOHUO\[OLYHOOHUQnWnWGHWKnOOHW|YHUKXYXGWDJHW-DJYLOOKDPHUWLG DWWYDUDPHGPLQDEDUQRFKPLQIUXPLQIDPLOML|YULJWRFKPLQDYlQQHU'HWlU GHWHQGDMDJYLOOlQGUDSnLPLWWOLY-DJKDUGRFNHQnWHUNRPPDQGHGDJGU|PDWW JHERUWRK\JJOLJWP\FNHWSHQJDUWLOOlQGDPnOGlUGHYHUNOLJHQVNXOOHJ|UDQ\WWD 7lQNDWWKDUHVXUVHUDWWEHIULDDQGUDPlQQLVNRUIUnQOLGDQGHRFKGHWEDUD JHQRPDWWJHERUWSHQJDUPDQLQWHHQVEHK|YHUVMlOY'HWKDGHYDULWQnW VAD GÖR DU OM TIO ÅR? ²cNHUUXQWKHODYlUOGHQSnSUHPLlUHUDY´-XQNµRFKGULFNHU&KDPSDJQH $OOYDUOLJWWDODWGU|PPHUMDJLQWHRPQnJRWVSHFLHOOWDQQRUOXQGDOLY0HQGHWlU HQGU|PDWWNXQQDOHYDXWDQDWWEHODVWDDQGUDHOOHUMRUGNORWHW.DQVNHKDUMDJ EOLYLWOLWHElWWUHSnGHWRPWLRnU" )|UPHULQIRUPDWLRQRP&KULVWRIIHUVVWXGLRRFKOLVWD|YHUWLGLJDUH NOLHQWHUEHV|NZZZDJPVZHGHQFRP


Vi har allt för inspelning till PC & Mac För nybörjare & proffs

Fredag 25 februari DJ Johnny D bjuder på det bästa inom House, Club, Trance, Techno och Hardstyle.

tiKonfet & e r y Kols kanoner

Lördag 26 februari På scen ca 23.30

Mikrofon med tillbehör Röde NT-1A 1.795:-

Högtalare Yamaha HS50 2.995:-/par

CALLE

KRISTIANSSON Lördag 5 mars På scen ca 23.30

CARL NORÉN

Midikeyboard Alesis Q49 995:-

Debutalbum och turné!

Lördag 12 mars På scen ca 23.30

Ljudkort Focusrite Saffire6 USB 1.595:-

TANTRUM TO BLIND Fredag 18 & Lördag 19 mars kl. 19.00 till ca 22.30 Kom och upplev den bejublade live showen

MERA POPPA

Borlänge Borganäsvägen48, 0243-824 00 t Falun Slaggatan12, 023-147 75

www.musikcenter.se

HH

4d‹^^ab4S^8Wef

HH

Liknas med TV’s ”Så ska det låta”, fast i liveversion. Showpaketet innehåller: 2-rätters supé i Dalarnas snyggaste nattklubb, med den kanske roligaste och mest underhållande kväll du varit med om. Allt detta får du för 495 kr. Boka bord nu!

Lördag 19 mars Efter ”Mera Poppa” är det Club 33 mellan kl. 22.00 och 02.00!

HIT PATRULLEN uppträder med kända hits från 1970 till 2000-talet!

Fredag 25 mars På scen ca 23.30

SARA VARGA Direkt efter sin Melodifestivaldebut kommer hon till oss!

Lördag 26 mars På scen ca 23.30

SATOR Nu ute med ny skiva! Nattklubb med DJ även kvällar med artistframträdanden. Öppet: 22.00–02.00. Ålder: 18 år.

Priser och mer info på www.rattvikbowling.se Artistbokning: Dalaartist och Event • www.dalaartist.se Rättvik Bowling & Krog • Enåbadsvägen, Rättvik • Tel: 0248-123 19

Dam Herr Barn Hos oss finner ni kläder, accessoarer och andra tillbehör för just Ert speciella tillfälle. Vi har också utbildade sömmerskor som gör inprovning och sömnad så allt sitter perfekt.

H[fSdZS`Va_V[Y

HögtidsHuset www.hogtidshuset.se Borganäsvägen 42 Borlänge Tel: 0243-810 98 Fax: 0243-812 02


INREDNING

Dags fรถr nytt kรถk? Luckorna hรคnger pรฅ sned, bรคnkskivan รคr vind och trasig, kaklet รคr frรฅn 1972 och maskinerna vรคsnas som en hel orkester. Kรถket skall รคntligen bytas, men hur gรถr man och vart bรถrjar man?! Hรคr kommer lite smรฅ tips som fรถrhoppningsvis kanske kan hjรคlpa till. 8)<8)ZIPMRE,EKWXV}Q 3 tips innan du bรถrjar INSPIRATION 'HWlUHQVWRUJUHMDWWE\WDN|NRFKVYnUWDWW YHWDKXUPDQVNDOOElUDVLJnW%|UMDPHGDWWWD UHGDSnYLONHQVWLOGXYLOOKDSnN|NHWGHWlUHQ ELWSnYlJ+lPWDNDWDORJHUIUnQN|NVEXWLNHU NDNHOร€UPRUJROYร€UPRURFKVnYLGDUH.LNDSn QlWHWRFKnNUXQWWLOOROLNDXWVWlOODUH BUDGET (QRWUROLJWYLNWLJGHOLN|NVE\WHWlUEXGJHWHQ +DUGXHQK\IVDGNROOSnKXUVWRUVODQWGXYLOO OlJJDSnN|NHWEOLUGHWP\FNHWOlWWDUHI|UEnGH GLJRFKGHQSHUVRQVRPVNDOOKMlOSDGLJPHG SODQHULQJRFKEHVWlOOQLQJ'HWJnULQWHDWWVlJD ยต9DGNRVWDUHWWN|N"ยตNDQGXVYDUDSnYDGHQ NDVVHPDWNRVWDU" 'HWEHURUVnNODUWSnYDGGXVWRSSDULGHW 'HWร€QQVHQGMXQJHOPHGSURGXNWHUGlUXWH EXGJHWHQKMlOSHUWLOODWWIRUWDUHKLWWDGHElVWD DOWHUQDWLYHQWLOOHUDEHKRYRFKSOnQERN JOBB +XUP\FNHWMREElUQLEHUHGGDDWWVMlOYDOlJJD SnDWWInN|NHWSnSODWVRFKYDGEHK|YHUQL KDQWYHUNDUHWLOObUQLEHUHGGDDWWJ|UDDOOW HOOHUGHWPHVWDVMlOYDNDQVNHlYHQVNUXYDLKRS VNnSHQร€QQVGHWP|MOLJKHWDWWNRPPDQHGLSULV .|SHUQLN|NDYHQN|NVร€UPDVRPKDUKDQW YHUNDUHNQ\WQDWLOOVLJDQOLWDUQLPHGVWRUI|UGHO GHP'HWJnUIRUWDUHGHNDQSURGXNWHUQDRFK KDUGLUHNWNRQWDNWPHGVlOMDUHQVnQLVOLSSHUVWn VRPPHOODQKDQG'HWNDQVNHVHUXWVRPDWWQL NDQVSDUDOLWHSHQJDUPHOODQRIIHUWHUQDPHQ VRPUHJHOEOLUGHWlQGnELOOLJDVWDWWDQYlQGD N|NVร€UPDQVHJQDVQLFNDUH

3 stรคnkskydd

4 fรคrger pรฅ vitvaror

KAKEL 9lQWDPHGDWWYlOMDNDNHOWLOOVGHWDWWGXKDU N|NHWSnSODWV'HWlULQWHDOOVVlNHUWDWW NDNOHWVHUOLNDXWLOMXVHWKHPPDKRVGLJVRPL XWVWlOOQLQJHQ 6WLUUDGLJLQWHEOLQGSnDWWGHWVNDOOYDUDND NHOVRPVWlQNVN\GGGHWร€QQVVnP\FNHWDQQDW VNRMSnPDUNQDGHQ

ROSTFRITT /LWHVRPยตGHQOLOODVYDUWDยตGHWIXQNDUDOOWLGbUGXUlGGI|Uร€QJHUDYWU\FNร€QQVGHWYlOGLJWEUD SURGXNWHUDWWEHKDQGOD\WDQPHG<WDQVNDOOJ|UDVIHWDUHlQYDGร€QJUDUQDlUVnDWWร€QJHUDYWU\FNHQ LQWHV\QV0HGOHWNDQLQQHKnOODYD[VRPWlSSHUWLOOUHSRUQDLGHQURVWIULD\WDQ$WW\WDQJ|UVIHW EHW\GHUVMlOYNODUWLQWHDWWGLQDNOlGHUEOLUROMLJDRPGXUnNDUNRPPDnWN\OVNnSVG|UUHQ9D[HW YDUNHQNlQQVHOOHUV\QV

GLAS *ODVVNLYRUlUVQ\JJDOlWWDDWWWRUNDDYPHGOLWH I|QVWHUSXWVRFKSLQVDPWHQNHOWDWWVlWWDXSS 'XEEHOKlIWDQGHWHMSSnEDNVLGDQRFKVHGDQOLWH VLOLNRQLNDQWHQUXQWRP EMALJ (PDOMVRPVWlQNVN\GGlUJDQVNDQ\WWSn PDUNQDGHQGHQVlWWVXSSLVNLYRUVnVRP JODVRFKNDQDQYlQGDVEnGHVRPZKLWHERDUG RFKDQVODJVWDYODPHGPDJQHWHU(PDOMHQKDU รHUOLNKHWHUPHGJODVGHQlUOlWWDWWWRUND DYRFKOlWWDWWVlWWDXSS$QYlQGVlWWOLPHOOHU NDUGERUUH

SVART 6YDUWDSURGXNWHUVHUH[NOXVLYDXWPHQIDNWXPlUDWWGHlUELOOLJDUHlQURVWIULD2IWDKDUGHVYDUWD YLWYDURUQDKDQGWDJRFKGHWDOMHULURVWIULWWOnWJlUQDGHWJnLJHQLKDQGWDJRFKVRFNODUHWF VITT 'HYLWDYLWYDURUQDlUSnYlJDWWnWHUWD|YHUWDJHWSnYLWYDUXVLGDQ0nQJDWLOOYHUNDUHKDUJHWWVLQD YLWDSURGXNWHUHWWUHMlOWDQVLNWVO\IWRFKJMRUWGHPULNWLJWร€QD7lQNGRFNSnDWWRPQLYDOWHQYLW OXFNDSnN|NHWNRPPHUPHGVW|UVWDVDQQROLNKHWLQWHOXFNRUQDRFKGHYLWDYLWYDURUQDKDVDPPD Q\DQV INTEGRERADE 1lUYLWYDURUQDG|OMVEDNRPHQVNnSOXFNDXSSOHYVN|NHWOLWHยตUHQDUHยต'LVNPDVNLQHQPnVWHGX E\JJDLQRPGXE\WHUN|N.\ORFKIU\VI|UORUDUHQGHOLQYlQGLJWXWU\PPHGnGHE\JJVLQRFK PRQWHULQJHQNDQYDUDOLWHNQHSLJPHQDFNVnร€QWGHWEOLU $QYlQGHUQLLQWHPLNURQVnRIWDNDQlYHQGHQLQWHJUHUDVEDNRPHQOXFNDHOOHUKHOWHQNHOWVWlOODV LQLVNDIIHULHW

3 funktioner som fรถrenklar vardagen INDUKTION ,QGXNWLRQVKlOOHQJ|UDWWGHWJnUOLNDIRUWVRP SnHQJDVKlOODWWNRNDXSSYDWWHQGXNDQVWlOOD YlUPHQGLUHNWRFKH[DNW+lOOHQEOLULQWH VlUVNLOWYDUPYLONHWJ|UDWWGHWLQWHEUlQQHU IDVWSnGHQVDPWDWWGXNDQOlJJDHQWLGQLQJ XQGHUVWHNSDQQDQVRPH[WUDVWlQNVN\GGGnGX VWHNHUEDFRQXWDQDWWULVNHUDDWWGHQE|UMDU EULQQD'HWHQGDVRPNUlYVlUDWWGXKDU PDJQHWLVNERWWHQSnGLQDNDVWUXOOHUWHVWDPHG HQN\OVNnSVPDJQHW SJร„LVRENGร–RING 6WlGDXUXJQHQlUMXLQWHGHWUROLJDVWHVRP ร€QQVPHQPHGHQXJQVRPKDUS\URO\WLVN VMlOYUHQJ|ULQJVOLSSHUGXGHW'HQKDUGn HWWยตNUHPHULQJVSURJUDPยตVRPEUlQQHUDOOD PDWUHVWHUWLOODVNDVRPPDQVHQEDUDNDQ WRUNDXU NOFROST 6MlOYDYIURVWDQGHN\ORFKIU\Vยต1R)URVWยตJ|U DWWGXDOGULJEHK|YHUVOLWDPHGDWWIURVWDDY

3 bรคnkskivor LAMINAT 'HWDOOUDYDQOLJDVWHRFKELOOLJDVWHPDWHULDOHWLElQNVNLYDQlUODPLQDWPHQGHWEHK|YHULQWHYDUD WUnNLJWI|UGHW/lJJWLOOHQIUDPNDQWLDOXPLQLXPHOOHUPDVVLYWWUlVnVHUGHWJHQDVWOLWHPHU SnNRVWDWXW/DPLQDWร€QQVLPlQJGHUDYIlUJHURFKlUUHODWLYWOlWWDWWE\WDXWGHQGDJQLYLOOJHN|NHW HQXSSIUlVFKQLQJ ROSTFRITT STร…L 7lQNHUQLKDGLVNElQNLN|NHW"/nWGHQJn|YHUDOODVNnSHQRFKIlOOQHUKlOOHQ9DUEHUHGGSnDWW VNLYDQPHGVWRUVDQQROLNKHWNRPPHUDWWXSSOHYDVVRPYlOGLJWUHSLJGHWI|UVWDnUHWPHQGHW I|UVYLQQHU7LOOVOXWlUGHQVnIXOOPHGUHSRUVnDWWUHSRUQDLQWHOlQJUHV\QVSUHFLVVRPSnHQ JDPPDOGLVNElQN CORIAN +DUPDQOLWHVW|UUHSOnQERNRFKYLOOKDHWWNXORFKKnOOEDUWPDWHULDOPHGRlQGOLJDP|MOLJKHWHUlU &RULDQHWWDOWHUQDWLY'XVOLSSHUVNDUYDURFKVNXOOHPRWI|UPRGDQHQRO\FNDKlQGDJnUGHWDWW UHSDUHUDHQVNDGD(IWHUVRPGHWlUHWWSRUIULWWPDWHULDOlUGHWVXSHUOlWWDWWKnOODVNLYDQUHQRFKIUlVFK



5 mรฅsten ,QGXNWLRQVKlOO 0MXNVWlQJQLQJSnOnGRURFKOXFNRU 8QGHUOLPPDGYDVN 6MlOYDYIURVWDQGHN\ORFKIU\V ,QWHJUHUDGGLVNPDVNLQ


Stövlar från Zdar

! s i t t gurna e g n ä l r & bo

fal Välkomna Maria & Gitte Detalj i Dalarna • Stora Vägen 30 • Vikarbyn Intill riksväg 70 Tel butik 0248-20210 • info@detalj.se • www.detalj.se Öppet ons – fre 11-18, lör 10-14.

Rätt ljus för ditt hem

www.ljusexperten.se

Från och med 20 maj så får du Nolltvå direkt i din brevlåda

HUSTILLVERKNING efter önskemål ARKITEKTHJÄLP vid planering

LjusExperten Kupolen Borlänge, Tel: 0243-81042, Vard 10-20, Lörd 10-17, Sönd 11-17

Välkommen in till oss. LjusExperten Kupolen Borlänge, Tel: 0243-81042, Vard 10-20, Lörd 10-17, Sönd 11-17

0706-73 14 19 • 0706-02 61 99 www.mästarvillan.se


SKร–NHET

Skรถnhet vรฅren 2011 Den lรฅnga vinterkylan har inte varit nรฅdig mot hud och hรฅr. Dรคrfรถr behรถver du vรฅrda detta extra mycket just nu. Kosta pรฅ dig kvalitetsprodukter som passar just din hud- och hรฅrtyp sรฅ kรคnner du dig mycket frรคschare! Eller sรฅ kan du fuska lite ocksรฅโ€ฆ $9$QQD:DKOElFN Nagellack 3ULVYlUWQDJHOODFNVRPSLIIDUXSS WU|WWDQDJODU)UnQ'HSHQGRFK NRVWDUFDNUVWKRV.LFNV

Askungekrรคm

Herrparfym

&ODULQV%HDXW\)ODVK%DOPlUHQDVNXQJHNUlPVRP JHUHWWOLWHWยตVN|QKHWVO\IWยตRFKPLQVNDUDOODWHFNHQSn WU|WWKHW*HUHWWOnQJYDULJWRFKRWUROLJWYDFNHUWPDNHXS UHVXOWDW,GHDOLVNRPGXKDUHQOnQJDUEHWVGDJIUDPI|UGLJ HOOHUVRPXSSIUlVFKDUHLQQDQGXJnUXWSnNYlOOHQ'XInU POI|UNUKRV.LFNV

%XUEHUU\6SRUW,FH)RU0HQ(G7lUHQ XSSIULVNDQGHGRIWPHGIUlVFKDWRSSQRWHUDY FLWUXVIUXVHQLQJHIlUDRFKLVNULVWDOOHU'XInU POI|UNUKRVHOHYHQVH

Krรคm fรถr grabbar 0RLVWXUL]LQJ5HFRYHU\&UHDPIUnQ6KLVHLGR 0HQlUHQnWHUIXNWDQGHNUlPVRPYHUNDU RPHGHOEDUWSnKXGVRPSnJUXQGDYXW WRUNQLQJRFK\WWUHSnIUHVWQLQJDUNlQQVVWUlY RFKLUULWHUDG'HQOXJQDUVNDGDGKXGVDPW KDUDQWLLQรDPPDWRULVNDHJHQVNDSHUPO NRVWDUNUKRV.LFNV

Ansiktsmask *ODPRXUรDJH0LD6XEOLPH)DFH0DVNlUHQ PDFDGDPLDQ|WROMDEDVHUDGDQVLNWVPDVNVRP J|UXQGHUYHUNI|UWU|WWK\.RVWDUNUI|U POKRVHOHYHQVH

Hรฅrkur 6DFKD-XDQ+DLU5HSDLUlUI|UVOLWHWRFK |YHUEHKDQGODWKnU,QWHQVLYKnUNXUPHG DOJSURWHLQHU+MlOSHUWLOODWWnWHUVNDSDVW\UND LKnUHW*HUHWWIRUPEDUWIULVNWRFKJODQVLJW KnU/RYDUOnQJYDULJHIIHNWPONRVWDU NUKRV$SRWHNHW

Organisk badolja *OLGQHULHWWYDUPWEDGWLOOVDPPDQVPHG -R:RRG2UJDQLFV$PND2UJDQLF%DWK2LO 'HQKlUO\[LJDEDGROMDQlUIXOODYRUJDQLVND RFKYlOJ|UDQGHROMRUPONRVWDUNU KRVHOHYHQVH

Skimmerkrรคm 18;(+XLOH3URGLJLHXVH2UlUHQVNLPUDQGHWRUU JXOGROMDI|UDQVLNWHNURSSRFKKnU*HUHWWUDIร€QHUDW SlUOHPRUVNLPPHUWLOONLQGHUGHNROOHWDJHD[ODURFK DUPDURFKJ|UKXGHQVDPPHWVOHQXWDQDWWNlQQDV IHW)|UQ\DUKXGHQVFHOOHURFKPRWYHUNDUI|UWLGLJW nOGUDQGHDYKXGHQPONRVWDUNUKRVHOHYHQVH



Hรฅrsvall 'U|PPHUGXRFNVnRPHWWOnQJWRFKรXIร€JWKnUVYDOO" 'nร€QQVGHWHQXSSVM|DYSULVYlUGDFOLSRQVHWSn QlWHW3nPLQร€[DUGXYlUVWDVYDOOHWI|USL[ )LQQVWLOOH[HPSHOKRVUDSXQ]HORIVZHGHQVH

Parfym /\[LJRFKH[NOXVLYlU-XLF\&RXWXUH9LYD/D-XLF\VRPGRIWDU YLOGDElUPDQGDULQNDSULIROJDUGHQLDRFKMDVPLQPONRVWDU NUKRVHOHYHQVH


Nu bjuder vi på 3 månader! Bli medlem i Unionen så får du alla våra tjänster och förmåner kostnadsfritt* hela det första kvartalet. *Du betalar bara avgiften till a-kassan och eventuell klubbavgift. Läs mer på unionen.se eller ring 0771-743 743.

