Page 1

So much food, so little flavor WEEKEND | 14 JULY 7, 2017 VOLUME 25, NO. 24

www.MountainViewOnline.com

650.964.6300

MOVIES | 17

Cautious high school district holds on to reserves CONSERVATIVE BUDGET EXCLUDES BEHAVIORAL-HEALTH, OTHER INITIATIVES By Kevin Forestieri

D

ANA SOFIA AMIEVA-WANG

THURSDAY NIGHT GETS LIVELY Espe Ndombe dances to music performed by the Cheeseballs at Thursday Night Live on June 29. Downtown Mountain View’s streets were filled with revelers enjoying the summer concert series and its many additional diversions, like children’s activities, a classic car show and farmers market food stalls. Next up is the classic rock sounds of Daze on the Green, playing on July 13. Just head to Castro Street between 5:30 and 8:30 p.m. You can’t miss it. (More photos on Page 10)

espite talk of launching expensive new programs and spending down reserves earlier this year, the Mountain View-Los Altos High School District opted to take a cautious approach to the budget for the 2017-18 school year. Last week, the high school district’s board of trustees approved a spending plan for the upcoming school year that, by most measures, is a “boring” budget with little in the way of new initiatives, according to Associate Superintendent Mike Mathiesen. Small changes include about $500,000 in new retirement costs, additional teachers to keep up with enrollment and a bigger pool of funds for updating and improving the district’s technology. The district expects to see another healthy increase in annual revenues — $84.9 million for the 2017-18 year — and

adopted a spending plan of $82.9 million. During a board study session in February, board members considered whether a $2 million reserve fund ought to be put to use in the upcoming school year; spending options reviewed included a $500,000 behavioral health program, an initiative to reduce school avoidance, new classroom technology and capital projects like new classrooms and cafeteria furniture. In the end, the district didn’t include any of those initiatives in the budget, Mathiesen said. Some of the ideas were instead addressed within existing, already budgeted programs, but no new big line-item in the budget came from the study session. One goal in this year’s budget is maintaining the district’s large stockpile of Chromebooks, which function as portable laptops for See BUDGET, page 6

Council balks at developer’s proposed ‘public benefits’ $115,000 FOR A PRIVATE DOG PARK? $112,000 FOR REQUIRED SEWER SYSTEM? By Mark Noack

T

he insatiable need for more housing was enough to win approvals for a 211unit apartment project that will go up along Mountain View’s crowded El Camino Real corridor. But while the City Council unanimously endorsed the project, council members also poked holes in its public-benefit package, criticizing the developers for what they see as trying to game the system to minimize costs. At the council’s June 27 meeting, the Palo Alto-based SummerHill Housing Group presented plans to replace a restaurant and

INSIDE

a hotel at 2700 W. El Camino Real with a dense, five-story apartment project. Taken altogether, a project of that size would be required to contribute $1.73 million in community benefits, according to city staff’s calculations. Developers can propose a variety of ways to meet this requirement, although city officials usually encourage them to focus on affordable housing and local neighborhood needs. As part of their pitch, SummerHill developers asked city officials to write off nearly $230,000 in public benefits for the project’s wastewater system as well as a fifth-floor dog park that would be

‘SummerHill homes has been very prosperous in Mountain View, but I think they can pay their fair share here.’ COUNCILWOMAN PAT SHOWALTER

closed to the public. Both requests were roundly rejected by council members. Taking aim at the wastewater system proposal, Councilwoman Pat Showalter pointed out that the system is a standard feature required for any development. She worried that letting it pass as

A +E 12 | GOINGS ON 18 | MARKETPLACE 19 | REAL ESTATE 21

a community benefit would send the wrong signal to other developers looking to pad their bottom line. “SummerHill homes has been very prosperous in Mountain View, but I think they can pay their fair share here,” she said. City planner Diana Pancholi

pointed out that the dog park was originally planned for the project’s ground level, but it had to be relocated upstairs to make way for a bike path connection that the city requested between Del Medio Avenue and Cesano Court in Palo Alto. She noted that the city has full discretion to reject these amenities. If it does, the money would likely be redirected into the city’s affordable housing fund. There were other aspects of the proposed apartment package that raised concerns. The project included just 11 units of affordable housing, which city leaders See COUNCIL, page 7


THE ADDRESS IS THE PENINSU THE EXPERIENCE IS AIN PINEL

LOS ALTOS $3,195,000

LOS ALTOS $2,998,000

LOS ALTOS HILLS $2,880,000

492 Deodara Drive | 5bd/4ba Kathy Bridgman | 650.941.1111

434 Orange Avenue | 4bd/3.5ba Kathy Bridgman | 650.941.1111

26550 Anacapa Drive | 3bd/2.5ba Kristi Foxgrover & Cliff Noll | 650.941.1111 OPEN SAT & SUN 1:00-5:00

PALO ALTO $2,488,000

LOS ALTOS $2,199,000

CAMPBELL $1,548,000

2599 Louis | 4bd/3ba David Chung & Sunny Kim | 650.941.1111

22151 Berkeley | 4bd/2.5ba Lynn North | 650.941.1111

327 Cloverdale | 4bd/2.5ba Ghodsi Emambakhsh | 650.941.1111

MOUNTAIN VIEW $1,298,000

MENLO PARK $1,280,000

SAN JOSE $1,279,000

925 Washington | 3bd/3ba Michael Galli | 650.941.1111

445 Oak Grove Avenue, Unit 14 | 3bd/2ba Janis Ahmadjian-Baer | 650.941.1111 OPEN SAT & SUN 1:30-4:30

2137 Sunny Vista | 3bd/2ba Denise Welsh | 650.941.1111

APR.COM

Over 30 Real Estate Offices Serving The Bay Area Including Los Altos 650.941.1111 Square footage, acreage, and other information herein, has been received from one or more of a variety of different sources. Such information has not been verified by Alain Pinel Realtors®. If important to buyers, buyers should conduct their own investigation.

2

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017


Voices A R O U N D

T O W N

Asked in downtown Mountain View. Photos and interviews by Ana Sofia Amieva-Wang.

Do you use Snapchat or other social media to share your location? “No. I just didn’t want to show where I am to the public. I prefer to keep my privacy more carefully.” Troy Chang, Sunnyvale

“I do, I use Google Maps so I can coordinate with my girlfriend to just figure out who’s going to get home or where she is and stuff like that. I just discovered that Snapchat has the feature where you can see where other people are.”

Are you missing a tooth (or teeth)? Have you considered Dental Implants?

Free

Dental Implant Consultation

A $250 Value!

Are your Wisdom Teeth causing you pain? Do you need your Wisdom Teeth removed? Second opinions welcome. Call for your complementary consultation. Having Trouble With Snoring/Sleeping? We Have The Solution! Call Smiles Dental to Learn More! 650.665.5001

100 W. El Camino Real, Suite 63A Mountain View ( Corner of El Camino & Calderon )

SmilesDental.com | 650.665.5001

Steven Xu, Mountain View

“I tried the Snapchat update where your emoji shows up in your location, but I have myself hidden so I don’t use that. I’ve shared my location with friends before but only briefly or for an hour, so I guess I don’t use it super often.” Anna Goldberg, Los Altos

“I allow my parents to track me, but I put myself on Ghost Mode for Snapchat because I just don’t really want to have random people knowing where I am.” Kaitlin Chiu, Palo Alto

www.demartiniorchard.com 66 N. San Antonio Rd., Los Altos

650-948-0881

Open Daily 8am-7pm Prices Effective 7/5 thru 7/11

NORTHWEST JUMBO

Farm Fresh and Always the Best

ORGANIC LOCAL

LOCALLY GROWN

CHERRIES TOMATOES WHITE CORN JUMBO SIZE SWEET AND CRISP

4

$

HEIRLOOM

4

99 $ 99 LB.

VERY TASTY AND COLORFUL

LB.

MELONS CHARD¢ LEEKS SAMPLE THEM ALL EVERYDAY AND FIND YOUR FAVORITE

CRENSHAW-GALIA ORANGE FLESH-HAMI SHARLYN-TUSCAN CANARY-SANTA CLAUSE CASABA-HONEYDEW GOLD DEW

ORGANIC

ALL KINDS

99

ORGANIC

BUN. ORGANIC

21

IN HUSK YOUNG AND TENDER SWEET

WINE

LOCAL

LB.

AUVIGNON

34

$

1 Your Everyday Farmers Market

“I don’t. I turned off my location, because I don’t like people knowing where my location is. I like privacy and it’s not OK to have everyone know where I’m at.” Ahmad Washington, Los Altos

WEEK

OF THE

PERTURE 149 A S B

$

SQUASH ZUCCHINI AND COLORED

00

$

EARS FOR

$ 99 L . B

LANC

99

Online at www.DeMartiniOrchard.com LET’S DISCUSS: Read the latest local news headlines and talk about the issues at Town Square at MountainViewOnline.com

Have H Have aa question question ti for fforV Voices Voices i A Around AroundTown? Town? E-mail Email itit to to editor@mv-voice.com editor@mv-voice.com July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

3


VERY REAL LOCAL NEWS

Retinal Diagnostic Center is pleased to announce the opening of a new office in Atherton, CA to better serve patients in the bay area Diagnostics and Therapeutics available include: • Optical coherence tomography • Fluorescein angiography

• A & B scan ultrasound • Intravitreal injection • Retinal laser

Support local journalism with a print or online subscription starting at only $5 /month

Conditions treated include: • Macular holes • Flashes and floaters • Age related macular degeneration

• Diabetic retinopathy • Retinal vein occlusion • Epiretinal membranes • Retinal detachment

Visit:

MV-Voice.com/user/ subscribe/

LocalNews QCRIMEBRIEFS

RIDER DIES IN MOTORCYCLE CRASH A man driving an unreported stolen motorcycle died after the motorcycle hit a tree in Mountain View early Saturday morning, July 1, a police spokeswoman said. Officers responded to a report of two people tampering with cars in the 200 block of Dana Street around 1:30 a.m., according to Mountain View police spokeswoman Katie Nelson. One of the officers saw a motorcycle leaving northbound Moorpark Way, turned on his red lights and tried to stop the motorcycle. The motorcyclist accelerated to around 70 mph and drove away, Nelson said. Following the department’s pursuit policy, the officer terminated the attempted traffic stop and turned off his lights and siren, according to Nelson. The officer saw sparks in the road from the area where the motorcyclist was last seen. When he drove to that area, he saw that the motorcycle had crashed into a tree, Nelson said. The rider was lying about 40 feet from the motorcycle. Several other officers arrived and performed CPR on the rider, according to Nelson. The rider was taken to Stanford University Medical Center, where he was later pronounced dead. Following the crash, police learned the motorcycle was stolen from a home on the 100 block of Calderon Avenue, Nelson said. As of the Voice’s press deadline on Wednesday, the coroner had yet to release the victim’s name because next of kin hadn’t been notified. —Bay City News Service See CRIME BRIEFS, page 6

ONLINE

3301 El Camino Real, Suite 101, Atherton, CA

QPOLICELOG

www.retinaldiagnostic.com

AUTO BURGLARY

650-257-3861 #PressOn

All Major Insurances accepted

Healthy Teeth and Gums That Last a Lifetime! • • • •

Experienced and Gentle Dentist, and Friendly Staff New Patients Welcome!

300 block Hope St., 6/29 W. Evelyn Av. & Franklin St., 7/2 600 W. El Camino Real, 7/2 1500 block N. Shoreline Blvd., 7/3 1600 block Alison Av., 7/3 100 block Franklin St., 7/3 1100 block N. Rengstorff Av., 7/3 2600 block Terminal Blvd., 7/4

BATTERY 1900 block Latham St., 6/29 1000 block N. Rengstorff Av., 6/30 200 block Castro St., 7/2

COMMERCIAL BURGLARY 300 block Showers Dr., 7/2 500 block Clyde Av., 7/3 1000 block La Avenida, 7/3

California St. & Castro St., 6/29 300 block Showers Dr., 7/2 100 block Del Medio Av., 7/3 100 block N. Rengstorff Av., 7/3

RESIDENTIAL BURGLARY 3300 block Brower Av., 7/1

STOLEN VEHICLE 100 block Calderon Av., 7/1 200 block E. Dana St., 7/1 600 block Cuesta Dr., 7/1 200 block Escuela Av., 7/4

VANDALISM Church St. & Franklin St., 6/29 500 block Central Av., 6/29 700 block Sylvan Av., 7/1 2500 block W. El Camino Real, 7/3

GRAND THEFT 500 block Ortega Av., 6/28

Free Consultations and Second Opinions Saturday Appointments Available

QCOMMUNITYBRIEFS

TECHNOLOGY SHOWCASE NEXT WEDNESDAY

Voted Best Dentist 2014

THE VOICE

Don’t Wait! Call 650.969.6077 for your appointment today!

