Page 1

residential WESTERN SUBURBS WEEKLY

ISSUE 105 • MARCH 9 • 2010

Thoroughly modern manor Despite its period magnificence, this imposing Peppermint Grove mansion conceals a fascinating secret. PAGE 5

Don’t miss our Invest in the South West feature. COMING SOON: Details page 20

GOING GOING GONE!

St yle IN STORE

UP TO

50% % OFF

SALE’S LAST DAYS

HEA3637

CALL OR VISIT NOW for your chance to experience the Heather Levi touch. 439 Hay Street Subiaco 6008 WA

Heather Levi Interiors’ unprecedented sale has helped ped ed many to start 2010 off in style. They have made savings off up u to 50% sensational savings on fantastic floor coverings, fabulous fabrics,

....or at

R YOUR DOO

W W W. H E AT H E R L E V I . C O M . A U

wicked wick wallpaper, wonderful window treatments, lustrous lamps and lovely lounge suites.... at up to half price! But you had better act now. The sale is about to end!

PHONE

9388 2788


AUCTION

on site Saturday 13th March 2010 @ 2PM UNLESS SOLD PRIOR

t S tmen N in TIO ppo pm C E A to 2 SP By IN y’s .15 a 1 esd ay’s n d rd We Satu

13/44 Ranelagh Crescent South Perth

Stunning Views on the River Backdropped by shimmering River and City Views this stunning residence offers a waterfront lifestyle that is second to none. Impressive yet understated and thoroughly appealing, this home’s prospects for capital appreciation are likely to be quite exceptional! Spacious rooms open out to deep patios and terraces over two levels, with the added bonus of a roof top spa deck.

FEATURING • Four bedrooms • 4 bathrooms • Gym/study • Numerous living areas • Swimming pool • Entertaining lounge • Abundant parking plus a communal tennis court • All set in a wonderful gated complex.

For full details contact

Michael Hood 0414 979 328

9386 2999

www.hoodpropertygroup.com.au


REVIEWS 6

5

2

PEPPERMINT GROVE 137 FORREST STREET EXPRESSIONS OF INTEREST FEATURES Hand-carved marble fireplaces, hand-painted leadlights, Tasmanian Oak parquetry flooring, French marble tiles and antique chandelier light fittings. AGENT Mack Hall & Associates CONTACT Frank Torre 0411 866 550 and 0417 744 600 WEB www.mackhall.com.au DETAILS http://tinyurl.com/yhx96ko

Period perfection with a modern twist Antique chandeliers and hand-carved door handles grace this home, writes JANE EVANS WHEN a rare and large block complete with a 1940s dwelling became available on Forrest Street, an inspired couple saw an opportunity to build a stately home better suited to the streetscape. The result of their grand vision, with its sweeping verandahs, cast iron lacework and prominent turret, would appear circa 1900s, perhaps even earlier. However, the heritage styled beauty belies its true age – number 137 was constructed in 2008. The grand home, spanning some 1434sqm, was painstakingly designed and completed in four years. Inside and out, the attention to detail has been executed exquisitely. Antique chandeliers were

sourced from around the world and a Cornish craftsman was commissioned to handcarve the door handles. Even the bathroom vanity units were handmade in Tuscany. A custom made ceiling dome above the stairs features a hummingbird motif. It was replicated to match the antique brass door handles on the second floor. Black wrought iron gates, in the

style of Victorian Italianate architecture, enclose the grounds of this gracious residence, which can only be described as aweinspiring on viewing. Guests are well catered for as the home has six bedrooms, five bathrooms and five living areas. There is also a formal lounge and dining, plus a home theatre and spacious office. The luxurious kitchen features hand-painted cabinetry, and was

styled on the designs of the British cabinetmaker, Clive Christian. Stunning landscaped gardens are playground to the owner’s four children, and the rear lawns stretch towards Hurstford Close. Well established oak and magnolia trees provide shade and contrast, and an ideal spot to sit quietly and contemplate life. There are vegetable gardens for the provision of fresh produce, and an outdoor pool completes the

vision for a healthy lifestyle. “We have always owned and been attracted to period homes,â€? said one owner. “The beauty of this home is that we have created the feeling of an old house, but have included modern conveniences. “This is something you simply couldn’t achieve in renovating an original older home,â€? he said. “Quality should last a lifetime,â€? added the co-owner. â–

GZENWUKXGMKVEJGPU HKG[ZOL[RHGZNXUUSY • Exclusive designer kitchens and bathrooms. • Unique, technically superior, functional and stylish. • Extensive industry experience for hassle free project management. • Cabinetry designed and manufactured in Italy. • Extensive range of quality brand tapware, sinkware, electrical goods and benchtops. • Space savings solutions for your kitchen and bathroom. • Commercial or domestic projects across Australia. If you are building, renovating or developing, visit our showroom to see the range of exclusive kitchens and beautiful bathrooms.

5JQYTQQO*C[5V5WDKCEQ 2JQPG   'OCKNUVGXG"TGVTGCVFGUKIPEQOCW YYYTGVTGCVFGUKIPEQOCW


Auction Sat 20 March 11.45 on site

28 Branksome Gardens, City Beach

INSPECT Sat 11-11.45am Wed Twilight 6.45-7.15pm Rep On Site

“Blank Canvas” - On the Strip... Possibly South City’s best positioned water front block in a private cul-de-sac shared with only one other property. Your own path leads to reserve, dunes, stunning white sand and pristine uncrowded beach. Look to the West and enjoy uninterrupted ocean views and to the East enjoy the backdrop of beautiful Bold Park. Walk the path at sunset to City Beach or stroll over the road for tennis with the kids. It doesn’t get any better than this! Once in a lifetime opportunity that cannot be repeated. Secure this dream property and start planning your South City lifestyle.

