Page 1

131724_Covers_Quark_2016.qxp_Cover 6/21/17 11:45 AM Page 1

Morris College

MORRIS COLLEGE

2017-2018 CATALOG

2017-2018 CATALOG


  8

2BDD<>G =B@@F1FG DF>FD%F>G A:FG D<1:AG ABG 6:C?1FG DB1DC9>7G 6B8D>F>7G C?5G 8,@<>:F5 6C@F?5CD>G C?5G ABG <?>A<A8AFG ?F.G DF 8<DF9F?A>G <?6@85<?1G 0FF>G .:F?G 6:C?1F>G C?5 C55<A<B?>G ,F6B9FG ?F6F>>CD4EG %FD4G F00BDAG .<@@G ,FG 9C5FG ABG 9<?<9< FG A:FG <?6B?%FG ?<F?6FG>86:G6:C?1F>G9<1:AG6DFCAFG0BDG>A85F?A>E

&8,@<>:F5G,4G2BDD<>G=B@@F1F #--G*F>AG=B@@F1FG;ADFFA7G ;89AFD7G;B8A:G=CDB@<?CG #"F@F:B?FG-'G'' -CG-'G'' ...E9BDD<>EF58


2016 - 2017 Board of Trustees Dr. Charles B. Jackson, Sr., Chairman ..............................................................Columbia, SC Dr. Mack T. Hines, Vice Chairman .................................................................... Florence, SC Dr. James Blassingame, Secretary ......................................................................... Sumter, SC Dr. Ronald Barton ................................................................................................ Mauldin, SC Dr. Jacqueline W. Canty ..................................................................................... Florence, SC Dr. James L. Carter .......................................................................................... Baltimore, MD Dr. James H. Cokley ............................................................................................ Conway, SC Mr. Jerry Earl ......................................................................................................... Pelzer, SC Rev. Ricky Ezell ................................................................................................Columbia, SC ++ Dr. Juana Davis-Freeman. ................................................................................ Sumter, SC Rev. Norman Gamble ......................................................................................... Florence, SC Rev. Tommy Gibson ........................................................................................... Eastover, SC Rev. Jamey O. Graham ......................................................................................Columbia, SC Dr. Donald Greene ......................................................................................... Orangeburg, SC Dr. Isaac Holt, Jr. ............................................................................................. Charleston, SC Dr. Solomon Jackson, Jr. ...................................................................................Columbia, SC +++Ms. Taylor Jenkins .......................................................................................... Sumter, SC Dr. Clifford Jones............................................................................................... Charlotte, NC Mrs. Keshia Howard-McCleave ........................................................................ Rock Hill, SC Dr. Milton R. Key .............................................................................................. Gastonia, NC Atty. Thomas B. Levy........................................................................................Columbia, SC Dr. Waymon Mumford ....................................................................................... Florence, SC Dr. Audrey Potts Neal ........................................................................................Columbia, SC Dr. Marion H. Newton ........................................................................................... Sumter, SC Dr. Emma Owens ................................................................................................. Mauldin, SC Dr. Toney C. Parks........................................................................................... Greenville, SC +Mrs. Ruth M. Pendergrass .................................................................................. Atlanta, GA *Dr. Henry B. Peoples ........................................................................................ Florence, SC Rev. McKinley Ravenell .................................................................................. Eutawville, SC Dr. Leo Richardson ............................................................................................Columbia, SC Dr. Luns C. Richardson ......................................................................................... Sumter, SC Mrs. Patricia Threatt ........................................................................................... Pageland, SC Rev. George P. Windley, Jr. .................................................................................. Sumter, SC **Dr. W. E. Givens, Jr., .................................................................................. Charleston, SC + Alumni ++ Faculty/Staff +++Student *Completing term of Dr. William A. Salley

**Emeritus

2


MORRIS COLLEGE CATALOG

 2 ++ ;GB8DG6B@@F1FG5FCD *<A:G:FCDA>GC@@G0<@@F5G.<A:G6:FFD *FG6B9FGABGA:FF ":DB81:B8AG@<0F>G6:F6)FDF5G.C4> ":4G?C9FG.F@@GF%FDGDC<>F "FC6:FDGB0G4B8A:08@G.C4> !@@G:C<@GABGA:FFE *:F?G0DB9GB8DG:B9F>G.FG6C9F "BGB.?GA:4G@B0A4G?C9F $DFCA:FG6B8DC1FG0DFFE &CDF?A>GC?5GAFC6:FD>G5FCD =C@9F5G,4GA:FG@C6)GB0G0FCD &C4G:B9C1FGA:DB81:GA:FG4FCD> !@@G:C<@GABGA:FFE =B9B>F5G,4G2>EG 5CGEG&8@@F?>7G#  =B@@F1FG2BAAB        

3


 $&,.%,4%$& .,$%4$&4.4(,"%,( 1EFFIDL2EAAK;KLBE<7AIKDL?@AA=LIG>LJAALJ77AIBJ5AKL?KCKFJALAJDLJHCLFK;@AJ9 GIEHDL 7KFGJIHIH;L GEL IGDL DG@CKHGD&L 7FE;FJ<D&L JHCL JBGI(IGIKD4L 0>KDKL AJDL JHC FK;@AJGIEHDLIHBA@CKLG>KL?EAAEIH; 0IGAKL*LE?LG>KLHIGKCL8GJGKDL2ECKLFK;JFCIH;LKGKFJHD LKHK?IGD4 0IGAKDL+LJHCL++LE?LG>KL2I(IAL.I;>GDL:BGLE?L6)!LJHCL8KBGIEHL$-6B* JHCL8KBGIEHL6-L56J3LE?LG>KL+HGKFHJAL.K(KH@KL2ECK&L7FE>I5IGIH; CIDBFI<IHJGIEHLEHLG>KL5JDIDLE?LFJBK&LBEAEF&LJHCLHJGIEHJALEFLKG>HIBLEFI;IH4 0IGAKL+ LE?LG>KL,C@BJGIEHL:<KHC<KHGDLE?L6)3L "L)39*6&LJDLJ<KHC9 KC&L7FE>I5IGIH;LCIDBFI<IHJGIEHLEHLG>KL5JDIDLE?LDK4L0>KL2EAAK;K DL0IGAKL+

2E<7AIJHBKL '??IBKFL IDL .E=L FJ>J<4L 1F4L FJ>J< DL E??IBKL IDL AEBJGKCL IH G>KL IHDEHL:C<IHIDGFJGIEHL@IACIH;&LJHCL>IDLGKAK7>EHKLH@<5KFLIDL-* )*!9*3)4 8KBGIEHL$-!LE?LG>KL.K>J5IAIGJGIEHL:BGLE?L6)*L "L)*9663&LJDLJ<KHC9 KC&L7FE>I5IGIH;LCIDBFI<IHJGIEHLEHLG>KL5JDIDLE?L>JHCIBJ7LIHLJAAL7FE;FJ<D JHCLJBGI(IGIKDLJHCLFK@IFIH;LJBBKDDI5IAIG=L?EFL>JHCIBJ77KCL7KFDEHD4 /J<IA=L ,C@BJGIEHJAL .I;>GDL JHCL FI(JB=L :BGL E?L 6)!L  "L )*9*-&L JD J<KHCKCL "L)*9$&LJADELHEHLJDLG>KL@BAK=L:<KHC<KHG&LL7FE9 (ICIH;L;FKJGKFL7FI(JB=LDJ?K;@JFCDLGEL7JFKHGDLJHCLDG@CKHGDLG>FE@;>LG>K J77AIBJGIEHLE?L?JIFLIH?EF<JGIEHL7FJBGIBKD4 +<<I;FJGIEHL JHCL %JGIEHJAIG=L :BGL  "L 96)$&L 5=L >IB>L G>KL 2EAAK;KL ID J@G>EFI KCL@HCKFL/KCKFJALAJLGELKHFEAALHEHI<<I;FJHGLJAIKHLDG@CKHGD4 0IGAKL +LE?L G>KL 6))3L  I;>KFL,C@BJGIEHL:<KHC<KHGDL5=L>IB>LG>KL2EA9 AK;KL <@DGL BE<7A=L IG>L JAAL FK;@AJGIEHDL E?L G>KL ?KCKFJAL DG@CKHGL AEJHL 7FE9 ;FJ<LJHCLJAALEG>KFL0IGAKL+L7FE;FJ<D4 0>KL KHKGIBL +H?EF<JGIEHL %EHCIDBFI<IHJGIEHL :BGL E?L 3--L +%:L 7FE9 >I5IGDL K<7AE=KFDL ?FE<L CIDBFI<IHJGIH;L J;JIHDGL IHCI(IC@JADL 5JDKCL EHL ;K9 HKGIBLGKDGDLJHCLIH?EF<JGIEH4 1EFFIDL2EAAK;KLFKDKF(KDLG>KLFI;>GLGEL<JKLB>JH;KDLIG>E@GLHEGIBKLEFLE5AI9 ;JGIEHL IHL B@FFIB@AJ&L CK;FKKL FK@IFK<KHGD&L BE@FDKL E??KFIH;D&L ?KKD&L JHCL JAA JBJCK<IBLJHCLHEHJBJCK<IBLFK;@AJGIEHDL>KH&LIHLG>KL@C;<KHGLE?LG>KL?JB@A9 G=&LG>KL7FKDICKHG&LEFLG>KL5EJFCLE?LGF@DGKKD&LD@B>LB>JH;KDLJFKLIHLG>KL5KDGLIH9 GKFKDGLE?LG>KLDG@CKHGDLJHCLG>KL2EAAK;K4 .K;IDGFJGIEHL JGL G>KL 2EAAK;KL JDD@<KDL G>KL DG@CKHG DL JBBK7GJHBKL E?L JAAL 7@5AID>KCL JBJCK<IBL JHCL HEHJBJCK<IBL FK;@AJGIEHD&L IHBA@CIH;L G>EDKL >IB> J77KJFL IHL G>IDL 5@AAKGIHL JHCL EG>KFL E??IBIJAL JHHE@HBK<KHGDL EFL 7@5AIBJGIEHD4 8G@CKHGDLD>E@ACLBEHGJBGLG>KL#KJHLE?L8G@CKHGL:??JIFDLGELE5GJIHLJLBE7=LE?LG>K B@FFKHGLDG@CKHGL>JHC5EE4 8G@CKHGDL D>E@ACL FKGJIHL G>IDL BJGJAE;L G>FE@;>E@GL G>KIFL GKH@FKL JGL G>KL 2EA9 AK;K4L 0>KL BJGJAE;L IAAL 5KL CIDDK<IHJGKCL 5=L G>KL '??IBKL E?L :C<IDDIEHDL JHC .KBEFCD4

4


.++&",.,$%4(,.,(4.%4&$ &. 4.&$.( 4 200*14 +2''334 *14 /##03*-34 4 -34 (2-30)4 .112#*/-*2)4 2 4 +2' '3314/)4(#22'14+2*11*2)42)4+2''3314-24//04 /##/'/03/-3 303314 +2)-/#-4 -34 +2*11*2)4 2)4 +2''3314 /-4 4 (2-30) /)343#/-04 320*/4!!! 4204#/''4! !!4 20431-*2)1 / 2-4-34/##03*-/-*2)42 4 200*14+2''334 %EGKL @5AIBJGIEHL E?L G>KL 2E<<IDDIEH DL JCCFKDDL JHCL BEHGJBGL H@<5KFL ID CKDI;HKCL EHA=L GEL KHJ5AKL IHGKFKDGKCL BEHDGIG@KHGDL 6L GEL AKJFHL J5E@GL G>KL JB9 BFKCIGJGIEHLDGJG@DLE?L1EFFIDL2EAAK;K&L3LGEL?IAKLJLG>IFC97JFG=LBE<<KHGLJGLG>K GI<KLE?LG>KLBEAAK;K DLCKBKHHIJALFK(IK&LEFL*LGEL?IAKLJLBE<7AJIHGLJ;JIHDGLG>K IHDGIG@GIEHL?EFLJAAK;KCLHEH9BE<7AIJHBKLIG>LJLDGJHCJFCLEFLFK@IFK<KHG4L%EF9 <JALIH@IFIKDLJ5E@GLG>KL2EAAK;K&LD@B>LJDLJC<IDDIEHLFK@IFK<KHGD&L?IHJHBIJA JIC&L KC@BJGIEHJAL 7FE;FJ<D&L KGB4&L D>E@ACL 5KL JCCFKDDKCL CIFKBGA=L GEL G>KL 2EA9 AK;KLJHCLHEGLGELG>KL2E<<IDDIEH DLE??IBK4LL 0>KL1EFFIDL2EAAK;KL0KJB>KFL,C@BJGIEHL FE;FJ<LIDLJBBFKCIGKCL5=LG>KL%J9 GIEHJAL2E@HBIAL?EFL:BBFKCIGJGIEHLE?L0KJB>KFL,C@BJGIEHL%2:0,LG>KL2E@H9 BIAL ?EFL G>KL :BBFKCIGJGIEHL E?L ,C@BJGEFL FK7JFJGIEHL 2:, &L JHCL JAAL GKJB>KF KC@BJGIEHL7FE;FJ<LJFKJDLJFKLJ77FE(KCL5=LG>KL8E@G>L2JFEAIHJL8GJGKLEJFC E?L,C@BJGIEH4 2E@FDKDL ?EFL CK;FKKL 7FE;FJ<DL JGL 1EFFIDL 2EAAK;KL JFKL J77FE(KCL 5=L G>K 8E@G>L2JFEAIHJL#K7JFG<KHGLE?L,C@BJGIEHL?EFLG>KLGFJIHIH;LE?L(KGKFJHD4 0>KL CK;FKKL 7FE;FJ<DL IHL @DIHKDDL :C<IHIDGFJGIEHL JHCL 'F;JHI JGIEHJA 1JHJ;K<KHGL JFKL JBBFKCIGKCL 5=L G>KL :BBFKCIGJGIEHL 2E@HBIAL ?EFL @DIHKDD 8B>EEADLJHCL FE;FJ<D4 #EB@<KHGJGIEHL?EFL:BBFKCIGJGIEHL8GJG@DLJHCL FE;FJ<L:77FE(JADL<J=L5K ?E@HCLIHLG>KL'??IBKLE?LG>KL FKDICKHG4 +$%,.+,4%$& .,$% +?L=E@LJFKLFK@KDGIH;L(JFIE@DLIHCDLE?LIH?EF<JGIEHLFK;JFCIH;LG>KLBEAAK;K IGDKA?&L7AKJDKLBJAALG>KLJ77FE7FIJGKLE??IBKLAIDGKCL5KAEL@DIH;LG>KL-*LJFKJ BECK4 '??IBKLE?L:C<IDDIEHDLJHCL.KBEFCD 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*33$ EFLGEAAL?FKKL699$*96*!$ '??IBKLE?L@DIHKDDL:??JIFD 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*33*LEFL*33) '??IBKLE?L/IHJHBIJAL:IC 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*3*LEFL*3!$ '??IBKLE?L:BJCK<IBL:??JIFD 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*36* '??IBKLE?L8G@CKHGL:??JIFD 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*36 '??IBKLE?L8G@CKHGL E@DIH;L 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*6$  KJAG>L8KF(IBKDL'??IBK 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*3$ KFDEHHKAL'??IBK 4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L)*!9*3) E@L<J=LJADELFK@KDGLIH?EF<JGIEHL5=L<JIALJCCFKDDKCLGELG>KLJ77FE7FIJGK E??IBKLJGL1EFFIDL2EAAK;K&L6--LKDGL2EAAK;KL8GFKKG&L8@<GKF&L8E@G>L2JFEAIHJ 3)6$-9*$))4

5


MORRIS COLLEGE CATALOG

,."4$4+$%,"%,( J;K :2:#,1+2L2:",%#:.3-693-6444444444444444444444444444444444444444444444444444449) ,%,.:"L+%/'.1:0+'% 4444444444444444444444444444444444444444444444444444444444444444446696$ :#1+88+'%L2:0,'.+,8&L.,+.,1,%08L:%#L .'2,#.,8 44444444446 93/+%:%2+:"L+%/'.1:0+'% 44444444444444444444444444444444444444444444444444444444444444443693) 80#,%0L://:+.8 4444444444444444444444444444444444444444444444444444444444444444444444444444*-9! ,0,.:%8L://:+.8 44444444444444444444444444444444444444444444444444444444444444444444444444!9!) ,%,.:"L:2:#,1+2L+%/'.1:0+'% 4444444444444444444444444444444444444444444444$-93 8 ,2+:"L .'.:18L:%#L8,.+2,8 44444444444444444444444444444444444444444444*9$ :2:#,1+2L#++8+'%8L:%#L .'.:18 #I(IDIEHLE?LKHKFJAL8G@CIKD 444444444444444444444444444444444444444444444444444444444444449#I(IDIEHLE?L@DIHKDDL:C<IHIDGFJGIEH 4444444444444444444444444444444444444444444444444469 #I(IDIEHLE?L,C@BJGIEH 444444444444444444444444444444444444444444444444444444444444444444444444)9)) #I(IDIEHLE?L%JG@FJAL8BIKHBKDLJHCL1JG>K<JGIBD444444444444444444444444444446--966 #I(IDIEHLE?L.KAI;IEH&L @<JHIGIKD LJHCLLLLLLLLLLLLLLLLLLLLLLLLLLLL444444444444444466)96$$ 8EBIJA 8BIKHBKD L 2'.8,#,82.+ 0+'%8 444444444444444444444444444444444444444444444444444444444444446$93-$ :#1+%+80.:0+,L80:// 4444444444444444444444444444444444444444444444444444444444444443-93- /:2"0 444444444444444444444444444444444444444444444444444444444444444444444444444444444444444443-936:.090+1,L/:2"0 4444444444444444444444444444444444444444444444444444444444444444444443669363 /:2"0 L:%#L80://L,1,.+0+444444444444444444444444444444444444444444444444444444444444363 80:// 4444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444363936$ ,%.'""1,%0 44444444444444444444444444444444444444444444444444444444444444444444444444444444436936) +%#, 444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444433-9336

6


ACADEMIC CALENDAR

ACADEMIC CALENDAR FOR 2017-2018 FALL SEMESTER 2017 August 10-11

Thursday-Friday

Faculty/Staff Institute

August 11

Friday

Student Leadership Retreat

August 12

Saturday

Residence halls open for new students Freshman Orientation begins

August 14 August 15

Monday Tuesday

Freshman Orientation continues Registration for freshmen Residence halls open for continuing and transfer students Clearing of student accounts and issuing of registration permits

August 16

Wednesday

Registration for continuing and transfer students

August 17

Thursday

August 21 September 1 September 4 September 7

Monday Friday Monday Thursday

Fall Semester classes begin Late registration begins Last day to register or add courses Last day to drop a course without penalty Labor Day Holiday Annual Fall Convocation

September 27

Wednesday (Afternoon)

Institutional Service Activities

October 2-5

Monday-Thursday

Mid-semester examinations

October 6

Friday

Mid-semesteUJUDGHVGXHLQ2IĂ&#x20AC;FHRI Admissions and Records

October 10

Tuesday

Graduate and Professional Schools Information Day

October 19

Thursday

Fall Semester Honors Day Convocation

October 23November 3

Monday-Friday

Academic planning, advisement, and pre-registration for Spring Semester

October 25 October 26

High School Visitation Day Institutional Service activities

November 6-10 November 13-17

Wednesday Thursday (Afternoon) Monday-Friday Monday-Friday

November 18

Saturday

Annual Fall Harvest Worship Service/Rally/Parade

November 22 November 27 November 30 December 1 December 3

Wednesday Monday Thursday Friday Sunday

Thanksgiving recess begins at 5:00 p.m Thanksgiving recess ends at 8:00 a.m. Last day of classes for fall semester Posttests for freshmen Annual Christmas Concert

Business Week American Education Week

7


MORRIS COLLEGE CATALOG December 4

Monday

Final examinations begin

December 7

Thursday

Final examinations end Residence halls close

December 12

Tuesday

Fall SemestHUJUDGHVGXHLQ2IÀFHRI Admissions and Records

SPRING SEMESTER 2018 January 2

Tuesday

Faculty and staff return Faculty/Staff Mid-Year Conference Residence halls open for new and continuing students

January 3

Wednesday

Clearing of student accounts and issuing of registration permits

January 4

Thursday

Registration for Spring Semester

January 5

Friday

Classes begin Late registration begins

January 9

Tuesday

Last day to register or add courses

-DQXDU\

7KXUVGD\

3UHVLGHQW·V,QIRUPDWLRQDO6HVVLRQ

January 12

Friday

Last day to drop a course without penalty

January 15

Monday

Martin Luther King, Jr., Birthday

January 21--27

Sunday-Saturday

Homecoming Week

January 24

Wednesday (Afternoon)

Institutional Service activities

January 29February 2

Monday- Friday

African-American History Week

January 31

Wednesday

Middle School Visitation Day

February 6-9

Tuesday-Friday

Science in Action Week

February 15

Thursday

Spring Semester Honors Day Convocation

February 19-23

Tuesday-Friday

Religious Emphasis Week

February 23

Friday

Mid-Winter Banquet and Rally

February 260DUFK·

Monday-Thursday

Mid-semester examinations

March 2)ULGD\

0LGVHPHVWHUJUDGHVGXHLQ2IÀFHRI  Admissions and Records Spring Break begins after 5:00 p.m. classes

March 12

Monday

Spring Break ends at 8:00 a.m.

March 12-23

Monday-Friday

Academic Planning, Advisement, and Pre-Registration for Fall Semester

March 13

Tuesday

Prizes and Awards Night

March 13-16

Tuesday-Friday

Honors Week

March 15-16

Thursday- Friday

Career Fest

March 15

Thursday (Afternoon)

Institutional Service activities

8


ACADEMIC CALENDAR March 19-23

Monday-Friday

Fine Arts Festival

March 29

Thursday

Annual Easter Worship Service

March 30

Friday

Easter recess begins after 5:00 p.m.

April 3

Tuesday

Easter recess ends at 8:00 a.m.

April 24-27

Tuesday-Friday

Final examinations for graduating seniors

April 26

Thursday

Last day of classes for Spring Semester Examinations in selected courses for freshmen

April 27 

Friday 

Final grades for graduating seniors due LQ2IÀFHRI$Gmissions and Records

April 30May 4

Monday-Friday

Senior Week activities

April 30

Monday

Final examinations begin

May 3

Thursday

Final examinations end

May 5

Saturday

Annual Commencement Convocation Residence halls close

May 8 

Tuesday 

Spring Semester grades due in 2IÀFHRIAdmissions and Records Last day of academic year for faculty

2018 SUMMER SESSION June 4 June 5 July 18

Registration Classes Begin Final Examinations

9


MORRIS COLLEGE CATALOG

04)14+4&*#/012) President Emeritus

10


!!)"# MORRIS COLLEGE CATALOG &%)"&% '&*%)8%8%))&*8+%##!! $;FG A6ED@EG =9<AEDCBA>G AB=G &D@@DCBA?1G 0CB2FBEDCBG C:G (C9E;G 0A?C>DBA5 <C86C@F=G C:G ?F6?F@FBEAED2F@G :?C8G A>>G C:G E;FG >A<!G A6ED@EG <;9?<;F@G DBG E;F @EAEF5G /A@G <;A?EF?F=G DBG 3G ECG 6?C8CEFG E;FG <A9@FG C:G 0;?D@E5G F@6F<DA>>1G DB (C9E;G 0A?C>DBAG .1G F@EA.>D@;DB7G AG $;FC>C7D<A>G AB=G DEF?A?1G %B@EDE9EFG :C?G E;F E?ADBDB7GC:G1C9B7G8FBG:C?GE;FG8DBD@E?15GAB=GA>@CG:C?GE;FGF=9<AEDCBGC:GC9?G@CB@ AB=G=A97;EF?@4G%EG/A@BEG9BED>G3-+5G;C/F2F?5GE;AEGE;FG0CB2FBEDCBG/A@GA.>F ECG A< 9D?FG AG @DEFG DBG (98EF?5G (C9E;G 0A?C>DBAG ECG F@EA.>D@;G AG @<;CC>5G /;D<;G DE BA8F=G DBG ;CBC?G C:G E;FG )F24G ?AB!G &C??D@5G AG 6DCBFF?G >FA=F?G C:G E;FG )C<!1 )D2F?G *@@C<DAEDCB4G $;9@G .F7ABG AG ;F?CD<G 2FBE9?FG DBG ;D7;F?G F=9<AEDCBG .1G A 7?C96GC:G8FBGAB=G/C8FBG>F@@GE;ABG;A>:GAG<FBE9?1G?F8C2F=G:?C8GE;FG.>D7;EGC: @>A2F?14G$;F@FG:C9B=F?@G/F?FG6CC?GAB=G/DE;C9EG:C?8A>G>FA?BDB7GE;F8@F>2F@5 .9EGE;F1G6C@@F@@F=GABG9B:A>EF?DB7G:ADE;GDBGC=GAB=GAG FA>GECG6?C2D=FG:C?GCE;, F?@GE;FGF=9<AEDCBA>GC66C?E9BDEDF@GE;F1GE;F8@F>2F@G;A=G.FFBG=FBDF=4 %BG3-33GE;FG0C>>F7FG?F<FD2F=GAG<F?ED:D<AEFGC:GDB<C?6C?AEDCBG:?C8GE;FG@EAEF C:G(C9E;G0A?C>DBA4G%BDEDA>>1GE;FGDB@EDE9EDCBG6?C2D=F=G@<;CC>DB7GAEGE;FGF>F8FB, EA?15G ;D7;G @<;CC>G AB=G <C>>F7FG >F2F>@G /DE;G E;FG <C>>F7FG <9??D<9>98G DB<>9=DB7 >D.F?A>GA?E@G6?C7?A8@5GAG6?C7?A8G:C?GE;FG<F?ED:D<AEDCBGC:GEFA<;F?@5GAB=GAGE;F, C>C7D<A>G6?C7?A84G%BG3-3 GE;FG:D?@EGA<;F>C?GC:G*?E@G=F7?FF@G/F?FGA/A?=F= ECGE/CG7?A=9AEF@4GG %BG3-+GE;FGF>F8FBEA?1G@<;CC>G/A@G=D@<CBEDB9F=5GAB=GE;FGDB@EDE9EDCBG<CB, 2F?EF=G:?C8GAG:C9?,1FA?G<C>>F7FGECGAGE/C,1FA?G9BDC?G<C>>F7F5G.9EGDBG3-GDE ?F@98F=GDE@G@EAE9@GA@GAG:C9?,1FA?G<C>>F7F4G%BG3-GE;FG;D7;G@<;CC>G/A@G=D@, <CBEDB9F=4G%BG3-G'?4G"=F>>G)4G)F9.FBG.F7ABGAGE/FBE1,E/C,1FA?GEF?8GA@ #?F@D=FBE5G=9?DB7G/;D<;GE;FG0C>>F7FGF6F?DFB<F=G@D7BD:D<ABEG7?C/E;GDBG6?C, 7?A8@5GFB?C>>8FBEGAB=G:A<D>DEDF@4G"BFGA@6F<EGC:GE;D@G7?C/E;G/A@GE;FGF@EA., >D@;8FBEGDBG3-GC:GE;FG&C??D@G0C>>F7FG(<;CC>GC:G)F>D7DCB5G/;D<;GC6F?AEF= 9BED>G3--G/;FBGDE@G6?C7?A8GECGE?ADBG8DBD@EF?@GAB=G0;?D@EDABGF=9<AEC?@G/A@ E?AB@:F??F=GECGE;FG0C>>F7FGDE@F>:4G%BG3-3GE;FG<F?ED:D<AEFGC:GDB<C?6C?AEDCBG/A@ A8FB=F=GECG=F>FEFGE;FG/C?=GF7?C5GE;F?F.1GC6FBDB7GE;FG=CC?@GAEG&C??D@ ECG@E9=FBE@GC:GA>>GFE;BD<G7?C96@4 %BG 3-G '?4G 9B@G 04G )D<;A?=@CBG .F<A8FG #?F@D=FBEG AB=G DBDEDAEF=G E;F >CB7F@EG EF?8G C:G @F?2D<FG C:G AB1G C:G E;FG 0C>>F7F@G #?F@D=FBE@4G '9?DB7G ;D@ EFB9?FG DBG 3-5G &C??D@G 0C>>F7FG A<;DF2F=G E;FG 7CA>G C:G A<<?F=DEAEDCBG .1G E;F (C9E;F?BG*@@C<DAEDCBGC:G0C>>F7F@GAB=G(<;CC>@G0C88D@@DCBGCBG0C>>F7F@GEC A/A?=G .A<<A>A9?FAEFG =F7?FF@4G %BG 3-G E;FG 0C>>F7FG .F<A8FG AG 8F8.F?G C: $;FG 0C>>F7FG 9B=05G E;FG BAEDCB@G >A?7F@EG AB=G 8C@EG @9<<F@@:9>G .>A<! :9B=,?AD@DB7GC?7ABD AEDCB4 *<<?F=DEAEDCBG AB=G 0G 8F8.F?@;D6G >A9B<;F=G E;FG 0C>>F7FG DBECG ABG F?A C:G?F8A?!A.>FG7?C/E;GAB=G=F2F>C68FBEG=9?DB7GE;FG3-+@GAB=G3--+@4G'9?, DB7GE;D@G6F?DC=5GE;FG0C>>F7FG.9D>EGC?G?FBC2AEF=G8C?FG@ 9A?FG:FFEGC:G.9D>=DB7 @6A<FGE;ABG;A=G.FFBGF@EA.>D@;F=G=9?DB7GE;FGFBED?FG:D?@EG@F2FBE1G1FA?@GC:GDE@ ;D@EC?14G *8CB7G E;FG BF/G :A<D>DEDF@G /F?FG AG FA?BDB7G )F@C9?<F@G 0FBEF?5G A DBFG *?E@G 0FBEF?5G AG 98ABG 'F2F>C68FBEG 0FBEF?5G AG 0;A6F>G AB=G )F>D7DC9@ 0FBEF?5GAB=GE;FG0C>>F7F@G:D?@EG:9>>,@<A>FG(E9=FBEG0FBEF?4G(C8FGC:GE;D@GBF/ <CB@E?9<EDCBGAB=G?FBC2AEDCBG/A@GAG?F@6CB@FGECGE;FGEF??D.>FG=F@E?9<EDCBGE;AE 11


MORRIS COLLEGE CATALOG E;FG0C>>F7FG@9::F?F=GDBG3--GA@GAG?F@9>EGC:G9??D<ABFG97C4G%BG@6DEFGC:GE;F /D=F@6?FA=G =A8A7F5G E;FG 0C>>F7FG /A@G A.>FG ECG ?FC6FBG /DE;DBG AG :F/G =A1@ AB=GA>>G@E9=FBE@G/F?FGA.>FGECG<C86>FEFGE;FD?G/C?!G/DE;C9EGAG>C@@GC:G<?F=DE@4 $;FG 7?C/E;G 1FA?@G C:G E;FG 3-+@G AB=G 3--+@G /F?FG A>@CG A<<C86ABDF=G .1 E;FGDBDEDAEDCBGC:GBF/GA<A=F8D<G6?C7?A8@GDB<>9=DB7G?CA=<A@EG&F=DA5G0;?D@, EDABG=9<AEDCB5G0?D8DBA>G9@ED<F5G#A@EC?A>G&DBD@E?15GAB=G)F<?FAEDCBG*=8DB, D@E?AEDCBGAB=GE;FGDBDEDAEDCBGC:GABG)"$0G#?C7?A84G%BG3--GE;FG0C>>F7FGDBE?C, =9<F=G AG @9<<F@@:9>G BF/G 6?C7?A8G DBG "?7ABD AEDCBA>G &ABA7F8FBEG /;D<;G D@ C::F?F=G=9?DB7GF2FBDB7GAB=G/FF!FB=G;C9?@GECGC>=F?G@E9=FBE@G/DE;G:9>>,ED8F C.@G/;CG/D@;GECG?F@98FGE;FD?GFA?>DF?G<C>>F7FG<A?FF?@GAB=G<C86>FEFGAG<C>, >F7FG =F7?FF4G $;FG F?AG C:G E;FG 3--+@G /A@G A>@CG 8A?!F=G .1G AG @9.@EABEDA>G F, 6AB@DCBGC:GBF/GEF<;BC>C7DF@GCBGE;FG<A869@G/DE;GE;FGF@EA.>D@;8FBEGC?GF, 6AB@DCBG C:G :D2FG <C869EF?G >A.C?AEC?DF@G AB=G E;FG <A6A<DE1G ECG A>>C/G F2F?1 @E9=FBEGECG;A2FGA<<F@@GECGE;FG%BEF?BFE4 %BG+3+GE;FG0C>>F7FGF8.A?!F=GCBGAGBF/GF?AGC:GF6AB@DCBGA@GE;FG?F@9>EGC: AG7D:EGC:G3+5+++5+++G:?C8G$;FG)F24G(C>C8CBGA<!@CB5G?45GAG@E9=FBEGDBGE;F (<;CC>GC:G)F>D7DCB4G9B=@G:?C8GE;D@G7D:EG/F?FG9@F=GECG<CB@E?9<EGAGBF/G8ADB, EFBAB<FG.9D>=DB75GAGBF/G@E9=FBEG;FA>E;GAB=G/F>>BF@@G<FBEF?5GAB=GE/CGBF/ ?F@D=FB<FG ;A>>@G AB=G ECG F6AB=G E;FG FB=C/8FBE4G *==DEDCBA>G :9B=@G :?C8G E;D@ 7D:EG/D>>G.FG9@F=GECG<CB@E?9<EGAGBF/GA=8DBD@E?AED2FG<FBEF?4 &C??D@G0C>>F7FG;A@G8C?FGE;ABG9@ED:DF=GE;FG:ADE;5GE;FG>A.C?@5GAB=GE;FG@A<?D, :D<F@GC:GDE@G:C9B=F?@ GAB=GE;FG@F?2D<F@GE;AEGDEG;A@G?FB=F?F=G;A2FG.FFBGFEFB, @D2FGAB=G.F1CB=G2A>9F4G?C8GDE@G.F7DBBDB75GE;FG0C>>F7FG ;A@G.FFBGAG<FBEF? :C?G E?ADBDB7G 8DBD@EF?@G AB=G EFA<;F?@G :C?G E;FG 69>6DE@G AB=G @<;CC>@G C:G E;FG @EAEF AB=GC:GE;FGBAEDCB5GAB=GDE@G7?A=9AEF@G;A2FGA==F=GECGE;FG?AB!@GC:G6?C:F@@DCB, A>@GAB=G.9@DBF@@G6F?@CB@4G9B=?F=@GC:G*:?D<AB,*8F?D<ABG1C9E;G/;CG/C9>= CE;F?/D@FG;A2FGBF2F?GAEEFB=F=G<C>>F7FG;A2FG?F<FD2F=GAEG&C??D@G0C>>F7FGE;F .FBF:DE@G C:G ;D7;F?G F=9<AEDCB4G &AB1G <C889BDEDF@G AB=G @EAEFG A7FB<DF@G ;A2F 9@F=G E;FG :A<D>DEDF@ G C:G E;FG 0C>>F7FG ECG <A??1G C9EG 6?C7?A8@G C:G 7FBF?A>G /F>:A?F AB=G C:G @C<DA>G 96>D:E4G &C??D@G 0C>>F7FG E;9@G C<<96DF@G AG 9BD 9FG AB=G @D7BD:D<ABE 6C@DEDCBGDBGE;FG*8F?D<ABG@C<DA>GC?=F?GA@GCBFGC:GE;FG:F/G@FBDC?G<C>>F7F@G.9D>E AB=G C6F?AEF=G @C>F>1G 9B=F?G E;FG A9@6D<F@G C:G *:?D<AB,*8F?D<AB@4G *@G @9<;5G DE ?F6?F@FBE@GAG=D@EDB<EG<CBE?D.9EDCBGECG*8F?D<ABGF=9<AEDCBGAB=G@C<DFE14 )!*&!*8%8'!8+%##!! $;FG:C>>C/DB7G6?F@D=FBE@G;A2FG@F?2F=GE;FG0C>>F7FG@DB<FGDE@G:C9B=DB7 '?4G=/A?=G&4G?A/>F15G3-+,3-3 '?4GC;BG4G(EA?!@5G3-3,3-+ '?4G%?AG'A2D=G#DB@CB5G3-+,3-'?4GA8F@G#4GA??D<!5G3--,3- '?4GFB?1G4G9E>F?5G3-,3- '?4GF::G 4GC1!DB5G3-G *<EDB7G#?F@D=FBE '?4G"=F>>G)4G)F9.FB5G3-,3-+ %BEF?D8G0C88DEEFFG'?4GFB?1G4GA?=DB5G0;AD?8AB '?4G 4G4G D>@CB5G'?4G 4G4GFA>5G'?4G4G4G?CC!@GAB= '?4G*BBAG'4G)F9.FB5G3-+,3-3 '?4GFB?1G4GA?=DB5G3-3,3-G *<EDB7G#?F@D=FBE '?4GFB?1G4GA?=DB5G3-,3-

12


GENERAL INFORMATION %BEF?D8G0C88DEEFFG'?4G4G 4G$A1>C?5G0;AD?8AB '?4G4G4G?CC!@5G)F24G)4G 4G(EA>>DB7@5G3-,3- '?4G9B@G04G)D<;A?=@CB5G3-,+3 &**&%8*"!!8%8%))&*8+%##!! &C??D@G0C>>F7FG/A@G:C9B=F=GDBG3-+G.1GE;FGA6ED@EG=9<AEDCBA>GAB=G&D@, @DCBA?1G 0CB2FBEDCBG C:G (C9E;G 0A?C>DBAG ECG 6?C2D=FG F=9<AEDCBA>G C66C?E9BDEDF@ :C?GF7?CG@E9=FBE@GDBG?F@6CB@FGECGE;FG;D@EC?D<A>G=FBDA>GC:GA<<F@@GECGE;FGFD@E, DB7GF=9<AEDCBA>G@1@EF84G$C=A15G9B=F?GE;FG<CBEDB9F=GC/BF?@;D6GC:GDE@G:C9B=, DB7G.C=15GE;FG0C>>F7FGC6FB@GDE@G=CC?@GECGAG<9>E9?A>>1GAB=G7FC7?A6;D<A>>1G=D, 2F?@FG @E9=FBEG .C=15G E16D<A>>1G :?C8G E;FG (C9E;FA@EG AB=G C?E;FA@EG ?F7DCB@4 &C??D@G0C>>F7FGD@GABGA<<?F=DEF=5G:C9?,1FA?5G<CF=9<AEDCBA>5G?F@D=FBEDA>5G>D.F?A> A?E@G AB=G <A?FF?,:C<9@F=G DB@EDE9EDCBG A/A?=DB7G .A<<A>A9?FAEFG =F7?FF@G DBG E;F A?E@GAB=G@<DFB<F@GAB=GDBG<A?FF?,.A@F=G6?C:F@@DCBA>G:DF>=@4 $;FG0C>>F7FG@F?2F@GE;FGBFF=@GC:GDE@G@E9=FBE@5GA>98BDGAB=G<C889BDE14 %EG@F?2F@GDE@G@E9=FBE@G.1  #?C2D=DB7G@C9B=G>D.F?A>GA?E@GAB=G<A?FF?,.A@F=G6?C7?A8@G/DE;GAG6A?ED<, 9>A?GF86;A@D@GCBGEFA<;F?GF=9<AEDCB4  #?C2D=DB7G ABG DBEFB@D2FG 6?C7?A8G :C?G 8A@EF?DB7G .A@D<G @C<DA>5G E;DB!DB75 >D@EFBDB75G@6FA!DB75G?FA=DB75G/?DEDB75G8AE;F8AED<A>5GEF<;BC>C7D<A>5GAB= >FA=F?@;D6G@!D>>@4  #?C2D=DB7G @F?2D<F@G AB=G 6?C7?A8@G ECG A@@D@EG DBG E;FD?G A<A=F8D<5G @C<DA>5 6?C:F@@DCBA>5GAB=G6F?@CBA>G=F2F>C68FBE4  #?C8CEDB7G ABG FE;D<A>G AB=G ?F>D7DC9@G FB2D?CB8FBEG /;D<;G <C86>F8FBE@ E;FG@E9=FBE@GECEA>G=F2F>C68FBE4 %EG@F?2F@GDE@GA>98BDG.1  #?C8CEDB7GAG?F>AEDCB@;D6GE;AEGD@G89E9A>>1G.FBF:D<DA>GECGE;FGA>98BDGAB= E;FGDB@EDE9EDCB4 %EG@F?2F@GDE@G<C889BDE1G.1  #?C2D=DB7G<CBEDB9DB7GF=9<AEDCBGAB=G@F?2D<F@GECG<>F?71GAB=G>ADE14  #?C8CEDB7G E;FG 7?C/E;G AB=G =F2F>C68FBEG C:G E;FG >A?7F?G <C889BDE1 E;?C97;G69.>D<G@F?2D<FG6?C7?A8@4  #?C2D=DB7G?F@FA?<;G@F?2D<F@GAB=G:A<D>DEDF@GDBGE;FG@C>9EDCBGC:GA<A=F8D< AB=G<C889BDE1G6?C.>F8@4 &C??D@G0C>>F7FGD@G6?D8A?D>1GAG@E9=FBE,<FBEF?F=GDB@EDE9EDCBG/;D<;G@FF!@GECG:9>:D>> E;D@G8D@@DCBG.1  2A>9AEDB7G E;FG A<A=F8D<G 6F?:C?8AB<FG C:G @E9=FBE@G ECG FB@9?FG <C86F, EFB<FGDBG<C889BD<AEDCB5G6?C.>F8G@C>2DB75G<?DED<A>GE;DB!DB75GAB=GE;FG9@F C:GDB:C?8AEDCBGEF<;BC>C714  86;A@D DB7GAG.?CA=G9B=F?@EAB=DB7GC:GE;FG>D.F?A>GA?E@GAB=G@<DFB<F@4  86;A@D DB7G @6F<D:D<G 6?C:F@@DCBA>G AB=G EF<;BD<A>G @!D>>@G BF<F@@A?1G EC 8FFEG@C<DFEA>G=F8AB=@4  86;A@D DB7GECEA>G=F2F>C68FBEGC:GE;FG@E9=FBEG:C?G?F@6CB@D.>FG<DED FB, @;D6GDBGAG7>C.A>G@C<DFE14 $;D@G@E9=FBE,<FBEF?F=G<C88DE8FBEGF8.?A<F@GE;FG0C>>F7F@G8CEEC5GBEF?GEC FA?B G'F6A?EGECG(F?2F4 "&#&"&%* &C??D@G0C>>F7FG;C>=@G8F8.F?@;D6GDBGE;FG0C9B<D>GC:G%B=F6FB=FBEG0C>>F7F@5 E;FG*@@C<DAEDCBGC:GC2F?BDB7GCA?=@GC:GBD2F?@DEDF@GAB=G0C>>F7F@5GE;FG*8F?, 13


MORRIS COLLEGE CATALOG D<ABG0C9B<D>GCBG=9<AEDCB5GE;FG*8F?D<ABG*@@C<DAEDCBGC:G0C>>F7F@G:C?G$FA<;, F?G=9<AEDCB5GE;FGAEDCBA>G*@@C<DAEDCBG:C?G 9A>G"66C?E9BDE1GDBGD7;F?G=9, <AEDCB5G(C9E;G0A?C>DBAG%B=F6FB=FBEG0C>>F7F@GAB=GBD2F?@DEDF@5GAB=GE;FG0C>, >F7FG9B=04 %#&+8%8%&*+)&&"&% &C??D@G0C>>F7FG=CF@GBCEG=D@<?D8DBAEFGA7ADB@EGAB1G6F?@CBGCBGE;FG.A@D@GC: @F5GA7F5G?A<F5G?F>D7DCB5G<C>C?5G6C>DED<A>GA::D>DAEDCB5GBAEDCBA>GC?GFE;BD<GC?D7DB5GC? ;AB=D<A6G DBG DE@G A=8D@@DCB@G 6C>D<DF@5G F86>C18FBEG C66C?E9BDEDF@5G @<;C>A?@;D6 AB=G>CABG6?C7?A8@5GF=9<AEDCBA>GAB=GAE;>FED<G6?C7?A8@5GC?GCE;F?G<C>>F7F,A=, 8DBD@EF?F=G6?C7?A8@4 #%+"&% &C??D@G0C>>F7FGD@G>C<AEF=GAEG3++G F@EG0C>>F7FG(E?FFEGCBGE;FGBC?E;G@D=FGC: E;FG 0DE1G C:G (98EF?G CBG AG :C?E1,CBF,A<?FG E?A<EG C:G BAE9?A>G .FA9E1G DBG AG 9DFE BFD7;.C?;CC=4G (98EF?G D@G >C<AEF=G DBG <FBE?A>G (C9E;G 0A?C>DBAG A66?CD8AEF>1 :C?E1,:D2FG 8D>F@G :?C8G 0C>98.DA5G E;FG <A6DEA>G <DE15G AB=G :?C8G E;FG 0C>98.DAG *D?, 6C?E4G $;FG 8C=F?AEFG <>D8AEFG AB=G <CB7FBDA>G AE8C@6;F?FG C:G E;FG <A869@G 6?C, 2D=FGAG6>FA@ABEG@FEEDB7G:C?G@E9=14 &#&* $;FG 8AC?G .9D>=DB7@G CBG E;FG &C??D@G 0C>>F7FG <A869@5G E;FD?G =AEF@G C:G <CB, @E?9<EDCB5GAB=GE;FD?G6?DB<D6A>G:9B<EDCB@GA?FGA@G:C>>C/@ ".4,7$5.8'433 3-5G?FBC2AEF=G3--+GD@G9@F=G:C?G<>A@@F@GC:GE;FG'D2D, @DCBGC:G9@DBF@@G*=8DBD@E?AEDCB5GAB=GE;FG'D2D@DCBGC:G)F>D7DCBGAB=G9, 8ABDEDF@5GAB=G:C?G@F2F?A>GA=8DBD@E?AED2FGC::D<F@GDB<>9=DB7GE;FG"::D<FGC: E;FG *<A=F8D<G 'FAB5G E;FG "::D<FG C:G (E9=FBEG *::AD?@5G AB=G E;FG "?7ABD A, EDCBA>G&ABA7F8FBEG#?C7?A84 2437*/4208".4,7$5.8* ..7008+76/72 3-5G?FBC2AEF=G3-- <CBEADB@G E;FG 'D2D@DCBG C:G FBF?A>G (E9=DF@5G (E9=FBEG (966C?EG (F?2D<F@5 E;FG6/A?=GC9B=G#?C7?A85GE;FG0A?FF?G(F?2D<F@G0FBEF?5GAB=GAG>A?7F >FA?BDB7G>A.C?AEC?14 560168 ",$5650/24/5168  53,56 3-G ;C9@F@G E;FG "::D<F@G C:G E;F #?F@D=FBE5G9@DBF@@G*::AD?@5GAB=G*=8D@@DCB@GAB=G)F<C?=@GCBGE;FG:D?@E :>CC?GAB=GC::D<F@GC:GA==DEDCBA>G@EA::G8F8.F?@GCBGE;FG@F<CB=G:>CC?4 '-8 '-8  /3728  53,56 3- 5G ?FBC2AEF=G +++G ;C9@F@G C::D<F@G AB= @C8FG <>A@@F@G C:G E;FG 'D2D@DCBG C:G =9<AEDCBG AB=G E;FG 'D2D@DCBG C:G (C<DA> (<DFB<F@4 4738 -8 '142,8  53,56 3- G ;C9@F@G E;FG "::D<FG C:G 0C9B@F>DB7 AB=G $F@EDB75G E;FG FA>E;G 0FBEF?5G E;FG DBAB<DA>G *D=G "::D<F5G E;FG A6ED@E C8FB@G)F<C?=@G)CC85GAB=G*?81G)"$0G"::D<F@4 -8 15608 4657308 '4338 3-5G =DBDB7G :A<D>DE1G ?FBC2AEF=G ++ D@G A ?F@D=FB<FG;A>>GAB=G=DBDB7G:A<D>DE14 1560 75/( (5/76728 )705,76.78 '433 3-G D@G AG ?F@D=FB<FG ;A>> :C?G8FB4  5301611728*.576.78'433 3-5GF6AB=F=G+3G;C9@F@G<;DF:>1 6?C7?A8@GC:GE;FG'D2D@DCBGC:GAE9?A>G(<DFB<F@GAB=G&AE;F8AED<@4 #-8 +-8 )5.(42,016 -8 "-8 1(60168 #7426568 )701 2.708 +76/72 3-+G<CBEADB@GE;FG0C>>F7F@G>D.?A?1GAB=G8F=DAG:A<D>DEDF@4 14