Best of MOUNTAIN VIEW

2016

Mountain View’s annual Technology Showcase is set to take place on Wednesday, July 12, from 11:30 a.m. to 3 p.m. at the Civic Center Plaza at 500 Castro St. The event is free and open to the public. Presented by the city of Mountain View and the Mountain View Chamber of Commerce, the showcase will feature new products and technologies made by local startups and technology companies. It is sponsored by Google, Intuit, Linkedin Corporation, and Yamaha Motor Company. See COMMUNITY BRIEFS, page 7

Conveniently located 650.969.6077 in Downtown Mountain View dentalfabulous.com 756 California Street, Suite B Mountain View 94041 cross street: Castro, next to Bierhaus

4

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

The Mountain View Voice (USPS 2560) is published every Friday by Embarcadero Media, 450 Cambridge Ave, Palo Alto CA 94306 (650) 964-6300. Periodicals Postage Paid at Palo Alto CA and additional mailing offices. The Mountain View Voice is mailed free upon request to homes and apartments in Mountain View. Subscription rate of $60 per year. POSTMASTER: Send address changes to Mountain View Voice, 450 Cambridge Ave, Palo Alto, CA 94306.


LocalNews MOUNTAIN VIEW VOICE

Q CITY COUNCIL UPDATES Q COMMUNITY Q FEATURES

Brock Turner judge responds to recall

PERSKY: ‘MY ROLE IS TO CONSIDER BOTH SIDES’

aron Persky, the Santa Clara County judge who is facing a recall after his controversial sentencing of former Stanford University student Brock Turner last summer, spoke out for the first time on Friday in a statement filed with the county Registrar of Voters. Without referencing the Turner case or others he has been criticized for in recent months by the recall campaign, Persky said that he “fought vigorously for victims” as a prosecutor and has followed the law by considering rehabilitation and probation for first-time offenders. “As a judge, my role is to consider both sides,” he said. “California law requires every judge to consider rehabilitation and probation for first-time offenders. “It’s not always popular, but it’s the law, and I took an oath to follow it without regard to public opinion or my opinions as a former prosecutor.” Persky is mounting his own retain campaign against the recall effort, which is working to collect signatures to place the recall on the ballot next summer. His statement Friday was a response to a notice of intent the Recall Persky campaign filed earlier in the week. Persky has been widely criticized for his sentencing of Turner — six months in jail for sexually assaulting an unconscious woman on campus in January 2015 — as well as other sentencing decisions the recall

organizers maintain show a pattern of judicial bias in sex crimes against women. Turner ultimately served half of his sentence for good behavior, his trial, conviction, sentencing and release garnering international attention and sparking the official campaign to recall Persky. The statement from the Retain Judge Persky campaign also includes a statement from retired Santa Clara County Judge LaDoris Cordell calling the recall “misguided.” “Judicial recalls over a single decision threaten our independent judiciary and set a dangerous precedent,” she said. “Recalls should be for judges who have a pattern of bias or misconduct. Judge Persky has neither.” Stanford Law Professor Michele Dauber, the chair of the recall campaign, said that Cordell’s statement is “inconsistent” with previous public comments she’s made criticizing Persky’s handling of other sexoffense cases. “The single biggest threat to judicial independence is a biased judge like Judge Persky, because bias diminishes public confidence in the justice system,” Dauber said. “There is a difference between judicial independence, on the one hand, and a total lack of accountability, on the other. The recall is a democratic process that is provided for by our constitution and is designed to hold elected officials accountable to the people they serve.” Email Elena Kadvany at ekadvany@paweekly.com

which is one of our four top priorities,” said Mayor Ken Rosenberg. “Mountain View will continue to work with local and state officials to support California’s global leadership in addressing climate change.” For Mountain View, these actions are largely in line with the city’s efforts that were already in place, said Steve Attinger, city environmental sustainability coordinator. The city’s climate action plan approved two years ago aims to cut local carbon

emissions by 80 percent by 2050. To that end, city-run facilities are switching over entirely to renewable energy sources, and officials have developed an ambitious longterm plan for further actions. A similar effort is underway by state governors who opposed Trump’s pullout from the Paris Agreement. Califonia Gov. Jerry Brown has partnered with his counterparts in 11 other states to uphold terms of the agreement. Email Mark Noack at mnoack@mv-voice.com

By Elena Kadvany

A

MICHELLE LE

Gerald Garrett, left, and Life Moves CEO Bruce Ives do an RV count along Crisanto Avenue near South Rengstorff Avenue on Jan. 25. Currently homeless, Garrett used to live in a motor home in Mountain View and is a volunteer helping with the homeless census count.

New census shows Mountain View homeless population growing COST OF HOUSING CITED AS MAJOR CAUSE By Mark Noack

C

all it Exhibit A of Silicon Valley’s worsening housing crisis: A new Santa Clara County homeless census has found a spike in the number of people living on the street in Mountain View and several nearby cities. The 2017 Point-In-Time Census found that the number of homeless in Mountain View jumped by 51 percent. This translates to about 130 additional people since the count

was last done in 2015. The uptick in people without stable housing is evident in many other South Bay communities. For Palo Alto, which just last week began cracking down on people living out of their cars, the number of homeless increased by 26 percent. In Cupertino, it went up by 74 percent. In Morgan Hill, it skyrocketed 379 percent. Approximately one-third of those people are living out of vehicles. The source of this problem is

obvious, said Dr. Brian Greenberg, vice president of LifeMoves, the homeless-services nonprofit that organized the new census. More people are now living on the street as a direct result of the lack of affordable housing, he said. “Rents have doubled in Mountain View in the last decade; you don’t build affordable housing, there’s no shelter in the whole city, and the service jobs only pay $12 or $13 an hour. See HOMELESS, page 8

City joins climate-change coalition MOVE PROMPTED BY PARIS AGREEMENT WITHDRAWAL By Mark Noack

I

t took nearly 20 years of negotiations, but in December 2015 countries worldwide had finally brokered an agreement on tackling climate change. It was far from perfect, but the pact known as the Paris Agreement was hailed as a huge milestone for

addressing the thorniest global issue of modern times. But last month, President Donald Trump announced he was pulling the U.S. out of the agreement, despite the country’s position as the leading a cumulative carbon emitter. In response, Mountain View is now joining a coalition of cities

across the U.S. that are pledging to uphold the Paris Agreement. The so-called Climate Mayors group, now joined by more than 330 municipalities, is a move of symbolic resistance, but it also commits U.S. cities to carbonreduction targets. “We remain committed to environmental sustainability,

V

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

V

5


LocalNews

Man connected with 2008 MV slayings arrested in Sacramento NICORY SPANN CHARGED WITH ATTEMPTED MURDER AFTER DEPUTY SHOT By Mark Noack

A

man previously linked to a 2008 double-homicide in Mountain View was arrested in Sacramento County this week for allegedly attacking a sheriff’s deputy and shooting him in the face with the deputy’s own gun. The deputy suffered major injuries from the shooting, but was reportedly in stable condition. The suspect, Nicory Marquis Spann, 27, is being charged

BUDGET

Continued from page 1

students at Mountain View and Los Altos high schools. Both campuses have a “bring your own device” policy (BYOD) requiring all students to have access to a personal computer for class work, and the district has to maintain thousands of Chromebooks for students to check out for the year. Chromebook replacement is projected to cost about $250,000

with attempted murder. The shooting occurred around 6 p.m. on June 27, when Sacramento County sheriff’s deputy Nicory Spann Alex Ladwig radioed that a man was attacking him at a local transit station. Shortly after the initial call for help, Ladwig radioed again to report he had been shot.

Sheriff’s officials report that Spann’s alleged assault on the deputy was unprovoked. It remains unclear how the suspect managed to get control of the deputy’s gun. He reportedly fired two shots, one of which hit Ladwig in the face. Spann was tracked to a nearby motel, where he was arrested in a SWAT team operation. At the time, Spann reportedly resided in Sacramento, but for years he lived in San Jose and was connected with a notorious Mountain View killing.

Spann pleaded no contest to charges stemming from a June 2008 Mountain View home invasion robbery that resulted in the slaying of two siblings, Omar Aquino and Maria Teresa Sanchez-Aquino. According to reports, the case involved Spann and seven other suspects who plotted to rob Aquino, whom they knew socially. One suspect, Fame Thomas, then 15, took Aquino out to the movies while others prepared to rob him when he returned to

his Plymouth Avenue home. The group ransacked the house. Calls to the Santa Clara County District Attorney’s Office were not immediately returned. Spann, who was 19 at the time of the killings, was initially listed in criminal filings as the triggerman in the murders, but police officials later back-pedaled on that theory. He pleaded no contest to charges including being an accessory after the fact and possession of stolen property. He served 16 months in prison.

each year, but the MVLA foundation has helped pay the costs, Mathiesen said. The district has budgeted $140,000 for Chromebook refreshment” for the 201718 school year. The widespread use of technology in the classroom means that the district also needs to spend more money on a robust WiFi network and better server infrastructure for its schools. Although the district has seen major boosts in revenue for several years straight, signs are showing that it won’t last much

longer. Annual increases in revenue are expected to shrink in the next few years, Mathiesen said, and the state’s economy has been on the upswing for an unusually long time. During Gov. Jerry Brown’s revision of the state budget in May, Brown said the state was in the midst of one of the longest expansionary periods in California’s economic history, and the state needs to start planning for a possible downturn. This is reflected in the boardapproved budget for 2017-18,

which assumes that the state budget will stop giving out one-time discretionary funding to school districts. The state budget, which was signed by the governor last week, did end up including discretionary funding amounting to nearly $900 million. Mathiesen said the district is also expecting the double-digit increases in annual property tax revenue to level off as soon as the upcoming school year. Projections estimate property tax growth will drop from 10

percent to 8 percent for 2017-18, followed by 6 percent growth in 2018-19. The district’s budget is still expected to stow away millions of dollars into the reserve fund over the next three years. Mathiesen said that reflects the district and the board’s goal to maintain a higher level of reserves for economic uncertainty, and that the goal will be met by the end of the 2019-20 school year. Email Kevin Forestieri at kforestieri@mv-voice.com

V

V

CRIME BRIEFS

Continued from page 4

ACUPUNCTURIST CHARGED WITH INSURANCE FRAUD

ANA SOFIA AMIEVA-WANG

A GLITTERING FOURTH Clear skies prevailed for this year’s annual Fourth of July fireworks show over Shoreline Amphitheatre, which drew crowds inside and out. For those lucky folks inside, the San Francisco Symphony played songs by Copeland and Sousa, and from “Star Wars” film scores.

6

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

A Los Altos acupuncturist has been charged with fraudulently billing insurance companies for treatments that he never gave, Santa Clara County prosecutors said Monday. According to the district attorney’s office, in December 2014 the California Department of Insurance received a tip that 53-year-old Aifeng Su had billed insurance companies for treatment visits that never happened. Two of Su’s patients, a husband and wife, later discovered that he had billed their insurance company for treatments they hadn’t received. According to prosecutors, Su received about $12,000 in payments for more than 60 phantom treatments. Su has been charged with two counts of making false or fraudulent claims for insurance. The charges carry a maximum prison sentence of six years, prosecutors said. Su is scheduled to be arraigned July 5 in the Hall of Justice in San Jose. —Bay City News Service


LocalNews COMMUNITY BRIEFS Continued from page 4

The National Aeronautics and Space Administration, Google Virtual Reality, and the Mountain View High School robotics team Spartan Robotics will participate in the event, along with several other technology companies. Showcase participants can view product demonstrations and businesses can connect to form partnerships. There will also be food trucks at the event to meet participants’ nontech gustatory needs for the afternoon. Visit chambermv.org/technology-showcase for more information. —Nathalie Camens

VA GETS NEW DIRECTOR Thomas “Tony” Fitzgerald III was selected as the new director of the Veteran Affairs Palo Alto Health Care System, an appointment that went into effect June 25. He will be replacing Lisa Freeman in overseeing the delivery of health care to more than 93,000 veterans at the Department of Veterans Affairs’ Palo Alto facility. “We are excited to bring Mr. Fitzgerald on board as the new director of the VA Palo Alto Health Care System,” said Sheila Cullen, the director of Veterans Integrated Service Network 21, in a press release. “His sound leadership qualities and proven experience will be valuable assets for the facility, the employees and volunteers, and

most importantly, for the veterans we are honored to serve.” Fitzgerald began his career with the department in 1988 as a psychiatric nursing assistant at the North Chicago VA and then moved on to a position as housekeeping aide at the facility. He started working in the VA Northern California in 2000. Before joining the department, Fitzgerald served in the U.S. Army for 16 years as a medical non-commissioned officer. Fitzgerald holds a bachelor’s degree in business administration with a concentration in health care management from the American InterContinental University in Hoffman Estates, Illinois. He is a graduate of the Leadership VA program, the Health Care Leadership Development Institute and the VA Management