CHRISTOPHER DEE 0413 122 499 9383 7199

realmark.com.au

Set Date Sale Monday 15 March 5pm 25 Bella Vista, Scarborough

“Your Pad on the Beach... Stunning ocean panorama can be enjoyed from every room in this quality built “Buildwise” home. Features include spacious accommodation, gourmet kitchen, bathroom built for two with double sinks and large bath, theatre room and views that will be the envy of all who visit!

CHRISTOPHER DEE 0413 122 499 9383 7199

Stroll across the road for a swim, walk the path to Scarborough’s Restaurant and Cafe Strip and enjoy the lifestyle this location provides. Inspect today!

realmark.com.au INSPECT Saturday & Sunday 1 - 1.45pm


REVIEWS 2

2

1

$1,200,000

WEST PERTH 6/32 OUTRAM STREET AGENT Hood Property Group CONTACT Maree Lawson on 0417 788 933 WEB hoodpropertygroup.com.au DETAILS http://tinyurl.com/yawwbwn

Unique penthouse a prize pick This penthouse linked to a five-star hotel has many advantages, writes AMANDA RANKIN WHETHER it is breakfast on the street front terrace cafe or sunset drinks in the lobby bar, this penthouse apartment perched atop a five star boutique hotel offers the ultimate in inner city living. Situated within The Outram, a chic and intimate hotel in the heart of West Perth, this is a rare opportunity to own a fully furnished strata title property that can be lived in or put into the hands of the hotel for high rental return. The apartment spans two levels with a private and spacious master suite at the very

top. The suite includes a large and luxurious bathroom with granite benches, an open shower and a deep bath. Two separate built in robes ensure plenty of hanging space plus there is storage in the loft. The second bedroom has its own separate entrance, allowing it to be used as an office or consulting room. It also has a bathroom and robe or storage area. The open-plan living room is spacious and leads to a sunny balcony with an inner City

view over West Perth. The kitchen is surprisingly large and very sleek with granite benches, stainless steel appliances and a generous walk in pantry. All the furnishings are high quality and appropriately contemporary, and included in the package is the use of all hotel facilities and services. Secure parking for one and a storage area are below ground and there is a separate side entrance for residents who don't wish to enter through the hotel foyer. Positioned in the heart of West Perth, it is

an easy stroll to restaurants, cafes and Kings Park, and as a bonus the bus stop for the free city CAT is right at the front door. â–


REVIEWS 5

3

2

$2,600,000

SHENTON PARK 7 WAVERLEY STREET AGENT CONTACT WEB DETAILS

Mack Hall and Associates Mark Anderson on 0411 645 174 www.mackhall.com.au http://tinyurl.com/yhg7qkq

Blended with personality A sleek and sophisticated home for the modern family. By JANE EVANS WITH three little girls, the owners of this striking contemporary house had their work cut out in creating a home that was both practical and stylish. But they succeeded. In the leafy surroundings of Shenton Park, this double-storey home blends perfectly into the treelined street while standing out from the typical older-style homes of the area. The home features clean lines with rich, warm finishes and an attractive and inviting facade. A landscaped front garden features two open, timber-decked patios; one an entrance into the home and the other a private retreat off the master bedroom. Through the solid timber front door, the home unfolds, bouncing light, space and beauty effortlessly. Off the foyer, the master bedroom is generous with its own lounge area and spacious walk-in robe.

Wooden floorboards flow from the front door through to the central living area, which features a galley-style kitchen with marble bench tops, Smeg stainless steel appliances and a Miele dishwasher. The dining and lounge area has bifold doors that allow the space to integrate with the outdoors. A timber-lined alfresco area with a built-in barbecue, granite bench tops and american oak cabinetry makes entertaining a delight. There is also a plunge pool with a striking stonecladded water feature and miniature frangipani trees on either side. An added feature of this area is a video camera, allowing children in the pool to be watched by adults on the internal televisions. The four minor bedrooms are on the second level of the home where there is also a large theatre or activity room for the children. ■

FACTOR Considering selling? Contact us for an obligation-free appraisal and you’ll discover why The Property Exchange’s X-factor has the edge in successfully marketing your home. Call 9388 3988 or visit thepropertyexchange.com.au THE PROPERTY E CHANGE


in the Lower Great Southern and the South West.

OSW315747

The Rural Building Company build through

OSWALD STYLE More than a builder of fine homes, Oswald is a culture. A style of living so exceptional it mirrors the aspirations of those privileged few, who desire the ultimate in design, construction, style and service. Visit one of our homes to find out more or call 9231 4800 oswaldhomes.com.au

t he p al is a de s

t he p l ant at ion

RBC314718

What inspires the Rural Building Company? The very same thing that inspires us all; an affinity to live in harmony with our great Australian landscape, resulting in homes that are uniquely Australian, from spacious practical designs that let the outside in, to traditional building materials such as bush poles and rustic bricks. No wonder the Rural Building Company are at home in every great Australian landscape, so whether you’re seeking a tree change, sea change, a place to indulge your outdoor hobbies or simply want to give the kids a taste of the real Australia, talk to the Rural Building Company. We reckon it’s worth a squizz online at ruralbuilding.com.au. Freecall 1800 643 800.

WE UNDERSTAND

Part of every great Australian landscape.


DALKEITH

2A Davies Road

4

EOI from $3,900,000

4

4

All expressions of interest presented by 4pm Tuesday March 30th 2010

Opulent Fusion of physical and metaphysical elements crafted together with the seal of approval from a Feng Shui Master, to give you this quintessential family home. From the stunning avant-garde entrance, expansive travertine floors, enormous kitchen (plus wet kitchen) with stainless steel Miele appliances, generous sized rooms focused around the lush, Balinese inspired sanctuary complete with alfresco area, Pagoda styled cabana and lagoon pool with waterfall. You will feel the calm after you return home after a hard day’s work. • 4 bedrooms 4 bathrooms (Two master suites) • Caesar stone bench tops • Statuario Venato marble verticals • Miele Nespresso Coffee Machine

• Wenge timber and white lacquer cabinets • Blend Victorian Ash and Travertine honed floors • Cellaring for 1000 bottles • Architect designed

Zorzi built, tastefully reappointed, this incredible home oozes quality and style. Ideal for the executive family.