Juridisk rådgivning

Karriärcoachning

d n a t y l f n I på jobbe

Inkomstförsäkring

Lönestatistik

FACKFöRBUNDET FÖR DIG I DET PRIVATA ARBETSLIVET


LINN LÖWES

KRÖNIKA

kärlekens dag ALLA HJÄRTANS DAGmVHIXMHEK 0mW )R HEKQERERXMRKIRLEXEVIPPIVmPWOEV(IXXEoVLEVNEK WIXXJVEQIQSXHIRREHEKI\XVEQ]GOIX%PPEWMRKPEVJoV LSTTE}ZIVHIWWEVEHIVSQHIZMPPIPPIVPmWEHIQSGL WIEXXHIX½RRWLSTTSQOmVPIOIR]SYVGLSMWI ,YVWSQWoZEOREHINEKFVIHZMHQMRmPWOPMRKOP 2mVNEKOSQYXJVoRFEHVYQQIXWXSHJVYOSWXIR WIVZIVEHFVIHZMHIXXOSVXQIHXI\XIR±.EKmPWOEVHMK² 4oFEOWMHEREZOSVXIXWXSHHIXXVIWEOIV)VMOTPERIVEX J}VSWWHIRREHEK )RLIPHEKTo6SQQI%PTMR oVWIHERNEKWXSHTo IRWRS[FSEVHQIRZMWWXOSQNEKRIVJVoRFIVKIX  1MHHEKYXI&MS9RHIVFEVX (IXJERRWXZoWEOIVXMPPToFSVHIXHIWWYXSQ GLSOPEHWIVZIVEHIMIXXTEVOSTTEVWSQNEKWEKXXMPP QMROmVEZmR%RREEXXNEKZMPPILEWSQLSRMWMRXYV WEKXXMPP)VMO7RIEO] 7MWXQIRMRXIQMRWXIXXJSXSEPFYQSGLIRIRKoRKW OEQIVE*SXSEPFYQIXWOEPPJ]PPEWQIVSGLQIVJ}VZEVNI EPPELNmVXERWHEKWSQTEWWIVEV7o½RX )VMOLEVMRXImRJoXXWMR±TVIWIRX²EZQMK1IRNEKOER XEPESQJ}VIVEXXHIXmVIRWXNmVREToLMQPIRWSQNEK H}TXMZoVEREQR

Bloggfest på Club Etage LÖRDAGEN DEN 12/2WEQPEHIWIXXXEPFPSKKEVIJVoRLIPE7ZIVMKI ToREXXOPYFFIR)XEKIM*EPYR(IXZEVHYOEXQIHZMXEHYOEVXmRHEPNYW SGLQYQWMKEXMPPXYKK1oRKEFPSKKEVILEHITPERIVEXOZmPPIRWSYX½XM QoREHIVEPPXJVoRXSTTXMPPXoZEVRSKKVERXYXXmROX,oVIXPoKTIVJIOX SGLWQMROIXZEV¾mGOJVMXX /ZmPPIRF}VNEHIQIHQMRKIPZmPOSQWXHVMROSGLQYWMOJVoRIR EPPHIPIWIKIRHN:MJSVXWEXXIQIHSPMOEXmZPMRKEVSGLYXWoKWIHERoVIXW XZoJEZSVMXFPSKKEV:MRREVREZEVFVS[RWYKEVFPSKKWISGL(EPEVREWIKRE KE]QEWIRWI -WPYXIXEZOZmPPIRHIPEHIWHIIJXIVPmRKXEHISGLTVSTTJ]PPHEKSSHMI FEKWIRYX(IMRRIL}PPEPPXJVoRWQMROSGLLoVTVSHYOXIVXMPPFVYRYXER WSPWXVYQTSVYRHIVOPmHIVSGLJVmWMKEWTIPJVoRWTIPI\TIVXIRGSQ 4STYPmVEWXMKSSHMIFEKIRZEVOERWOIXERHFPIORMRKIRJVoR&I'SR½HIRX LYHTVSHYOXIVREJVoR%GSIPPIVWQMROIXJVoR0SVIEP JAG, OCH MIN VÄN %RRELEVTPERIVEXHIRREOZmPPMJ]VEQoREHIV SGLmZIRSQHIXOmRRWWSQIRZMWWPmXXREHEXXEPPXKMGOFVESGLEXX OZmPPIRZEVIRWXSVWYGGqWoOmRRWHIXSGOWoZmPHMKXXSQX :MLEVWTIRHIVEXXMQQEVZEVNIHEKQIHEXXTPERIVEQEMPEWTSRWSVIV SGLK}VEEPPXZMOYRHIJ}VEXXJoIRP]GOEHOZmPP:MZEVWoOSRGIRXVIVEHI ToJIWXIREXXZMRoKSRXMQQEMRRERHIXZEVHEKWJ}VSWWEXXoOEMZmK MRWoKEXXZMMRXIIRWZMWWXIZEHZMWOYPPILEToSWW :MZMPPHSGOKIIXXIRSVQXXEGOXMPPHEPX}WIRSGLQEOIYTEVXMWXIR ,IPIR8SVWKoVHIR LMMPIRFPSKKWI WSQWQMROEHISWWMRJ}VJIWXIR,SR P]JXIIXXWXSVXFIVKJVoRZoVEE\PEV %XXJoWMXXERIVMIRXMQQEQMXXMEPPWXVIWWSGLFPMWQMROEHIZEVKYPH ZmVX(IWWYXSQmVLSRSXVSPMKXTVSJJWMKSGLXEVJVEQHIXZEGOVEWXIM ZEVNIQmRRMWOE 2SPPXZoWIKREZMQQIPJSXSKVEJ%RHVIEW%RHIVWWSRLNmPTXISWWEXX JoRKEOZmPPIRToFMPH7XSVXXEGOXMPPLSRSQSGLEPPEYRHIVFEVEFPSKKEVI WSQOSQFN}HToWMKWNmPZESGLKNSVHIHIRREOZmPPQMRRIWZmVH 7MWXQIREFWSPYXMRXIQMRWXZMPPZMXEGOEREXXOPYFFIR)XEKIWSQMRXI FEVEPIZHIYTTXMPPZoVEJ}VZmRXRMRKEVQIRWSQmZIRKEZSWWHIXHmV PMPPEI\XVE(IZEVTVSJIWWMSRIPPELNmPTWEQQESGLSXVSPMKXP]L}VHE +VEFFEVRETo)XEKIZEVmZIRHIWSQOSQQIHHIRJERXEWXMWOEMHqR EXXZMWOYPPIZMWE:MGXSVME´W7IGVIX*EWLMSRWLS[ToXZETTEVEXIVREYRHIV OZmPPIR(ISQZERHPEHIIREHIPIREZREXXOPYFFIRXMPPIRVSQERXMWO TIVWSRPMKSGLLIPXTIVJIOXQMPN}J}VIXXKmRKRIVZ}WESGLJ}VZmRXERW JYPPEFPSKKEVI :MPPRMPmWEQIVWIZEHWSQK}QHIWMKMHITVSTTJ]PPHEKSSHMIFEKWIR IPPIVWIFMPHIVJVoRHIRREQEKMWOEOZmPPWomVHIXFEVEEXXFIW}OEZoVE FPSKKEV 0MRRPMRRPS[IWGSQ %RREQEHIMRNETERRY

VINTERAKTIVITETER 1MRTSNOZmRFSOEHIMRSWWToIRLIPHEKM6SQQI%PTMRToEPPE LNmVXERWHEK(IXZEVWNYoVWIHERNEKWXSHToIRWRS[FSEVH *}VWXoVRMWNYoV#:EVXXEVXMHIRZmKIR:mPToTEVOIVMRKIRZMWEHI FMPIRXIQTIVEXYVIRKVEHIV-RXIWoNmXXIPSGOERHIEXXWXMKEYV OERWOI&EGOEVREWoKHYFFIPXWoFVERXEYXmRRmVNEKZEVVYRX oVKEQQEP YRK HIWWYXSQ (IXZEVVYKKMKXOEPPXMWMXXPMJXIRToZmKYTTJ}VJ}VWXEoOIX:mPYTTI ZEVNEKLIPXWmOIVToEXXNEKZEVOIRWOYPPIJoToQMKFVmHERIPPIVXE QMKRIVPIZERHI&VmHER)VMOL]VXXMPPQMKZEVGQPmRKVImRHIR NEKmKHIJ}VWMWoHmVWNYoVWIHER(IROmRHIWNmXXIXYRKSGLKMGO MRXIEPPWFVEEXXWZmRKEQIH.EKXSKQMKRIVJ}VLIPEPoRKEFEGOIR QIHFEVERoKSRZYVTELmVSGLHmV+ERWOER}NHEXXNEKLEHIPMZIX MFILoPP :MHERHVEoOIXJ}VWXSHNEKEXXHIXMRXIZEVFVmHERWSQZEVWo JEWPMKXXYRKYXERNEKWSQZEVSXVSPMKXSXVmREH&IRIRZEVWSQ WTEKIXXMZMPOIXMRXImVWoFVEJ}VRmVQERWPETTREVEZWoJEPPIVQER WSQIROmKPE 8SKQMKRIVmZIRHIRREKoRKQIRQIHWXSVEFPoQmVOIRTo ORmRE,ELE-RRERXVIHNIoOIXLERRZMMRSGLZmVQESWWRoKSR QMRYX&MXERHIO]PE8VIHNIKoRKIRMWMXXPMJXIROmRHIWHIXWSQ ERWMOXIXWOYPPIJEPPEEZToKVYRHEZO]PER :MFIWXmQHISWWVmXXWREFFXEXXHIXXE½GOFPMHIXWMWXEoOIX JVYWREWSQZMZEVFoHEXZo.EKXSKQMKRIVQIRSNZEHK]QQIX PSGOEVRY8VmRMRKWZmVOIROSQRSKVIHERRmVNEKWPSKRIVVYQTER MJVEQWmXIXToFMPIR2mWXEoVWOENEKO}TEQMKIRIKIRFVmHEMKIR HIXmVNYJEOXMWOXWoVSPMKXWSQEPPEWmKIVEXXHIXmV.EKLEHIFEVE KP}QXHIXIJXIVWMWoHmVWNYoV

VI VILL TACKA ALLA FANTASTISKA SPONSORER SOM GJORDE DENNA BLOGGFESTEN MÖJLIG: &IGSR½(IRX 8MHRMRKWOYRKIR 0SVIEP 2EMPWLST 'EVISJ'EVP ;IEVMX 3&,2SVHMGEQIH&N}VR%\qR8SSPW &YXXIVMGOW)HKI 0YWXNEOX &IGGE(IWMKR 8IRHIR^ 2EXYZMXEP -E1ME´W 6SWIRWIVMIR %GS 1],IEVX &IEYX]4PERIX :IHE0MPE 1IH8V]GO ;I0SZI&IEYX] &EVE&VMPPSV 'PYF)XEKI &IVV]8IQTXEXMSYW 8SO]S.ERI 6ETWSHMRI 4EYPE1]S 8MOIM %PPF]REXYVI (IVQSWLST (ITIRH 3VM¾EQI 4V]HPMKX 1S]EREGSVMKER ,IROIP +SPH[IPP 2SVHPNYW /ER(II +SSHMIFEKRY 2S(SYFX :MWEKI3RPMRI 7TIPI\TIVXIR 'ERHMIH4SMWSR 4MRO3V(IEH 0MFVIWWI (VIWWVSSQ

saker att se fram emot Club Etage Tack för en bra kväll

SOMMAREN /ERMRXIWmKEHIXXMPPVmGOPMKXQ]GOIX QIRNEKPmRKXEVXMPPWSQQEVIR 8mROIVKVmWIXYRHIVJ}XXIVREWERH QIPPERXoVREKPEWWMWSPIRSGLMRXI QMRWXEPPEWIREYXIOZmPPEV.EKPmRKXEV IJXIVWSQQEVIRZEVNIZMRXIVQIR HIXXEoVmVHIXI\XVIQX



SOMMARLOVET :MWWIVPMKIRLEVNEKMRKIXWSQQEVPSZ SGLLEVMRXILEJXToIRLIVVERW QEWWEoV1IRHIXmVmRHoRoKSX WTIGMIPPXQIHXMHIRHoQoRKEXEV WXYHIRXIRIPPIVKoVToWSQQEVPSZ

UTESERVERINGAR dLZEHWO}RXHIXOSQQIVEXXFPM RmVQEROERWPmRKEYRHERHIRWXSVE OPYQTMKEZMRXIVNEGOERSGLWTVMRKE RIVToWXERMFEVEXWLMVXJ}VEXX Q}XETSPEVREToIRYXIWIVZIVMRK SGLFEVEWTEREToJSPO

SEMESTER ,YVWO}RXmVHIXMRXIEXXFEVEOYRRE HVEMZmKIXXXEKToSFIWXmQHXMH,MX IPPIVHMX9XSQPERHWIPPIVToWZIRWO QEVO(IWTIPEVMRKIRVSPP&EVEQER ZIXEXXQERLEVQ}NPMKLIXIREXXK}VE ZEHQERZMPPTVIGMWRmVQERZMPP

Läs mer om Linn på LINNLOWES.COM


Ă&#x2026;F expanderar i Dalarna I vĂĽrt expansiva skede i Dalarna sĂśker Ă&#x2026;F nu dig med erfarenhet frĂĽn branschen, konsult alternativt entreprenĂśr, inom nĂĽgot av fĂśljande tekniska omrĂĽden:

- Järnväg - Geoteknik - Väg & TraďŹ k - El - VVS - IndustrirĂśr - Elkraft - Automation - Mekanik FĂśr mer info om alla inriktningar besĂśk: www.afconsult.com/jobb

. . . r e t t ä s t r o f a SuccÊn bar

Ny Tjejväll pü Romme fredag 1 april med trollkarl/illusionist i världsklass!

Nu är det dags att samla och ha roligt tillsammans med sina tjejgänget fĂśr en trevlig kväll med vänner, arbetskamrater etc. god mat och häftig underhĂĽllning i en annorlunda och fräck miljĂś! Skynda nu att boka, platserna brukar snabbt ta slut. Ring SĂśren Tjejkvällar pĂĽ Romme är väldigt pĂĽ Romme, 0243-23 39 68. Läs populära.Senast i oktober 2010 mera pĂĽ www.dalatravet.se slog vi nytt rekord med Ăśver 400 Mycket välkommen pĂĽ en jättetrevlig kväll! tjejer pĂĽ plats i travrestaurangen. Den här kvällen gästas â&#x20AC;?Tjejkvällenâ&#x20AC;? av en illusionist och trollkarl i världsklass. Love Melander hĂĽller â&#x20AC;?Joe Laberoklassâ&#x20AC;? och är kungafamiljens speciella favorittrollkarl. En magisk show som fĂśrtrollar som ni inte fĂĽr missa! Man behĂśver inte vara ett dugg insatt i travet fĂśr att vara med pĂĽ en tjejkväll. Det viktigaste är att träffas $QPlOGLWWWMHMJlQJVHQDVWPnQGDJPDUV Sn 6|UHQ 1LE|UYDUD PLQVWIHPSHUVRQHULVlOOVNDSHW6N\QGDDWW ERNDLQGLWWWMHMJlQJLQQDQSODWVHUQDWDUVOXW

Pris 375 kronor  EntrĂŠ & travprogram  FĂśrrätt, varmrätt & kaffe  En cider alt. en starkĂśl till maten  Andelssystem pĂĽ V5  Spännande utställningar  â&#x20AC;?Hästägare fĂśr en dagâ&#x20AC;Śâ&#x20AC;?  Trollkarl i världsklass  Tävlingar med ďŹ na priser


welcome Ryan! Vi på redaktionen hälsar fotografen Ryan Garrison varmt välkommen till oss på nöjestidningen Nolltvå. Efter några år som vår mest anlitade modefotograf så var det en självklarhet att anställa Ryan nu när tidningen är i ett expansivt skede. Vi bad Ryan berätta lite mer om sin bakgrund samt varför han valde just Nolltvå som arbetsgivare.  7H[W3DWULFN(NEORP)RWR5\DQ*DUULVRQ VnNODUW

DET HAR SAGTS DWWHQELOGVlJHUPHUlQWXVHQRUG(IWHUVRPDWWMDJKDU P\FNHWDWWVlJDVnlUGHWDQOHGQLQJHQDWWMDJKDUYDOWDWWXWWU\FNDPLJVMlOY JHQRPIRWRJUDIHULQJ bQGDVHGDQMDJYDUXQJKDUMDJDOOWLGYDULWIDVFLQHUDGDYP|MOLJKHWHQDWW NXQQDI|UPHGODHWWEXGVNDSYLVXHOOW0\FNHWWLGLJWE|UMDGHMDJDWWVWXGHUDROLND IRUPHUDYNRQVWPHQGHWYDULQWHI|UHQVMDJSORFNDGHXSSHQNDPHUDVRPMDJ NlQGHPLJKHOWKHPPD ,nUDWDOKDUMDJWDJLWELOGHUDYUHQNlUOHNWLOONRQVWHQEHDUEHWDWGHWWDRFK OlUWPLJPHURFKPHUOlQJVYlJHQ ,QWHEDUDOlUDPLJGHQWHNQLVNDVLGDQDYIRWRJUDIHULQJPHQRFNVnDWWKLWWD PLJVMlOYLGHWMDJJ|U )|UQnJUDnUWLOOEDNDE|UMDGHPLWWDUEHWHDWWInQJDWLOOUlFNOLJWPHG XSSPlUNVDPKHWI|UP|MOLJKHWHUQDDWWOHYDSnYDGMDJJMRUGHXSSHQEDUDGH VLJ(QWXVLDVWLVNDWWI|OMDGHQQDGU|PG|NMDJPHGKXYXGHWI|UVWRFKE|UMDGH DUEHWDVRPIRWRJUDI UNDER DE SENASTE ÅRENKDUMDJIRWRJUDIHUDWWLOOHWWDQWDODQQRQVE\UnHU WLGQLQJDURFKPDJDVLQEnGHORNDOWRFKLQWHUQDWLRQHOOW 0LQIDYRULWNXQGKlUL'DODUQDKDUDOOWLGYDULW1ROOWYn'HKDUDOOWLGYDULW |SSQDI|UPLQDLGpHURFKVWUlYDWHIWHUDWWJ|UDHQYLVXHOOWVWDUNWLGVNULIW6n QlUP|MOLJKHWHQDWWEOLHQVW|UUHGHODYWLGQLQJHQG|NXSSVnWRJMDJFKDQVHQ 'HWLQQHElUDWWLQRPPDJDVLQRFKWLGQLQJDUKlUL'DODUQDVnMREEDUMDJ H[NOXVLYWI|U1ROOWYn JAG SER FRAM EMOTDWWVDWVDP\FNHWPHUWLGRFKHQHUJLWLOOVDPPDQV PHGUHVWHQDYUHGDNWLRQHQKlUSn1ROOWYnLDWWJ|UDHQUHGDQVWDUNSURGXNW lQQXVWDUNDUH


0 0 1 3 D n Niko : 0 9 9 4 u n t jus R V 5 5 8 1 d e m Så långt lagret räcker!