Development Program. He is a member of the American Hospital Association and American College of Healthcare Executives. The VA Palo Alto Health Care System is one of the most complex facilities in the VA system, serving 11 congressional districts and 10 counties located in Northern California. It consists of three inpatient facilities located in Palo Alto, Menlo Park and Livermore; plus seven outpatient clinics in San Jose, Fremont, Capitola, Monterey, Stockton, Modesto and Sonora. In 2016, the VA Palo Alto system had 817,448 outpatient visits and 7,416 inpatient stays. In addition to health care services for veterans, the system serves as a teaching hospital for doctors, nurses and allied health care professionals providing a

full range of patient care services with state-of-the art technology. VA Palo Alto maintains one of the top two research programs in the department, with extensive research centers in geriatrics, mental health, Alzheimer’s disease, spinal cord regeneration, schizophrenia and HIV research. It also runs a Rehabilitation Research and Development Center and Health Economics Resource Center. The VA Palo Alto system is affiliated with Stanford University Hospital. —Elinor Aspegren

Like us on www.facebook.com/ MountainViewVoice

COUNCIL

Continued from page 1

pointed out was disappointingly low. But city planners explained that they have little leverage to request more. City rules require housing developers to set aside 10 percent of their new apartments as subsidized, below-market-rate housing. But SummerHill developers circumvented these rules by tailoring their project for a density bonus under state law. In the past, Mountain View officials have blasted the state density program, which has been in place since 1979, for giving developers a loophole for “double dipping” in incentive programs. When compared with local city rules, the state system ends up rewarding developers with a sizable density bonus for building fewer affordable housing units. “We’re only getting 11 (affordable) units and we should be getting 22,” fumed Councilman John McAlister as he reviewed the SummerHill plans. “If there’s a way to figure out how we can get more, we need to do that.” But city planners said there’s little they could do, and it’s not the first time they’ve encountered this problem. Just a block away from the SummerHill site, a 605-unit project by Prometheus Real Estate Group also made use of this state density bonus, which frustrated city leaders at the time. The council approved the SummerHill apartment project in a 6-0 vote with Mayor Ken Rosenberg absent. V

Sign up today at MountainViewOnline.com July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

7


LocalNews HOMELESS

Weekend fire whipped by wind burns an acre near Shoreline Park Firefighters raced to Mountain View’s baylands on Sunday afternoon to put out a grass fire that was quickly spreading due to the windy weather. The fire reportedly burned about an acre of vegetation near a Terminal Boulevard parking lot by the entrance to Shoreline Park. Mountain View resident Jyoti Bachani said she first spotted the blaze around 4 p.m. when

she and a friend returned to their cars after a hike. Smoke was billowing from the grassy field and they saw flames spreading through the area, she told the Voice. They called the fire department to report the blaze. “In my 25 years of hiking here, I’ve never seen anything like this,� Bachani said. “I’ve never been that close to a fire like this — it was difficult to breathe from all the smoke.�

The fire ended up burning a couple trees and about 100 yards of the field, said Battalion Chief Ted Vandenberg of the Mountain View Fire Department. The only property damage reported was a city-owned wooden fence that was burned. Fire officials say they are still investigating the cause of the blaze. A short video of the blaze is online at mv-voice.com. —Mark Noack

Two-alarm fire destroys MV townhouse An electric coffee-roaster may have sparked a two-alarm fire in Mountain View on Wednesday morning that gutted a Jackson Park townhouse. Mountain View fire officials say they received word just after 8:30 a.m. that a fire had started in a house garage in the 400 block of Mountain Laurel Court.

Firefighters reportedly arrived within minutes, but the fire had already spread to the home’s second floor and attic. The burning townhouse was part of a four-plex of homes that share adjoining walls; the other residences remain safe, fire officials said. But the house where the fire

LET’S DISCUSS: Read the latest local news headlines and talk about the issues at Town Square at MountainViewOnline.com

started was destroyed. Within about 20 minutes, the fire raging in the attic had damaged the structure to the point that its roof collapsed. An unspecified number of nearby residents were evacuated from the area. Fire officials reported that a resident of the destroyed home said that a coffee roaster in the garage started the blaze. The fire is under investigation. —Mark Noack

give an inexact picture of the local homeless problem, but Continued from page 5 Greenberg emphasized that “This is the natural out- the most important takeaway growth of all that,� Greenberg from the report is that the homeless problem seems to said. The picture for Santa Clara be worsening. That trend is County as a whole is not as likely to continue until South dire. Overall, the county saw Bay cities partner to create a a 13 percent increase in home- new service network across the lessness, or about 850 more area, he said. “Everyone in Silicon Valley people. The report shows a drop needs to step up to the plate,� in the county’s number of he said. “It has to be a regional homeless veterans and people solution with every community with disabling conditions who stepping up.� Some relief is coming. Last have been chronically homeless for one year or more, November, voters countywide overwhelmbut an increase ingly approved in families and a $950 million independent ‘Everyone in bond measure youth ages 24 and under. Silicon Valley to address lowincome housThe homeless census was con- needs to step up ing. Some of that money will be ducted in Januto the plate.’ doled out in the ary with an early coming months. morning street BRIAN GREENBERG, In March, count that cov- VICE PRESIDENT OF LIFEMOVES Mountain View ered more than leaders dedicated 1, 30 0 squa re miles of the county. Vol- $1 million to fighting homelessunteers and paid homeless ness, including funding new guides navigated the streets staffing and providing new and tallied individuals and services for people living out of families who appeared to be their cars. homeless. Email Mark Noack at This method will inevitably mnoack@mv-voice.com V

2017 REMODELING WORKSHOP SERIES Whole House + Additions –

Going up or out or both!

Two workshop locations to choose from! SATURDAY, JULY 15, 2017 Workshop: 9:00-11:00am Registration and breakfast from 8:30-9:00am

Harrell Design Center: 944 Industrial Avenue, Palo Alto Harrell of Los Gatos: 233 North Santa Cruz Avenue, Los Gatos What our designers see as the top 5 things to consider when planning a remodel – whether your home is small or large. How to choose a contractor: What to look for and how to hire one.

Functional design ideas to make the best use of your living space. ([SORUDWLRQRIPDWHULDOVIURPĂ RRULQJWR countertops, cabinetry and more!

Our seminar is designed for homeowners who are considering a major remodeling project, such as an addition or whole-house renovation. Meet our team in person, while you learn about the design build remodeling process and see an inspiring array of design ideas for your home.

PRE-REGISTRATION IS REQUIRED AS THESE CLASSES FILL UP QUICKLY!

Call us or go online to register today!

650.230.2900 | info@harrell-remodeling.com | harrell-remodeling.com License 8479799

8

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017


NOTICE OF DISTRICT DIRECTOR SEAT VACANCY The El Camino Healthcare District* Board of Directors seeks applicants to fill a vacancy on its Board of Directors for a term through November 2018. Applicants must be registered voters residing within the El Camino Healthcare District. The District Board will hold an additional Regular Meeting to interview applicants on Wednesday, August 16, 2017 at 5:30 p.m. El Camino Hospital, 2500 Grant Road Ground Floor Conference Rooms E, F and G Applications must be received by the District on or before August 1, 2017. To obtain applications: Pick up: Administration, C131, El Camino Hospital, 2500 Grant Road, Mountain View Download: elcaminohealthcaredistrict.org E-mail: nominations@elcaminohospital.org Questions:

650-940-7300

*The purpose of the District shall be to establish, maintain and operate, or provide assistance in the operation of one or more health facilities (as that term is defined in the California Health and Safety Code Section 1250) or health services at any location within or without the territorial limits of the District, for the benefit of the District and the people served by the District, and to do any and all other acts and things necessary to carry out the provisions of the District’s Bylaws and the Local Health Care District Law.

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

9


LocalNews

Getting lively on Thursday nights Photos by Ana Sofia Amieva-Wang

Summertime is for outdoor revelry, and the city of Mountain View-sponsored Thursday Night Live events offer locals the chance to celebrate the season with live music, a custom/classic car show, sidewalk strolling, a farmers’ market and other activities. Castro Street between Mercy and Villa streets in downtown Mountain View close to traffic during the events, from 5:30 to 8:30 p.m. on two nights in July. Last Thursday, the “high-energy” dance band the Cheeseballs performed. On July 13, Daze on the Green is scheduled to perform classic rock, and the rock-and-soul Houserockers will rock the downtown on July 27. For more information, call 903-6331 or email recreation@mountainview.gov.

10

Clockwise from top left: Community members join hands and dance during Mountain View’s Thursday Night Live event on June 29; the Cheeseballs, a high-energy dance band, performs at the event; a farmers’ market stall offers samples including dried and candied fruits; a ballerina from Western Ballet catches the attention of passersby as she hands out flyers; passersby snap photos as the car show comes to a close; a balloon sword battle is underway on Castro Street; master face-painter Susan Worley creates butterfly magic on a young girl’s face.

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017


LocalNews

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

11


Arts&Events MOUNTAIN VIEW VOICE

A midsummer night’s mash-up by Kaila Prins

P

alace intrigue. Mistaken identities. Kidnapping, quarreling lovers and civil unrest in the dukedom. Sound like Shakespeare? Well, it is and it isn’t — at least, not quite as written by the Bard himself. “What You Will” (“the Shakespeare play that Shakespeare never wrote”) makes its worldpremiere run at the Pear Theatre through July 16. Playwright Max Gutmann borrowed every word and phrase from Shakespeare’s works and rearranged them to create a play that seems as if it very well could have trod the boards at the Rose or the Globe. Gutmann set himself the Herculean task of creating a brand new play by rearranging only words, words, words from Shakespeare’s texts. Constructed like a giant puzzle without a box, “What You Will” is a thoroughly unique piece of theater with a few of Shakespeare’s iconic phrases peppered in as laugh lines. The prologue warns you not to get too wrapped up in listening for the Bard in this stage work. I found it difficult to heed that warning at first, trying to spot the “Lear” or the “Hamlet” in each line, but a few scenes in, I found myself becoming utterly immersed

Theater Review and unbothered that Shakespeare had a hand in this at all. The plot is simple: A nobleman, Antonio (played by Mark Vashro) returns from a successful diplomatic mission in France with a beautiful French wife (LeighAnn Cannon) who can speak only a few words of English. He is received well by the Duke (Kevin Hammond), a man who prizes honesty above all else, until the scheming Malvolio (Lauren Hayes) and hapless Roderigo (Dan Wilson) turn the Duke against Antonio and turn poor Antonio’s world upside down. Or, perhaps the plot is this: A physician (Alyssa Lupo-Zulueta) comes to court to attend to the Duke, but, when he asks to be returned to the poor peasants in the north, the Duke, through Malvolio, refuses. The peasants, who have no doctor to cure their sick and injured, plan to kidnap the Duke, but their plot is foiled by a case of mistaken identity. Or, the plot is a tale of love gone awry. The Duchess (Amelia Adams) and the Duke do not love each other, but they’re both very jealous. The Duke, a “lecherous monkey,” can’t seem to keep his hands off the young women of the court, including Antonio’s wife, while the

COURTESY OF THE PEAR THEATRE

“What You Will” playwright Max Gutmann borrowed from Shakespeare’s works to create an entirely new play, with a cast including Alyssa Lupo-Zulueta, Mark Vashro, Amelia Adams , Lauren Hayes and Jim Johnson.

Duchess discovers that she’s got a thing for Antonio. Will they be able to keep their mate out of the garden long enough to rendezvous with their new beloveds? OK, maybe the plot isn’t so simple. But the playwright has woven this together so well that you won’t have too much trouble keeping the story lines straight. The direction, by William J. Brown III, also has a hand in keeping you grounded in the plot: With just a simple wood

COURTESY OF THE PEAR THEATRE

“What You Will” playwright Max Gutmann borrowed every word and phrase from Shakespeare’s works and rearranged them to create an entirely new play, with a cast including Lauren Hayes and Dan Wilson.

12

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

floor, a couple of moving platforms, and your imagination, Brown paints entire landscapes. The staging, at times, tends to be less Shakespeare and more “Scooby-Doo,” with actors playing multiple characters entering and exiting in pursuit of one another, but with a few simple costume pieces and recognizable character affectations, they become easy to discern. Even though this play is not Shakespeare, per se, it’s clear that all of the actors have facility with his language. This is no small feat. Their emotions, intentions, and characters all shine through the antiquated-seeming text, so you need not be a Shakespeare buff to enjoy the show. It may take a few minutes to tune your ear to the Elizabethan turns of phrase, but after a scene or two, you’ll be firmly invested in the characters’ plights. The actors all handle the difficult task of portraying multiple characters convincingly with ease, although the acting was a bit lopsided, with some characters portrayed earnestly, as was Vashro’s Antonio, and others in over-the-top caricatures, like Adams’ Duchess. For the realistically portrayed characters, Hayes is a standout as Malvolio, her acting subtle, yet convincing, and Hammond’s Duke is almost uncomfortably realistic, as he chases after the female-presenting characters

throughout the play. But it was Jim Johnson, who plays the Duke’s attendant and the bumbling peasant Claudio, who had the audience in stitches with his completely deadpan delivery and stoic expression. The entire ensemble is a welloiled machine, turning the small theater-in-the-round into a world where comedy, intrigue, and confusion reign and the audience becomes co-conspirator. So, to see or not to see? This fun, funny, and complex play is a can’t-miss midsummer night’s dream. And if their shadows have offended, Think but this, and all is mended: This production shall but linger here And it might be on you to brush up your Shakespeare. V

Freelance writer Kaila Prins can be emailed at kailaprins@ gmail.com. Q  I N F O R M AT I O N What: “What You Will” Where: The Pear Theatre, 1110 La Avenida St., Mountain View When: Through July 16, Thursday-Saturday at 8 p.m. and Sundays at 2 p.m. Cost: $28 - $32 Info: Go to thepear.org


A+E

Lean on us.