Register your interest for a twilight viewing Wednesday 10th March 2010 GORDON DAVIES 9480 9385 (pager)

DAVID FEAR 0403 052 222

gordon@gdre.com.au

david@altusrealestate.com.au REAL ESTATE Listening. Learning. Leading.


REVIEWS

This land will sell quicker than the time it took to make this ad

CHURG315532

STAGE 5 RELEASED AT CHURCHLANDS GREEN. ALL PAST RELEASES 100% SOLD. Stage 5 at Churchlands Green is now selling. Secure your dream land and lifestyle in a picturesque, western suburbs estate just 3km from the beach and 8km from the CBD. Stage 4 sold extremely quickly. Act now to secure not only your dream lifestyle, but a dream investment. Visit our state-of-the-art website churchlandsgreen.com.au to select your lot online now. Call Time Conti ShefďŹ eld on 9225 4300, email churchlands@timeconti.com.au or visit our Sales OfďŹ ce on Alumni Terrace, Churchlands between 2–4pm Sat or Sun.

www.churchlandsgreen.com.au

Trendy address THE north side of Nedlands might not have the river nearby, but its close proximity to hospitals, the CBD, public transport, Kings Park and the Hampden Road cafe strip makes it a trendy and convenient address. A stunning tasmanian oak front door sets the scene for the stylish interior of this contemporary two level home with its extensive quality finishes and fixtures. On ground level, a front bedroom with ensuite bathroom is ideal for guests or an older child, while the open-plan living and dining area wraps around a sunny, north facing courtyard. The sleek kitchen has Caesar stone benches and stainless steel appliances, while bifold doors open on to the nearbydecked area for easy outdoor entertaining. To the rear of the home is a fully equipped home cinema with a giant screen set up for some serious movie watching.

4

3

2

$1,650,000

NEDLANDS 30A WILLIAMS ROAD AGENT Abel McGrath CONTACT Adam Gilbert 0430 360 031 VIEW By appointment WEB www.abelmcgrath.com.au The very private master suite is towards the rear where a ba2lcony offers glimpses of the City and Hills, and provides a cooling breeze. Two more large bedrooms on the second level have mirrored built in robes and share a stunning bathroom with dark timber cabinetry and more of the sparkling mosaic tiles. â–

$&712:7261$5($3,(&(2)7+(+,*+/<628*+7$)7(50$5*$5(75,9(55,6('(9(/230(17 /RQJDZDLWHGDQG \HDUV LQ WKH PDNLQJ IURP WKH 2XWOLQH 'HYHORSPHQW 3ODQWKLV VSHFLDO 5HVLGHQWLDO ODQG UHOHDVH LV EHLQJRIIHUHG IRU D OLPLWHG WLPH RQO\ DW D QHYHU WR EH UHSHDWHG SULFH ZLWK VWURQJ LQWHUHVW IURP 3HUWK DQG WKH 1RUWK :HVW H[SHFWHG  6LWXDWHG ZHVW RI WRZQ WKH GHYHORSPHQW LV SURYLQJSRSXODUZLWKVL[RIWKHORWVDOUHDG\HDUPDUNHGIRUVDOH7KLVLVQRWDWLPHWRVLWRQWKHIHQFHDVWKHILUVWILYHEX\HUVZLOOKDYHWKHLU FKRLFHRIORWVIRUMXVW7KHODVWODQGUHOHDVHLQWKHDUHDZDVLQVRLWPD\EHDQRWKHUGHFDGHEHIRUHDQRSSRUWXQLW\DVJRRG DV WKLV SUHVHQWV LWVHOI DJDLQ :HVW RI WRZQ RSWLPL]HV WKH 0DUJDUHW 5LYHU OLIHVW\OH EHLQJ FORVH WR IDPRXV VXUI EHDFKHV WKH PDLQ VWUHHW RI WRZQDZDUGZLQQLQJZLQHULHVWKH0DUJDUHW5LYHUDQGSULVWLQHIRUHVWV7KHDUHDLVSHUIHFWIRUWKRVHORRNLQJWRVORZGRZQEXWVWLOOOHDGDQ DFWLYHOLIHVW\OH 0DUJDUHW5LYHU5LVHZLOOHVWDEOLVKLWVHOIDVWKH3HSSHUPLQW*URYHRIWKLVSRSXODUUHJLRQ 63(&,$/,1752'8&725<%218621),567/276 /,0,7('7,0(21/< â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

%XLOGHU¡VUHEDWH %ORFNVL]HVUDQJHIURPVTPWRVTP 0LQXWHVIURPWKH&HQWUHRI7RZQ

&+2,&(2)/276)520


AUCTION

JOLIMONT

INSPIRATIONAL : TRANQUIL : SENSATIONAL OUTSTANDING RESORT STYLE RESIDENCE Designed by Hofman and Brown Architects, this fabulous home is extraordinary in its presentation, quality of workmanship and design.... With tranquil tropical Asian inspired landscaping throughout the grounds, this home offers a casual yet sophisticated indoor/outdoor lifestyle in these most luxurious surroundings. Its presentation is amazing and the attention to detail paid in its creation is quite exceptional.

15 PEEL STREET, JOLIMONT OPEN WEDNESDAYS 5.30-6.30pm and SATURDAYS 10.30-11.30am AUCTION ON SITE SATURDAY 27 MARCH AT 10.00AM (if not sold prior)

Janey Sanderson 0411 524 211

$1,139,000

SUBIACO

Terrace In Prime Location

Only seconds from Rokeby road in fashionable Park Street is this 3 big bedroom, 2 bathroom, 2 living area ducted air conditioning home on Green Title. Features fresh paint, neat neutral decor, north facing timber rear deck off family room, ideal for alfresco entertaining. Double lock up garage with remote control off rear laneway.