EN RIKTIG FOTOBUTIK Framkallning på 1 timme Ny fräsch lokal på Åsgatan 12 Välkommen!

Fullsortimentsbutik med allt för amatörer och proffs 023-711 221 | www.fotoabild.se | Åsgatan 12 791 71 Falun


MUSIK

krönika

HÅRDA PLATTA PAKET. LÄS FREDRIK B NILSSON KRÖNIKA I ÄMNET.

Don’t Stop the Music – Alice, Robyn, Reinfeldt MUSIK KAN VARA ALLT.2FKLQJHW,EODQGSnVDPPDJnQJ0DJLVNW²DOOWLG 'HQVHQDVWHWLGHQKDU5RE\QGRPGHUDWRFKEOLYLWEHO|QDGI|UVLQLQVDWV SnVFHQHQ(QPRGHUQLVHUDGYHUVLRQDY*DUERRFK0DGRQQDPHGJUDFH LQWHJULWHWRFKND[LJKHWVRPKDUWDJLWKHQQHWLOORDQDGHK|MGHU)UHGVSULVJDODQ L2VOR*UDPPLVDU0XVLNH[SRUWSULVRFK3*XOG8SSPlUNVDPPDGL86$ RFKUHVWHQDYYlUOGHQ+RQlUHWWOHYDQGHEHYLVSnNYLQQOLJVYHQVNPXVLNDOLVN XUNUDIW6YHULJH6WROW0XVLN 7lQNHURFNVnSn$OLFH&RRSHUDOOWVn6HQDVWMDJVnJKRQRPYDUQlUKDQVDWW SnVDPPDSUHVVNRQIHUHQVVRP0HORGLIHVWLYDOGRFNDQ0DULH6HUQHKROWRFK KHQQHVFUHZL$7HHQV'HKDGHHWWVDPDUEHWHRFK$OLFHKDGHQnWWERWWHQ W\QJGDYGnOLJWVlOOVNDSRFKHQPDVVD&DOODZD\JROIVSRQVULQJVSHQJDU$OOWlU GRFNI|UOnWHWQlUKDQVQDPQG\NHUXSSSn*HWDZD\VDIÀVFKHULQI|UNRQVHUWHQ L*lYOHWLOOVRPPDUHQ2UP6WROW0XVLN 3nWU|VNHOQWLOO6WRUEULWDQQLHQVQ\OLEHUDOHXWUHQVDUH'DYLG&DPHURQVWnUYnU VYHQVNHGLWRRFKZDQQDEHODQGVIDGHU OlVODQGVOlQVDUH +HUU5HLQIHOGW7Yn SOXVVDUHVRPEHWHUVLJVRPXUJDPODJXEEDURFKVDPWLGLJWI|UV|NHUYDUD OLWHFKLFNDJHQRPDWWO\IWDIUDPµHQWUHSUHQ|UHUVRP6SRWLI\µ8QGHUHQUHVD PHGUHJHULQJVIRONÀFNGHWVYHQVNDPXVLNXQGUHWLIRUPDYHQGLJLWDOOHYHUDQW|U YLVDXSSVLJSn'RZQLQJ6WUHHW$WW+HUU5HLQIHOGWVWnUI|UDWWGHQLOOHJDOD PXVLNVSULGQLQJHQVNDInIRUWJn OlVGHQPRGHUDWHSLUDWHQ.DUO6LJIULGVLQOlJJ SnQlWHW OlJJHU\WWHUOLJDUHHWWEHYLVI|UDWWDOOLDQVUHJHULQJHQOMXJHURVVUlWW XSSLIHMMDQlQQXHQJnQJ6YHULJH6W|OG0XVLN 'HWJnULQWHDWWVWRSSDPXVLNHQ'lUHPRWE|UYLI|UV|NDVWRSSDHOHPHQW VRPDQYlQGHUVLJDYDUWLVWHURFKGHUDVPXVLNI|UDWWO\IWDIUDPVLQDRlUOLJD EXGVNDS0XVLNVNDSDGL6YHULJHJ|ULDOODIDOOPLJVWROW²QlVWDQDOOWLG )UHGULN%1LOVVRQ

Charlotte Berg

Liny Wood

Patrik Jansson Band

FRITT FALL

LINY WOOD

PATRIK JANSSON BAND

CD: 1lUPDQKDUWUlIIDWHQSHUVRQ PHQDOGULJK|UWGHQQHVPXVLNlUGHW H[WUDLQWUHVVDQWDWWWU\FNDSnSOD\6DWW EUHGYLG&KDUORWWHLHQVRIIDI|UHQWLG VHGDQ(WWµ+HMµRFKµ9HPlUGX"µ² LQJHWPHU/\VVQDUQXSnDOEXPHW)ULWW IDOO²WlQNHUµ0HUµ &KDUORWWHKDUN|UDWEDNRPVYHQVND JLJDQWHUVRP:LQQHUElFNRFK/XQGHOO RFKlYHQVOlSSWWYnDOEXPPHG &KDUOLHV0DJD]LQHVDPWHQSODWWDXQGHU QDPQHW&KDUORWWH 'HDL-DSDQ *RWOlQGVNDQGUDEEDGHVDYHQ KMlUQWXP|ULVOXWHWDYI|UUDPLOOHQQLHW RFKKDUQXLQJHQK|UVHOSnHQD|UDW $WWQnJRQVRPK|UVnLOODNDQOnWD VnEUD /lVHUQXHQERNPHGVDPPD WLWHOVRPSODWWDQ)ULWWIDOODYQREHO SULVWDJDUHQ-RVHSK(6WLJOLW]RPGHQ NULVDQGHYlUOGVHNRQRPLQ&KDUORWWH %HUJVYHUVLRQKDUOLNDP\FNHW NRQFHQWUHUDGNULVLVLJPHQXWIDOOHW lUKRSSRFKLQWHVDPPDQHGnWJnHQGH VSLUDOVRP6WLJOLW]I|UXWVSnU$OEXPHW lUHQGLPHQVLRQHOOWUDNWPHGHQ JDPPDOV\QWKSDUNLERWWHQRFKHQ OlWWUHYHUEEXUHQVnQJLI|UJUXQGHQ ,QVSLUDWLRQKDUKlPWDWVIUnQWDOHWV WLGLJDSURGXNWLRQHU²GnÁlVNLJD YLUYODUlQQXLQWHYDUIUlPVWDVLJQXP ²RFKGHWIXQJHUDUP\FNHWEUDXWDQ DWWWDSSDOLY'HWDNXVWLVNDlUGRFN QlUYDUDQGHLJLWDUUHURFKWUDGLWLRQHOOD N|UDUUDQJHPDQJ&KDUORWWHVVnQJVlWW WLOOI|UYlUPHRFKWDQNDUIDULYlJWLOO DQGUDUHVSHNWHUDGHVYHQVNDDUWLVWHU +RQOHYHUHUDUHQVW\UNDLVnUEDUKHWHQ RFKGH&KDUOLH3HUVVRQQHGWHFNQDGH WH[WHUQDJ|UKRQWLOOVLQDHJQD )DNWXPlUDWWLQJHQDYVSnUHQSn SODWWDQWDSSDULNlQVODRFKNYDOLWHW /nWDUQDJnUSnUHSHDWI|UPLQHJHQ VNXOORFKI|UDWWMDJKlUInUFKDQVHQ DWWPLVVLRQHUDRPHWWULNWLJWEUD DOEXP1lVWDJnQJLVDPPDVRIIDEOLU GHWPHUlQHWW+HM

CD:1lUMDJWLWWDUSnNRQYROXWHW RFKEOlGGUDUEODQGELOGHUQDSn/LQ\ :RRGVHUMDJHQWDWXHUDGURFNEUXG VRPVHUULNWLJWKnUGXW0DKRJQ\ %|UMDUDWWOlVDELRJUDÀQRFKVHU DWWKRQlUHQHUIDUHQVYHQVNDPHG U|WWHUQDLGHQVPnOlQGVNDP\OODQ 0DOXVGRPHVWLFD 9LGDUHJnUDWWXWW\GDKHQQHV NULQJHONURNLJDYlJPHGPXVLNHQVRP OHGVWMlUQDGlUKRQEODQGDQQDWKDU MREEDWVRPJLWDUUWHNQLNHURFKlU XWELOGDGJLWDUUE\JJDUH-DNDUDQGD 6RPnULQJEDUGHWDYWLOO +ROO\ZRRGI|UVWXGLHUSn0,RFKI|U DWWELOGDEDQGHW7KURZ$ZD\+HURHV PHG3QNVEDVVLVW-DQLV7DQDND :HOOLQJWRQLD 0XVLNHQKDUHQNlUQDPHG nOGHUVULQJDUQnJRQVWDQVNULQJ PLWWHQDYRFKE|UMDQDY WDOHW5RFNMDYLVVW0HQLQWH UDNWLJHQRPNQDOOKnUG(QUnKHW LU|VWHQRFKIUDPWRQLQJHQPHG WDJJLJDV\QWKYLEUDWRQEDUNULVSDQGH JLWDUUHURFKURWYlOWDQGHWUXPEHDWV GnRFKGn0HQGlUHPHOODQlUIUDVLJD O|YYHUNRFKYHNDJUHQSDUWLHUHQ OLNDVWRUGHODYXSSOHYHOVHQ(Q YlOXWYHFNODGÁRUDPHGOLNDGHODU KLWVlNHU%HOLQGD&DUOLVOHRFKUnKHW D·OD:HQG\2:LOOLDPV/LQ\:RRG EODQGDUDWWULEXWSnHWWKlIWLJWVlWW VRPInUJHQUHGRJPDWLNHUDWWGDUUD VRPDVSDU+RQOlUYDUDPLQVWOLND EUDHQVDPPHGHQJLWDUURFKVLQ VlNUDU|VWVRPPHGXSSEDFNQLQJ DYSURIHVVLRQHOODPXVLNHU3ODWWDQlU SURGXFHUDGLVDPDUEHWHPHG3RODU VWXGLRQVOHYDQGHOHJHQG/HQQDUW gVWOXQGRFKlUHWWlNWDKDQWYHUN

CD: %OXHVHQlUPRGHUWLOOPnQJHQ PXVLN5\WPVHNWLRQHQlUYLNWLJL EOXHVPXVLNHQ3DWULN-DQVVRQKDU VSHODWEHW\GHOVHIXOODEDWWHULÀOOVQRUU RP'DOlOYHQEODQGDQQDWLEDQGVRP 0DU\VOLPRFK+HOOVLQJODQG8QGHU JURXQG$WWNOLYDLQLEOXHVJHQUHQ J|UPDQGRFNLQWHRVWUDIIDWGlUlU GHWVYnUWDWWYDUDQ\WlQNDQGHRFK LFNHGRJPDWLVN$WWGHVVXWRPE\WD LQVWUXPHQWRFKJUHSSDHQJXUDL VWlOOHWI|UDWWGXQNDWUXPPRUlUHQ QlVWDQEURWWVOLJKDQGOLQJ'HWKDU 3DWULN-DQVVRQJMRUWRFKKX[ÁX[ VSHODWLQHQSODWWDPHG3-%VRP VNLYERODJHWYLOOUHIHUHQVVLJQDOHUDWLOO IDQVDY6WHYLH5D\9DXJKDQRFK-RKQ 0D\DOO 0DQK|USnIRONVRPVNDSDUXWDQ RN'HWlUEHIULDQGHDWWGHVRP VNDSDUDYJOlGMHlUVn|SSQDRFK D[HOU\FNDQGHDWWGHUDVSUHWHQWL|VD NRQNXUUHQWHUVDQVWUlQJGD²RFK P|MOLJHQPHUYlOVSHODGHRFK NRUUHNWD²SUHVWDWLRQHUKDPQDUL EDNYDWWQHW3-%lUYLWEOXHVGlUPLQ I|UVWDUHIHUHQVODPSDVRPE|UMDU EOLQNDKHWHU*DU\0RRUH 5,3  7MDYDUI|ULQWH3DWULN-DQVVRQVOnWDU b5EOXHVPHQKDQKDUVNULYLWGHP VRP/c7$5I|UVWRFKIUlPVWLQWH %/8(6/c7$5+DQNRPPHUDWW WXUQHUDPHGVLQNYDUWHWWXQGHUnUHW RFKMDJYHWLQWHKXUPnOJUXSSHQVHU XWPHQPHGU|WWHULDQGUDEDQG OlUGHWÀQQDVHQJUXQGSXEOLNRFK GlUHIWHUInUYlOU\NWHWRPSODWWDQ À[DUHVWHQ'HQEHVWnUQlPOLJHQDY WLRVSnUVRPKDUHQK|JPHGHOQLYn 'HQDQGUDODPSDQVRPEOLQNDUKHWHU $FH)UHKOH\HOOHUP|MOLJHQ3HWHU &ULVV3DWULNlULQJHQK|MGDUVnQJDUH ,QWH(XURSDVElVWDJLWDUULVW0HQKDQ OHYHUVLQPXVLNRFKGHWUlFNHUOnQJW 9LWEOXHVNDQNlQQDVIUlVFK

INOM KORT… 7XUQHUDU/LQ\7\VNODQG« «WLOOVDPPDQVPHG$ODQQDK0\OHV )UHGULN%1LOVVRQ

YTTERLIGARE TVÅ ARTISTER SOM DYKER UPP I MEDVETANDET UNDER FRITT FALL: 8OI6WXUHVVRQ 7RPDV$QGHUVVRQ:LM

TA ETT LYSS PÅ FÖLJANDE SPÅR: ,·OO.HHS2Q0RYLQJ 6HSDUDWH:D\V )UHGULN%1LOVVRQ

)UHGULN%1LOVVRQ

spotlight! Thomas Di Leva HJÄRTAT VINNER ALLTID CD: )|UUDSODWWDQYDUHQFRYHUNDVNDGDYWDOVQHRQRFKIHWDJDWHYLUYODU6HQDVWH PHGLHXSSVWnQGHOVHQH[SORGHUDGHHIWHUGHOWDJDQGHWL79SURJUDPPHW6nP\FNHW ElWWUH7URWVDOOWKDU'L/HYDO\FNDWVELEHKnOOD0DQQHQ0\WHQSRVLWLRQHQLGHWVYHQVND NROOHNWLYDPLQQHW1lUKDQYLVDUVLJXWDQNDIWDQHQGDVWLNOlGGMHDQVRFKWVKLUWVRPHQ YDQOLJWMHMLYnU79UXWDÁlPWDUYLIRUWIDUDQGHWLOO9D")LQQVKDQSnULNWLJW"7RONQLQJDUQDL 79SURJUDPPHW I|UGLJVRPLQWHYHWROLNDDUWLVWHUWRONDGHYDUDQGUDVOnWDU EOHYKHOW GLOHYLVWLVNDRDYVHWWXSSKRYVPDQRFKGHWlUHWWEHYLVSnDWWKDQVHGDQVLQGHEXWSn WDOHWKDUEOLYLWHWWPHGVLQUROO bQWOLJHQKDUGHWNRPPLWHQSODWWDPHGOLWHDPELWLRQLJHQ3n+MlUWDWYLQQHUDOOWLGKDU 6YHQ7KRPDV0DJQXVVRQ²WLOOVDPPDQVPHG$QGUHDV$KOpQLXV$QGHUVµ0DYHULFNµ/XQG VWU|PRFK%ULWD%HUJVWU|P²InWWXUVLJGHGlUVWRUDRUGHQRFKXUODGGQLQJDUQDVRP VNDSDGHKDQVDOWHUHJR+DQEOLUEDVWRPWYnnURFKNDQIRUWIDUDQGHIRUPXOHUDGH nQJHVWEHIULDQGHPROOWRQHUVRPJULSHUHQO\VVQDUHVKMlUWD6RPHQ|YHUYLQWUDGWRQnUVLGRO HQYLQQDQGHYnUGDJLPDM7LJHU6nVRPLKLPOHQ9lONRPPHQKHP'DJVOlQGDRFKNlUOHNVEDO ODGHQ6RÀHlUQnJUDDYVSnUHQVRPDOOWLGNRPPHUDWWJ|UDQDPQHW'L/HYDLKnJNRPPHW