Treading water DRAGON OFFERS A TENSE, WELL-ACTED PRODUCTION OF ‘THE NORTH POOL’ by Karla Kane

A

high school student and his vice principal engage in an escalating game of cat-and-mouse in Rajiv Joseph’s “The North Pool,” currently presented at the Dragon Theatre. In this two-man show, set in 2007, it’s a battle of wills at the start of spring break between Sheffield High administrator Dr. Danielson (Edward Hightower) and Syrian-born, internationally raised Khadim (Salim Razawi), an 18-year-old senior who transferred in mid-September from an elite prep school under mysterious circumstances. Danielson calls him into his office for equally vague reasons, at first jovially grilling him on how he’s getting along academically and socially, acting all buddy-buddy and playing the fool. Khadim, for his part, plays dumb, too, giving typical surly-teen shrugs and eye rolls to Danielson’s questioning and attempts at establishing trust. As the one-act, one-room play rolls on, Danielson and Khadim’s interactions intensify, and they attempt to outsmart, outmaneuver and one-up each other, ramping up the accusations and revealing that they both know a lot more than either one was at first willing to admit. Was Khadim called into the office simply for ditching class? Perhaps he’s under suspicion in connection with a string of pranks and vandalism? Or is he connected to on-campus drug dealing? Could there be something even darker at stake, something related to the sex scandal and resulting suicide of another student who has ties to both characters? Fans of the classic play and film “Sleuth” (or, for more modern audiences, of the Netflix series “13 Reasons Why”) will find a similar squirmy pleasure in watching the unraveling mysteries of “The North Pool” and feeling the tension crackling between the leads. While this may not be Josephe’s all-time finest work (he was nominated for the Pulitzer Prize in 2010 for “Bengal Tiger at the Baghdad Zoo”), his masterful skill in crafting realistic dialogue and building suspense is on display in this psychological thriller. A two-person show relies, of course, heavily on the chemistry and skill of the two actors, Hightower and Razawi, along with Joseph’s script and director Jacquelyn Montellato’s brisk

We’re here to help older adults and their families with resources and programs for positive aging: • Transportation Assistance

• Aging-in-Place Support

• Information & Counseling

• Handyman Services

• Health & Wellness Programs

• Volunteering Opportunities

• Personal Growth Activities

• Adult Day Care

For more information, visit us at www.avenidas.org or call (650) 289-5400.

LANCE HUNTLEY

TOOLS FOR POSITIVE AGING

Edward Hightower and Salim Razawi play a vice principal and a high-schooler engaged in mental warfare in the Dragon Theatre’s production of “The North Pool.”

Theater Review pacing, which do not disappoint. Hightower is particularly excellent in the surprisingly complex character of Danielson, who at first appears to be a swaggering buffoon, a clueless, cringeworthy adult who still clings to his own high-school glory days while wanting desperately to be liked and respected. His students, he says, are the lost sheep to his benevolent shepherd. And peppered into his persona are unpleasant undertones of racism and misogyny, and even accusations of sexual misconduct. It’s easy, initially, to root for Khadim in this standoff: the victimized minority student being bullied by a power-hungry, petty dictator in a post-9/11 world where Muslim-Americans are under unfair persecution. But it becomes clear that Khadim is more of a wolf in sheep’s clothing. He’s smug and arrogant, used to getting what he wants thanks to his parents’ wealth and worldly connections. And he has seemingly little remorse for some of the disgusting acts in which he’s allegedly become entangled. On the other hand, maybe he is just a kid, trying to find a place for himself in a cutthroat world. The audience is continually torn, pulled between sympathy and suspicion for both characters as the interrogation develops (ultimately, though, after some revelations about animal cruelty, I was not left with many kind feelings toward Khadim). A third character, the deceased student, Lia, is often mentioned

but, despite her importance to the plot, not sufficiently fleshed out in order to give a sense of who she really was. The play, it should be noted, has local roots: It made its premiere with TheatreWorks in 2011 (TheatreWorks has produced a number of other Joseph works as well). According to Dragon’s artistic director Meredith Hagedorn, “North Pool” director Montellato and star Razawi both, separately, presented the idea to produce a version through Dragon’s Second Stage program, which supports the passion projects of emerging artists in the community. Their eventual collaboration has proved highly successful. This production is well-crafted and riveting, even as the plot itself continues to deal in ambiguities, leaving the audience with more questions than answers. Dragon’s version of “The North Pool” is a captivating look at two characters who are treading water, trying to keep from drowning in the deep end. Arts & Entertainment Editor Karla Kane can be emailed at kkane@paweekly.com. V

Q  I N F O R M AT I O N What: “The North Pool” Where: Dragon Theatre, 2120 Broadway St., Redwood City When: Through July 16, Thursdays-Saturdays at 8 p.m.; Sundays at 2 p.m. Cost: $27-$35 Info: Go to dragonproductions. net July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

13


Weekend MOUNTAIN VIEW VOICE

So much food, so little flavor

Q RESTAURANT REVIEW Q MOVIE REVIEWS Q BEST BETS FOR ENTERTAINMENT

Falafel served on mixed greens with toppings like pickled turnips, beets, cucumber tomato salad, and tahini sauce at Sajj Mediterranean.

Q R E S TA U R A N T R E V I E W

Hit or miss Mediterranean fast-casual food at Sajj in Mountain View REVIEW BY ALISSA MERKSAMER PHOTOS BY VERONICA WEBER

14

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

S

ajj Mediterranean in Mountain View feels more like a fueling station than a restaurant. With two food trucks, five restaurant locations (and more to come), it has done to Mediterranean food what Chipotle has done to Mexican food — made it fast, customizable and, too often, forgettable. The restaurant’s gleaming brushed-metal counters, metal trays and matching chairs are as functional as they are

nondistinctive. The Arabic music that pipes at a comfortably low level through the sound system is the only clue as to the type of food served here. Ordering is intimidating and confusing if it’s your first time, even though the restaurant, located at the San Antonio Center on El Camino Real, tries to help. A TV monitor flashes back and forth between a scene of Mediterranean food and instructions on how to order

with three steps listed. Another monitor streams a football game on mute. A big arrow and the word “start” tells you where to begin, but if you arrive during lunch, it will be hidden behind the line of people. Just like at Chipotle, you choose your meal first and pay last. Rows of metal containers filled with shawarma, falafel, hummus and more than 20 vegetable sides demand a quick scan if people are waiting behind


Weekend

Mayeli Olvera, manager of Sajj Mediterranean in Mountain View, prepares a chicken shawarma bowl.

you. Point to what you want, and someone scoops the various items into your tortilla wrap, rice bowl, or salad bowl (between $8.50 and $10.50, depending on the protein you choose). Both the allure and downside of Sajj is that the restaurant often gives priority to

quantity over f lavor. If you choose every vegetable side — which you can do free of charge, except for the guacamole (yes, there’s guacamole here) — you’ll have plenty of food for two meals. Yet many of those sides are bland. Close your eyes and the

pickled onions dusted with sumac could be regular raw onions, their sharpness almost fully intact. An Israeli salad of chopped tomatoes and cucumbers offers merely the flavors of its respective ingredients, Continued on next page

A side dish of pita bread or pita chips comes with hummus.

2017 REMODELING WORKSHOP SERIES Designing & Remodeling Your Perfect Kitchen or Bathroom WEDNESDAY, JULY 19, 2017 Workshop: 6:00pm-8:00pm Registration and dinner from 5:30pm-6:00pm Harrell Design Center: 944 Industrial Avenue Palo Alto Creating a beautiful, yet highly functional kitchen or bathroom with proper space planning, cabinetry layouts, and storage ideas and inspirations.

:KDWLVXQLYHUVDOGHVLJQHQHUJ\HIÀFLHQW low maintenance design and remodeling? :KRGRHVQ¡WZDQWDORZPDLQWHQDQFH high style kitchen and bathroom!

Hear about the latest trends in color, FRXQWHUWRSVĂ RRULQJFDELQHWU\DQGWLOH

Small or large, you will learn how to maximize your space and so much more!

PRE-REGISTRATION IS REQUIRED AS THESE CLASSES FILL UP QUICKLY!

Call us or go online to register today!

650.230.2900 | info@harrell-remodeling.com | harrell-remodeling.com License 8479799 July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

15


Weekend QDININGNOTES Sajj Mediterranean 2580 W El Camino Real, Mountain View 650-941-7255 sajjstreeteats.com Hours: Sunday-Thursday, 11 a.m. to 9 p.m.; Friday-Saturday, 11 a.m. to 10 p.m. Credit Cards Alcohol Children Takeout Noise Level Parking

low lot

Continued from previous page

while tiny cubes of purple beets taste as if they were poured straight from the can. While the shredded cabbage provides great crunch, it tastes solely of shredded cabbage. During one visit, cauliflower stained purple from sumac was so overcooked it limped like injured soldiers. The proteins could also be

Steak shawarma wrap with turmeric rice, pickled turnips, cucumber tomato salad, lettuce and hummus spread.

better. The falafel was crunchy, but dry. Zaib Ayoub, the president of Falafel Inc., which owns Sajj, admits that it’s hard to get the timing right when cooking

falafel. The falafel balls are fried frequently throughout the day, but they’ll dry out if they sit for too long. Sajj doesn’t want to make customers wait for a falafel to be freshly fried. (Note: I would gladly wait.) Other proteins are hit-andmiss. During one visit, the steak shawarma had a bizarre, almost liver-like consistency, though Ayoub said it doesn’t contain any liver. The chicken shawarma tasted like plain grilled chicken — perfectly acceptable if not memorable. Pomegranate chicken carried a touch of sweetness, but it was chopped into such tiny pieces that it was sometimes difficult to identify as meat. None of this is to say that the ingredients aren’t good quality. According to Ayoub, the vegetables come from local farms and the meat is antibiotic- and

‘With most hummus, people add preservatives, but Sajj keeps it simple with dried garbanzo beans, olive oil and tahini.’ SAJJ CHEF LOUIE ALHINDI

hormone-free as well as halal. Everything is prepped in a commercial kitchen in Menlo Park and then cooked on-site at the various restaurants. Not everything is ordinary at Sajj. The hummus is fantastic. It’s thick and earthy, made in small batches by chef Louie Alhindi, who oversees all the cooking at the central kitchen.

4pm-9pm Sun-Thurs

THE VOICE

Happy Hour

Best of

MOUNTA IN VIEW

2016

ÂŒ+TIZSMÂź[*]ZOMZ[̆ WĐ„  ÂŒ.ZMVKP.ZQM[̆ WĐ„  ÂŒ WĐ„IVaLQVVMZ • Kids 12 & under - buy 1 get 1 free* *item from kids menu of equal or lesser sser value

70 th year ANNIVERSARY!

NOW HIRING applications @clarkes.com and Restaurant

Open 7 days Clarkes.com Lunch & Dinner 11am-9pm; Fri ’til 10pm Breakfast on Weekends 8am-2pm

Mountain View • 615 W. El Camino Real • (650) 967-0851

16

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

“With most hummus, people add preservatives,� said Alhindi, but Sajj keeps it simple with dried garbanzo beans, olive oil and tahini. Sajj’s tzatziki, or yogurt dip, is cool, creamy and rife with crunchy cubes of cucumber. An off-white garlic dip teems with crushed garlic that feels pleasantly gravelly on the tongue. Another vegetable side, spicy peppers, may trigger a sweat response, so counter it with a bite of soft yellow rice. Sajj’s sauces also excel. A bright green cilantro mint chutney reminiscent of Indian chutney brightened everything it touched. The tahini sauce was creamy yet pourable, tasting purely of the ground sesame seeds from which it’s made, while a pale pink tahini spiked with the Arabic hot sauce shatta tingled more than it burned. Would I go back to Sajj? If I want a lot of food for not a lot of money, sure. A visit during lunchtime proves the restaurant has quite a following. Ayoub and Sajj co-owner Mashar Sakhouri must have figured out that this is what the public wants. (Sakhouri was the former food and beverage director for the Hyatt hotels, and his family owns Bay Area chain Crepevine Restaurant.) Yet one has to wonder if Sajj — and fast-casual restaurants like it — are doing customers a disservice by dumbing down flavor in favor of convenience and low cost. Freelance writer Alissa Merksamer can be reached at amerksamer@gmail.com. V


Weekend QMOVIEOPENINGS

Web design upgrade “SPIDER-MAN: HOMECOMING” GOES BACK TO SCHOOL 000 (Century 16 & 20) We’re deep enough into the age of comic-book movies that “Spider-Man: Homecoming” in some ways feels like a throwback. Conspicuously kid friendly, the first Spider-Man movie to be produced by Marvel Studios — as a part of the Marvel Cinematic Universe — not only doesn’t shy from being goofy, but it cheerfully embraces the cartoony. Director Jon Watts’ first shot at Spidey lands close enough to the summer-movie sweet spot that any quibbles feel a bit churlish. Tom Holland’s Peter Parker, first seen in “Captain America: Civil War,” remains beholden to billionaire Tony Stark (Robert Downey Jr.), with whom the 15-year-old is serving an “internship.” But Peter finds himself held at arm’s length, not a good place to be for someone of his bouncing-of-the-walls, chomping-at-the-bit energy. The rubber meets the road when the economically needy salvage crew of Adrian Toomes (Michael Keaton) gets screwed by the government, prompting Toomes to begin stealing Chitauri technology left over from the alien invasion in “The Avengers.” To keep his family and his

workers afloat, Toomes turns his business into an arms trade, his secret weapon being a flying suit. Toomes keeps running afoul of Parker, a conflict that comes to a head on the night of the Homecoming Dance. “Homecoming” gets plenty right. Keaton makes a great Vulture, and the character’s conception here as the workingclass villain to Peter’s “workingclass hero” proves dramatically effective, especially as goosed by a certain third-act reveal. The characterization of Spider-Man as a snarky teen in science-nerd T-shirts — as unmistakably a kid — also feels fresh. Twenty at the time of filming, Holland looks and sounds considerably more like a teenager than Tobey Maguire and Andrew Garfield (both asssumed the role in their late 20s). Director Jon Watts makes a credible leap into blockbuster filmmaking following his breakthrough indies “Clown” and “Cop Car.” Though there’s plenty of action excitement throughout, three well-staged major set pieces—each within or adjacent to a recognizable American landmark — effectively crank up tension.