GENERAL INFORMATION  -8'-8743&1348167085678"2/08+76/72 3-+G<CBEADB@GABGA9=DEC?D, 98GAB=GDB@E?9<EDCBA>G:A<D>DEDF@G:C?G6?C7?A8@GDBGA?E5G89@D<5GAB=GE;FAEF?4 "6648-8)7 7684$578+17284613548#7508"372/(48*5$160 '433 3-GD@GAG?F@D=FB<FG;A>>G:C?G/C8FB4 *7. 25/8 46,8 &612$4/5168 11/(8 3-5G F6AB=F=G ++G D@G >C<AEF= AEGE;FGFBE?AB<FGECGE;FG<A869@GAB=G;C9@F@GE;FG(F<9?DE1G"::D<F5G/;D<; A>@CG6?C2D=F@GDB:C?8AEDCBGECG<A869@G2D@DEC?@4 (78 2705,76/ 08 '1$7 3-G D@G E;FG C::D<DA>G ?F@D=FB<FG C:G E;FG #?F@D, =FBEGC:GE;FG0C>>F7F4 4225.1568' $4687731$76/8+76/72 3--3G6?C2D=F@G:A<D>D, EDF@G:C?G6;1@D<A>GF=9<AEDCBG<>A@@F@5G@C<DA>GAB=G<9>E9?A>GA<ED2DEDF@5G@6F, <DA>GF2FBE@5G?F<?FAEDCBGA=8DBD@E?AEDCBG<>A@@F@5GAB=GAE;>FED<GF2FBE@4 -8%-8)5.(8*-8+-8+ 27/168!,8-81(60168'433 3--GD@GAG?F@D=FB<F ;A>>G:C?G8FB4 40728 #-8 21102468 '-8 '4$8 24(5.08 +76/72 3--G ;C9@F@ E;FG0C>>F7F@G6?DBEDB7G6?F@@GAB=G<C61DB7G:A<D>DE14 %-8)-8)7 768+(473846,8)73551 08+76/72 3--G<CBEADB@GAG@AB<, E9A?1G:C?G@6F<DA>G?F>D7DC9@G/C?@;D6G@F?2D<F@4G$;FG)F>D7DC9@G0FBEF?G<CB, EADB@GE;FGC::D<FGC:GE;FG0C>>F7FG&DBD@EF?GAB=GC::D<F@GAB=G<>A@@?CC8@G:C? :A<9>E1GDBGE;FGA?FAGC:G)F>D7DCB4 +(423708 53.(250/8 ",4$08 +-8 4.78 4657308 425168  11,42,  25(/8 .#70/728 74/25.78 278 *46,7208 '433 3--G D@G AG ?F@D, =FB<FG;A>>G:C?G/C8FB4 "3(16018 )-8 3478  533578 !,568 57608 2-8 "2473348 '-8 )5.( 4 35678  560/168 (1$0168 */ ,76/8 +76/72 3--G <CBEADB@G :CC= @F?2D<FG :A<D>DEDF@5G E;FG .CC!@EC?F5G 6C@EG C::D<F5G 7A8FG ?CC85G 8FFEDB7 ?CC85G>C9B7F5G@E9=FBEG7C2F?B8FBEGC::D<F@5GAB=G@E9=FBEG>C<!F?@4 72/578 -8  (5/78 +76/728 128 !.73376.78 568 74.(568 46,8 #742656 <C86>FEF=G +3+G @F?2F@G ECG B9?E9?F5G 6?C8CEF5G AB=G FB;AB<FG EFA<;DB7 F<F>>FB<FGA8CB7G:A<9>E1G8F8.F?@GAB=GECGFB;AB<FG@E9=FBEG>FA?BDB74 $;FG0FBEF?GD@G>C<AEF=GAEG33G F@EG0C>>F7FG(E4 127605.08+76/72 +33G@966C?E@GE;FG0?D8DBA>G9@ED<FG#?C7?A8GAB= DB<>9=F@G E/CG >A.C?AEC?DF@G :C?G 7FBFED<G EF@EDB7G AB=G CBFG FA<;G :C?G :DB7F?, 6?DBEG ABA>1@D@5G .A>>D@ED<@G ABA>1@D@5G AB=G :D?FG =F.?D@G AB=G <CBE?C>>F=G @9., @EAB<FG ABA>1@D@4G $;FG 0FBEF?G A>@CG DB<>9=F@G E/CG <>A@@?CC8@5G E/CG C:, :D<F@5GAG<CB:F?FB<FG?CC85GAG>C9B7F5GAB=GAG2F;D<>FG.A14 *131$1684.0168*2-8 53354$8. 563781$468*2-8)4$16, +42135648 (05.438 346/8  53,56 +33G DB<>9=F@G C::D<FG @6A<F@5G A @EA::G <CB:F?FB<FG ?CC85G AG >A/BG 8ADBEFBAB<FG F 9D68FBEG A?FA5G @EC?A7F 2A9>E@5G/C?!@;C6GA?FA@5GAB=G:C9?G2F;D<>FG.A1@4 */ ,76/8 '743/(8 46,8  73367008 +76/72 +3G <CBEADB@G C::D<FG AB= <>A@@?CC8G @6A<FG :C?G E;FG FA>E;G (<DFB<F5G )F<?FAEDCBG *=8DBD@E?AEDCB5 AB=G )"$0G #?C7?A8@ G ABG C::D<FG :C?G E;FG <FBEF?G =D?F<EC? G AB=G AG :DEBF@@ A?FAG E;AEG DB<>9=F@G AG /FD7;EG ?CC85G AF?C.D<@G ?CC85G @;C/F?@5G >C<!F?@5 AB=G@EAEFGC:GE;FGA?EGA9ED>9@GFF?<D@FGF 9D68FBE4 7876 08)705,76.78'4338  

78 1$76 08)705,76.78'4338  

15


"--#$-6 ,#!,- !,!,,$ -6$"6 !#,"!,0C5H 9B>AD9D=BFDECH E@H E;DAADECH E9H B?;DAADECAH DC9E@;BFDECH E@H ?E=:;GCFAH 4D>> @GA:>FHDCHD;;G?DBFGH?DA;DAAB>H9@E;HE@H?GCDB>HE9HGCF@5HFEH+E@@DAH1E>>G8G6 0?;DAADECH 7E>D=DGAH B@GH =ECADAFGCFH 4DF<H F<GH ;DAADECH E9H F<GH DCAFDF:FDEC6 0?;DAADECH DAH E7GCH FEH B>>H 7G@AECAH 4<EH A<E4H F<GH 7EFGCFDB>H 9E@H =E>>G8G(>G3G> 4E@&/H 4<EH A:2A=@D2GH FEH F<GH 7<D>EAE7<5H BC?H 7:@7EAGH E9H +E@@DAH 1E>>G8G/H BC? 4<EH ;GGFH B?;DAADECH @G:D@G;GCFA6H .F:?GCFAH E9H B>>H @B=GA/H =@GG?A/H BC? CBFDECB>H E@D8DCAH B@GH 4G>=E;G6H G4H AF:?GCFAH B@GH B?;DFFG?H DCH F<GH 9B>>/H A7@DC8/ BC?HA:;;G@6 "--#$6#6",!,,-,,$6- ",$ DF<H F<GH G"=G7FDECH E9H 9E@GD8CH AF:?GCFA/H AF:?GCFAH AGG&DC8H B?;DAADECH FEH B ?G8@GGH7@E8@B;HB@GH@G:D@G?HFEHA:2;DFH01,HE@H.0,HA=E@GA6H,<GAGHA=E@GAHB@G :AG?H9E@HDC9E@;BFDECH7:@7EAGAHEC>56H 05.)'1/6-4%*5/4. 077>D=BCFAH ;B5H 8BDCH B?;DAADECH FEH F<GH 9@GA<;BCH =>BAAH 25H ;GGFDC8H BC5 ECGHE9HF<GH9E>>E4DC8H=@DFG@DB %B$ 0CH.0,HA=E@GHE9H''HE@HBCH01,HA=E@GHE9H- %2$ 0H<D8<HA=<EE>H8@B?GH7EDCFHB3G@B8GHE9H#6'HE@H<D8<G@ %=$ 0H<D8<HA=<EE>H@BC&HDCHF<GH:77G@HH7G@=GCFHE9HF<GH8@B?:BFDC8H=>BAA )F<G@H@G:D@G;GCFAHDC=>:?GHBC5HECGHE9HF<GH9E>>E4DC8

%B$ @GAGCFDC8HG3D?GC=GHE9H8@B?:BFDECH4DF<HBH?D7>E;BH9@E;HBCHB==@G?DFG? <D8<HA=<EE>/H@BC&DC8HDCHF<GH:77G@HH7G@=GCFHE9HF<GH8@B?:BFDC8H=>BAA/ BC?H A:==GAA9:>>5H =E;7>GFDC8H BH =:@@D=:>:;H 4<D=<H DC=>:?GAH F<G 9E>>E4DC8H#HAFBC?B@?H:CDFA *C8>DA< 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H +BF<G;BFD=A 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H BF:@B>H.=DGC=GA 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H CDFG?H.FBFGAH DAFE@5 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H.E=DB>H.F:?DGA 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6HE3G@C;GCF 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H-# *=ECE;D=A 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H-# <5AD=B>H*?:=BFDECHE@H!),1 6H6H6H6H6H6H6H6H6H6H1E;7:FG@H.=DGC=G 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6HE@GD8CHBC8:B8GHE@HE=BFDECB> 6H6H6H6H6H6H6H*>G=FD3GA 6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H6H %2$ @GAGCFDC8HG3D?GC=GHE9H8@B?:BFDECH4DF<HBH?D7>E;BH9@E;HBCHB==@G?DFG? <D8<H A=<EE>/H B=<DG3DC8H BCH E3G@B>>H 8@B?GH 7EDCFH B3G@B8GH E9H BFH >GBAF #6''/HBC?HA:==GAA9:>>5H=E;7>GFDC8HF<GH7@G=G?DC8H#HAFBC?B@?H:CDFA6H %=$ @GAGCFDC8HG3D?GC=GHE9H8@B?:BFDECH4DF<HBH?D7>E;BH9@E;HBCHB==@G?DFG? <D8<HA=<EE>/HA:==GAA9:>>5H=E;7>GFDC8HF<GH7@G=G?DC8H#HAFBC?B@?H:CDFA/ 16


ADMISSIONS CATEGORIES BC?HB=<DG3DC8HGDF<G@HBH=E;2DCG?H3G@2B>HBC?H;BF<G;BFD=AHA=E@GHE9H'' E@H<D8<G@HECHF<GH.=<E>BAFD=H07FDF:?GH,GAFH%.0,$HE@H-HECHF<GH0;G@D=BC 1E>>G8GH,GAFH%01,$6 %?$ @GAGCFDC8H G3D?GC=GH E9H <B3DC8H A:==GAA9:>>5H 7BAAG?H F<GH GCG@B> *?:=BFDECB>HG3G>E7;GCFH%*$H,GAF6 %G$ @GAGCFDC8H G3D?GC=GH E9H <B3DC8H A=E@G?H CEH >GAAH F<BCH H ECH BC5H 7B@FH E9H F<GH0@;5HGCG@B>HG3G>E7;GCFH,GAF6 %9$ @GAGCFDC8H G3D?GC=GH E9H <B3DC8H 8@B?:BFG?H 9@E;H BH <D8<H A=<EE>H :C?G@H F<GHG>G3GC(5GB@H7>BCH7@DE@HFEHF<GH-(-HA=<EE>H5GB@6 0H >D;DFG?H C:;2G@H E9H B77>D=BCFAH 4<EH ?EH CEFH ;GGFH F<GH B?;DAADECAH =@DFG@DB ;B5H 2GH B?;DFFG?H ECH B=B?G;D=H 7@E2BFDECH BFH F<GH @G=E;;GC?BFDECH E9H F<G 0?;DAADECAH 1E;;DFFGG6H .F:?GCFAH 4<EH B@GH B?;DFFG?H ECH B=B?G;D=H 7@E2BFDEC ;B5H CEFH GC@E>>H 9E@H ;E@GH F<BCH -H =@G?DFH <E:@AH ?:@DC8H GB=<H E9H F<GH 9D@AFH F4E AG;GAFG@A HBC?HF<EAGH4<EH?EHCEFH;GGFHF<GHAFBC?B@?AHE9HB=B?G;D=H7@E8@GAA B9FG@H F4EH AG;GAFG@AH E9H GC@E>>;GCFH 4D>>H 2GH 7G@;BCGCF>5H ?DA;DAAG?H 9@E;H F<G 1E>>G8G6 01/.&506-4%*5/4. 0HAF:?GCFH4<EH7@G3DE:A>5HBFFGC?G?HBCEF<G@HB==@G?DFG?H=E>>G8GH;B5HGCFG@ +E@@DAH 1E>>G8GH BAH BH F@BCA9G@H AF:?GCF H BC?H B==E@?DC8H FEH F<GH CBF:@GH E9H F<G B=B?G;D=H @G=E@?/H AE;GH E@H B>>H E9H F<GH =@G?DFAH GB@CG?H ;B5H 2GH F@BCA9G@@G?H FE +E@@DAH1E>>G8G6H0>>HF@BCA=@D7FAH9@E;HEF<G@H=E>>G8GAHBC?H:CD3G@ADFDGAH;:AFH2G @G=GD3G?HF4EH;ECF<AH7@DE@HFEH@G8DAF@BFDECHE9HF<GHFG@;HE9HGCF@BC=G6 0H F@BCA9G@H AF:?GCFH ;B5H 2GH B?;DFFG?H FEH +E@@DAH 1E>>G8GH B==E@?DC8H FE B77>D=B2>GH =@DFG@DBH BC?H 7@E=G?:@GAH :AG?H 9E@H 9@GA<;GCH 4DF<E:FH @GAF@D=FDEC 7@E3D?G?H F<GH AF:?GCFAH 8@B?GH 7EDCFH B3G@B8GH BFH F<GH 7@G3DE:AH DCAFDF:F:DECH DA GDF<G@HA:99D=DGCFHFEHB>>E4HF<GHAF:?GCFHFEH=ECFDC:GHBFHF<GH7@G3DE:AHDCAFDF:FDECHE@ FEH 7>B=GH F<GH AF:?GCFH DCH 8EE?H B=B?G;D=H AFBC?DC8H BFH +E@@DAH 1E>>G8G6H ,<G 8@B?GH 7EDCFH B3G@B8GH BFH +E@@DAH 1E>>G8GH ?D99G@AH B==E@?DC8H FEH 4<GF<G@H F<G AF:?GCFH DAH AGG&DC8H FEH F@BCA9G@H BAH BH 9@GA<;BC/H AE7<;E@G/H :CDE@/H E@H AGCDE@/ BC?H F<GH @G:D@G?H B3G@B8GAH 9E@H GB=<H =BFG8E@5H B@GH >DAFG?H G>AG4<G@GH DCH F<DA =BFB>E86 0H F@BCA9G@H AF:?GCFH 4<EH <BAH 2GGCH ?DA;DAAG?H 9@E;H BCEF<G@H =E>>G8GH 9E@ B=B?G;D=H ?G9D=DGC=DGAH BC?H 4<EAGH 8@B?GH 7EDCFH B3G@B8GH DAH CEFH A:99D=DGCFH FE 7>B=GHF<GHAF:?GCFHDCH8EE?HAFBC?DC8HBFH+E@@DAH1E>>G8GH;:AFH?G>B5HF@BCA9G@HFE F<GH 1E>>G8GH 9E@H BFH >GBAFH ECGH AG;GAFG@6H 09FG@H BH ECG(AG;GAFG@H ?G>B5/H F<G F@BCA9G@HAF:?GCFH;B5H2GHB?;DFFG?HFEH+E@@DAH1E>>G8GHECHB=B?G;D=H7@E2BFDEC BC?H 4D>>H @G;BDCH ECH B=B?G;D=H 7@E2BFDECH 9E@H F<GH 9D@AFH F4EH AG;GAFG@A6H ,E @G;BDCH GC@E>>G?/H BH F@BCA9G@H AF:?GCFH ;:AFH ;GGFH F<GH AB;GH AFBC?B@?AH 9E@ A=<E>BAFD=HG>D8D2D>DF5HBAHB>>HEF<G@HAF:?GCFAHDCHF<GHAB;GH=>BAAD9D=BFDEC6 CHG3B>:BFDC8H7@E9GAADECB>H;D>DFB@5HG?:=BFDECHBC?HEF<G@HCEC(=@G?DFH=E:@AG 4E@&/H F<GH 1E>>G8GH B?<G@GAH FEH F<GH 8:D?G>DCGAH GAFB2>DA<G?H 25H F<GH 0;G@D=BC 1E:C=D>HECH*?:=BFDECHBC?H7:2>DA<G?HDCH  

      6H ,<GH 1E>>G8GH ?EGAH CEFH B4B@?H =@G?DFH 9E@ G"7G@DGCFDB>H>GB@CDC86 -5(21+6$3456436/450/1423/1O6-4%*5/4. CFG@CBFDECB>HAF:?GCFAH;:AFH;GGFH B>>H B?;DAADECAH @G:D@G;GCFAH G"=G7FH A:2;DAADECH E9H 01,H E@H .0,H A=E@GA6H ,<G5 A<E:>?H ;B&GH B77>D=BFDECH BFH >GBAFH 'H ?B5AH 7@DE@H FEH F<GH G"7G=FG?H ?BFGH E9 GCF@BC=G6H *"=G7FH DCH =E:CF@DGAH 4<G@GH *C8>DA<H DAH F<GH E99D=DB>H >BC8:B8G/H F<G 17


MORRIS COLLEGE CATALOG B77>D=BCFH DAH @G:D@G?H FEH A<E4H 7@E9D=DGC=5H DCH E@B>H BC?H 4@DFFGCH G"7@GAADECH BA G3D?GC=G?H25HABFDA9B=FE@5H7G@9E@;BC=GHECHF<GH,GAFHE9H*C8>DA<HBAHBHE@GD8C BC8:B8GH %,)*$6H @E2BFDECB@5H B?;DAADECH 4D>>H 2GH =ECAD?G@G?H 9E@ B77>D=BCFAH 4<EH >B=&H 7@E9D=DGC=5H DCH *C8>DA<6H .:=<H AF:?GCFAH 4D>>H 2GH 8D3GC A7G=DB>HDCAF@:=FDECHDCH*C8>DA<H2G9E@GHB?;DAADECHBAHBH?G8@GG(AGG&DC8HAF:?GCF DAH 8@BCFG?6H CFG@CBFDECB>H B77>D=BCFAH B@GH B>AEH @G:D@G?H FEH 7@E3D?GH G3D?GC=G F<BFH B?G:BFGH 9DCBC=DB>H @GAE:@=GAH B@GH B3BD>B2>GH FEH ?G9@B5H F<GH =EAFH E9 F<GD@HG?:=BFDECB>HG"7GCAGAH4<D>GHF<G5HB@GHBFFGC?DC8H+E@@DAH1E>>G8G6 042(%+1423/624)6#4)506/.424%423/.63&62)506,*%(1423/ +E@@DAH 1E>>G8GH ;BDCFBDCAH B@FD=:>BFDECH B8@GG;GCFAH 4DF<H AG3G@B>H F4E(H BC? 9E:@(5GB@H DCAFDF:FDECAH E9H <D8<G@H G?:=BFDECH 2EF<H 4DF<DCH .E:F<H 1B@E>DCBH BC? E:FAD?GH F<GH AFBFG6H ,<GAGH DCAFDF:FDECAH DC=>:?GH @GGC3D>>GH ,G=<CD=B>H 1E>>G8G/ >E@GC=G(B@>DC8FECH,G=<CD=B>H1E>>G8G/ 1GCF@B>H1B@E>DCB ,G=<CD=B> 1E>>G8G/ E@F<GBAFG@CH,G=<CD=B>H1E>>G8G/HF<GHCD3G@ADF5HE9H.E:F<H1B@E>DCB/H1>G;AEC CD3G@ADF5/HBC?HE@F<H1B@E>DCBH0HH,H.FBFGHCD3G@ADF56HGFBD>G?HDC9E@;BFDEC @G8B@?DC8H B@FD=:>BFG?H =E:@AGA/H 7@E8@B;A/H BC?H ?G8@GGAH ;B5H 2GH E2FBDCG? 9@E;H F<GH =E:CAG>DC8H E99D=GH E9H F<GH DCAFDF:FDECAH 4DF<H 4<D=<H +E@@DAH 1E>>G8G ;BDCFBDCAHB8@GG;GCFAHE@H9@E;HF<GH+E@@DAH1E>>G8GH)99D=GHE9H0?;DAADECAHBC? !G=E@?A6H ,$!# ,$ 6#6$#$",!,,-,,$6- ",$ .F:?GCFAHDCHF<GHCEC(?G8@GG(AGG&DC8H=BFG8E@5HB@GH7G@AECAH4<EHGC@E>>HBF +E@@DAH1E>>G8GH2:FH4<EH?EHCEFHDCFGC?HFEH7:@A:GHBH?G8@GG6H.F:?GCFAHDCHF<G CEC(?G8@GG(AGG&DC8H =BFG8E@5H DC=>:?GH A7G=DB>H AF:?GCFAH BC?H F@BCADGCF AF:?GCFA6 -5(21+6-4%*5/4. .7G=DB>H AF:?GCFAH B@GH DC?D3D?:B>AH 4<EH 4DA<H FEH FB&GH =E>>G8GH =E:@AGAH 9E@ F<GD@H7G@AECB>HDCFG@GAFHBC?HGC E5;GCFH2:FH?EHCEFHDCFGC?HFEH7:@A:GHBH?G8@GG6 ,<GAGHDC?D3D?:B>AH4D>>H2GH>DAFG?HBAHA7G=DB>HAF:?GCFAHBC?H4D>>HCEFH2GHA:2 G=F FEH F<GH @G:D@G;GCFAH 9E@H B?;DAADECH BAH ?G8@GG(AGG&DC8H AF:?GCFA6H .7G=DB> AF:?GCFAH;:AF/H<E4G3G@/H8D3GHG3D?GC=GHE9H7@G7B@BFDECHBC?HB2D>DF5HFEH7G@9E@; A:=GAA9:>>5HDCH=E>>G8G(>G3G>H=E:@AGA6H0HAF:?GCFHDCHF<DAH=BFG8E@5H;B5HGB@CHCE ;E@GHF<BCH'HAG;GAFG@H<E:@A6H .7G=DB>H AF:?GCFAH 4DA<DC8H FEH =<BC8GH F<GD@H AFBF:AH FEH ?G8@GGH AGG&DC8H ;B5 ?EHAEH25H;GGFDC8HB>>H1E>>G8GHB?;DAADECH@G:D@G;GCFA6H7ECH=<BC8DC8HF<GD@ AFBF:AH FEH ?G8@GGH AGG&DC8/H AF:?GCFAH ;B5H B77>5H =@G?DFAH GB@CG?H BAH A7G=DB> AF:?GCFAHFEHF<GH?G8@GG6H 01/.25/46-4%*5/4. 0HAF:?GCFHGC@E>>G?HBFHBCEF<G@HDCAFDF:FDECHE9H<D8<G@H>GB@CDC8H;B5HB77>5H9E@ B?;DAADECHFEH+E@@DAH1E>>G8GHBAHBHF@BCADGCFHAF:?GCFH7@E3D?G?HA:=<HAF:?GCFHDA DCH 8EE?H B=B?G;D=H AFBC?DC8H BFH <DA <G@H <E;GH DCAFDF:FDECH BC?H 7@E3D?G?H F<G 7@E8@B;H E9H AF:?5H FEH 2GH 7:@A:G?H BFH +E@@DAH 1E>>G8GH <BAH 2GGCH B77@E3G?H 25 F<GH B77@E7@DBFGH E99D=DB>H E9H F<GH <E;GH DCAFDF:FDEC6H 077>D=BFDECH 9GGAH ;:AFH 2G 7BD?H7@DE@HFEHB?;DAADEC6

18


ADMISSIONS CATEGORIES "--#$6 !#,"!,,506 (1/*2*1456 &306 1*'2..23/6 '%.46 '156 &30'1+6 1+2(1423/6 436 4)5 #&&2(563&6*'2..23/.61/*6!5(30*.63002.63++556 65.463++55 -405546-%'4506-3%4)6103+2/16  6+2(1423/6&30'.61056112+1+5 &03'6 4)56 #&&2(56 3&6 *'2..23/.6 1/*6 !5(30*.6 )5.56 &30'.6 '%.46 5 (3'+545*6 1/*6 054%0/5*6 436 4)56 (3++556 4354)506 24)6 1/6 1+2(1423/ &5563&6 6)2()62.6/34605&%/*1+5 06

@GA<;BCH B77>D=BCFAH 4<EH <B3GH CEFH 7@G3DE:A>5H BFFGC?G?H BC5H =E>>G8G ;:AFH9E>>E4HF<GAGH7@E=G?:@GA -6 !G:GAFH B77>D=BFDECH ;BFG@DB>AH 9@E;H F<GH )99D=GH E9H 0?;DAADECAH BC?H !G=E@?A6 #6 !G:GAFH F@BCA=@D7FH E9H AG=EC?B@5H A=<EE>H @G=E@?AH 2GH AGCFH ?D@G=F>5H FE F<GH)99D=GHE9H0?;DAADECAHBC?H!G=E@?A 6 B3GH +G?D=B>H *"B;DCBFDECH 9E@;H =E;7>GFG?H 25H >D=GCAG?H ;G?D=B> 7G@AECCG>6H CH B??DFDECH FEH F<GH +G?D=B>H *"B;DCBFDECH 9E@;/H 7G@AECA 2E@CHB9FG@HG=G;2G@H-/H-/H;:AFHB>AEH<B3GH ;;:CDBFDECAH9@E; =E;7>GFG?H 25H >D=GCAG?H ;G?D=B>H 7G@AECCG>6H )56 5*2(1+6 , 1'2/1423/6 &30'6 .)3%+*6 56 '12+5*6 436 4)56 "205(4306 3&6 51+4)6 -502(5. 6 .GC?H =E;7>GFG?H 077>D=BFDECH 9E@H 0?;DAADECH %G"=G7FH 9E@H +G?D=B>H *"B;DCBFDECH 9E@;$H BC?H B77>D=BFDECH 9GGH FEH F<GH )99D=GH E9H 0?;DAADECAH BC?H!G=E@?A6 6 1E;7>GFGH 7>B=G;GCFH G"B;DCBFDECH DCH *C8>DA</H @GB?DC8/H BC?H ;BF<G;BFD=AH 7@DE@H FEH @G8DAF@BFDECH 9E@H B77@E7@DBFGH 7>B=G;GCFH DCH *C8>DA<HBC?H;BF<G;BFD=AH=E:@AGA6

6

,@BCA9G@H B77>D=BCFAH 4<EH <B3GH CEFH 7@G3DE:A>5H BFFGC?G?H +E@@DAH 1E>>G8G A<E:>?H 9E>>E4H F<GH AB;GH 7@E=G?:@GAH E:F>DCG?H B2E3GH 9E@H @GA<;BC B77>D=BCFA6H CHB??DFDECHF<G5H   -6 .:2;DFHBCHE99D=DB>HF@BCA=@D7FH9@E;HGB=<H=E>>G8GH7@G3DE:A>5HBFFGC?G?6 #6 .:2;DFHG3D?GC=GHE9H<ECE@B2>GH@G>GBAGH9@E;HF<GH=E>>G8GH9@E;H4<D=< F<GHB77>D=BCFHDAHF@BCA9G@@DC86 0C5H =E:@AGH DCH 4<D=<H BH F@BCA9G@H AF:?GCFH <BAH ;B?GH BH 8@B?GH 2G>E4H 1 4D>>HCEFH2GHB==G7FG?H9E@HF@BCA9G@H=@G?DF6

16

E@;G@H AF:?GCFAH E9H +E@@DAH 1E>>G8GH 4<EAGH BFFGC?BC=GH <BAH 2GGC DCFG@@:7FG?H 9E@H ECGH E@H ;E@GH AG;GAFG@%A$H ;:AFH B77>5H 9E@H @GB?;DAADEC BC?HA<E:>?H9E>>E4HF<GAGH7@E=G?:@GA -6 B3GH +G?D=B>H *"B;DCBFDECH 9E@;H =E;7>GFG?H 25H >D=GCAG?H ;G?D=B> 7G@AECCG>H :C>GAAH 7@G3DE:A>5H 7@E3D?G?H ?:@DC8H F<GH 7BAFH 5GB@6H C B??DFDECH FEH F<GH +G?D=B>H *"B;DCBFDECH 9E@;/H 7G@AECA 2E@CH B9FG@H G=G;2G@H -/H -/H ;:AFH B>AEH <B3GH  ;;:CDBFDECA 9E@;H =E;7>GFG?H 25H >D=GCAG?H ;G?D=B>H 7G@AECCG>6H )56 5*2(1+6 , 1'2/1423/6 30'6 .)3%+*6 56 '12+5*6 436 4)56 "205(4306 3&6 51+4)6 -502(5. #6 .:2;DFH BCH E99D=DB>H F@BCA=@D7FH 9@E;H BC5H =E>>G8GH BFFGC?G?H ADC=GH >BAF BFFGC?DC8H+E@@DAH1E>>G8G6 19


MORRIS COLLEGE CATALOG 0C5H AF:?GCFH @GB?;DFFG?H FEH F<GH =E>>G8GH B9FG@H BCH DCFG@@:7FDECH E9H F4EH E@ ;E@GH=ECAG=:FD3GHAG;GAFG@AH;:AFH;GGFHB>>H8@B?:BFDECH@G:D@GH;GCFAHDC G99G=FHBFHF<GHFD;GHE9H@GGCF@5HDCHB==E@?BC=GH4DF<HF<GH=BFB>E8HDCHG99G=FHBF F<GH FD;GH E9H @GGCF@56H @G3DE:AH =:;:>BFD3GH 8@B?GH 7EDCFH B3G@B8GH 4D>> ?GFG@;DCGH@GHB?H;DAHADECHAFBF:A6 6

0C5HAF:?GCFHA:A7GC?G?H9@E;HF<GH=E>>G8GH9E@HBC5H@GBAECH;:AFHB77>5H9E@ @GB?;DAADEC6

*6

0C5H AF:?GCFH 4<EAGH @G=E@?H A<E4AH BH 2@GB&H DCH BFFGC?BC=GH 9@E;H <D8< A=<EE>H E@H =E>>G8GH ;:AFH =E;7>GFGH BH <G@GB2E:FAH E@;6H .F:?GCFA A<E:>?H=ECFB=FHF<GH)99D=GHE9H0?;DAADECAHBC?H!G=E@?AH9E@H?GFBD>A6

20


-3)1)31!MORRIS COLLEGE CATALOG 3)-%+1(3%) -22>02"!2>-%+>& &

KL6<KNJHML@Q IODHPLOQ ODMOMKLQ NLHQ BPPIQ MLFGDHML@Q MLIDJNLFPQ BKJ O?KQIPCPIOPJIQ-LKOQOKQPFPPHQ0!QEKDJIQAPJQIPCPIOPJ, ========= 

.&& KNJHML@QIODHPLOQODMOMKLQNLHQBPPIQMLFGDHML@QMLIDJNLFP;QJKKC NLHQ<KNJHQBKJQO?KQIPCPIOPJIQ-LKOQOKQPFPPHQ0!QEKDJIQAPJ IPCPIOPJ, ==============================================================================   .&& 4EPQN<K9PQFKIOIQHKQLKOQMLFGDHPQ<KK IQ-LKJCNGG>Q*%8=88QOKQ%%8=88QAPJ QQQQIPCPIOPJ;QHPAPLHML@QKLQOEPQIODHPLOIQCNKJ,QNLHQAPJIKLNGQPAPLIPI= 7GGQODMOMKLQFENJ@PIQNLHQBPPQFENJ@PIQNJPQNIIM@LPHQNOQOEPQOMCPQKBQJP@MIOJN6 QQQOMKL;QNLHQOEPQKLG>QNFFPAON<GPQBKJCIQKBQAN>CPLOQBKJQOEPIPQFENJ@PIQIENGGQ<P QQQQFNIE;QFNIEMPJIQFEPF ;QFPJOMBMPHQFEPF ;QCKLP>QKJHPJ;QKJQCNKJQFJPHMOQFNJH= )%)%1+"3)>0("2)(0 -786<>0=,=6<=8 0=/9:5>0=,=6<=8 4DMOMKL================================================= ;8%8=88 ;8%8=88 4PFELKGK@>Q5PP================================== !1=88 !0=88 .LIDJNLFPQ5PP =================================== %!=88 %=88 (%(1!>2+>0220(2+ ..............

 &.&&

%1+"3)>0("2)(0 -786<>0=,=6<=8 4DMOMKL================================================= ;8%8=88 4PFELKGK@>Q5PP================================== !1=88 .LIDJNLFPQ5PP =================================== %!=88 KKCQ5PP=========================================== 0;1%8=88 KNJHML@Q5PP ====================================== 0;0=88 (%(1!>2+>0220(2+ ..............

  .&&

  .&&

0=/9:5>0=,=6<=8 ;8%8=88 !0=88 %=88 0;1%8=88 0;0!=88   .&&

:ODHPLOIQ?EKQNJPQPLJKGGPHQBKJQCKJPQOENLQPM@EOPPLQEKDJIQAPJQIPCPIOPJQ?MGG <PQ NIIPIIPHQ  &.&& BKJQ PNFEQ EKDJQ K9PJQ PM@EOPPL=Q :ODHPLOIQ ?EKQ NJPQ PL6 JKGGPHQBKJQGPIIQOENLQO?PG9PQEKDJIQ-ANJO6OMCPQIODHPLOI;QMLFGDHML@Q3KKAPJNOM9P 2HDFNOMKLQKJ Q2APJMPLFP,Q?MGGQ<PQNIIPIIPHQKLQOEPQ<NIMIQKBQ &.&& APJ FJPHMOQEKDJ= :ODHPLOIQ?EKQFNLQAJK9MHPQ/KJJMIQ3KGGP@PQ?MOEQFKLBMJCNOMKLQOENOQOEP>QNJP NGJPNH>QFK9PJPHQ<>QNLQNFFPAON<GPQEPNGOEQMLIDJNLFPQAGNLQFNLQPGPFOQOKQ KAO KDO QKBQOEPQ/KJJMIQ3KGGP@PQAGNLQNLHQLKOQAN>QOEPQMLIDJNLFPQBPP= 8;5*;<79:>-== ==================================================================================!8=88 4EMIQBPPQMLFGDHPIQFENJ@PIQBKJQNFNHPCMFQNOOMJP;QHMAGKCN;QNLHQPAPLIPIQBKJ @JNHDNOMKL= !;<=>+=76<8;<79:>-========================================================================= 1%=88 /DIOQ<PQANMHQ<>QIODHPLOIQJP@MIOPJML@QNBOPJQOEPQ<P@MLLML@QKBQFGNIIPI= 0 =/7;4>98>"=47: *=:<>2;,7:;<79:>-=========================================== 08=88 +PJIKLIQHPIMJML@QOKQON PQNQIAPFMNGQPNCMLNOMKLQKJQNQHPGML$DPLOQBMLNGQP6 2110


MORRIS COLLEGE CATALOG NCMLNOMKLQ CDIOQ AN>Q OEMIQ BPPQ NBOPJQ ?EMFEQ OEPQ FNIEMPJQ ?MGGQ 9NGMHNOPQ NLH MIIDPQNQIAPFMNGQPNCMLNOMKLQAPJCMO= (8;:6/87 <>-==..................................................................................... *=88 # AKLQ@JNHDNOMKL;QKLPQFPJOMBMPHQOJNLIFJMAOQKBQNLQNFNHPCMFQJPFKJHQMIQMIIDPH ?MOEKDOQFENJ@PQNBOPJQ?EMFEQPNFEQNHHMOMKLNGQJP$DPIOQJP$DMJPIQAN>CPLOQKBQN OJNLIFJMAOQBPP=Q4JNLIFJMAOQBPPIQOENOQNJPQIPLOQOKQOEPQFKGGP@PQ<>QCNMGQIEKDGH NG?N>IQ<PQMLQOEPQBKJCQKBQNQFNIEMPJIQFEPF ;QFPJOMBMPHQFEPF ;QCKLP>QKJHPJ; KJQCNKJQFJPHMOQFNJH;QNLHQLP9PJQMLQOEPQBKJCQKBQFNIE= 89#=6679:;4>%8;:7;<79:>-==........................................................ 0=%8 The Professional Organization Fee, which provides liability insurance as DEHQHÃ&#x20AC;WRIPHPEHUVKLSLVDQDQQXDOIHHIRUHDFKRIWKHDFDGHPLF\HDV during which a student is enrolled in one of the following courses: EDU: 251 Foundations of Education, EDU: 302 Educational Psychology, EDU: 304 Educational Assessment and Evaluation, EDU: 306 Classroom Behavior and Development, EDU: 310 Curriculum, Instruction and Assessment in Language Development and Communication Skills, EDU: 312 Curriculum, Instruction and Assessment in Health and Physical Education, EDU: 313 Curriculum, Instruction and Assessment in Social Studies, EDU: 319 Literature for Children and Adolescents, EDU: 320 Curriculum, Instruction and Assessment in Visual and Performing Arts, EDU: 321 Curriculum, Instruction and Assessment for Early Childhood and Elementary Classrooms, EDU: 400 Curriculum, Instruction and Assessment in Reading, EDU 402: Observation and Directed Teaching (Early Childhood Education, EDU 403: Observation and Directed Teaching (Elementary Education), EDU: 406 Curriculum, Instruction and Assessment in Secondary School Science, EDU: 407 Curriculum, Instruction and Assessment in Secondary School Social Studies, EDU: 412 Observation and Directed Teaching (Secondary Education, EDU: 413 Curriculum, Instruction and Assessment in Secondary School Mathematics, EDU: 415 Curriculum, Instruction and Assessment in Secondary School English, EDU 430: DiDJQRVLVDQG&RUUHFWLRQRI5HDGLQJ'LIÃ&#x20AC;FXOWLHV0$70DWKHPDWLFVIRU Early Childhood and Elementary Classrooms, HSC: 320 Foundations of Health Education, HSC: 492 Internship, REC: 310 Recreation for Special Populations, REC: 440 Internship. 0<*5=:<>(=;/'7:>-==$$$$$$$$$$$$$$$$........$088=88 4EPQ:ODHPLOQ4PNFEML@Q5PPQMIQFENJ@PHQBKJQPNFEQKBQOEPQBKGGK?ML@QFKDJIPI NLHQMIQAN>N<GPQNOQOEPQ<P@MLLML@QKBQOEPQIPCPIOPJQHDJML@Q?EMFEQOEPQIODHPLO PLJKGGIQMLQOEPQBKGGK?ML@QFKDJIPQKJQFKDJIPI) 2' # Q *81)Q ( <IPJ9NOMKLQ NLHQ ' MJPFOPHQ 4PNFEML@Q -2NJG>Q 3EMGHEKKHQ 2HDFN6 OMKL,;Q2' # Q*8&)Q( <IPJ9NOMKLQNLHQ' MJPFOPHQ4PNFEML@Q-2GPCPLONJ>Q2HDFN6 OMKL,;Q2' # Q*01)Q( <IPJ9NOMKLQNLHQ' MJPFOPHQ4PNFEML@Q-:PFKLHNJ>Q2HDFN6 OMKL, +99,>+=6=8;<79:>-== ================================================================== 088=88 -:PPQ PIMHPLFPQ NGGI , +=#*:5>947/ 4EPQ  M@EPJQ 2HDFNOMKLQ 7CPLHCPLOIQ KBQ 0!Q -+D<GMFQ "N?Q 08%61**, FENL@PHQ ID<IONLOMNGG>Q OEPQ ?N>Q BDLHIQ ANMHQ OK?NJHQ NQ IODHPLOIQ PHDFNOMKL 22


FINANCIAL INFORMATION NJPQOKQ<PQENLHGPHQ?EPLQNQJPFMAMPLOQKBQ:ODHPLOQ5MLNLFMNGQ7MHQ-:57,QBDLHI ?MOEHJN?IQBJKCQIFEKKG=Q/KJJMIQ3KGGP@P;QOEPJPBKJP;QENIQFENL@PHQMOIQJPBDLH AKGMF>Q OKQ FKMLFMHPQ ?MOEQ OEPQ P?Q M@EPJQ 2HDFNOMKLQ PODJLQ KBQ 4MOGPQ . 5DLHIQ+KGMF>= 7Q IODHPLOQ ?EKQ ?MOEHJN?IQ BJKCQ OEPQ 3KGGP@PQ NBOPJQ JP@MIOJNOMKLQ <DOQ <PBKJP EPIEPQENIQFKCAGPOPHQ8QAPJFPLOQKBQOEPQAPJMKHQKBQPLJKGGCPLOQMIQPLOMOGPHQOK NQFJPHMOQKBQODMOMKL;QBPPI;QJKKCQNLHQ<KNJHQ<NIPHQKLQOEPQBKGGK?ML@QBKJCDGN) ('=> =8/=:<;=>9#> <'=> =8795>9#>=:8944,=:<> /9, 4=<=5> 4EPQLDC<PJQKBQFNGPLHNJQHN>IQFKCAGPOPHQMLQOEPQAPJMKHQNIQKBQOEPQHN>QOEPQIODHPLOQ?MOEHJP? 4EPQLDC<PJQKBQFNGPLHNJQHN>IQMLQOEPQAPJMKHQKBQPLJKGGCPLO

=8/=:<;=>9#><'=> =8795>9#>=:8944,=:<>/9, 4=<=5>>3:6<7<*<79:;4 /';8=6>>15*6<=5>/';8=6>;#<=8>7<'58;;4 Example: 15 days completed prior to withdrawal = 33% period of enrollment 45 days in period of enrollment completed 33% x $9,599.00 = $3168.00 adjusted charges :ODHPLOIQ?EKQCK9PQKBBQFNCADIQHDJML@QOEPQIPCPIOPJQBKJQNL>QJPNIKLQKOEPJQOENL ?MOEHJN?NGQ?MGGQLKOQJPFPM9PQNL>QJPBDLHQKBQOEPMJQJKKCQNLHQ<KNJHQFENJ@PI=Q4EPQML6 IDJNLFPQBPPQNGIKQMIQLKL6JPBDLHN<GP= (42)Q4EPQAJPFPHML@QBKJCDGNQMIQNGIKQDIPHQOKQHPOPJCMLPQEK?QCDFEQ:57Q+JK@JNCQBDLHIQOEPQIODHPLO ENIQPNJLPHQNOQOEPQOMCPQKBQ?MOEHJN?NG=Q7BOPJQOEPQ8QAPJFPLOQAKMLOQMLQOEPQAPJMKHQKBQPLJKGGCPLO;QNQIOD6 HPLOQENIQPNJLPHQ088QAPJFPLOQKBQOEPQ:57Q+JK@JNCQBDLHI=Q-:PPQ3KLIDCPJQ.LBKJCNOMKLQDGGPOML=,

-3)1)31!>13" /KJJMIQ3KGGP@PQ<PGMP9PIQOENOQLKQIODHPLOQIEKDGHQ<PQHPLMPHQNQFKGGP@PQPHD6 FNOMKLQ<PFNDIPQKBQNQGNF QKBQJPIKDJFPIQNLHQMLQIDAAKJOQKBQOEMIQMHPN;QOEPQFKG6 GP@PQCNMLONMLIQNQLDC<PJQKBQBMLNLFMNGQNMHQAJK@JNCIQHPIM@LPHQOKQAJK9MHPQNI6 IMIONLFPQOKQMOIQLPPH>QIODHPLOI=Q4EMIQNIIMIONLFPQMIQKBBPJPHQOKQOEPQPOPLOQOENO BDLHIQNJPQN9NMGN<GPQMLQOEPIPQAJK@JNCI;QNLHQOEPQAJK@JNCIQOEPCIPG9PIQNJPQBM6 LNLFPHQ<>QOEPQBPHPJNGQNLHQIONOPQ@K9PJLCPLOQNIQ?PGGQNIQOEJKD@EQ9NJMKDIQML6 IOMODOMKLNGQ NLHQ AJM9NOPQ IKDJFPI=Q 7CKL@Q OEPQ MLHIQ KBQ BMLNLFMNGQ NMHQ N?NJHI OENOQ NJPQ N9NMGN<GPQOKQ IODHPLOIQNJPQ OEPQ 5PHPJNGQ+PGGQJNLO;Q5PHPJNGQ:DAAGP6 CPLONGQ2HDFNOMKLNGQ(AAKJODLMO>QJNLO;QMGGMNCQ'=Q5KJHQ5PHPJNGQ'MJPFOQ:OD6 HPLOQ "KNL;Q 5PHPJNGQ 3KGGP@PQ KJ 6:ODH>;Q :KDOEQ 3NJKGMLNQ 4DMOMKLQ JNLO; :KDOEQ 3NJKGMLNQ "MBPQ :FEKGNJIEMA;Q :KDOEQ 3NJKGMLNQ KAPQ :FEKGNJIEMA;Q +NG6 CPOOKQ 5PGGK?IQ :FEKGNJIEMA;Q :KDOEQ 3NJKGMLNQ NOMKLNGQ DNJHQ :ODHPLOQ "KNL PAN>CPLOQ+JK@JNC;Q:KDOEQ3NJKGMLNQ4PNFEPJQ"KNL;Q5PHPJNGQ'MJPFOQ+NJPLO "KNL;QNLHQNQLDC<PJQKBQIFEKGNJIEMAIQNLHQKOEPJQ<PLPBMOIQAJK9MHPHQ<>QOEPQFKG6 GP@P;QAJM9NOPQN@PLFMPI;QNLHQOEPQBPHPJNGQ@K9PJLCPLO= 7GGQIODHPLOIQNAAG>ML@QBKJQNHCMIIMKLQOKQ/KJJMIQ3KGGP@PQNJPQPGM@M<GPQOKQNAAG> BKJQIODHPLOQBMLNLFMNGQNMHQNLHQNJPQPLFKDJN@PHQOKQNAAG>QBKJQIDFEQNMH=Q:ODHPLOI IPP ML@QBMLNLFMNGQNMHQIEKDGHQFKCAGPOPQOEPQBKGGK?ML@) -0, /KJJMIQ3KGGP@PQ7AAGMFNOMKLQBKJQ7MH -1, 5JPPQ 7AAGMFNOMKLQ BKJQ 5PHPJNGQ :ODHPLOQ 7MHQ -575:7,Q -KLQ OEPQ ?P<Q NO ???=BNBIN=PHD=@K9=, 23


MORRIS COLLEGE CATALOG -&, 7AAG>QBKJQOEPQ:KDOEQ3NJKGMLNQ4DMOMKLQJNLOQ<>QGMIOML@Q/KJJMIQ3KGGP@PQML OEPQFKGGP@PQFEKMFPQIPFOMKLQKBQOEPQ575:7= -*, 5PHPJNGQ+NJPLOQ"KNLQ7AAGMFNOMKLQ-KAOMKLNG, +3%+3(>"21"!3)20>-%+>-3)1)31!>13" 5NGGQ:PCPIOPJ============================================================================ 7AJMGQ&8 :AJML@Q:PCPIOPJ ================================================================= (FOK<PJQ&8 :DCCPJQ:PIIMKL==================================================================== /NJFEQ&8 5KJQNHHMOMKLNGQMLBKJCNOMKL;QFKLONFOQOEPQ(BBMFPQKBQ5MLNLFMNGQ7MHQNOQ-!8&,Q&*6 &1&!QKJQ-!8&,Q&*6&1*%=Q4EPQ(BBMFPQMIQGKFNOPHQMLQOEPQ/N<PGQ =QK?NJHQDMGHML@= :ODHPLOIQ ?EKQ NJPQ JPIMHPLOIQ KBQ :KDOEQ 3NJKGMLNQ IEKDGHQ NAAG>Q BKJQ NQ :KDOE 3NJKGMLNQ 4DMOMKLQ JNLO=Q 7AAGMFNOMKLIQ IEKDGHQ <PQ ID<CMOOPHQ NBOPJQ NLDNJ>Q 0 OEPQ >PNJQ OEPQ IODHPLOQ MIQ AGNLLML@Q OKQ NOOPLHQ FKGGP@P=Q 7GGQ PGM@M<GPQ NAAGMFNOMKLI JPFPM9PHQOEJKD@EQDLPQ&8Q?MGGQ<PQBDLHPH= 7AAGMFNOMKLQBKJQNQ:KDOEQ3NJKGMLNQ4DMOMKLQJNLOQMIQCNHPQ<>QFKCAGPOML@QOEP 5JPPQ 7AAGMFNOMKLQ BKJQ 5PHPJNGQ :ODHPLOQ 7MHQ -575:7,=Q >Q ID<CMOOML@Q OEP 575:7QOKQOEPQBPHPJNGQAJKFPIIKJQNLHQ<>QGMIOML@Q/KJJMIQ3KGGP@PQMLQOEPQFKGGP@P FEKMFPQIPFOMKL;QOEPQ4DMOMKLQJNLOIQ3KCCMIIMKLQ?MGGQ<PQN<GPQOKQPGPFOJKLMFNGG> HJN?QHK?LQOEPQNAAGMFNOMKL= :ODHPLOIQ ?EKQ LPPHQ NHHMOMKLNGQ MLBKJCNOMKLQ N<KDOQ BMLNLFMNGQ NMHQ AJK@JNCI KJQ ?EKQ LPPHQ HMJPFOQ NIIMIONLFPQ MLQ FKCAGPOML@Q BMLNLFMNGQ NMHQ NAAGMFNOMKLI IEKDGHQPMOEPJQFKCPQOKQOEPQ5MLNLFMNGQ7MHQ(BBMFPQNOQOEPQFKGGP@PQKJQ?JMOPQKJQOPGP6 AEKLP) (BBMFPQKBQ5MLNLFMNGQ7MH /KJJMIQ3KGGP@P 088QPIOQ3KGGP@PQ:OJPPO :DCOPJ;Q:KDOEQ3NJKGMLNQ10%8 4PGPAEKLP)-!8&,Q&*6&1&!QKJQ-!8&,Q&*6&1*% P6CNMG)Q5MLNMH/KJJMI=PHD 4EPQKBBMFPQMIQGKFNOPHQMLQOEPQ/N<PGQ =QK?NJHQDMGHML@QNLHQMIQKAPLQ/KL6 HN>QOEJKD@EQ5JMHN>;Q!)88Q7=/=QOKQ%)88Q+=/= %!3>%)>01(30-1(%+>11"23>+%+200>-%+> 2!333!3(>(%>+2232>-2"2+1!>-3)1)31!>13">-)"0