VILKA TVÅ FAKTORER ÄR DET, FÖRUTOM MELODIERNA, SOM FRÄMST HÖJER BETYGET? 6nQJHQ²IDQYDEUDVQXEEHQ\ODU 7H[WHUQD²YDFNUDRFKYLNWLJD )UHGULN%1LOVVRQ


MUSIK

FEM FRÅGOR!

klassiker Simple Minds NEW GOLD DREAM (1981) CD:1\OLJHQI|UGHVHQ)DFHERRN GLVNXVVLRQRPYLONHWVRPYDU6NRWW ODQGVElVWDEDQGQnJRQVLQ)|UYLUULQJ LQWUlGGHVQDEEWHIWHUVRPIUnJHVWlO ODUHQW\FNWHDWWPnQJDDYI|UVODJHQ YDUI|UREVN\UD0HQKDQKDGHMX EHWWRPGHElVWDLQWHGHVW|UVWD'n InUPDQUlNQDPHGEDQGVRP'HO $PLWUL7KH6HQVDWLRQDO$OH[+DUYH\ %DQG1D]DUHWK7KH%OXH1LOHRFK LQWHPLQVW%HOOH 6HEDVWLDQ 'HÁHVWDU|VWDGHGRFNSn6LPSOH 0LQGV²LQWHEDUDI|UDWWGHlU 6NRWWODQGVSRSXOlUDVWHEDQG GHYDU OlQJHVW|UUHlQ8 XWDQI|UDWWGH XQGHUPnQJDnUYDUEnGHVWRUD RFKNULWLNHUK\OODGH ([DNWQlUGHWVNHWWUnGGH RHQLJKHWRPPHQDOODYDUU|UDQGH |YHUHQVRPDWWEDQGHWYLGQnJRQ SXQNWKDGHI|UYDQGODWVWLOOWU|WWD NRORVVHUVRPI|UORUDWVLQUHOHYDQV 9DGVRPGlUHPRWVWRGNODUWYDUDWW GHWWDlQQXLQWHKDGHVNHWWSn1HZ *ROG'UHDPEDQGHWVIHPWHDOEXP 'nYDUGHVRPPHVWVSlQQDQGH(WW JDQVNDVPDOWRFKDYDQWJDUGLVWLVNW EDQGDYQ\URPDQWLNHUVRPE|UMDW InKLWVPHQlQQXLQWHEOLYLWXWVOlWDW RFKWDSSDWVLQDYLVLRQHU3URPLVHG<RX $0LUDFOHRFK*OLWWHULQJ3UL]HlUEDUD WYnNODVVLNHUWDOHWYDUHWWRVNULYHW EODG7\YlUUVDWWVnQJDUHQ-LP.HUU W\GOLJHQEDUDLQQHSnHWWEHJUlQVDW DQWDOPHORGLHULQRPVLJRFKSn/LYH $LGÀFNMDJHQNODUNlQVOD DY6LPSOH0LQGVYDUSnYlJXWI|U PHGDQ8KDGHµDQOlQWµSnDOOYDU 6nEOHYGHW0HQGHWlUHQIU|MG DWWO\VVQDSnDUWLVWHUQlUGHlU VRPKXQJULJDVW'HWWDlUHQVnGDQ SODWWD2FKLWLGHUGnDOOQlVWDQQ\ SRSPXVLNNlQQVVRPHQWLGVUHVDWLOO MXVWNDQMDJUHNRPPHQGHUDDOOD VRPLQWHYDUPHGGnDWWJnWLOONlOODQ $QGHUV/XQGTXLVW

Harry Nilsson

Beyoncé

WHO IS HARRY NILSSON… AND WHY IS EVERYBODY TALKING ABOUT HIM?

I AM… WORLD TOUR

DVD: (QDYGHPHVWIDVFLQHUDQGH EHJnYDGHRFKPRWVlJHOVHIXOOD NDUDNWlUHUGHQDPHULNDQVND PXVLNEUDQVFKHQVHWW +DQKDGHHQU|VWVRPHQlQJHO (QU|VWVRPKDQIHVWDGHV|QGHU+DQ YDUHQIDQWDVWLVNOnWVNULYDUHPHQ GHWYnOnWDUKDQJMRUGHWLOORG|GOLJD NODVVLNHU :LWKRXW<RXRFK(YHU\ERG\·V 7DONLQJ YDUFRYHUV'HWVRPVNLOGH KRQRPIUnQDQGUDIDQVDY7KH %HDWOHVYDUDWW7KH%HDWOHVYDUHWW OLNDVWRUWIDQDYKRQRP-RKQ/HQQRQ NDOODGHKRQRPµP\IDYRXULWHEDQGµ 6HGDQEOHYGHElVWLVDU2FKIHVWDGH ERUWHWWKHOWnULKRS +DQYDUUXPODUHRFKIDPLOMHIDU YDUPRFKVYnUnWNRPOLJFKDUPLJRFK VMlOYI|UEUlQQDQGH 'HQVRUJOLJDIUXVWUHUDQGHRFK NlQVORVWDUNDKLVWRULHQRP+DUU\ EHUlWWDVPHGVDPPDQDWXUOLJD NOXYHQKHWLGHQQDGRNXPHQWlU$OOD ²NROOHJRUEUDQVFKIRONYlQQHUIUXDU RFKEDUQKDUHQ+DUU\VNU|QD2FK GHInUHQEXVLJJOLPWL|JDWQlUGH EHUlWWDURPKRQRPlYHQQlUGHWGH EHUlWWDUlUVRUJOLJW +DUU\1LOVVRQU|VWNRQVWQlUHQ ÀFNWLOOVOXWJHYLNDI|U+DUU\ IHVWSULVVHQ-XVWQlUKDQKDGH EHJUDYWVGUDEEDGHVKHOD/RV$QJHOHV DYHQJLJDQWLVNMRUGElYQLQJµ'HW YDU+DUU\VRPMXVWNRPPLWIUDPWLOO KLPPHOHQRFKInWWK|UDDWWEDUHQ lUVWlQJGµVlJHU0RQW\3\WKRQV PHGOHPPHQ(ULF,GOHOHHQGH([ EHDWOHQ*HRUJH+DUULVRQRFKQnJUD DQGUDJMRUGHGHWHQGDUlWWDGH VM|QJRUGDJUDQWXU+DUU\VELWWUDVWH VHSDUDWLRQVOnWµ<RX·UHEUHDNLQJP\ KHDUW\RX·UHWHDULQJLWDSDUWVRIXFN \RXµWLOONLVWDQ2FKMRUGHQPXOOUDGH $QGHUV/XQGTXLVW

DVD: 'HWEUXNDUXSSUHSDVVRP HWWPDQWUDµ2PPDQVNDNXQQDEOL DUWLVWLGDJVnPnVWHPDQNXQQDEnGH VMXQJDGDQVDRFKYDUDVQ\JJµ0DQ KDGHNXQQDWOlJJDWLOOµVDPWVSHOD KXYXGUROOHQLHQOnQJÀOPµRFNVn 'HWWDXWWDODQGHNRPPHURIWDVW IUnQXQJDDUWLVWZDQQDEHVVRPVMlOYD KDUOLNQDQGHDVSLUDWLRQHU9DGGH LQWHVHUlUDWWGHÁHVWDDUWLVWHUVRP VLNWDWSnDWWYDUDµDOOWµIUnQGHJDPOD PXVLNDOVWMlUQRUQDYLD(OYLV3UHVOH\ RFKIUDPnWRIWDEOLYLWXWEUlQGDL I|UWLG:KLWQH\+RXVWRQlUHWWDQQDW H[HPSHO6nIXQNDUVKRZEXVLQHVV VSHFLHOOWL86$ *LYHWYLVÀQQVWXVHQWDOVH[HPSHO SnDUWLVWHUVRPEDUDVNULYHUVLQD OnWDURFKVHGDQIUDPI|UGHPUDNW XSSRFKQHUXWDQJOLWWHURFKVWMlUQ VWDWXV0HQGHWLOOK|ULQWHVKRZEL] 2PPDQYLOOKDKHODSDNHWHW² SOXVOnWVNULYDUWDODQJHQ²NDQPDQ JnWLOO5 %GURWWQLQJHQ%H\RQFp .QRZOHV +RQNRPPHUVRPVnPnQJDL KHQQHVVLWVIUnQHQEUDQVFKIDPLOM +RQYDUVXSHUVWMlUQDUHGDQL 'HVWLQ\·V&KLOGRFKIRUWVDWWHDWW YDUDGHWSnHJHQKDQG+RQKDU WDODQJHQRFKGHWGlUGULYHWVRP J|UIRONWLOOVXSHUVWMlUQRU+HQQHV VKRZHULQQHKnOOHUKLWVGDQVHIIHNWHU RFKIDQWDVWLVNDPXVLNHU$PHULNDQVN SURIHVVLRQDOLVPLQDFWLRQNDQYDUD GHWOlFNUDVWHPDQNDQXSSOHYD 0LFKDHO-DFNVRQOLYHlUEODQGGHW ElVWDMDJVHWW SUREOHPHWlUDWWPDQ RIWDVLWWHUGlULHQLVKDOOHOOHUSnHQ LGURWWVSODWVRFKWLWWDUSnVWRU ELOGVVNlUPDUVQDUDUHlQVFHQHQ'HW SnJnUMXVnP\FNHW )|UHGUDUGlUI|UDWWVHGHQQD W\SDYVKRZKHPPD,$PVKRZHQ ÀOPDGHVI|U'9'RFK%OX5D\(QIHVW I|UEnGH|JDRFK|UD9LVVWÀQQVGlU EXGVNDS0HQGHWlULI|UVWDKDQG XQGHUKnOOQLQJ(QWHUWHMQPHQW/HQD $GHOVRKQ/LOMHURWKVNXOOHMXEOD $QGHUV/XQGTXLVW

shy SHY ÄR EN ”TWENTYSOMETHING”VRPJ|UPRGHUQ5 %'HEXW DOEXPHW&OXEV +HDUWVVOlSSWHVSUHFLVGLJLWDOWYLONHWÀUDGHVPHGNLFNRIISn 3HW6RXQGV%DUL6WRFNKROP9LVWlOOGHIHPIUnJRUWLOO(OLDV5LQJTXLVWVRPKDQ HJHQWOLJHQKHWHU 1. OM DU TRÄFFAR NÅGON PÅ EN FEST OCH DE FRÅGAR VEM DU ÄR OCH VAD DU GÖR, VAD SVARAR DU? ²-DJEUXNDUVlJDDWWMDJKnOOHUSnPHGPXVLN6HQlUGHWDOOWLGOLWHVYnUWDWW VSHFLÀFHUDGnMDJJMRUWDOOWLIUnQMLQJODURFKUDGLRUHNODPWLOODWWYDUDSLDQLVW PHGYHUNDL,GROVMXQJDPHG)ULVSUnNDUQHJQDSURMHNWRFKVnYLGDUH-XVWQXlU GHWGRFNVN|QWDWWNXQQDVlJDDWWIRNXVOLJJHUSnPLWWHJHWVRORSURMHNWGHWMDJ OlQJHYHODWPHVW 2. DET ÄR INTE SÅ MÅNGA I SVERIGE SOM GÖR DIN TYP AV MUSIK. VARFÖR TROR DU ATT DET ÄR SÅ? ²'HWlUQRJÁHUlQPDQWURUHJHQWOLJHQlYHQRPMXVW5 %JHQUHQW\YlUU LQWHULNWLJWWDVSnDOOYDU9DUI|UGHWlUVnYHWMDJLQWHPHQMDJWURUDWWGHWlU HQNRPELQDWLRQDYDWWI|UOLWHXWU\PPHJHVRFKDWWVYHQVNDUJHQHUHOOWLQWH I|UVWnUVWRUKHWHQLGHVRPJ|UGHW'lUI|UNlQQHUMDJPLJH[WUDVWROW|YHU DWWKDJHQRPI|UWHWWSURMHNWVRPYHUNOLJHQEHO\VHUDOODGHELWDUVRPWLOO H[HPSHOMDJVDNQDUKlUKHPPDQ\DQVHUQHRQVRXOVWRUDDUURFKIUDPI|UDOOW KDUPRQLHU0nQJDWURUDWWVYHQVNDUlUUlGGDI|UKDUPRQLHUPHQMDJWURULQWH GHWlUKHOWVDQW)DQYLKDUMXDOODlOVNDW%nGH0LFKDHO-DFNVRQRFK3ULQFHHQ JnQJLWLGHQ 3. VILKA ÄR DINA STÖRSTA STYRKOR RESPEKTIVE SVAGHETER? ²7URUHQDYPLQDVW|UVWDVW\UNRUlUDWWMDJlUµDOOURXQGµ-DJEHKlUVNDUDOOD OHGLSURGXNWLRQHQRFKlURIWDVWVQDEEMREEDGYLONHWJ|UDWWMDJNDQVNDSDHQ |YHUEOLFNUlWWVQDEEW$WWMDJVSHODULQVWUXPHQWEUDRFKKDUHWWPXVLNDOLVNW|UD KMlOSHUPLJLGHWWD6HQKDUMDJRIWDInWWK|UDDWWMDJlUOLWHDYHQUHIUlQJNLOOH MDJKLWWDUJUHMHUVRPVlWWHUVLJYLONHWNDQVNHOHWWWLOODWWMDJInWWHQGHOVnQD XSSGUDJWLGLJDUH6YDJKHW"+PlUSHUIHNWLRQLVWYLONHWJ|UGHWOLWHVYnUWDWW YDUDVSRQWDQLEODQGVRPLGHQKlULQWHUYMXQWLOOH[HPSHOKHKH9LOOJlUQDKD NRQWUROO|YHUGHWVRPNRPPHUXW)nUMREEDSnGHW 4. VAD DRIVER DIG? ²3DVVLRQHQI|UPXVLNHQ+DUHQVWDUNNlQVODDYDWWMDJKDUQnJRWXQLNWDWW NRPPDPHGIUDPI|UDOOWKlUL6YHULJHRFKYLOOJHDOODHQFKDQVDWWO\VVQD/LWH DYGHQLGpMDJKDIWRFKKDUlURFNVnDWWWDGHWXWDQI|U'U|PPHQlUDWW6+< EOLUHQVHULHÀJXUL-DSDQ 5. VAD GÖR DU NÄR DU INTE SYSSLAR MED MUSIK? ²0LQYDUGDJNUHWVDUYlOGLJWP\FNHWNULQJPXVLNHQRFKYDGVRPEOLUQlVWD µPRYHµPHQW\YlUUPnVWHPDQLEODQGRFNVnMREEDPHGDQQDW7\FNHURP SURPHQDGHUJlUQDHQUHVDRPHNRQRPLQWLOOnWHUJRGPDWEUDÀOPHU$WWN|UD ÀOPFLWDWPHGYlQQHUInUPLJDOOWLGSnEUDKXP|U $QGHUV/XQGTXLVW

NYHET! VÄRLDEN SOM ARBETSFÄLT bQVnOlQJHlUGHWLQWHPnQJDXWDQI|UPXVLNEUDQVFKHQVRP NlQQHUWLOOKHQQHL6YHULJH0HQGHWlUEDUDHQWLGVIUnJDLQQDQ /LVD/|YEUDQGlUQDPQHWSnDOODVOlSSDU 'HQnULJDVYHQVNDQI|UGHODUVLQWLGPHOODQ86$6YHULJH RFK-DSDQ6nQJHUVNDQRFKVNnGHVSHOHUVNDQKDUDJHUDWLÁHUD +ROO\ZRRGÀOPHURFKVOlSSWWYnMD]]GRIWDQGHVRORDOEXP3nGHW VHQDVWHVM|QJKRQGXHWWPHGEnGHVXSHUSURGXFHQWHQ'DYLG )RVWHU VRPMREEDWPHGDOOWRFKDOOD RFK3DXO%XFKDQDQ YDUV PDJQLÀNDEDQG7KH%OXH1LOHYLWLGLJDUHWLSVDWRPLGHQQD WLGQLQJ 0HGYHUNDUJ|UlYHQ&KULV%RWWLSnWUXPSHW /LVD/|YEUDQGNRPPHUXUVSUXQJOLJHQIUnQ'RURWHDL/DSSODQG PHQI|UHGUDUDWWKDYlUOGHQVRPDUEHWVIlOW+RQJ|ULQJHQ KHPOLJKHWDYDWWGHQQRUUOlQGVNDMDQWHODJHQKlPPDGHKHQQH ²-DJYLOOLQWHIUDPVWlOODPLJVRPHWWRIIHUPHQPnQJDXSSOHYGH PLJVRPNRQVWLJ0LWWPnOEOHYDWWSOXJJDRFKWDPLJGlULIUnQ 5RWO|VKHWHQÀQQVNYDU²MDJERUHJHQWOLJHQLQJHQVWDQV²PHQL GDJNDQMDJNlQQDDWWµMDJInUV\QDVMDJInUÀQQDVMDJInUWDSODWVµ VlJHU/LVD ,PDMNRPPHU/|YEUDQGVWUHGMHDOEXP5lNQDPHGDWWGHW NRPPHUDWWV\QDV2FKK|UDV

58 «VnPnQJDnUEOHY*DU\0RRUH

PÅ NOLLTVA.SE KAN DU SÅKLART LÄSA MER INOM ÄMNET

MUSIK

$QGHUV/XQGTXLVW




SPEL

KRÖNIKA

Half-Minute Hero

Nail’d

Deadly Premonition

PSP

XBOX 360

XBOX 360

-OPEWWMWOWO}RVIXVSTM\IPERHE WOEQERWSQLNmPXIR,IVSVmHHE ZmVPHIRSGLHIXToWIOYRHIV:M LEVEPPXWoIRLEPZQMRYXToSWWEXX J}VLMRHVEHISRHELmVWOEV½KYVIVRE JVoREXXJ}VK}VEZmVPHIRQIHIR XVSPPJSVQIPRoKSXWSQWOIVSQ SGLSQMKIR(IXmVOSVXEYTTHVEK QIHIRSRHFSWWMZEVNIWSQQoWXI FIWIKVEW7XVMHIVREToZmKIRmV WREFFESGLEYXSQEXMWOESGLMF]EVRE WSQ½RRWPMXIZEVWXERWOERQERO}TE IRoXIVWXmPPRMRKEZRIHVmORMRKIRIXX QoWXISQQERZMPPLMRREQIHEPPX 7MHSYTTHVEKSGLQMRHVIHMEPSKIV KIVWTIPIXPMXII\XVEOEVEOXmVSGL HIWWYXSQ½RRWHIXERHVEWTIPX]TIV EXXTVSZEToWSQWLSSX³IQYTQIH QIVE)RIROIPLMWXSVMEI\XVIQX TM\PMKE½KYVIVRESGLIRXSOWMQTIP OSRXVSPPK}V,EPJ1MRYXI,IVSXMPP QMXXEFWSPYXEJEZSVMXWTIPNYWXRY 6MGOEVH3PWWSR