COURTESY OF COLUMBIA PICTURES

Peter Parker (Tom Holland) tries to balance life as an ordinary high school student while fighting crime as his superhero alter ego, Spider-Man, in “Spider-Man: Homecoming.”

The film’s first act struggles a bit to nail down its tone and pacing, a probable result of at least six screenwriters leaving their prints on the script. Another arguable problem with “SpiderMan: Homecoming,” if a guaranteed box-office smash can be said to have one, is that everyone is Iron Man. The crazy amount of technology Stark affords to Parker, a kid from Queens, functions like a plot crutch for much of the film’s first two acts—although it sets up a third-act reversal. Then there’s the Vulture, with his hightech flying suit and, of course, the tricked-out Iron Man. The story doesn’t afford much emotional depth, but it does score points by noting Parker’s sacrifices and having Stark teach him the lesson “If you’re

nothing without the suit, then you shouldn’t have it.” A diverse ensemble adds value: Jacob Batalon as “man in the chair” Ned, Laura Harrier as love interest Liz, Zendaya as hilariously deadpan smart-girl Michelle, and Tony Revolori as bully Flash Thompson. Ultimately, “Spider-Man: Homecoming” can’t shake off

superhero formula or its corporate sheen, but it works nicely within those parameters as an action-packed, beat-the-heat distraction. Rated PG-13 for sci-fi action violence, some language and brief suggestive comments. Two hours, 13 minutes. — Peter Canavese

QNOWSHOWING 47 Meters Down (PG-13) Century 20: Fri. - Sun. 9 To 5 (PG) Century 20: Sunday All Eyez on Me (R) Century 16: Fri. - Sun. Baby Driver (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. Beatriz at Dinner (R) +++1/2 Century 20: Fri. - Sun. The Beguiled (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Big Sick (R) +++ Century 20: Fri. - Sun. Palo Alto Square: Fri. - Sun. Cars 3 (G) +++ Century 16: Fri. - Sun. Century 20: Fri. - Sun.

QMOVIEREVIEWS

THE BIG SICK 000

“The Big Sick” is a romantic comedy Kumail Nanjiani (“Silicon Valley”) co-wrote with his wife, Emily V. Gordon. The film is essentially the true story of Nanjiani and Gordon’s relationship, starring Nanjiani as himself. We see Nanjiani working the room at Chicago’s comedy clubs, hanging with fellow comedians, struggling to please his Pakistani-American family, and wooing Emily (Zoe Kazan). All of this business works as engaging high-spirited slice-of-life material, with Kazan and Nanjiani charming with their comic banter. But the rub is in that title: “The Big Sick” refers to the unavoidable spoiler that Emily unexpectedly finds herself incapacitated by a health crisis. That crisis not only winds up ultimately bringing the lovers together for good (see the screenwriting credits) but sets the stage for Kumail to meet Emily’s lovably loving parents, Beth and Terry, played by Holly Hunter and Ray Romano. Nanjiani and Gordon also do a nice job of laying out an arc of acceptance within Nanjiani’s immediate family, despite his choices of a comedy career and a nonPakistani woman (since more-or-less arranged marriage is the norm). This boilerplate romantic-comedy is consistently amusing and possessed with charming leads, and also serves as a heartwarming drama. Rated R for language including some sexual references. One hour, 59 minutes. — P.C.

BEATRIZ AT DINNER 000 1/2

Screenwriter Mike White and director Miguel Arteta — frequent collaborators, most recently on HBO’s “Enlightened” — make our nation’s political intractability the stuff of comedy and drama in their provocative new film “Beatriz at Dinner,” which dramatizes the spiritual exhaustion of our time.Happenstance sets the table for middle-class holistic healer Beatriz Luna (Salma Hayek) when one of her rich clients (Connie Britton) invites her to stay for dinner within the walls of a gated community. The dinner celebrates an impending business deal, and the guest of “honor” is a hotel-owning mogul named Doug Strutt (John Lithgow). Strutt quickly proves racist, callous and smug. It’s no great leap to see Strutt as Trumpian, but “Beatriz at Dinner” has bigger fish to fry than any one figure. White and Arteta’s big picture frames the troubling way of the world under American hegemony, the smokestacks and oil spills idealists can’t wish away. The meeting of Luna and Strutt contrasts healing and nurturing to destruction and a killer instinct (Strutt concludes, “The world is dying. What are you going to do?...You should try to enjoy yourself”).Rated R for language and a scene of violence. One hour, 23 minutes. — P.C.

TRANSFORMERS: THE LAST KNIGHT 1/2

“Transformers: The Last Knight,” Michael Bay’s fifth movie about shape-shifting alien robots, tries to whip up tension by having

some character or other remind us every five minutes that “The whole world’s at stake,” unless a few choice humans can ally with a few good Autobots and save the day. But Bay makes it very, very difficult to care. “The Last Knight” is all mirthless jokes and thrill-less mayhem. RatedPG-13 for violence and intense sequences of sci-fi action, language, and some innuendo. Two hours, 29 minutes. — P.C.

CARS 3 000

Pixar’s “Cars 3” gets the franchise back on track with a story that U-turns to the heart of the 2006 original. This time, champion race car Lightning McQueen (Owen Wilson) faces stiff competition from smack-talking Jackson Storm (Armie Hammer), a sleek, custom-built “NextGen” Piston Cup Racer. After a series of losses, Lightning begins to wonder: is it time to retire? It’s a bumpy road, and soon Lightning’s being encouraged by Rust-Eze’s new owner Sterling (Nathan Fillion) to “cash in” and become a “brand” through product endorsements. It’ll all come down to the Florida 500: if Lightning wins, he can keep racing for Rust-Eze. If he loses, he’s done. “Cars 3” sets up the expectation, then, that it is a latter-day “Rocky” story, a comeback journey for an aging competitor who’s still got life left in him. That’s not wrong, but it turns out that what “Cars 3” is really about is the role of a great teacher, or mentor. The turns of the final race cleverly integrate both halves of the movie into a surprisingly satisfying whole, another entertaining and meaningful G-rated win for Pixar. Rated G. One hour, 49 minutes. — P.C.

Despicable Me 3 (PG) Century 16: Fri. - Sun. Century 20: Fri. - Sun. Guardians of the Galaxy Vol. 2 (PG-13) ++1/2 Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Hero (R) Aquarius Theatre: Fri. - Sun. The House (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Little Hours (R) Aquarius Theatre: Fri. - Sun. Maudie (PG-13) Aquarius Theatre: Fri. - Sun. The Mummy (PG-13) +1/2 Century 20: Fri. - Sun. The Music Man (Not Rated) Stanford Theatre: Fri. - Sun. Rough Night (R) Century 20: Fri. - Sun. Spider-Man: Homecoming (PG-13) +++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. Tammy and the Bachelor (Not Rated) Stanford Theatre: Fri. - Sun. Transformers: The Last Knight (PG-13) 1/2 Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Women’s Balcony (Not Rated) Guild Theatre: Fri. - Sun. Wonder Woman (PG-13) +++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. Aquarius: 430 Emerson St., Palo Alto (For recorded listings: 327-3241) tinyurl.com/Aquariuspa

CineArts at Palo Alto Square: 3000 El Camino Real, Palo Alto (For information: 493-0128) tinyurl.com/Pasquare

Century Cinema 16: 1500 N. Shoreline Blvd., Mountain View tinyurl.com/Century16

Guild: 949 El Camino Real, Menlo Park (For recorded listings: 566-8367) tinyurl.com/Guildmp

Century 20 Downtown: 825 Middlefield Rd, Redwood City tinyurl.com/Century20

0Skip it 00Some redeeming qualities 000A good bet 0000Outstanding

Stanford Theatre: 221 University Ave., Palo Alto (For recorded listings: 324-3700) Stanfordtheatre.org

For show times, plot synopses, trailers and more movie info, visit www.mv-voice.com and click on movies.

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

17


M O U N TA I N V I E W V O I C E

QHIGHLIGHT ‘WHAT YOU WILL’ Pear Theatre’s season concludes with “What You Will,” a “Shakespearean travesty” by Max Gutmann. Kidnapping, cross-dressing and adultery combine in this madcap comedy, written by rearranging thousands of snippets cut from the plays of William Shakespeare into a completely new plot. June 23-July 16, times vary. $10, previews; $35, opening; $32, regular. The Pear Theatre, 1110 La Avenida, Mountain View. thepear.org

THEATER “The Four Immigrants: An American Musical Manga” TheatreWorks Silicon Valley presents the world premiere of “The Four Immigrants: An American Musical Manga.” Set to an infectious ragtime and vaudeville score by local composer/lyricist Min Kahng, the comic musical follows four Japanese immigrants in turn-of-the-20th-century San Francisco. July 12-Aug. 5, times vary. Discounts for educators, seniors, and patrons 35 and under. Lucie Stern Theatre, 1305 Middlefield Road, Palo Alto. theatreworks.org ‘The North Pool’ “The North Pool,” by Rajiv Joseph and directed by Jacquelyn Montellato, follows Khadim, a Syrian-born student in a large U.S. high school who is called into the vice principal’s office to discuss recent absences; he soon becomes caught in a web of lies about crimes he may (or may not) have committed. Through July 16, Thursday-Saturday, 8 p.m.; Sunday, 2 p.m; $15-$35. Dragon Theatre, 2120 Broadway St., Redwood City. dragonproductions.net/activities/ mondaynight.html TheatreWorks: Hershey Felder, Beethoven TheatreWorks Silicon Valley completes its 2016/2017 season with the regional premiere of a newly-revised work by acclaimed performer/playwright Hershey Felder. Following his triumph as Irving Berlin at TheatreWorks, Felder will bring Ludwig van Beethoven to life through the eyes of a Viennese doctor who spent his boyhood by the Maestro’s side in “Hershey Felder, Beethoven.” June 7-July 9, times vary. $45-$105. Mountain View Center for Performing Arts, 500 Castro St., Mountain View. theatreworks.org/calendar/2016-2017season/beethoven/

CONCERTS Concert on the Plaza All are invited to join friends and neighbors and bring a blanket or lawn chair to the Civic Center Plaza for a variety of musical performances. There will also be food trucks, a “Pop Up Park” area for children and — for adults — beer and wine. First Friday of the month, 6-7:30 p.m. Free. Mountain View Civic Center Plaza, 500 Castro St., Mountain View. mountainview.gov/plazaevents

Merola Opera Program: Schwabacher Summer Concert Some of opera’s greatest moments come to life as the Merola Opera Program’s young artists perform staged vignettes from Mascagni’s “Cavalleria Rusticana,” Moore’s “The Ballad of Baby Doe,” Massenet’s “Thais,” Weber’s “Der Freischutz,” Donizetti’s “Lucrezia Borgia” and more, accompanied by a full orchestra with English supertitles. July 9, 2:30 p.m. $30-$40. Bing Concert Hall, 327 Lasuen St., Stanford. events. stanford.edu/events/ Russian Movie Club With the art critic Boris Vladimirsky, viewers will watch new and old movies with the foreword of the Docent and following discussion with participation of all who will be present. Boris Vladimirsky many years managed the Art and Concert Department of Palo Alto JCC, edited the monthly magazine “Vstrecha”, staged performances of the group “Baby Boomers & Co” and gave lectures on literature and art. This is for Russian Speakers. Third Tuesday of the month, 7-9:30 p.m. $12, general. Oshman Family JCC, 3921 Fabian Way, Palo Alto. brownpapertickets.com/event/ Train Chart-topping San Francisco locals Train are hitting the road on their “Play That Song Tour” in celebration of their latest album, “A Girl, a Bottle, a Boat,” including this home show at Shoreline Amphitheatre. Jam band O.A.R. and British pop singer Natasha Bedingfield open the concert on the peninsula. July 8, 7 p.m. Ticket prices vary. Shoreline Amphitheatre, 1 Amphitheatre Parkway, Mountain View. facebook.com/events/