3 2 2

Michael Hoad

313 ROKEBY ROAD, SUBIACO

0411 885 556

T 9381 9111

W WWW.PAXTONHOAD.COM.AU


SUBIACO

$620,000 - $679,000

CLAREMONT

Love Shack

$1,200,000

YOKINE

$1,500,000

Poolside Apartment

Overlooking the pool and the garden this two bedroom two bathroom apartment offers living and dining opening onto alfresco balcony. Beautiful finishes, Miele kitchen, reverse cycle air conditioning, double glazing, ready to go!

James Paxton

0418 923 900

3 2 2

SHENTON PARK

A unique opportunity for a hassle free inner-suburban development, this prime block of land (1315sqm approx) comes with approved plans for four street frontage homes.

Khaled Garman

0422 388 515

$659,000 JUST THE GO....

Premium Land...

6 3 6

Welcome To This fabulous New York style studio is perfect for those looking for a discreet hideaway close to Subiâ&#x20AC;&#x2122;s hub. Being sold fully furnished, so just bring your toothbrush!! Lovely location - very self contained. Unique and one of just two.

1

For those looking for a townpad. Ideal for lock up and leave or rental investment.

2

1

Luxurious 2 bedroom, 2 bathroom first level apartment, facing park. Big balcony enjoys the outlook. End unit in well maintained group.

2

ROY PAXTON

1

Chris Ehlers 0419 935 295

Carolena Boyd

SHENTON PARK

1

Sales and Marketing Executive 0410 818 896

0418 905 963

AUCTION

Michael Hoad

SUBIACO

More Resort Than Residence

0411 885 556

$1,690,000 SUBLIME!

Over 3 years selling success in the Western Suburbs

SUBIACO

From $899,000

DOUBLEVIEW

Truly Amazing

Auction 13th March 2010 at 12.30pm

The most beautiful character home on offer in Subiaco today. Exquisitely furnished and immaculately presented by attentive owners. 3 big bedrooms, 2 lavish

4

Your last opportunity to view before you bid for this outstanding residence with award winning Renovations. Stunning 1900â&#x20AC;&#x2122;s cottage conversion offers stylish, relaxed living! 4 beds, plus study, 2 baths, beautiful open living, resort style gardens.

2

2

View 5.30-6.30pm Wednesday 10th and From noon Saturday 13th.

Carolena Boyd

$1.2M - $1.4M A Home and Development Site

Circa 1891 brick and iron semi detached cottage with large additions completed some years ago and only recently completely redecorated. Large living areas, high ceilings and masses of light accentuate the charm of this extremely appealing home.

0418 905 963 Michael Hoad

3 1 3 R O K E BY R OA D, S U B I AC O

0411 885 556

T 9381 9111

3 2 2

There is something for everyone here in this beautifully located 904sqm block opposite Hale school oval with a big 4 bedroom 2 bathroom plus study, lounge, TV room and family area. Good enough to live in for a few years before building 3 new homes.

Chris Ehlers

0418 935 295

4

bathrooms, formal sitting room (or bedroom 4), formal dining and vast family area with meals section adjacent to designer kitchen. The charm of this home is evident from the instant you arrive at the front gate. Internal inspection only reinforces this view.

3

2

2

2 1

W W W W. P A X T O N H O A D . C O M . A U

Michael Hoad

0411 885 556


PROPERTIES FOR SALE WEST LEEDERVILLE

104 BLENCOWE STREET

PAST THE GATE INTO WORLD OF CHARM STEP through a wrought iron gate into the romantic, private front garden of this enchanting brick and iron cottage near Lake Monger. The home has three bedrooms, a central lounge with an open fireplace, a large kitchen, charming stained glass entry and decorative cornices and ceiling roses. Polished floorboards feature throughout, as do timber blinds and ceiling fans. There is a brick paved courtyard garden with a limestone wall and a lush garden at the rear with roses, hedges of rosemary and a beautiful central tree providing shade and ambience. ■

3

2

1

$1,100,000 AGENT Paxton Hoad CONTACT Carolena Boyd 0418 905 963 WEB http://www.paxtonhoad. com.au DETAILS http://tinyurl.com/yb6gfa2

Aurora. Your home in the sky.

live

in the village in the city.

Mirvac’s vision for The Peninsula at Burswood was revolutionary – to create a masterplanned community to rival anything that has come before. The reality is even more astonishing. The five luxurious apartment buildings have already become local landmarks. However, it isn’t until you enter The Circus that you truly appreciate how brilliantly all the elements work together. It’s all part of the grand design and quality construction, with every facet managed by Mirvac’s multi-award-winning team of planners, builders, architects and interior designers.

MF MIFB0288I

If you’ve only ever admired The Peninsula from afar, why not visit this weekend. It may just change your life. Move in today. Luxury residences in Aurora now selling: • 2 bedroom apartments from $680,000 • 3 bedroom apartments from $1.5 million • 4 bedroom apartments from $1.75 million

MIRVAC REAL ESTATE PTY LTD

Book to view the stunning display apartment today by calling 9424 9999 or visit the Sales and Information Centre, located off The Circus, Burswood. Open 10am to 5pm daily. www.mirvac.com/peninsula-burswood

Apartments now selling from $680,000 Rising majestically into Perth’s eastern sky is Aurora, The Peninsula Burswood’s newest luxury apartment building. Experience this truly magnificent residence, located within the heart of this thriving community. Aurora puts a host of resort-style facilities at your door, including a fully equipped gymnasium, a barbecue courtyard and a stunning recreation deck with heated swimming pool. • 2, 3 & 4 bedroom residences available • 92sqm to 218sqm of internal living space • Choice of 3 contemporary colour schemes • Live it now!