.EKLEVEPPXMHZEVMXIXXWXSVXJEREZ HIQIVI\XVIQEVEGMRKWTIPIRSGL HMXL}VREMP´HQIHVoKI1ERO}V HMZIVWIXIVVmRKJSVHSRVYRXQIV IPPIVQMRHVISQ}NPMKEFERSVSGL KIVNmVRIXMTVIGMWZEVNIWMXYEXMSR +EWELSTTEPoRKXFSSWXEQIH XYVFSRSGLOVEWGLELoVX9TTVITE .EKKMPPEVZIVOPMKIRXEROIRQIH WTIPIXHIRXMPPXEPEVQMKKVSZXQIR KIRSQJ}VERHIXOmRRWHIWWZmVVI MRXIQIVmRSOINMWPYXmRHER:MWWX KoVJSVXSGLLSTTIRmVL}KEQIR NEKJoVEPHVMKRoKSRVMOXMKX]RKHM O}VOmRWPER(IXOmRRWQIWXWSQ QERKPMHIVJVEQToVmPWSGLNEKFPMV WmPPERWmVWOMPXXEKKEH)XXmRHSGO SOINVEGMRKWTIPWSQEFWSPYXOER WOmROEKPmHNIoXVEGMRKJERXEWXIV QIRZmRXEOERWOIXMPPWHIXLEQREVM VIEOSVKIR 6MGOEVH3PWWSR

&)=32(=28,

,)6)373*/%0):%0%

',9',963'/)8

Vart är vi på väg egentligen? FRAM TILL IDAGLEV8:WTIPWYXZIGOPMRKIROmRXWRoKSVPYRHEWXEFMPSGL ToPMXPMK:MLEVPmVXSWWQ}RWXVIXLIPXIROIPX:MLEVOYRREXJ}VWXoZEHWSQ WOYPPIOSQQEYXEREXXIKIRXPMKIRLEIRERMRKHIXLEV2MRXIRHSPmVXSWW1IR ZEHLmRHIVRY# (IXZEVIXXTEVoVWIHER2MRXIRHSWOYPPIWPmTTEW1IHHIRMRXVS HYGIVEHIWHIREREPSKEWTEOIRToLERHOSRXVSPPIRSGLKNSVHIHIRXMPPWXERHEVH MFVERWGLIR(IERHVEWOYPPIKMZIXZMWJ}PNEIJXIV&oHI4PE]7XEXMSRSGL<FS\ KMGOMWEQQEWToV%REPSKXWOYPPIHIXLIPXIROIPXZEVEJVoRJ}VWXEF}VNER7IHER QIH2MRXIRHS(7SGL;MMZEVHIoXIVMKIRTMSRNmVIVREToQEVOREHIRWSQ 7SR]SGL1MGVSWSJX½GOVmXXEWMKIJXIV:M½GO4PE]7XEXMSR1SZISGL/MRIGX IRFEVXToKVYRHEZ2MRXIRHS (IXOmRHIWFIOZmQXToRoKSXWmXXEXXSVHRMRKIRZEVoXIVWXmPPHIJXIVHIX PMPPEQMWW}HIXQIH+EQI'YFI(IX2MRXIRHSK}VK}VSGOWoHIERHVE1IR WSQNEKWOVIZMRPIHRMRKWZMWZEHLmRHIVRY#

:EHJoVQERSQFPERHEV8[MR 4IEOWQIH7MPIRX,MPP#7ZEVIXmV (IEHP]4VIQSRMXMSR2mVIR*&-EKIRX ERPmRHIVXMPPWQoWXEHIR+VIIRZEPI J}VEXXYXVIHEQSVHIXToIRYRK OZMRREmVHIXWXEVXIRToIRFMWEVV YRHIVW}ORMRK:MQ}XIVQoRKE YHHETIVWSRPMKLIXIVSGLFIW}OIV QEVHV}QWPMOETPEXWIVWSQWTIKPEV XMHMKEVIXV]KKETPEXWIV0oXIVHIX FIOERX#*}VPEKSVREmVX]HPMKESGL WTIPIXLmQXEVJVMWOXJVoRHIVEW WXmQRMRKSGLLERHPMRK(IXJYRKIVEV QIRX]ZmVVMRXIPMOEFVEWSQMJ}V PEKSVRE7TIPIXmVMRXIHoPMKXWREVEVI XZmVXSQQIRJ}VPEKSVREmVVYWOMKX Q]GOIXFmXXVI8VSXWIXXFVMWXERHI WSYRHXVEGOSGLIRKVE½OJVoRJ}VVE KIRIVEXMSRIRWWTIPOSRWSPIVP]GOEW QERHSGOWOETEIXXQ]GOIXXVIZPMKX WYVZMZEPLSVVSVWTIP+MPPEVHYKIRVIR mVHIXLmVIXXQoWXIJ}VHMK

NINTENDO 3DSQoXEKPEW}KSRP}W(XMPPHIXFmVFEVEJSVQEXIXQIR( MWMKmVNYMRKIXR]XX(IXXEmVSGOWoOSRWSPIRWIRHEVMOXMKEJ}VWmPNRMRKWEVKY QIRXJ}VVIWXIRLEVZMWIXXJ}VYX,mVLEHINY7SR]SGL474GLERWIREXXP]WE SVHIRXPMKX1IRJ}KESZmRXEXXSKHIMRXIGLERWIR:MLEVJoXXWIIXXL}KYTTP}WX QSRWXIVQIHRoKSXERRSVPYRHEOSRXVSPPQIXSHIVQIRHIXZEVORETTEWXRoKSX WSQKEZIRZERWMRRMK[S[YTTPIZIPWImZIRSQHIXZEVZEHQoRKEMROPYWMZI QMKWNmPZZMPPILE 3GLZEHLmRHIVQIHYTTJ}PNEVIRXMPP;MM#:EHWOE2MRXIRHSXEWMKXMPPRmV FoHIV}VIPWIOSRXVSPPOEQIVSVSGL(VIHERR]XXNEXW,YVXYWERWOEZMWTIPE 8:WTIPSQJIQoV#.EKLEVMRKIRERMRK

6SFIVX.SRWWSR

6MGOEVH3PWWSR

spotlight!

HIXQIRMRKIREXXKSHMWIXWOERoLERWQYR2]E}ZIVVEWOERHISGL½RYVPMKEWQo MRWPEKToFERSVRELoPPIVMRXVIWWIXJ}VWTIPIXYTTI

diverse spel

HEREOS OF KALEVALA (22 KR/38 KR) )XXEZHIQIWXOmRHEQEXGLEXVIWTIPIRmVHIXWXEVOXFIVSIRHIJVEQOEPPERHI &INI[IPIHWTIPIRJVoR4ST'ET,IVSIWSJ/EPIZEPEmVToQoRKEWmXXTVIGMWWSQ &INI[IPIHQIRLEVmRHoWMREIKREWQoIKIRWOETIVWSQK}VWTIPIXWoSXVSPMKX XVIZPMKXSGLQ]WMKXEXXWTIPE8MPPI\IQTIPKIVOSVTIRWSQ¾]KIVVYRXWTIPTPERIR SGLVITVIWIRXIVEVXMHIRIRI\XVESGLZmPHMKXZmPOSQQIRYXQERMRKXMPPWTIPIX

iPHONE OCH iPAD

'988,)634)

FRAMTIDEN INOM SPELBRANSCHEN. LÄS RICKARDS KRÖNIKA OM ÄMNET.

3QQERKMPPEVOPYVMKEYXQERMRKEVM JSVQEZTYWWIPIPPIVTPEXXJSVQWWTIP mVYXFYHIXZmPHMKXWXSVXXMPPM4LSRI SGLM4EH,mVmVJ]VEWTIPWSQWXMGOIV YXPMXII\XVESGLWSQHI½RMXMZXFSVHI OSQQEQIHIRX]HPMKZEVRMKWXI\X J}VVMWOIREXXFPMEPPZEVPMKXFIVSIRHI mVWXSV CUT THE ROPE (7 KR/15 KR) (IXKV}REPMPPEQSRWXVIX3QRSQ LEVPIZIVIVEXWMIRPoHEXMPPHMRH}VV QIHMRWXVYOXMSRIR±QEXEWQIHKS HMW²+IRSQEXXOPMTTEXVoHEVTERKE FYFFPSVSGLLEIRKV]QXENQMRKmV

BEYOND YNTH (15 KR/22 KR) &I]SRH=RXLmVIXXmZIRX]VWTIPQIHIRLIPXYRHIVFEVMRXVSWoRKSGLQoRKE SZmRXEHIYXQERMRKEV(IRQSHMKEVMHHEVIR/VMFPWSQmVIRR]GOIPTMKEWOMGOEW YXJ}VEXXWEQPEMRHMEQERXIVWSQ½IRHIRWTVMHMX}ZIVZmVPHIR&ERSVREYXWTIPEV WMKMWOSK}OIRMWWEQXZYPOERPERHWOET+IRSQEXXZmPXEPoHSVP}WIVQERVSPMKE SGLYXQERERHITVSFPIQ CHUCHU ROCKET! (7 KR/7 KR) (IRKEQPEOPEWWMOIVR'LY'LY6SGOIXJVoR7IKEFNYHIVToIRSXVSPMKQmRKH OPYVMKEXEROIR}XXIV-RoKSXWSQMFPERHOERYTTPIZEWWSQXSXEPXOESWWOEWQo W}XEQ}WWKYMHEWJVoRLYRKVMKEOEXXIVWKMKERXMWOEQYRREV+IRSQEXXWmXXEYX TMPEVToWTIPTPERIRWX]VQERQ}WWIRXMPPWmOIVLIXSQFSVHToQoRVEOIXIV 1EPMR.SRWWSR

nyheter! FÖRETAGET NINTENDO GRUNDADES AV FUSAJIRO YAMAUCHI DEN 23 SEPTEMBER 1889. FÖRETAGETS FÖRSTA PRODUKT VAR HANDTILLVERKADE SPELKORT

150 MILJONER PLAYSTATION 2 2mWXERIPZEoVIJXIVHIXEXXOSRWSPIR J}VWXPERWIVEHIWM.ETERLEVQERZMH HEXYQIXNERYEVMWOITTEX LIPEQMPNSRIV4PE]7XEXMSR QEWOMRIVKPSFEPX(IXmVEPPXWo MVIREWMJJVSVIXXLIPXLSXIPP F]KKXEZFEVEWTIPOSRWSPIVIPPIV RoKSXWoHERX2YXVSVNEKFIWXmQX EXXEPPE4PE]7XEXMSRIRLIXIVZmVPHIR }ZIVF}VNEVWZIXXEWPMXI



LINEAGE II LEVER VIDARE (IXRYQIVERoKSXoPHIVWXMKRE SRPMRIVSPPWTIPIX0MRIEKI--JoVQIV (0'(IRWIREWXIYTTHEXIVMRKIR OEPPEH,MKL*MZIMROPYHIVEVIXXR]XX NEOXW]WXIQLIPER]EJ}VQoKSV R]ESQVoHIRSGLFSWWEVWEQX J}VFmXXVEHKVE½OToQSFFIR/SWXEV GEZMPOIXQSXWZEVEVORETTX OVSRSV

GEARS OF WAR: EXILE FÖR KINECT? (IXZEVPmRKIWREGOSQEXX)TMG+EQIWZMPPIK}VERoKSXQIH<FS\ OEQIVER/MRIGXSGL+IEVWSJ;EVSGLRYWIVHIXYXEXXFPMIRWoOEPPEH VmPWWONYXEVIHmVWTIPEVIRQIWXFEVEJ}PNIVQIHMHIEYXSQEXMWOEV}VIPWIVRE SGLWMOXEVSGLWONYXIV(IXmVJSVXJEVERHISOPEVXI\EOXLYVWTIPIXOSQQIV EXXWIYXQIRHmVIQSXLEV)TMGR]PMKIRVIKMWXVIVEXZEVYQmVOIX+IEVWSJ;EV )\MPIWoZMOERERXEEXXHIXmVZEHWTIPIXOSQQIVLIXEMEPPEJEPP(IXXEWOEIN J}VZm\PEWQIH+IEVWSJ;EVWSQmVHIRVMOXMKEYTTJ}PNEVIRXMPP+IEVWSJ;EV SGLJSVXWmXXRMRKIRToLERHPMRKIRHmVMJVoR8EGOSGLPSZ:MLEVMRXIJoXXRoKSX VIPIEWIHEXYQJ}V)\MPImRRYQIRZIXoXQMRWXSRIEXX+IEVWSJ;EVWPmTTW J}VWXXMPPZMRXIVR

Läs mer om spel på SPELBLOGGEN.SE


STOR VINTERREA! www.teamsportia.se

Start onsdagen den 9 februari. Välkommen in till oss! =pSRVTTLUPU[PSSVZZ

20-70%

RABATT PÅ ALLA VINTERVAROR!

STAVAR t PJÄXOR PJÄXOR t t SKIDOR SKIDOR t t MÖSSOR STAVARt MÖSSOR HANDSKAR t JACKOR t HJÄLMAR SKOR HANDSKARt JACKORt HJÄLMAR tt MM. ISHOCKEY t LÅNGFÄRDSSKRIDSKOR t MM. ,YIQ\KHUKL[NpSSLY[PSS LQYHIH[[LYH[WYPZWrZRPK]HSSH

)693f5., 0243-24 50 ORT, GATUADRESS Tel.81000-00 00 00


FILM & TV

topp 8

1. PULP FICTION OCH NYCKELN TILL FRIHET (1995) -DJNDQI|UVWnDWW)RUUHVW*XPSlU HQPHGU\FNDQGHGUDPHG\PHGHQ SDWULRWLVNYLQNOLQJDYDPHULNDQVN KLVWRULD0HQGHWlUGRFNULNWLJW VYDJWDYDNDGHPLQRPPDQE|UMDU IXQGHUDSnYLONDÀOPHUGHQVORJ 3XOS)LFWLRQlUNDQVNHWDOHWVPHVW EHW\GHOVHIXOODÀOPRFK1\FNHOQWLOO )ULKHWlUHQDYGHElVWDK\OOQLQJDUQD WLOOGHQPlQVNOLJDYLOMDQQnJRQVLQ

KRISTOFER LISTAR FILMERNA SOM BORDE VUNNIT EN OSCAR FÖR BÄSTA FILM.

2. CITIZEN KANE (1942) 'HWKlUlUMXGHWNODVVLVNDH[HPSOHW SnDWWDNDGHPLQJ|UGnOLJDYDOLEODQG 'HWlUQlVWDQV\QGRP+RZ*UHHQ :DV0\9DOOH\VRPEOLYLWVPXWVNDVWDG L|YHUnU&LWL]HQ.DQHVHVLGDJ VRPHQDYGHElVWDRFKlUGHQ PHVWLQÁ\WHOVHULNDÀOPHQLKLVWRULHQ 1lUÀOPHQNRPXWDQVnJGRFN WLGQLQJVPRJXOHQ:LOOLDP5DQGROSK +HDUVWDWWGHQYDUHQSHUVRQOLJ DWWDFNPRWKRQRPRFKJMRUGHDOOW I|UDWWVPXWVNDVWDGHQ

bio prog nosen

OSÄKER PÅ OM EN STUNDANDE BIOFILM HÅLLER MÅTTET ELLER INTE? LÄS KRISTOFERS BIOPROGNOS. VI VET ATT DEN HÅLLER!

• Het! • ljummen • kall

Inside Job • 18 februari 'HQQD2VFDUVQRPLQHUDGHGRNXPHQWlUJ|UGHWVRPMDJWURUPnQJD|QVNDUDWWGHNXQGHJ|UD'H ÁHVWDDYRVVVDNQDUGRFNEnGHWLGRFKNXQQDQGHI|UDWWI|UV|NDI|UVWnGHQHNRQRPLVNDNROODSVHQ 7URWVDWW&KDUOHV)HUJXVRQVGRNXPHQWlUNUlYHUYLVVNXQVNDSRPDPHULNDQVNSROLWLNVnlUGHQ LQWUHVVDQWPHQIUDPI|UDOOWHWWEUDXWORSSI|UGHQLOVNDPnQJDNlQQHUI|U:DOO6WUHHW Kokvinnorna • 18 februari 3HWHU*HUGHKDJlUPDQQHQEDNRPGHQK\OODGHGRNXPHQWlUHQ+lVWPDQQHQQXlUKDQWLOOEDNDPHG HQQ\ELOGDYHWW6YHULJHVRPInIRUWIDUDQGHWURUH[LVWHUDU,+DOODQGVVNRJDUÀQQVQlPOLJHQGHVLVWD JnUGDUQDLODQGHWVRPVlOMHUKDQGPM|ONDGPM|ONWLOO$UOD*HUGHKDJKDUnWHULJHQO\FNDWVKLWWDHWWÁHUWDO µRULJLQDOµYDUVH[LVWHQVDOGULJKDGHXSSPlUNVDPPDWV Sanctum • 18 februari $WWNXQQDDQYlQGDVNDSDUHQDY7LWDQLFRFK$YDWDUlUHQHIIHNWLYPDUNQDGVI|ULQJVWDNWLN-DPHV &DPHURQVQDPQlUQlPOLJHQNOLVWUDW|YHUEnGHWUDLOHUQRFKDIÀVFKHQPHQKDQVSURGXFHQWLQYROYHULQJ VWUlFNHUVLJQRJWLOODWWKDQJLOODUG\NQLQJ-DJlUK|JVWWYHNVDPRPPDQXVHWRFKVNnGHVSHODUQDlU WLOOUlFNOLJWEUDQlUGHIDVWQDULHQJURWWDL|YHUHQWLPPH Tamara Drew • 18 februari 'HQEULWWLVNHUHJLVV|UHQ6WHSKHQ)UHDUVlUHQULNWLJNODVVÀOPPDNDUHVRPPHGHWWSDUnUVPHOODQUXP NRPPHUXWPHGHQOLWHQEULWWLVNÀOPVRPLQWHInUVnVWRUXSSPlUNVDPKHWPHQIRUWIDUDQGHlUEUD 7DPDUD'UHZ *HPPD$UWHUWRQ NRPPHUWLOOEDNDWLOOODQGVE\JGHQRFKYULGHURPKXYXGHWSnE\QV PlQ(QVPDUWRFKJDQVNDP|UNIDUVlUDWWYlQWDPHQLHQYlOGLJWEULWWLVNWRONQLQJ