MUSIC Classical Guitarist Yuri Liberzon All are invited to enjoy this summer evening featuring Yuri Liberzon, an internationally acclaimed concert classical guitarist and recording artist. Wine and light refreshments will be provided for further enjoyment. July 13, 7-8:30 p.m. $10. Museum of American Heritage, 351 Homer Ave., Palo Alto. Federspiel (“Austriafest”) This sevenpiece ensemble redefines brass-band music. All are invited to join for Austrian-themed food, drink and fun in Bing’s Gunn Atrium. July 8, 7:30 p.m. $20. Bing Concert Hall, 327 Lasuen St., Stanford. events.stanford.edu/events/

Inspirations a guide to the spiritual community To include your Church in

Inspirations Please call Blanca Yoc at 650-223-6596 or email byoc@paweekly.com

MOUNTAIN VIEW CENTRAL SEVENTH-DAY ADVENTIST CHURCH Sabbath School: 9:30 a.m. Saturday Services: Worship 10:45 a.m. Wednesday Study Groups: 10-11 a.m. Pastor Kenny Fraser, B.A.M. DIV 1425 Springer Rd., Mtn. View - Office Hrs. M-F 9am-1pm www.mtviewda.adventistfaith.org Phone: 650-967-2189

18

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

French Country Dance Workshop and Party Start celebrating Bastille Day a week early! Instructors will help teach and lead French country dances to the live music of Fete Musette in addition to couple dances, mixers and line dances from Alsace, Brittany, Central France and Gascony, ending with a delightful waltz. July 7, 8 p.m. $12 at the door; half-price for students; free for children. First Baptist Church Event Hall, 305 N. California Ave., Palo Alto. meetup.com Thursday Night Live The Thursday Night Live Series in Downtown Mountain View takes place on Castro Street between Mercy and Villa streets, which will be closed to traffic so the public can walk the street to enjoy restaurant dining, shopping, children’s activities, a farmer’s market, live music and a custom/classic car show. July 13 and 27, 5:30-8:30 p.m. Free. Downtown Mountain View, Castro Street, Mountain View. mountainview.gov/thursdaynightlive

FESTIVALS & FAIRS 2017 ACGA Palo Alto Clay and Glass Festival Celebrating 25 years, this fabulous festival celebrates clay and glass art. More than 140 local artists will display the finest in handcrafted glass and ceramics. Take part in fun activities such as clay, glass, raku and ikebana demonstrations. Free admission; valet parking available. July 8-9, 10 a.m.-5 p.m. Palo Alto Art Center, 1313 Newell Road, Palo Alto. clayglassfestival.com Summer Youth Camps These one-week camps are for kids ages 7-12 and 10-14. They offer Intro to Video Production, Claymation and Field Production. Each camp is one week from 10 to 4 p.m. Summer, ongoing, June 12-Aug. 11. $350-$475. KMVT Community Television, 1400 Terra Bella Ave., Suite M, Mountain View. kmvt15.org/learn/youthactivities. html#summercamp

TALKS & LECTURES Astronomer Andrew Fraknoi The Menlo Park Library will host astronomer Dr. Andrew Fraknoi, who will entertain & educate with an illustrated, nontechnical talk about the upcoming full solar eclipse. There will be a book signing afterwards, with Kepler’s Books making copies available for sale. July 13, 7-8:30 p.m. Free. Menlo Park Library, 800 Alma St., Menlo Park. menlopark.org/adults Bonnie Rochman Bonnie Rochman, awardwinning journalist and former health and parenting columnist for Time.com and staff writer for Time magazine, discusses her compelling work, “The Gene Machine: How Genetic Technologies Are Changing the Way We Have Kids--And the Kids We Have.” July 13, 7-9 p.m. Free. Books Inc. Palo Alto, 74 Town & Country, 855 El Camino Real, Palo Alto. booksinc.net Family Love Letter: Vital Information for Your Family This presentation addresses items that are not normally included in a family will or trust. Family Love Letter is a system which helps to reduce confusion and stress and provide families with tools. July 11, 7-8:30 p.m. Mountain View Public Library, 585 Franklin St., Mountain View. mountainview.gov Residential Curbside Food Scraps Program Learn about Mountain Viewís new residential food scraps program for residents who have curbside trash and recycling service (individual carts). A pilot for apartment residents will be developed in 2017 for implementation in 2018. July 10, 6-7 p.m. Mountain View Library, 585 Franklin St., Mountain View. mountainview. gov/depts/library/

FAMILY Dads at Play in the Park Elisabeth Stitt of Joyful Parenting Coaching has a mission to bring joy to parenting and a key tool for that is being more playful. This workshop provides a chance for dads and kids to play together, putting into action tips and games and activities that can be modified and played in all kinds of settings. July 8, 4:305:30 p.m. Free, RSVP requested. Cuesta Park, 615 Cuesta Drive, Mountain View. eventbrite.com

Free Mock ACT Test Students in grades 8 through 12 can try a full-length mock ACT test and receive guidance to increase their test score. Test-takers must bring pencils and calculator. Seats are limited. July 8, 1-5 p.m. Free, RSVP requested. ThinkTank Learning, 4856 El Camino Real, Suite 200, Los Altos. eventbrite.com

COMEDY Comedians at Red Rock Bay Area comedian Kevin Wong will host his monthly comedy showcase at Red Rock Coffee. This comedy event is held on the third Saturday of each month through the end of the year, 8:30-10:30 p.m. Free, donations welcome. Red Rock Coffee, 201 Castro St., Mountain View. kevinwongcomedy. com/shows/ Comedy Night at O’Malley’s All are invited to enjoy some laughs as they see some of best comedians in the Bay Area as they work out new material. The even is for ages 21 and over, and there is no cover charge. It’s hosted by Wes Hofmann. Sundays, July 2-30, 8-10 p.m. Free. O’Malley’s Sports Pub, 2135 Old Middlefield Way, Mountain View. facebook.com/ comedynightatomalleys/

FOOD & DRINK Off the Grid: Mountain View @ The Computer History Museum Off the Grid: Mountain View @ Computer History Museum returns in partnership with the Computer History Museum. There will be 10 food trucks, live music and additional amenities. This is a kid-friendly event. Fridays, ongoing, 5-9 p.m. Free. Computer History Museum, 1401 N. Shoreline Blvd., Mountain View. facebook.com/events/

LESSONS & CLASSES Animation Camp Using industry standard animation software, students will learn to create 2D animations and special effects for movies. Kids plan, design and storyboard their projects. This camp is suitable for grades 6 to 9. July 10-14, 9 a.m.-3 p.m. $450. Midpen Media Center, 900 San Antonio Road, Palo Alto. midpenmedia.org/ youth/digiquest/#Animation-Camps ESL Conversation Club The ESL Conversation Club will help participants practice English through casual conversation with friendly company. All levels, everyone welcome. No registration required. Tuesdays, July 11-25, 5-6 p.m. Free. Mountain View Library, 585 Franklin St., Mountain View. mountainview.gov/ depts/library/ Fitness with the YMCA This class helps to develop balance, flexibility, strength, posture, coordination and fall prevention. It is appropriate for all levels and backgrounds in partnership and led by instructors from the YMCA. Please bring your own Yoga mat or towel. Wednesdays, July 5-July 26, noon-1 p.m. Free, registration required. Mountain View Library, 585 Franklin St., Mountain View. mountainview.gov/depts/library/ Kids Read Kids Read is a program for Kindergarten, First and Second graders who would like to practice their reading with a Middle or High School buddy. The program is free and no registration is required. July 9, 3:30-4:30 p.m. Free. Mountain View Library, 585 Franklin St., Mountain View. mountainview.gov/depts/library/

OUTDOOR RECREATION A Hike on Shaky Ground A hike in the Santa Cruz Mountains near the San Andreas Fault. The route will go through grasslands, woodlands, a riparian corridor and an old orchard before visiting the Los Trancos earthquake trail. July 9, 10 a.m.-2 p.m. $100. Montebello and Los Trancos Open Space Preserves, 4185 Page Mill Road, Los Altos. eventbrite.com Design-It Yourself Native Plant Garden Learn the principles of garden design, including how to remove a lawn in order to save water, decrease maintenance time and create habitat. See an example of a design from start to finish, learn about free online designs available to download and modify and get ready to put pencil to paper. July 12, 7-8:30 p.m. Free.

Los Altos Library, 13 South San Antonio Road, Los Altos. sccl.org Hiking with WWC Hike with Women Who Code to take a break away from computers, talk about coding and have fun. Meet at the lower right parking lot of the preserve for a roughly two-hour hike. July 9 and Aug. 13, 9-11 a.m. Free. Rancho San Antonio County Park and Open Space Reserve, 22500 Cristo Rey Drive, Los Altos. meetup.com Hike at Monte Bello Open Space Preserve A strenuous, moderately paced, outand-back 11-mile hike. Route will go down the Bella Vista trail to Black Mountain and continue on to the Ridge Winery for an extended lunch break and wine tasting. July 9, 9:30 a.m. $10, four wine tastings; $20, exclusive wines. Monte Bello Open Space Preserve (Parking Lot), 4185 Page Mill Road, Los Altos. meetup.com

TEENS Cube Club Cubing experts share the excitement of solving the cube and friends help friends. Program open to students in third through 12th grades. Participants asked to bring their own cube or borrow one from the library. No registration required. July 13, 4-5 p.m. Free. Mountain View Library, 585 Franklin St., Mountain View. mountainview.gov/depts/library/ Knit & Crochet Club Learn something new, get answers to questions or just bring a project and enjoy the company of other knitters. Supplies provided for beginners. Open to all skill levels, ages 8 and up. Fridays, June 30-July 21, 1-4 p.m. Free. Mountain View Library, 585 Franklin St., Mountain View. mountainview.gov/depts/library/ My Digital TAT2 Presents: Digital Dialogue Join the founders of My Digital TAT2, Erica Pelavin and Gloria Moskowitz-Sweet, who will use a lively, informative and interactive format. This workshop brings tweens and parents together to facilitate and improve communication around safe, responsible, and conscious digital use. July 13, 7-8:30 p.m. Mitchell Park Community Center, 3700 Middlefield Road, Palo Alto. brownpapertickets.com Python for Tweens and Teens This fourweek class will teach students how to code in Python, an object-oriented, popular and easy to learn programming language. Students need to bring their own laptops but may reserve a loaner in advance. Saturdays, July 8-29, 3-5 p.m. Free. Mountain View Library, 585 Franklin St., Mountain View. mountainview.gov/depts/library/ Read Quest Tween: Realistic Fiction Explore popular genres and topics in tween literature. The program includes goofy games, cool crafts, and crazy charades while participants share their favorite books around the theme of realistic fiction. July 7, 3-4 p.m. Free, RSVP requested. Mountain View Library, 585 Franklin St., Mountain View. mountainview.gov/depts/library/

BUSINESS Burritos and Startups A monthly meeting to discuss all things startup and what is involved in becoming a startup co-founder. Participants asked to bring your questions, hopes, and dreams. July 13, noon. Free. Una Mas, 1040 Grant Road, Mountain View. meetup.com Monthly mixer: find your startup co-founder Attendees can receive help with business basics; participate in networking activities and choose co-founders; find marketing resources and strategic partners; seek investors and raise venture capital; and get access to advisory boards and mentors, as well as improve entrepreneurship skills in various training programs. July 12, 12:15 p.m. Free. Techcode, 1172 Castro St., Mountain View. meetup.com MV Technology Showcase The Technology Showcase is a one-day outdoor event where local tech companies and startups showcase their latest products/technologies. The event is presented by the City of Mountain View and the Chamber of Commerce. July 12, 11:30 a.m.-3 p.m. Free. Civic Center Plaza, 500 Castro St., Mountain View. chambermv.org


Marketplace PLACE AN AD ONLINE fogster.com E-MAIL ads@fogster.com PHONE 650.326.8216 Now you can log on to fogster.com, day or night and get your ad started immediately online. Most listings are free and include a one-line free print ad in our Peninsula newspapers with the option of photos and additional lines. Exempt are employment ads, which include a web listing charge. Home Services and Mind & Body Services require contact with a Customer Sales Representative. So, the next time you have an item to sell, barter, give away or buy, get the perfect combination: print ads in your local newspapers, reaching more than 150,000 readers, and unlimited free web postings reaching hundreds of thousands additional people!!