The river. The city. The rhythm.


The Views

The Pool

The Villa

Location, Location, Lembongan Less than four hours from Perth and 30 minutes by boat from Bali, you’ll find the beautiful island of Lembongan and its famous ocean views that go on forever. You’ll also find Villa Rumahku. This stunning, fully furnished villa on 400 sqm has it all: secure permanent title, 60m from the beach, quality fittings, privacy and comfort, space to move and relax, ocean views, mains power with back-up

ahku m u R a l l Vi

Lembongan Island

To find out more call Greg 0419 044 503 or visit

generator, secure water supply, four king size air-conditioned bedrooms with en-suites, separate staff quarters, a beautiful infinity pool and, best of all, a very affordable price.

www.villarumahku.com

Offers over $450,000 will secure this amazing property. Imagine the cost down south?

Auction (unless sold prior) Saturday 20 March 2010 12.00pm - on site 5

3

4

1

APPLECROSS 67 Melville Beach Road

Riverside Mansion

Impressive in its proportion and position, all aspects of riverfront living have been addressed! Words will do very little to prepare you for the breathtaking experience you will enjoy by owning this home! Tastefully renovated and extended in recent times to make use of the elevated 945sqm green title lot. With a combination of top range modern appliances, marble, granite and solid timber, full security system and ducted reverse cycle air conditioning throughout the home, you’ll feel safe, secure and comfortable. Enjoy all this and more.... and 365 glorious sunsets every year! This is a lifestyle property!

OPEN FOR INSPECTION: Wednesdays 5.30 - 6.30pm Saturdays 12.00 - 1.00pm Adam Piller: 0402 456 485 Alan Bourke: 0411 812 434 Office: 9474 2000 www.alanbourke.com.au


77 Archdeacon Street, Nedlands Exquisite Family Home Expertly designed with a focus on contemporary family living, this BRAND NEW luxury home features clean architectural lines, generous living areas, brilliant alfresco that looks over a stunning L-shape pool and grass area.

FOR SALE $3,750,000 INSPECTIONS

• 4 bedrooms, 5 bathrooms • Study • Stunning gourmet kitchen • 3 separate living zones

Wednesday 10th March 6.00-7.00pm & Saturday 13th March 10.00-10.45am

• River and district views “One of Nedlands’ finest new homes”

Mark Anderson “The Nedlands Expert”

m: 0411 645 174 www.mackhall.com.au T: (61 8) 9286 5555

F: (61 8) 9286 5566

mark@mackhall.com.au


2/10 The Avenue, Crawley Unique Water Front Lifestyle DECEASED ESTATE SALE

3

2

1

3

First Time Offered in over 20 years!

AUCTION

27th March 2010 12 noon Onsite

A rare opportunity to experience the ďŹ nest in exclusive water front living just a breath away from the shore line of the sparkling Swan River.

INSPECTIONS

Saturdays & Wednesdays or by appointment

This SINGLE LEVEL villa home offers over 200sqm of internal living and expansive entertaining terrace featuring direct access to parkland.

Mack Hall

Mark Anderson

mack@mackhall.com.au

mark@mackhall.com.au

m: 0417 744 600

m: 0411 645 174


29 Colin Street, Dalkeith SIMPLY GORGEOUS! Perfect for those wanting a low maintenance high quality luxury lifestyle, this elegant single storey home is set in private landscaped gardens. Superbly appointed throughout and designed for how we want to live. With sweeping entry, separate theatre/lounge, stunning master with feature ďŹ replace plus three other generous beds, 2.5 resort style baths plus vast open plan living which overlooks the pool and deck and opens onto a superb alfresco area. Itâ&#x20AC;&#x2122;s all here and more!

4

2.5

FOR SALE $3,195,000

INSPECTIONS

Saturdays or by appointment

Linda Sullivan M: 0439 926 688 lindas@mackhall.com.au

T: (08) 9286 5555 www.mackhall.com.au

2


2b Mosman Terrace, Mosman Park Unparalleled with River and City Views NEW - Exceptional specification, encompassing every conceivable luxury appointment. Architectural detailing has created both ‘Kitchen of the Year’ and ‘Bathroom of the Year’. Be amazed - every room displays ‘WOW’ factor, from moody master suite with retreat, separate teenage wing and activity, guest suite, cinema, lounge/ dining to alfresco pool terrace, beautiful landscaping.

For Sale $6,880,000 Inspections By appointment

“A unique home” • 4 Bedrooms • Study • 3½ Bathrooms • Kitchen/meals/family • Theatre • Activity • Retreat • Alfresco • Cellar, lift and pool • 4 car garage

Peter Burns M: 0418 925 012 www.mackhall.com.au T: 9286 5555

F: 9286 5566

peter@mackhall.com.au


COASTAL

COUNTRY

Country charm meets modern chic This spacious Dunsborough home makes the most of its lush surroundings, reports SAMANTHA JONES A CHARMING facade adorned by beautifully landscaped lawns and cottage gardens belies the sophisticated, modern interior of this Dunsborough home. With a northerly aspect that looks out over a creek and surrounding bushland, the property has a distinctly rural feel despite being within walking distance of the town and beach. Its external aesthetic is a rammed earth, cedar and limestone foundation that combines with a Colorbond roof to accentuate the opulent native surrounds. A spacious 420sqm interior ensures this residence is ideal for family living. It has five large bedrooms, two bathrooms and plenty of living space. Upstairs, the expansive master suite incorporates a generous walk-in robe,

ensuite and a balcony with bushland views. The remaining minor bedrooms are well proportioned and the fifth bedroom would suit multiple purposes. It is currently being used as a home office. The hub of the home, a large kitchen and dining area, is adjacent to the large informal lounge room. This central space has an abundance of windows and doors that allow the sumptuous landscaped gardens to feature as garnishing to its light and bright decor. Accessed through bi-fold doors, the veranda has a large decked alfresco space, complete with water feature, shade sail and lawn area. Additional features include a separate family room, underfloor heating and a large 70sqm garage that provides plenty of extra storage room. ■