3. MAFFIABRÖDER (1991) 1lUPDQSUDWDURPEUDPDIÀDÀOPHU VnlUGHWIDNWLVNWEDUDGHWYnI|UVWD GHODUQDDY*XGIDGHUQWULORJLQVRP NDQVlJDVYDUDSnVDPPDK|JD QLYnVRP0DUWLQ6FRUVHVHElVWD ÀOP.HYLQ&RVWQHUVOnQJGUDJQD LQGLDQGUDPD'DQVDUPHG9DUJDUlU LQWHGnOLJPHQKDULQWHULNWLJWVDPPD HQHUJLVRP0DIÀDEU|GHU'HWYDU GRFNLQWHI|UVWDJnQJHQ6FRUVHVH EOHYVQXYDGSnNRQIHNWHQ

4. BROKEBACK MOUNTAIN (2006) 'HWlUDEVROXWLQJHWIHOSn3DXO+DJJLV GUDPDRPUDVLVPRFKI|UGRPDUL/RV $QJHOHV&UDVKlUHQEUDÀOPPHQGHQ lUHWWW\GOLJWH[HPSHOSnVPDUWKHWJnU XW|YHUVMlO%URNHEDFN0RXQWDLQlU GHWVHQDVWHnUWLRQGHWVPHVWVRUOLJD RFK|YHUW\JDQGHNlUOHNVKLVWRULD 3UREOHPHWYDUQRJDWWDNDGHPLQVRP KDUHQPHGHOnOGHUSnVQDUWG|GLQWH YDUULNWLJWUHGRDWWJHSULVHWWLOOHQ E|JURPDQV

True Grit • 18 februari )|UVWDJnQJHQGHQKlUERNHQEOHYWLOOÀOPYDURFKGnYDUGHWHQKMlOWHPRGLJ-RKQ:D\QHVRP VSHODGHKnUGVKHULII,EU|GHUQD&RHQVWRONQLQJlU-HII%ULGJHVEHW\GOLJWVPXWVLJDUHRFKPHUPRUDOLVN WYHNVDP-RHORFK(WKDQJ|UDOGULJHQHQNHOÀOPRFK7UXH*ULWNRPPHUQRJQlUPDUHGHQELVWUDERNHQ PHQLQWHXWDQGHUDVHJQDSHUVRQOLJDWRXFK Min låtsasfru • 23 februari $GDP6DQGOHUKDUI|UYDQDDWWHPHOODQnWJ|UDHQEUDÀOPVRP)XQQ\3HRSOHI|UDWWVHGDQJnWLOOEDNDWLOO DWWJ|UDHWWSDU*URZ8SV0HQYHPNDQNODQGUDKRQRPKDQYHWKXUPlQQLVNRUYLOODWWKDQVNDEHWH VLJRFKKDQWMlQDUQRJJURYDSHQJDUSnNXSSHQ'HQKlUJnQJHQKDUKDQ-HQQLIHU$QLVWRQWLOOKMlOSVRP VSHODUKDQVSnKLWWDGHIUX-DJYHWDWWMDJLQWHULVNHUDUPLWWDQVHHQGHKlUPHQÀOPHQlUQRJLQJHWYLGDUH Boy • 25 februari VnOHYHUGHQnULJH%R\LPLVlUSn1\D=HHODQGKDQlUPDRULHUKDQVSDSSDVLWWHULIlQJHOVH RFKKDQVVWRUDLGROlU0LFKDHO-DFNVRQ+DQVOLYI|UlQGUDVSnEnGHJRWWRFKRQWQlUSDSSDQ UHJLVV|UHQ7DLND:DLWLWL NRPPHUWLOOEDNDWLOOE\Q)LOPHQlUEDVHUDGSn:DLWLWLVHJQDEDUQGRPRFKlU I|UVWRFKIUlPVWHQNRPHGLPHQGHQKDUQRJOLWHGUDPDWLVNDnGURU Sarahs Nyckel • 25 februari 'HQQDIUDQVNDÀOPlUEDVHUDGSn7DWLDQDGH5RVQH\VURPDQPHGVDPPDQDPQVRPOnJSn1HZ<RUN 7LPHVElVWVlOMDUOLVWDLYHFNRU+LVWRULHQYl[ODUPHOODQQXWLGGlUHQMRXUQDOLVWXQGHUV|NHUHQMXGLVN ÁLFNDV|GHXQGHUDQGUDYlUOGVNULJHWRFKDWWYLNDQVHYDGVRPKlQGHGn'HWlUNDQVNHLQWHQnJRW VRPOnWHUMlWWHNXOPHQMDJJHUDOOWVRPPLQIDYRULW.ULVWLQ6FRWW7KRPDVlUPHGLFKDQVHQ

5. TAXI DRIVER (1977) ,QWHHQVRPPDQERUWVHUIUnQ XSSI|OMDUQDVRPEOLYLWJUDGYLV XVODUHNDQPDQJRGWDDWW6\OYHVWHU 6WDOORQHV5RFN\VNXOOHYDUDElWWUH lQ6FRUVHVHVLQQHUVWDGVZHVWHUQ 7D[L'ULYHU$NDGHPLQEUXNDUGRFN IDOODI|UÀOPHUPHGHQYLVVIHHO JRRGNlQVODRFKKLVWRULHQRPGHQ SV\NRWLVNH7UDYLV%LFNOHVEORGLJDMDNW SnYDGKDQDQVHUµDYVNXPµVDNQDU MXVWGHWWD

6. DR. STRANGELOVE (1965) $NDGHPLQKDURFNVnHQVWRU I|UNlUOHNI|UPXVLNDOHURFKlYHQRP MDJLQWHGHODUGHQnVLNWHQVnlU0\ )DLU/DG\IDNWLVNWHQDYGHElVWD0LWW SUREOHPlUDWWGHQO\FNDGHVVOnGHQ OHJHQGDULVNH6WDQOH\.XEULFNVElVWD ÀOP'U6WUDQJHORYHlUHQVDQVO|V NRPHGLVRPYLVDUKXUO|MOLJWGHW NDOODNULJHWYHUNOLJHQYDUVDPWLGLJW VRP3HWHU6HOOHUVJ|UI\UDDYVLQD ElVWDUROOHU

Black Swan • 4 mars 'DUUHQ$URQRIVN\NRPPHUDOOWLGKDPLWWI|UWURHQGHHIWHUGHQPlVWHUOLJWGHSULPHUDQGH5HTXLPIRU D'UHDPPHQMDJNlQGHDWWKDQVI|UUDÀOP7KH:UHVWOHUYDUOLWHYlO|YHUK\SDG1XlUKDQWLOOEDNDL YLQQDQGHIRUPPHGSV\NLVNDNROODSVHULEDOHWWHQVYlUOG1DWDOLH3RUWPDQVNDVSHODKXYXGUROOHQL 6YDQVM|QPHQQlUKRQInUNRQNXUHQVDY0LOD.XQLVE|UMDUKRQWDSSDIRWIlVWHWLWLOOYDURQ Rango • 4 mars (QDQLPHUDGÀOPPHG-RKQQ\'HSSNDQYHUNOLJHQLQWHEDUDYDUDHQLPlQJGHQGHWÀQQVQnJRQVODJV GURJLQÁXHUDGNlQVODVRPJ|UDWWGHWOLNQDUHQWHFNQDG)HDUDQG/RDWKLQJL/DV9HJDV3RlQJHQlUDWWGHQ LQWHNlQQVVnSnYHUNDGDYWHVWJUXSSHURFKG\OLNWVRPInUÀOPHUDWWEOLVOlWVWUXNQD%DUDGHWDWWGHQ LQWHlUJMRUGL'NRPPHUVRPHQJODG|YHUUDVNQLQJ Ritualen • 4 mars ([RUFLVPlUHQLQWHRYDQOLJLQJUHGLHQVLPRGHUQDVNUlFNÀOPHUPHQMDJYHWLQWHRPGHWNlQQVVn OlVNLJWPDQPnVWHQRJYDUDGMXSWWURHQGHNDWROLNI|UDWWEOLUlGGI|UHWWYDQOLJWSV\NIDOO'HWWDlU SUHFLVYDGHQVNHSWLVNSUlVWVWXGHUDQGHW\FNHUQlUKDQNRPPHUWLOO9DWLNDQHQ'lUWUlIIDUKDQGRFNHQ REHKDJOLJ$QWKRQ\+RSNLQVRFKHQXQJNYLQQDPHGVWRUDSUREOHPPHGHQLQQHERHQGHGHPRQ Adjustment Bureau • 11 mars bQQXHWWRIIHUI|UGHQLGLRWLVNDVYHQVNDLGpQDWWWDERUWGHQEHVWlPGDIRUPHQ´7KHµIUnQHQJHOVND WLWODU+lUWUlIIDV0DWW'DPRQRFK(PLO\%OXQWDYHQVOXPSRFKLQOHGHUHQDIIlU'HWYHUNDUGRFN VRPDWW|GHWYLOOKnOODGHPLVlU|GHWlULGHWKlUIDOOHWlUHQKHPOLJP\QGLJKHWVRPVW\UWLOOYDURQ(Q RULJLQHOOWKULOOHUVRPNlQQVLQVSLUHUDGDY&KDUOLH.DXIPDQ

7. JAKTEN PÅ DEN FÖRSVUNNA SKATTEN (1982)  'HWlUQRJLQJHQVRPW\FNHUDWW ,QGLDQD-RQHVI|UVWDlYHQW\UlUHQ NODVVLVN2VFDUVYLQQDUHPHQGHQ YDUHJHQGRPOLJWQRJQRPLQHUDG WLOOElVWDÀOP'HWlURFNVnHQDY InnUQlUYLQQDUHQIDNWLVNWYDUGHQ JDQVNDPHGHOPnWWLJD&KDULRWVRI)LUH KLVWRULHQRPWYnNRQNXUUHUDQGH O|SDUHYLG26HQJDJHUDU DOGULJIXOOWXWRFKGnERUGHGHQ VNDPO|VWXQGHUKnOODQGH´5DLGHUVµ IDNWLVNWKDYXQQLW



8. TJUREN FRÅN BRONX (1981) 0DUWLQ6FRUVHVHlUQRJGHQUHJLVV|U VRPEOLYLWVlPVWEHKDQGODGLPRGHUQ 2VFDUVKLVWRULDDWWGHWKlUlUKDQV WUHGMHÀOPSnGHQKlUOLVWDQVlJHU QRJGHWPHVWD5REHUW5HGIRUGV IDPLOMHPHORGUDPD2UGLQDU\3HRSOH lUWLOOVDPPDQVPHG.HYLQ&RVWQHU RFK&OLQW(DVWZRRGlQQXHWW H[HPSHOSnDWWDNDGHPLQJLOODUNlQGD VNnGHVSHODUHVRPUHJLVVHUDUÀOP

Möte i Toscana • 11 mars (QEULWWLVNNRQVWSURIHVVRURFKHQIUDQVNJDOOHULlJDUHVRPWUlIIDVLGHWURPDQWLVND7RVFDQD'HQK\OODGH LUDQVNHUHJLVV|UHQ$EEDV.LDURVWDPLKDUEHJHWWVLJWLOO(XURSDI|UDWWJ|UDHQURPDQWLVNNRPHGL 0HQGHWKlUGRFNOnQJWLIUnQ.DWKHULQH+HLJOVWHUULWRULHUI|UKlUÀQQVGHWIULNWLJDNlQVORURFKGMXS -XOLHWWH%LQRFKHYDQQVNnGHVSHODUSULVHWL&DQQHVI|UVLQUROOKlU Route Irish • 11 mars $UEHWDUNODVVHQVIUlPVWHVNLOGUDUH.HQ/RDFKOlPQDUKlUGLVNElQNHQI|UDWWWDVLJDQ,UDNNULJHW+DQ JnURFNVnLIUnQVLQDYDQOLJDGUDPHUI|UHQWKULOOHUPHGHWWPRUGP\VWHULXPLFHQWUXP)HUJXVNRPPHU KHPIUnQ,UDNI|UDWWEHJUDYDVLQElVWDYlQVRPGRJGlUKDQWURUGRFNLQWHDWWGHWYDUHWWYDQOLJW DWWHQWDWRFKE|UMDUJUlYDHIWHUVDQQLQJHQ The Eagle • 11 mars 6RQHQWLOOOHGDUHQI|UGHQQLRQGHURPHUVNHOHJLRQHQNRPPHUWLOO+DGULDQVPXUI|UDWWnWHUXSSUlWWD VLQIDGHUVQDPQRFKKDQWlQNHUJ|UDGHWJHQRPDWWWDWLOOEDNDOHJLRQHQVJ\OOHQH|UQ-DJKDUGRFN VYnUWDWWVH&KDQQLQJµWUlSODQNDQµ7DWXPVRPURPHUVNVROGDWGHVVXWRPNlQQVGHWVRPMDJVHWW ÀOPHQI|UXW-DGHWPnVWHKDYDULWQlUMDJVnJ&HQWXULRQLK|VWDV


FILM & TV

dvd & blu-ray

'9' %/85D\ )(%58$5,

'9' %/85$< 0$56

'9' %/85$< 0$56

'9' %/85$< 0$56

'9' %/85$< 0$56

'9' 0$56

'9' 0$56

RECENSIONER AV FILMER PÅ DVD & BLU-RAY.

Krönika

OSCARSGALAN. LÄS KRISTOFERS KRÖNIKA OM ÄMNET.