  /KJJMIQ3KGGP@PIQ+KGMF>QKLQ:NOMIBNFOKJ>Q7FNHPCMFQ+JK@JPIIQENIQ<PPLQHP6 9PGKAPHQ MLQ NFFKJHNLFPQ ?MOEQ OEPQ 5PHPJNGQ P@DGNOMKLIQ OENOQ NJPQ HPBMLPHQ ML +D<GMFQ "N?Q *6*!1Q -#=:=Q 'PANJOCPLOQ KBQ 2HDFNOMKL,;Q ?EMFEQ JP$DMJPQ PNFE IODHPLOQJPFPM9ML@QBPHPJNGG>QBDLHPHQIODHPLOQBMLNLFMNGQNMHQOKQCN PQINOMIBNFOKJ> NFNHPCMFQAJK@JPIIQNIQNQFKLHMOMKLQBKJQFKLOMLDML@QOKQJPFPM9PQBPHPJNGG>QBDLHPH IODHPLOQ BMLNLFMNGQ NMH=Q 7FFKJHML@G>;Q PNFEQ IODHPLOQ ?EKQ JPFPM9PIQ BPHPJNGG> BDLHPHQ IODHPLOQ BMLNLFMNGQ NIIMIONLFPQ NOQ /KJJMIQ 3KGGP@PQ CDIOQ NHEPJPQ OKQ OEMI AKGMF>Q MLQ KJHPJQ OKQ FKLOMLDPQ JPFPM9ML@Q NL>Q O>APQ KBQ BPHPJNGQ BMLNLFMNGQ NIIMI6 ONLFP=     4KQ <PQ PGM@M<GPQ BKJQ OEPQ BPHPJNGG>Q BDLHPHQ BMLNLFMNGQ NMHQ NOQ /KJJMIQ 3KGGP@P;Q N IODHPLOQCDIOQCPPOQOEPQBKGGK?ML@QIONLHNJHI) 24


FINANCIAL INFORMATION 0=4EPQIODHPLOQCDIOQ<PQNHCMOOPHQNLHQPLJKGGPHQMLQNLQNFNHPCMFQAJK@JNC= 1=4EPQ IODHPLOQ CDIOQ CPPOQ OEPQ 3KGGP@PIQ NFNHPCMFQ IONLHNJHIQ OENOQ NJP IAPFMBMPHQMLQOEPQ/KJJMIQ3KGGP@PQ3NONGK@= &=Q7QIODHPLOQ?EKQMIQJP$DMJPHQOKQON PQHP9PGKACPLONGQFKDJIPIQ?MGGQ<PQPGM@M6 <GPQOKQJPFPM9PQBMLNLFMNGQNMHQOKQFK9PJQHP9PGKACPLONGQFKDJIPIQBKJQKLG>QOEPQBMJIO NFNHPCMFQ>PNJ= *=Q7QIODHPLOQ?EKQMIQIPP ML@QOKQPLJKGGQNOQNLKOEPJQMLIOMODOMKLQNIQNQOJNLIMPLO IODHPLOQ?MGGQ<PQFKLIMHPJPHQOKQJPFPM9PQBMLNLFMNGQNMHQBKJQIDCCPJQIFEKKGQPLJKGG6 CPLOQKLG>=Q4EPQIODHPLOQCDIOQCN PQNQIAPFMNGQJP$DPIOQOKQOEPQ(BBMFPQKBQ5MLNL6 FMNGQ7MHQKLPQCKLOEQAJMKJQOKQPLJKGGCPLO=Q4EPQIODHPLOQCDIOQNGIKQEN9PQOEPQNA6 AJK9NGQKBQOEPQ7FNHPCMFQ'PNL=Q 7Q IODHPLOQ ?EKQ MIQ IPP ML@Q NHCMIIMKLQ OKQ OEPQ 3KGGP@PQ OKQ ADJIDPQ NLKOEPJ NFEPGKJIQ HP@JPPQ ?MGGQ LKOQ <PQ PGM@M<GPQ BKJQ BMLNLFMNGQ NMHQ DLGPIIQ EPIEPQ ENI <PPLQ NFFPAOPHQ MLOKQ OEPQ 4PNFEPJQ 2HDFNOMKLQ +JK@JNC=Q 4EPIPQ IODHPLOIQ ?MGG <PQ FGNIIMBMPHQ NIQ BMBOE6>PNJQ DLHPJ@JNHDNOPI=Q 5KJQ BMLNLFMNGQ NMHQ ADJAKIPI;Q NGG FKDJIPIQON PLQCDIOQ<PQBKJQOPNFEPJQFPJOMBMFNOMKL= 4EPQ M@EPJQ 2HDFNOMKLQ 7FOQ JP$DMJPIQ OENOQ MLQ KJHPJQ OKQ JPFPM9PQ NL>Q 4MOGPQ . 7MHQ -5PHPJNGQ +PGGQ JNLO;Q 5PHPJNGQ :DAAGPCPLONGQ 2HDFNOMKLNGQ (AAKJODLMO> JNLOQ-5:2(,;Q5PHPJNGQKJ 6:ODH>Q-5:,;Q5PHPJNGQ4273QJNLO;Q5PH6 PJNGQ 'MJPFOQ "KNL;Q 5PHPJNGQ 'MJPFOQ +NJPLOQ "KNLQ BKJQ #LHPJ@JNHDNOPQ :ODHPLOI -+"#:,;QNQIODHPLOQCDIOQCNMLONMLQINOMIBNFOKJ>QNFNHPCMFQAJK@JPIIQOK?NJHIQN HP@JPP=Q4EPQINOMIBNFOKJ>QNFNHPCMFQAJK@JPIIQNAAGMPIQOKQNGGQOPJCIQJP@NJHGPII KBQ?EPOEPJQBMLNLFMNGQNMHQ?NIQJPFPM9PH=       4KQ<PQFKLIMHPJPHQCNMLONMLML@Q:NOMIBNFOKJ>Q7FNHPCMFQ+JK@JPIIQBKJQ5PHPJ6 NGQ5.MLNLFMNGQ7MH;QNQIODHPLOQCDIOQCPPOQOEPQBKGGK?ML@QCMLMCDCQJP$DMJPCPLOI) 4KONG:PCPIOPJ 2NJLPHQQKBQ3DCDGNOM9P KDJIQ7OOPCAOPH 3DCDGNOM9PQ+7 KDJIQ7OOPCAOPH #AQOKQ1* 0=%8  1%QOKQ%% 0=8  NBOPJQBKDJQIPCPIOPJIQKBQPLJKGGCPLO 1=88  5KJQ IONOPQ BDLHIQ OEPQ IODHPLOQ CDIOQ PNJLQ NQ CMLMCDCQ KBQ O?PLO>6BKDJQ -1*, IPCPIOPJQEKDJIQPNFEQNFNHPCMFQ>PNJ;QKJQO?PG9PQEKDJIQBKJQKLPQIPCPIOPJQKB PLJKGGCPLO;Q NLHQ CDIOQ CPPOQ 5PHPJNGQ :NOMIBNFOKJ>Q 7FNHPCMFQ +JK@JPIIQ JP6 $DMJPCPLOI=   4EPQ N9PJN@PQ GPL@OEQ KBQ NLQ DLHPJ@JNHDNOPQ AJK@JNCQ NOQ /KJJMIQ 3KGGP@PQ MI 01Q FJPHMOQ EKDJI=Q 7LQ DLHPJ@JNHDNOPQ IODHPLOQ MIQ PGM@M<GPQ OKQ JPFPM9PQ BMLNLFMNG NMHQBKJQNQCNMCDCQKBQ0%8QKBQOEPQEKDJIQJP$DMJPHQBKJQOEPQHP@JPP=Q4EPQ:OD6 HPLOQ5MLNLFMNGQ7MHQ(BBMFPQ?MGGQNGGK?QIODHPLOIQ0!QNOOPCAOPHQEKDJIQMLFGDHML@ IDCCPJQIFEKKGQBKJQFKCAGPOMKLQKBQNQ01QIPCPIOPJQEKDJQHP@JPP=Q7GGQNOOPCAO6 PHQEKDJIQNJPQFKDLOPHQMLQHPOPJCMLML@QOEPQ0!QEKDJIQGMCMO;QMLFGDHML@QOJNLIBPJ EKDJI;Q ?EPOEPJQ KJQ LKOQ BMLNLFMNGQ NMHQ ?NIQ JPFPM9PH;Q KJQ OEPQ FKDJIPQ ?KJ Q ?NI IDFFPIIBDGG>QFKCAGPOPH=Q7QIODHPLOQ?MGGQ<PQFKLIMHPJPHQOKQEN9PQJPNFEPHQOEP CNMCDCQLDC<PJQKBQEKDJIQNBOPJQOEPQIPCPIOPJQMLQ?EMFEQOEPQ0!QNOOPCAOPH EKDJIQMIQJPNFEPHQKJQPFPPHPH= 25


MORRIS COLLEGE CATALOG 5PHPJNGQ +PGGQ JNLOQ 'DJNOMKLQ KBQ 2GM@M<MGMO>P@MLLML@Q ?MOEQ 7?NJHQ PNJ 18016180&;Q OEPQ HDJNOMKLQ KBQ NQ IODHPLOIQ PGM@M<MGMO>Q OKQ JPFPM9PQ NQ 5PHPJNGQ +PGG JNLOQMIQJPHDFPHQBJKCQ0!QIPCPIOPJIQKJQMOIQP$DM9NGPLOQOKQ01QIPCPIOPJIQKJQMOI P$DM9NGPLO=Q 4EMIQ JP$DMJPCPLOQ NAAGMPIQ OKQ NGGQ IODHPLOI;Q JP@NJHGPIIQ KBQ ?EPL OEP>QBMJIOQPLJKGGPHQMLQNL>QAKIOIPFKLHNJ>QMLIOMODOMKL= :NOMIBNFOKJ>QAJK@JPIIQ?MGGQ<PQP9NGDNOPHQBKJQNGGQIODHPLOIQ-BDGGQKJQANJO6OMCP, NOQOEPQPLHQKBQPNFEQNFNHPCMFQ>PNJQ-PLHQKBQIAJML@QIPCPIOPJ,=Q:ODHPLOIQ?EK PLJKGGQ NOQ OEPQ CMH6AKMLOQ -NLDNJ>,Q KBQ NLQ NFNHPCMFQ >PNJQ KJQ NOOPLHQ KLP IPCPIOPJQKLG>Q?MGGQ<PQP9NGDNOPHQNOQOEPQPLHQKBQOEPQIAJML@QIPCPIOPJ= -;74*8=> <9> =;8:> <'=> 8= *78=5> 8;5=> 97:<> ;=8;=> ;:5> /*,*4;<7= '9*86> 744> 4;/=> <'=> 6<*5=:<> 9:> #7:;:/7;4> ;75> 6*6 =:679:.> 0<*5=:<6 '9> ;8=> 6*6 =:5=5> #89,> #7:;:/7;4> ;75> ,*6<> 8=,9=> <'=78> ;/;5=,7/ 5=#7/7=:/7=6> 98> ';=> ;:> ; =;4> 8;:<=5> =#98=> 8=7:6<;<=,=:<> 9#> ;75. 144>6<*5=:<6>;8=>=:/9*8;=5><9>;<<=:5>6*,,=8>6/'994><9>8=,9=><'=78 5=#7/7=:/7=6> 98> <9> =<> ;'=;5.> > 1> 6<*5=:<> '9> 59=6> :9<> =:8944> #98> ; 6=,=6<=8>;:5>8==:89446>744>=>=;4*;<=5>;<><'=><7,=>9#>8=;5,76679:. 'POPJCMLNOMKLQKBQNFNHPCMFQGKNHQMIQCNHPQNOQOEPQPLHQKBQOEPQNHHHJKAQAPJM6 KHQ PNFEQ IPCPIOPJ=Q MOEHJN?ML@Q BJKCQ FGNII-PI,Q NBOPJQ OEPQ NHHHJKAQ APJMKH CN>QNBBPFOQOEPQIODHPLOIQN<MGMO>QOKQPNJLQOEPQJP$DMJPHQEKDJI=     7Q ANJO6OMCPQ DLHPJ@JNHDNOPQ IODHPLOQ MIQ PLJKGGPHQ MLQ GPIIQ OENLQ O?PG9PQ -01, IPCPIOPJQEKDJI=Q+NJO6OMCPQIODHPLOIQCDIOQCPPOQOEPQINCPQ@JNHPQAKMLOQN9PJ6 N@PQ JP$DMJPCPLOQ BKJQ PGM@M<MGMO>Q NIQ NQ BDGG6OMCPQ IODHPLOQ NLHQ CDIOQ PNJLQ OEP INCPQ APJFPLOQ KBQ OEPQ ANJO6OMCPQ EKDJIQ PLJKGGPH=Q :ODHPLOIQ ?EKQ NOOPLHQ ?MOE CMPHQ PLJKGGCPLOQ -P=@=Q BDGG6OMCP6BMJIOQ IPCPIOPJQ NLHQ ANJO6OMCP6IPFKLH IPCPIOPJ,QCDIOQPNJLQ01QEKDJIQBKJQOEPQBDGG6OMCPQIPCPIOPJQNLHQ%QAPJFPLOQKB OEPQANJO6OMCPQEKDJI=Q 5NMGDJPQ OKQ CPPOQ OEPQ CMLMCDCQ IONLHNJHIQ KDOGMLPHQN<K9PQ?MGGQJPIDGOQMLQ MC6 CPHMNOPQBMLNLFMNGQNMHQIDIAPLIMKL= 7Q IODHPLOQ ?EKQ ENIQ LKOQ JPFPM9PHQ BMLNLFMNGQ NIIMIONLFPQ MLQ AJP9MKDIQ N?NJH >PNJIQNLHQID<IP$DPLOG>QNAAGMPIQBKJQBMLNLFMNGQNMHQ?MGGQ<PQP9NGDNOPHQ<NIPHQKL OEPQAKGMF>QGMIOPHQN<K9P= 4JNLIBPJQIODHPLOIQ?MGGQ<PQP9NGDNOPHQ<NIPHQKLQOEPQN<K9PQAKGMF>=Q4JNLIBPJ FJPHMOIQ MLFGDHPQ EKDJIQ PNJLPHQ NOQ MLIOMODOMKLIQ KOEPJQ OENLQ /KJJMIQ 3KGGP@PQ NLH ?MGGQ<PQDIPHQOKQHPOPJCMLPQOEPQIODHPLOIQFGNIIMBMFNOMKL=Q4JNLIBPJQEKDJIQ?MGGQ<P MLFGDHPHQ MLQ OKONGQ EKDJIQ NOOPCAOPH Q MLQ HPOPJCMLML@Q OEPQ 0!Q EKDJIQ JP$DMJP6 CPLOQNLHQOKQHPOPJCMLPQOEPQFDCDGNOM9PQ@JNHPQAKMLOQN9PJN@PQJP$DMJPH=Q4JNLI6 BPJQIODHPLOIQNJPQJP$DMJPHQOKQPNJLQOEPQJP$DMJPHQLDC<PJQKBQEKDJIQHPAPLHML@ DAKLQPLJKGGCPLOQIONODIQ-BDGGQKJQANJO6OMCP,=QKDJIQOJNLIBPJJPHQMLQNL>OMCPQNBOPJ OEPQIODHPLOQPLJKGGCPLOQ-NOQGPNIOQ0QIPCPIOPJ,Q?MGGQ<PQDIPHQOKQNIIMIOQOEPQIOD6 HPLOQMLQJP@NMLML@QBMLNLFMNGQNMHQPGM@M<MGMO>= MOEHJN?NGIQ-;Q5;QNLHQ+Q@JNHPI,QOENOQNJPQJPFKJHPHQKLQOEPQIODHPLOI OJNLIFJMAOQ?MGGQ<PQMLFGDHPHQNIQFJPHMOIQNOOPCAOPHQNLHQ?MGGQEN9PQNLQNH9PJIPQPB6 BPFOQ KLQ OEPQ IODHPLOIQ N<MGMO>Q OKQ CNMLONMLQ INOMIBNFOKJ>Q NFNHPCMFQ AJK@JPII= :ODHPLOIQ?EKQKBBMFMNGG>Q?MOEHJN?QBJKCQOEPQ3KGGP@PQNJPQFKLIMHPJPHQLKOQOKQ<P 26


FINANCIAL INFORMATION CNMLONMLML@Q INOMIBNFOKJ>Q NFNHPCMFQ AJK@JPIIQ NLHQ CDIOQ CN PQ DAQ OEPQ HPBMFMO EKDJI=Q4EPIPQIODHPLOIQNJPQPLFKDJN@PHQOKQNOOPLHQIDCCPJQIFEKKG= 4EPQIDFFPIIBDGQFKCAGPOMKLQKBQNQFKDJIPQMIQHPBMLPHQNIQJPFPM9ML@QKLPQKBQOEP BKGGK?ML@Q @JNHPI)Q 7;Q ;Q 3Q KJQ '=Q 3KDJIPIQ ?MOEQ @JNHPIQ KBQ 5;Q .;Q ;Q 5;Q NLH +Q?MGGQLKOQ$DNGMB>QMLQCPPOML@QOEPQCMLMCDCQIONLHNJH= 7LQ .LFKCAGPOPQ -.,Q @JNHPQ MLHMFNOPIQ OENOQ NQ IODHPLOQ ENIQ LKOQ BMLMIEPHQ NGG FKDJIPQ?KJ QJP$DMJPHQBKJQNQ@JNHPQNLHQMIQMLFGDHPHQMLQOEPQFDCDGNOM9PQFJPHMOI NOOPCAOPH=Q7LQMLFKCAGPOPQ?MGGQLKOQFKDLOQNIQEKDJIQANIIPHQDLOMGQNQBMLNGQ@JNHP MIQAKIOPHQMLQOEPQ(BBMFPQKBQ7HCMIIMKLIQNLHQPFKJHI= 7Q IODHPLOQ KLQ BMLNLFMNGQ NMHQ CN>Q JPAPNOQ NQ FKDJIPQ ?MOEKDOQ APLNGO>Q NIQ GKL@ NIQOEPQIODHPLOQENIQLKOQPNJLPHQNQANIIML@Q@JNHP=Q.BQOEPQIODHPLOQENIQPNJLPHQN ANIIML@Q@JNHP;QOEPQJPAPNOPHQFKDJIPQ?MGGQLKOQ<PQFKDLOPHQMLQHPOPJCMLML@QOEP LDC<PJQKBQEKDJIQKBQPLJKGGCPLOQBKJQBMLNLFMNGQNMHQADJAKIPI= 3ENL@PQ KBQ CNKJQ 6Q 7Q IODHPLOQ CN>Q FENL@PQ BJKCQ KLPQ HP@JPPQ OKQ NLKOEPJ HDJML@QNOOPLHNLFPQNOQOEPQ3KGGP@P=Q:ODHPLOIQ?EKQFENL@PQBJKCQKLPQCNKJQOK NLKOEPJQ NJPQ IOMGGQ PAPFOPHQ OKQ CNMLONMLQ INOMIBNFOKJ>Q NFNHPCMFQ AJK@JPIIQ NLH FKCAGPOPQOEPQFKDJIPQ?KJ Q?MOEMLQOEPQOMCPQBJNCPQKJQEKDJIQGMCMONOMKL= 7DHMOPHQFKDJIPIQHKQLKOQFKDLOQNIQPMOEPJQNOOPCAOPHQKJQPNJLPHQEKDJI= 5MLNLFMNGQ7MHQIODHPLOIQ?EKIPQFDCDGNOM9PQ@JNHPQAKMLOQN9PJN@PQBNGGIQ<PGK? NQ1=8QNBOPJQOEPQ5NGGQIPCPIOPJQ?MGGQJPFPM9PQNQ?NJLML@QGPOOPJQBJKCQOEPQ(BBMFPQ(B 7HCMIIMKLIQNLHQPFKJHI= 4EPQ LDC<PJQ KBQ FJPHMOQ EKDJIQ MLQ ?EMFEQ OEPQ IODHPLOQ MIQ PLJKGGPHQ KLQ OEPQ HN> BKGGK?ML@QOEPQAD<GMIEPHQGNIOQHN>QOKQNHHHJKAQNQFGNIIQ?MGGQ<PQDIPHQNIQKBBMFMNG PLJKGGCPLOQBKJQBMLNLFMNGQNIIMIONLFPQADJAKIPIQBDGG6OMCPQIONODIQMIQ01QKJQCKJP EKDJI=Q .BQ NQ IODHPLOQ ?MOEHJN?IQ BJKCQ FGNIIPIQ NBOPJQOEPQ HNOPQ FMOPHQ N<K9PQ NLH JPHDFPIQEMIEPJQPLJKGGCPLOQ<PGK?QOEPQN?NJHPHQIONODI;Q-OEPQLDC<PJQKBQEKDJI JPFKJHPHQ NIQ KBQ OEPQ NHHHJKAQ HNOP,Q OEPQ IODHPLOQ ?MGGQ LKOQ CPPOQ OEPQ CMLMCDC LDC<PJQKBQEKDJIQOKQ<PQPNJLPHQMLQKLPQNFNHPCMFQ>PNJ= Q(42)QKDJIQPNJLPHQ<>Q7H9NLFPHQ+GNFPCPLO;Q.LOPJLNOMKLNGQNFFNGND6 JPNOPQ NLHQ 3KGGP@PQ "P9PGQ 2NCMLNOMKLQ +JK@JNCQ -3"2+,Q NJPQ FKLIMHPJPHQ OK6 ?NJHIQ CPPOML@Q OEPQ IPCPIOPJQ EKDJIQ JP$DMJPCPLOQ KLG>Q BKJQ NQ IODHPLOIQ BMJIO NFNHPCMFQ>PNJ= P6NHCMOOPHQ :ODHPLOIQ ?MGGQ <PQ JP9MP?PHQ KLQ OEPMJQ AJP9MKDIQ NFNHPCMF JPFKJHIQMLQKJHPJQOKQHPOPJCMLPQPGM@M<MGMO>QBKJQNIIMIONLFP;Q?EPOEPJQKJQLKOQBMLNL6 FMNGQNMHQ?NIQJPFPM9PH=Q7FNHPCMFNG>QIDIAPLHPHQIODHPLOIQ?EKQNJPQNGGK?PHQOK JPODJLQOKQOEPQ3KGGP@PQCDIOQNOOPLHQKLPQIPCPIOPJQNLHQPNJLQNQCMLMCDCQKBQ01 FJPHMOQEKDJIQNLHQNQ1=8QIPCPIOPJQ@JNHPQAKMLOQN9PJN@P=Q7BOPJQOENOQIPCPIOPJ; OEPQ IODHPLOQ CN>Q NAAPNGQ BKJQ BMLNLFMNGQ NMHQ JPMLIONOPCPLO=Q .BQ OEPQ NAAPNGQ MI @JNLOPH;Q OEPQ IODHPLOQ CDIOQ CPPOQ OEPQ IAPFMBMPHQ PGM@M<MGMO>Q JP$DMJPCPLOIQ BKJ FKLOMLDPHQJPFPMAOQKBQBMLNLFMNGQNMH=Q5MLNLFMNGQNMHQ?MGGQ<PQFNLFPGPHQBKJQNL>QIOD6 HPLOQ?EKQMIQIDIAPLHPHQKJQHMICMIIPHQBJKCQOEPQ3KGGP@P= PCK9NGQBJKCQBMLNLFMNGQNMHQHKPIQLKOQAJP9PLOQIODHPLOIQBJKCQNOOPLHML@QOEP 3KGGP@P;QMBQOEP>QNJPQKOEPJ?MIPQPGM@M<GPQOKQFKLOMLDPQOEPMJQPLJKGGCPLO=Q:ODHPLOI ?EKQPLJKGGQNOQOEPQ3KGGP@PQ?MOEKDOQ<PLPBMOQKBQBMLNLFMNGQNMHQCN>QJP$DPIOQNQJP6 9MP?Q KBQ OEPMJQ NFNHPCMFQ JPFKJHQ NBOPJQ NL>Q OPJCQ MLQ ?EMFEQ OEP>Q NJPQ PLJKGGPH 27


MORRIS COLLEGE CATALOG ?MOEKDOQ OEPQ JPFPMAOQ KBQ BMLNLFMNGQ NMHQ OKQ HPOPJCMLPQ ?EPOEPJQ INOMIBNFOKJ>Q NFN6 HPCMFQ AJK@JPIIQ ENIQ <PPLQ CPO=Q .BQ OEPQ IONLHNJHIQ NJPQ CPO;Q PGM@M<MGMO>Q MIQ JP6 @NMLPHQBKJQID<IP$DPLOQOPJCIQKBQPLJKGGCPLOQMLQOEPQNFNHPCMFQ>PNJ=Q .OQMIQOEPQIODHPLOIQJPIAKLIM<MGMO>QOKQ<PQN?NJPQKBQEMIQKJQEPJQNFNHPCMFQIONLH6 ML@Q PNFEQ IPCPIOPJ=Q 7GOEKD@EQ OEPQ :ODHPLOQ 5MLNLFMNGQ 7MHQ (BBMFPQ ?MGGQ CN P P9PJ>QPBBKJOQOKQAJKCAOG>QLKOMB>QIODHPLOIQKBQOEPQFNLFPGGNOMKLQKBQOEPMJQN?NJHI; IODHPLOIQNJPQJPIAKLIM<GPQBKJQK<ONMLML@QOEPMJQ@JNHPIQNLHQHPOPJCMLML@QMBQOEP> CPPOQOEPQFJMOPJMNQBKJQFKLOMLDNOMKLQKBQOEPMJQN?NJH=        7L>Q IODHPLOQ ?EKIPQ BMLNLFMNGQ NMHQ ENIQ <PPLQ OPJCMLNOPHQ CN>Q JPPION<GMIE INOMIBNFOKJ>QAJK@JPIIQ<>QNL>QKBQOEPQBKGGK?ML@QCPOEKHI)

QON ML@QFKDJIPIQHDJML@QOEPQ:DCCPJQ:PIIMKL-I,

QJPAPNOML@QBNMGPHQFKDJIPI

QJPCK9ML@QMLFKCAGPOPQ@JNHPI 3DCDGNOM9PQ@JNHPQAKMLOQN9PJN@PQFNLQKLG>Q<PQMLFJPNIPHQ<>QNOOPLHNLFPQNO /KJJMIQ3KGGP@P=Q'PBMFMPLOQEKDJIQCN>Q<PQCNHPQDAQ<>QIDFFPIIBDGG>QFKCAGPO6 ML@QFKDJIPQ?KJ QNOQ/KJJMIQ3KGGP@PQKJQNOQNLKOEPJQMLIOMODOMKL=QPBKJPQPLJKGGML@ NOQNLKOEPJQMLIOMODOMKL;QOEPQIODHPLOQCDIOQ@NMLQOEPQNAAJKAJMNOPQNAAJK9NGQBJKC OEPQ7FNHPCMFQ'PNL=   :NOMIBNFOKJ>Q7FNHPCMFQ+JK@JPIIQBKJQIDCCPJQIFEKKGQ?MGGQ<PQ<NIPHQKLQOEP IODHPLOIQFDJJPLOQPGM@M<MGMO>QIONODI=Q:ODHPLOIQ?EKQNJPQIDIAPLHPHQBJKCQBMLNL6 FMNGQNMHQNJPQPLFKDJN@PHQOKQNOOPLHQIDCCPJQIFEKKGQOKQJPCK9PQOEPMJQNFNHPCMF HPBMFMPLFMPI=Q 5PHPJNGQ KJQ IONOPQ BMLNLFMNGQ NIIMIONLFPQ MIQ LKOQ N9NMGN<GPQ OKQ IOD6 HPLOIQ LKOQ CNMLONMLML@Q INOMIBNFOKJ>Q NFNHPCMFQ AJK@JPIIQ BKJQ IDCCPJQ IFEKKG DLGPIIQNLQNAAPNGQMIQNAAJK9PH= 7OQOEPQFKCAGPOMKLQKBQIDCCPJQIFEKKG;QIODHPLOIQNFNHPCMFQIONLHML@QMIQJP6 9MP?PH=Q .BQ OEPQ HPBMFMPLFMPIQ NJPQ JPCK9PHQ NBOPJQ IDCCPJQ IFEKKGQ NOOPLHNLFP; OEPQIODHPLOQMIQN?NJHPHQNLHQ?MGGQLKOQ<PQJP9MP?PHQN@NMLQDLOMGQOEPQPLHQKBQOEP :AJML@Q:PCPIOPJ=Q7QIODHPLOQ?EKQBNMGIQOKQCPPOQKJQCNMLONMLQINOMIBNFOKJ>QNFN6 HPCMFQAJK@JPIIQMIQAGNFPHQKLQBMLNLFMNGQNMHQIDIAPLIMKL= 

  :ODHPLOIQHPLMPHQBPHPJNGQNLHKJQIONOPQBMLNLFMNGQNMHQBKJQBNMGDJPQOKQCPPOQOEP INOMIBNFOKJ>Q NFNHPCMFQ AJK@JPIIQ IONLHNJHIQ NJPQ NH9MIPHQ KBQ OEPMJQ JM@EOQ OKQ NA6 APNGQOEPQHPFMIMKL=Q7QIODHPLOQCN>QJP$DPIOQJPMLIONOPCPLOQKBQOEPMJQBMLNLFMNGQNMH <NIPHQ KLQ POPLDNOML@Q FMJFDCIONLFPIQ <>Q ID<CMOOML@Q NQ FKCAGPOPHQ 5MLNLFMNG 7MHQ+JK<NOMKLQP$DPIOQ5KJCQNFFKCANLMPHQ<>QIDAAKJOML@QHKFDCPLONOMKLQOK OEPQ(BBMFPQKBQ5MLNLFMNGQ7MH;Q088Q=Q3KGGP@PQ:OJPPO;Q:DCOPJ;Q:3Q10%8=Q4EP IODHPLOQ /#:4Q MLHMFNOPQ MLQ ?JMOML@Q -N,Q JPNIKLIQ ?E>Q EPIEPQ HMHQ LKOQ NFEMP9P CMLMCDCQNFNHPCMFQJP$DMJPCPLOI;QNLHQ-<,QJPNIKLIQ?E>QEMIEPJQNMHQIEKDGH LKOQ<PQOPJCMLNOPH=QNM9PJIQBKJQINOMIBNFOKJ>QNFNHPCMFQAJK@JPIIQ?MGGQ<PQFKL6 IMHPJPHQMBQOEPQIODHPLOQENIQIDBBPJPHQDLHDPQENJHIEMAQIDFEQNIQHPNOEQKBQNLQMC6 CPHMNOPQBNCMG>QCPC<PJ;QMLDJ>QKJQMGGLPIIQKBQOEPQIODHPLO;QFENL@PQKBQCNKJ;QKJ KOEPJQIAPFMNGQFMJFDCIONLFPIQOENOQCN>QEN9PQAJP9PLOPHQOEPQIODHPLOQBJKCQAPJ6 BKJCML@Q EMIEPJQ NFNHPCMFQ <PIO=Q :ODHPLOIQ IEKDGHQ ID<CMOQ HKFDCPLONOMKLQ OK 28


FINANCIAL INFORMATION IDAAKJOQOEPQJP$DPIOQBKJQNQ?NM9PJ=Q 3KLHMOMKLIQ DLHPJQ ?EMFEQ NQ IODHPLOQ CN>Q JPFPM9PQ NQ AJK<NOMKLNJ>Q APJMKH CN>Q MLFGDHPQ <DOQ NJPQ LKOQ GMCMOPHQ OKQ IMF LPII;Q HPNOEQ MLQ OEPQ IODHPLOIQ BNCMG>; NLHQ DLDIDNGQ FMJFDCIONLFPI=Q .BQ OEPQ NAAPNGQ MIQ NAAJK9PH;Q OEPQ IODHPLOQ ?MGGQ <P AGNFPHQKLQBMLNLFMNGQNMHQAJK<NOMKLQNLHQOEPMJQ:NOMIBNFOKJ>Q7FNHPCMFQ+JK@JPII ?MGGQ<PQJP9MP?PHQN@NMLQNOQOEPQPLHQKBQPNFEQIPCPIOPJ= .BQNLQNAAPNGQMIQNAAJK9PH;QOEPQIODHPLOQCDIOQHKQOEPQBKGGK?ML@) :M@LQNQ:NOMIBNFOKJ>Q7FNHPCMFQ+JK@JPIIQ7FOMKLQ+GNLQ?MOEQOEPQ:ODHPLOQ5M6 LNLFMNGQ 7MHQ (BBMFP;Q ?EMFEQ MLHMFNOPIQ OEPQ IOMADGNOMKLQ KBQ OEPQ NAAPNG=Q :ODHPLOI CDIOQIFEPHDGPQNLQNAAKMLOCPLOQ?MOEQOEPMJQ7FNHPCMFQ7H9MIKJQOKQHP9PGKAQNL NFNHPCMFQAGNLQKBQNFOMKL=Q:ODHPLOIQ?MGGQ<PQLKOMBMPH;QMLQ?JMOML@;QKBQOEPQ7AAPNGI 3KCCMOOPPIQHPFMIMKLQ?MOEMLQOEJPPQ?PP IQKBQOEPQJP$DPIO=Q       :ODHPLOIQ?EKQHKQLKOQCPPOQOEPQJP$DMJPCPLOIQKBQOEPQINOMIBNFOKJ>QNFNHPCMF AJK@JPIIQAKGMF>Q?MGGQ<PQLKOMBMPHQ<>QCNMGQKBQOEPMJQIDIAPLIMKLQBJKCQBMLNLFMNGQNMH NOQOEPQPLHQKBQOEPQNFNHPCMFQ>PNJ=Q4EPQGPOOPJQ?MGGQ<PQCNMGPHQOKQOEPQIODHPLOI APJCNLPLOQEKCPQNHHJPII= :ODHPLOIQ?EKQNJPQ@JNLOPHQNLQNAAPNGQNLHQHKQLKOQCPPOQOEPQJP$DMJPCPLOI KBQ OEPQ NFOMKLQ AGNLQ ?MGGQ <PQ LKOMBMPHQ NOQ OEPQ PLHQ KBQ OEPQ IPCPIOPJQ MLQ ?EMFEQ OEP NAAPNGQ?NIQNAAJK9PHQOENOQOEPMJQBMLNLFMNGQNMHQAJK<NOMKLQMIQIDIAPLHPHQOEPQBKG6 GK?ML@QIPCPIOPJ= 

        .BQ NQ IODHPLOQ PLJKGGIQ BKJQ FKDJIPIQ NLHQ HKPIQ LKOQ ?MOEHJN?Q KBBMFMNGG>Q BJKC OEPIPQFKDJIPI;Q@JNHPIQ?MGGQ<PQNIIM@LPHQMLQNFFKJHNLFPQ?MOEQOEPQMLIOMODOMKLI @JNHML@QI>IOPC=Q4EPQ@JNHPQKBQ.QJPAJPIPLOIQMLFKCAGPOPQ?KJ =Q7QIODHPLOQ?EK JPFPM9PIQ NQ @JNHPQ KBQ .Q -.LFKCAGPOP,Q MIQ PAPFOPHQ OKQ FKCAGPOPQ ?ENOP9PJQ JP6 CNMLIQOKQ<PQFKCAGPOPHQNLHQOKQJPCK9PQOEPQ.LFKCAGPOPQ@JNHPQ<>QOEPQPLHQKB OEPQIPCPIOPJQBKGGK?ML@QOEPQOPJCQHDJML@Q?EMFEQOEPQ.LFKCAGPOPQ@JNHPQ?NIQNI6 IM@LPH=Q5KJQPNFEQ@JNHPQKBQ.LFKCAGPOPQOENOQMIQLKOQJPCK9PHQ?MOEMLQOEPQPION<6 GMIEPHQOMCPQGMCMO;QNQ@JNHPQKBQ5Q?MGGQ<PQJPFKJHPHQKLQOEPQIODHPLOIQAPJCNLPLO JPFKJH=Q :EKDGHQ OEMIQ KFFDJ;Q MOQ CN>Q EN9PQ NQ LP@NOM9PQ PBBPFOQ KLQ OEPQ IODHPLOI NFNHPCMFQIONODIQMLQOPJCIQKBQOEPQ+KGMF>QKLQ:NOMIBNFOKJ>Q7FNHPCMFQ+JK@JPII= 

       7QIODHPLOQKLQBMLNLFMNGQNMHQCN>QJPAPNOQNQBNMGPHQFKDJIPQNIQCNL>QOMCPIQNI LPPHPHQ?MOEKDOQAPLNGO>QDLHPJQOEPQJDGPIQKBQ:NOMIBNFOKJ>Q7FNHPCMFQ+JK@JPII= .BQNQIODHPLOQJPAPNOIQNQFKDJIPQBKJQ?EMFEQEPIEPQJPFPM9PHQNQANIIML@Q@JNHPQML KJHPJQ OKQ @POQ NQ EM@EPJQ @JNHP;Q EK?P9PJ;Q OEPQ JPAPNOPHQ FKDJIPQ ?MGGQ LKOQ <P FKDLOPHQMLQHPOPJCMLML@QOEPQLDC<PJQKBQEKDJIQPLJKGGQBKJQBMLNLFMNGQNMHQADJAKI6 PI=

29


21! -$1?//'&2 1:>?! 9959;7?;?23(4>73?/=9<5?LKN2HGGJFN5HCCM?MN>GH;JEMFNFKL==7N=LBJCJKJMF7 AMKDHEF7NLIENLBKJ;JKJMFN=HGN@IEMGFKLIEJI?NLIENAMMKJI?NKDMNIMMEFNH=NFK@EMIKFNFH KDLKNMLBDN9JCCN8MN>GH;JEMENKDMNAL,JA@ANH>>HGK@IJK:N=HGNEMGJ;JI?N=@CCN8MIM=JKN=GHA KDMN5HCCM?MNM,>MGJMIBM< 1DMNEM;MCH>AMIKNLFN9MCCNLFNKDMNLEAJIJFKGLKJHINH=NKDJFN>GH?GLANJFNKDMNGMF>HIFJ+ 8JCJK:NH=NKDMN.MLINH=N4K@EMIKN6==LJGFNLIENKDMNFKL==NDH9M;MG7NJIJKJLKJ;MNJINEM;MCH>JI? FK@EMIKN >GH?GLAFN LIEN LBKJ;JKJMFN L>>GH>GJLKMN KHN KDMN ME@BLKJHILCN >@G>HFMN H=N KDM 5HCCM?MNLFN9MCCNLFNJA>CMAMIKJI?NF@BDNLBKJ;JKJMFNJFNFDLGMEN9JKDNFK@EMIKNHG?LIJL+ KJHIF<N The President of the College N N isN in charge N N ofN the Athletics Program. 1:>? 23(4>73? ;><7.>73? /55;09=39;7? JFN HIMN H=N KDMN >GJIBJ>LCN HG?LIJLKJHIF KDGH@?DN9DJBDNFK@EMIKFNFDLGMNJINKDMNLEAJIJFKGLKJHINH=NKDMN5HCCM?M<N4HAMNH=NKDM H80MBKJ;MFNH=NKDMN4K@EMIKN'H;MGIAMIKN6FFHBJLKJHINLGMNLFN=HCCH9F < 1HNFMG;MNLFNLNAMEJ@AN=HGNKDMNM,>GMFFJHINH=NFK@EMIKNH>JIJHINJINKDMN=HG+ A@CLKJHINH=N5HCCM?MN>HCJBJMFNLIENGM?@CLKJHIF< !< 1HN>GH;JEMNM,>MGJMIBMNJINKDMNF)JCCFNH=NEMAHBGLKJBNCMLEMGFDJ>< #< 1HNLFFJFKNKDMN5HCCM?MFNFK@EMIKNL==LJGFNFKL==NJINKDMNBHHGEJILKJHINH=NFK@EMIK HG?LIJLKJHIFNLIENLBKJ;JKJMF< < 1HN DMC>N KDMN LEAJIJFKGLKJHIN JIN >CLIIJI?N LIEN EJGMBKJI?N GMBGMLKJHILC7N GMCJ+ ?JH@F7NLIENB@CK@GLCNLBKJ;JKJMF< 4K@EMIKFN=@GKDMGNLFFJFKNJINKDMNEMKMGAJILKJHINH=NJIFKJK@KJHILCN>HCJB:NKDGH@?DNFMG+ ;JBMNHINFKLIEJI?NBHAAJKKMMF<N IMNFK@EMIKNJFNLCFHNMCMBKMENLII@LCC:NKHNFMG;MNHI KDMN&HLGENH=N1G@FKMMF< * *&&'*%/&?/*1''1'-2 /*/!-,'*?*%2 >=83:?209>70>?*8(?>GH;JEMFNAMLIJI?=@CN>@8CJBNDMLCKDNM,>MGJMIBMFN=HGNDMLCKD FBJMIBMN FK@EMIKF7N =LBJCJKLKMFN FBDHHC+BHAA@IJK:N JIKMGLBKJHIN GM?LGEJI?N DMLCKD ALKKMGF7N>GHAHKMFNDMLCKD:NCJ=MFK:CMFNLAHI?NKDMNFK@EMIKFNLIEN=LB@CK:7NFDH9BLFMF KDMN 8MIM=JKFN H=N LN FK@EMIK+=LB@CK:N DMLCKDN >GHAHKJHIN >GH?GLA7N LIEN >GH;JEMF MIGJBDAMIKNKHNKDMNBHA>GMDMIFJ;MNMLCKDN4BJMIBMNEM?GMMN>GH?GLA< 21-,? *8(? JFN H>MIN KHN LCCN FK@EMIKFN JIKMGMFKMEN JIN 4BJMIBM7N 1MBDIHCH?:7 3I?JIMMGJI?7N LIEN 2LKDMALKJBFN 4132<N 1@KHGJLCN FMFFJHIF7N CMBK@GMN FMGJMF7N LIE GMFMLGBDN >GH0MBKFN LGMN ;JKLCN >LGKFN H=N KDMN >GH?GLA7N 9JKDN ALI:N H>>HGK@IJKJMFN =HG FK@EMIKFNKHN>LGKJBJ>LKMNJINKDMFMNLBKJ;JKJMF< ,;<<95?*;88>#>?'$,,? '75393(3>?;?$(08>=<?,=3><9=85?,=7=#>.>73? ?23(4>73 *:=)3><? JFN H>MIN KHN LI:N =@CC+KJAMN 2HGGJFN 5HCCM?MN FK@EMIK<N 1DJFN HG?LIJLKJHIN JF EMFJ?IMEN KHN =HFKMG7N >GHAHKM7N LIEN =@GKDMGN KDMN >@G>HFMN LIEN H80MBKJ;MFN H=N KDM (22N KHN LE;LIBMN I@BCMLGN ALKMGJLCFN ALIL?MAMIK7N >GHAHKMN GMFMLGBDN JIN KDJF =JMCE7N MFKL8CJFDN FKLIELGEF7N JA>GH;MN KDMN @LCJ=JBLKJHIFN LIEN @FM=@CIMFFN H=N KDHFM MA>CH:MEN JIN KDJFN =JMCE7N LIEN JIBGMLFMN LIEN EJFFMAJILKMN JI=HGALKJHIN H=N I@BCMLG ALKMGJLCFNALIL?MAMIK< 2;09;8;#"? *8(? JFN EMFJ?IMEN KHN =LAJCJLGJMN LIEN =@GKDMGN >GM>LGMN 4HBJHCH?: FK@EMIKFN9JKDNLCCNLF>MBKFNH=NKDMNBLGMMGN=JMCENLIENKHN?J;MNKDMANLINH>>HGK@IJK:NKH IMK9HG)N9JKDN>GH=MFFJHILCFNJINKDMNBHAA@IJK:< 1:>? *;;)? *8(? LFFJFKFN FK@EMIKFN JIN EM;MCH>JI?N ALG)MKL8CMN F)JCCFN KDLKN 9JCC MIL8CMNKDMANKHNMIKMGNKDMN9HGCENH=N9HG)NF@BBMFF=@CC:< 1:>? 22*-/? 1:>? 23(4>732;(3:? *=<;897=? -4(0=39;7? /55;09=39;7 ? JFN L >GH=MFFJHILCNHG?LIJLKJHIN=HGNBHCCM?MNFK@EMIKFN>GM>LGJI?NKHNKMLBD<N(KNJFNLINJIKM?GLC >LGKN H=N 8HKDN KDMN LKJHILCN 3E@BLKJHIN 6FFHBJLKJHIN LIEN KDMN 4H@KDN 5LGHCJIL 3E@BLKJHIN 6FFHBJLKJHI<N (KN >GH;JEMFN JKFN AMA8MGFN LIN H>>HGK@IJK:N =HGN >MGFHILC ?GH9KDNLIENKDMNEM;MCH>AMIKNH=N>GH=MFFJHILCNBHA>MKMIBM<N5LIEJELKMFNMIGHCCME 30


STUDENT AFFAIRS JINKDMN1MLBDMGN3E@BLKJHIN/GH?GLANLGMNGM@JGMENKHNDHCENAMA8MGFDJ>NJINLNFK@EMIK ME@BLKJHILCN>GH=MFFJHILCNLFFHBJLKJHI< 1:>?/<3?*8( >GH;JEMFNH>>HGK@IJKJMFN=HGNFK@EMIKFNKHNMIDLIBMNKDMJGNBGMLKJ;MNF)JCCF >GHAHKMFN L9LGMIMFFN H=N ;JF@LCN LGKFN LIEN >GH;JEMFN DLIEF+HIN M,>MGJMIBMFN JI >GHE@BJI?NLGK<N4K@EMIKFNLGMNLFFJFKMENJINEM;MCH>JI?NALG)MKL8CMN;JF@LCNF)JCCFNKDLK 9JCCNMIL8CMNKDMANKHNMIKMGNKDMN;JF@LCNLGKFN9HGCENF@BBMFF=@CC:< 2;09=8?23(49>5?*8( JFNEM;HKMENKHNKDMNFK@E:NLIENEJFB@FFJHINH=NB@GGMIKNL==LJGF LIEN KH>JBFN GMCLKMEN KHN KDMN FHBJLCN FBJMIBMF<N 2MA8MGFDJ>N JFN H>MIN KHN LCCN FK@EMIKF LIENJFNFKGHI?C:NMIBH@GL?MEN=HGNFK@EMIKFNAL0HGJI?NJINLI:NFHBJLCNFBJMIBMNLGML< <>70:?*8( JFNH>MINKHN=@CC+KJAMN2HGGJFN5HCCM?MNFK@EMIKFN9DHNLGMNJIKMGMFKMENJI CMLGIJI?N *GMIBDN LIEHGN MIDLIBJI?N KDMJGN B@CK@GLCN @IEMGFKLIEJI?N H=N *GLIBMN LIE =GLIBH>DHIMNBH@IKGJMF<N ,;<<95?*;88>#>?*:=)3><?;?3:>?$=39;7=8?<;=40=5397#?2;09>3" JFNH>MINKHNLCC 2LFFN5HAA@IJBLKJHIFNAL0HGFN9DHNDL;MNLINJIKMGMFKNJIN>GH=MFFJHIFNKDLKNJI;HC;M H;MG+KDM+LJG7NBL8CM7NLIENHKDMGNMCMBKGHIJBNAMEJLNH@KCMKF< 1:>?&>0<>=39;7?*8(?>GHAHKMFNLINL9LGMIMFFNH=NGMBGMLKJHINLKN2HGGJFN5HCCM?M 8:NLBKJ;MN>LGKJBJ>LKJHINH=NKDMN-MBGMLKJHIN6EAJIJFKGLKJHINAL0HGFNJINBC@8N>GH0MBKF< :9?>3=?%=.4=?LN8@FJIMFFNBC@87NBHA>CMAMIKFNBCLFFGHHAN9HG)NJIN8@FJIMFF LEAJIJFKGLKJHI7NEM;MCH>FNFK@EMIKNCMLEMGFDJ>7NEM;MCH>FNLIENFKGMI?KDMIFNFK@EMIK+ KMLBDMGNGL>>HGK7NLIENJIFKJCCFN>GH>MGNLKKJK@EMFNLIENFHBJLCNGMF>HIFJ8JCJK:<N >MINHIC: KHN&@FJIMFFN6EAJIJFKGLKJHINLIEN G?LIJLKJHILCN2LIL?MAMIKNAL0HGF< 1:>? %9<=<"? *8(? MIDLIBMFN FK@EMIKN CJ8GLG:N GMCLKJHIFN LIEN LJEFN FK@EMIKFN JI @IEMGFKLIEJI?N GM?@CLKJHIFN GMCLKJ;MN KHN FK@EMIKN @FMN H=N KDMN %MLGIJI?N -MFH@GBMF 5MIKMGN %-5<N 5C@8N AMA8MGFN AL)MN GMBHAAMIELKJHIFN =HGN JA>GH;JI?N %-5 FMG;JBMF<N2MA8MGFDJ>NJFNH>MINKHNJIKMGMFKMENFK@EMIKF< '7>53.>73? *8(? JFN H>MIN KHN LCCN FK@EMIKFN 9DHN LGMN JIKMGMFKMEN JIN CMLGIJI?N KDM >GJIBJ>CMFNLIENAMBDLIJBFNH=NLCCNLF>MBKFNH=N=JILIBJLCNALIL?MAMIKNLIENJI;MFKJI?< 1:>?%93><=<"?2;09>3"?JFNEMFJ?IMENKHN>GHAHKMN?GH9KDNKDGH@?DNGMLEJI?F7NCMBK@GMF LIENCJKMGLG:N>GH?GLAF<N2MA8MGFDJ>NJINKDMNHG?LIJLKJHINJFNH>MINKHNLCCNFK@EMIKF< 4K@EMIKFN9JKDNAL0HGNHGNAJIHGN>GH?GLAFNJIN3I?CJFDNLGMNFKGHI?C:NMIBH@GL?MENKH 8MBHAMNAMA8MGF< 1:>? :;3;#<=):" 5C@8N JFN EMFJ?IMEN KHN MIDLIBMN KDMN >DHKH?GL>DJBN F)JCCFN H=N JKF AMA8MGFNKDGH@?DN;LGJH@FN>DHKH?GL>D:+GMCLKMENLBKJ;JKJMFNLIENKDMNEHB@AMIKLKJHI H=N FK@EMIKN LBKJ;JKJMFN KDLKN GM=CMBKN KDMN 5HCCM?MFN AHKKHN 3IKMGN KHN %MLGIN .M>LGKN KH 4MG;M<