5

2

2

$1,075,000

DUNSBOROUGH 75A NORFOLK STREET AGENT CONTACT VIEW WEB DETAILS

JMW Real Estate Joe White 9756 8800 Contact the agent www.jmwrealestate.com.au http://tinyurl.com/yjl5yzk

INVEST IN THE SOUTH WEST Residential will feature a special Invest in the South West feature on March 30th 2010, prior to the Easter long weekend. lnvest in the South West will feature leading agents and many of the outstanding opportunities that can come from investing in a property down south. Property anlaysts have their say on when is the best time to buy after property values fell by as much as 40 per cent in some areas during the global financial crisis. They also have some bold predictions on the future outlook for the region. For more information or to make a booking, please contact

Jenny Weir 0413 444 085 jenny.weir@communitynews.com.au

9444 3943

www.sovereignbuilding.com.au Winchester Display Home Open Open Mon & Wed 2-5pm Open Sat & Sun 1-5pm Bletchley Park Estate Harlequin Pass Southern River

March 30 is the edition of Residential leading into the Easter long weekend. Traditionally, most of Perth including our Western Suburbs readers takes advantage of the long weekend to re-visit the beautiful Southwest region. There will be extra copies of Residential on hand in and around Bunbury, Busselton, Dunsborough and Margaret River during these holidays. Booking and copy deadline for lnvest in the South West feature is close of business, March 24. *60,000 people read the Western Suburbs Weekly each week. Morgan Readership Survey 24 months to September 3oth 2009

residential WESTERN SUBURBS WEEKLY

ISSUE 1 • DECEMBER • 2007

western

suburbs weekly


PROPERTIES FOR SALE 4

3

2

$1,450,000 AGENT Stocker Preston Dunsborough CONTACT Louis De Chiera 9756 8888 WEB www.stockerpreston .com.au VIEW Contact the agent DETAILS http://tinyurl.com /yz2q3nc

DUNSBOROUGH

2/112A GEOGRAPHE BAY ROAD

HAVE A PROPERTY TO RENT? Melita Means Business Our Property Manager specialises in leasing properties to corporate tenants. Why not benefit from Melita’s corporate contacts with the management of your property?

OUR COSTS Being a new agency, we’re keen for your business so we have a highly competitive all inclusive fee structure.

Melita Ryan Property Manager

SAVINGS TO YOU The following services are not charged: • No fees for Property Condition Reports • No fees for Final Bond Inspections • No fees for Property Inspections • No fees for Financial Year Reports • No Letting Fees • No Advertising Costs

P: 9499 6000 M: 0419 347 276 E: melita@defreitasryan.com.au W: www.defreitasryan.com.au

For a FREE APPRAISAL of your rental property, contact our Property Manager Melita Ryan today.

Why not call Melita now?

LIVE IN LUXURY OR HOLIDAY IN STYLE MODERNITY fuses with a classic country aesthetic in this striking Dunsborough home built by Lodge and Co. Sprawled over two levels, this spacious residence has quality fixtures throughout, as well as high ceilings, jarrah flooring and an elegant decor. The central living area with a sleek, modern kitchen is on the upper level and has double slider doors leading to the undercover deck area. Functional and stylish, the kitchen has granite bench tops, De Longhi appliances and self-closing drawers and cupboards. The master bedroom is on the second floor and has a large walk-in robe and a luxury ensuite with large spa bath and two separate vanities with granite bench tops. A second master bedroom is on the first floor and has an ensuite, while the two minor bedrooms are double sized. There is

also a second living area, third bathroom and formal entry with solid jarrah door to the first floor. Extras include airconditioning, a double garage with separate storage area and landscaped native gardens. Set on 515sqm, the property is suitable as a high quality permanent residence or beachfront holiday home. It is near Geographe Bay and close to schools, shops and transport. ■

Do you know what your property is really worth? Do you also own a property in Margaret River, Dunsborough, Busselton, Mandurah or the Southwest? ...or are you looking at buying?

For peace of mind call... CBRE Rural & Residential Valuations who can provide independent property advice on stamp duty, property disputes, CGT and GST.

CBRE offers one of the best LOCAL Residential Valuation services in WA

PEETB315915

STAGE 10 NOW SELLING!

Perfectly positioned by the magnificent Grand Ocean Entrance park and just a stone’s throw from the beach, Stage 10A includes an exciting collection of low maintenance cottage lots, allowing residents more time to enjoy the relaxed beachside lifestyle on offer at Burns Beach Estate. Homesites in Stage 10A are situated close to beautiful landscaped parklands and are priced from $350,000 (avg $408,875*). Lot sizes range between 352sqm and 576sqm. Don’t delay – call Gail of Peet Estates on 9322 6734 or visit burnsbeachestate.com.au *Prices correct as at 2 March, 2010. Prices subject to change.

PEET.COM.AU

Call Michael Veletta Ph: 9320 0000 e. michael.veletta@cbre.com.au w. www.cbre.com.au/residentialvaluations


Q U I N DA LU P

PROPERTIES FOR SALE

4

2

2

$2,475,000 AGENT Acton CONTACT Debbie Bridges 9755 3399 WEB www.acton.com.au VIEW Contact the agent DETAILS http://tinyurl.com/ yan8o3g

DUNSBOROUGH

6 TURNER STREET

HERITAGE HAVEN IN OLD DUNSBOROUGH

Quindalup Beachfront Vacant Lot Build your dream home just steps from the shores of Quindalup beach on this large 1001m2 beachfront block with a 20.10m frontage. Within easy walking / driving distance to the boat ramps and just 5 minutes from the town centre, this is an opportunity not to be missed! $995,000