The Social Network 7URWVDWWGHWÀQQVHQPnOJUXSSSnPHUlQHQKDOYPLOMDUGPlQQLVNRUVRPKDUHQDQNQ\WQLQJWLOO )DFHERRNVnVNDMDJHUNlQQDDWWMDJLQWHUI|UVWRGKXUHQÀOPRPHQKHPVLGDVNXOOHXWIRUPDV'HW YHUNDGHEDUDVRPRPQnJRQKDGHLQVHWWDWWPDQNXQGHWMlQDJURYDSHQJDUSnHQÀOPRPQnJRW VRPGHÁHVWDXPJnVPHGPHUlQVLQDULNWLJDNRPSLVDU-DJYDUDOOWVnK|JVWWYHNVDPPHQQlU'DYLG )LQFKHUUHJLVVHUDURFK$DURQ6RUNLQVNULYHUPDQXVHWVnNDQPDQUlNQDPHGNYDOLWp,E|UMDQDY WDOHWInUGHQDVRFLDOH+DUYDUGVWXGHQWHQ0DUN=XFNHUEHUJ -HVVH(LVHQEHUJ HQJ\OOHQHLGp RFKWLOOVDPPDQVPHGElVWHYlQQHQ(GXDUGR6DYHULQ $QGUHZ*DUÀHOG VNDSDUKDQHWWIHQRPHQ VRPVNXOOHI|UlQGUDYlUOGHQ6QDUWNRPSOLFHUDVGRFNVLWXDWLRQHQDYVWlPQLQJDURFKWYLVWHUEnGH XWLIUnQRFKLQRPI|UHWDJHWRFKVLWXDWLRQHQEOLULQWHElWWUHQlU1DSVWHUVNDSDUHQ6HDQ3DUNHU -XVWLQ 7LPEHUODNH DQVOXWHUVLJWLOOJUXSSHQ9DUMHGHODY7KH6RFLDO1HWZRUNlUIDQWDVWLVNGHQlUVQ\JJW ÀOPDGVNnGHVSHODUQDJ|UGHWYlOGLJWEUDGLDORJHUQDVPDWWUDURFKVRXQGWUDFNHWDY7UHQW5H]QRU lUIMROnUHWVElVWD'HWVRPJ|UDWWÀOPHQlQGnLQWHInUIXOOSRWWlUDWWJUXQGKLVWRULHQLQWHlUVn LQWUHVVDQWYHPKDGHEU\WWVLJRPGHWYDUVDPPDVWRU\PHQRPHWWDQQDWI|UHWDJ Scott Pilgrim vs. the World 'HQEULWWLVNHUHJLVV|UHQlUQ|UGDUQDVIUlPVWDIDQElUDUHLÀOPLQGXVWULQIUnQGHEXWHQPHGNXOWVHULHQ 6SDFHGWLOOGHIDQWDVWLVNDJHQUHSDVWLVFKHUQD6KDXQRIWKH'HDGRFK+RW)X]]KDUKDQI\OOWGHPPHG REVN\UDUHIHUHQVHUWLOOVSHOÀOPHURFKPXVLN)|UVLQ1RUGDPHULNDQVNDGHEXWKDUKDQKLWWDWHWW JUXQGPDWHULDOVRPSDVVDUKRQRPSHUIHNW6HULHDOEXPHQRPGHQNDQDGHQVLVNHVODFNHUQ6FRWW 3LOJULP 0LFKDHO&HUD lUI\OOGDDYVXUUHDOLVPGlUJUlQVHQPHOODQSRSXOlUNXOWXURFKYHUNOLJKHWlU KHOWXWVXGGDG6FRWWVSHODUEDVLEDQGHW6H[%RERPERFKGHMWDUKLJKVFKRROWMHMHQ.QLYHV&KDX QlUKDQWUlIIDUGU|PWMHMHQKRQKHWHU5DPRQD)ORZHUV 0DU\(OL]DEHWK:LQVWHDG PHQI|UDWWIn KHQQHPnVWHKDQEHVHJUDKHQQHVVMXRQGDH[lOVNDUH EOD&KULV(YDQV%UDQGRQ5RXWKRFK-DVRQ 6FKZDUW]PDQ +DQGOLQJLQVSLUHUDVDYWYVSHORFKVWULGHUQDPHGGHROLNDµERVVDUQDµVRP6FRWW PnVWHWDVLJI|UELVSHJODUGHWWD)LOPHQYDUHWWNRPPHUVLHOOWPLVVO\FNDQGHSnELRPHQGHQI|UWMlQDU DWWKLWWDHQSXEOLNSnGYG:ULJKWKDUVNDSDWHQHJHQGRPOLJÀOPVRPWURWVDWWGHQLQWHlUOROUROLJ VnlUGHQXQGHUKnOODQGHSnHWWK|JVWRULJLQHOOWVlWW Legenden om Ugglornas Rike =DFN6Q\GHUlUQRJLQWHGHQI|UVWDUHJLVV|UHQVRPI|UYlQWDVJ|UDHQDQLPHUDGIDPLOMHÀOP+DQ KDUMXWLGLJDUHNRQFHQWUHUDWVLJSnJUDÀVNWVORZPRWLRQYnOG  RFKKMlOWDUPHGWYHNVDP PRUDO :DWFKPHQ 0HQQlUPDQVHUÀOPHQVnI|UVWnUPDQYDUI|U6Q\GHUW\FNWH.DWKU\Q/DVN\V IDQWDV\E|FNHUSDVVDGHKRQRPVnEUDGHQlULVWRUWVHWWHQEDUQYlQOLJYHUVLRQDY7RUQXJJORUQD 6RUHQ -LP6WXUJHVV RFK.OXGG 5\DQ.ZDQWHQ IDOOHUXUVLWWERRFKEOLUNLGQDSSDGHDYRQGVNHIXOOD XJJORU'HlUOHGGDDY1\UD +HOHQ0LUUHQ VRPYLOOKMlUQWYlWWDGHPWLOO]RPELHUVRPNDQWD|YHU YlUOGHQ6RUHQWURUGRFNSnGHJDPODOHJHQGHUQDRPGHKMlOWHPRGLJDXJJORUQDIUnQ*D·+RROH+DQ O\FNDVÁ\RFKJHUVLJDY|YHUKDYHWI|UDWWKLWWDGHPKDQGOLQJHQlUSUHFLVVnNOLFKpI\OOGVRPGHQ OnWHUPHQGHWlUKHOWDFFHSWDEHOWI|UHQEDUQÀOP)LOPHQVVWDUNDVWHVLGDlUGRFNKXUVQ\JJWGHQlU DQLPHUDGPDQKDUYDOWDWWJ|UDDOOWVnQDWXUOLJWVRPP|MOLJW/HJHQGHQRP8JJORUQDV5LNHKDUQRJ GHQVNDUSDVWHRFKPHVWWHNQLVNWLPSRQHUDQGHDQLPDWLRQHQQnJRQVLQ'HWWDJ|UDWWPDQNDQKDOLWH |YHUVHHQGHPHGKDQGOLQJHQRFKGHNDRWLVNDVWULGVFHQHUGlUPDQLQWHYHWYHPVRPlUYHP Unstoppable 7nJlUHWWKHOYHWHQlUGHLQWHlULQVWlOOGDI|UVHQDGHHOOHUNRVWDUPHUlQGHERUGHVnO|SHUGH DPRNRFKNUDVFKDULQLDPHULNDQVNDVPnVWlGHU'HWlUQlPOLJHQKDQGOLQJHQL7RQ\6FRWWVQ\DDFWLRQ GlUHWWIUDNWWnJI\OOWDYJLIWLJDlPQHQSnJUXQGXWDYHWWNODQWLJWPLVVWDJVnVlWWHUDYPRW6FUDQWRQ 3HQQV\OYDQLD(QVNUlPPDQGHWDQNHPHQGHWNlQQVVYnUWDWWKnOODSXEOLNHQVLQWUHVVHQXSSHL WLPPH(WWWnJNDQLQWHOLNVRPLQWHJ|UDQnJRWGLUHNWRYlQWDWPHQOLOOHEURU6FRWWJ|UHWWEUDMREE PHGDWWKnOODVSlQQLQJHQXSSH%nGH'HQ]HO:DVKLQJWRQRFK&KULV3LQHJ|UHWWEUDMREEVRP UXWLQHUDGORNI|UDUHRFKND[LJQ\NRPOLQJ'HVSHODUYDQOLJDDUEHWDUHVRPKDPQDULHQH[WUDRUGLQlU VLWXDWLRQRFKGHJ|UGHWSnHWWWURYlUGLJWVlWW6FRWWKDUHQLUULWHUDQGHWHQGHQVDWWI|UV|NDVNDSD VSlQQLQJPHGHSLOHSVLVQDEENOLSSQLQJPHQKlUOLJJHUGHWSnHQDFFHSWDEHOQLYn8QVWRSSDEOHVNXOOH NXQQDGHÀQLHUDPHGHOPnWWLJKHWGHQlUDOGULJWUnNLJPHQDOGULJKHOOHUULNWLJH[DOWHUDQGH(WWDQQDW SUREOHPlUDWWGXVRPWLWWDUHJDQVNDVQDUWNDQNRPPDSnO|VQLQJHQVRPWDUNDUDNWlUHUQDHQ WLPPHDWWOLVWDXW Exam $QVWlOOQLQJVLQWHUMXYHUlUEODQGGHWMREELJDVWHPDQNDQJ|UDLYDQOLJDOLYHWPHQMDJKRSSDVDWW MDJDOGULJVNDXWVlWWDVI|UGHWVRPKlQGHUNDUDNWlUHUQDL6WXDUW+D]HOGLQHVGHEXWÀOP'HQLR SHUVRQHUQDVRPQXVLWWHULHWWIXWXULVWLVNWUXPlUGHVLVWDNDQGLGDWHUQDI|UHWWGU|PMREEKRV HWWPlNWLJWPHQQDPQO|VWI|UHWDJ'HInUVWULNWLQIRUPDWLRQRPYDGGHInURFKLQWHInUJ|UDRFK VDPWLGLJWKDUGHVWRUDSUREOHPPHGDWWI|UVWnYDGGHVNDJ|UD+D]HOGLQHVPDQXVlUO|VWEDVHUDG SnSMlVHQ7KH*U|QKROP0HWKRGRFKGHWPlUNVKDQGOLQJVWDQQDULUXPPHWKHODWLGHQPHQGHWEOLU DOGULJWUnNLJW)|UVWI|UV|NHUNDUDNWlUHUQDKLWWDOHGWUnGDULUXPPHWVROLNDJ|PGDIXQNWLRQHUPHQ VQDUWE|UMDUGHUDVHJQDSHUVRQOLJKHWHURFKPRWLYDWLRQHUNRPPDXSSWLOO\WDQ*LYHWYLVXSSVWnU NRPSOLNDWLRQHURFKGHWKHODXWP\QQDULHQEODQGQLQJPHOODQ7KH$SSUHQWLFHRFK)OXJRUQDV+HUUH'HW lUHWWWLJKWRFKYlOVSHODWGUDPDVRPO\FNDVEHKnOODDXUDDYP\VWLNlQGDIUDPWLOOVOXWHW3UREOHPHW ([DPKDUlUDWWÀOPHQLQWHHQVVMlOYNDQQ\VWDXWVLQKDQGOLQJLVOXWHWRFKGHWEOLUOLWHYlOÁXPPLJD LGpHUVRPLQWHJ|UÀOPHQUlWWYLVD

The Oscars NU ÄR DET SNART DAGS I|UnUHWVVW|UVWDU\JJGXQNDUJDODL+ROO\ZRRG GlUPRYHUVRFKVKDNHUVNDQK\OODYDUDQGUDVLQVDWVHU 0HGOLNDOLWHLURQLVRPQlUPDQNDOODUVLQDLQKHPVNDVSRUWÀQDOHUI|U µ:RUOG6HULHVµVnI|USDVVDUGHQDPHULNDQVNDÀOPLQGXVWULQUHVWHQDYYlUOGHQ WLOOHQOLWHQXQGDQVN\PGNDWHJRULVRPNDOODVElVWDXWOlQGVNDÀOP )|UGHWlUYHUNOLJHQHWWSROLWLVNWPDNWVSHOVRPDYJ|UYDUGHnWUnYlUGD VWDW\HWWHUQDNRPPHUDWWKDPQD'HVWRUDÀOPERODJHQOlJJHURHUK|UWP\FNHW SHQJDUSUHVWLJHRFKVP|UDQGHSnDWWGHUDVÀOPHURPI|ULQWHOVHQVNDYLQQDVn PnQJDSULVHUVRPP|MOLJW 7URWVDOOWGHWKlUlUGHWVYnUWDWWLQWHVYHSDVPHGLVWlPQLQJHQRFKVLWWD YDNHQKHODQDWWHQI|UDWWWLOOVOXWVRPQDLQQDQGHVWRUDSULVHUQDGHODVXW)|U LQWHHQVHQQ|UGVRPMDJNDQHQJDJHUDPLJLYHPVRPJMRUWGHQElVWDVRXQG PL[HQHOOHUYHPVRPV\WWGHÀQDVWHNRVW\PHUQD HUR KOMMER DET DÅ GÅLGHKlULQWUHVVDQWDNDWHJRULHUQDSULVHWI|U ElVWDUHJLVV|UNlQQVMXIDNWLVNWYlOGLJWQlUDNRSSODWWLOOSULVHWI|UElVWDÀOP 0HQLnUWURUMDJSULVHWVWnUPHOODQWYnNLOODUVRPKDU|YHUW\JDWL|YHUnU 'HWNlQQVGRFNVRPDWW$DURQ6RUNLQVIDQWDVWLVNDPDQXVL7KH6RFLDO1HWZRUN |YHUJOlQVHU'DYLG)LQFKHUVUHJL 'lUI|UNRPPHUQRJSULVHWJnWLOO'DUUHQ$URQRIVN\I|U%ODFN6ZDQ,NDPSHQ RPElVWDELUROOHUlU7KH)LJKWHUGHQÀOPVRPYHUNDUOLJJDElVWWLOOKRV PlQQHQlUQRJ&KULVWLDQ%DOHJDODQVVW|UVWDIDYRULWVRPNQDUNDQGHER[DUH RFKEDUD*HRIIUH\5XVKVWDOSHGDJRJIUnQ7KH.LQJ·V6SHHFKYHUNDUNXQQD XWPDQD %ODQGNYLQQRUQDlU7KH)LJKWHUlQQXVW|UUHIDYRULWHIWHUVRPEnGD IDYRULWHUQD$P\$GDPVRFK0HOLVVD/HRlUKlPWDGHGlULIUnQMDJVNXOOHWURDWW /HRYLQQHUI|UVLQUROOVRPERVVLJPDPPD %lVWDNYLQQOLJDKXYXGUROONDQJnWLOOGHQKMlOWHPRGLJD-HQQLIHU/DZUHQFHL :LQWHU·V%RQHHOOHU$QQHWWH%HQLQJVRPOHVELVNRFKVPnDONDGHOlNDUHL7KH .LGV$UH$OO5LJKW -DJWURUGRFNDWW1DWDOLH3RUWPDQVSRUWUlWWDYHWWSV\NLVNWVDPPDQEURWWL %ODFN6ZDQVRPNRPPHUGUDGHWOlQJVWDVWUnHW+RVPlQQHQlU&ROLQ)LUWKV SRUWUlWWDYHQVWDPPDQGHHQJHOVNNXQJL7KH.LQJ·V6SHHFKVWRUIDYRULW RFKKDQI|UWMlQDUGHWYHUNOLJHQVSHFLHOOWHIWHUVRPKDQEOHYEOnVWQlUKDQ I|UWMlQDGHSULVHWI|UUDnUHWI|U$6LQJHO0DQ +DQXWPDQDVGRFNDYXQJWXSSDUQD-DPHV)UDQFRVRPHQDUPDGNOlWWUDUHL 7LPPDURFK-HVVH(LVHQEHUJVRPGDWDQ|UGL7KH6RFLDO1HWZRUN 'nlUGHWGnGDJVI|Uµ7KH%LJ.DKXQDµQlPOLJHQElVWDÀOP2FKGHWNlQQV VRPGHWVWnUPHOODQWYnÀOPHUVRPEnGDlUEDVHUDGHSnWYnJDQVNDWULYLDOD PHQYHUNOLJKHWVEDVHUDGHKLVWRULHU0HQGHWEOLUQRJ WLOOVOXW7KH.LQJ·V6SHHFKVRPVOnU7KH6RFLDO1HWZRUN VRPJDODQVNXQJ

Red (QDYVRPPDUHQVPHVWIUDPHPRWVHGGDÀOPHUYDU6\OYHVWHU6WDOORQHVWDOVIDQWDVL7KH([SHQGDEOHV 0HQLVWlOOHWI|UDWWYDUDXQGHUKnOODQGHYDUGHQYnOGVDPRFKGHQYLVDGHDWWYDUNHQ'ROSK/XQGJUHQ RFK6WDOORQHVMlOYEOLYLWPHUNDULVPDWLVNDSnlOGUHGDU5HGKDUGRFNJOLGLWIUDPXQGHUUDGDUQRFK lUHQP\FNHWSRVLWLY|YHUUDVNQLQJ'HQlUQDWXUOLJWYLVRFNVnYnOGVDPPHQGHWlUVSHNWDNXOlUW RFKXQGHUKnOODQGHLVWlOOHWI|UDWWYDUDI\OOWDY&*,EORG'HQVWRUDVNLOOQDGHQlUGRFNDWW KXYXGUROOVLQQHKDYDUQDIDNWLVNWlUVNnGHVSHODUHRFKLQWHWDHNZRQGRPlVWDUH%UXFH:LOOLVVSHODU HQSHQVLRQHUDGDJHQWVRPYHUNDUYHWDOLWHI|UP\FNHWKDQVJDPODNROOHJRUKRV&,$J|UQlPOLJHQ VLWWElVWDI|UDWWEOLDYPHGKRQRP0HQKDQlULQWHNODVVLÀFHUDGVRP5(' 5HWLUHG([WUHPHO\ 'DQJHURXV XWDQDQOHGQLQJKDQVDPODUVQDEEWLKRSVLWWJDPODLGXEEHOEHPlUNHOVHFUHZEHVWnHQGH DY0RUJDQ)UHHPDQ-RKQ0DONRYLFKRFK+HOHQ0LUUHQ$OODGHVVDVHUL|VDVNnGHVSHODUYHUNDUW\FND GHWlUVN|QWDWWOXWDVLJWLOOEDNDRFKKDOLWHUROLJW'HWPlUNVDWWGHWIXQJHUDUI|U5HGlUYHUNOLJHQVn OlWWVDPRFKXQGHUKnOODQGHVRPHQEUDDFWLRQNRPHGLVNDYDUD The Other Guys :LOO)HUHOOVRFK$GDP0F.D\VWLGLJDUHVDPDUEHWHQKDUYDULWJDQVNDEODQGDGH$QFKRUPDQ lUHQRGLVNXWDEHOPRGHUQNRPHGLNODVVLNHUGHQOHYHUHUDULGLRWLVRPSnQnJRWVlWWEHKnOOHU WURYlUGLJKHWHQ1lUGHKDUI|UV|NWUHSHWHUDVXFFpQKDUGHWLQWHJnWWOLNDEUDEnGH7DOODGHJD 1LJKWVRFK6WHS%URWKHUVYDUEHW\GOLJWPHUODUYLJDlQUROLJD1lU1HZ<RUNVVXSHUSROLVHU'ZD\QH µ7KH5RFNµ-RKQVRQRFK6DPXHO/-DFNVRQG|UVn|SSQDVG|UUHQI|UµGHDQGUDNLOODUQDµ'HlU VNULYERUGVSROLVHUQD$OOHQ )HUUHOO RFK7HUU\ 0DUN:DKOEHUJ VRPPHVWVQXEEODUSnHWWEURWW VRPLQYROYHUDU6WHYH&RRJDQVDIIlUVPDQ)LOPHQVKDQGOLQJNlQQVJDQVNDRYLNWLJRFKGHWlUOXJQW QlUGHUROLJDVNlPWHQDYO|VHUYDUDQGUD(WWDYGHPHVWXQGHUKnOODQGHRFKnWHUNRPPDQGHVNlPWHQ lUDWW$OOHQDOOWLGDWWUDKHUDUYlOGLJWYDFNUDNYLQQRUIUDPI|UDOOWKDQVRXSSVNDWWDGHIUX6KHLOD (YD 0HQGHV bYHQRP:DKOEHUJYHUNDUKDOLWHSUREOHPPHGHQRYDQNRPLVNUROOVnO\FNDVPDQXVHW UlGGDXSSVLWXDWLRQHQ7KH2WKHU*X\VlULQWHHQQ\$QFKRUPDQPHQGHQlUIRUWIDUDQGHHQP\FNHW XQGHUKnOODQGHNRPHGLVRPKDUEnGHEUHGKXPRURFKPHUVXEWLODVNlPW

/VMWXSJIV8oUZMWX OVMWXSJIV$RSPPXZEWI




KORSORD DET Fร–RSTA SVENSKA KORSORDET PUBLICERADES 1924 I Gร–TEBORGS HANDELS- OCH SJร–FARTSTIDNING

'HWUHI|UVWDUlWWDO|VQLQJDUQDYLQQHUYDUVLQ7ULVVORWW9LQQDUQDSUHVHQWHUDVLQlVWDQXPPHUDY1ROOWYnGHQPDUV6nYlVVDSHQQDQRFKN|U 6NLFNDUlWWDO|VQLQJHQWLOOVDPPDQVPHGGLWWQDPQDGUHVVRFKWHOHIRQQXPPHUVnYLKDUGHWVHQDVWGHQPDUVWLOO0HGLDSURGXFHQWHUQD$%.XSROHQ%RUOlQJH GRATTIS!7LOO6RQMD%RJUHQ0RUD,QJHU5XGPDQ/HNVDQGRFK%HULW%HUJHU6XQGERUQVRPKDGHUlWWO|VQLQJLI|UUDPnQDGHQVNRUVRUG

Missa inte Faluns bรคsta After Work Buffรฉ! 9 Fredagar 16.00-19.00 9:- ink st 79:- fรถ

r alkoh

023-79 48 88 www.olearys.se/falun 

olfritt

or รถl alterna

tiv


Soliga mars på Idre Fjäll. Ljuvligaste tiden i fjällen är marsveckorna med mycket snö och soliga dagar. Mysigt boende i fjällstuga Söndag-torsdag v. 10-13. 3660:-/stuga, nära till skidåkning och med plats för 6 personer.

Fjällpaket på Pernilla Wiberg Hotel Torsdag-söndag v. 10-13. Del i dubbelrum inkl. frukost och 3-dagars skipass 3610:-/vuxen.