INDEX QBULLETIN

BOARD 100-199 QFOR SALE 200-299 QKIDS STUFF 330-399 QMIND & BODY 400-499 QJ  OBS 500-599 QB  USINESS SERVICES 600-699 QH  OME SERVICES 700-799 QFOR RENT/ FOR SALE REAL ESTATE 800-899 QP  UBLIC/LEGAL NOTICES 995-997 The publisher waives any and all claims or consequential damages due to errors. Embarcadero Media cannot assume responsibility for the claims or performance of its advertisers. Embarcadero Media has the right to refuse, edit or reclassify any ad solely at its discretion without prior notice.

fogster.com THE PENINSULA’S FREE CLASSIFIEDS WEBSITE

Combining the reach of the Web with print ads reaching over 150,000 readers!

fogster.com is a unique website offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in the Palo Alto Weekly, The Almanac and the Mountain View Voice.

Bulletin Board 115 Announcements A PLACE FOR MOM. The nation’s largest senior living referral service. Contact our trusted,local experts today! Our service is FREE/ no obligation. CALL 1-800-550-4822. (Cal-SCAN) DID YOU KNOW Information is power and content is King? Do you need timely access to public notices and remain relevant in today’s highly competitive market? Gain an edge with California News Publishers Association new innovative website capublicnotice.com and check out the Smart Search Feature. For more information call Cecelia @ (916) 288-6011 or www.capublicnotice.com (Cal-SCAN) DID YOU KNOW 7 IN 10 Americans or 158 million U.S. Adults read content from newspaper media each week? Discover the Power of Newspaper Advertising. For a free brochure call 916-288-6011 or email cecelia@cnpa.com (Cal-SCAN) DID YOU KNOW Information is power and content is King? Do you need timely access to public notices and remain relevant in today’s hostile business climate? Gain the edge with California News Publishers Association new innovative website capublicnotice.com and check out the FREE One-Month Trial Smart Search Feature. For more information call Cecelia @ (916) 288-6011 or www.capublicnotice.com (Cal-SCAN) DISH NETWORK. TV for Less, Not Less TV! FREE DVR. FREE Install (up to 6 rooms.) $49.99/mo. PLUS Hi-Speed Internet - $14.95/mo (where available.). Call 1-855-734-1673. (Cal-SCAN) DONATE YOUR CAR, TRUCK OR BOAT TO HERITAGE FOR THE BLIND. FREE 3 Day Vacation, Tax Deductible, Free Towing, All Paperwork Taken Care of. Call 1-800-731-5042 (Cal-SCAN) EVERY BUSINESS Has a story to tell! Get your message out with California’s PRMedia Release – the only Press Release Service operated by the press to get press! For more info contact Cecelia @ 916-288-6011 or http://prmediarelease.com/california (Cal-SCAN) GET CASH FOR CARS/TRUCKS!!! All Makes/Models 2000-2016! Top $$$ Paid! Any Condition! Used or wrecked. Running or Not. Free Towing! Call For Offer: 1- 888-417-9150. (Cal-SCAN)

PREGNANT? CONSIDERING ADOPTION? Call us first. Living expenses, housing, medical, and continued support afterwards. Choose adoptive family of your choice. Call 24/7. 1-877-879-4709 (Cal-SCAN) Safe Step Walk-In Tub! Alert for Seniors. Bathroom falls can be fatal. Approved by Arthritis Foundation. Therapeutic Jets. Less Than 4 Inch StepIn. Wide Door. Anti-Slip Floors. American Made. Installation Included. Call 1-800-799-4811 for $750 Off. (Cal-SCAN) Social Security Disability? Up to $2,671/mo. (Based on paid-in amount.) FREE evaluation! Call Bill Gordon & Associates. 1-800-966-1904. Mail: 2420 N St NW, Washington DC. Office: Broward Co. FL., member TX/NM Bar. (Cal-SCAN) Switch to DIRECTV. Lock in 2-Year Price Guarantee ($50/ month) w/AT&T Wireless. Over 145 Channels PLUS Popular Movie Networks for Three Months, No Cost! Call 1- 800-385-9017 (Cal-SCAN) Water Damage to Your Home? Call for a quote for professional cleanup & maintain the value of your home! Set an appt. today! Call 1-855-401-7069 (Cal-SCAN) Astronomer Andrew Fraknoi FREE BOOK GIVEAWAY

Nice Crock Pot! Works Great! - $15.00

Mind & Body 405 Beauty Services ELIMINATE CELLULITE And Inches in weeks! All natural. Odor free. Works for men or women. Free month supply on select packages. Order now! 1-844-703-9774. (Cal-SCAN)

Jobs 500 Help Wanted TECHNOLOGY Informatica LLC has the following job opportunity available in Redwood City, CA: Development Architect (VS-CA): Ensure sound design and implementation of big functional areas for Informatica’s core products. Submit resume by mail to: Attn: Global Mobility, Informatica LLC, 2100 Seaport Blvd., Redwood City, CA 94063. Must reference job title and job code: VS-CA.

Stanford music theory for all Stanford music tutorials Vintage Mountain View Gifts

120 Auctions DID YOU KNOW 144 million U.S. Adults read a Newspaper print copy each week? Discover the Power of Newspaper Advertising. For a free brochure call 916-288-6011 or email cecelia@cnpa.com (Cal-SCAN)

133 Music Lessons Christina Conti Piano Private piano lessons for all levels, all ages. In your home or mine. Bachelor of Music, 20+ years exp. 650/493-6950 Hope Street Music Studios Now on Old Middefield Way, MV. Most instruments, voice. All ages and levels 650-961-2192 www.HopeStreetMusicStudios.com

145 Non-Profits Needs DONATE BOOKS/HELP PA LIBRARY

150 Volunteers ASSIST IN FRIENDS BOOKSTORE

Got Knee Pain? Back Pain? Shoulder Pain? Get a painrelieving brace -little or NO cost to you. Medicare Patients Call Health Hotline Now! 1-800-796-5091 (Cal-SCAN)

JOIN OUR ONLINE STOREFRONT TEAM

OXYGEN Anytime. Anywhere! No tanks to refill. No deliveries. The All-New Inogen One G4 is only 2.8 pounds! FAA approved! FREE info kit: 1-844-359-3976. (Cal-SCAN)

245 Miscellaneous

Literature Book Club:

ASST SECTION MGRS FOR FOPAL

Lowest Prices On Health & Dental Insurance. We have the best rates from top companies! Call Now! 888-989-4807. (Cal-SCAN)

WANTED! Old Porsche 356/911/912 for restoration by hobbyist 1948-1973 Only. Any condition, top $ paid! PLEASE LEAVE MESSAGE 1-707- 965-9546 (Cal-SCAN)

HUGE USED BOOK/CD/DVD SALE

Got an older car, boat or RV? Do the humane thing. Donate it to the Humane Society. Call 1- 800-743-1482 (Cal-SCAN)

KC BUYS HOUSES FAST - CASH - Any Condition. Family owned & Operated . Same day offer! (951) 805-8661 WWW.KCBUYSHOUSES.COM (Cal-SCAN)

235 Wanted to Buy

FRIENDS OF MENLO PARK LIBRARY FRIENDS OF THE PALO ALTO LIBRARY Stanford Museum Volunteer

For Sale 210 Garage/Estate Sales Menlo Park, 1340 Crane St, Sat July 8, 8am-2pm Mountain View, Xxxxx, Call for time Palo Alto, 50 Embarcadero Road, July 8, 9-3

To place a Classified ad in The Almanac, The Palo Alto Weekly or The Mountain View Voice call 326-8216 or visit us at fogster.com

ENGINEERING Informatica LLC has the following position available in Redwood City, CA: Senior Engineer, Cloud Operations (VN-CA): Participate in the operations automation project. Develop operation harness suite. Submit resume by mail to: Attn: Global Mobility, Informatica LLC. 2100 Seaport Blvd. Redwood City, CA 94063. Must reference job title and job code (VN-CA). ENGINEERING ItsOn, Inc. accptg resumes for Senior Network Security Engineer in Redwood City, CA. Provide dsgn, implmt’n, & spprt of IT & Prdctn Ops ntwrk & security infrastructure. Mail resume: ItsOn, Inc., HR Recruiting, 3 Lagoon Dr, Ste 230, Redwood City, CA 94065. Must Ref. #SNSE-AM. ENGINEERING Highfive Technologies, Inc. is accepting resumes for the position of Device Software Engineer in Redwood City, CA. Design, implement, test and deploy software for audio/video applications written in C and C++. Mail resume to Highfive Technologies, Inc., Staffing Dept., 500 Arguello Street, Suite 200, Redwood City, CA 94063. Must reference Ref. DSE-MT.

Fogster.com is a unique website offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in The Almanac, the Palo Alto Weekly, and the Mountain View Voice.

Engineering Program Manager Resp. for eng’g dvlpmt cycle of co.’s prdcts from initial reqmt setting to release. MS or equiv. deg. in CS, Comp. Eng., EE, Eng. or equiv. field. 2 yrs exp. as Eng Prog Mgr, Prog Mgr, Eng or equiv. 2 yrs concurrent exp. with: Prgrm Mgmt, incl. Agile Scrum methodologies, sprint goals, Scrum tools, such as Version One, JIRA & Microsoft Prjct; Creating & defining PMO methodology & best practices, such as acceptance criteria, entry & exit criteria & milestone tracking; Prep’g & rvw’g Test Plans, envrnmt config., app installations & tst’g schedules, conducting risk-based tst’g & rvws, Build & Release mgmt & defect mgmt; Creating comprehensive Governance roadmap for Prcss, compliance & audits & metrics, implementing Change Ctrl Mgmt for s/w releases w/ tools like SVN & Bugzilla; Forex Mrkts, foreign exchng principles & FIX (Finc’l Info. eXchange) protocols; Wrkg w/ RDBMS: Oracle 9i, SQL Srvrs & UI Dsgn lang. such as HTML, DHTML, XML & JavaScript; Web Srvrs such as IIS & NT; Rprt’g tools such as Oracle Rprts, JIRA/Version One, Data Rprts & Salesforce. Jobsite: Palo Alto, CA. Mail resume: Position VC072017 Integral Development Corp., 850 Hansen Way, Palo Alto CA 94304 Newspaper Delivery Routes Available Deliver the award-winning Palo Alto Weekly to curbside racks and local businesses every Friday morning. Routes pay approx. $80 each. Own vehicle, driver’s license, insurance and familiarity with the Palo Alto area are required. Email circulation@embarcaderopublishing.com for more details. SCIENCE DNAnexus, Inc. has job opp. in Mountain View, CA: Genomic Scientist. Dvlp & implmt data analysis systms for genomics data. Mail resumes refernc – Req. #GNM17 to: Attn: K. Green, 1975 W El Camino Real, Ste 101, Mountain View, CA 94040. Software Engineer Software Engineer – Programmable Voice, Twilio, Inc.; BS in Computer Science or related + 2 yrs exp as a Software Engineer or related. Worksite is 399 W El Camino Real, Mountain View, CA 94040. Resume to HR at 375 Beale St., Suite 300, San Francisco, CA, 94105. Reference Job #333

Business Services

Silvia’s Cleaning We don’t cut corners, we clean them! Bonded, insured, 22 yrs. exp., service guaranteed, excel. refs., free est. 415/860-6988

748 Gardening/ Landscaping LANDA’S GARDENING & LANDSCAPING *Yard Maint. *New Lawns. *Clean Ups *Irrigation timer programming. 20 yrs exp. Ramon, 650/576-6242 landaramon@yahoo.com

751 General Contracting A NOTICE TO READERS: It is illegal for an unlicensed person to perform contracting work on any project valued at $500.00 or more in labor and materials. State law also requires that contractors include their license numbers on all advertising. Check your contractor’s status at www.cslb.ca.gov or 800-321-CSLB (2752). Unlicensed persons taking jobs that total less than $500.00 must state in their advertisements that they are not licensed by the Contractors State License Board.