Andrew Hopkins 0407 440 438

LANDG315924

Shop 5, Naturaliste Forum, Dunsborough WA 6281 Tel: 9759 1300 • Fax: 9759 1311 Email: info@jhyrealty.com.au • Website: www.jhyrealty.com.au

WITH its unique brickwork and heritage red Colorbond roof, this old Dunsborough home makes an impressive impact. The double-storey classic designer home is on a 735sqm lot with picturesque gardens and panoramic ocean views. The home has good separation with jarrah polished timber floors and a staircase leading upstairs to the kitchen. There is a dining area with a feature leadlight window and a formal lounge with open fireplace. French doors open on to a private balcony in the master suite and the main outdoor entertaining deck has a warm northerly aspect with expansive views of the ocean and Meelup Reserve. Downstairs, through the antique leadlight door, is the terracotta-tiled

Before yyou buyy this... FOR SALE

family room with a traditional old Frenchstyle wood fire. There are also three double-sized bedrooms, a bathroom, laundry and separate toilet. A double garage opens into the family room. Outdoors, a rear deck and gardens complete the home. There is also a Colorbond shed and storage and side access for a boat. Old Dunsborough is a unique area and this home is one of a kind. ■

buyy this.

PROSPECT

FOR SALE

PROPERTY SALES REPORT

Property

Sales Repor

t - Street

Listing for

GR

ACE ST PR Filters Date OSPECT Range: 07/0 Request Nu 6/2004 to Area Ran 07/06/2007 mber: 352 ge: ALL Bed rooms: 3 Price Ran 39836 Bathroom ge: $400,00 s: ALL Last 0 to $525,00 Sale Only Property 0 : No Addres s

6 GRACE ST

0 5,00 $49

8 GRACE ST 14 GRACE 14 GRACE 27 G

PROSPECT

PROSPECT

ST PROSPE CT

ST PROSPE CT

Land Area 931 761 761 761

Parcel Identifier

Lot 51 On Plan 1818 Lot 18 On Plan 2224 Lot 20 On Plan 2224 Lot 20 O

Property Bed/Bath Type HOUSE HOUSE HOUSE

3/1

From3/1 3/1

0 $5.5 Price

$400,000

$405,000

$415 000

Buy online today!

Get the full picture before you buy. View the sales history for a home, street or entire suburb. From Landgate to your inbox within minutes from just $5.50. Visit propertyinfo.wa.gov.au today or call 9273 7341.

CBH Cullen Babington Hughes

lawyers

Buying or Selling? Need a Settlement Agent? Why not use a local law firm which charges at or below Settlement Agent Rates?

With an average practicing experience of over 25 years, our principals combine broad experience in the areas of property and commercial law with high standards of technical legal knowledge and a practical attitude.

Our services include: Residential Settlements Commercial Settlements Registration of Sub Divisions Private Sales Transfer between related parties

95 95 Stirling StirlingHighway Highway Nedlands NedlandsWA WA6009 6009 Telephone: Telephone: 9389 93893999 3999 Facsimile: 1511 Facsimile: 9389 9389 151 1 smurphy@cbhlegal.com.au smurphy@cbhlegal.com.au www.cbhlegal.com.au www.cbhlegal.com.au

Cullen Babington Hughes will undertake your settlement at a very competitive rate. Contact Shannon Murphy on 9389 3999 for an obligation free quote.


Selling South West Real Estate MARGARET RIVER $1,129,000

DUNSBOROUGH

$1,435,000

WEST BUSSELTON

$775,000

DUNSBOROUGH

$880,000

● Designed to maximise the natural surrounds ● Nestled in a tranquil bush setting on 3.3ha (8.15 acres) with elevated and private native vistas ● Close to Town and the coast on the Boodjidup creek system ● High ceilings, Jarrah flooring and restored internal fixtures ● North facing verandah perfect for entertaining and wood fire pizza oven

● Perfect opportunity to capitalize on 1012sqm duplex approved site ● Two level, four bedroom, two bathroom beach house currently rented at $325 per week ● Would make the perfect holiday home or short term rental ● Utilize the approval and develop with the plans already in place ● Side by side development maximises the outstanding views of the Bay

● A fantastic opportunity to purchase a duplex potential property so close to Geographe Bay ● Beautifully renovated home sits on a massive 951sqm block ● Fully reticulated landscaped gardens and superb pool ● Timber floors,raised ceilings,Granite benchtops, air-con, spacious living areas and quality fixtures and fittings

● Quality built two storey home located in a quiet cul-de-sac a short stroll from town ● The home is well positioned on a massive 2003sqm block ● Alfresco and BBQ area with heated pool and spa ● Quality fixtures and fittings, 2 living areas, A/C, extra high ceilings, balcony and timber flooring

David Cross 0439 496 926 david@jmwrealestate.com.au

Darryl Sorgiovanni 0427 767 147 darryl@jmwrealestate.com.au

Lance Hart 0417 979 516 lance@jmwrealestate.com.au

Lance Hart 0417 979 516 lance@jmwrealestate.com.au

QUINDALUP

$689,500

DUNSBOROUGH

$635,000

DUNSBOROUGH

$765,000

AUSTRALIND

$999,000

● Beautiful 4 bedroom, 2 bathroom family home positioned on a quiet alcove ● Spacious master bedroom and ensuite, theatre room and activities room ● Massive backyard on 652sqm block with shed, rear access and fully reticulated lawns and gardens ● Approx 350m stroll to the beach and just a short ride or drive to town

● ● ● ●

4 bedroom 2 bathroom home with open plan kitchen/dining/living area Separate lounge and theatre room with slow combustion wood heater Spacious outdoor alfresco area Lock up shed measuring 5.5m x 6.0m and double garage on a 773sqm block ● Close to Town, transport and schools

● Modern 3 bedroom, 2 bathroom home located looking over the 10th green ● Large open plan, tiled family area and low maintenance gardens ● First class address surrounded by other quality homes and only a short stroll to the Clubhouse