;>3<"?*8(?JFNLINHG?LIJLKJHINEMEJBLKMENKHNKDMN>GHAHKJHINH=N>HMKJBNLIENB@CK@GLC MIGJBDAMIKN =HGN JKFN AMA8MGF<N 1DMN @IEMGFKLIEJI?N H=N >HMKG:N MIDLIBMFN FK@EMIK GMCLKJHIFNLIENMA>DLFJMFNBGMLKJ;JK:NKDGH@?DN9GJKKMINLIEN;MG8LCNM,>GMFFJHI< ,;<<95? *;88>#>? 8="><5? JFN H>MIN KHN LCCN FK@EMIKFN JIKMGMFKMEN JIN LI:N >DLFMN H= EGLALKJBNMIEML;HGF< ,;<<95?*;88>#>?!=70>?1>=. JFNH>MINKHNFK@EMIKFNJIKMGMFKMENJINEMAHIFKGLKJI? LIEN EJF>CL:JI?N KDMJGN KLCMIKFN LIEN F)JCCFN KDGH@?DN ELIBJI?N KHN MIDLIBMN KDM ME@BLKJHILC7NFHBJLC7NLIENB@CK@GLCNLKAHF>DMGMNH=NKDMNBLA>@F< 2;(3:?*=<;897=?*:=)3><?;?3:>?$=39;7=8?/55;09=39;7?;?8=05?97?*<9.97=8 (5390>? $/* ? JFN LN IMK9HG)N H=N BGJAJILCN 0@FKJBMN >GH=MFFJHILCFN LIEN BGJAJILC 0@FKJBMNAL0HGFNMIGHCCMENLKNLBBGMEJKMENBHCCM?MFNLIEN@IJ;MGFJKJMFN9DHNLEEGMFFNKDM IMMEF7NBHIBMGIF7NLIENBHIKGJ8@KJHIFNH=N6=GJBLI+6AMGJBLIFNLIENHKDMGNAJIHGJKJMFNLF KDM:NGMCLKMNKHNKDMNLEAJIJFKGLKJHINH=NM@LCN0@FKJBMNJINKDMNIJKMEN4KLKMF< <>%=+?*8(?BHIFJFKFNH=NFK@EMIKFN9DHNLGMNJIKMGMFKMENJINLKKMIEJI?NCL9NFBDHHC LIEN>GM>LGJI?N=HGNKDMN%L9N4BDHHCN6EAJFFJHIN1MFKN%461< 31


MORRIS COLLEGE CATALOG  $ &?2 *'-1'-2 /8):=? =))=? ,(? $=39;7=8? ;7;<? 2;09>3"? 2@N %LA8ELN 5DL>KMGN >GHAHKMF DJ?DNCM;MCFNH=NFBDHCLGFDJ>NLIENLBDJM;MAMIKNJINLCCN=JMCEFNH=N)IH9CME?MNLIENFMG+ ;JBM<N(KNJFNH>MINKHN0@IJHGNLIENFMIJHGNFK@EMIKFN9JKDNLNB@A@CLKJ;MN?GLEMN>HJIKNL;MG+ L?MNH=NIHKNCMFFNKDLIN#<#< &/&-?-MJI=HGBMGF7N6BDJM;MGFNLIEN-M>GMFMIKLKJ;MFNH=N3,BMCCMIBMN-6-3+HI+ HGF<N1DMN>@G>HFMNH=NKDMNHG?LIJLKJHINJFNKHNJA>CMAMIKNKDMNH80MBKJ;MFNH=NKDMN2HG+ GJFN5HCCM?MNHIHGFN/GH?GLANKDGH@?DNLBBM>KJI?NCMLEMGFDJ>NGHCMFNKHN=@GKDMGN>GH+ AHKMN KDMN >HFJKJ;MN JAL?MN H=N KDMN 5HCCM?MN >GHAHKJI?N LBLEMAJBN M,BMCCMIBM7 FMC=+EJFBJ>CJIM7N JIJKJLKJ;M7N FMC=+MFKMMAN LIEN BGMLKJ;JK:N >@8CJFDJI?N LIEN >GMFMIKJI? FBDHCLGC:N>L>MGFN>LGKJBJ>LKJI?NJINILKJHILCNLIENGM?JHILCNBHI=MGMIBMFNLIENF:A+ >HFJLNLIENF@>>HGKJI?NLIENMIBH@GL?JI?NLINMI;JGHIAMIKNBHIE@BJ;MNKHNM==MBKJ;M KMLBDJI?7NFK@E:7NLIENCMLGIJI?NLKN2HGGJFN5HCCM?M< /8):=?%=.4=?!>83=?;7;<?2;09>3"?*GMFDALINHIHGN4HBJMK:NMIBH@GL?MF F@>MGJHGNFBDHCLFKJBNLBDJM;MAMIKNLAHI?NFK@EMIKFNJINKDMJGN=JGFKN:MLGNJINJIFKJK@KJHIF H=NDJ?DMGNME@BLKJHI7N>GHAHKMFNJIKMCCJ?MIKNCJ;JI?NLIENLNDJ?DNFKLIELGENH=NCMLGIJI?7 LIENLFFJFKFNAMINLIEN9HAMINJINGMBH?IJJI?NLIENEM;MCH>JI?NAMLIJI?=@CN?HLCF =HGNKDMJGNGHCMFNJINFHBJMK:< 29#.=?1=(?!>83=?6C>DLN'LAALN/JN5DL>KMGNJFNH>MINKHN3I?CJFDNAL0HGFN9JKDNL & N L;MGL?MN JIN 3I?CJFD<N 2MA8MGFN A@FKN DL;MN BHA>CMKMEN LKN CMLFKN KDGMM FMAMFKMGFNH=NBHCCM?MN9HG)< 977=08> JFN H>MIN KHN LCCN LE@CKN ?MIMGLCC:N EM=JIMEN LFN !N :MLGFN LIEN HCEMGN LIE HKDMGNIHI+KGLEJKJHILCNFK@EMIKFN9DHNDL;MNLBDJM;MENLKNCMLFKN0@IJHGNFKLK@F7NDL;MNL B@A@CLKJ;MN ?GLEMN >HJIKN L;MGL?MN H=N LKN CMLFKN #<$7N LIEN LGMN JI;HC;MEN JIN LKN CMLFK KDGMMNBLA>@FNHGNBHAA@IJK:NLBKJ;JKJMF< /8):=? -)598;7? &:; JFN H>MIN KHN 2LFFN 5HAA@IJBLKJHIF AL0HGFN 9JKDN L B@A@CLKJ;MN?GLEMN>HJIKNL;MGL?MNH=NLKNCMLFKN#<!< !>83=? ,(? !>83=? ;7;<? 2;09>3"? %LA8ELN AJBGHIN 5DL>KMG GMBH?IJMFN LIE GM9LGEFN FBDHCLFKJBN LBDJM;MAMIKN JIN 8@FJIMFFN LEAJIJFKGLKJHIN >GH?GLAF< 2MA8MGFDJ>N JFN H>MIN KHN 0@IJHGN LIEN FMIJHGN FK@EMIKFN AL0HGJI?N JIN &@FJIMFF 6EAJIJFKGLKJHINLIEN G?LIJLKJHILCN2LIL?MAMIKN9JKDNLNB@A@CLKJ;MN?GLEMN>HJIK L;MGL?MNH=NLKNCMLFKN#<!NLIENKHNKDHFMNFK@EMIKFN9DHNLGMNJINKDMNKH>N!$N>MGBMIKNH= KDMJGNBHCCM?MNBCLFFNJINB@A@CLKJ;MN?GLEMN>HJIKNL;MGL?MF< >3=?=))=?*:9? 

?JFNH>MINKHN0@IJHGFNLIENFMIJHGFNGLI)MENJINKDMN@>>MGN=J=KD H=NKDMJGNBCLFFN9DHNDL;MNBHA>CMKMENLKNCMLFKNNFMAMFKMGNDH@GFN9JKDNLKNCMLFKNFM;+ MIKMMINFMAMFKMGNDH@GFNJINHIMNH=NKDMNFBJMIBMFNGMBH?IJMEN8:N& NLIENA@FK DL;MNLN'/6NH=NLKNCMLFKN#<$NHINLN<$N?GLEJI?NFBLCMNJINKDMNFBJMIBMNLGMLNLIENL ?MIMGLCNBHCCM?MNL;MGL?MNH=NLKNCMLFKNLN & < 1-?% *?,?*% 1:>?8;0?,?*8(?JFNLNBLA>@FNHG?LIJLKJHINBHA>HFMENH=NLIENEJGMBKMEN8: JIKMGBHCCM?JLKMN LKDCMKMF<N 6I:N FK@EMIKN 9DHN >LGKJBJ>LKMFN JIN LI:N JIKMGBHCCM?JLKM F>HGKNH=NKDMN5HCCM?MNJFNMCJ?J8CMN=HGNAMA8MGFDJ><

32


STUDENT AFFAIRS ,2'*?& 2 ,;<<95? *;88>#>? *:;<=8>? JFN BHA>HFMEN H=N LN FMCMBKN ?GH@>N H=N KDJGK:N KHN =HGK:N ;HJBMF< ,;<<95? *;88>#>? ;5)>8? *:;9<? JFN H>MIN KHN FK@EMIKFN 9DHN MI0H:N ?HF>MC FJI?JI?< *''*? &/$'/1' $2 1:>? $=39;7=8? /55;09=39;7? ;<? 3:>? /4=70>.>73? ;? *;8;<>4? >;)8>? 5HC+ CM?MN5DL>KMG7N9HG)FNBHH>MGLKJ;MC:N9JKDNKDMNCHBLCN&GLIBDNLIENKDMN4KLKMNLIENL+ KJHILCN6FFHBJLKJHI< $=39;7=8?*;(7098?;?$>#<;?;.>7?'706 JFNH>MINKHNLCCN9HAMINLIENAMI7N9DLK+ M;MGNKDMJGNGLBM7NBGMME7NBHCHG7NILKJHILCNHGJ?JI7NHGNMBHIHAJBNFKLK@F<N1DJFNHG?LIJL+ KJHINJFNEMFJ?IMENKHN>GHAHKMNLIENGMBH?IJMNCMLEMGFDJ>NLAHI?N9HAMINH=NBHCHG7 ALJIKLJINM==MBKJ;MIMFF7NLIENKHNGMALJINLN;JKLCNLIENJA>HGKLIKNGMFH@GBMN=HGN6=GJBLI 6AMGJBLIN9HAMINH=NLCCNL?MF< &-2'!-$*-?/%%? &/$'/1' $2? ;.>7 5?2>7=3>?=74?,>7 5?2>7=3>6?1DMFMNHG?LIJLKJHIFN>GH;JEMNFK@EMIKF 9JKDNLINH>>HGK@IJK:NKHNFDLGMNJIN>GHAHKJI?NLNDLGAHIJH@FNLIEN9DHCMFHAMNMI;J+ GHIAMIKNJINKDMNGMFJEMIBMNDLCCFNLIENJINEM;MCH>JI?N?HHENBJKJMIFDJ>< &-%'' 2? &/$'/1' $2 =)3953?23(4>73?79;76?3IBH@GL?JI?NBD@GBDNLKKMIELIBMNLIENAMA8MGFDJ>7NKDM &4NFMG;MFNLFNLNCJI)N8MK9MMINKDMNFK@EMIKNLIENKDMNCHBLCNBD@GBDNLIENFMM)FNKH >GH;JEMN5DGJFKJLIN=MCCH9FDJ>NLIEN9DHCMFHAMN=@IN=HGNLCCNFK@EMIKF< !(<:=.? ,97953><9=8? 79;7? JFN LIN HG?LIJLKJHIN H>MIN KHN LCCN AJIJFKMGF<N (KN JFN EM+ FJ?IMEN KHN EM;MCH>N BD@GBDN >HCJB:N LIEN MB@AMIJBLCN H@KCHH)N LIEN KHN >GHAHKM L9LGMIMFFNH=NAL0HGNFHBJLCNLIENGMCJ?JH@FNJFF@MFNH=NH@GNKJAMF< &-*&-/1' $/%?/$!?!--% ,-$1? &/$'/1' $2 ,;<<95?*;88>#>?5:><5?JFNLINHG?LIJLKJHINKDLKN>GH;JEMFN@FDMGFN=HGNBHCCM?MNLF+ FMA8CJMF7N-MCJ?JH@FN3A>DLFJFN"MM)N"HGFDJ>N4MG;JBMF7NLIENHKDMGN=HGALCNBHC+ CM?MN=@IBKJHIF< $- $2? $>+? -.):=595? ;7? $;73<=4939;7=8? 23(4>735 ? JFN LIN HG?LIJLKJHI EMEJBLKMENKHNFMG;JI?NKDMNIMMEFNH=NIHIKGLEJKJHILCNFK@EMIKFNLIENMIL8CJI?NKDMANKH 8MBHAMNAHGMNJI;HC;MENJINFK@EMIKNCJ=M< 1:>? <>/8(.79? *;(7098? JFN EMFJ?IMEN KHN >GH;JEMN FK@EMIKFN LIN H>>HGK@IJK:N KHN =@GKDMGN JIKMGLBKN 9JKDN LC@AIJN LIEN KDMGM8:N MIDLIBMN KDMJGN >GM>LGLKJHIN =HGN M==MBKJ;MNFMG;JBMNL=KMGN?GLE@LKJHI< &--?%-11-&? &/$'/1' $2 6C>DLN L>>LN6C>DLN4HGHGJK:7N(IB< 6C>DLN/DJN6C>DLN*GLKMGIJK:7N(IB< .MCKLN4J?ALN1DMKLN4HGHGJK:7N(IB<

L>>LN6C>DLN/FJN*GLKMGIJK:7N(IB< /DJN&MKLN4J?ALN*GLKMGIJK:7N(IB< AM?LN/FJN/DJN*GLKMGIJK:7N(IB< 4J?ALN'LAALN-DHN4HGHGJK:7N(IB< MKLN/DJN&MKLN4HGHGJK:7N(IB<

33


MORRIS COLLEGE CATALOG 1DMN 'GMM)N CMKKMGN HG?LIJLKJHIFN 9MGMN HG?LIJMEN KHN GMIEMGN FMG;JBMFN KHN D@+ ALIJK:NKDGH@?DNBHIBMGKMENM==HGKFNKHNFKJA@CLKMNKDMJGNAMA8MGFNKHN?GMLKMGN@FM+ =@CIMFFNJINKDMNBL@FMFNH=ND@ALIJK:7N=GMMEHA7NLIENKDMNEJ?IJK:NH=NKDMNJIEJ;JE@LC< %'*/1' $?& 2 1:>? ><93=#>? JFN KDMN FK@EMIKN IM9F>L>MGN KDLKN >GH;JEMFN LN AMEJ@AN KDGH@?D 9DJBDN FK@EMIKFN AL:N M,>GMFFN KDMJGN ;JM9FN LIEN EM;MCH>N KDMJGN CJKMGLG:N LIE LGKJFKJBNL8JCJKJMF< 1:>?;<7>3?KDMNFK@EMIKN:MLG8HH)7N>GH;JEMFNLN>JBKHGJLCNGMBHGENH=NBHCCM?MNCJ=M LIENM;MIKF< /1%-1'*? &/$'/1' $2 1:>? *:>><8>=4><5? (IN LEEJKJHIN KHN BDMMGJI?N LKN 8LF)MK8LCCN ?LAMF7N KDM BDMMGCMLEMGFN ?HLCN JFN KHN 8HCFKMGN BHCCM?MN F>JGJKN LIEN KHN =@GKDMGN KDMN JEMLCFN H= F>HGKFALIFDJ>NHINBLA>@F< '$1-&* %%-'/1-?1-/,2 &LFM8LCC &LF)MK8LCC 5GHFFN5H@IKG: 4H=K8LCC 1GLB) HCCM:8LCC

2MI 2MINLIEN"HAMI 2MINLIEN"HAMI "HAMI 2MINLIEN"HAMI "HAMI

&'-2?/$!?//&!2 /6?16?-=44"?,>.;<9=8?/+=<46?1HNKDMNFK@EMIKNAJIJFKMGN9DHNM,MGKFN>HFJKJ;M GMCJ?JH@FNJI=C@MIBMNKDGH@?DNDJFDMGNGMCJ?JH@FNBHI;JBKJHIFNLIENFJIBMGM EMEJBLKJHINKHNKDMN?HF>MCNAJIJFKG:<N'J;MIN8:NEL@?DKMG7N-M;<N3CJLN3LEE: &CLB)< 8;<>70>?!=<"?/+=<46?1HNLINJIEJ;JE@LCN=GHANKDMNFK@EMIKNAMA8MGFNH=NKDM 2HGGJFN5HCCM?MN=LAJC:N9DHNM,MA>CJ=JMFNFKGHI?NGMCJ?JH@FNBHI;JBKJHIF<N'J;MI 8:NMIG:N.LG8:< 1:>? 7>?,;<>?-;<3?>4><=3>4?*8(?/+=<46?*HGNKDMNMIBH@GL?MAMIKNH= LN=@CC+KJAMN2HGGJFN5HCCM?MNFH>DHAHGMNHGN0@IJHGN1MLBDMGN3E@BLKJHINAL0HG GM?LGECMFFNH=N=JMCENH=NBHIBMIKGLKJHIN9DHNDLFN?HHENAHGLCN@LCJKJMFNLIENL ?GLEMN>HJIKNL;MGL?MNH=NIHKNCMFFNKDLIN#<$<N.HILKMEN8:NKDMN IMN2HGMN3==HGK *MEMGLKMEN5C@8NH=N4@AKMG7N4H@KDN5LGHCJIL< 1:>?'7>?983;7?><>>7?<=0390(.?97?-4(0=39;7?/+=<46 /GMFMIKMENKH KDMN0@IJHGNFK@EMIKN9DHNE@GJI?NKDMNFMAMFKMGNH=N/GLBKJB@ANM,MA>CJ=JMF BGMLKJ;JK:7NGMF>HIFJ8JCJK:7NFMC=+GMCJLIBMNLIEN>GH=MFFJHILCJFA<N1DMNFK@EMIK A@FKNALJIKLJINLN#<$NHGN8MKKMGN?GLEMN>HJIKNL;MGL?MNE@GJI?NKDMNFMAMFKMGNH= KDMN/GLBKJB@ANM,>MGJMIBM<N.HILKMEN8:N=GJMIEFNH=NKDMNMGMMIN=LAJC:NLIENH= KDMN5HCCM?M< 1:>?=<<95?2=97;?&90:=<45;7?,>.;<9=8?/+=<46?69LGEMENKHNLN0@IJHGNH= ?HHENAHGLCNBDLGLBKMGN9JKDNLN?GLEMN>HJIKNL;MGL?MNH=N!<NHGNL8H;MN9DHNJF F@>>HGKJI?NDJAFMC=DMGFMC=N=JILIBJLCC:<N.HILKMEN8:N2GF<N2<N-<NHCCJI?F9HGKD< 98895?*6?;:75;7?,>.;<9=8?/+=<46?69LGEMENKHNLNFK@EMIKNJINIMMENH= LFFJFKLIBMN9DHNDLFNBHA>CMKMENKDMNFH>DHAHGMN:MLGN9JKDNLN?GLEMN>HJIK L;MGL?MNH=N#<!NHGN8MKKMG<N1DJFNFK@EMIKNA@FKNLCFHNDL;MNM,DJ8JKMEN@LCJKJMFNH= ?HHENBJKJMIFDJ>NE@GJI?N=GMFDALINLIENFH>DHAHGMN:MLGF<N.HILKMEN8:N2GF< 2JIIJMN"<NHDIFHINJINAMAHG:NH=N2G<N"JCCJFN5<NHDIFHI< 34


STUDENT AFFAIRS 6?6?(38><?*;..>.;<=39>?/+=<46?1HNKDMNFK@EMIKN9DHNM,DJ8JKFNL FKGHI?N>MGFHILCJK:7NEMM>NMLGIMFKNBHI;JBKJHIF7NLIEN5DGJFKJLINBDLGLBKMG< .HILKMEN8:NKDMN"HALIFN&L>KJFKN4KLKMN5HI;MIKJHI< =<<90975;7?*;..>.;<=39>?/+=<46?1HNKDMN8MFKNLCC+LGH@IENFK@EMIK JINKDMN4MIJHGN5CLFF<N.HILKMEN8:NKDMN"HALIFN6@,JCJLG:NH=NKDMN"LKMGMM 6FFHBJLKJHI< 6?&6?&>(>7?<9>6?'J;MINKHNKDMNALCMNFK@EMIKN9DHN8MFKNM,MA>CJ=JMF JIKMGMFKNLIEN>LGKJBJ>LKJHINJINB@GGMIKNJFF@MFNLIENJIN>GH0MBKFNH=ND@ALIN9MC=LGM LIEN@>CJ=K<N5HIKGJ8@KMENKDGH@?DNKDMN <N-<N-M@8MIN2MAHGJLCN*@IE< 16?6?<9#:3?,>.;<9=8?/+=<46?1HNKDMNFMIJHGN9DHNDLFNKL)MINKDMNAHFK LBKJ;MN>LGKNJINGMCJ?JH@FNLBKJ;JKJMFNHINKDMNBLA>@F<N.HILKMEN8:N2GF<N2LG?LGMK "<N.L;JF< 2)>09=8?/+=<4?;<?*<>=39>?<9397#6?*HGNKDMN8MFKNBGMLKJ;MN9GJKJI?NE@GJI? KDMN:MLGN8:NLN2HGGJFN5HCCM?MNFK@EMIK<N.HILKMEN8:N.G<N2LGBN.L;JE< 1:>?&>><>74?;:7?*6?29..;75?,>.;<9=8?/+=<46?69LGEMENKHNKDM FK@EMIKN=GHANLF>MGN5H@IK:N9DHNM,MA>CJ=JMFNH@KFKLIEJI?N@LCJKJMFNH= CMLEMGFDJ>7NFBDHCLGFDJ>7NLIENDJ?DNAHGLCNBDLGLBKMG<N4>HIFHGMEN8:NKDM 4JAAHIFN*LAJC:< !<6?,=<397?%(3:><?97#?<6?,>.;<9=8?/+=<46?69LGEMENKHNKDMNFK@EMIKN9JKD LN!<N?GLEMN>HJIKNL;MGL?MNLIENL8H;MN9DHN>LGKJBJ>LKMENJIN8HKDNBHAA@IJK: LIENFK@EMIKNLBKJ;JKJMFNKDLKN=HFKMGNLIENGM=CMBKNKDMN>DJCHFH>DJMFNH=N.G<N2LGKJI %@KDMGN JI?7NG<N 1:>?>7975?=.98"?/+=<46?/GMFMIKMENKHNKDMN=GMFDALIN9DHN9GJKMFNKDM 8MFKNLGKJBCMNJINKDMN&MCCN-JI?MG< 6?6?9#:3;+><?,>.;<9=8?/+=<46?69LGEMENKHNLNFH>DHAHGM7N0@IJHGNHG FMIJHGN=MALCMNFK@EMIKN9DHNBHIKGJ8@KMENH@KFKLIEJI?NCMLEMGFDJ>NKDGH@?DNDMG 9HG)N9JKDNKDMN&L>KJFKN4K@EMIKNIJHI< ,<56?-6?!6?!9 ;7?,>.;<9=8?/+=<46?69LGEMENKHNLINH@KFKLIEJI?NALCMNLIE =MALCMNAMA8MGNH=NKDMN'HF>MCN5DHJG< =83><?<;+7?/+=<46?69LGEMENKHNKDMN0@IJHGNHGNFMIJHGNAL0HGJI?NJIN/HCJKJBLC 4BJMIBMN9JKDNKDMNDJ?DMFKN?GLEMN>HJIKNL;MGL?M< %>7=?,6?=84+97?,>.;<9=8?/+=<46 /GMFMIKMENKHNKDMN0@IJHGNHGNFMIJHG AL0HGJI?NJINMLCKDN4BJMIBMN9JKDNKDMNDJ?DMFKN?GLEMN>HJIKNL;MGL?M< &;7=84?,0$=9<?/+=<46?/GMFMIKMENKHNLN0@IJHGNHGNFMIJHGN&JHCH?:NAL0HGN9JKD KDMNDJ?DMFKN?GLEMN>HJIKNL;MGL?M<N %(75?*6?&90:=<45;7?<>5:.=7?-7#895:?/+=<46?1HNKDMN=GMFDALINFK@EMIK ALJIKLJIJI?NKDMNDJ?DMFKNL;MGL?MNJIN*GMFDALIN3I?CJFD<N.HILKMEN8:N.G<N%@IF 5<N-JBDLGEFHI7N/GMFJEMIK< %(75?*6?&90:=<45;7?<= 95?''?- =.97=39;7?/+=<46?1HNKDMNFK@EMIK AL)JI?NKDMNDJ?DMFKN/GL,JFN((N3,LAJILKJHINFBHGMFNE@GJI?NKDMNFMIJHGN:MLG< .HILKMEN8:N.G<N%@IFN5<N-JBDLGEFHI7N/GMFJEMIK< ;8>"!9##52=74><5?/+=<46?69LGEMENKHNLN=MALCMNFK@EMIKN9DH M,MA>CJ=JMFNFBDHCLGFDJ>NLIEN5DGJFKJLIN>GJIBJ>CMF<N.HILKMEN8:NKDMN"HALINF 6@,JCJLG:7N"LKMGMMN&L>KJFKN6FFHBJLKJHIN%H9MGN.J;JFJHINJINDHIHGNH=N2LG?LGMK 4<N&HCM:7N2LG:N<N.J??FNLIEN&MLKGJBMN'<N4LIEMGF<

9?-)598;7?*:=)3><?/8):=?:9?/8):=?<=3><793"?'706?/+=<46?1HNKDM 2HGGJFN5HCCM?MNFK@EMIKN9DHNKDGH@?DNDJFDMGN>LGKJBJ>LKJHINLIENCMLEMGFDJ> BHIKGJ8@KMFNKDMN?GMLKMFKNKH9LGEN>GHAHKJI?NKDMNJIKMCCMBK@LCNLKAHF>DMGMNH= KDMN5HCCM?M<N1DMNFK@EMIKNA@FKN8MNLNGJFJI?NFH>DHAHGM7N0@IJHGNHGNFMIJHGN9JKD 35


MORRIS COLLEGE CATALOG LNB@A@CLKJ;MN?GLEMN>HJIKNL;MGL?MNH=N!<NHGNL8H;M<N.HILKMEN8:NKDMNBHCCM?M BDL>KMG< 1:>?'6?!>(970"?$>+.=7?/+=<46?69LGEMENKHNLNFK@EMIKNAL0HGJI?NJI /HCJKJBLCN4BJMIBMN9DHNEMAHIFKGLKMENH@KFKLIEJI?NCMLEMGFDJ>NF)JCCF<N2@FK DL;MNLN?GLEMN>HJIKNL;MGL?MNH=N!<NHGNDJ?DMG< !<6?=74?,<56?26?6?,=<5:=88?/+=<46?69LGEMENKHNLNEMFMG;JI?NFK@EMIKN9DH M,MA>CJ=JMFNDJ?DNFBDHCLGFDJ>7NDLFNLN?HHENBJKJMIFDJ>NGMBHGE7NLIENFDH9F BHAAJKAMIKNKHNKDMN?GH9KDNLIENEM;MCH>AMIKNH=N2HGGJFN5HCCM?M<N.HILKMEN8: .G<NLIEN2GF<N4<N&<N2LGFDLCC< 9889>?/8.=?!=+5;7?,;;4"?,>.;<9=8?/+=<46?69LGEMENKHNLNFH>DHAHGM HGN0@IJHGN9JKDNLKNCMLFKNLN!<N?GLEMN>HJIKNL;MGL?MNHGN8MKKMGNJIN3E@BLKJHI 3LGC:N5DJCEDHHEN3E@BLKJHINLIEN9DHNEJF>CL:FN?HHENBDLGLBKMGNLIE KMLBDJI?N>GHAJFM7NCMLEMGFDJ>N@LCJKJMFNLIENJFNJINIMMENH=N=JILIBJLCNLFFJFKLIBM KHNLBDJM;MNME@BLKJHILCN?HLCF< =88.=7?-4(0=39;7?/+=<46?1HNLNGJFJI?NFH>DHAHGMNFK@EMIKNAL0HGJI?NJI 1MLBDMGN3E@BLKJHIN9DHNDLFN>LFFMENKDMN/GL,JFN(N3,LAJILKJHI<N 1:>?,=<9;7?$>+3;7?/+=<46?1HNKDMNAHFKNH@KFKLIEJI?NFK@EMIKNJINFK@EMIK LBKJ;JKJMF<N'J;MIN8:N-M;<N2LGJHINM9KHI< -3:>8?><.=7?20;33?,>.;<9=8?/+=<46?69LGEMENKHNKDMNFK@EMIKNA@FJBJLI H=NKDMN2HGGJFN5HCCM?MN'HF>MCN5DHJGN=HGNKDMNB@GGMIKNLBLEMAJBN:MLG<N.HILKME 8:N2GF<N4LIEGLN4BHKKN'J8FHI< 1:>?$;8>?%>;7?-8<94#>?20;33?,>.;<9=8?/+=<46?69LGEMENKHNLNFK@EMIK AL0HGJI?NJIN&@FJIMFFN6EAJIJFKGLKJHIN9JKDNLKNCMLFKNLN!< N?GLEMN>HJIK L;MGL?M<N1DMNFK@EMIKNFDH@CEN8MNJIKMGMFKMENJIN8MBHAJI?NLIN3IKGM>GMIM@G< .HILKMEN8:NDJFNEL@?DKMG7N2GF<N4LIEGLN4BHKKN'J8FHI< 1:>?(79(5?-6?!;+>88?/+=<46 69LGEMENKHNLNAMA8MGNH=N/JN1DMKLN5DL>KMG H=NMKLN/DJN&MKLN4HGHGJK:7N(IB<NLIENLNAMA8MGNH=N(HKLNMKLN5DL>KMGNH=N/DJ &MKLN4J?ALN*GLKMGIJK:7N(IB<N9JKDNLNB@A@CLKJ;MN?GLEMN);973?=><=#>?;?6 ;<?>33><6? 1:>?2:>889>?!(7=<?<9>6?1HNKDMN:H@I?NCLE:N9DHNAL)MFNKDMNAHFK JA>GH;MAMIKNJINFBDHCLGFDJ>7NJFNKDMNAHFKNBHH>MGLKJ;M7NLIENM,BMCFNJI @FM=@CIMFF<N.HILKMEN8:NKDMN"HALIFN&L>KJFKN4KLKMN5HI;MIKJHI< 1:>?>;<#>33>?%6?>84><2)=97?/+=<4?BDLGKMGNAMA8MGNH=N JN-DH 5DL>KMGNH=N.MCKLN4J?ALN1DMKLN4HGHGJK:7N(IBHG>HGLKMENN2HGGJFN5HCCM?M<N1H 8MN?J;MINKHNLNAMA8MGNH=N JN-DHN5DL>KMGNAL0HGJI?NJIN3E@BLKJHIN9JKDNKDM DJ?DMFKN'/6<N'J;MIN8:NBDJCEGMI7N5DGJFKH>DMGNN6CM,:@FN4>LJIN>LGMIKF7 %@BJ@FNN'CHGJLN-<N*MCEMGNFJFKMG7N6CKH:LN*MCEMG+.MLFNJAAJM7NLIE M>DM9F7NJALCNLIEN6IKHJIM< 1:>?><3:=?<9#:3?-8.;<>?/77(=8?/+=<46?69LGEMENKHNLN4H@KDN5LGHCJIL FK@EMIKNJINIMMENH=N=JILIBJLCNLFFJFKLIBMNLIENAL0HGJI?NJIN3E@BLKJHI< 1:>?-=?,0%>74;7;:75;7?/+=<46?69LGEMENKHNLNFK@EMIKNAL0HGJI?NJI 5GJAJILCN@FKJBM7NALJIKLJIJI?NLN?GLEMN>HJIKNL;MGL?MNH=N!<NHGNL8H;MNLIE >HFFMFFMENH=NFKGHI?NAHGLCNBDLGLBKMGNLIENLNFJIBMGMNJIKMGMFKNJINKDMNBGJAJILC 0@FKJBMNF:FKMA<N.HILKMEN8:N.G<N-MIMMN.@MLI< 1:>?,;<4>0=9?;:75;7?/+=<46?/GMFMIKMENKHNLNEMFMG;JI?NGJFJI?N0@IJHG /HCJKJBLCN4BJMIBMNAL0HGN9JKDNLN/GM+%L9N2JIHGN9DHNDLFNLN!<NHGNL8H;MN?GLEM >HJIKNL;MGL?M< 1:>?><3:=?>88>?9889=.5?/+=<46?69LGEMENKHNLNEMFMG;JI?NFK@EMIKN9JKD =JILIBJLCNIMME< 36


STUDENT AFFAIRS 1:>?&>6?6?&6?8=7497#?/+=<46?69LGEMENKHNLNEMFMG;JI?NFK@EMIKN=GHAN%MM HGN5CLGMIEHIN5H@IK:< 1:>?,=33:>+? 6?&=.5>"?-74;+>4?/+=<46?69LGEMENKHNLNEMFMG;JI? FK@EMIKNAL0HGJI?NJIN3E@BLKJHIN9JKDN>CLIFNKHNKMLBDNLKNKDMNMCMAMIKLG:NHG FMBHIELG:NCM;MC<N3FKL8CJFDMEN8:N2LKKDMKKMN-LAFM:N"JCCJLAF7NJINDHIHGNH= DMGN=LKDMG7NLN2HGGJFN5HCCM?MN?GLE@LKMNLIENJIFKG@BKHG< 1:>?&>6?-4+=<4?6?1:;.=5?-74;+>4?,>.;<9=8?/+=<46?69LGEMENKHNL FK@EMIKN;MG:NA@BDNJI;HC;MENJIN;HKMGNGM?JFKGLKJHINLIEN?GLFF+GHHKFN>HCJKJBF7 9DHNJFNJIN?HHENFKLIEJI?N9JKDNKDMN5HCCM?M<N1DMNFK@EMIKNA@FKNDL;MNLKNCMLFKNL !<<N?GLEMN>HJIKNL;MGL?M<N3FKL8CJFDMEN8:NKDMN=LAJC:NJINGMBH?IJKJHINH=NDJFNCJ=M H=NFMG;JBMNKHN'HENLIEND@ALIJK:< 1:>?><3:=?2.93:?'<97#?,>.;<9=8?/+=<46?69LGEMENKHNLNFK@EMIKN9DH EMAHIFKGLKMFN=JILIBJLCNIMME<N4K@EMIKNA@FKN8MNJIN1MLBDMGN3E@BLKJHINLIE EHJI?NDJFNHGNDMGN/GLBKJB@A<N69LGEMEN8:N.G<NLKDLIJMCN(G;JI?NLIEN=LAJC:NJI AMAHG:NH=NKDMJGNAHKDMG7N&MGKDLN4AJKDN(G;JI?< 1:>?!<6?6?26?,=44; ?/+=<46?69LGEMENKHNLNIMME:NLIENEMFMG;JI?NFK@EMIK7 AL0HGJI?NJIN5DGJFKJLIN3E@BLKJHINHGN/LFKHGLCN2JIJFKG:7NFDH9JI?N?GMLKN>GHAJFM =HGN5DGJFKJLINCMLEMGFDJ><N3FKL8CJFDMENJINDHIHGNH=N.G<NN<4<N2LEEH,N8:N2GF< &MFFJMN2LEEH,7N=LAJC:NLIEN=GJMIEF< 1:>?&;><3?%><;"?,0%>;4?2<6?-74;+>4?/+=<46?69LGEMENKHNLNFK@EMIK 9JKDNLN#<N?GLEMN>HJIKNL;MGL?MNHGNL8H;MN9DHNJIKMIEFNKHN>@GF@MNLNBLGMMGNJI ME@BLKJHINHGNJINAMEJBJIM<N1DMNFK@EMIKNA@FKNM,MA>CJ=:NLINH@KFKLIEJI?NCM;MC H=NBHAAJKAMIKNLIEN9JCCJI?IMFFNKHNDMC>NHKDMGFNLIENEMAHIFKGLKMNJKN8: JI;HC;MAMIKNJINBHAA@IJK:NFMG;JBM<N.HILKMEN8:NDJFN9J=M<N"JCDMCAJIL /JIB)IM:N2B%MHENLIENBDJCEGMI< 1:>?*;>8?*6?=74?,=<"?-6?,;;<>?/+=<46?69LGEMENKHNLN=@CC+KJAMNFK@EMIK 9JKDN=JILIBJLCNIMME< /8> =74><?=74?2:=39<=:?&:;4>5?,>.;<9=8?/+=<46?69LGEMENKHNLI: EMFBMIELIKNH=N6CM,LIEMGNLIEN4DLKJGLDN-DHEMFN9DHNJFNLN=@CC+KJAMNFK@EMIKNLK 2HGGJFN5HCCM?M<N4K@EMIKNA@FKNALJIKLJINLNAJIJA@AN 5 NL;MGL?MNJINLI:NLGML H=NFK@E:<N3FKL8CJFDMEN8:NKDMN6CM,LIEMGNLIEN4DLKJGLDN-DHEMFN*LAJC: -M@IJHIN5HAAJKKMM< 9889>?;#=7?9..><.=7?<6?/+=<4?6?69LGEMENKHNLNAMA8MGNH=N3>FJCHI %LA8ELN5DL>KMGNH=N AM?LN/FJN/DJN*GLKMGIJK:7N(IBHG>HGLKMEN9DH M,MA>CJ=JMFNDJ?DNFBDHCLFKJBNL8JCJK:7NCMLEMGFDJ>7NFKGHI?NAHGLCNBDLGLBKMG7NLIE DLFNEJFKJI?@JFDMENDJAFMC=NL8H;MNHKDMGFNJINH@KGMLBDNKH9LGENKDMN?GMLKMG 4@AKMGNBHAA@IJK:NLFN9MCCNLFNAL)JI?NLNFMC=CMFFNBHAAJKAMIKNKHNAL)JI?NKDM BHCCM?MNM,>MGJMIBMNLKN2HGGJFN5HCCM?MNAHGMNALIL?ML8CMN=HGN>MMGF< -MBJ>JMIKNA@FKN8MNLN=@CC+KJAMNFK@EMIKN9JKDNLNEMBCLGMENBHIBMIKGLKJHI7NDL;MNL !<NH;MGLCCN?GLEMN>HJIKNL;MGL?M7NLIENEMAHIFKGLKMNF@==JBJMIKNIMMEN=HG =JILIBJLCNF@>>HGK<N4K@EMIKNA@FKNIHKNDL;MNLI:NEJFBJ>CJILG:NHGNCM?LCNLBKJHIF >MIEJI?NLIENIHKN8MNKDMNGMBJ>JMIKNH=NKDMN'LAALN(HKLN4BDHCLGFDJ>NE@GJI?NKDM FLAMN:MLG<N3FKL8CJFDMEN8:N6C@AIJN8GHKDMGFNLIENKDMN=LAJC:NLIEN=GJMIEFNH= "JCCJMN&H?LINJAAMGALI7NG< 1:>?%>53><?16?*;<8>"?,>.;<9=8?/+=<46?/GMFMIKMENJINAMAHG:NH=N%MFKMGN1< 5HGCM:7N=HGAMGN6E;JFHGNH=N JN3>FJCHIN5DL>KMGNH=N6C>DLN/DJN6C>DLN*GLKMGIJK:7 (IB<7NKHNLIN@>>MGBCLFFNFK@EMIKN9DHNM,MA>CJ=JMFNFKGHI?NCMLEMGFDJ>NF)JCCF7 H@KFKLIEJI?NFMG;JBMNKHNKDMNBHCCM?MNLIENBHAA@IJK:NLIENFH@IENJIKMCCMBK@LC L8JCJK:<N1DMNFK@EMIKNA@FKNDL;MNLN!<N?GLEMN>HJIKNL;MGL?MNHGNL8H;M<N1DJF FBDHCLGFDJ>NJFNMLGALG)MEN=HGN8HH)FNLIENF@>>CJMF<N.HILKMEN8:N2GF<N2:GIL @LIJKLN5HGCM:NLIENFHIN1HEE< 37


MORRIS COLLEGE CATALOG 1:>?!;<;3:"?!(0>33>?&;><35;7?/+=<46?/GMFMIKMENKHNLNEMFMG;JI? FK@EMIKNAL0HGJI?NJIN3CMAMIKLG:N3E@BLKJHIN9JKDNLNAJIJA@ANH=NLN!<N?GLEM >HJIKNL;MGL?M< 1:>?>530;33?/6?;:75;7?/+=<46?/GMFMIKMENKHNLN9HGKD:NFK@EMIKN9DHNDLF LN?HHENLBLEMAJBNGMBHGENLIEN9DHNM,DJ8JKFNH@KFKLIEJI?NBHAAJKAMIKNKHNLIE F@>>HGKNH=N2HGGJFN5HCCM?M< /GM=MGMIBMN?J;MINKHNLNFK@EMIKN=GHAN'MHG?MKH9INHGN*CHGMIBMN5H@IK:< 3FKL8CJFDMEN8:N.G<NHDIFHIFNFJFKMG7N2GF<N-@KDNHDIFHINL9)JIF< 1:>?>;<#>?=74?,;889>?6?=5:97#3;7?/+=<46?/GMFMIKMENKHNKDMNAHFK H@KFKLIEJI?NFK@EMIKNJINFMBHIELG:NME@BLKJHI<N.HILKMEN8:N-M;<N'MHG?MN< "LFDJI?KHI< 1:>?29.?=74?*;53>88=?1;+75>74?,>.;<9=8?/+=<46?3FKL8CJFDMEN8:NKDM 1H9IFMIEN=LAJC:NH=N&LA8MG?NLIEN.JCCHIN5H@IKJMF<N1DMNL9LGENJFN>GMFMIKME KHNLNEMFMG;JI?NFK@EMIKN8LFMENHINIMMENLIENLBLEMAJBN>HKMIKJLC< 1:>?983;7?6?2:9<8>"?2<6?/+=<46?69LGEMENKHNLNEMFMG;JI?NALCMNHGN=MALCM 9DHNM,BMCFNJIN5HA>@KMGN4BJMIBMNLIENM,MA>CJ=JMFN?MI@JIMNCMLEMGFDJ>< 69LGEMEN8:NJCKHIN"<N4DJGCM:7N4G<N 1:>?%=(<=?1>=8?,0*8>>5>?%=+<>70>?=74?%=(<=?,6?1<(5>4>88?/+=<46 69LGEMENKHNLNEMFMG;JI?NGJFJI?NFMIJHGN=GHAN1GJIJK:N&L>KJFKN5D@GBDNH= *CHGMIBM7NHGN=GHANKDMNBJK:NHGNBH@IK:NH=N*CHGMIBM7N4H@KDN5LGHCJIL7N9DH M,DJ8JKFNFBDHCLGFDJ>7NCMLEMGFDJ>7NFMG;JBM7NLIENBDLGLBKMGNLIENJFNAL0HGJI?NJI 3CMAMIKLG:N3E@BLKJHI<N'GLEMN>HJIKNL;MGL?MNA@FKN8MN!< NHGNL8H;M< .HILKMEN8:N2GF<N/MLGCN%<N2B5CMMFM< 1:>?/74><5;7?;7;<5?<;#<=.?/+=<46?/GMFMIKMENKHNLNAMA8MGNH= -6-3N9JKDN=JILIBJLCNIMMEN=HGNME@BLKJHILCNM,>MIFMF<N.HILKMEN8:N.G< MLIIMN2<N2BMKKNLIEN=LAJC:< 1:>?!=7?&;><3?;495;7?2<6?,>.;<9=8?/+=<46?69LGEMENKHNLNGJFJI? 0@IJHGNHGNGJFJI?NFMIJHGN9JKDNLNEMBCLGMENJIKMGMFKNJIN3I?CJFDNHGNGMCLKMENLGML< *6?6? +>75?/+=<46?/GMFMIKMENKHNKDMNFK@EMIKN9JKDNKDMNDJ?DMFKNL;MGL?MNJI -MCJ?JHINLIEN9DHNDLFN?HHENCMLEMGFDJ>NL8JCJKJMF< 1:>?&>6?6?!6?27;44"?-74;+>4?/+=<46?69LGEMENKHNLINLBKJ;MNAMA8MG H=NLN&L>KJFKNBD@GBD<N1DMNFK@EMIKNA@FKNDL;MNLKNCMLFKNLN!<NHGN8MKKMGN?GLEM >HJIKNL;MGL?MNLIEN8MNLNCJBMIFMENAJIJFKMGNH=NKDMN'HF>MCN8:NLNAJFFJHILG: &L>KJFKNBD@GBD<N1DMNFK@EMIKNA@FKNGM=CMBKNLNFJIBMGMNLIENBHAAJKKME GMCLKJHIFDJ>N9JKDNMF@FN5DGJFK<N4>MBJLCNBHIFJEMGLKJHINAL:N8MN?J;MINKHNLNCL: FK@EMIKN9DHNJFNAL0HGJI?NJIN/LFKHGLCN2JIJFKG:NHGN5DGJFKJLIN3E@BLKJHI< .HILKMEN8:NKDMN4H@KDN5LGHCJILN&L>KJFKN5HI?GMFFNH=N5DGJFKJLIN3E@BLKJHI< 1:>?-6?6?%>+95?/+=<46?69LGEMENKHNLNFK@EMIKN9JKDNLN'/6NH=N!<NHGNDJ?DMG 9DHNJFN>@GF@JI?NLNEM?GMMNJINEJ;JIJK:NHGNME@BLKJHINLIENJFNLINLBKJ;M >LGKJBJ>LIKNJINBLA>@FNHG?LIJLKJHIFNLIEHGNAJIJFKGJMFN9DJBDNF@>>HGKNKDM 4@AKMGNBHAA@IJK:< 1:>?,=<"?/6?><>>7;<4;7?,>.;<9=8?/+=<46?69LGEMENKHNLFFJFK FK@EMIKF7N8LFMENHIN=JILIBJLCNIMME7NJINKDMJGN>@GF@JKNH=NLBLEMAJBNFK@EJMFNLK 2HGGJFN5HCCM?M<N3FKL8CJFDMEN8:NKDMNBHCCML?@MF7N=GJMIEF7NLEAJGMGF7NLIE =LAJC:NH=N.G<N2LG:N6<NMGMMI+'HGEHI7N=HGAMGN6BLEMAJBN.MLINLIENLI H@KFKLIEJI?N=LB@CK:NAMA8MG< 1:>?6?,6?8;(73?-74;+>4?/+=<46?69LGEMENKHNLN9HGKD:NLIENEMFMG;JI? FK@EMIKNAL0HGJI?N(IN5DGJFKJLIN3E@BLKJHI7N/LFKHGLCN2JIJFKG:7NHGN1MLBDMG 3E@BLKJHI<N3FKL8CJFDMEN8:NKDMN=LAJC:NH=N.G<N"<N2<N&CH@IK< 1:>? 50=<?%6?<970>?,>.;<9=8?/+=<46?69LGEMENKHNLNGJFJI?NFH>DHAHGM7 38