771 Painting/ Wallpaper STYLE PAINTING Full service interior/ext. Insured. Lic. 903303. 650/388-8577

775 Asphalt/ Concrete Roe General Engineering Asphalt, concrete, pavers, tiles, sealing, artificial turf. 36 yrs exp. No job too small. Lic #663703. 650/814-5572

Real Estate 801 Apartments/ Condos/Studios Menlo Park 1B/Near Dwtn $2000 Per Month. Includes Utils, frplc, gar.,sm patio. 1BR/1BA. Call 650 322-2814. San Carlos, 1 BR/1 BA - $2,200.00

805 Homes for Rent

624 Financial

Menlo Park, 2 BR/1 BA - $3750

Do you owe over $10,000 To the IRS or State in back taxes? Our firm works to reduce the tax bill or zero it out completely FAST. Call now 855-993-5796. (Cal-SCAN)

809 Shared Housing/ Rooms

Home Services 715 Cleaning Services Isabel and Elbi’s Housecleaning Apartments and homes. Excellent references. Great rates. 650/670-7287 or 650/771-8281 Orkopina Housecleaning Cleaning homes in your area since 1985. Last minute calls! 650/962-1536

FOGSTER.COM

Place an ad or for more info

Redwood City, 1 BR/2 BA - 1200.00

810 Cottages for Rent Los Altos Hills, 1 BR/1 BA - $2850/mo

845 Out of Area NORTHERN AZ WILDERNESS RANCH $197 MONTH - Quiet secluded 37 acre off grid ranch set amid scenic mountains and valleys at clear 6,200’. Near historic pioneer town & large fishing lake. No urban noise & dark sky nights amid pure air & AZ’s best year-round climate. Evergreen trees /meadowland blend with sweeping views across uninhabited wilderness mountains and valleys. Self-sufficiency quality garden loam soil, abundant groundwater & maintained road access. Camping & RV’s ok. No homeowner’s Assoc. or deed restrictions. $22,900, $2,290 dn. Free brochure with additional property descriptions, photos/ terrain map/ weather chart/area info: 1st United Realty 800.966.6690. (Cal-SCAN)

GO TO FOGSTER.COM TO RESPOND TO ADS WITHOUT PHONE NUMBERS July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

19


MARKETPLACE the printed version of

fogster.com

TM

THE PENINSULA’S FREE CLASSIFIEDS WEBSITE TO RESPOND TO ADS WITHOUT PHONE NUMBERS GO TO WWW.FOGSTER.COM

Public Notices 995 Fictitious Name Statement EUROPEAN WAX CENTER FICTITIOUS BUSINESS NAME STATEMENT File No.: FBN630604 The following person (persons) is (are) doing business as: European Wax Center, located at 1039-L El Monte Avenue, Mountain View, CA 94040, Santa Clara County. This business is owned by: A Corporation. The name and residence address of the registrant(s) is(are): TCT VENTURES INC. 303 Sacramento Street, 3rd. Floor San Francisco, CA 94111 Registrant began transacting business under the fictitious business name(s) listed above on 06/11/2012. This statement was filed with the County Clerk-Recorder of Santa Clara County on June 5, 2017. (MVV June 16, 23, 30, July 7, 2017)

SING-ALONG STORY TIME FICTITIOUS BUSINESS NAME STATEMENT File No.: FBN630731 The following person (persons) is (are) doing business as: Sing-Along Story Time, located at 23 Mercy St., Apt. 7, Mountain View, CA 94041, Santa Clara County. This business is owned by: An Individual. The name and residence address of the registrant(s) is(are): KRISTEN NOELLE CASTANEDA WAPLES 23 Mercy St. Apt. 7 Mountain View, CA 94041 Registrant began transacting business under the fictitious business name(s) listed above on 05/01/2017. This statement was filed with the County Clerk-Recorder of Santa Clara County on June 8, 2017. (MVV June 16, 23, 30, July 7, 2017) WE HANDLE ALL YOUR LEGAL PUBLISHING NEEDS࠮7\ISPJ/LHYPUN5V[PJL࠮9LZVS\[PVUZ࠮ )PK5V[PJLZ࠮5V[PJLZVM7L[P[PVU[V(KTPUPZ[LY ,Z[H[L࠮3PLU:HSL࠮;Y\Z[LL»Z:HSL;OL4V\U[HPU =PL^=VPJL

KELLY’S HEALING MASSAGE FICTITIOUS BUSINESS NAME STATEMENT File No.: FBN630873 The following person (persons) is (are) doing business as: Kelly’s Healing Massage, located at 714 Villa St., Mountain View, CA 94041, Santa Clara County. This business is owned by: Married Couple. The name and residence address of the registrant(s) is(are): HUBERT C. GOTUACO 60 Wilson Way Spc. 23 Milpitas, CA 95035 ZHIXING T. GOTUACO 60 Wilson Way Spc. 23 Milpitas, CA 95035 Registrant began transacting business under the fictitious business name(s) listed above on 05/09/2016. This statement was filed with the County Clerk-Recorder of Santa Clara County on June 12, 2017. (MVV June 23, 30, July 7, 14, 2017)

Do You Know? • The Mountain View Voice is adjudicated to publish in the County of Santa Clara. • Our adjudication includes the Mid-Peninsula communities of Palo Alto, Stanford, Los Altos and Mountain View. • The Mountain View Voice publishes every Friday.

Deadline: 5 p.m. the previous Friday To assist you with your legal advertising needs Call Alicia Santillan (650) 223-6578 or email: asantillan@paweekly.com

WE MEASURE QUALITY BY RESULTS Is Quality Important to You?

r of Powe

Two!

Yvonne Heyl

Direct (650) 947-4694 Cell (650) 302-4055 yheyl@interorealestate.com BRE# 01255661

Jeff Gonzalez

THE PENINSULA’S FREE CLASSIFIEDS WEB SITE

Direct (650) 947-4698 Cell (408) 888-7748 jgonzalez@interorealestate.com BRE# 00978793

COMBINING THE REACH OF THE WEB WITH PRINT ADS REACHING OVER 150,000 READERS!

THINK GLOBALLY, SHOP LOCALLY

496 First St. Suite 200 Los Altos 94022

YvonneandJeff@InteroRealEstate.com www.yvonneandjeff.com

YO U R S U C C E S S I S O U R B U S I N E S S !

a one-line free print ad in our Peninsula newspapers with the option of photos and additional lines. So, the next time you have an item to sell, barter, give away or buy, get the perfect combination: print ads in your local newspapers, reaching more than 150,000 readers and unlimited free web postings reaching hundreds of thousands additional people!

ONLINE

fogster.com 20

E-MAIL

ads@fogster.com

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

PHONE

650/326-8216

ALICE NUZZO

(650) 504-0880 alice@serenogroup.com CalBRE # 00458678

ALICIA NUZZO

(650) 504-2394 alicia@serenogroup.com CalBRE # 01127187

CERTIFIED RESIDENTIAL SPECIALISTS

(except for employment and business ads) free of charge online. You automatically get

CERTIFIED RESIDENTIAL BROKERS

Now you can log on to Fogster.com, day or night, and get your ad started immediately


2 1 4 G L A DY S AV E N U E # A & # B , M O U N TA I N V I E W

TWO UPDATED HOMES ON ONE LOT CLOSE TO DOWNTOWN A unique oppor tunity to own two homes in the hear t of Silicon Valley, across the street from Google daycare and Slater Elementary (re-opening in 2019), close to transit at Whisman Station, and just one mile from downtown Mountain View. Residence A has 3 bedrooms and 2 bathrooms and features an updated chef ’s kitchen. Residence B, ideal as a rental proper ty or guest cottage, has 2 bedrooms, 2 bonus rooms, and 1 bathroom, plus a full-sized kitchen and laundry room. Each home also has its own private, fully-fenced outdoor space. Truly a rare oppor tunity! OFFERED AT $1,699,000 WWW.214GLADYS.COM

214 GLADYS AVENUE #A

214 GLADYS AVENUE #B

3 bedrooms and 2 bathrooms

Approximately 1,189 square feet of living space

2 bedrooms, 1 bath, plus 2 bonus rooms

Paneled front door opens to living room with gleaming hardwood floors and woodburning fireplace with tiled surround

Approximately 900 square feet of living space

Dining area has recessed lighting, a lighted ceiling fan, and hardwood floor

Tiled foyer opens to freshly painted living room with laminate wood flooring, lighted ceiling fan, and large front-facing window

Remodeled chef ’s kitchen features hardwood floors, maple cabinetr y, granite counter tops, and a built-in workstation

Kitchen with white cabinetr y, black granite counter tops, and vinyl flooring

Appliances include GE 5-burner gas range and a Kenmore refrigerator

Appliances include: Thermador 4-burner gas range, Panasonic microwave, Bosch dishwasher, and Amana refrigerator

Two bedrooms each feature laminate wood flooring, center light, and wardrobe closet

Master bedroom suite has new carpeting, a center light, a wall of closets plus a walk-in closet, and a sliding glass door that opens to the side yard; en suite bath is tiled with a glass-enclosed shower

Additional bedroom/office has its own exterior entrance and a lighted ceiling fan

Flexible-use room is located between the living room and bedroom 3

Full bathroom has a single-sink vanity and tub with overhead shower

Laundry room with washer and dryer

Fully-fenced rear yard features a paved patio and large shed

Electronic gated driveway has parking for 4 vehicles

DIANE SCHMITZ (650) 947-2955 CalBRE # 01235034

Two additional bedrooms, each with new carpeting, center light, and wardrobe closet, are served by tiled hallway bath with tub and overhead shower

Attached 1-car garage with laundry hook-ups

Paved and privately fenced patio

CR AIG GORMAN (408) 313-8411 CalBRE # 01080717

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

21


20545 BEGGS ROAD

Los Gatos

Hope you had a great 4th of July! Now claim your own Independence with Real Estate.

A Dream Home that balances the demands of work and provides the serenity of nature and family! Stunning home with mountain views and tech upgrades, minutes from downtown Los Gatos.

6 Bedrooms, 4.5 Bathrooms, with 7,561 Square Feet of Living Space Q 2.21 Acre Lot with an Amazing View! Q Built in 2007- 10 Years Young! Q Dual Living Rooms and Family Rooms Q Massive Open Floor-plan from the Family Rooms, Kitchen and Dining Rooms Surrounded by Views of the Redwood Forest Q

3 Bedrooms All on the Same Level for Coziness Q Basement Houses an In-law Suite at 2,488 Square Feet with a Bedroom, Bathroom, Living and Bonus Rooms! Q Seconds to the Main Road, 5 minutes to Highway 17 and just 12 minutes to Downtown Los Gatos Q

Whether buying or selling, calling me is your move in the right direction

Tori Ann Atwell Broker Associate Alain Pinel Realtors

T ORI ANN ATWELL

(650) 996-0123

Cell:Â (408) 313-4352

BRE #00927794

www.ToriSellsRealEstate.com

www.alanwangrealty.com | CalBRE #01380385

Dream Vacation Home at an Affordable Price

New Listing Do you want to have a vacation dream spot on Pelican Point in Pajaro Dunes right on the sand? This is a 1/5 fractional sale with 4 other partners. This is a CA, General Partnership for only $275,000 where you can go almost 3 months of the year hassle free. 7KLV EHDXWLIXO  EHGURRP  EDWK JURXQG ñRRU FRQGRPLQLXP is fully furnished and has all your necessities like kitchenware DQGOLQHQVLQFOXGHG%HDXWLIXOñDWVFUHHQWHOHYLVLRQVDQGDSDWLR to BBQ or listen and watch the white-water waves crash right from the living area. This is just a small part of this wonderful YDFDWLRQVSRWDQGWKHDPHQLWLHVWKDWWKLVKDVWRRσHU Call Faith Sackett for more details. 22

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

Faith Sackett Realtor BRE # 01502244

Cell: (831) 251-1557 Direct: (831) 465-7015 Fax: (831) 464-0565 e-mail: Faith.sackett@cbnorcal.com www.faithsackett.cbintouch.com


Your home is where our heart is

THE

TROYER GROUP

1971 W Middlefield Rd #10 MOUNTAIN VIEW

BRIGHT END-UNIT TOWNHOME WITH MEDITERRANEAN STYLE EXTENDED HOURS: FRIDAY, 9:30AM – 5:00PM SATURDAY & SUNDAY, 1:00 – 5:00PM 3 BEDS

2.5 BATHS

EXPANSIVE BALCONY

HARDWOOD FLOORS

REAR DECK & YARD

GRANITE-APPOINTED CHEF’S KITCHEN

2-CAR GARAGE

ONE BLOCK TO SHOPPING & DINING

1971WMIDDLEFIELD10.COM

DAVID TROYER

GAS FIREPLACE WITH CRUSHED GLASS EXCELLENT MOUNTAIN VIEW SCHOOLS

$1,398,000

CalBRE# 01234450

650.440.5076 | DAVID@DAVIDTROYER.COM | DAVIDTROYER.COM

A Berkshire Hathaway Affiliate

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q

23


Open Saturday / Sunday

Remodeled Cul-de-Sac Home in Sought-After Waverly Park Privately located at the end of a cul-de-sac, this Monterey Colonial has been extensively remodeled and expanded to offer incredible space with resort-like grounds in sought-after Waverly Park. Thoughtfully re-constructed and unified by behind-the-scenes media wiring and solar-powered electricity, this home exemplifies casual everyday living boosted by modern day engineering. Public rooms include a living room with stacked stone fireplace, elegant dining room, and inviting family room, all catered by a richly appointed gourmet kitchen. The home has 5 bedrooms, an office, and 5 full baths, including a main-level bedroom ideal for guests and an expansive upstairs master suite. The lower level, with 9-foot ceilings and abundant natural light, is designed for recreation and play with integrated media, a full bar, and temperature-controlled wine cellar. Outside, the gorgeous rear yard awaits entertaining with a pool, spa, fire pit, and tremendous pergola-covered outdoor kitchen. Just blocks away from Cooper and Cuesta Parks, a quick drive via Highways 237 and 85 to all of Silicon Valley, plus access to excellent Mountain View schools – this home has it all!

Offered at $3,250,000

Jim Nappo

Alain Pinel Realtors – Los Altos

Cell - 650-906-5775 email: jim@nappo.com website: www.nappo.com 24

Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017

Jimmy Nappo

Alain Pinel Realtors – Los Altos

Cell - 650-861-7661 email: jimmy@nappo.com website: www.nappo.com

Mountain View Voice July 7, 2017  
Read more
Read more
Similar to
Popular now
Just for you