Boka fjällsemestern på idrefjall.se eller ring 0253-410 00


KRÖNIKA

VI SKA TA TILLBAKA VÅREN I VÅR

och sen då? JAG VAR EXTREMT LÄTTPÅVERKADVRPEDUQ2FKGnPHQDUMDJLQWHDY DONRKROHOOHUDQQDQVWLPXODQWLD'HJMRUGHVLWWLQWUlGHI|UVWVHQDUH1HMMDJV\IWDU SnYDGVRPVNXOOHJ|UDV9DGMDJVNXOOHJ|UD1XVHQRFKDOOGHOHVQ\VV+DGH VNRONODVVHQYDULWSnVWXGLHEHV|NSnHQEUDQGVWDWLRQVnNlQGHMDJPLJWYLQJDG DWWEOLEUDQGPDQ9DUMDJDYHQKlQGHOVHSnHQERQGJnUGMDGnYDUGHWEDUDDWW VLNWDSnDWWEOLERQGH-DJVNXOOHlJQDUHVWHQDYOLYHWWLOODWWWU|VNDVnRFKKlUVD (YHQWXHOOWYDOODJHWWHUPM|ONDRFKLQVHPLQHUDNRVVRULHWWU\VOLJWWHPSR2FK VnIRUWVDWWHGHW0LQQVDWWMDJWLOOOLNDGHODURUREHVYLNHOVHXSSKHWVQLQJRFK I|UYnQLQJInWWORYDWWVLNWDSnDWWEOLEnGHRSWLNHUEUHYElUDUHRFKVDPH0LQQV RFNVnDWWMDJHIWHUDWWKDVHWWQnJRQN|UDVNRWHUSnWYNlQWHWWREHVWULGOLJW EHKRYDYDWWEOLVNRWHUI|UDUHlYHQIDVWMDJUHGDQGnI|UVWRGDWWGHWWUROLJWYLVLQWH YDUHQOHJLWLPHUDG\UNHVUROO'HVVXWRPW\FNWHMDJLQWHHQVRPVNRWUDUVnVRPQL I|UVWnUNDQWDGHVMXVWGHQGlUSHULRGHQDYPLQEDUQGRPDYV|PQO|VDQlWWHURFK HQRUROLJSRMNPDJH VID ETT TILLFÄLLEVnJMDJHWWUHSRUWDJHRPYlUOGVRPVHJOLQJ-DJWRJHWW GMXSWDQGHWDJVDWWHHQDKDQGHQI|USDQQDQRFKNRQVWDWHUDGHGDJVDWWVHJOD NORWHWUXQWLHQJLVWHQNDMXWD7URJQDOlVDUHNlQQHUWLOOPLQUlGVODI|UGMXSW YDWWHQ²RFKGHQKDUYDULWOLYVOnQJ²VnlYHQGHQQDSHULRGI\OOGHVDYVNDUSODGGDG QHUYRVLWHW7URWVGHWWDI|UVWRGMDJDWWLQJHQWLGIDQQVDWWI|UORUD-DJWRJHWW UDWLRQHOOWEHVOXWWURWVPLQDXQJDnU'HWYDUEDUDDWWVlWWDLJnQJ6HWLOODWWYlQMD VLJPHGNDE\VVERPVWDJRFKVHJHO0HGKMlOSDYPLQSDSSDVKlQGLJDKlQGHU E\JJGHVHQSURWRW\SDYHQVHJHOEnWSnJnUGHQL.YDUQVYHGHQ1LNDQVNHLQWH WURUPLJPHQGHWlUVDQW)UnJDJUDQQDUQD'HNRPPHUVYDUDDWWGHQYDUYLW GU\JWI\UDPHWHUOnQJRFKDWWGHQVWRGEUHGYLGYHUDQGDQ0HQQnJRQVWDQVXQGHU EDUQGRPHQI|UVYDQQGHQPlUNOLJDDPELWLRQHQDWWEOLHQQ\PHQQnJRWPLQGUH EORGVW|UVWLJNDSWHQ$KDE.DQVNHWXUGHW0HQYlUUHVNXOOHGHWEOL OCH JAG TROR²HOOHUWLOORFKPHGYHW²DWWPnQJDDQGUDEnGHNlQWRFK NlQQHUVDPPDnQJHVW9DGVNDMDJJ|UD"1lUVNDMDJVOXWDJ|UDGHWMDJJ|U QXRFKE|UMDPHGGHWVRPMDJHJHQWOLJHQYLOOJ|UD"9DUGHWYHUNOLJHQGHWKlU



VRPMDJGU|PGHRPVRPEDUQ"-DJ VSULQJHUSnGHGlUIXQGHULQJDUQD LEODQG6RPHQJDPPDOYlQVRPMDJ UDPODULQLSnVWDQ6RPQnJRQMDJ P|WHUSnNURJHQLEODQG9LNDQVNH LQWHW\FNHURPYDUDQGUDVnP\FNHW 0HQYLWYLQJDVWLOODWWXPJnVMDJ RFKGHGlUWDQNDUQD'HWYDUYlUUH I|UXW'nYDUIXQGHULQJDUQDRPYDG MDJVNXOOHJ|UDPHGPLWWOLYVRP HWWVWU\SJUHSSSnPLQWLOOYDUR(Q LQIHNWLRQLKMlUQDQ1XNDQMDJKnOOD GHPSnDYVWnQG7LOOUlFNOLJWOnQJW ERUWDI|UDWWGHLQWHNDQVNDGDYDUD LUULWHUDQGHHOOHUInPLJDWWnQJUD 0HQQRJKDUMDJWYLYODW3nPLJVMlOY RFKPLQDYDO3nRPGHEHVOXWVRP MDJWDJLWYHUNOLJHQYDULWGHUlWWD3n RPMXVWPLQYlJVNDOHGDPLJWLOO QnJRQWLQJYHWWLJW'HWYDUYlUUHI|UXW 1lUMDJYDUHQOLWHQSRMNH JAG ÖNSKARDWWMDJYLVVWHGn KXUYDFNHUWGHWlUPHGGHQGlU RYLVVKHWHQ2VlNHUKHWHQ$WWMDJLQWH DOOVERUGHKDRURDWPLJ$WWWLOOYDURQ lUVRPÀQDVWQlUGHWLQWHEOLUVRP PDQWlQNWVLJ$OOGHOHVQ\VVKDGHMDJ EHVWlPWPLJI|UDWWÀ[DUHVWHQDY GHWKlUOLYHWSnHJHQKDQG.lQGH

PLJ|YHUW\JDGnWPLQVWRQHI|UHWW |JRQEOLFN2FKVnVSUDQJMDJLQL KHQQH+RQPHGNUDIWHQ+RQVRP I|UlQGUDGHDOOW6RPI|UlQGUDUDOOW 2PDOOWVRPMDJWlQNWWURWWRFK SODQHUDWYHUNOLJHQEOLUVRPMDJWlQNW WURWWRFKSODQHUDWnWHUVWnUDWWVH 2FKGHWJ|UPLJLQJHQWLQJ.lQQHU LQWHOlQJUHVDPPDQHUYRVLWHWHOOHU I|UYLUULQJVRPQlUMDJYDUNDSWHQSn GHQGlUVHJHOEnWHQLWUlGJnUGHQ NU STÅR JAG HÄR.cUHQKDU JnWW9LVVDDYGHPOLWHI|UIRUW9LVVD DYGHPDOOGHOHVI|UOnQJVDPW9DGMDJ lUHOOHUYHPMDJlUSnYlJDWWEOLYHW MDJLQWHVlNHUW0HQSO|WVOLJWNlQQV RYLVVKHWHQVRPHQWU|VW1XVHU MDJIUDPHPRWHQPRUJRQGDJGlU MDJLQWHYHWYDGMDJVNDJ|UD.DQVNH I|UVYLQQHUMDJERUWLHQPnQDGHOOHU WYnLJHQ0HQI|UVWRFKIUlPVWVND MDJOlUDPLJDWWOHYDPLWWLGHWKlUVn NDOODGHQXHW/lUDPLJDWWEDUDYDUD 7LOOYDURQKDQGODULQWHEDUDRPPLJ VMlOYOlQJUH3UHFLVYDGMDJKDUOlQJWDW HIWHU.DQVNHNRPPHUMDJDWWJ|UD GHQGlUYlUOGVRPVHJOLQJHQLDOODIDOO .DQVNHEOLUMDJEUHYElUDUH.DQVNH EOLUMDJVDPH0HQGHWYLNWLJDVWH

MXVWQXGHWVRPYHUNOLJHQEHW\GHU QnJRQWLQJlUGHWVRPKlQGHUEUHGYLG DUEHWHW+DUVnVYnUWDWWNRPPDLIUnQ GHWHIWHUVRPGHWKDUYDULWGHWHQGD IDVWDLPLQWLOOYDURXQGHUGHVHQDVWH nUHQ1XlUGHWVRPNlQQVYLNWLJDVW DWWNlUOHNHQNRPPHUDWWIRUWVlWWD 2FKGHWYHUNDUYLYDUD|YHUHQVRP )LQWVn9LVNDWDWLOOEDNDYnUHQLYnU I|UGHQKDULQWHYDULWYnUSnÁHUD nU9LKDUVXWWLWSnROLNDSODWVHURFK XSSOHYWOLNQDQGHNlIWVPlOODURFK KROPJnQJDULSULQFLSRYHWDQGHV RPYDUDQGUDVH[LVWHQV1XKDUYL YDUDQGUD2FKHIWHUDWWYnUHQEOLYLW YnUVnVNDYLWDWLOOEDNDVRPPDUHQ 2FKVHQInUYLVHYDGVRPKlQGHU 'HWNDQVNHLQWHDOOVEOLUVRPMDJ KDUWlQNWPLJPHQMDJNDQNQDSSW EHVNULYDKXUP\FNHWMDJVHUIUDP HPRWDWWInXSSOHYDGHW

7(;7.ULVWLDQ*LGOXQG


Mündag-Fredag serverar vi härlig Lunchbuffè 11.30-14.00 Pris: 95:I lunchen ingür stor salladsbuffÊ, sill o potatis, mültidsryck, smÜr, brÜd, kaffe och hembakt kaka.

Ă&#x201E;ven Ăśppet helger fĂśr helgbuffè LĂśrdag & sĂśndag 12.00-15.00 Pris: 195:I helgbuffèn ingĂĽr stor salladsbuffĂŠ, sill o potatis, mĂĽltidsryck, smĂśr, brĂśd, kaffe och hembakt kaka.

ZZZVWDEHUJUHVWDXUDQJVH

Lunch i fantastisk miljĂś

LunchbuffÊ mündag-fredag 11-14 med flera olika välsmakande rätter som dukas upp som buffÊ i Geschwornergürden. I lunchen ingür stor salladsbuffÊ, mültidsdryck, smÜr, brÜd, kaffe och kaka.

Lunchmenyn hittar du www.falugruva.se Där finner du även all information om middagar och konferanser m.m.

Elin med personal Ünskar er varmt välkomna!

Konferera i vĂĽr nyrenoverade filmsal fĂśr upp till 75 personer, mer info om konferenspaket m.m hittar du pĂĽ WWWSTABERGRESTAURANGSEs 

G

Välkomna Ünskar Maria & Sara

Konferensbokning: 023-78 20 50

Hallen är fylld med nya Bßrstner! Välkommen till Eljasmotor!

Sista chansen vinterpriser pü vüra begagnade husbilar! Skynda fynda innan vüren är här!

Hobby Van Exclusiv 2008

BĂźrstner Solano T725 2010

1000 mil, LĂĽngbäddar, Solcell, 1000mil, Mittbädd, DesignAC, Larm Backkamera. paket, Komfortpaket, KĂśksďŹ&#x201A;äkt, Kyl, Frys, Ugn, Utvändig dusch, Vinterpris 510000:120l Dieseltank. Ord.pris 585000:Vinterpris 765000:Ord.pris 825000:-

BĂźrstner Elegance i810 Lyx,lyx,lyx...

Bßrstner Solano 729 SäljsuccÊn! Lüga lüngbäddar.

BĂźrstner Quadro it664 2008

Adria IS 687 2006

2000mil. Vinterpris 545000:Ord.pris 585000:-

4000mil. Vinterpris 410000:Ord.pris 440 000:-

Eura Mobil C652sb 2004 4800mil. Vinterpris 399000:- Ord.pris 439000:Swift Royale 590 1998 10200mil. Vinterpris 185000:- Ord.pris 235000:BĂźrstner Solano 710 2007 2000mil. Vinterpris 530000:- Ord.pris 595000:Knaus ST500 2003 8400mil. Vinterpris 230 000:- Ord.pris 250000:Eura Mobil 1999 8500mil. Vinterpris 320000:- Ord.pris 349000:BĂźrstner Nexxo t660 Perfekt fĂśr tvĂĽ!

BĂźrstner Viseo i696 Perfekt fĂśr familjen!

KĂśp en av vĂĽra demobilar till specialpris! Leverans i vĂĽr!

Projektgatan 7 Borlänge | 0243-175 50 Ă&#x2013;ppet: mĂĽn-fre 9-18, lĂśr 10-14

www.eljasmotor.se


TÃ&#x201E;VLING & SERIE

vinn exlusivt

miss li-paket! )HPO\FNOLJDSHUVRQHUQDVRPVYDUDUUlWWSn IUnJDQKlUQHGDQYLQQHUYDUVLWW0LVV/LSDNHW GHWLQQHKnOOHUGHQNRPPDQGHVNLYDQVDPWJUDWLV LQWUlGHWLOO0LVV/L·VWXUQHSUHPLlUL%RUOlQJH ,YLONHQVNRODJLFN0LVV/LnUVNXUV" )RUVVDlQJVNRODQ 2UQlVVNRODQ 7MlUQDlQJVNRODQ 7lYODUJ|UGXSnZZZQROOWYDVH 9LJLOODUlYHQY\NRUWVnGXNDQlYHQSRVWDVYDUHWWLOO 1ROOWYn,QGXVWULJDWDQ%RUOlQJH 9LYLOODWWGXVYDUDULQQDQPDUV /\FNDWLOO

)RWR-HDQHWWH$QGHUVVRQ

0,66/,7851e35(0,b5 'DWXP7RUVGDJ0DUV 7LG )|UEDQG/LWWOH0DUEOHV

jan andersson




UPPTร„CK!

prylar

NYA GRYMMA TIPS VARJE Mร…NAD!

Love Jelly

LED skosnรถren

)|UGHQlYHQW\UOLJHNlUOHNVEDGDUHQVRPDOOWLG lUXWHHIWHUGHWOLOODH[WUDร€QQVEDUDHQYlJ DWWJn/RYH-HOO\(QSnVHUlFNHUWLOOHWWEDGNDU RFKI|UYDQGODUYDWWQHWWLOOHQVSDJHOpVRPRP VMlOYDVWH$PRUKDGHWDSSDWXSSEDGHW,VWlOOHW I|UDWWEDUDVNYDOSDRPNULQJVRPJDPPDOW YDQOLJWWULVWYDWWHQEOLUGHWWU|Jร\WDQGHRFK I|OMHUNURSSDUQDVU|UHOVHU'HWKnOOHUYlUPHU XSSWLOOWUHJnQJHUOlQJUHlQYDQOLJWYDWWHQGHW J|UHUOHQDRFKPMXNDRFKGHWGRIWDUYDQLOMROMD NUย‡FRROVWXIIVH

1XKDUHQKMlOSVDPVMlOlQWOLJHQNRQVWUXHUDW VNRVQ|UHQVRPO\VHUPHGKMlOSDY/(' ODPSRU$OODSODWVHUGlUGHWlUP|UNWRFKGX ElUVNRUEOLUHQOLWHQVPXODIHVWOLJDUHPHG O\VDQGHVNRVQ|UHQ'LQDQlWWHUSnGDQVJROYHW NRPPHUDOGULJPHUDWWEOLVLJOLND9lOMPHOODQ WUHOMXVOlJHQ6DNWDSXOVHUDQGHVQDEESXOVHOOHU IDVWVNHQ'HWlUHWWSDUW\SnGLQVNRRFKDOOD lUEMXGQD NUย‡FRROVWXIIVH

modell? ร„r du intresserad av att vara modell i vรฅra modereportage? Vi sรถker bรฅde killar & tjejer. Kanske just DU kรคnner dig lockad av denna utmaning? Skicka en bild och dina kontaktuppgifter till redaktionen@nolltva.se sรฅ hรถr vi kanske av oss till just dig!

Go for it! Pac Man kakformar

Klassisk yuppie-nalle

6HGDQKDUDOODVYnUJXODOLOODGDWD NUDEDW3DF0DQlWLWPLOMDUGHUSULFNDURFKHWW RUlNQHOLJWDQWDOIlUJJODGDVS|NHQ'lUI|UlU GHWLQWHPHUlQUlWWDWWGXQXNDQlWDKRQRP 1RPQRPQRPQRPQRPQRPQRP NUย‡FRROVWXIIVH

1XNDQGU|PPHQEOLYHUNOLJKHWPHGHWWQ\WW ,SKRQHIRGUDOVWRUWVRPHQWHJHOVWHQ)|UUL WLGHQEOHYWHOHIRQHUQDPLQGUHRFKPLQGUH1X KDUGHWW\GOLJHQYlQW6HQDVWHQ\WWI|U,SKRQH lJDUHlUHWWVNDOVRPI|UYDQGODUGHVODQND PRELOHUQDWLOOHQRUPDNORVVDU GROODUย‡WKXPEVXSXNFRP

citatet

9LQQDUHDYHQYDOIULEHKDQGOLQJYlUGHNUKRV 6W\OH(GXFDWLRQL%RUOlQJHlU0DULD=HWWHUVWU|P

*UDWWLV

siffran

โ€œPengar รคr inte allt hรคr i vรคrlden, men de hjรคlper en onekligen att hรฅlla kontakten med sina barn. โ€

 Bing Crosby

besรถk

27 ยซPDUVbQWOLJHQGDJVI|UVRPPDUWLG

Mร…NADENS MUSIKVIDEO &RROUDSDYGHQDOOWLGOLNDYDFNUD1DWDOLH3RUWPDQ <RXJRJLUO <RXWXEHยฒV|NSn1DWDOLH3RUWPDQ5DS

Mixa ihop din egen sallad. Kom till vรฅr salladsbar, 109:-/kg mรฅn-fre 7-22 lรถr-sรถn 9-22 0243-15945

ICA KVANTUM - EN RIKTIG MATBUTIK




.$/(1'(5

&/8% 1,1(7((1 9$5-(/g5'$*)5,(175e+(/$ .9b//(1)5$07,//35(0,b5(1 $99c51<$/g5'$*6./8%% )5('$* 0$56 

%2/$1&+(*2(6 ./$66)(67 <HV1XILUDUYLLQYnUHQPHGGH JU\PWSRSXOlUDNODVVIHVWHUQD *DUDQWHUDWIXOOW|VVMXO|UGDJDULUDG

%25/b1*(6 +(7$67( 52&../8%%

621,&6<1',&$7( 0$5<)$< (7(51$/ )5('$* 0$56 

%25/b1*(6 +(7$67( 52&../8%%

(7 // 8 % 21 9,(7& *32516h5)(56 7+(6&$06 /g5'$* 0$56 

672535(0,b5 )g59c5

1<$/g5'$*6./8%% )5('$* $35,/ 

.QDSSDLQGHVVDGDWXP LGLQNDOHQGHU

 PDUV  DSULO

/22375223 52&.(56 )5('$* $35,/ 

5(%(&&$ ),21$

LIGEN ร–RMODP F R! R A H I V TE IZZO S A D O G STANS

ร–ppettider: Onsdag-Torsdag: 17-23 Fredag: 16-01 Lรถrdag: 17-01 Sรถndag-Tisdag: Stรคngt

PHULQIRZZZERODQFKHVH

.$/$6 256'$E*HDUQDLVHVnV 6'$*P7 5 VRFK 2 LWH 7 IU HV -( 5 RP 9$ ILOpPHGS +HOVWHNWR[

NU

gSSHWWLGHU 0nQ7RUV )UHGDJ /|UGDJ 6|QGDJ6WlQJW


Nolltvå #2-2011