STUDENT AFFAIRS 0@IJHG7NHGNFMIJHGNAL0HGJI?NJIN3E@BLKJHINLIEN>HFFMFFJI?NLNB@A@CLKJ;MN?GLEM >HJIKNL;MGL?MNH=NLKNCMLFKN#<$NHINLN<$NFBLCM<N3FKL8CJFDMENLIENMIEH9MEN8: =LAJC:NLIEN=GJMIEF< 1:>?9889=.?6?=.>5?,>.;<9=8?-74;+>4?/+=<46?69LGEMENKHNLI H@KFKLIEJI?NFK@EMIKNAL0HGJI?NJIN/HCJKJBLCN4BJMIBMN9JKDNLINJIKMGMFKNJI >@GF@JI?NLNCL9NEM?GMM<N1DMNFK@EMIKNA@FKN8MNLN0@IJHGNHGNGJFJI?NFMIJHGNLIE A@FKNDL;MNLN'/6NH=N#<$NLIEN8MNLBKJ;MNJINBHAA@IJK:NFMG;JBMNHIN8MDLC=NH= EJFLE;LIKL?MEN?GH@>F<N3FKL8CJFDMEN8:NKDMN4@AKMGN5H@IK:N/@8CJB 69LGMIMFFN6FFHBJLKJHI7N(IBHG>HGLKME< 2* %/&2'2 #  !#"!!" #  #"#""# ##!"# " #"#"!#!#!#"#  !#!#"#! "#" #"! " "!!"# ! #"#! "#!#"#" !#" 1:>?%(75?*6?&90:=<45;7?-74;+>4?20:;8=<5:9)6?69LGEMENKHNM,BM>KJHILC DJ?DNFBDHHCN?GLE@LKMFN9JKDNLN?GLEMN>HJIKNL;MGL?MNH=N#<NHGNDJ?DMGNH@KNH= <$<N4BDHCLGFDJ>FNH=N7$$NLII@LCC:NLGMNGMIM9L8CMN=HGN@>NKHN=H@G :MLGF<1DMN2HGGJFN5HCCM?MN/GMFJEMIKJLCN4BDHCLGFDJ>N/GH?GLAN9LF MFKL8CJFDMEN8:NKDMN5HCCM?MNKHNGMBH?IJMNLIENGMBG@JKNDJ?DNFBDHHCNFMIJHGF 9DHNDL;MNL8H;M+L;MGL?MNLBLEMAJBNGMBHGEF<N 1:>?<>594>739=8?20:;8=<5?<;#<=.6 1DMN/GMFJEMIKJLCN4BDHCLGFN/GH?GLA 9LFNMFKL8CJFDMEN8:NKDMN5HCCM?MNKHNGMBH?IJMNLIENGMBG@JKNDJ?DNFBDHHC FMIJHGFN9DHNDL;MNL8H;M+L;MGL?MNLBLEMAJBNGMBHGEF<N69LGENGMBJ>JMIKFNA@FK GLI)NJINKDMN@>>MGNHIM+=H@GKDNH=NKDMJGN?GLE@LKJI?NBCLFF7NA@FKNDL;MN8MMI LEAJKKMENKHN2HGGJFN5HCCM?MNLIENA@FKNDL;MNF@8AJKKMENLNBHA>CMKME L>>CJBLKJHIN=HGNKDMNFBDHCLGFDJ>N8:NKDMN>GMFBGJ8MENELKM< 1:>?<>594>739=8?20:;8=<5?!;7;<5 1DMN-@KDN2LB)N2MAHGJLCN*@IE7 1DMNMGJKL?MN5CLFFJBN*H@IELKJHIN4BDHCLGFDJ>7N46*3N*MEMGLCN5GMEJK IJHI7N1DMN-HKLG:N5C@8NH=N4@AKMG7N4<5<7N*H@IELKJHINH=N(IEM>MIEMIK 5HCCM?MF7N4566N5HG>HGLKJHIN453'7N.<%<N4B@GG:N*H@IELKJHI7N.LI)L (IE@FKGJMF7N'4 N5DMAJBLCN4MG;JBMF7N(IB<7N-JCM:NN5HA>LI:7N1DMN'GMLKMG 4@AKMGN5DLA8MGNH=N5HAAMGBM7N"LBDH;JLN*H@IELKJHI7N5<N<NLCCALI7 LIENKDMN5HCCM?M< 1:>?9889=.?&=74;8):?>=<53?-74;+>4?20:;8=<5:9)6?69LGEMENKHNL FK@EMIKNAL0HGJI?NJIN3E@BLKJHIN9DHNDLFN>LFFMENKDMN/GL,JFN(N3,LAJILKJHI7 DLFNLN?GLEMN>HJIKNL;MGL?MNH=NLKNCMLFKN!<NHGN8MKKMG7NLIENFDH9FNCMLEMGFDJ> @LCJKJMF< 1:>?/<3:(<?9797#?!=95?;(74=39;7?20:;8=<5:9)6 69LGEMENKHN=H@G FK@EMIKFNGJFJI?NFH>DHAHGMF7N0@IJHGFNHGNFMIJHGFN9JKDNLN?GLEMN>HJIKNL;MGL?M H=N!<NHGNL8H;M7NAL0HGJI?NJIN/LFKHGLCN2JIJFKG:NHGN5DGJFKJLIN3E@BLKJHI< .HILKMEN8:NKDMN6GKD@GNJIJI?N.L;JFN*H@IELKJHI< 1:>?903;<9=?97>?20:;8=<5:9)6 69LGEMENKHNLNEMFMG;JI?NGJFJI?N0@IJHG 3E@BLKJHINAL0HGN9DHNALJIKLJIFNLNAJIJA@AN!<$N?GLEMN>HJIKNL;MGL?M< .HILKMEN=GHANKDMNJBKHGJLN"JIMN3FKLKMN*@IEF< 1:>?=.>5?6?=74?*=<<9>?!>7795?=98>?20:;8=<5:9)6 69LGEMENKHNL EMFMG;JI?NFK@EMIKN9JKDNLNAJIJA@AN?GLEMN>HJIKNL;MGL?MNH=N#<$$NHINLN<$$ FBLCMNJINKDMN=JMCENH=N1MLBDMGN3E@BLKJHI< 1:>?=5:39?=05;7?2.93:?20:;8=<5:9)6 69LGEMENKHNK9HNIMME:N=JGFK+KJAM =GMFDAMINNALCMNLIENN=MALCMN9JKDNH@KFKLIEJI?NDJ?DNFBDHHCNLBLEMAJB LBDJM;MAMIKNLIEN?HHENBJKJMIFDJ><N.HILKMEN8:NKDMNLFDKJNLB)FHIN4AJKD 3FKLKM< 39


MORRIS COLLEGE CATALOG 1:>?=0:;9=?-74;+>4?20:;8=<5:9)6 /GMFMIKMENKHNLNGJFJI?N0@IJHGNHG FMIJHGNAL0HGJI?NJIN&@FJIMFFN6EAJIJFKGLKJHI<N.HILKMEN8:NKDMN"LBDH;JL *H@IELKJHI< ,;<<95?*;88>#>?1<(53>>?20:;8=<5:9)6 69LGEMENKHNLN?GLE@LKJI?NFMIJHG 9DHNEMAHIFKGLKMFN=JILIBJLCNIMME7N9DHNJFNLINH@KFKLIEJI?NFK@EMIK7NLIEN9DH DLFNM,BMCCMENJINDJFNHGNDMGNAL0HGNLGMLNH=NFK@E:<N*JILIBJLCNIMMENJFNFKGHI?C: MA>DLFJME<N6NFMIJHGN9DHFMNH;MGLCCN=JILIBJLCNLJEN>LB)L?MNCML;MFNDJANHG DMGN9JKDNLN8LCLIBMNLIEN9DHNIMMEFN=JILIBJLCNLFFJFKLIBMNKHNDMC>NBH;MGNKDM FDHGK=LCCN9JCCN8MNBHIFJEMGME<N1DMNFK@EMIKNA@FKNDL;MNLNAJIJA@AN#<$N?GLEM >HJIKNL;MGL?MNLIENEMAHIFKGLKMNLBLEMAJBNM,BMCCMIBMNLIENH@KFKLIEJI? CMLEMGFDJ>NLIENBJKJMIFDJ><N(=NIHNHIMNAMMKFNKDMNBGJKMGJL7NKDMNFBDHCLGFDJ>N9JCC 8MNL9LGEMENKHNLN0@IJHG<N4>HIFHGMEN8:NKDMN2HGGJFN5HCCM?MN&HLGENH= 1G@FKMMF< 1:>?&>><>74?/<3:(<?=83><?9889=.5?20:;8=<5:9)6 69LGEMENKHNKDM KDGMMNGJFJI?NFH>DHAHGMFN9JKDNKDMNDJ?DMFKN?GLEMN>HJIKNL;MGL?MF< 1:>?%;339>?=74?:>8><?,=33:>+5?20:;8=<5:9)6 /GMFMIKMENKHNL BHIFBJMIKJH@FNFK@EMIKNAL0HGJI?NJIN3E@BLKJHIN9JKDNLN?GLEMN>HJIKNL;MGL?MNH= !<NHGNL8H;MNLIENJINIMMENH=N=JILIBJLCNLJE<N.HILKMEN8:N2G<NN2GF<N%HKKJMNLIE "DMCMGN2LKKDM9F< 1:>?2=<=:?,6?9889=.5?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNLNEMFMG;JI? FK@EMIKN9DHNALJIKLJIFNDJ?DNFBDHCLGFDJ>NLIEN>GH;JEMFNFK@EMIKNCMLEMGFDJ> KDGH@?DNDJFNHGNDMGN>LGKJBJ>LKJHINJINBH+B@GGJB@CLGNLBKJ;JKJMF<N.HILKMENJI AMAHG:NH=N2GF<N4LGLDN2<N"JCCJLAF< 1:>?&>><>74?6?/6?;:75;7?2<6?=74?,<56?/779>?,6?;:75;7 ,>.;<9=8?20:;8=<5:9)6 /GMFMIKMENKHNLINH@KFKLIEJI?NFK@EMIKNJIN-MCJ?JHI< .HILKMEN8:N2GF<N"<N<N2HHGM< 1:>?>7>=?=74?-><>33?6?1:;.)5;7?20:;8=<5:9)6 69LGEMENKHNLNGJFJI? FH>DHAHGMNFK@EMIKN9JKDNKDMNDJ?DMFKNL;MGL?MNJIN3CMAMIKLG:N3E@BLKJHI< .HILKMEN8:NKDMN1DHA>FHIN*LAJC:< 1:>?1:;.=5?,;55?/.><90=795.?20:;8=<5:9)6?3FKL8CJFDMEN8:NKDMN=HGAMG <N4<N4MILKHGN4KGHAN1D@GAHIE7N6E;JFHGNKHNHDIN/<N'LK:N5DLGJKL8CMN1G@FK< 69LGEMENLII@LCC:NKHNIMME:NLIEN9HGKD:NFK@EMIKFN8LFMENHINLN>L>MGNHI 6AMGJBLIJFA7NKDMNF>MBJ=JBNKH>JBNH=N9DJBDNJFNLIIH@IBMEN>GJHGNKHNLI@LG:<N 1:>?!=94?,0%=(#:897?20:;8=<5:9)6?69LGEMENJINAMAHG:NH=N.G<N.L;JE 2B%L@?DCJINKHNLNEMFMG;JI?NFK@EMIKNH=N?HHENAHGLCNBDLGLBKMGNAL0HGJI?NJINHIM H=NKDMNFBJMIBMFNLIENALJIKLJIJI?NLN?GLEMN>HJIKNL;MGL?MNH=N&NHGNL8H;M< .HILKMEN8:N2GF<N(GJFN2B%L@?DCJI< 1:>?,;<<95?*;88>#>?$=39;7=8?/8(.79?20:;8=<5:9)6?69LGEMENKHNKDGMM LE;LIBMENFK@EMIKFNJIN1MLBDMGN3E@BLKJHINLIENK9HNFK@EMIKFNJINLI:NHKDMG AL0HGN9DHNAMMKNKDMN=HCCH9JI?NBGJKMGJLN5@A@CLKJ;MN?GLEMN>HJIKNL;MGL?MNH= !<NHGNL8H;M7NM;JEMIBMNH=N?HHENBDLGLBKMGNLIENKMLBDJI? >GHAJFM7NCMLEMGFDJ>N@LCJKJMF7NLIENLNIMMEN=HGN=JILIBJLCNLFFJFKLIBMNKH LBDJM;MNME@BLKJHILCN?HLCF<N4>HIFHGMEN8:NKDMN2HGGJFN5HCCM?MNLKJHILC 6C@AIJN6FFHBJLKJHI< 1:>?><790>?>885?23(>5,;5>?20:;8=<5:9)6?/GMFMIKMENJINAMAHG:NH= LAMFN"<N4K@)MFNKHNKDMNFK@EMIKN9DHNDLFNDJ?DNFBDHCLGFDJ>NLIENJF H@KFKLIEJI?NJINCMLEMGFDJ>NF)JCCFNLIENJINFMG;JBMNKHNKDMNBHCCM?MNLIENCHBLC BHAA@IJK:<N.HILKMEN8:N.G<N&MGIJBMN2HFM< 1:>?6?-6?<90>?=74?/4=?%>>?<90>?,>.;<9=8?20:;8=<5:9)6 1DMN=@IE L9LGEFNLII@LCC:NLNFBDHCLGFDJ>NKHNLNEMFMG;JI?N=MALCMNLIENLNEMFMG;JI?NALCM 40


STUDENT AFFAIRS FK@EMIK<N(INFMCMBKJI?NKDMNEMFMG;JI?NGMBJ>JMIKF7NMA>DLFJFNFDLCCN8MN>CLBMENHI BDLGLBKMGNLFN9MCCNLFNFBDHCLFKJBNL8JCJK:<N*JILIBJLCNIMMENAL:NLCFHN8M BHIFJEMGME< 1:>?2(.3><?/8(.7=>?*:=)3><?;?!>83=?29#.=?1:>3=?2;<;<93"?'706 20:;8=<5:9)6 69LGEMENKHNKDMNAMA8MGNH=N JN-DHN5DL>KMGNH=N.MCKLN4J?AL 1DMKLN4HGHGJK:7N(IB<N9JKDNKDMNDJ?DMFKN?GLEMN>HJIKNL;MGL?M<N*@IEFNLGMNKHN8M @FMEN=HGNKDMN>@GBDLFMNH=NJIFKG@BKJHILCNALKMGJLCF< $=39;7=8?*;(7098?;?$>#<;?;.>7?,=<"?,0%>;4?>3:(7>?2>039;7 20:;8=<5:9)6 69LGEMENKHNK9HN0@IJHGNHGNFMIJHGN1MLBDMGN3E@BLKJHINAL0HGF HIMNALCMNLIENHIMN=MALCMN9DHNDL;MNB@A@CLKJ;MN?GLEMN>HJIKNL;MGL?MFNH= LKNCMLFKN!<7NEMAHIFKGLKMNM,MA>CLG:NFKLIELGEFNH=NCJ;JI?7NLIENLGMNLBKJ;MC: JI;HC;MENJINBLA>@FNLIEHGNBHAA@IJK:NL==LJGF< 1:>?9889=.?,6?;;4+97?,>.;<9=8?20:;8=<5:9)6?3FKL8CJFDMEN8:N.G<N5< 5<N'HHE9JI7NG<NH=N4@AKMG7NKDJFNL9LGENJFN>GMFMIKMENKHNLNEMFMG;JI?NFK@EMIK 9DHNM,MA>CJ=JMFNFKGHI?NLBLEMAJBN>HKMIKJLC7NCMLEMGFDJ>NF)JCCF7NLIENLN?HHE BJKJMIFDJ>NGMBHGE< 1:>?;;><?,>.;<9=8?20:;8=<5:9)6 /GMFMIKMENKHNLNFK@EMIKN9DH >HFFMFFMFNDJ?DN5DGJFKJLINJEMLCFNLIENEMAHIFKGLKMFNLN)MMINJIKMGMFKNJI /D:FJBFNHGN5DMAJFKG:<N3IEH9MEN8:NKDMN3FKLKMNH=N2GF<N-<N5<N&HH)MG< 1:>?=..=?';3=?*:=)3><?;? .>#=?59?:9?<=3><793"?20:;8=<5:9)6 69LGEMENKHNKDMNAMA8MGNH=N3>FJCHIN%LA8ELN5DL>KMGNH=N AM?LN/FJN/DJ *GLKMGIJK:N9JKDNKDMNDJ?DMFKN?GLEMN>HJIKNL;MGL?M< 1:>?%(75?*6?&90:=<45;7?>>?!>>?/<>=?20:;8=<5:9)6?69LGEMENKHNL 9HGKD:NFK@EMIKN9DHNEMAHIFKGLKMFNM,BM>KJHILCNBJKJMIFDJ>7NFBDHHCNF>JGJKNLIE LBLEMAJBNM,BMCCMIBM<N4K@EMIKNA@FKN8MNH=N?HHENGM>@KLKJHI7NDL;MN=JILIBJLC IMMENLIENDL;MNLN'/6NH=N#<$NHGN8MKKMG<N/GM=MGMIBMN9JCCN8MN?J;MINKHNLNFK@EMIK =GHANKDMN/MMN.MMNLGML<N4>HIFHGMEN8:NKDMN/MMN.MMNLGMLNLC@AIJ7 8@FJIMFFMF7NJIEJ;JE@LCNBD@GBDMFNLIEN=GJMIEFNJINGMBH?IJKJHINH=N/GMFJEMIK -JBDLGEFHIFNEMEJBLKMENCMLEMGFDJ>< 1:>?=.>5?2=.(>85?<6?,>.;<9=8?,(590?20:;8=<5:9)6 1HNLNGJFJI? 0@IJHGNHGNFMIJHGNA@FJBN5HIBMGKN5DHJG7N;HJBM7NHGN>JLIHNFK@EMIKN9DH EMAHIFKGLKMFNCMLEMGFDJ>NL8JCJK:<N1DMNGMBJ>JMIKNA@FKNDL;MNLNAJIJA@AN?GLEM >HJIKNL;MGL?MNH=N!<NLIENA@FKN8MNGMBHAAMIEMEN8:NKDMNA@FJBN=LB@CK:< .HILKMEN8:NKDMN4@AKMGN2@FJBN'@JCE7N(IB<NLIEN=GJMIEF< 1:>?979>?&>94?20:;8=<5:9)6 69LGEMENKHNLN0@IJHGNH=N?HHENAHGLC BDLGLBKMGNAL0HGJI?NJIN2LFFN5HAA@IJBLKJHIF7NALJIKLJIJI?N!<NHGNL8H;M ?GLEMN>HJIKNL;MGL?MNLIEN>HFFMFFMENH=NLNFJIBMGMNJIKMGMFKNLIENEMAHIFKGLKME KLCMIKNJIN8GHLEBLFKNAMEJL<N.HILKMEN8:N38MIMMGN&L>KJFKN5D@GBDNH= 5DJBL?H< 1:>?/<3:(<>>?,0*;"?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNLN0@IJHGNH=N?HHE AHGLCNBDLGLBKMGNAL0HGJI?NJIN2LFFN5HAA@IJBLKJHIFNHGN3I?CJFDN9DHN9GJKMF KDMNAHFKNH@KFKLIEJI?NLGKJBCMN>@8CJFDMENJIN1DMNMGJKL?MNHGNHKDMG >@8CJBLKJHIF<N.HILKMEN8:N.G<N-LCMJ?DN2B5H:< 1:>?-3=?>3=? .>#=?*:=)3><?/8):=?=))=?/8):=?2;<;<93"?'706 20:;8=<5:9)6 69LGEMENKHNLNAMA8MGNH=N@N'LAALN5DL>KMGNH=N6C>DL

L>>LN6C>DLN4HGHGJK:7N(IB<N9DHNM,MA>CJ=JMFNDJ?DNFBDHCLFKJBNL8JCJK:7 CMLEMGFDJ>7NFKGHI?NAHGLCNBDLGLBKMGNLIENDLFNMLGIMENKDMNDJ?DMFKN?GLEMN>HJIK L;MGL?MNJINKDMNBDL>KMG<NN.HILKMEN8:NKDMN3KLNMKLN AM?LN5DL>KMG7N4@AKMG7 4<5< 1:>?9?1:>3=?*:=)3><?;?>3=?:9?>3=?2;<;<93"?'706?20:;8=<5:9)6 /GMFMIKMENKHNKDMN:H@I?NCLE:NJINKDMN=GMFDALINBCLFFN9DHNEMAHIFKGLKMFNDJ?D 41


MORRIS COLLEGE CATALOG FBDHCLFKJBNLBDJM;MAMIKNLIENEJF>CL:FNKDMN@LCJKJMFN=HGN=JIMGN9HALIDHHE7NLF EMKMGAJIMEN8:NKDMNBDL>KMGNAMA8MGF<N4DMNA@FKNDL;MNLNB@A@CLKJ;MN'/6NH= #<#NHGNL8H;M< 1:>?!<6?6?6?$>=8?20:;8=<5:9)6 /GMFMIKMENKHNKDMN0@IJHGNFK@EMIKN9JKDNKDM DJ?DMFKNL;MGL?MNJIN2LKDMALKJBFN=HGNKDGMMNBHIFMB@KJ;MN:MLGF<N.HILKMEN8: 2GF<N6@EGM:N/<NMLC< 1:>?<=7?6?29.5?20:;8=<5:9)6 69LGEMENKHNLNFK@EMIKNAL0HGJI?NJI 4HBJHCH?:N9DHNM,MA>CJ=JMFNFBDHCLGFDJ>7NCMLEMGFDJ>7NLIENFKGHI?NAHGLC BDLGLBKMG< 1:>?;:7?=74?>=3<90>?*:=).=7?1:;.=5?20:;8=<5:9)6 69LGEMENKHNL FK@EMIKNAL0HGJI?NJIN2LKDMALKJBFNHGN4BJMIBM< 1:>?6?26?35>"?20:;8=<5:9)6 /GMFMIKMENKHNLNGJFJI?N0@IJHGNHGNFMIJHG &@FJIMFFN6EAJIJFKGLKJHINFK@EMIKN9JKDNLN?GLEMN>HJIKNL;MGL?MNHGN!<NHG L8H;M< 1:>?;;4>88;+5?*8(?20:;8=<5:9)6 69LGEMENKHNLNGMFJEMIKNH=N4@AKMG7 457N9DHNJFNAL0HGJI?NJIN3E@BLKJHINLIEN9DHNDLFN>LFFMENKDMN/GL,JFN( 3,LAJILKJHI< 1:>?,=.9>?$6?*;><?20:;8=<5:9)6 69LGEMENKHNKDMN0@IJHGN9JKDNKDMNDJ?DMFK L;MGL?MNJIN3LGC:N5DJCEDHHEN3E@BLKJHI<N3FKL8CJFDMEN8:NKDMN&L>KJFK 3E@BLKJHILCNLIEN2JFFJHILG:N5HI;MIKJHINH=N4H@KDN5LGHCJIL< 1:>?=79>?26?9#:3;+><?,>.;<9=8?20:;8=<5:9)6 /GMFMIKMENKHNLNFK@EMIK AL0HGJI?NJIN3E@BLKJHIN9DHNALJIKLJIFNLN!<N?GLEMN>HJIKNL;MGL?MNHGNL8H;M LIENJFNJINIMMENH=N=JILIBJLCNLFFJFKLIBM<N.HILKMEN8:N2G<N"JCCLGN<NJ?DKH9MG7 G< 1:>?&;5=?26?&98>"?-74;+>4?20:;8=<5:9)6 69LGEMENKHNLN0@IJHGNHGNFMIJHG 3E@BLKJHINAL0HGN9JKDNLN#<$N?GLEMN>HJIKNL;MGL?MNHGNL8H;MN9DHN>CLIFNKH KMLBDNJIN4H@KDN5LGHCJIL<N.HILKMEN8:N2G<N5DLGCMFN3<N-JCM:NLIEN2GF LB@MCJIMN2<N"JCCJLAF< 1:>?%6?6?9889=.5?-74;+>4?,97953><9=8?20:;8=<5:9)6 /GMFMIKMENKHNL GJFJI?N0@IJHGNHGNFMIJHGN9JKDNLN!<N?GLEMN>HJIKNL;MGL?M<N1DMNGMBJ>JMIKNA@FKN8M MJKDMGNLNCJBMIFMENHGNLINHGELJIMENAJIJFKMGNH=NLI:N5DGJFKJLIN.MIHAJILKJHI 9DHNJFN>@GF@JI?NLN&LBDMCHGNH=N6GKFNEM?GMMNJIN/LFKHGLCN2JIJFKG:<N.HILKMEN8: KDMNBDJCEGMINLIENHKDMGN=LAJC:NAMA8MGFNH=N.G<N%<N"<N"JCCJLAF< 1:>?!<6?,=<9;7?;;4=<4?<9#:3?,0%>53><?-74;+>4?20:;8=<5:9)6?6I LII@LCNL9LGEN>GMFMIKMENKHNKDMN3E@BLKJHINAL0HGN9DHN>MG=HGAFNKDMN?GMLKMFK LAH@IKNH=NBHCCM?MNLIENBHAA@IJK:NFMG;JBMNLFNJEMIKJ=JMEN8:NKDMN3E@BLKJHI .J;JFJHIN5DLJG< !<6?%6?6?%;7#?,>.;<9=8?20:;8=<5:9)6?/GMFMIKMENKHNLNGJFJI?NIHI+ KGLEJKJHILCN0@IJHGNHGNFMIJHGN9JKDNKDMNDJ?DMFKN?GLEMN>HJIKNL;MGL?M< 1:>?=(897>?9753;7?1:;.)5;7?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNLI H@KFKLIEJI?NFK@EMIKNJINKDMN5HH>MGLKJ;MN3E@BLKJHIN/GH?GLA< 1:>?*<>>0:?&;44>"?=35;7?'75(<=70>?20:;8=<5:9)6 /GMFMIKMENKHNKDM GJFJI?NFMIJHGNAL0HGJI?NJIN&@FJIMFFN6EAJIJFKGLKJHIN9JKDNKDMNDJ?DMFKN?GLEM >HJIKNL;MGL?M<N.HILKMEN8:N5GMMBDN-HEEM:N"LKFHIN(IF@GLIBM< 1:>?!<6?/4>88>?6?23>+=<3?20:;8=<5:9)6 69LGEMENKHNLNEMFMG;JI?NFK@EMIK 9JKDN=JILIBJLCNIMME< 1:>? 9?&:;?*:=)3><?;?!>83=?29#.=?1:>3=?2;<;<93"?'706?20:;8=<5:9)6 69LGEMENKHNKDMN=MALCMN=GMFDALINFK@EMIKN9JKDNKDMNDJ?DMFKN?GLEMN>HJIK L;MGL?M<N 42


STUDENT AFFAIRS 1:>?!988?=74?/=8>>?=3>5?=.8>?20:;8=<5:9)6 69LGEMENKHNLNFK@EMIK AL0HGJI?NJIN3CMAMIKLG:N3E@BLKJHIN9JKDNLN&NHGN8MKKMGNL;MGL?M< 1:>?,=.9>?=.>5?=77=:?=74?*=74=0>?=.>5?&90:=<45;7 20:;8=<5:9)6 69LGEMENKHNLNEMFMG;JI?NFK@EMIKN9JKDN=JILIBJLCNIMME<N.HILKME 8:N2G<NMGG:NLIILD< 1:>?&;><3?<>#;<"?:93>?,>.;<9=8?20:;8=<5:9)6?69LGEMENLII@LCC:NKH LFFJFK7NMIBH@GL?M7NLIENF@>>HGKNLNEMFMG;JI?NALCM<N4K@EMIKNA@FKN8MNL =GMFDALIN9JKDNLN?GLEMN>HJIKNL;MGL?MNIHNCMFFNKDLIN!<$NLIENIHNDJ?DMGNKDLI !<N9DHNM,DJ8JKFNLNBHAAJKAMIKNKH9LGEN?MKKJI?NLINME@BLKJHINLIENGMLBDJI? DJFN>HKMIKJLC<N3FKL8CJFDMEN8:N2G<N-H8MGKNLIEN2GF<N/GJFBJCCLN"DJKMNKHNGM=CMBK KDMNAMAHG:NH=N-H8MGKN'GM?HG:N"DJKM7NKDMJGNFHI7NL==MBKJHILKMC:N)IH9INLF DJH< 1:>?>559>?6?1="8;<?20:;8=<5:9)6 69LGEMENKHNLNFK@EMIKNAL0HGJI?NJI 3I?CJFDNHGN2LFFN5HAA@IJBLKJHIFNHGN9DHN9GJKMFNJIF>JGLKJHILCNCJKMGLK@GM< 1:>?6?6?:9))><?2<6?-74;+>4?20:;8=<5:9)6 69LGEMENKHNLINJIBHAJI? =GMFDALIN=HGNBHCCM?MNGMCLKMENM,>MIFMF<N1DMNFK@EMIKNA@FKNDL;MNLKNCMLFKNL !<N?GLEMN>HJIKNL;MGL?MNLIENM,MA>CJ=:N5DGJFKJLINBDLGLBKMGNLIEN>HFFMFFNL >GH;MINGMBHGENH=NCMLEMGFDJ>NLIENFMG;JBM<N/GJHGJK:N9JCCN8MN?J;MINKHNFK@EMIKF 9DHN9JCCNAL0HGNJIN5DGJFKJLIN3E@BLKJHINHGN/LFKHGLCN2JIJFKG:<N3FKL8CJFDMEN8: .G<N%@BJCCMN4<N"DJ>>MG< 1:>?&>6?6?*6?=<<95;7?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNL FH>DHAHGMNFK@EMIKN9DHNDLFNLN#<$$N?GLEMN>HJIKNL;MGL?MNAL0HGJI?NJI /LFKHGLCN2JIJFKG:NHGN5DGJFKJLIN3E@BLKJHI<N/GM=MGMIBMN?J;MINKHNLNFK@EMIKN9DH JFNLNAMA8MGNH=NLNBD@GBDNJINKDMN%H;MC:NJCCN&L>KJFKN6FFHBJLKJHI<N3FKL8CJFDME 8:NDJFN9J=M7N-@KDN&<NLGGJFHI7NLIEN*LAJC:< 1:>?-..>33?=74?*<>7>88>?*;7"><5?20:;8=<5:9)6?69LGEMENMLBDN:MLGNKH LN?GLE@LKJI?NFMIJHGN9JKDNLN#<NL;MGL?MNHGNL8H;M7N9JKDNLNIHKL8CMNGMBHGENH= FMG;JBMNKHNKDMNBHCCM?MNLIENLNBHAAJKAMIKNKHNJA>GH;JI?ND@ALINGMCLKJHIFNLIE KDMN@LCJK:NH=NCJ=MN=HGN=MCCH9ND@ALIN8MJI?F<N3FKL8CJFDMEN8:N.G<NLAMFN3< 5HI:MGFNLIENHKDMGNBDJCEGMINH=N3AAMKKNLIEN5GMIMCCM< 1:>?%>8><?20=<;(#:?>;<#>?20:;8=<5:9)?/+=<46?69LGEMENKHNLNGJFJI? FMIJHGNJIN>@GF@JKNH=NLNEM?GMMNJIN1MLBDMGN3E@BLKJHIN9JKDNLN?GLEMN>HJIK L;MGL?MNH=N#<$$NHGNL8H;M<N3FKL8CJFDMEN8:NKDMN%MCMGN4BLG8H@?DN'MHG?M *LAJC:< .>#=?59?:9?<=3><793"?'706?%(75?*6?&90:=<45;7?-74;+>4 20:;8=<5:9)6?69LGEMEN>GM=MGL8C:NKHNLN?GLE@LKJI?NFMIJHGN8LFMENHIN=JILIBJLC IMME<N*JILIBJLCNIMMENJFNFKGHI?C:NMA>DLFJME7NLIENLNFMIJHGN9DHFMNH;MGLCC =JILIBJLCNLJEN>LB)L?MNCML;MFNDJANHGNDMGN9JKDNLN8LCLIBMNLIEN9DHNIMMEF =JILIBJLCNLFFJFKLIBMNKHNDMC>NBH;MGNKDMNFDHGK=LCCN9JCCN8MNBHIFJEMGME<N1DM FK@EMIKNA@FKNDL;MNLN#<$N?GLEMNL;MGL?MNEMAHIFKGLKMNM,BMCCMIBMNJI LBLEMAJBNLBDJM;MAMIK7NCMLEMGFDJ>NJINM,KGLB@GGJB@CLGNLBKJ;JKJMF7NLIE BHAA@IJK:NJI;HC;MAMIKNLIENFDH9N?GMLKN>GHAJFMN=HGNCMLEMGFDJ>NL=KMG ?GLE@LKJHI<N(=NIHNFMIJHGNAMMKFNKDMNBGJKMGJL7NKDMNFBDHCLGFDJ>N9JCCN8MNL9LGEME KHNLN0@IJHG<N3FKL8CJFDMEN8:NKDMNILKJHILCNH==JBMNH=N AM?LN/FJN/DJN*GLKMGIJK:7 (IB<NJINDHIHGNH=N.G<N-JBDLGEFHIFNBHAAJKAMIKNLIENFMG;JBMNKHNDJ?DMG ME@BLKJHI< 1:>?/8.>33=?!98>"?*8"(<7?-74;+>4?20:;8=<5:9)6 69LGEMENKHNL EMFMG;JI?NFK@EMIKN>LGKJBJ>LKJI?NJINKDMNBHCCM?MFN1MLBDMGN3E@BLKJHI /GH?GLA<N4K@EMIKNA@FKN8MNJIKMIFMC:N>@GF@JI?NKDMN LBLEMAJBNLIE >GH=MFFJHILCNEM;MCH>AMIK NIMBMFFLG:NKHN8MBHAJI?NLNBHA>MKMIKNLIE M==MBKJ;MNKMLBDMGNLIENA@FKNDL;MN>LFFMEN/GL,JFN IM<N3FKL8CJFDMEN8:NIJKME 43


MORRIS COLLEGE CATALOG 4KLKMFN-M>GMFMIKLKJ;MNLAMFN3<N5C:8@GI7NKDN5HI?GMFFJHILCN.JFKGJBK7NKH >MG>MK@LKMNKDMNAMAHG:NH=NDJFNAHKDMG7NLINLC@AILNH=NKDMNBHCCM?M< 1:>?-7;5?%8;"4?*8"(<7?-74;+>4?20:;8=<5:9)6?69LGEMENKHNLN9HGKD: LIENEMFMG;JI?NFK@EMIKNAL0HGJI?NJIN/LFKHGLCN2JIJFKG:NHGN5DGJFKJLIN3E@BLKJHI< 4K@EMIKNA@FKN8MNLN0@IJHGNHGNFMIJHGN9JKDNLN?GLEMN>HJIKNL;MGL?MNH=N!<NHG L8H;MNLIENA@FKNEMAHIFKGLKMNLNFKGHI?NLIENBHIKJI@JI?NEMEJBLKJHINKH KDMHCH?JBLCNKGLJIJI?NLIEN>GM>LGLKJHI<N3FKL8CJFDMEN8:NIJKMEN4KLKMF -M>GMFMIKLKJ;MNLAMFN3<N5C:8@GI7NKDN5HI?GMFFJHILCN.JFKGJBK7NKHN>MG>MK@LKM KDMNAMAHG:NH=NDJFN=LKDMG7NLINLC@AI@FNH=NKDMNBHCCM?M7NLIENDJFNCJ=MNH=NFMG;JBM KHN'HENLIENALI< 1:>? 395?20;33?2<6?-74;+>4?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNKDM AHFKNIMME:NFK@EMIKNAL0HGJI?NJIN1MLBDMGN3E@BLKJHI<N1DMNFK@EMIKNA@FK >LGKJBJ>LKMNJINKDMNBHCCM?MFN1MLBDMGN3E@BLKJHIN/GH?GLANLIENFDH9NM;JEMIBM H=NH@KFKLIEJI?N>MG=HGALIBM7NEMAHIFKGLKMNCMLEMGFDJ>NL8JCJK:NLIEN?HHE BDLGLBKMG7NLIENALJIKLJINLKNCMLFKNLN#<$N'/6<N3FKL8CJFDMEN8:N2GF< "JCDMCAMIJLN.MIIJFN4BHKKNLIENBDJCEGMINJINAMAHG:NH=N.G<N KJFN4BHKK7N4G<7NL F)JCC=@CNME@BLKHG7NEMEJBLKMEN>LFKHGNLIENE:ILAJBN>GMLBDMG< 1:>?=<=8>>?=<<90?!()<>>?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNL =GMFDALI7NFH>DHAHGM7N0@IJHG7NHGNFMIJHGNAL0HGJI?NJIN/LFKHGLCN2JIJFKG:NHG 5DGJFKJLIN3E@BLKJHIN9JKDNLN!<NL;MGL?MNHINLN<$NFBLCMNLIEN9DHNJFNLBKJ;MNJI KDMNGMCJ?JH@FNCJ=MNH=NKDMNBLA>@F<N1DMNFK@EMIKNA@FKN8MNGMBHAAMIEMEN8:NKDM 5DLJG>MGFHINH=NKDMN.J;JFJHINH=N-MCJ?JHINLIEN@ALIJKJMF<N3FKL8CJFDMENLIE MIEH9MENJIN!$$N8:N=LAJC:NLIEN=GJMIEF< 1:>?=8><?-6?2;8;.;7?-74;+>4?20:;8=<5:9)6?1DJFNFBDHCLGFDJ>NJF CJAJKMENKHNLNFH>DHAHGM7N0@IJHG7NHGNFMIJHGNFK@EMIKNAL0HGJI?NJIN1MLBDMG 3E@BLKJHI7N9JKDNLNEMFJGMNKHNKMLBDNJINKDMN>@8CJBNFBDHHCNF:FKMA<N4K@EMIKNA@FK DL;MN>LFFMEN/GL,JFN(NLIENALJIKLJINLKNCMLFKNLN!<N?GLEMN>HJIKNL;MGL?M< 3FKL8CJFDMEN8:NKDMN/LCAMKKHN3E@BLKJHIN6FFHBJLKJHINLIENKDMN"LC)MGN"< 4HCHAHIN4BDHCLGFDJ>N*@IE7N(IBHG>HGLKME< <=9><?=.98"?;(74=39;7?20:;8=<5:9)6?69LGEMENKHNLNAJIJA@ANH=NK9H FK@EMIKFN9DHNLGMN=GMFDAMIN=GHANKDMN5DLGCMFKHIN1GJ+5H@IK:NLGML<N4K@EMIKF A@FKNEMAHIFKGLKMNLN=JILIBJLCNIMME<N3FKL8CJFDMEN8:NKDMN*GLJMGN*LAJC: *H@IELKJHI< /<3:(<??'<95?,0%=(#:897? /', ?-74;+>4?20:;8=<5:9)6 69LGEMENKHNL FK@EMIKNF>MBJLCJJI?NJINME@BLKJHI7NA@FJBNHGNLIHKDMGNFHBJLCNFBJMIBMNHG D@ALIJKJMFNEJFBJ>CJIM<N4K@EMIKNA@FKNEMAHIFKGLKMNLN=JILIBJLCNIMMENLIE ALJIKLJINLN?GLEMN>HJIKNL;MGL?MNH=N&NHGNL8H;M<N3FKL8CJFDMEN8:N6GKD@GMM 2B%L@?DCJIN"GJ?DKNKHNAMAHGJLCJMNDMGN>LGMIKF7N6GKD@GN4>J?MCNLIEN(GJF %LEFHIN2B%L@?DCJI7N9DHN9MGMN>GH@ENLIENCH:LCNLC@AIJ< +>74;8"7?-6?/74><5;7?-74;+>4?20:;8=<5:9)6 69LGEMENKHNLNFK@EMIK AL0HGJI?NJIN1MLBDMGN3E@BLKJHI<N4K@EMIKNA@FKNDL;MN>LFFMEN/GL,JFN(7 ALJIKLJINLKNCMLFKNLN!<N?GLEMN>HJIKNL;MGL?M7NLIENL?GMMNKHNKMLBDNMCMAMIKLG: ME@BLKJHINJIN4H@KDN5LGHCJILN=HGNLKNCMLFKNHIMN:MLG<N3FKL8CJFDMEN8:NKDMNMFKLKM H=N'9MIEHC:IN3<N6IEMGFHI< *=889>?*8=<?2>=8>5?20:;8=<5:9)6 69LGEMENKHNLNFK@EMIKN9DH EMAHIFKGLKMFNLN=JILIBJLCNIMME<N4K@EMIKNA@FKN8MNLNAMA8MGNH=N*JGFKN&L>KJFK 2JFFJHILG:N5D@GBDNH=N4@AKMG7N4H@KDN5LGHCJILN=HGNLKNCMLFKNK9HN:MLGFNLIE JI;HC;MENJIN;LGJH@FNLBKJ;JKJMF<N4K@EMIKNA@FKN8MNJI;HC;MENJINBHAA@IJK: FMG;JBM<N3FKL8CJFDMEN8:NJ;JLIN%<N4AJKDNJINAMAHG:NH=NDMGNAHKDMG7N5LCCJM 5CLG)N4MLCMF7N9DHN9LFNLINLBKJ;MNAMA8MGNH=N*JGFKN&L>KJFKN2JFFJHILG: 5D@GBD< 44


STUDENT AFFAIRS 1:>?%;(95?8>.97#?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNKDMN=JGFK ?MIMGLKJHI7NIHI+KGLEJKJHILCNALCMNFK@EMIKN9DHNJFNDMLENH=NDH@FMDHCEN9JKD BDJCEGMI7N9DHNDLFNEMAHIFKGLKMENLNBHAAJKAMIKNKHNM,BMCCMIBMNJINME@BLKJHI 8:NALJIKLJIJI?NLN#<$$N'/6<N4BDHCLGFDJ>NJFNGMIM9L8CMN=HGN@>NKHNKDGMMN:MLGF< 3FKL8CJFDMEN8:NKDMN=LAJC:< 1:>?;88=74?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNLNEMFMG;JI?NFK@EMIKNJI IMMENH=N=JILIBJLCNLFFJFKLIBMNLIEN9DHNM,MA>CJ=JMFNFKGHI?NLBLEMAJB >HKMIKJLC<N4K@EMIKNA@FKN8MNLNGJFJI?NFH>DHAHGM7N0@IJHG7NHGNFMIJHGNDL;MNLN!<$ N!<N?GLEMN>HJIKNL;MGL?MNLIENDL;MNLN?HHENBJKJMIFDJ>NGMBHGE<N3FKL8CJFDME JINAMAHG:NH=N2G<N2HGF8:NHCCLIEN8:NDJFN9J=M7N2GF<N"JCCJMN2LMNHCCLIE BDJCEGMINM==MG:N&<NHCCLIENLIEN4LIEGLN2<N/GHBKHGNLIEN?GLIEEL@?DKMG7

L:CLN/GHBKHG< 1:>?!<6?%>+95?6?<=:=.?2<6?-74;+>4?20:;8=<5:9)6 69LGEMENKHNL IMME:NLIENEMFMG;JI?NFK@EMIK7NAL0HGJI?NJIN5DGJFKJLIN3E@BLKJHINHGN/LFKHGLC 2JIJFKG:7N9DHNFDH9FN?GMLKN>GHAJFMN=HGN5DGJFKJLINCMLEMGFDJ><N4K@EMIKNA@FK ALJIKLJINLN!<N?GLEMN>HJIKNL;MGL?M<N3FKL8CJFDMENJINDHIHGNH=N.G<N%M9JFN/< 'GLDLA7N4G<N8:NKDMN'GLDLAN=LAJC:7N=GJMIEF7NLIENKDMN&L>KJFKN3E@BLKJHILC LIEN2JFFJHILG:N5HI;MIKJHINH=N4H@KDN5LGHCJIL< 1:>?9707>"?984><?<6?,>.;<9=8?20:;8=<5:9)6 69LGEMENKHNK9HNGJFJI? 0@IJHGFNHGNFMIJHGFN9JKDNLNB@A@CLKJ;MN?GLEMN>HJIKNL;MGL?MNH=N!<NHGNDJ?DMG< IMNA@FKN8MNAL0HGJI?NJIN&JHCH?:NHGN2LKDMALKJBF7NLIENKDMNHKDMGNA@FKN8MNL ?GLE@LKMNH=N4BHKKFN&GLIBDNJ?DN4BDHHCNJINLI:NAL0HG<N3FKL8CJFDMEN8: EL@?DKMGFN&GMIELN"JCEMG+"LK)JIFNLIEN2LG?@MGJKMN"JCEMG< 1:>?&>><>74?<=7?-6?9889=.5?2<6?-74;+>4?20:;8=<5:9)6 1HN8M L9LGEMEN>GM=MGL8C:NKHNLN=@CC+KJAMNFK@EMIKNAL0HGJI?NJIN3I?CJFD7NHGNAL0HGJI?NJI 3I?CJFD4MBHIELG:N3E@BLKJHIN9DHN9JFDMFNKHNKMLBDN3I?CJFD<N1DMNFK@EMIK A@FKNDL;MNLN#<$N?GLEMN>HJIKNL;MGL?MNHGNL8H;MNLIEN8MNJINIMMENH=N=JILIBJLC LFFJFKLIBM<N1DMNFBDHCLGFDJ>NJFNKHN8MNL9LGEMENHIBMNM;MG:NLBLEMAJBN:MLG< 3FKL8CJFDMEN8:N9J=M7N2GF<N2L?IHCJLN-<N"JCCJLAF7NLIENBDJCEGMINJINDHIHGNH= KDMN-M;MGMIEN*GLI)N3<N"JCCJLAF7N4G< 1:>?/(#(53(5?16?=74?-(790>?26?23>):>75?-74;+>4?20:;8=<5:9)6 69LGEMENKHNLNFK@EMIKNL8H;MNKDMN=GMFDALINCM;MC<N1DMNFK@EMIKNA@FKN8MNJI ?HHENFKLIEJI?NLKN2HGGJFN5HCCM?MN9JKDNLNB@A@CLKJ;MN?GLEMN>HJIKNL;MGL?MNH= LKNCMLFKN#<<$<N.HILKMEN8:N%MAM@CN5<N4KM>DMIFN=HGNKDMN3@IJBMN4<N4KM>DMIF 3FKLKM< >7?-6?=74?,=<#=<>3?,="9>84?<993:?-74;+>4?20:;8=<5:9)6 69LGEME KHNLN9HGKD:NLIENEMFMG;JI?NFK@EMIKNAL0HGJI?NJINLIEN>GM>LGJI?NKHNKMLBD 3I?CJFD<N4K@EMIKNA@FKN8MNLNGJFJI?NFMIJHGNLIENALJIKLJINKDMNDJ?DMFKNL;MGL?M< 3FKL8CJFDMEN8:N&MIN3<NLIEN9J=M7N.MCHGJFN'GJ==JKD7NJINDHIHGNH=NDJFN>LGMIKF< %><;"?2.93:?2<6?,>.;<9=8?-.><#>70"?;;?(74?20:;8=<5:9)6 69LGEMENKHNLFFJFKNFK@EMIKFNJINIMMENH=N=JILIBJLCNLFFJFKLIBMNKHN>@GBDLFM KM,K8HH)F<N1DMNFK@EMIKNA@FKNM,DJ8JKN?HHENBDLGLBKMG7NBJKJMIFDJ>7NLIENL FMGJH@FNEMFJGMNKHNLBDJM;MNKDMJGNME@BLKJHILCN?HLCF<N1DJFNL9LGENJFN?J;MIN8: DJFNBDJCEGMINLIMKN4AJKDN5CL:KHINLIEN%MGH:N4AJKD7NG< &-%'' 2?%'-MCJ?JH@FNLBKJ;JKJMFNLKN2HGGJFN5HCCM?MNLGMNEMFJ?IMENKHNMIGJBDNKDMNAHGLCNLIENF>JG+ JK@LCNLKAHF>DMGMNH=NKDMNBLA>@FNLIENKDMNF>JGJK@LCN?GH9KDNH=NMLBDNFK@EMIK< 1HNBLGG:NH@KNKDJFN>@G>HFM7NKDMN=HCCH9JI?N>GH?GLAFNLGMN>GH;JEMENE@GJI?NKDMNGM?@+ CLGNFBDHHCN:MLG  5HCCM?MN LFFMA8CJMFN LGMN DMCEN MLBDN 1D@GFEL:N LKN $$$N L<A<N .@GJI?N KDM 45