● Rare 1668sqm land holding which enjoys a premium waterfront address and a spectacular panoramic view ● Potential for redevelopment to 5 units, subdivided into 3 separate green titles or duplex ● Located close to numerous first class facilities and has the benefit of rental income

Darryl Sorgiovanni 0427 767 147 darryl@jmwrealestate.com.au

Michael Mort 0403 342 681 michael@jmwrealestate.com.au

Tony Branch 0408 921 812 tony@jmwrealestate.com.au

Michael Mort 0403 342 681 michael@jmwrealestate.com.au

EAGLE BAY

$1,800,000

DUNSBOROUGH

$305,000

GRACETOWN

$990,000

DUNSBOROUGH

$649,000

● Huge 43.3m frontage, this fantastic 2001sqm block offers plenty of options to the astute investor ● Located in Old Eagle Bay on prestigious Eagle Crescent only a short stroll to the Bay ● Is well treed which could provide privacy from the road and potential views from a 2nd storey home

● ● ● ●

A block which offers excellent fairway and ridge views Located in the highly sought after 10th Tee Estate Only a stones throw from the Clubhouse, parks and lakes A generous 646sqm lot which is surrounded by quality homes ● Act now, this block will not last long

● Renovated single storey beach shack with potential to maximise panoramic views of Cowaramup Bay ● Existing residence is currently rented - provides holiday enjoyment while you consider the future ● 3x1 private home with carport on a 587sqm block with battle axe access

● Fantastic opportunity to purchase a quality built 3 bedroom, 2 bathroom home located in the family friendly Estate of Cape Rise ● Spacious open plan kitchen/dining/living with a huge theatre room adjoining ● Enclosed north facing alfresco area overlooking landscaped gardens

Michael Mort 0403 342 681 michael@jmwrealestate.com.au

Lance Hart 0417 979 516 lance@jmwrealestate.com.au

David Cross 0439 496 926 david@jmwrealestate.com.au

Michael Mort 0403 342 681 michael@jmwrealestate.com.au

DUNSBOROUGH

● ● ● ● ● ●

$1,495,000

Quiet cul-de-sac running off the very western end of Geographe Bay Road Glistening waters of Geographe Bay approximately 150m away Being 984sqm and sewered, the block qualifies for duplex consideration Master bedroom upstairs opens onto timber deck with superb Bay views Huge two storey family home renovated around 1995 3 minute stroll to town centre

Joe White 0417 939 715 joe@jmwrealestate.com.au

Alan Jones 0418 947 000

Michael Mort 0403 342 681

YALLINGUP

$1,995,000

DUNSBOROUGH

$525,000

QUEDJINUP

$1,250,000

● Unique & architecturally designed quality 6 bedroom family home ● Aztec stone benchtops, European stainless cooking appliances, Marri floors, expansive living and entertaining areas, wood heating and a/c ● Enormous North facing outdoor entertaining deck ● Ensuite houses a luxury spa bath with resort quality features ● Double garage and workshop, 150,000 litre rain water tank and a bore

● 3 bed, 2 bath resort style living situated in a security gated complex ● Auto reverse cycle air -conditioning ● Small easy-care reticulated garden and storage shed ● Swimming pool and tennis court located in complex ● Situated on the edge of Golf Course

● ● ● ● ●

Darryl Sorgiovanni 0427 767 147 darryl@jmwrealestate.com.au

Tony Branch 0408 921 812 tony@jmwrealestate.com.au

Lance Hart 0417 979 516 lance@jmwrealestate.com.au

Joe White 0417 939 715

Darryl Sorgiovanni 0427 767 147

David Cross 0439 496 926

Tony Branch 0408 921 812

Paul Rumenos 0427 820 713

238 Naturaliste Tce, Dunsborough WA 6281

Rare opportunity to purchase a massive 3.40ha (8.4acre) property A quality constructed 4 bedroom, 2 bathroom rammed earth home Open plan living and beautiful solid timber kitchen Feature stone fireplace, extensive veranda’s and timber lined ceilings The property also offers a large powered workshop

Julian Nott 0439 917 321

Lance Hart 0417 979 516

Phone: (08) 9756 8800


Ripe for the picking.

Perth 60 Palmerston Street From $700,000 2 Charm of Yesteryear... Today! A sought-after extended character semi wonderfully situated between the City 1 and Hyde Park offers the charm of yesteryear with modern convenience. Fall in love.... Claude Iaconi 0412 427 877

Floreat 1/449 Cambridge Street $360,000 1 Jarrahdale This unique apartment has been revamped with style! It is your opportunity 1 to live in this sought after suburb at an affordable price with NO common walls. Renovated to a high standard throughout. 1 Lorraine Thorpe 0414 593 360

West Leederville 41 Blencowe Street $2,150,000 Ultimate Family Home Rarely do we see a home of this size and quality hit the market. Massive block, sought after location and brilliant accommodation.

West Leederville 22/10-14 Kimberley Street $739,000 Stylish & Relaxed Stunning ultra modern townhouse in security group with open plan living. Fabulous outdoor patio/entertaining with double remote garage.

Michelle McGill and Meagen Crump

0407 950 588

4 2 2

Michelle McGill and Meagen Crump

0407 950 588

Mt Lawley 88 Chelmsford Road From $1,950,000 Chelmsford House Early Federation brick and iron home on corner site of 945sqm. All the original character has been retained but with a modern influence including and indoor swimming pool. Lovely timber verandah decking and balustrading overlook manicured gardens. A “Grand Old Lady” which awaits its next loving family. A piece of history. Michelle McGill and Meagen Crump

0407 950 588

3 2 2

5 2 3

Residential Magazine  

Residential Magazine in Perth, Western Australia. Property magazine for the prestige suburbs of Perth and the South-West published by the Co...

Read more
Read more
Similar to
Popular now
Just for you