MORRIS COLLEGE CATALOG 9MM)NH=N1DLI)F?J;JI?7NKDMNLFFMA8C:NJFNDMCENHIN1@MFEL:< ! 4@IEL:N4BDHHCNJFNDMCENMLBDN4@IEL:NLKN$$NL<A< # &J8CMN4K@E:NJFNDMCENMLBDN"MEIMFEL:NLKN$$N><A<  -MCJ?JH@FN 3A>DLFJFN "MM)N FMG;JBMFN LGMN DMCEN K9JBMN ELJC:N E@GJI?N GMCJ?JH@F 3A>DLFJFN"MM)7N2HIEL:NKDGH@?DN1D@GFEL:NLIENHIBMNHIN*GJEL:< 6BKJ;JKJMFN >GH;JEMEN 8:N KDMN &L>KJFKN 4K@EMIKN IJHIN LIEN KDMN 'HF>MCN 5DHJG LCFHN MIDLIBMN KDMN GMCJ?JH@FN CJ=MN H=N KDMN 5HCCM?MN BHAA@IJK:<N 1DMNDJ?DCJ?DKNH=NGMCJ?JH@FNLBKJ;JKJMFNJFN-MCJ?JH@FN3A>DLFJFN"MM)N9DJBDN?J;MF KDMN 5HCCM?MN BHAA@IJK:N LIN H>>HGK@IJK:N KHN >CLBMN F>MBJLCN MA>DLFJFN HI 9HGFDJ>NLIENGMCJ?JH@FNJEMLCF< &-2'!-$*-?/%%2 2HGGJFN 5HCCM?MN H>MGLKMFN FJ,N GMFJEMIBMN DLCCFN KDGMMN =HGN =MALCMN GMFJEMIKF7 KDGMMN=HGNALCMNGMFJEMIKF7NLIENHIMNLFFJ?IMENLFNIMMEME<N6NFK@EMIKNEMFJGJI? KHNGMFMG;MNLNGHHANJINKDMNGMFJEMIBMNDLCCN=HGNKDMNGM?@CLGNLBLEMAJBN:MLGN=LCC LIEN F>GJI?N FMAMFKMGFN A@FKN >L:N LN HIM+KJAMN GM=@IEL8CMN GHHAN EM>HFJKN KDLK LCCH9FNKDLKNFK@EMIKNKHNGMFMG;MNLNGHHAN=HGNMLBDNFMFFJHI7NF@AAMGFNJIBC@EME< 1DMNHIM+KJAMN>L:AMIKNH=NKDMN$$NEM>HFJKN9JCCN?J;MNKDMNFK@EMIKNKDMNGJ?DKNKH GMFMG;MN LN GHHAN 8:N BHA>CMKJI?N KDMN DH@FJI?N L?GMMAMIKN =HGN MLBDN FMFFJHI< 1DMN EM>HFJKN 9JCCN 8MN GM=@IEMEN @>HIN KDMN FK@EMIKFN ?GLE@LKJHIN HGN FM>LGLKJHI =GHAN 2HGGJFN 5HCCM?M7N >MIEJI?N >L:AMIKN H=N LCCN H@KFKLIEJI?N EM8KFN KHN KDM 5HCCM?M< 1HN 8MN LEAJKKMEN KHN KDMN GMFJEMIBMN DLCCF7N FK@EMIKFN A@FKN F@8AJKN LN DH@FJI? >MGAJKN=GHANKDMN ==JBMNH=N&@FJIMFFN6==LJGF7N;MGJ=:JI?NKDLKNKDM:NDL;MNBCMLGME LCCN >GM;JH@FN =JILIBJLCN LIEN HKDMGN H8CJ?LKJHIFN KHN KDMN 5HCCM?M<N M9N FK@EMIKF LGMN LEAJKKMEN KHN KDMN GMFJEMIBMN DLCCFN 8M?JIIJI?N LKN $$N L<AN HIN KDMN EL:N H= /LGMIKM9N 4K@EMIKN GJMIKLKJHI<N -MK@GIJI?N FK@EMIKFN LGMN LEAJKKME 8M?JIIJI?N LKN $$N ><A<N HIN KDMN EL:N EMFJ?ILKMEN =HGN GMK@GIJI?N FK@EMIKFN KH HBB@>:NGMFJEMIBMNDLCCFNHGNLKN$$N><A<NHINKDMNEL:N>GJHGNKHNGMF@AJI?NBCLFFMF L=KMGNLNDHCJEL:<N-HHANGMFMG;LKJHIFNLGMNALEMN8:NB@GGMIKNFK@EMIKFN8MK9MMI *M8G@LG:NNLIEN2L:NNJINKDMN ==JBMNH=NKDMN.JGMBKHGNH=N-MFJEMIKJLCN%J=MN=HGNKDM L>>GHLBDJI?NF@AAMGNFMFFJHI7N=LCCNFMAMFKMG7NHGNF>GJI?NFMAMFKMG< * $2-%'$?2-&'*-2 5H@IFMCJI?N FMG;JBMFN LKN 2HGGJFN LGMN EMFJ?IMEN KHN DMC>N KDMN FK@EMIKN ?GH9N JI @IEMGFKLIEJI?NH=NDJFDMGN=MMCJI?F7NLKKJK@EMF7NLIEN8MDL;JHG7NLIENJIN@IEMGFKLIEJI? HKDMGFN9DHNLGMNJI;HC;MEN9JKDNKDMNFK@EMIK<N1DMFMNFMG;JBMFNJIBC@EMNBH@IFMCJI?NKH EMLCN 9JKDN >GH8CMAFN KDLKN LGMN >MGFHILC7N FHBJLC7N LBLEMAJB7N GMCJ?JH@F7N =JILIBJLC7 ALGJKLC7N>GMALGJKLCNHGNDMLCKD+GMCLKME< 4K@EMIKFNEMFJGJI?NKHNMIKMGN?GLE@LKMNFBDHHCNAL:NBHAMNKHNKDMN5H@IFMCJI? 5MIKMGNKHNH8KLJINJI=HGALKJHINL8H@KNKDMN2JCCMGN6ILCH?JMFN1MFKN261< HEALTH SERVICES AND INSURANCE All students are encouraged to have a medical record that includes immuni]DWLRQIRUPHDVOHVPXPSVDQGUXEHOODRQÃ&#x20AC;OHLQWKH+ HDOWK&HQWHU$SK\VLFDOLV required of any and all students who are planning to participate in any of the colOHJH·VVSRUWV$OOVWXGHQWVDUHJLYHQWKHRSSRUWXQLW\WRFKRRVHLQVXUDQFHFRYHUDJH WKURXJKWKHFROOHJH·VKHDOWKSODQRULIWKH\KDYHFRYHUDJHSULRUWRFRPLQJWR0RUULV WKH\PD\JRWKHVWXGHQWLQVXUDQFHZHEVLWHDQGRSWRXWRIWKHFROOHJH·VSODQ,ID VWXGHQWGHFLGHVWRGURSRUHQUROOLQWKHFROOHJH·VLQVXUDQFHSODQDWWKHHQGRIWKH semester, he/she must go online and change their status. Coverage for the Fall Semester begins in August and ends in December. Spring Semester coverage is from January through Summer School. $VFKHGXOHRIEHQHÃ&#x20AC;WVFDQEHREWDLQHGIURPWKH2IÃ&#x20AC;FHRI+ HDOWK6HUYLFHV7KH health program is coordinated by the Director of Health Services. Illnesses that 46


STUDENT AFFAIRS cannot be treated in the health room are referred out to the Colonial Family Urgent &DUHZKLFKDFFHSWVWKHFROOHJH·VLQVXUDQFH,OOQHVVHVRFFXUULQJDIWHUWKH+ HDOWK Center has closed should be reported immediately to the residence hall director or the assistant hall director on duty. The residential life staff on duty may, in turn, contact the Director of Health Services. 3DUHQWVZLOOEHQRWLÃ&#x20AC;HGLPPHGLDWHO\LIDVWXGHQWUHFHLYHVDVHULRXVLQMXU\LV DGPLWWHGWRWKHKRVSLWDORULVFRQÃ&#x20AC;QHGWRWKHUHVLGHQFHKDOOIRUPRUHWKDQWZRFRQVHFXWLYHGD\VGXHWRDQLQMXU\RUDQLOOQHVV HEALTH POLICY STATEMENT Prior to enrolling, all students are required to submit to the College a complete PHGLFDOUHFRUGRQDQRIÃ&#x20AC;FLDO0RUULV&ROOHJHPHGLFDOIRUP$FFXUDWHFRPSOHWLRQRI WKHPHGLFDOIRUPLVRISDUWLFXODULPSRUWDQFHIRUVWXGHQWVZLWKPDMRUDQGRQJRLQJ medical problems or problems requiring specialized care. The information on the medical form is essential for College personnel to assess and identify appropriate and effective treatment or make proper referrals in emergency situations. Morris &ROOHJHLVDOVRUHTXLUHGE\IHGHUDOODZWRKDYHWKLVLQIRUPDWLRQRQÃ&#x20AC;OHIRUHYHU\ full-time student enrolled. In addition to completing the initial medical record form, students participating in intercollegiate athletics are also required to have annual medical examinations. Students who have medical problems that are not included on the Morris College Health Form are required to report such conditions to the College Health staff. $OOKHDOWKLQIRUPDWLRQLVFRQÃ&#x20AC;GHQWLDODQGZLOOEHXVHGRQO\E\SURSHUKHDOWKDQG FROOHJHRIÃ&#x20AC;FLDOV Again, all students must be immunized against rubella, mumps, and measles. 6WXGHQWVFDQQRWDWWHQGFODVVHVXQWLOWKH\KDYHVDWLVÃ&#x20AC;HGWKLVUHJXODWLRQ 21!-$1?* $!*1 4K@EMIKFNGMALJINLKN2HGGJFN5HCCM?MNHINKDMNBHIEJKJHINH=NALJIKLJIJI?NFLKJF=LBKHG: AHGLCNBDLGLBKMGNLFN9MCCNLFNFBDHCLGFDJ><N1DMN5HCCM?MNGMFMG;MFNKDMNGJ?DKNKHNEJFAJFF =GHANKDMNJIFKJK@KJHINLI:NFK@EMIKN9DHFMNBHIE@BKNJFNIHKNJINDLGAHI:N9JKDNKDMNJEMLCF HGNFKLIELGEFNH=NKDMNJIFKJK@KJHI<1HNJIF@GMNKDMNFL=MK:NLIENFMB@GJK:NH=NKDMNBLA>@F7NKDM 5HCCM?MN DLFN KDMN GJ?DKN KHN EMLCN JAAMEJLKMC:N 9JKDN LI:N FK@EMIKN 9DHN JFN LN KDGMLKN KH DJAFMC=NHGNKHNHKDMGFNLIENBLINKL)MNIMBMFFLG:NLBKJHIN>MIEJI?N=HGALCN>GHBMMEJI?F< 3LBDNFK@EMIKNJFNH8CJ?LKMENKHNDMC>NALJIKLJINEJFBJ>CJIMNLIENHGEMG<N2JIHGNFK@EMIK ;JHCLKJHIFN LGMN DLIECMEN KDGH@?DN GMFJEMIBMN DLCCN FMILKMFN HGN KDMN 4K@EMIK 'H;MGIAMIKN6FFHBJLKJHIN4MILKM<N KDMGNEJFBJ>CJILG:N>GH8CMAFNLGMNDLIECMEN8:NKDM .MLIN H=N 4K@EMIKN 6==LJGFN HGN LN EMFJ?ILKMEN 5HIE@BKN 6EAJIJFKGLKHGN JIN LI LEAJIJFKGLKJ;MN DMLGJI?N HGN KDMN *LB@CK:+4K@EMIKN @EJBJLG:N 5HAAJKKMM<N *HGN =@GKDMG JI=HGALKJHINL8H@KNKDMNFK@EMIKN?GJM;LIBMN>GHBME@GM7N>CMLFMNFMMNKDMNB@GGMIKN ! ""#"##HGNKDMNB@GGMIKN!"##"#! ## !! ""  -'*%-?&-'21&/1' $ 3LBDN FK@EMIKN A@FKN GM?JFKMGN KDMN AHKHGN ;MDJBCMN DMFDMN H9IFN HGN H>MGLKMFN LIE >L:NKDMNIMBMFFLG:NGM?JFKGLKJHIN=MM<N*GMFDALINGMFJEMIKNFK@EMIKFNLGMNIHKN>MGAJKKME JIJKJLCC:N KHN 8GJI?N L@KHAH8JCMFN HGN HKDMGN AHKHGN ;MDJBCMFN KHN BLA>@F<N 6=KMGN AJE+ FMAMFKMGN M,LAJILKJHIFN JIN KDMN =LCCN KMGA7N LCCN =GMFDAMIN 9JCCN 8MN L8CMN KHN GM?JFKMG ;MDJBCMFN HIN BLA>@F<N 3;MG:N ;MDJBCMN A@FKN AMMKN LCCN FKJ>@CLKJHIFN =HGN HI+BLA>@F GM?JFKGLKJHIN F@BDN LFN 8MJI?N GM?JFKMGMEN KHN LN >LGMIK7N ?@LGEJLI7N F>H@FM7N HGN KDM FK@EMIK7N LFN 9MCCN LFN AMMKJI?N KDMN HKDMGN ?@JEMCJIMFN LFN H@KCJIMEN HIN KDMN MDJBCM -M?JFKGLKJHIN=HGAF< (=N LN =GMFDALIN JFN FMM)JI?N KHN GM?JFKMGN LN ;MDJBCMN >GJHGN KHN KDMN MIEN H=N KDMN AJE+ FMAMFKMGNM,LAJILKJHIN>MGJHE7NDMNHGNFDMNA@FKN=JGFKNH8KLJINLNCMKKMGNH=N>MGAJFFJHI =GHANKDMN ==JBMNH=N4K@EMIKN6==LJGF<N 47


MORRIS COLLEGE CATALOG

(  (((( (((  ( '$& ( %( $ ("'(&$&' ($('!( '"'&!#($&('%% '('& $#  *C9@?;<D18A98D<8@1DB8CD4?@3?C<<D@7DC=98D0CBC?=>D@?DC:A3A2:CD4C?<@>D=?C C4BD=>;D5=A>B=A>C;D2.DB8CD,@::C3C -::D 9@6?<C<D 18A98D =D 0CBC?=>D @?D C:A3A2:CD 4C?<@>D B=C<D A>D =D 4?@3?=5D @7 <B6;.D =?CD ?C9@?;C;D 2.D >652C?<D =>;D ;C<9?A4BA0CD BAB:C<D @>D =>D @77A9A=: ?C3A<B?=BA@>D 7@?5/D -D 3?=;CD ?C4@?BD 7@?D C=98D 9@6?<CD A<D <625ABBC;D =BD B8C C>;D@7DC=98D<C5C<BC?/

8C>D=D0CBC?=>D@?DC:A3A2:CD4C?<@>D1AB8;?=1<D@?DA<D;?@44C;'DB8CD;=BCD@7 1AB8;?=1=:D@?DBC?5A>=BA@>DA<D?C9@?;C;DA>D8A<D7@:;C?/

8C>D=D0CBC?=>D?C(C>?@::<D=7BC?D8=0A>3D1AB8;?=1>D@?D;?@44C;D7?@5DB8C 9@::C3C'DB8CD;=BCD@7D?C(C>?@::5C>BDA<D?C9@?;C;DA>DB8CD<B6;C>B <D7@:;C?/ &CBC?=><D =?CD 3C>C?=::.D <62C9BD B@D B8CD <=5CD <B=>;=?;<D @7D =9=;C5A9 4C?7@?5=>9CD=>;D9:=<<D=BBC>;=>9CDB8=BD=44:.DB@D=::D@B8C?D<B6;C>B<D=BD)@??A< ,@::C3C/D@1C0C?'D    1A::D>@BD=::@1D=D0CBC?=>D@?DC:A3A2:C 4C?<@>DB@D?C5=A>D@>D=9=;C5A9D4?@2=BA@>D2C.@>;DB1@D<C5C<BC?<D1AB8@6BD=> A54?@0C5C>BDA>D8A<"8C?D=9=;C5A9D<B=>;A>3/D8C?C7@?C'D=D0CBC?=>D@?DC:A3A2:C 4C?<@>DA<D<62C9BDB@D<6<4C><A@>DA7D8C"<8CD;@C<D>@BD?C5@0CDB8CD4?@2=BA@>=?. <B=B6<D=7BC?DB1@D<C5C<BC?</ &$'&' ( $&( '"'&%#%#( "'( $%#"( %#( "%'( "'( '%% '( '& $# '! ' ("$(!%#"!%#(!""'#!#'(%#(!($& '

#% $77A9A=:D1AB8;?=1=:D7?@5D=D9@6?<C/ $77A9A=:D 1AB8;?=1=:D =44:A9=BA@>D 56<BD 2CD 5=;CD 2.D B8CD C:A3A2:CD 4C?<@> A>DB?A4:A9=BC'D<A3>C;D2.DB8CD@77A9A=:<D:A<BC;D@>DB8CD7@?5'D=>;D;C:A0C?C; B@D B8CD $77A9CD @7D -;5A<<A@><D =>;D *C9@?;</D *C4@?B<D =?CD B8C>D <C>BD B@ B8CD &CBC?=><D ,@6><C:@?D 2.D B8CD $77A9CD @7D -;5A<<A@><D =>;D *C9@?;</ -BBC>;=>9CD?C4@?B<D1A::D?C7:C9BD6>@77A9A=:D1AB8;?=1=:/ #% >@77A9A=:D 1AB8;?=1=:D @?D 6><98C;6:C;D A>BC??64BA@>D A>D 9@6?<CD C>?@::D( 5C>BD=>;"@?D=BBC>;=>9C/ #% ><=BA<7=9B@?.D9@>;69BD@7D<B6;C>B<DA<D;CBC?5A>C;D@>DB8CD2=<A<D@7D;6C 4?@9C<<D A>0@:0A>3D 7@?5=:D 8C=?A>3<D =>;"@?D @77A9A=:D 1?ABBC>D >@BA7A9=BA@> B@DB8CD<B6;C>BD9@>9C?>C;/D->.D98=>3CD5=;CDA>DB8CDC>?@::5C>BD<B=B6< @7D=D0CBC?=>D@?DC:A3A2:CD4C?<@>D<8=::D2CD5=;CDB@DB8CD&CBC?=><D-;5A>D( A<B?=BA@>D1AB8A>DB8CD5@>B8D@996?A>3D@?DA55C;A=BC:.DB8C?C=7BC?/ #+% !CCD!B6;C>B<D,=::C;DB@D)A:AB=?.D!C?0A9CD#=3CD+%/ &$'&' ( $&( ! !&%#( !&$&%!"'( &'%"( $&( &' %$ ( '!"%$# !#("&!%#%#($("'( '"'&!#($&('%% '('& $#

,@::C3CD 9?C;AB<D C=?>C;D =BD =>@B8C?D A><BAB6BA@>D @7D 8A38C?D C;69=BA@>D =?C C0=:6=BC;D 2.D B8CD A?C9B@?D @7D -;5A<<A@><D =>;D *C9@?;<D =>;D B8CD =;0A<@?D A> 8CDBC?5DC:A3A2:CD4C?<@>DA<D6<C;DB@DA>9:6;CD0CBC?=><D=>;D@B8C?D&/-/(?C:=BC;DC:A3A2:C 4C?<@></

48


VETERANS AFFAIRS B8CD =9=;C5A9D 4?@3?=5D B@D 18A98D B8CD C:A3A2:CD 4C?<@>D A<D <CCA>3D =;5A<<A@>/ ?=><9?A4B<D 56<BD 2CD <C>BD 7?@5D B8CD A><BAB6BA@>D 18C?CD 9?C;ABD 1=<D C=?>C; ;A?C9B:.D B@D B8CD )@??A<D ,@::C3CD $77A9CD @7D -;5A<<A@><D =>;D *C9@?;</D )@??A< ,@::C3CD1A::D>@BD=99C4BD=>.D9@6?<CD9@54:CBC;DA>D=>@B8C?D9@::C3CD7@?D18A98 B8CD 3?=;CD ?C9CA0C;D A<D 2C:@1D ,/D ,@6?<C<D 1A::D 2CD =99C4BC;D 7@?D 3?=;6=BA@> ?C6A?C5C>B<D @>D B8CD 2=<A<D @7D B8CA?D ?C:C0=>9CD B@D B8CD ?C6A?C5C>B<D C<B=2D( :A<8C;D2.D)@??A<D,@::C3CD7@?DB8CD?C<4C9BA0CD;C3?CCD4?@3?=5<D@77C?C;D2.DB8C A><BAB6BA@>/ ,?C;ABD7@?DC;69=BA@>=:DC4C?AC>9C<DA>DB8CD-?5C;D!C?0A9C<D1A::D2CD=1=?;C; @>D B8CD 7@::@1A>3D 2=<A<D #%D =>D C0=:6=BA@>D 5=;CD 64@>D 4?C<C>B=BA@>D @7D 0=:A; 9?C;C>BA=:<D9C?BA7.A>3D<698DC;69=BA@>=:DC4C?AC>9C<'D#%D36A;C:A>C<D<CBD7@?B8 A>D B8CD           

 462:A<8C;D2.DB8CD,@55A<<A@>D@>D;69=BA@>=:D,?C;ABD@7DB8CD-5C?AD( 9=>D ,@6>9A:D @>D ;69=BA@>'D =>;D #%D B8CD ?C:C0=>9CD @7D <698D C;69=BA@>=: C4C?AC>9C<DB@DB8CD?C6A?C5C>B<D@7D)@??A<D,@::C3CD7@?DB8CD?C<4C9BA0CD;C3?CC 4?@3?=5<D@77C?C;D2.DB8CDA><BAB6BA@>/ @BA7A9=BA@>D @7D B8CD =1=?;D @7D 9?C;ABD 7@?D 4?C0A@6<D C;69=BA@>D =>;D B?=A>A>3 <8=::D2CD5=;CDB@DB8CDC:A3A2:CD4C?<@>'DB@DB8CD&CBC?=> <D,@6><C:@?D=>;DB@DB8C &CBC?=><D-;5A>A<B?=BA@>D4?A@?DB@D=;5A<<A@>/ &CBC?=><D =>;D C:A3A2:CD 4C?<@><D =?CD C4C9BC;D B@D ?C6C<BD C0=:6=BA@>D @7 4?C0A@6<DC;69=BA@>=:DC4C?AC>9C<D=BDB8CDBA5CD@7D=44:A9=BA@>D7@?D=;5A<<A@>DB@ B8CD,@::C3C/

49


!.).+0?0-0&.%,,)"$+%0#,$) $+!0),0#,$) /KNDJII:NKALNM??MDLH8MC:NLBMN=AI=KGMNJFEN=BHCKGK=B:NK?N+KIIHGN5KCCM>M6NLBM JDJEM@HDN=IK>IJ@NK?NLBMN5KCCM>MNHGNKI>JFH MENAFEMINGH*NEH8HGHKFG %H8HGHKFNK?NMFMIJCN4LAEHMG %H8HGHKFNK?NAGHFMGGN7E@HFHGLIJLHKF %H8HGHKFNK?N1EADJLHKF %H8HGHKFNK?N.MCH>HKF6N!A@JFHLHMGNJFEN4KDHJCN4DHMFDMG %H8HGHKFNK?NJLAIJCN4DHMFDMGNJFEN+JLBM@JLHDG %H8HGHKFNK?N4KDHJCN4DHMFDMG &.!+../ /BMN5KCCM>MNK??MIGNLBMN?KCCK;HF>NEM>IMMG <62>5;9? ;*? 0987 ;HL BN @JKIGN HFN 5BIHGLHJFN 1EADJLHKF6N 5IH@HFJCN AGLHDM6 1F>CHGB6N!HGLKI:6N&H9NMIJCN4LAEHMG6N'JGLKIJCN+HFHGLI:6N'KCHLHDJCN4DHMFDM6N4KDHKC2 K>:6N 1F>CHGB4MDKFEJI:N 1EADJLHKF6N JFEN 4KDHJCN 4LAEHMG4MDKFEJI:N 1EADJ2 LHKF< <62>5;9?;*?"=:>?0987 ;HLBNJN@JKINHFN+JGGN5K@@AFHDJLHKFG< <62>5;9? ;*? /6=>:6> ;HLBN @JKIGN HFN HKCK>:6N AGHFMGGN 7E@HFHGLIJLHKF6 !MJCLBN 4DHMFDM6N +JLBM@JLHDG6N -I>JFH JLHKFJCN +JFJ>M@MFL6N .MDIMJLHKFN 7E@HFHGLIJLHKF6N HKCK>:4MDKFEJI:N 1EADJLHKF6N JFEN +JLBM@JLHDG4MDKFEJI: 1EADJLHKF< <62>5;9?;*?/6=>:6> =:?.416<8=;: ;HLBN@JKIGNHFN1JIC:N5BHCEBKKEN1EA2 DJLHKFNJFEN1CM@MFLJI:N1EADJLHKF< %0$+?0)&?%,)$+ 7N3<;9 HGNEM?HFMENJGNLBMN=IH@JI:NJDJEM@HDNJIMJNK?NG=MDHJCH JLHKFN;HLBHF LBMNGLAEMFLGNDAIIHDACA@<NKIN@KGLN@JKIGNLBMNBKAIGNIM"AHIMEN?KINDK@=CMLHKF 8JI:N ?IK@N JN @HFH@A@N K?N ,3N LKN JN @J*H@A@N K?N ,<N 7N 3=:;9 HGN EM?HFMEN JGN J GMDKFEJI:NJDJEM@HDNJIMJNK?NG=MDHJCH JLHKF<N/BMNBKAIGNIM"AHIMEN?KINLBMNDK@2 =CMLHKFNK?NJN@HFKIN8JI:N?IK@NJN@HFH@A@NK?N0NLKNJN@J*H@A@NK?N)< 4LAEMFLGN JIMN 9>1=9>4? 8;? 4>65<9>? <? 3<;9? <:4? <9>? >:6;19<(>4? 8;? 7>5>68? <? 3=:;9? 7EEHLHKFJCC:6N MJDBN =IK>IJ@N =IK8HEMGN ?KIN JLN CMJGLN GH* GM@MGLMIN BKAIGN K?N MCMDLH8MN DIMEHL<N .M"AHIM@MFLGN ?KIN MJDBN @JKIN JFEN @HFKI K??MIMENJLNLBMN5KCCM>MNJIMN?KAFENHFNLBMN 7DJEM@HDN%H8HGHKFGNJFEN'IK>IJ@G GMDLHKFNK?NLBMN5JLJCK>< /BMNHF?KI@JLHKFN?KINMJDBN@JKINHFDCAEMGNJNGM@MGLMI29:2GM@MGLMINDAIIHDA2 CA@N M*BH9HL6N ;BHDBN KALCHFMGN LBMN DKAIGMGN LBJLN JN GLAEMFLN =AIGAHF>N JN @JKIN HF LBJLNEHGDH=CHFMNGBKACENLJ#MNEAIHF>NMJDBNGM@MGLMINK?NBHGNKINBMIN?KAIN:MJIGNJL LBMN5KCCM>M<N4HFDMNGLAEMFLGNHFNJN>H8MFN@JKIN;HCCNGMCMDLNEH??MIMFLN@HFKIGNJFE MCMDLH8MG6NLBMNDAIIHDACA@NM*BH9HLNHFEHDJLMGNKFC:NLBMNGM@MGLMINE AIHF>N;BHDBNJ @HFKINDKAIGMNKINJFNMCMDLH8MNHGNLKN9MNLJ#MF<N/BMN?JDACL:NJE8HGKIN;HCCNBMC=NLBM GLAEMFLN GMCMDLN LBMN J==IK=IHJLMN @HFKIN DKAIGMN KIN MCMDLH8MN EAIHF>N JDJEM@HDN JE8HGM@MFL<

50


GENERAL ACADEMIC INFORMATION !.).+0?.&-0#,$) /BMN>MFMIJCNMEADJLHKFN=IK>IJ@NHGNEMGH>FMENLKNEM8MCK=N#FK;CME>M6NAFEMI2 GLJFEHF>6NG#HCCGNJFENJLLHLAEMGN;BHDBNGBKACEN9MNLBMNDK@@KFN=KGGMGGHKFNK?NJCC MEADJLMEN =MIGKFGN HFN JN ?IMMN GKDHML:<N /BMIMN JIMN L;KN MFMIJCN 1EADJLHKF LIJD#G<N /BMN MFMIJCN 1EADJLHKFN LIJD#N ?KIN GLAEMFLGN @JKIHF>N HFN 9HKCK>:N IM2 "AHIMGN$$NGM@MGLMINBKAIG<N/BMNMFMIJCN1EADJLHKFNLIJD#N?KINGLAEMFLGN@JKI2 HF>NHFN@JLBM@JLHDGNJFENFKFGDHMFDMNEHGDH=CHFMGNIM"AHIMGN0NGM@MGLMINBKAIG< !.).+0?.&-0#,$)?+. ,+.%.)#/ /-,.)-.?,$$! #+0- .:(5=72<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 0)N!KAIG 1N03, AFEJ@MFLJCGNK?N5K@=KGHLHKF<<<<<<<<<<<<<<<<<<<< , 1N03 .MGMJIDBNJFEN5K@=KGHLHKF <<<<<<<<<<<<<<<<<<<<<<<< , 1N)3) (FLIKEADLHKFNLKN&HLMIJLAIM <<<<<<<<<<<<<<<<<<<<<<<<<<<< , 1N)3$ 7?IHDJFN7@MIHDJFN&HLMIJLAIM <<<<<<<<<<<<<<<<<<<<<<<< , /;6=<5>2< =;9<5?/6=>:6>7 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 0)N!KAIG !(4N03 KICEN!HGLKI: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , !(4N03 7?IHDJFN7@MIHDJFN!HGLKI: <<<<<<<<<<<<<<<<<<<<<<<<<<<< , '4N)30 MFMIJCN'G:DBKCK>: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , 4-5N030 'IHFDH=CMGNK?N4KDHKCK>: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , KI 1-N)30 KICENMK>IJ=B: )<819<5?/6=>:6>7<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< (-N03, MFMIJCNKKCK>: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<  5!+N030 MFMIJCN5BM@HGLI:N( <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 

N!KAIG

+>5=(=;: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< .1&N)30 &HLMIJLAIMNJFEN.MCH>HKFNK?NLBMN-CEN/MGLJ@MFL < , .1&N)3) &HLMIJLAIMNJFEN.MCH>HKFNK?NLBMNM;N/MGLJ@MFL ,

N!KAIG

%<82>3<8=67 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< +7/N03, 5KCCM>MN7C>M9IJ <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< ,

,N!KAIG

><582?<:4?27=6<5?.416<8=;: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< !45N)03 !MJCLBNJFEN'B:GHDJCN1EADJLHKF<<<<<<<<<<<<<<<<<<< ,

,N!KAIG

"=:>?0987 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 7./N030 7ILN7==IMDHJLHKF <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< ) +4N030 +AGHDN7==IMDHJLHKF <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< )

N!KAIG

"+/??"9>723<:?/>3=:<9?, <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<

0N!KAIG

"+/??"9>723<:?/>3=:<9?,, <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<

0N!KAIG

-,/??,:89;4168=;:?8;?-;3'18>97 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<

)N!KAIG

;=6>?<:4?/'>>62?,3'9; >3>:8 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 4'!N03, KHDMNJFEN4=MMDBN(@=IK8M@MFL <<<<<<<<<<<<<<<< ,

,N!KAIG

/-/7& <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< $$N!KAIG '!4N033N'B:GHDJCN4DHMFDMGNHGNIM"AHIMEN?KINHKCK>:4MDKFEJI:N1EADJLHKFN@JKIGNHF CHMANK?N5!+N030< /BIMMNDIMEHLNBKAIGNK?N+HCHLJI:N4DHMFDMN@J:N9MNGA9GLHLALMEN?KIN!45N)03<

51


MORRIS COLLEGE CATALOG

!.).+0?.&-0#,$)?+. ,+.%.)#/ %0#.%0#,-/?0)&?)$)/-,.)-.?#+0- .:(5=72<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 0)N!KAIG 1N03, AFEJ@MFLJCGNK?N5K@=KGHLHKF<<<<<<<<<<<<<<<<<<<< , 1N03 .MGMJIDBNJFEN5K@=KGHLHKF <<<<<<<<<<<<<<<<<<<<<<<< , 1N)3) (FLIKEADLHKFNLKN&HLMIJLAIM <<<<<<<<<<<<<<<<<<<<<<<<<<<< , 1N)3$ 7?IHDJFN7@MIHDJFN&HLMIJLAIM <<<<<<<<<<<<<<<<<<<<<<<< , /;6=<5>2< =;9<5?/6=>:6>7 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 0)N!KAIG !(4N03 KICEN!HGLKI: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , !(4N03 7?IHDJFN7@MIHDJFN!HGLKI: <<<<<<<<<<<<<<<<<<<<<<<<<<<< , '4N)30 MFMIJCN'G:DBKCK>: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , 4-5N030 'IHFDH=CMGNK?N4KDHKCK>: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , KI 1-N)30 KICENMK>IJ=B: )<819<5?/6=>:6>7<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< (-N033 HKCK>HDJCN4DHMFDMG <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<  '!4N033 'B:GHDJCN4DHMFDMG <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 

N!KAIG

+>5=(=;: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< .1&N)30 &HLMIJLAIMNJFEN.MCH>HKFNK?NLBM -CEN/MGLJ@MFL <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , .1&N)3) &HLMIJLAIMNJFEN.MCH>HKFNK?NLBM M;N/MGLJ@MFL <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< ,

N!KAIG

%<82>3<8=67 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< +7/N03, 5KCCM>MN7C>M9IJ <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , +7/N03 /IH>KFK@MLI: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< , +7/N03$ 1CM@MFLJI:NAFDLHKFG<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< ,

,N!KAIG

><582?<:4?27=6<5?.416<8=;: <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< !45N)03 !MJCLBNJFEN'B:GHDJCN1EADJLHKF<<<<<<<<<<<<<<<<<<< ,

,N!KAIG

"=:>?0987 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 7./N030 7ILN7==IMDHJLHKF <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< ) +4N030 +AGHDN7==IMDHJLHKF <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< )N

N!KAIG

"+/??"9>723<:?/>3=:<9?, <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<

0N!KAIG

"+/??"9>723<:?/>3=:<9?,, <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<

0N!KAIG

-,/??,:89;4168=;:?8;?-;3'18>97 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<

)N!KAIG

;=6>?<:4?/'>>62?,3'9; >3>:8 <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 4'!N03, KHDMNJFEN4=MMDBN(@=IK8M@MFL <<<<<<<<<<<<<<<< ,

,N!KAIG

";9>=(:?<:(1<(>??<:4? <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<   

   

N!KAIG

/-/7& <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 0N!KAIG 4LAEMFLGN;BKN=CJFNLKN@JKINHFN4KDHKCK>:NJIMNJE8HGMENLKNLJ#MN4-5N030 NGLAEMFLG< NN;BKN=CJFNLKN@JKINHFN1EADJLHKFN@AGLNLJ#MN1-N)30< .M"AHIMEN?KIN+JLBM@JLHDGN@JKIGNKFC:< /BIMMNDIMEHLNBKAIGNK?N+HCHLJI:N4DHMFDMN@J:N9MNGA9GLHLALMEN?KIN1%N)03<

52


GENERAL ACADEMIC INFORMATION &> >5;'3>:8<5?/814=>7 M;NGLAEMFLGN;BKNGDKIMN9MCK;NJNDMILJHFNCM8MCNKFNLBMN=CJDM@MFLNLMGLN;HCC 9MNIM"AHIMENLKNDK@=CMLMNKFMNKIN@KIMNEM8MCK=@MFLJCNDKAIGMGN9M?KIMN9M>HF2 FHF>N LBMHIN ?IMGB@JFN DKAIGMG<N /IJFG?MIN GLAEMFLGN ;HLBN )N KIN @KIMN GM@MGLMI BKAIGN JFEN FKN >IJEMN 9MCK;N 5N ;HCCN FKLN 9MN IM"AHIMEN LKN LJ#MN EM8MCK=@MFLJC DKAIGMG< 0-0&.%,-?+.!0#,$)/ +>(=789<8=;: .M>HGLIJLHKFNHGNK=MFNLKNJCCN=MIGKFGNJE@HLLMENLKN+KIIHGN 5KCCM>MN9:NLBMN-?2 ?HDMNK?N7E@HGGHKFGNJFEN.MDKIEG<N4LAEMFLGN@J:NIM>HGLMINHFNLBMN?JCC6NG=IHF>NKI GA@@MINJDDKIEHF>NLKNEJLMGNCHGLMENHFNLBMNK??HDHJCNJDJEM@HDNDJCMFEJI<N7CCN?JDAC2 L:NJFENGLJ??N@M@9MIGNJGGHGLNHFNLBMNIM>HGLIJLHKFN=IKDMGGNEAIHF>NLBMNEMGH>FJL2 MEN=MIHKEG< .M>HGLIJLHKFN HGN FKI@JCC:N BMCEN ?KIN L;KN EJ:G<NM;N?IMGB@MFN JIMNIM>HGLMIME KFN LBMN ?HIGLN EJ:<N 5KFLHFAHF>N JFEN LIJFG?MIN GLAEMFLGN JIMN IM>HGLMIMEN KFN L BMN GMDKFENEJ:<N4LAEMFLGNJIMNEHIMDLMENLBIKA>BNLBMN?KCCK;HF>N=IKDMGG 0< )< ,< < $< <

< <

< 03<

MMN=J:@MFL=MI@HLNLKNIM>HGLMI 7DJEM@HDNDCMJIJFDM 7E8HGM@MFL .M>HGLIJLHKFNJ==IK8JC MMNJGGMGG@MFL HFJFDHJCNJHE /MI@HFJCNDKFLIKC (<%<NDJIEG &H9IJI: 'CJDM@MFLNJFEN5KK=MIJLH8MN1EADJLHKF

/BMN 4LAEMFLN 4LJLHGLHDJCN (F?KI@JLHKF-??HDHJCN .M>HGLIJLHKFN KI@N @AGLN 9M =IK=MIC:N?HCCMENKAL6NGH>FMEN9:NLBMNGLAEMFL6NLBMN?JDACL:NJE8HGKI6NLBMN7DJEM@HD %MJF6N JFEN LBMN %HIMDLKIN K?N 7E@HGGHKFGN JFEN .MDKIEG<N /BMN ?KI@N @AGLN 9M LAIFMENHFNJLNLBMN7E@HGGHKFGNJFEN.MDKIEGNGLJLHKFNHFNKIEMIN?KINLBMNGLAEMFLNLK 9MNK??HDHJCC:NIM>HGLMIMENJLN+KIIHGN5KCCM>MN?KINJNEMGH>FJLMEN=MIHKE< -9>4=8?;19?;<4 /BMNFKI@JCNCKJEN?KINJN?ACC2LH@MNGLAEMFLNIJF>MGN?IK@N0)NLKN0NDIMEHLNBKAIGNJ GM@MGLMI<N !K;M8MI6N JN GLAEMFLN KFN JDJEM@HDN =IK9JLHKFN @J:N FKLN MFIKCCN ?KI @KIMNLBJFN0,NDIMEHLNBKAIGNJNGM@MGLMI<N7NGLAEMFLN;HLBNJN>IJEMN=KHFLNJ8MIJ>M K?N ,<3N KIN BH>BMIN ?KIN 0$N KIN @KIMN DIMEHLN BKAIGN HFN FKF2EM8MCK=@MFLJCN DKAIGMG ?KINLBMN=IMDMEHF>NGM@MGLMIN@J:NMFIKCCN?KIN0 NLKN)0NBKAIGN;HLBNLBMNJ==IK8JC K?NBHGBMINJDJEM@HDNJE8HGKINJFENLBMN7DJEM@HDN%MJF< =3=8<8=;:?;*?-;197>7?$**>9>4 /BMN5KCCM>MNIMGMI8MGNLBMNIH>BLNLKNDJFDMCNJF:NDKAIGMN?KIN;BHDBNLBMNMFIKCC2 @MFLN HGN FKLN GA??HDHMFL<N /BMN CHGLHF>N K?N J8JHCJ9CMN D KAIGMGN HFN LBHGN DJLJCK>N EKMG FKLN H@=C:N JN DKFLIJDLAJCN K9CH>JLHKFN KFN LBMN =JILN K?N LBMN 5KCCM>MN LKN K??MIN LBMGM DKAIGMGNMJDBN:MJI<N7NGLAEMFLN;BKNFMMEGNKFC:NKFMNA==MI2EH8HGHKFNDKAIGMNLK @MMLN >IJEAJLHKFN IM"AHIM@MFLGN @J:N 9MN =MI@HLLMEN LKN LJ#MN LBMN DKAIGMN 9:N EH2 53


MORRIS COLLEGE CATALOG IMDLMEN GLAE:N EAIHF>N MHLBMIN LBMN ?HIGLN KIN LBMN GMDKFEN GA@@MIN GMGGHKFN H?N LBM DKAIGMN EKMGN FKLN J==MJIN KFN LBMN GA@@MIN GDBKKCN GDBMEACM<N %HIMDLMEN GLAEHMG JIMNFKLN=MI@HLLMENEAIHF>NLBMN?JCCNKINLBMNG=IHF>NGM@MGLMIG< +>'><8>4?-;197>7 7NGLAEMFLN@J:NIM=MJLNJNDKAIGMNHFNKIEMINLKNIJHGMNJN %NKIN N>IJEMNLBJLNJ=2 =MJIGN KFN LBMN IMDKIEN K?N DKAIGMGN JLN +KIIHGN 5KCCM>M<N 7N IM=MJLMEN DKAIGMN HG DKAFLMENKFC:NKFDMNHFNDK@=ALHF>NLBMN>IJEMN=KHFLNJ8MIJ>M<N5KAIGMGNHFN;BHDB LBMN>IJEMNMJIFMENHGN 5NKINJ9K8MN@J:NFKLN9MNIM=MJLMEN?KINDIMEHL< !9<4>?+>';987 4LAEMFLN >IJEMN IM=KILGN JIMN =IM=JIMEN JFEN EHGLIH9ALMEN JLN LBMN @HE2GM@MGLMI JFENLBMNMFENK?NMJDBNGM@MGLMI<NIJEMGNJIMN@JHCMENLKNGLAEMFLGNKFNEMGH>FJLME EJ:G<NIJEMGNJIMN;HLBBMCENH?NLBMNGLAEMFLNHGNEMCHF"AMFLNHFNBHGNKINBMINJDDKAFL KINHFEM9LMENLKNLBMN5KCCM>MNHFNJF:N;J:<N4LAEMFLGNGBKACENIM8HM;N>IJEMNIM= KILG DJIM?ACC:N JFEN FKLH?:N LBMN -??HDMN K?N 7E@HGGHKFGN JFEN .MDKIEGN K?N JF:N >IJEHF>N MIIKIG<N (?N FKN MIIKIN HGN IM=KILMEN ;HLBHFN JN @KFLBN K?N LBMN LMI@N MFEHF>N EJLM6N HLN HGN JGGA@MEN LBJLN LBMN IM=KILN HGN DKIIMDL N JFEN JCCN MFLIHMGN 9MDK@MN JN =JILN K?N LBMN GLAEMFLGN=MI@JFMFLNIMDKIE< -5<77=*=6<8=;:?;*?/814>:87?/>9 =:(?,:8>9:72='7 M?KIMNGMI8HF>NJFNHFLMIFGBH=6NJNGLAEMFLN@AGLN9MNDCJGGH?HMENJGNJNGMFHKINJG EM?HFMEN9:NLBMNDAIIMFLNMEHLHKFNK?NLBMN< &>769='8=;:?;*?-;197>7 7CCNDKAIGMGNK??MIMENJLN+KIIHGN5KCCM>MNJIMNCHGLMENAFEMINLBMNGA9MDLNJIMJGNHF ;BHDBN LBM:N 9MCKF><N /BMGMN JIMJGN JIMN CHGLMEN HFN JC=BJ9MLHDJCN KIEMIN 9M>HFFHF> ;HLBN7ILNJFENMFEHF>N;HLBN4=MMDBNJFEN/BMJLMI< BMFN JN GLAEMFLN BJGN GDBMEACHF>N EH??HDACLHMGN JFEN BJGN LKN MFIKCCN HFN JN DKAIGM LBJLNHGNFA@9MIMENBH>BMINLBJFNBHGNK;FNIJF#6NLBMNGLAEMFLN@J:NEKNGKNA=KFNLBM J==I K8JCNK?NLBMN@JKINJE8HGKINJFENLBMN7DJEM@HDN%MJF< (FN>MFMIJC6NLBMNCM8MCNK?NJNDKAIGMNHGNHFEHDJLMEN9:NLBMN?HIGLNEH>HLNJGN?KCCK;G 0 ) , 

<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< IMGB@JFNCM8MC <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 4K=BK@KIMNCM8MC <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< AFHKINCM8MC <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< 4MFHKINCM8MC

!9<4=:(?/78>3 7DJEM@HDN JDBHM8M@MFLN JLN +KIIHGN HGN HFEHDJLMEN 9:N LBMN ?KCCK;HF>N CMLLMI >IJEMG6NFA@MIHDJCN>IJEMGNJFEN>IJEMN=KHFLGNAGMENHFNDJCDACJLHF>N>IJEM2=KHFL J8MIJ>MG 7  5 %   4

 32033 32   32

 32  MCK;N3 MCK;N 3 79K8MN 

N=KHFLG ,N=KHFLG )N=KHFLG 0N=KHFL 3N=KHFLG 3N=KHFLG 3N=KHFLG

1*DMCCMFL KKE6NJ9K8MNJ 8MIJ>M 4JLHG?JDLKI:6NJ8MIJ>M 'KKI6N9ALN=JGGHF> JHCAIM FGJLHG?JDLKI: 4JLHG?JDLKI:

54


GENERAL ACADEMIC INFORMATION

NJFEN 4N>IJEMGNJIMNAGMENHFNJCCNFKFDIMEHLNDKAIGMG< (N HFDK@=CMLMN EMFKLMGN LBJLN LBMN GLAEMFLN ?JHCMEN LKN DK@=CMLMN JCCN IM"AHIMN2 @MFLGN?KINJNDKAIGM< NEMFKLMGNLBJLNLBMNGLAEMFLN;JGNJ9GMFLN?IK@NLBMN?HFJCNM*J@HFJLHKF< NJFEN (N>IJEMGNHFDAIIMENEAIHF>NLBMNJDJEM@HDN:MJIN@AGLN9MNIM@K8MEN9: LBMNMFENK?NLBMNGADDMMEHF>NGM@MGLMIN;BMLBMINKINFKLNLBMNGLAEMFLNHGNMFIKCCME KLBMI;HGMNLBMN>IJEMNK?N N;HCCN9MNIMDKIEMENKFNLBMN=MI@JFMFLNIMDKIE< 4H@HCJIC:6N NJFEN (N>IJEMGNHFDAIIMENEAIHF>NLBMNGA@@MINGMGGHKFGN@AGLN9M IM@K8MEN9:NLBMNMFENK?NLBMNGADDMMEHF>NGM@MGLMIN;BMLBMINKINFKLNLBMNGLAEMFL HGN MFIKCCME N KLBMI;HGMN LBMN >IJEMN K?N N ;HCCN 9MN IMDKIEMEN KFN LBMN =MI@JFMFL IMDKIE< 'NEMFKLMGN;HLBEIM;N=JGGHF>N?IK@NJNDKAIGM6NH?NLBMNGLAEMFLNHGN=MI?KI@2 HF>NGJLHG?JDLKIHC:NJLNLBMNLH@MNK?N;HLBEIJ;JC< NEMFKLMGN;HLBEIM;N?JHCHF> N?IK@NJNDKAIGMNJ?LMINLBMNEMJECHFMN?KINEIK=2 =HF>NJNDKAIGM6NKIN9MDJAGMNK?NM*DMGGH8MNJ9GMFDMG< 7NEMFKLMGN JAEHLNJFENHGNCHGLMENHFNLBMNDK@=ALMIN@KEACMNKFC:< /BMN?KCCK;HF>N>IJEMNG:@9KCNHGNJCGKNAGMEN9ALNHGNFKLNHFDCAEMENHFNDK@=ALHF> LBMN>IJEM2=KHFLNJ8MIJ>M NEMFKLMGN;HLBEIJ;JCN?IK@NLBMN5KCCM>M< !9<4>?;=:8?0 >9<(> /BMN >IJEMN =KHFLN J8MIJ>MN HGN EMLMI@HFMEN 9:N EH8HEHF>N LBMN LKLJCN FA@9MIN K? "AJCHL:N=KHFLGNMJIFMEN 9:NLBMNLKLJCNFA@9MINK?NDIMEHLNBKAIGNJLLM@=LME<N(FNKIEMI LKN IMDMH8MN JN EM>IMM6N JN GLAEMFLN @AGLN JLLJHFN JFN K8MIJCCN J8MIJ>MN K?N 5N )<33 JFENFKN>IJEMNCMGGNLBJFN 5NHFNBHGN@JKINJFEN@HFKINJIMJGN;BHDBNJIMNK??MIMENLK @MMLN>IJEAJLHKFNIM"AHIM@MFLG<N +JKINJFEN@HFKINJIMJGNHFDCAEMNDKAIGMGNCHGL2 MENHFNLBMN -LBMIN.M"AHIMEN5KAIGMGNGMDLHKFNK?NMJDBN=IK>IJ@NKALCHFM6N;HLBNLBM M*DM=LHKFNK?N.4N,336NHFN;BHDBNJNGLAEMFLN@AGLNMJIFNJN  . ?N N -5<77?088>:4<:6> 4LAEMFLGN JIMN IM"AHIMEN LKN JLLMFEN IM>ACJIC:N JCCN DCJGGMGN ?KIN ;BHDBN LBM:N JIM K??HDHJCC:N IM>HGLMIME N JFEN?JDACL:N @M@9MIGN JIMN IM"AHIMEN LKN #MM=N DK@=CMLM JFENJDDAIJLMNJLLMFEJFDMNIMDKIEGN?KINJCCNGLAEMFLGNK??HDHJCC:NIM>HGLMIMENHFNLBMHI DCJGGMG<N7NGLAEMFLN;BKNDK@=HCMGNJNIMDKIENK?NJ9GMFDMGNLBJLNM*DMMEGNL;HDM LBMNFA@9MINK?N;MM#C:NDCJGGN@MMLHF>GN;HCCN9MNEIK==MEN?IK@NLBMNDKAIGMN;HLB JN>IJEMNK?N'NJFEN<N/BMN@J*H@A@NFA@9MINK?NJ9GMFDMGN=MI@HLLMEN?KINJ DCJGGN LBJLN @MMLGN ?KAIN LH@MGN JN ;MM#N HGN MH>BL N ?KIN JN DCJGGN LBJLN @MMLGN LBIMM LH@MGNJN;MM#6NGH* N?KINJNDCJGGNLBJLN@MMLGNL;HDMNJN;MM#6N?KAI NJFEN?KINJNDCJGG LBJLN @MMLGN KFDMN JN ;MM#6N L;K<N 7N GLAEMFLN ;BKN IMDMH8MGN JN 'N KIN JN  9MDJAGMNK?NEKDA@MFLMENM*LMFEMEN=MIGKFJCNHCCFMGGNKINFJLAIJCNEHGJGLMINGADB JGN LKIFJEK6N BAIIHDJFM6N MJILB"AJ#M6N KIN 9CH JIEN @J:N J==MJCN ?KI IMHFGLJLM@MFLN HFN LBMN DCJGG<N /BMN CMLLMIN K?N J==MJCN @AGLN 9MN GA9@HLLMEN LKN LBM DBJHI=MIGKFN K?N LBMN EH8HGHKFN LKN ;BHDBN LBMN GLAEMFLN HGN JGGH>FMEN ;HLBHFN LBIMM ;KI#N EJ:G<N /BMN GLAEMFLN @AGLN DKFLHFAMN LKN JLLMFEN DCJGGN AFLHCN JN EMDHGHKFN KF LBMNJ==MJCNHGNIMFEMIME<N4LAEMFLGN;HCCN9MNM*DAGMEN?IK@NDCJGGNLKN=JILHDH=JLM HFN K??HDHJCN JDLH8HLHMGN K?N LBMN 5KCCM>MN GADBN JGN DBKHIN MF>J>M@MFLG6 HFLMIDKCCM>HJLMNJLBCMLHDNDKFLMGLG6NJFEN?HMCENLIH=G< 55


MORRIS COLLEGE CATALOG #9<:7=>:8?.:9;553>:8 >93=77=;:?*;9?89<:7=>:8?>:9;553>:8?=55?>?(9<:8>4?;:5?*;9?7133>9 762;;5 (?NJNGLAEMFLNHGNMFIKCCMENJLN+KIIHGN5KCCM>M6NBMNKINGBMNDJFFKLNMFIKCCN?KI DIMEHLNJLNJFKLBMINKLBMINHFGLHLALHKFN;HLBKALN=IHKIN=MI@HGGHKFN?IK@NLBMN7DJEM@HD %MJF<N-LBMI;HGM6NLBMNDIMEHLNGKNMJIFMEN;HCCNFKLN9MNJDDM=LMEN9:N+KIIHG<N 4LAEMFLGNIM"AMGLHF>N=MI@HGGHKFNLKNLJ#MNDKAIGMGNJLNJFKLBMINHFGLHLALHKFN@AGL BJ8MN JLLJHFMEN JN DA@ACJLH8MN >IJEMN =KHFLN J8MIJ>MN K?N JLN CMJGLN 56N @AGLN 9MN HF >KKEN ?HFJFDHJCN GLJFEHF>6N JFEN @AGLN 9MN DAIIMFLC:N MFIKCCMEN 9M?KIMN J==IK8JCN HG >IJFLME<N 7CCN DKAIGMGN @AGLN 9MN LJ#MFN JLN JFN JDDIMEHLMEN HFGLHLALHKF6N JFEN A==MI2 CM8MCNDKAIGMGNDJFFKLN9MNLJ#MFNJLNJNL;K2:MJINHFGLHLALHKF< &9;''=:(?-;197>7 7NGLAEMFLNEMGHIHF>NLKNEIK=NJNDKAIGMN@AGLNK9LJHFNLBMNIM"AHIMEN?KI@GN?IK@ BHGBMINJDJEM@HDNJE8HGKI<N/BMN?KI@G6N;BMFNDK@=C MLME6N@AGLN9MN=IMGMFLME LKNLBMN-??HDMNK?N7E@HGGHKFGNJFEN.MDKIEGN?KINDMILH?HDJLHKFNK?NLBMNIMDKIE< HLBEIJ;JCN ?IK@N JN DKAIGMN 9:N LBMN MFEN K?N LBMN EIK=JEEN =MIHKEN ;HCCN FKLN 9M IMDKIEMEN KFN LBMN GLAEMFLGN =MI@JFMFLN IMDKIEN JFE6N LBMIM?KIM6N ;HCCN FKLN 9M DKAFLMENHFNLBMNDK@=ALJLHKFNK?NBKAIGNJLLM@=LME<N(?NJNGLAEMFLNEIK=GNJNDKAIGM J?LMINLBMN=IMGDIH9MENEMJECHFMN?KINEIK==HF>NJNDKAIGM6NLBMNBKAIGNJIMNDKAFLMENHF DK@=ALHF>NLBMN>IJEMN=KHFLNJ8MIJ>M< ;51:8<9? =8249<<5?*9;3?82>?-;55>(> 7N GLAEMFLN EMGHIHF>N LKN ;HLBEIJ;N ?IK@N LBMN 5KCCM>MN GBKACEN GMDAIMN JFN 7==CHN2 DJLHKFN?KINHLBEIJ;JCNKI@N?IK@NLBMN-??HDMNK?N7E@HGGHKFGNJFEN.MDKIEG<N/BM ?KI@N@AGLN9MNDK@=CMLMENJFENIMLAIFMENLKNLBMNHGGAHF>NK??HDMN;HLBNJCCNEMGH>FJLME GH>FJLAIMGNJ??H*ME<N4LAEMFLGN@AGLNEM=JILNLBMNDJ@=AGNA=KFN;HLBEIJ;JC<N7NGLA2 EMFLN ;BKN ;HLBEIJ;GN ?IK@N LBMN 5KCCM>MN DKFLIJI:N LKN LBHGN =KCHD:N ;HCCN IMDMH8MN J >IJEMNK?N NHFNJCCNDKAIGMGNHFN;BHDBNBMNGBMNHGNMFIKCCME<N7CCNGLAEMFLGN;BKNK??H2 DHJCC:N ;HLBEIJ;N ?IK@N LBMN 5KCCM>MN +4/N 9MN ?KI@JCC:N IMJE@HLLME<N (F?KI@JLHKF J9KALN IMJE@HGGHKFN DJFN 9MN K9LJHFMEN ?IK@N LBMN -??HDMN K?N 7E@HGGHKFGN JFE .MDKIEG< ,: ;51:8<9? =8249<<5?*9;3?82>?-;55>(> 4LAEMFLGN;BKNIMDMH8MNN>IJEMGNJLN@HELMI@N;BHDBNLKLJCN $N=MIDMFLNK?NLBMHI DIMEHLNBKAINCKJENEAIHF>NJF:NGM@MGLMIN;HCCN9MNJE@HFHGLIJLH8MC:N;HLBEIJ;FN?IK@ LBMN5KCCM>MNJFEN@AGLNEM=JILNLBMNDJ@=AGN;HLBHFN)NBKAIG<N4LAEMFLGN;BKNBJ8M 9MMFNJE@HFHGLIJLH8MC:N;HLBEIJ;FN?IK@NLBMN5KCCM>MNJIMNGA9MDLNLKNLBMN=IK8HGHKFG K?NLBMNJDJEM@HDN=IK9JLHKF6NGAG=MFGHKF6NJFENEHG@HGGJCN=KCHD:< /814>:87?-<55>4?8;?%=5=8<9?/>9 =6> /BMN?KCCK;HF>N=KCHD:NJ==CHMGNKFC:NLKNGLAEMFLGN;BKNJIMNIM"AHIMENLKN;HLBEIJ; ?IK@NKF>KHF>NDCJGGMGN9MDJAGMNK?N9MHF>NDJCCMENLKNJDLH8MN@HCHLJI:NGMI8HDMNMHLBMI JGN JN @M@9MIN K?N LBMN 7I@MEN KIDMGN .MGMI8MN KIN JN JLHKFJCN AJIEN FHLN KI LBIKA>BNJDLHKFGNK?NJN4MCMDLH8MN4MI8HDMNKJIE<N(FNJCCNDJGMGN;BMIMNGADBNJDLHKFG KDDAI6NLBMNGLAEMFLNGBKACEN?HIGLNGMM#NJFNM*LMFGHKFNK?NLBMNIM"AHIMENIM=KILHF>NEJLM HFNKIEMINLKNDK@=CMLMNLBMN;KI#NK?NLBMNGM@MGLMINKINGA@@MINGMGGHKFN;HLBKALNLBM CKGGNK?NJF:NJDJEM@HDNDIMEHL<N(?NGADBNJFNM*LMFGHKFNDJFFKLN9MN>IJFLME6NLBMN5KC2 CM>MN;HCCNJ==C:NLBMN?KCCK;HF>NG=MDHJCNIM>ACJLHKFG 0N7NGLAEMFLN;BKNBJGNDK@=CMLMEN?M;MINLBJFN $N=MIDMFLNK?NLBMNDJCMFEJINEJ:G =IMGDIH9MEN?KINLBMNGM@MGLMINKINGA@@MINGMGGHKFNGBJCCNIMDMH8MNJN>IJEMNK? 56


GENERAL ACADEMIC INFORMATION N ?KIN JCCN DKAIGMGN ?IK@N ;BHDBN LBMN GLAEMFLN HGN IM"AHIMEN LKN ;HLBEIJ;N JFE GBJCCNIMDMH8MNJN?ACCNIM?AFENK?NJCCNLAHLHKF6N?MMG6NJFENIKK@NJFEN9KJIENDBJI>MG LBJLNBJ8MN9MMFNJGGMGGMEN?KINLBMNLMI@NEAIHF>N;BHDBNLBMN@HCHLJI:N;HLBEIJ;2 JCNKDDAIG< )N7NGLAEMFLN;BKNBJGNDK@=CMLMEN $N=MIDMFLNKIN@KIMNK?NLBMNDJCMFEJINEJ:G =IMGDIH9MEN?KINLBMNGM@MGLMINKINGA@@MINGMGGHKFN@J:N0NIM"AMGLNJN>IJEM K?N (NKIN NJGNEMM@MENJ==IK=IHJLMN9:NLBMN?JDACL:N@M@9MINLMJDBHF>NLBM DKAIGMNKIN)NIM"AMGLNLKN;HLBEIJ;N;HLBNJN>IJEMNK?N <N4LAEMFLGNIMDMH8HF> JN >IJEMN K?N (N KIN N AFEMIN LBMGMN G=MDHJCN IM>ACJLHKFGN GBJCCN 9MN JCCK;MEN J =MIHKENK?NLBHIL:2GH*N@KFLBGN?IK@NLBMNEJLMNK?N;HLBEIJ;JCNLKNDKF8MILNLBMN (NKI N>IJEMNLKNJNDK@=CMLMEN=JGGHF>N>IJEMNKINMCGMNIMDMH8MNJN>IJEMNK?N < 4LAEMFLGNIMDMH8HF>NJN>IJEMNK?N (NKIN NAFEMINLBMGMNG=MDHJCNIM>ACJLHKFG GBJCCNIMDMH8MNFKNIM?AFENK?NJF:NLAHLHKFNKIN?MMGN9ALNGBJCCNIMDMH8MNJN=IKNIJLJ IM?AFENK?NAFAGMENIKK@NJFEN9KJIENDBJI>MG<N4LAEMFLGN;HLBEIJ;HF>N;HLBNJ >IJEMNK?N NGBJCCNIMDMH8MNFKNIM?AFE< (?N JN GLAEMFLN EKMGN FKLN @JHFLJHFN4JLHG?JDLKI:N7DJEM@HDN'IK>IMGGNJGN JN IM2 GACLNK?N9MHF>NDJCCMENLKNJDLH8MN@HCHLJI:NGMI8HDM6NLBMNGLAEMFLN;HCCN9MN>IJFLMENJ ;JH8MIN ?KIN LBMN =MIHKEN LBJLN BMN KIN GBMN EHEN FKLN MJIFN LBMN IM"AHIMEN >IJEMN =KHFL J8MIJ>MN JFEKIN DIMEHLN BKAIG<N 4LAEMFLGN ;BKN JIMN IM"AHIMEN LKN ;HLBEIJ;N ?IK@ KF>KHF>NDCJGGMGNEAMNLKNJDLH8MNEAL:N@HCHLJI:NGMI8HDMNJIMNM*M@=LN?IK@NIMJE2 @HLN=KCHDHMG< 06<4>3=6?9;<8=;:?/17'>:7=;:?<:4?&=73=77<5 4LAEMFLGN @AGLN @JHFLJHFN JN @HFH@A@N >IJEMN =KHFLN J8MIJ>MN 9JGMEN KFN LBM FA@9MINK?NGM@MGLMINBKAIGNJLLM@=LME<N/BMN@HFH@A@N>IJEMN=KHFLNJ8MIJ>MNHG JGN?KCCK;G /KLJCN4M@MGLMIN!KAIGN7LLM@=LME 5A@ACJLH8MNIJEMN'KHFLN78MIJ>M A=NLKN) 0<$3 )$NLKN$$ 0< 3 $NJFENJ9K8M )<33 06<4>3=6?9;<8=;: /BMNIMDKIENK?NMJDBNGLAEMFLNHGNIM8HM;MENJLNLBMNMFENK?NMJDBNGM@MGLMI<NKI MJDBNGM@MGLMINEAIHF>N;BHDBNLBMNGLAEMFLN?JHCGNLKNJDBHM8MNLBMN@HFH@A@N>IJEM =KHFLNJ8MIJ>M6NBMGBMNHGN=CJDMENKFNJDJEM@HDN=IK9JLHKF<N7NGLAEMFLNKFNJDJ2 EM@HDN=IK9JLHKFN@J:NMFIKCCN?KINFKN@KIMNLBJFN0,NGM@MGLMINDIMEHLNBKAIGNJFE @J:N=JILHDH=JLMNKFC:NHFNJDJEM@HDNJFENJDJEM@HD2IMCJLMENJDLH8HLHMG< 06<4>3=6?/17'>:7=;: 7?LMINL;KNDKFGMDALH8MNGM@MGLMIGNK?N?JHCAIMNLKNJDBHM8MNLBMN@HFH@A@N>IJEM =KHFLNJ8MIJ>M6NLBMNGLAEMFLN;HCCN9MNGAG=MFEME<N7NGLAEMFLNGAG=MFEMEN?KINJDJ2 EM@HDNIMJGKFGNDJFNFKLNIMMFIKCCNJLNLBMN5KCCM>MN?KINKFMN?ACCNGM@MGLMI NBK;M82 MI6N BMGBMN @J:N GMM#N J==IK8JCN ?IK@N LBMN 7DJEM@HDN %MJFN LKN JLLMFEN GA@@MI GDBKKCNHFNKIEMINLKNH@=IK8MNBHGBMINDA@ACJLH8MN>IJEMN=KHFLNJ8MIJ>M<N/BMNGLA2 EMFLN@A GLN=IMGMFLN;IHLLMFNDKF?HI@JLHKFNK?NLBMN7DJEM@HDN%MJFGNJ==IK8JCN9M2 ?KIMNBMGBMN;HCCN9MN=MI@HLLMENLKNIM>HGLMIN?KINLBMNGA@@MINGMGGHKF< 06<4>3=6?&=73=77<5 7NGLAEMFLN;BKNBJGN9MMFN=IM8HKAGC:NGAG=MFEMENJFEN;BKN?JHCGNLKNJDBHM8M LBMN@HFH@A@N>IJEMN=KHFLNIJLHKNJ?LMIN9MHF>NIMJE@HLLMEN;HCCN9MNEHG@HGGMEN?IK@ LBMN5KCCM>MNJFEN;HCCNFKLN9MNMCH>H9CMNLKNIMMFIKCC< 57


MORRIS COLLEGE CATALOG 06<4>3=6?-5<77=*=6<8=;: 7DJEM@HDNDCJGGH?HDJLHKFNHGN9JGMENKFNLBMNFA@9MINK?NDIMEHLNBKAIGNMJIFME IMGB@MFCMGGNLBJFN)NBKAIG 4K=BK@KIM)NGM@MGLMINBKAIG AFHKI$NGM@MGLMINBKAIG 4MFHKI 3NGM@MGLMINBKAIG &>65<9<8=;:?;*?<?%<;9?<:4?%=:;9 7N GLAEMFLN =AIGAHF>N DKAIGMGN CMJEHF>N LKN JN 9JDDJCJAIMJLMN EM>IMMN @AGLN GM2 CMDLN JN @JKI<N /BHGN GMCMDLHKFN GBKACEN 9MN @JEMN JGN MJIC:N JGN =KGGH9CMN 9ALN FKL CJLMINLBJFNLBMN9M>HFFHF>NK?NLBMNAFHKIN:MJI<N/BMNIM"AHIM@MFLGN?KIN@JKIGNJFE @HFKIGNJIMNGLJLMENHFNLBMNJDJEM@HDN=IK>IJ@GN>H8MFNAFEMINMJDBNEH8HGHKF<NK DIMEHLGN LK;JIEN >IJEAJLHKFN ;HCCN 9MN >IJFLMEN ?KIN JF:N DKAIGMN HFN LBMN @JKIN KI @HFKIN?HMCENHFN;BHDBNLBMN>IJEMNMJIFMENHGN9MCK;N 5< -2<:(>?;*?%<;9 7NGLAEMFLN;BKNEMGHIMGNLKNDBJF>MNBHGBMIN@JKINGBKACENEKNGKNJLNCMJGLNL;K GM@MGLMIGN =IHKIN LKN >IJEAJLHKF<N /BMN GLAEMFLN GBKACEN DK@=CMLMN LBMN ?KCCK;HF> =IK DMEAIMG 0 -9LJHFN JN 5BJF>MN HFN +JKIN KI@N ?IK@N LBMN -??HDMN K?N 7E@HGGHKFGN JFE .MDKIEG< ) 5K@=CMLMN LBMN ?KI@N JFEN BJ8MN HLN J==IK8MEN 9:N LBMN ?KI@MIN JE8HGKI6N LBM FM;NJE8HGKINJFENLBMN7DJEM@HDN%MJF< , 4A9@HLN JN DK=:N K?N LBMN DK@=CMLMEN JFEN J==IK8MEN ?KI@N LKN LBMN ?KI@MI JE8HGKI6N LBMN FM;N JE8HGKI6N LBMN 7DJEM@HDN %MJF6N JFEN LBMN %HIMDLKIN K? 7E@HGGHKFGNJFEN.MDKIEG< "=:<5?.<3=:<8=;:7 HFJCN M*J@HFJLHKFGN JIMN GDBMEACMEN 9:N LBMN -??HDMN K?N LBMN 7DJEM@HDN %MJF EAIHF>NLBMNCJGLN;MM#NK?NMJDBNGM@MGLMI<N/BMN5KCCM>MNIM"AHIMGNLBJLNJN?HFJCNM*2 J@HFJLHKFN9MN>H8MFN?KINM8MI:NDKAIGMNLBJLNDJIIHMGNDIMEHLNJFENLBJLN?HFJCNM*J@H2 FJLHKFGN9M>HFNJLNLBMNLH@MNGDBMEACME<N5KF?CHDLGNJFENDBJF>MGNDKFDMIFHF>NM*2 J@HFJLHKFGNJIMNLKN9MNIMGKC8MENKFC:N9:NLBMN7DJEM@HDN%MJF<N7FNM*J@HFJLHKF LJ#MFN JLN JF:N LH@MN KLBMIN LBJFN LBJLN K??HDHJCC:N GDBMEACMEN 9:N LBMN EMGH>FJLMEN K??HDMN ;H CCN 9MN DKFGHEMIMEN JN G=MDHJCN M*J@HFJLHKFN JFEN @AGLN IMDMH8MN LBMN J=2 =IK8JCNK?NLBMN7DJEM@HDN%MJF< -9>4=8??.<3=:<8=;: +KIIHGN5KCCM>MNJ;JIEGNDKAIGMNDIMEHLNKFNLBMN9JGHGNK?NM*J@HFJLHKFGNJE@HF2 HGLMIMENAFEMINLBMN5KCCM>MN&M8MCN1*J@HFJLHKFN'IK>IJ@N5&1'6N%JFLMGN'IK2 >IJ@N 4LJFEJIEH MEN /MGLG6N JFEN 75/N 'IK?HDHMFD:N 1*J@HFJLHKFGN 'IK>IJ@ '1'<N4LAEMFLGN@J:NFKLNLJ#MNJN5&1'6N%JFLMG6NKIN'1'NM*J@HFJLHKFNNLKNIM2 DMH8MNDIME HLN?KINJNDKAIGMN;BHDBNLBM:NBJ8MNJAEHLME6N?JHCME6NKIN=JGGME<N5IMEHL @J:N FKLN 9MN MJIFMEN ?KIN ,332N KIN 332CM8MCN DKAIGMGN KIN ?KIN KFMN GM"AMFLHJCN KI L;K2GM@MGLMIN DKAIGMGN H?N GLAEMFLGN BJ8MN JCIMJE:N LJ#MFN KFMN K?N LBMN DKAIGMG< 4LAEMFLGN;BKN;HGBNLKNLJ#MN5&1'6N%JFLMG6NKIN'1'NM*J@HFJLHKFGN@AGLNEKNGK =IHKINLKNLBMNDK@=CMLHKFNK?N 3NGM@MGLMINBKAIG<N7F:NGLAEMFLN;BKN;HGBMGNLKNK92 LJHFN DIMEHLN 9:N M*J@HFJLHKFN LBIKA>BN LBMN 5&1'6N %JFLMG6N JFEN '1'N 'IK>IJ@G 58


GENERAL ACADEMIC INFORMATION @AGLN DK@=CMLMN JFN J==CHDJLHKFN JFEN GMDAIMN GH>FJLAIMGN K?N J==IK8JCN ?IK@N LBM =IK?MGGKIN HFN LBMN GA9MDLN JIMJ6N LBMN %H8HGHKFN 5BJHI6N JFEN LBMN 7DJEM@HDN %MJF =IHKINLKNLJ#HF>NLBMNM*J@HFJLHKF<N7N=JGGHF>NGDKIMN;HCCNIMGACLNHFNJN>IJEMNK?N ' 'JGGN9MHF>N=KGLMENLKNLBMNGLAEMFLGNJDJEM@HDNIMDKIE<N5IMEHLN;HCCN9MNJ;JIE2 MEN 9ALN ;HCCN FKLN 9MN AGMEN LKN DK@=ALMN LBMN GM@MGLMIN KIN LBMN DA@ACJLH8MN >IJEM =KHFLNJ8MIJ>M< +KIIHGN 5KCCM>MN JCGK N J;JIEGN DIMEHLN ?KIN BH>BN GDBKKCN DKAIGMGN HFN ;BHDBN 5KC2 CM>MN1FLIJFDMN1*J@HFJLHKFNKJIEN511N7E8JFDMEN'CJDM@MFLN7'NM*J@2 HFJLHKFGNBJ8MN9MMFN>H8MFNJFENJ==IK=IHJLMNCM8MCGNK?NDK@=MLMFDMNEM@KFGLIJL2 ME<N4LAEMFLGN@J:NFKLNLJ#MN?KINDIMEHLNJNDKAIGMNKINDKAIGMGN?KIN;BHDBNLBM:NBJ8M MJIFMENJE8JFDMEN=CJDM@MFLNDIMEHL< 7N@J*H@A@NK?N,3NDIMEHLGN@J:N9MNMJIFMENLBIKA>BNDIMEHLN9:NM*J@HFJLHKF< %M>IMMNDIMEHLN;HCCN9MNJ;JIEMEN LKNGLAEMFLGN;BKN@J#MNJNGDKIMNK?N 5NKIN9MLLMI KIN LBMN FA@MIHDN M"AH8JCMFLN KFN JCCN M*J@HFJLHKFG<N IJEMG6N N DIMEHLN BKAIG6N JFE "AJCHL:N =KHFLGN ;HCCN 9MN IMDKIEMEN KFN LBMN LIJFGDIH=LGN K?N GLAEMFLGN ;BKN IMDMH8M DIMEHLN9:NM*J@HFJLHKF<N4LAEMFLGN;BKNBJ8MNLJ#MFN511N7'NM*J@HFJLHKFGNHF BH>BN GDBKKCN N GBKACEN BJ8MN LBMHIN GDKIMGN GMFLN EHIMDLC:N LKN LBMN -??HDMN K?N 7E@HG2 GHKFGNJFEN.MDKIEG<NN 4LAEMFLGN@J:NDKF?MIN;HLBNLBMHINIMG=MDLH8MNJE8HGKIGN?KINJEEHLHKFJCNHF?KI@J2 LHKFN J9KALN MJIFHF>N DIMEHLN 9:N LJ#HF>N LBMN 5&1'6N %JFLMG6N JFEN '1'N M*J@HFJ2 LHKFG<N'IKG=MDLH8MNGLAEMFLGN@J:NDKF?MIN;HLBNLBMN%HIMDLKINK?N7E@HGGHKFGNJFE .MDKIEGNIM>JIEHF>N511N7'NDIMEHL< 014=8=:( 7F:N GLAEMFLN @J:N 9MN >IJFLMEN LBMN =IH8HCM>MN K?N FKFDIMEHLN MFIKCC@MFLN HFN J DIMEHLN DKAIGMN A=KFN J==IK8JCN K?N LBMN GLAEMFLGN JE8HGKIN JFEN LBMN 7DJEM@HD %MJF<N /BHGN JAEHLHF>N =IH8HCM>MN DJIIHMGN ?ACCNIH>BLGNLKNDCJGGN=JILHDH=JLHKFN9ALNHL EKMGNFKLNDJII:NJDJEM@HDNDIMEHL<N/BMNJAEHLHF>N=IH8HCM>MNHGNGA9MDLNLKNLBMNGJ@M ?MMGNJGNDIMEHLNDKAIGMG< &>8>93=:<8=;:?;*?&>(9>>?+>1=9>3>:87 (FN LBMN EMLMI@HFJLHKFN K?N EM>IMMN IM"AHIM@MFLG6N JN GLAEMFLN @AGLN ?KCCK;N LBM DJLJCK>NHFNM??MDLNJLNLBMNLH@MNK?NBHGBMINHFHLHJCNMFIKCC@MFL6N=IK8HEMENBMGBMNBJG 9MMFN DKFLHFAKAGC:N MFIKCCME<N !K;M8MI6N JN GLAEMFLN ;BKN HFLMIIA=LGN BHGBMI GLAEHMGNJLN+KIIHGN5KCCM>MN?KINL;KNKIN@KIMNDKFGMDALH8MNGM@MGLMIGN@AGLN@MML JCCNIM"AHIMN@MFLGNJDDKIEHF>NLKNLBMNDJLJCK>NHFNM??MDLNJLNLBMNLH@MNK?NIMMFLI:< #9<:769='87 -??HDHJCNLIJFGDIH=LGN?IK@NLBMN5KCCM>MNJIMNK9LJHFMENA=KFN;IHLLMFNIM"AMGLNLK LBMN-??HDMNK?N7E@HGGHKFGNJFEN.MDKIEG<N7CCNJDDKAFLG6NCH9IJI:N?HFMG6N?MMG6NJFE JF:N KLBMIN K9CH>JLHKFGN LKN LBMN 5KCCM>MN @AGLN 9MN DCMJIMEN 9M?KIMN JN LIJFGDIH=LN HG IMCMJGME<N-FDMNJNGLAEMFLN >IJEAJLMG6NKFMNLIJFGDIH=LNHGNHGGAMEN?IMMNK?NDBJI>M< 7N?MMNK?N<33NHGNIM"AHIMEN?KINJCCNJEEHLHKFJCNLIJFGDIH=LG< 0-0&.%,-?$)$+/ 9>7=4>:8 7?=78?<:4?&><: 7?=78 /BMN 'IMGHEMFLGN &HGLN DKFLJHFGN LBMN FJ@MGN K?N JCCN GLAEMFLGN ;BKN JLLJHFMEN J GM@MGLMIN>IJEM2=KHFLNJ8MIJ>MNK?N<36N=IK8HEMENLBMNGLAEMFLNBJGNDK@=CMLMENJ @HFH@A@NK?N0$NDIMEHLNBKAIGN;HLBNFKNEM8MCK=@MFLJCNGLAEHMGNDKAIGMG< 59


MORRIS COLLEGE CATALOG /BMN %MJFGN &HGLN DKFLJHFGN LBMN FJ@MGN K?N JCCN GLAEMFLGN ;BKN JLLJHFMEN J GM@MGLMIN >IJEM2=KHFLN J8MIJ>MN K?N ,<3N KIN J9K8M<N #2>? 7814>:8? 3178? 2< > 6;3'5>8>4? <? 3=:=313? ;*?  ? 69>4=8? 2;197? =82? :;? 4> >5;'3>:8<5 7814=>7?6;197>7?0582;1(2??7>3>78>9?2;197?=7?4>*=:>4?<7?*155?8=3> <?2=(2>9?5> >5?;*?<62=> >3>:8?=7?>'>68>4?*;9?<6<4>3=6?2;:;97?2>:6> 82>?9>1=9>3>:8?*;9?82>?7>3>78>9?69>4=8?2;19?5;<4?;*? ?2;197 %;99=7?-;55>(>?/62;5<97 4LAEMFLGN;BKNJIMNFJ@MENLKNLBMN'IMGHEMFLGN&HGLNJFEKINLBMN%MJFGN&HGLN?KI GH*N DKFGMDALH8MNGM@MGLMIGN JFEN;BKNDK@=CMLMN JLN CMJGLN 0$N DIMEHLN BKAIGN MJDB GM@MGLMIN;HLBNFKNEM8MCK=@MFLJCNDKAIGMGNJIMNEMGH>FJLMENJGN +KIIHGN5KCCM>M 4DBKCJIG<N /BHGN HGN LBMN BH>BMGLN JDJEM@HDN BKFKIN GLAEMFLGN DJFN JLLJHFN =IHKIN LK >IJEAJLHKF<N 4DBKCJIGBH=N M@9CM@GN 9MJIHF>N LBMN GMJCN K?N LBMN 5KCCM>MN JIM J;JIEMEN LKN MJDBN +KIIHGN 5KCCM>MN 4DBKCJI<N 7N >IJEM2=KHFLN J8MIJ>MN K?N ,<3N HG IM"AHIMEN ?KIN MJDBN GM@MGLMIN ?KCCK;HF>N LBMN HFHLHJCN CHGLHF>N ?KIN DKFLHFAME EMGH>FJLHKFNJGNJN+KIIHGN5KCCM>MN4DBKCJI< $?+?+>1>:?/62;5<97 4LAEMFLGN;BKNBJ8MN9MMFNCHGLMENKFNLBMN%MJFGNKIN'IMGHEMFLGN&HGLN?KIN9KLB GM@MGLMIGN K?N LBMHIN ?IMGB@JFN :MJIN JIMN EMGH>FJLMEN -<N .<N .MA9MFN 4DBKCJIG< /BHGNJDJEM@HDNBKFKINHGNFJ@MEN?KINLBMNCJLMN-EMCCN.<N.MA9MF6NJN?KI@MIN'IMGH2 EMFLNK?NLBMN5KCCM>M< !9<41<8=;:?;:;97 /BMN ?KCCK;HF>N BKFKIGN JIMN J;JIEMEN JLN >IJEAJLHKFN LKN GLAEMFLGN ;BKN BJ8M @JHFLJHFMEN JN BH>BN CM8MCN K?N GDBKCJIGBH=N EAIHF>N LBMHIN DKCCM>MN DJIMMIG<N 7N GLA2 EMFLN@AGLN9MNMFIKCCMENJLNLBMN5KCCM>MN?KINJLNCMJGLNKFMN:MJIN,3NDIMEHLNBKAIG HFNKIEMINLKNIMDMH8MN>IJEAJLHKFNBKFKIG< 5A@N&JAEM>IJEMN=KHFLNDA@ACJLH8MNJ8MIJ>MNK?N,<3NKINBH>BMI< +J>FJN5A@N&JAEM>IJEMN=KHFLNDA@ACJLH8MNJ8MIJ>MNK?N,<$3NKINBH>BMIN< 4A@@JN 5A@N &JAEM>IJEMN =KHFLN DA@ACJLH8MN J8MIJ>MN K?N ,<$N KI BH>BMIN< !9<41<8=;:?+>1=9>3>:87 0< 7NDJFEHEJLMN?KIN>IJEAJLHKFN@AGLNBJ8MNMJIFMENJLNCMJGLN)$N=MIDMFLNK?NLBM IM"AHIMENBKAIGNHFNIMGHEMFDMNJLN+KIIHGN5KCCM>M< )< 7NDJFEHEJLMN?KIN>IJEAJLHKFN@AGLNBJ8MNMJIFMENJN@HFH@A@NK?N0)NDIMEHL BKAIGN JFEN JN >IJEMN =KHFLN J8MIJ>MN K?N FKLN CMGGN LBJFN )<3<N 5MILJHFN @JKI =IK>IJ@GNN IM"AHIMN JN BH>BMIN FA@9MIN K?N DIMEHLN BKAIGN JGN LBMN @HFH@A@N ?KI >IJEAJLHKFN< ,< 7N;IHLLMFNJ==CHDJLHKFN?KIN>IJEAJLHKFNLBJLNHGNJ8JHCJ9CMNHFNLBMN-??HDMNK?N7E2 @HGGHKFGNJFEN.MDKIEGN@AGLN9MN?HCMEN;HLBNLBJLNK??HDMNFKNCJLMINLBJFNLBMNMFENK?NJ GLAEMFLGNAFHKIN:MJI<N7FNJ==CHDJFLN?KIN>IJEAJLHKFN;HCCN9MNFKLH?HMEN9:NLBMN-??HDM K?N7E@HGGHKFGNJFEN.MDKIEGNK?NBHGNKINBMINGLJLAGN=IHKINLKNLBMNFM*LNIM>HGLIJLHKF =MIHKE< < 7N >IJEAJLHKFN ?MMN K?N 3<33N @AGLN 9MN =JHEN LKN LBMN HFJFDHJCN 4MI8HDMGN -??HDMNJLNLBMNLH@MNLBMNJ==CHDJLHKFNHGN@JEM< $< IJEAJLHKFN M*MIDHGMGN JIMN BMCEN JFFAJCC:N HFN +J:N ?KCCK;HF>N LBMN DCKGMN K? LBMNG=IHF>NGM@MGLMI<N7CCNDJFEHEJLMGNJIMNM*=MDLMENLKN=JILHDH=JLMNHFNLBMNM*MIDHG2 60


GENERAL ACADEMIC INFORMATION MGNJLNLBHGNLH@M<N(?NDK@=CHJFDMN;HLBNLBHGNIM>ACJLHKFNHGNFKLN=KGGH9CM6NIM"AMGLGN?KI >IJEAJLHKFNHFNJ9GMFLHJN@AGLN9MN@JEMNHFN;IHLHF>NLKNLBMN7DJEM@HDN%MJF< < 7CCNDJFEHEJLMGN?KIN>IJEAJLHKFN@AGLN9MNDMILH?HMEN9:NLBMN%HIMDLKINKIN7E@HG2 GHKFGNJFEN.MDKIEG<

< 7N?HFJCN;IHLLMFNM*J@HFJLHKFNHGNIM"AHIMENK?NJCCNDJFEHEJLMGN?KIN>IJEAJLHKF< <N4LAEMFLGNGMM#HF>NLKN>IJEAJLMNHFN?KAIN:MJIGN@J:NIM"AHIMN@KIMNLBJFN?KAI :MJIGNH? 0 ) , 

LBM:NBJENJDJEM@HDNEM?HDHMFDHMGNHFN1F>CHGBNJFEKIN@JLBM@JLHDG LBM:N;MIMNKFNJDJEM@HDN=IK9JLHKFNKFMNKIN@KIMNLH@MG LBM:NMFIKCCMENHFNLMJDBMIN=IM=JIJLHKFN=IK>IJ@G NKI LBM:NDBJF>MENLBMHIN@JKINJDJEM@HDN=IK>IJ@<

-2<:(>?;*?)<3>?<:4;9?0449>77 (LNHGNLBMNK9CH>JLHKFNK?NM8MI:NGLAEMFLNLKNFKLH?:NLBMN-??HDMNK?N7E@HGGHKFGNJFE .MDKIEGNK?NJF:NDBJF>MNHFNFJ@MNKIN=MI@JFMFLNJEEIMGG<NJHCAIMNLKNEKNGKNDJF DJAGMNGMIHKAGNEMCJ:NHFNBJFECHF>NK?NGLAEMFLNIMDKIEGNJFENH@=KILJFLNDKIIMG=KF2 EMFDM< #>8;;?;5=6 /M*L9KK#GN JIMN IM"AHIME<N 7CCN GLAEMFLGN @AGLN JEBMIMN LKN LBMN LM*L9KK#N DK=:2 IH>BLNCJ;<N/M*L9KK#GN@AGLN9MNK9LJHFMENJLNCMJGLNKFMN@KFLBN=IHKINLKN@HELMI@ KIN?HFJCN>IJEMGN;HCCN9MNJ??MDLME< -5<779;;3?&=791'8=;: 7CCNGLAEMFLGNJIMNM*=MDLMENLKN9MBJ8MNHFNJN@JLAIMNJFENKIEMIC:N@JFFMI<N%HG2 IA=LH8MNJFEKINEHGKIEMIC:NDKFEADLN;HCCNFKLN9MNL KCMIJLMENHFNLBMNDCJGGIKK@GNKI CJ9KIJLKIHMGNJLN+KIIHGN5KCCM>M<N7?LMINLBMNHFHLHJCN;JIFHF>6N?JDACL:N@J:NEHG@HGG ?IK@NDCJGGNKINCJ9KIJLKI:NJNGLAEMFLN;BKGMNDKFEADLNHG6NHFNBHGBMINK=HFHKF6NEHG2 IA=LH8M<N/BHGNHFDCAEMG6N9ALNHGNFKLNCH@HLMENLK6N8MI9JCNJ9AGM6NJF:N#HFENK?NBJIJGG2 @MFL6N =IK?JFHL:6N ?H>BLHF>6N EHGIA=LHKFN K?N =IK=MIL:6N DBIKFHDN LJIEHFMGG6N KIN JF: KLBMIN HFLMI?MIMFDMN ;HLBN DCJGGIKK@N JDLH8HLHMG<N 4ADBN GLAEMFLGN ;HCCN FKLN 9MN =MI2 @HLLMEN IM2MFLI:N HFLKN LBMN DCJGGN AFLHCN DCMJIJFDMN HGN K9LJHFMEN ?IK@N LBMN ?JDACL: @M@9MI6N LBMN J==IK=IHJLMN EH8HGHKFN DBJHI6N JFEKIN LBMN 7DJEM@HDN %MJF<N 792 GMFDMGN HFDAIIMEN EAIHF>N JN EHG@HGGJCN ?IK@N DCJGGN ;HCCN 9MN IMDKIEMEN JGN AFM*2 DAGME<N /BMN CMF>LBN K?N J9GMFDMN ?IK@N DCJGGN GBJCCN FKLN M*DMMEN L;KN DCJGGN EJ:G NBKAIGN?IK@NLBMNEJLMNK?NLBMNHFDHEMFL< (FNJNDJGMNHF8KC8HF>NM*LIM@MC:NEHGIA=LH8MN9MBJ8HKI6NLBMNDKCCM>MNIMGMI8MGNLBM IH>BLNLKNLJ#MNJEEHLHKFJCNEHGDH=CHFJI:NJDLHKFNLBIKA>BNHLGNMGLJ9CHGBMENAEHDHJCN=IK2 DMGG<N(?NJNGLAEMFLNHGN?KAFENIMG=KFGH9CMN?KINGADBN8HKCJLHKF6NLBMN@HFH@A@NEHGDH2 =CHFJI:NJDLHKFN@J:N9MNEHG@HGGJCN?IK@NLBMNDCJGGNHFN"AMGLHKFN;HLBNJNGM@MGLMI >IJEMN K?N 6N ;BHCMN LBMN @J*H@A@N EHGDH=CHFJI:N JDLHKFN @J:N 9MN M*=ACGHKFN ?IK@ LBMNDKCCM>M6NEM=MFEMFLNA=KFNLBMN>IJ8HL:NK?NLBMN8HKCJLHKF< 06<4>3=6?;:>78 7DJEM@HDN BKFMGL:N HGN M*=MDLMEN HFN JCCN GHLAJLHKFGN JLN +KIIHGN 5KCCM>M<N +KIIHG 5KCCM>MN GLAEMFLGN JIMN M*=MDLMEN LKN BJ8MN LBMN GMC?2DKF?HEMFDM6N LBMN GMC?2 IMG=MDL6N JFEN LBMN >KKEN AE>@MFLN LKN IMDK>FH MN LBJLN JN GKAFEN MEADJLHKFN IM"AHIMGNEKHF>NKFMGNK;FN;KI#<N/BAGN=CJ>HJIHG@NJFENKLBMIN?KI@GNK?NJDJEM@HD 61


MORRIS COLLEGE CATALOG EHGBKFMGL:N JIMN LBMN 9JGHGN ?KIN ?JHCAIM6N JDDKIEHF>N LKN LBMN DKCCM>MGN =KCHD:N JGN ?KC2 CK;G %HGBKFMGLN;KI#NK?NLBMN?KCCK;HF>N#HFEGN;HCCNIMGACLNHFNGLAEMFLGN9MHF>N=MFJCH ME NGMNK?NJF:NAFJALBKIH MENJGGHGLJFDMNHFNLJ#HF>N"AH MG6NLMGLG6NKINM*J@HFJ2 LHKFG NGMN K?N JF:N =KILHKFN K?N 9KK#G6N =J=MIG6N KIN FKLMGN DK=HMEN ?IK@N JF:N GKAIDM HFDCAEHF>NMCMDLIKFHDNLIJFG@HGGHKFN;HLBKALNJD#FK;CME>@MFL NGMNK?N9IH9MI:6NLBIMJLG6NKI NJF:NKLBMIN@MJFGNK?NDKMIDHKFNLKNHF?CAMFDMNJF: DKCCM>MNK??HDHJC6N?JDACL:N@M@9MI6NKINM@=CK:MMNIMG=KFGH9CMN?KIN=IKDMGGHF> >IJEMG6NM8JCAJLHF>N>IJEMGNKIN?KIN@JHFLJHFHF>NJDJEM@HDNIMDKIEG NGMN K?N ?KI>MI:6N JCLMIJLHKF6N AFJALBKIH MEN =KGGMGGHKF6N KIN @HGAGMN K?N 5KC2 CM>MNEKDA@MFLGN=MILJHFHF>NLKNJDJEM@HDNIMDKIEG6NHFDCAEHF>6N9ALNFKLNCH@HL2 MENLK6NCJLMNKINIMLIKJDLH8MNDBJF>MNLKNGDBMEACMN?KI@GNJFENCJLMNKINIMLIKJD2 LH8MN ;HLBEIJ;JCNK?NJ==CHDJLHKFN?KI@G NGMNK?NJF:NKLBMIN@HGCMJEHF>NKINEHGBKFMGLN=IJDLHDM< 7NIM=KILN@AGLN9MNHFHLHJLMENJFENM*MDALMEN;HLBHFNNBKAIGN9:NLBMNHFGLIADLKI KFN LBMN =IMGDIH9MEN ?KI@6N    <N (FN JN DJGMN K?N EHG2 BKFMGL:6N JFN HFGLIADLKIN @J:N EMDHEMN LKN >H8MN LBMN GLAEMFLN FKN DIMEHLN ?KIN LBMN JG2 GH>F@MFLNHFN"AMGLHKFNKIN?KINLBMNDKAIGMNJGNJN;BKCM<N%M=MFEHF>NKFNLBMNGM8MIH2 L:NK?NLBMNDJGM6NLBMNH FGLIADLKIN@AGLNGA9@HLNJN;IHLLMFNGLJLM@MFLNLKNLBMN-??HDMNK? 4LAEMFLN 7??JHIGN JFEN LBMN -??HDMN K?N 7DJEM@HDN 7??JHIGN ?KIN ?AILBMIN JDLHKFN LKN 9M LJ#MF<N7NGLAEMFLN@J:NJ==MJCNLBMNJDLHKFN9:N;IHLLMFNGLJLM@MFLNLKNLBMN-??HDMNK? 7DJEM@HDN7??JHIG< 06<4>3=6?!9=> <:6>?9;6>419> KINHF?KI@JLHKFNJ9KALNLBMNJDJEM@HDN>IHM8JFDMN=IKDMEAIM6N=CMJGMNGMMNLBM DAIIMFLN  

62


"%"  %"" &'!$%&'$ ! #$%&#&! $>DE>C@3EF BA@E>D?D@B>F ?<D@3@D@ECF ?AEF B55EAE=F DBF >E/F CD:=E>DCF =:A@>6F E>DA4 /EE%CFB5FD9EF5?;;F?>=FC7A@>6FCE8ECDEAC1F,D:=E>DCFD9E>F<B>D@>:EFD9E@AFBA@E>D?D@B>F /@D9@>F ?F <B87AE9E>C@3EF <B:ACE2F (,F &&F AEC98?>F ,E8@>?A1F +9E 7@3BD?;F<B><EA>F@CFD9?DFCD:=E>DCF/@;;F0EF7AB3@=E=F/@D9F?FCB:>=2FC:<<ECC5:;2 E>DA4F;E3E;F?<?=E8@<F6AB/D9FE 7EA@E><E1 " '$ %"#& %"'&' ,D:=E>DF,:77BADF,EA3@<ECF@CF?F5E=EA?;;4F5:>=E=F7AB6A?8F/9@<9F7AB3@=EC B77BAD:>@D@ECF5BAF?<?=E8@<F=E3E;B78E>DF5BAF&&F5AEC98E>F?>=FCB79B8BAEC ?>>:?;;41F@ACD-6E>EA?D@B>2F;B/-F@><B8EFCD:=E>DCF?>=FCD:=E>DCF/@D9F=@C?0@;@D@ECF ?AEF E;@6@0;EF DBF 7?AD@<@7?DE1F +9EF 7AB6A?8F ?CC@CDCF CD:=E>DF @>F D9E@AF DA?>C@D@B>F5AB8F9@69FC<9BB;FDBF<B;;E6E2F9E;7CF/@D9F0?C@<F<B;;E6EFAE:@AE8E>DC2F?>= CEA3ECFDBF8BD@3?DEFCD:=E>DCFDB/?A=FD9EFC:<<ECC5:;F<B87;ED@B>FB5FD9E@AF7BCDCE<B>=?A4FE=:<?D@B>1FF !&''&%"'&'%'$ '& The Career Services Center offers career development and counseling; workshops DQGVH PLQDUVRQFDUH H UUH ODWH GVXEMH FWVDQGDVVLVWDQFH ZLWKUpVXPpZULWLQJLQWH UYLH ZLQJLQWH UQVKLSVJUDGXDWH DQGSURIH VVLRQDOVFKRRODGPLVVLRQDQGMRESODFH PH QW +9@CF CEA3@<EF @CF 7AB3@=E=F 5BAF CD:=E>DCF 04FD9EF.B;;E6EFDBFB55EAF@>5BA8?D@B> ?0B:DF<?AEEAC2FDBF?CC@CDF@>FCE<:A@>6FE87;B48E>DF=:A@>6FC:88EACF?>=F?5DEA 6A?=:?D@B>2F ?>=F DBF ?CC@CDF @>F 6?@>@>6F E>DA4F @>DBF 6A?=:?DEF ?>=F 7AB5ECC@B>?; C<9BB;C1 "'&'%'!&$$%&#&! $>F%EE7@>6F/@D9FD9EF.B;;E6E CF8BDDBFB5F">DEAFDBF;E?A>F!E7?ADFDBFCEA3E2 D9EF ,EA3@<EF #E?A>@>6F AB6A?8F B55EACF CD:=E>DCF D9EF B77BAD:>@D4F DBF DA?>C5EA <B>DE>DF%>B/;E=6EF5AB8F?<?=E8@<F<B:ACECFDBF7A?<D@<?;F?77;@<?D@B>FD9AB:69 AE;?DE=F<B88:>@D4FCEA3@<E1F,D:=E>DCF7AB3@=EF8E?>@>65:;FCEA3@<EFDBF3?A@B:C ?6E><@ECFD9AB:69B:DF,:8DEAF.B:>D4F?DFD9EFC?8EFD@8EFD9?DFD9E4F?AEFC?D@C54@>6F<B:ACEFB0E<D@3EC2FD9EAE04F7AE7?A@>6FDBFCEA3EFD9E@AF<B88:>@D@ECF?>=FD9E ;?A6EAFCB<@ED4F?5DEAF6A?=:?D@B>1 "'&%"## 'BAA@CF.B;;E6EF,:88EAF,<9BB;F<B>C@CDCFB5FB>EFC@ -/EE%FCECC@B>F=:A@>6F/9@<9 CD:=E>DCF 8?4F E?A>F :7F DBF >@>EF <AE=@DF 9B:AC1F ,:88EAF ,<9BB;F @CF =EC@6>E= 7A@8?A@;4F DBF 9E;7F CD:=E>DCF /9BF /@C9F DBF 8?%EF :7F >EE=E=F <AE=@DC2F ;@69DE> D9E@AF<B:ACEF;B?=F=:A@>6FD9EFAE6:;?AFCE8ECDEA2FBAFAE=:<EFD9EFD@8EFAE:@AE= 5BAF6A?=:?D@B>1F,:88EAF,<9BB;F?;CBFB55EACFC7E<@?;F0E>E5@DCFDBF@>-CEA3@<E DE?<9EAC2F7EACB>CF/@C9@>6FDBF7:AC:EF?<?=E8@<F/BA%F5BAF7EACB>?;F?=3?><E8E>D2F ?>=F AE<E>DF 9@69F C<9BB;F 6A?=:?DECF /9BF =EC@AEF ?>F E?A;4F CD?ADF @> <B;;E6E1F ">DEA@>6F 5@ACD-D@8EF CD:=E>DCF 8:CDF ?77;4F DBF D9EF 55@<EF B5F )=8@CC@B>CF ?>= (E<BA=C2F?>=F?=8@CC@B>FDBFD9EFC:88EAFC<9BB;F@CF=EDEA8@>E=FB>FD9EFC?8E 0?C@CF?CF?=8@CC@B>FDBFD9EF5?;;FBAFC7A@>6FCE8ECDEAC1F+A?>C@E>DFCD:=E>DCF8?4 0EF?=8@DDE=F04F;EDDEAFB5F?77AB3?;F5AB8FD9E@AFAEC7E<D@3EFC<9BB;C1 BAF =ED?@;CF ?0B:DF D9EF C:88EAF CECC@B>2F CEEF D9EF <:AAE>DF    

    63


MORRIS COLLEGE CATALOG

'!&$$%'#&'%'$ '& The Richardson-Johnson Resources Center (LRC) opened to the +9EF (@<9?A=CB>-B9>CB>FLearning #E?A>@>6F (ECB:A<ECF .E>DEAF #(.

F B7E>E=F DB Morris College Community in 1980.@>F The a three-story building, can0:@;=@>62 seat 350 D9EF 'BAA@CF .B;;E6EF <B88:>@D4F  LRC, &1F +9EF #(.2F ?F D9AEE-CDBA4F users.CE?DF This facility houses +9@CF the Library, the9B:CECF Media Services Department, and an academic <?>F &F :CEAC1F 5?<@;@D4F D9EF #@0A?A42F D9EF 'E=@?F ,EA3@<EC FRPSXWHUODERUDWRU\ !E7?AD8E>D2F ?>=F ?>F2QWKHĂ&#x20AC;UVWĂ RRUDUHFDWDORJLQJFLUFXODWLRQDQGUHIHUHQFH ?<?=E8@<F <B87:DEAF ;?0BA?DBA41F >F D9EF 5@ACDF 5;BBAF ?AE GHSDUWPHQWV.@A<:;?D@B>2F DGPLQLVWUDWLYHRIĂ&#x20AC;FHV DQGWKHDUFKLYHV room. The library offers over .?D?;B6@>62F ?>=F (E5EAE><EF !E7?AD8E>DCF ?=8@>@CDA?D@3EF B55@<EC 132,000 book volumes (both print and electronic books) and 74 databases are ?>=FD9EF)A<9@3ECF(BB81F+9EF#@0A?A4FB55EACFCE3EA?;FB>;@>EF=?D?0?CECF/9@<9F?AE available for use to Morris College students, faculty and staff. As a member ?3?@;?0;EF5BAF:CEF0BD9FB>-F?>=FB55F<?87:CF'BAA@CF.B;;E6EFCD:=E>DC2F5?<:;D42F?>=FCD?551 of >FD9EFCE<B>=F5;BBAF?AEFAE?=@>6F?>=F7A@3?DEFCD:=4FABB8CF?>=F<B87:DEAC PASCAL (Partnership Among South Carolina Academic Libraries), Morris College students, faculty and staff have to over million ;?>6:?6E print books 5BAF AECE?A<91F );CBF B>F D9EFadditional CE<B>=Faccess 5;BBAF ?AEF D9EF12 5BAE@6>F and over 300,000D9EF electronic books.B;;E<D@B>F through PASCAL Delivers, state wide)5A@<?> catalog. ;?0BA?DBA@ECF .B;E8?>F B5F 0BB%CF 04Fthe ?>=F ?0B:DF 2QWKHVHFRQGĂ RRUDUHUHDGLQJDQGSULYDWHVWXG\URRPVDQGFRPSXWHUV )8EA@<?>CF?>=FD9EF6E>EA?;F0BB%CF<B;;E<D@B>FAE<B88E>=E=F04FD9EF#@0A?A4 IRUUHVHDUFK$OVRRQWKHVHFRQGĂ RRUDUHWKHIRUHLJQODQJXDJHODERUDWRU\ B5F.B>6AECC1F the+9EF Coleman Collection ofD9EF books by .E>DEAF and about African3@=EBC2F Americans; and.!C2 the D9@A=F 5;BBAF 9B:CECF 'E=@?F 7AB3@=@>6F !!C2F general books collection recommended by the American Association. ?>=F 8:;D@8E=@?F E:@78E>DF 5BAF :CEF 04F 8E80EACF B5F D9EFLibrary .B;;E6EF ?>=F ?F 5@;8 7KHWKLUGĂ RRUKRXVHVWKH0HGLD& HQWHUSURYLGLQJYLGHRV'9 'V& 'VDQGPXOWLPHGLD ;E<D:AEFABB8FE:@77E=F/@D9F?FC8?ADF0B?A=F?>=F?F3@=EBF7ABE<D@B>FC4CDE8 HTXLSPHQWIRUXVHE\PHPEHUVRIWKHFROOHJHDQGDĂ&#x20AC;OPlecture room well equipped to DBFC:77BADF<;?CCEC2F8EED@>6C2F?>=F<B>5EAE><EC1F);CBFB>FD9EFD9@A=F5;BBAF?AEF? VXSSRUWFODVVHVPHHWLQJVDQGFRQIHUHQFHV $OVRRQWKHWKLUGĂ RRUDUHDMRXUQDOLVP B:A>?;@C879BDB6A?794F ;?0BA?DBA42F D9EF DE;E3@C@B>F ?>=F A?=@BF CD:=@BC2F ?> photography laboratory, the;?0BA?DBA4F television and/@D9F radiostudios, an academic computer laboratory ?<?=E8@<F <B87:DEAF F CD?D@B>C2F ?>=F -F <:AA@<:;:8 ZLWKVWDWLRQVDQG.  FXUULFXOXPPDWHULDOVVXSSRUWLQJWKHVXEMHFWDUHDVWDXJKWLQ 8?DEA@?;CFC:77BAD@>6FD9EFC:0E<DF?AE?CFD?:69DF@>FD9EF,B:D9F.?AB;@>?F7:0;@< WKH6RXWK& C<9BB;C1 DUROLQDSXEOLFVFKRROVHJWKH& KLOGUHQ¡V/LWHUDWXUH& ROOHFWLRQ $#&! #$%'$# # %'#&' (E<B6>@@>6FD9EF@87BAD?><EFB5F<B87:DEACF@>F8B=EA>FCB<@ED42F'BAA@CF.B;;E6EF7AB3@=ECF@>5BA8?D@B>FDE<9>B;B64FAECB:A<ECFCBFD9?DFE3EA4FCD:=E>DF@CF?55BA=E=FD9EFB77BAD:>@D4FDBF?<:@AEF0?C@<F<B87:DEAF<B87EDE><@EC1FF+9EAEF?AE DE>F<B87:DEAF;?0BA?DBA@ECF/@D9F$>DEA>EDF?<<ECCFDBFC:77BADF@>CDA:<D@B>?;F?>= AECE?A<9F?77;@<?D@B>CF@>FD9EF8?BAF?<?=E8@<F?AE?C1FF+47@<?;F?77;@<?D@B>CF@><;:=EF =EC%DB7F 7:0;@C9@>62F CD?D@CD@<C2F =?D?0?CEF 8?>?6E8E>D2F C7AE?=C9EED ?>?;4C@C2F6A?79@<C2F?>=F<B88:>@<?D@B>C1FF+9EF.B;;E6EF?;CBF7AB3@=ECF/@AE;ECCF$>DEA>EDF?<<ECCFD9AB:69B:DFD9EF<?87:C1 'BAA@CF.B;;E6E CF:CEFB5FDE<9>B;B64FE>9?><ECFCD:=E>DF;E?A>@>62F@CF?77AB7A@?DEF5BAF8EED@>6FD9EFB0E<D@3ECFB5F@DCF7AB6A?8C2F?>=FE>C:AECFD9?DFCD:=E>DC 9?3EF?<<ECCFDBF?>=FDA?@>@>6F@>FD9EF:CEFB5FDE<9>B;B641FB:ACFB5FB7EA?D@B>F5BA E?<9F;?0BA?DBA4F?AEF7BCDE=1F !&% #$ 7/?A=FB:>=F@CF?F5E=EA?;;4F5:>=E=F7AE-<B;;E6EF7AB6A?8F5BAF9@69FC<9BB; CD:=E>DC1F $DF @CF =EC@6>E=F DBF 9E;7F ;B/-@><B8EF 7BDE>D@?;;4F 5@ACD-6E>EA?D@B> <B;;E6EFF CD:=E>DCFC:<<ECC5:;;4F6A?=:?DEF5AB8F9@69FC<9BB;F?>=F7:AC:EF7BCDFCE<B>=?A4F E=:<?D@B>1F 7/?A=F B:>=F @CF 5:>=E=F 04F D9EF >@DE=F ,D?DEC !E7?AD8E>DFF B5F"=:<?D@B>F +@D;EF$ 2F?>=F'BAA@CF.B;;E6EFCEA3ECF?CFD9EF9BCD @>CD@FD:D@B>1F+9EFF7AB6A?8F@CF5:>=E=FDBFCEA3EF*F;B<?;F9@69FC<9BB;FCD:=E>DCF1 +9EF'BAA@CF.B;;E6EF7/?A=FB:>=FAB6A?8F7AB3@=ECFD9EF5B;;B/@>6FC:77BADFCEA3@<ECF5BAF@DCF7?AD@<@7?>DC 1FF$>=@3@=:?;F?>=FC8?;;F6AB:7F<B:>CE;@>6 1FF.;?CCECF @>F 8?D92F C<@E><E2F AE?=@>62F ">6;@C92F 5BAE@6>F ;?>6:?6E2F ?>= <B87:DEAF;@DEA?<4 64


SPECIAL PROGRAMS AND SERVICES 1FF.:;D:A?;FE>A@<98E>DF?<D@3@D@EC 1FF"=:<?D@B>?;F8?DEA@?;CF?>=FC:77;@EC 1FF)<?=E8@<2F<?AEEA2F7EACB>?;2F?>=FCB<@?;F<B:>CE;@>6 *1FF+A?>C7BAD?D@B> 1FF,@ -/EE%CFAEC@=E><EFB>F<?87:C 1FF@C@DCFDBF7BCDCE<B>=?A4F@>CD@D:D@B>C 1FF$>=@3@=:?;@E=FD:DBA@>6 &1FF)FC8?;;FCD@7E>= +9EF 7AB6A?8F B7EA?DECF /@D9F <E>DA?;@E=F ?>=F =E<E>DA?;@E=F CECC@B>CF =:A@>6F D9EF ?<?=E8@<F 4E?A1F !:A@>6F D9EF C:88EAF ?;;F 7?AD@<@7?>DCF AEC@=EF B>F D9E <?87:CF 5BAF C@ F * F /EE%C1F );;F <E>DA?;@E=F CECC@B>CF ?AEF 9E;=F B>F <?87:C D/@<EF8B>D9;4FB>F,?D:A=?4C1

65


< /< +> -;/?+;;4;:54 <5+?2:(2<-4 6>?+;;4;:5?:?(>5>2<,?46*+;>4 &;HI 'E6EBECGI C7I HGHAF@I 4D=?EHBI FDI /CAAEBI (C@@H8HI C77HABI BD=?HGDB3 D;AC=8;I EDBI >CAHI >=AAE>=@=<I C7I @E0HAF@I FADBI >C=ABHB3I FGI C99CAD=GED5I DC E<9AC6HI D;HEAI B$E@@BI FG?I @HFAGI D;HI >CGDHGDI GH>HBBFA5I 7CAI B=>>HBBI EGI <FCA >C=ABHB:I =AD;HA<CAH3I D;HI 'E6EBECGI C7I HGHAF@I 4D=?EHBI F?<EGEBDHAB 9AC8AF<BI7CAI7EABDIFG?IBH>CG?5HFAIBD=?HGDBIHGDHAEG8ID;HI>C@@H8H3IFG?ID;H 'E6EBECGI9AC6E?HBIFGIF>F?H<E>I9AC8AF<IFG?IF>F?H<E>IB=99CADIBHA6E>HBIDC <HHDI D;HI ?E6HABHI GHH?BI C7I 7AHB;<HG3I BC9;C<CAHBI FG?I DAFGB7HAI BD=?HGDB: &;HI 9AC8AF<BI B9CGBCAH?I 05I D;EBI ?E6EBECGI FAHI ?HBE8GH?I DCI 9AC<CDH AH@FDECGB;E9BIF<CG8I7F>=@D53IF?6EBCAB3IFG?IBD=?HGDBIEGIFGIH77CADIDCI9AC6E?H BD=?HGDBI2ED;ID;HI>C@@H8EFDHIHG6EACG<HGDIGH>HBBFA5I7CAIF>F?H<E>IB=>>HBB: (C=ABHBIFG?I9AC8AF<BIC77HAH?I05ID;HI'E6EBECGIC7I HGHAF@I4D=?EHBI9AC6E?HIF AE8CAC=BI F>F?H<E>I 7C=G?FDECGI 7CAI BD=?HGDBI D;AC=8;I B=>>HBBCAEHGDH? H9HAEHG>HBI 2;E>;I 9AC<CDHI H>H@@HG>H3I B>;C@FAB;E9I FG?I AHDHGDECG:I &;H 'E6EBECGI F@BCI B9CGBCABI FI 6FAEHD5I C7I F>DE6EDEHBI DCI HG;FG>HI FG?I ?EB9@F5I D;H DF@HGDBIC7I7AHB;<HGIFG?IBC9;C<CAHB:I)F>;I5HFA D;HI'E6EBECGI9=0@EB;HBI      FI @EDHAFA5I <F8FEGHI 7CAI 7AHB;<HG3I FG?I        F @EDHAFA5I<F8FEGHIFG?IGH2B@HDDHAI7CAIBC9;C<CAHB: +;;4;:5?:' >/6;>4?,><25;5(:*6/:->4?<5+?> ;6 2>*;2>->564 &;HI 9AE<FA5I 8CF@I C7I D;HI 'E6EBECGI C7I HGHAF@I 4D=?EHBI EBI DCI 9AC6E?H BD=?HGDBI2ED;IFIBC@E?I7C=G?FDECGIEGID;HI@E0HAF@IFADB:I-GICA?HAIDCIF>;EH6HID;EB 8CF@3ID;HI'E6EBECGI;FBID;HI7C@@C2EG8IC0H>DE6HB ":I&CI9AC6E?HIFIBDE<=@FDEG8IB=>>HBBCAEHGDH?IF>F?H<E>IHG6EACG<HGDID;FD 2E@@I9AC<CDHIBD=?HGDIAHDHGDECG: :I &CI 9AC6E?HI BD=?HGDBI FI >CAHI >=AAE>=@=<I C7I >C=ABHI 2CA$I EGI CAF@I FG? 2AEDDHGI>C<<=GE>FDECG3ID;HI;=<FGEDEHB3I<FD;H<FDE>B3IFG?ID;HIGFD=AF@ FG?IBC>EF@IB>EHG>HB: 1:I &CI ;H@9I BD=?HGDBI ?H6H@C9I F?H=FDHI >C<9HDHG>EHBI EGI AHF?EG83I 2AEDEG8 FG?I<FD;H<FDE>B: %:I&CIE<9AC6HID;HIBD=?HGDB IF0E@EDEHBIDCIFGF@5H3IB5GD;HBEH3IFG?IH6F@=FDH EGDH@@H>D=F@IE?HFBIFG?I9AEG>E9@HB: :I&CIHGB=AHID;FDIBD=?HGDBIFAHI9@F>H?IEGIF99AC9AEFDHI>C=ABHBIFG?I7C@@C2 FIB9H>E7E>I>C=ABHIC7IBD=?5: :I&CIEGBDA=>DID;HIBD=?HGDBIEGID;HI7=G?F<HGDF@BIC7I>C<9=DHAI@EDHAF>5: !:I &CI 9AC6E?HI BDACG8I F>F?H<E>I B=99CADI BHA6E>HBI D;AC=8;I D=DCAEF@B3 F?6EBH<HGD3I FG?I 7F>E@EDEHBI 7CAI FBBEBDH?I @HFAGEG8I EGI )G8@EB;3 <FD;H<FDE>B3IFG?IAHF?EG8: (=7=.9&?>!%)91837?,=9.787#?:%1)3$=0 -DI EBI D;HI FE<I C7I D;HI /CAAEBI (C@@H8HI HGHAF@I )?=>FDECGI (=AAE>=@=<I DC HGB=AHID;FDIHF>;IBD=?HGDI>FG 66


ACADEMIC DIVISIONS AND PROGRAMS ":I 'H<CGBDAFDHI $GC2@H?8HI C7I D;HI 7=G?F<HGDF@BI C7I 2AEDDHGI FG?I CAF@ >C<<=GE>FDECGID;FDIFAHIF99AC9AEFDHIFG?IH77H>DE6HIEGIFI6FAEHD5IC7IBED=FDECGB FG?I7CAIFI6FAEHD5IC7I9=A9CBHBIFG?IF=?EHG>HB: :I'H<CGBDAFDHI$GC2@H?8HIC7I@EDHAFA53I6EB=F@IFG?I9HA7CA<EG8IFADBIEGID;HEA >=@D=AF@I>CGDHDB: 1:I-?HGDE75IFG?IFGF@5HIDHA<BIAH@FDH?IDCID;HI<FCAI9HAEC?BIFG?IH6HGDBIC7 .7AE>FGI.<HAE>FGIFG?ICA@?IEBDCA5: %:IDE@EHID;HIB>EHGDE7E>I<HD;C?IDCI?H6H@C9I2CA$EG8I$GC2@H?8HIC7IHBBHGDEF@ 9;5BE>F@I FG?I 0EC@C8E>F@I B>EHG>HI 9AEG>E9@HB3I FG?I FGF@5HI 6FAEC=BI 2F5BI DC <FEGDFEGI8CC?I;=<FGI;HF@D;IFG?I2H@@I0HEG8: :I 'H<CGBDAFDHI FI 0FBE>I $GC2@H?8HI C7I D;HI <EG?I FG?I ;C2I EDI 2CA$BI FG? EGDHAF>DBI0CD;IF@CGHIFG?I2ED;ICD;HAB: :IDE@EHIFG?IF99@5I<FD;H<FDE>F@IAHFBCGEG8IEGICD;HAIFAHFBIC7I$GC2@H?8H: !:I 'H<CGBDAFDHI $GC2@H?8HI C7I D;HI ;EBDCA53I AH@E8EC=BI DHDB3I FG?I ?C>DAEGF@ DHF>;EG8BIC7ID;HI#E0@H: :I 'H<CGBDAFDHI >C<9=DHAI @EDHAF>5I FG?I 9AC7E>EHG>5I 2ED;I EG7CA<FDECG HBBHGDEF@BIFG?IC77E>HIF99@E>FDECGB: -GICA?HAI7CAIBD=?HGDBIDCI<C6HI7AC<ID;HI'E6EBECGIC7I HGHAF@IBD=?EHBIDCID;H <FCAI?E6EBECGB3IBD=?HGDBI<=BDI<HHDID;HI7C@@C2EG8IHEDIAH=EAH<HGDB ":I)GAC@@I EGI AH=EAH?I >C=ABHBI EGI )G8@EB;3I <FD;H<FDE>B3I FG?I AHF?EG8I E7 AH=EAH?IHF>;IBH<HBDHAI=GDE@ID;HBHI>C=ABHBIFAHIBFDEB7F>DCAE@5I>C<9@HDH?: :I,H>HE6HI FI 8AF?HI C7I (I CAI 0HDDHAI EGI F@@I ?H6H@C9<HGDF@I >C=ABHBI FG?I EG ) I"+13I) I"+%3IFG?I/.&I"+1: 1:I.?;HAHIDCI9AHAH=EBEDHBI7CAIB9H>E7EH?I>C=ABHB: %:I,H>HE6HI F99AC6F@I 7CAI F@@I B>;H?=@HI FG?I 9AC8AF<I >;FG8HBI 7AC<I 7F>=@D5 F?6EBCAB: :I.DDHG?IFI<HHDEG8I2ED;I HGHAF@I4D=?EHBIF?6EBCAIFG?I9ACB9H>DE6HI<FCA F?6EBCABI9AECAIDCI>C<9@HDECGIC7I HGHAF@I)?=>FDECGIAH=EAH<HGDB: 9CGI >C<9@HDECGI C7I F@@I HGHAF@I )?=>FDECGI AH=EAH<HGDB3I BD=?HGDI 7E@HBI FAH DAFGB7HAAH?I DCI D;HI <FCAI ?E6EBECGB:I 4D=?HGDBI 2EB;EG8I DCI HGDHAI D;HI &HF>;HA )?=>FDECGI AC8AF<I <=BDI ;F6HI FI :I 8AF?HI 9CEGDI F6HAF8HI FG?I <=BDI ;F6H 9FBBH?IF@@I9FADBIAHF?EG83I2AEDEG83IFG?I<FD;H<FDE>BIC7ID;HIAFEBI-I)F<EGFDECG: ,</>->56?6>46;5(?<5+?+>>,:->56<,?46*+;>4 4D=?HGDBI 2;CI 9@FGI DCI HGAC@@I FDI /CAAEBI (C@@H8HI <=BDI DF$HI D;HI .(& (C<9FBBI9@F>H<HGDIHF<EGFDECGI2;E>;IDHBDBIB$E@@BIEGI)G8@EB;3I<FD;H<FDE>B FG?IAHF?EG8:I#FBH?ICGID;HIAHB=@DBIC7ID;HIDHBDB3IBD=?HGDBI<F5I0HI9@F>H?IEG ?H6H@C9<HGDF@I>C=ABHB:I&;H5I<=BDIAH>HE6HIFI8AF?HIC7I(ICAIF0C6HIEGIHF>; ?H6H@C9<HGDF@I >C=ABHI EGI CA?HAI DCI 9AC>HH?I DCI D;HI GHDI ?H6H@C9<HGDF@I CA 8HGHAF@I H?=>FDECGI >C=ABHI EGI D;HI BH=HG>H:I (AH?EDI 7CAI ?H6H@C9<HGDF@ >C=ABHBI ?CHBI GCDI >C=GDI DC2FA?I 8AF?=FDECGI CAI D;HI "I ;C=ABI AH=EAH?I 7CA F>F?H<E>I;CGCAB:I'H6H@C9<HGDF@I>C=ABHBIFAHIFBI7C@@C2B ') I"+" ') I"+

'H6H@C9<HGDF@I)G8@EB;I'H6H@C9<HGDF@I)G8@EB;I-67


MORRIS COLLEGE CATALOG '/.I"+" '/.I"+ ','I"+" ','I"+

'H6H@C9<HGDF@I/FD;H<FDE>BI'H6H@C9<HGDF@I/FD;H<FDE>BI-'H6H@C9<HGDF@I,HF?EG8I'H6H@C9<HGDF@I,HF?EG8I--

:2>;(5?,<5(*<(> 4D=?HGDBI 2;CI ;F6HI B=>>HBB7=@@5I >C<9@HDH?I D2CI 5HFABI C7I AHG>;I CAI D2C 5HFABI C7I 49FGEB;I EGI ;E8;I B>;CC@I 2E@@I 0HI 9@F>H?I EGI D;HI 7EABDI EGDHA<H?EFDH AHG>;I>C=ABHICAID;HI7EABDIEGDHA<H?EFDHI49FGEB;I>C=ABH:I4D=?HGDBI2;CI;F6H @HBBI D;FGI D2CI 5HFABI C7I ;E8;I B>;CC@I AHG>;I CAI 49FGEB;I ;F6HI D;HI C9DECGI C7 DF$EG8IFIBDFG?FA?EH?I9@F>H<HGDIHF<EGFDECGIEGID;HIF99AC9AEFDHI@FG8=F8H: -7ID;H5I?CIGCDI2EB;IDCIDF$HID;HI9@F>H<HGDIHF<EGFDECG3ID;H5I2E@@I0HI9@F>H? EGI D;HI 7EABDI H@H<HGDFA5I AHG>;I >C=ABHI CAI D;HI 7EABDI H@H<HGDFA5I 49FGEB; >C=ABH:I)@H<HGDFA5I@FG8=F8HI>C=ABHBI<F5I0HI=BH?IFBIH@H>DE6HB: </<+>-;/?2:'<6;:5 4D=?HGDBI2;CIFAHIF?<EDDH?ICGIF>F?H<E>I9AC0FDECGI<F5IGCDIHGAC@@IEGII<CAH D;FGI "1I >AH?EDI ;C=ABI ?=AEG8I HF>;I C7I D;HI 7EABDI D2CI BH<HBDHABI C7I HGAC@@<HGD: &;HI BD=?HGDBI FG?I D;HEAI 9FAHGDBI <=BDI BE8GI FI >CGDAF>DI 2;E>;I BDE9=@FDHB F?;HAHG>HIDCIFIBDA=>D=AH?I9AC8AF<IC7IBD=?53IB>;H?=@H?ID=DCAEF@IBHBBECGBIFG? AH8=@FAI>@FBBIFDDHG?FG>H:I)F>;IBD=?HGD BI9AC8AHBBI2E@@I0HI<CGEDCAH?: </<+>-;/?<+;4>->56 .GIEGDHA?EB>E9@EGFA5I7F>=@D5I9AC6E?HIF>F?H<E>IF?6EBEG8IDCIBD=?HGDBIEGID;H 'E6EBECG:I )F>;I F?6EBCAI EBI FBBE8GH?I FI G=<0HAI C7I F?6EBHHBI 2;CI AH>HE6H FBBEBDFG>HI EGI AH8EBDHAEG8I EGI F99AC9AEFDHI 8HGHAF@I H?=>FDECGI >C=ABHBI FG? 2;CBHI F>F?H<E>I 9AC8AHBBI EBI <CGEDCAH?I DCI HGB=AHI >C<9@HDECGI C7I 8HGHAF@ H?=>FDECGIAH=EAH<HGDBI9AECAIDCIHEDEG8ID;HI'E6EBECGIC7I HGHAF@I4D=?EHB: '2< ,>46<2 4?</<+>-;/?4*//>44?/>56>2 &;HI#AF2@H54DFA$BI.>F?H<E>I4=>>HBBI(HGDHAIC77HABIBD=?HGDBIF>>HBBIDC >C<9=DHAI2CA$BDFDECGBIFG?ICAD;BDFAI'H6H@C9<HGDF@I)?=>FDECGIBC7D2FAH 9AC8AF<BI 8HFAH?I DC2FA?I E<9AC6EG8I D;HEAI B$E@@BI EGI )G8@EB;3I <FD;H<FDE>BI FG? AHF?EG8:I&;EBI7F>E@ED5IEBIF6FE@F0@HIDCIF@@IBD=?HGDB: :5:24?2:(2<&;HI 'E6EBECGI C7I HGHAF@I 4D=?EHBI ;C=BHBI D;HI /CAAEBI (C@@H8HI CGCAB AC8AF<:I &;EBI 9AC8AF<I 9AC6E?HBI FGI HG6EACG<HGDI >CG?=>E6HI DCI EGDH@@H>D=F@ BDE<=@FDECGI FG?I 8AC2D;I D;AC=8;I ;CGCABI BH<EGFABI FG?I >C>=AAE>=@FA H9HAEHG>HB:I (CGBEBDHGDI 2ED;I D;HI EGBDED=DECG BI 8CF@I C7I 9AC<CDEG8I D;H EGDH@@H>D=F@I FG?I 9HABCGF@I 8AC2D;I C7I F@@I BD=?HGDB3I D;HI CGCABI AC8AF<I EB ?HBE8GH?IDCIHG>C=AF8HI@HF?HAB;E93IDCI9AC<CDHI>AEDE>F@ID;EG$EG83IFG?IDCI<HHD D;HIGHH?BIC7IB>;C@FABI2;CIFAHIF>F?H<E>F@@5I>F9F0@H3IEGDH@@H>D=F@@5I>=AEC=B3 FG?I;E8;@5I<CDE6FDH?:I&;HI9AC8AF<IEBIE<9@H<HGDH?ID;AC=8;IB9H>EF@ICGCAB BH<EGFABI FG?I CD;HAI 9ACH>DBI FG?I F>DE6EDEHBI >CCA?EGFDH?I 05I D;HI 9AC8AF<

68


ACADEMIC DIVISIONS AND PROGRAMS ?EAH>DCA:I *1"+3I *I 1+3I *I %"+3I FG?I *I %+I FAHI AH=EAH?I7CAI F BD=?HGDIDCI8AF?=FDHIFBIFI<H<0HAIC7ID;HICGCABIAC8AF<: (>5>2<,?>+*/<6;:5?/*22;/*,*-?> ;';64 &;HI HGHAF@I )?=>FDECGI (=AAE>=@=<I );E0EDBI CGI D;HI 7C@@C2EG8I 9F8HI FAH 8HGHAE>I EGI GFD=AH3I FG?I F>D=F@I >C=ABHBI DF$HGI ?=AEG8I D;HI 7AHB;<FGI FG? BC9;C<CAHI 5HFABI <F5I 6FA5I B@E8;D@5I 7AC<I <FCAI DCI <FCA:I &;HI F>D=F@ >C=ABHBIDCI0HIDF$HGIFAHI?HDHA<EGH?I?=AEG8IF>F?H<E>IF?6EBH<HGD:I

69


MORRIS COLLEGE CATALOG (>5>2<,?>+*/<6;:5?/*22;/*,*5:54/;>5/>?62</ ,)4/.I )., ART BIO CIS ENG FRS MAT

101 100 101 103 100 103

Fall Semester Cr. Art Appreciation ......................... 2 Biological Sciences .................... 4 Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 College Algebra .......................... 3 15

Spring Semester Cr. Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Voice and Speech Improvement........................ 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 16 ENG FRS HIS SPH

104 102 106 103

4**/*,)I )., ENG 202 FRE 201 SPA HIS HSC REL

201 104 210 201

Fall Semester Cr. Introduction to Literature ........... 3 Intermediate French I ................. 3 or Intermediate Spanish I World History............................. 3 Health and Physical Education........... 3 Literature and Religion of the Old Testament ................ 3 15

Spring Semester Cr. ENG 205 African American Literature........ 3 FRE 202 Intermediate French II ................ 3 or SPA 202 Intermediate Spanish II REL 202 Literature and Religion of the New Testament .............. 3 PSY 201 General Psychology ................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 15

/*22;/*,*-?:2?6>?'</>,:2?:?4/;>5/>?+>(2>>

;6?<?-< :2?;5 ';:,:( FRESHMAN YEAR BIO 103 CIS 101 ENG 103 FRS 100 HIS 104 MAT 103

Fall Semester Cr. General Zoology ......................... 4 Introduction to Computers ......... 2 Fundamentals of Composition......................... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 16

BIO ENG HIS MAT SPH FRS

204 104 106 104 103 102

Spring Semester Cr. General Botany........................... 4 Research and Composition ........ 3 African American History ........... 3 Trigonometry ............................. 3 Voice and Speech Improvmt ...... 3 Freshman Seminar II.................. 1 17

SOPHOMORE YEAR ART 101 BIO 201 CHM ENG MUS REL

101 202 101 201

Fall Semester Cr. Art Appreciation ......................... 2 Vertebrate Developmental Biology ................................. 4 General Chemistry I.................... 4 Introduction to Literature ........... 3 Music Appreciation .................... 2 Literature and Religion of the Old Testament ...................... 3 18

BIO BIO CHM ENG REL

70

202 203 102 205 202

Spring Semester Cr. General Microbiology ................. 4 Research Methods .................... 4 General Chemistry II .................. 4 African American Literature........ 3 Literature and Religion of the New Testament .................... 3 18


ACADEMIC DIVISIONS AND PROGRAMS

6>?+;;4;:5?:?'*4;5>44?<+-;5;462<6;:5 4D=?HGDBI >C<9@HDEG8I D;HI >C=ABHI AH=EAH<HGDBI 7CAI <FCABI C77HAH?I 05I D;H 'E6EBECGI 2E@@I HFAGI FI #F>;H@CAI C7I 4>EHG>HI ?H8AHHI 2ED;I FI <FCAI EGI #=BEGHBB .?<EGEBDAFDECGICAI*A8FGEFDECGF@I/FGF8H<HGD:I&;HI<EBBECGIC7ID;HI'E6EBECG C7I#=BEGHBBI.?<EGEBDAFDECGIEBID;HI?H6H@C9<HGDIC7IEG?E6E?=F@IF0E@EDEHBIFG?ID;H ?H6H@C9<HGDI C7I <FA$HDF0@HI B$E@@BI GH>HBBFA5I DCI BH>=AHI H<9@C5<HGDI EG 0=BEGHBB3IEG?=BDA53I8C6HAG<HGD3IFG?ICD;HAIBH@H>DH?IFAHFB:I&;HI'E6EBECGIEB F2FAHI C7I BC>EHD5 BI GHH?I 7CAI 9HABCGBI EGI AHB9CGBE0@HI 9CBEDECGBI DCI ?EB9@F5 9AC7HBBECGF@3I<CAF@3IFG?IHD;E>F@I0H;F6ECA:I&;=B3ID;HI'E6EBECGIHG?HF6CABIDC 9AC6E?HI >C<9HDHGDI EGBDA=>DECG3I @HF?HAB;E93I FG?I 8=E?FG>HI DC2FA?I D;HBH HG?B: PROGRAM REQUIREMENTS '9)"=&3.?3?4)8=7)=?+=#.==?81"?9?-9 3.?87?'%087=00?<!$87801.91837 -GI F??EDECGI DCI D;HI "I ;C=ABI C7I HGHAF@I )?=>FDECGI AH=EAH<HGDB3I F@@ 0=BEGHBBIBD=?HGDBI>C<9@HDHI%I;C=ABIEGID;HI#=BEGHBBI.?<EGEBDAFDECGI<FCA3 BEI ;C=ABI C7I )>CGC<E>B3I CGHI ;C=AI C7I =GECAI 4H<EGFAI FG?I "I ;C=ABI C7 H@H>DE6HB: '9)"=&3.?3?4)8=7)=?+=#.==?81"?9?-9 3.?87?:.#978918379& -979#=$=71 -GI F??EDECGI DCI D;HI +I ;C=ABI C7I >AH?EDBI DAFGB7HAAH?3I F@@I BD=?HGDBI EGI D;H *A8FGEFDECGF@I /FGF8H<HGDI <FCAI >C<9@HDHI +I ;C=ABI C7I CA8FGEFDECGF@ <FGF8HI<HGDI>CAHIAH=EAH<HGDBIFG?ICGHI;C=AIC7I =GECAI4H<EGFA:I4D=?HGDB <F5I BH@H>DI FI <EGE<=<I C7I "1I ;C=ABI C7I F??EDECGF@I >C=ABHBI DCI >C<9@HDH ?H8AHHIAH=EAH<HGDB: 41%!=71?2=037088&81 4D=?HGDBI FAHI AHB9CGBE0@HI 7CAI $GC2EG8I FG?I >C<9@HDEG8I D;HEAI <FCA AH=EAH<HGDBIFBIBDFDH?IEGID;EBI>FDF@C8:I.?6EBCABI2E@@I9AC6E?HIH6HA5I9CBBE0@H FBBEBDFG>HIDCIHGF0@HIBD=?HGDBIDCI>C<9@HDHID;HEAIAH=EAH<HGDB: 6"=?: =)18=0?3?1"=?'%087=00?<!$87801.91837?$9 3.?9.=?90?3&&30 ":I &CI 9AC6E?HI H9HAEHG>HBI D;FDI 2E@@I FBBEBDI BD=?HGDBI EGI ?H6H@C9EG8I FG =G?HABDFG?EG8IC7ID;HI7AHHIHGDHA9AEBHIB5BDH<: :I &CI FBBEBDI BD=?HGDBI EGI ?H6H@C9EG8I FGI =G?HABDFG?EG8I C7I 0=BEGHBB 7=G>DECGB3IC9HAFDECGB3IDH>;GC@C853IFG?IEGDHAAH@FDECGB;E9B: 1:I&CI9AC6E?HIH9HAEHG>HBID;FDI2E@@IHGF0@HIBD=?HGDBIDCI0H>C<HIEGDH@@E8HGD >CGB=<HABIFG?IDCIHH>=DHID;HEAI9HABCGF@I0=BEGHBBIDAFGBF>DECGB: %:I &CI ?H6H@C9I EGI BD=?HGDBI D;HI @HF?HAB;E9I DAFEDBI D;FDI 2E@@I FBBEBDI D;H<I EG FBB=<EG8I AHB9CGBE0@HI 9CBEDECGBI EGI >C<<=GED5I 0HDDHA<HGD3I 0=BEGHBB3 EG?=BDA53I8C6HAG<HGD3IFG?IAH@FDH?IFAHFB: :I&CIAHEG7CA>HIFG?IHG>C=AF8HI>CGDEG=F@I?H6H@C9<HGDIC7I>C<I<=GEI>FDECG FG?I?H>EBECG<F$EG8IB$E@@B: :I&CI9AC6E?HIC99CAD=GEDEHBI7CAI>FAHHAIF2FAHGHBBIFG?IH9@CAFDECGBIEGID;H FAHFBIC7I0=BEGHBB3IEG?=BDA53I8C6HAG<HGD3IFG?IAH@FDH?IFAHFB: &;HI?H8AHHI9AC8AF<BIEGI#=BEGHBBI.?<EGEBDAFDECGIFG?I*A8FGEFDECGF@I/FGF8H<HGD FAHIF>>AH?EDH?I05ID;HI.>>AH?EDFDECGI(C=G>E@I7CAI#=BEGHBBI4>;CC@BIFG?IAC8AF<B:

71


MORRIS COLLEGE CATALOG !:I&CI9AC<CDHI>CGDEG=EG8IH?=>FDECGIEGI0=BEGHBB: '%087=00?<!$87801.91837?.3#.9$?,=9.787#?:%1)3$=0 AF?=FDHBI B=>>HBB7=@@5I >C<9@HDEG8I D;HI #=BEGHBBI .?<EGEBDAFDECGI ?H8AHH 9AC8AF<I2E@@ ": 'H<CGBDAFDHI FG?I F99@5I BE8GE7E>FGDI 7F>DB3I >CG>H9DB3I D;HCAEHB3 <HD;C?C@C8EHB3IFG?I$GC2@H?8HIEGID;HI>CAHI0=BEGHBBIFAHFB: : )9@FEGI D;HI 0=BEGHBBI FG?I <FGF8H<HGDI >CG>H9DBI 7AC<I FI 8@C0F@ 9HAB9H>DE6H: 1: (C<<=GE>FDHIFIAHF?F0@HIBH=HG>HIC7IAFDECGF@IE?HFBIH77H>DE6H@53I0CD; CAF@@5I 9AHBHGDFDECGI 0=E@?EG8I FG?I ?H@E6HA5I FG?I EGI 2AEDEG8I AH9CADB3I H <FE@B3IFG?I0=BEGHBBI>CAAHB9CG?HG>H: %: )<9@C5I 6FAEC=BI <HD;C?BI FG?I 9AC>HBBHBI 7AC<I ?E6HABHI FAHFBI C7 0=BEGHBBI DCI 7CA<=@FDHI FGF@5DE>F@ =FGDEDFDE6HI BC@=DECGBI DCI 0=BEGHBB 9AC0@H<B: : .99@5I >AEDE>F@I D;EG$EG8I B$E@@BI DCI 7CA<=@FDHI BC@=DECGBI DCI 9AC0@H<FDE> B>HGFAECBIFG?I>FBHBIEG6C@6EG8I?E6HABHIFAHFBIC7I0=BEGHBB: : -?HGDE75I D;HI F99AC9AEFDHI 0H;F6ECAF@I AHB9CGBHBI DCI H;E0EDI EGI 9HABCGF@3 BC>EF@3I FG?I 9AC7HBBECGF@I HG6EACG<HGDBI DCI 9AC<CDHI HD;E>F@I ?H>EBECG <F$EG8IFG?I>CA9CAFDHIBC>EF@IAHB9CGBE0E@ED5: !: AC?=>HI 0=BEGHBBI AH9CADBI D;FDI EG>CA9CAFDHI >AEDE=H?I ?C>=<HGDFDECG3 ?FDF0FBHIFGF@5BEB3IFG?IBDFDEBDE>F@@5IBC=G?IAHBHFA>;I<HD;C?C@C8EHB: : )BDF0@EB;I FG?I E<9AC6HI 9HABCGF@I FG?I 9AC7HBBECGF@I @HF?HAB;E9I FG? DHF<0=E@?EG8IB$E@@B: : )9@FEGI;C2I>CGDH<9CAFA5IH6HGDBIFG?IEBB=HBIFAHIF77H>DEG8ID;HI2CA@? C7I0=BEGHBB:

72


ACADEMIC DIVISIONS AND PROGRAMS REQUIREMENTS FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN BUSINESS ADMINISTRATION (=7=.9&?>!%)91837:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: '%087=00?<!$87801.91837?-9 3. :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: #4I1! #4I1+ #4I1 #4I1+ #4I1 #4I%++ #4I%+ #4I%"+ #4I% #4I%!+ #4I%! #4I%+ #4I%+ #4I% #4I%!

AEG>E9@HBIC7I/FGF8H<HGD:::::::::::::::::::::::::::: 1 AEG>E9@HBIC7I/FA$HDEG8::::::::::::::::::::::::::::::::: 1 EGFG>EF@I.>>C=GDEG8 :::::::::::::::::::::::::::::::::::: 1 #=BEGHBBI(C<<=GE>FDECG::::::::::::::::::::::::::::: 1 4DFDEBDE>B::::::::::::::::::::::::::::::::::::::::::::::::::::::: 1 #=BEGHBBIF2IFG?I)D;E>B ::::::::::::::::::::::::::::: 1 *9HAFDECGBI/FGF8H<HGD:::::::::::::::::::::::::::::: 1 /FGF8HAEF@I.>>C=GDEG8::::::::::::::::::::::::::::::::: 1 -GDHAGFDECGF@I#=BEGHBBI/FGF8H<HGD:::::::::::: 1 =<FGI,HBC=A>HI/FGF8H<HGD ::::::::::::::::::: 1 /FGF8HAEF@IEGFG>H:::::::::::::::::::::::::::::::::::::: 1 /FGF8H<HGDI-G7CA<FDECGI45BDH<B :::::::::::::: 1 *A8FGEFDECGF@I#H;F6ECA::::::::::::::::::::::::::::::: 1 #=BEGHBBIC@E>5 :::::::::::::::::::::::::::::::::::::::::::: 1 #=BEGHBBI,HBHFA>; :::::::::::::::::::::::::::::::::::::: 1

:1"=.?2=%8.=!?/3%.0=0 :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: )(*I1+" )(*I1+

,4 1++

/F>ACH>CGC<E>B :::::::::::::::::::::::::::::::::::::::::: 1 /E>AC>CGC<E>B ::::::::::::::::::::::::::::::::::::::::::::: 1

=GECAI4H<EGFA ::::::::::::::::::::::::::::::::::::::::::::: "

>&=)18=0 :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 6:6<, :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::

73


MORRIS COLLEGE CATALOG REQUIREMENTS FOR A MINOR IN BUSINESS ADMINISTRATION 4D=?HGDBI <FCAEG8I EGI CD;HAI ?EB>E9@EGHBI 2;CI 2FGDI DCI <EGCAI EGI #=BEGHBB .?<EGEBDAFDECGIFAHIAH=EAH?IDCI>C<9@HDHID;HI7C@@C2EG8I>C=ABHB #4I1! #4I1+ #4I1 #4I%++ #4I% #4I%!+

AEG>E9@HBIC7I/FGF8H<HGD:::::::::::::::::::::::::::: 1 AEG>E9@HBIC7I/FA$HDEG8::::::::::::::::::::::::::::::::: 1 EGFG>EF@I.>>C=GDEG8 :::::::::::::::::::::::::::::::::::: 1 #=BEGHBBIF2IFG?I)D;E>B ::::::::::::::::::::::::::::: 1 -GDHAGFDECGF@I#=BEGHBBI/FGF8H<HGD:::::::::::: 1 =<FGI,HBC=A>HI/FGF8H<HGD ::::::::::::::::::: 1

6:6<, ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: REQUIREMENTS FOR A MINOR IN BUSINESS INFORMATION TECHNOLOGY 4D=?HGDBI <FCAEG8I EGI CD;HAI ?EB>E9@EGHBI 2;CI 2FGDI DCI <EGCAI EGI #=BEGHBB -G7CA<FDECGI&H>;GC@C85IFAHIAH=EAH?IDCI>C<9@HDHID;HI7C@@C2EG8I>C=ABHB #4I1! #4I%+ #4I%!+ #4I%+ (-4I%%+ (-4I%+

AEG>E9@HBIC7I/FGF8H<HGD::::::::::::::::::::::::::::::::::1 *9HAFDECGBI/FGF8H<HGD:::::::::::::::: 1 =<FGI,HBC=A>HI/8D:::::::::::::::: 1 /FGF8H<HGDI-G7CI45BDH<B:::::::::::::::: 1 -G7CA<FDECGI,HBC=A>HI/FGF8H<HGD::::::::::1 &H>;I/FGF8H<HGDI&AHG?BIFG?I-BB=HB::::::::::1

6:6<, ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: REQUIREMENTS FOR A MINOR IN COMPUTER INFORMATION SYSTEMS 4D=?HGDBI <FCAEG8I EGI CD;HAI ?EB>E9@EGHBI 2;CI 2FGDI DCI <EGCAI EGI (C<9=DHA -G7CA<FDECGI45BDH<BIFAHIAH=EAH?IDCI>C<9@HDHID;HI7C@@C2EG8I>C=ABHB (-4I1++ (-4I1"+ (-4I1+ (-4I%++ (-4I%%+ (-4I%+

45BDH<BI.GF@5BEBIFG?I'HBE8G:::::::::::::::::::::: 1 -GDAC?=>DECGIDCI(C<9=DHAIAC8AF<<EG8 ::::::: 1 #=BEGHBBI&H@H>C<<=GE>FDECGB::::::::::::::::::::: 1 'FDF0FBHI'HBE8G:::::::::::::::::::::::::::::::::::::::::: 1 -G7CA<FDECGI,HBC=A>HI/FGF8H<HGD::::::::::::: 1 &H>;GC@C85I/FGF8H<HGDI&AHG?BIFG?I-BB=HB : 1

6:6<, :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::

74


ACADEMIC DIVISIONS AND PROGRAMS CURRICULUM FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN BUSINESS ADMINISTRATION ,)4/.I )., CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement........................ 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Principles of Sociology .............. 3 or GEO 201 World Regional Geography REL 201 Literature and Religion of the Old Testament ...................... 3 17 BIO ENG FRS HIS SOC

100 104 102 106 101

4**/*,)I )., Fall Semester Cr. ART 101 Art Appreciation ......................... 2 Minor Course/Elective ................................... 3 BUS 395 Statistics .................................... 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .............. 3 17

Spring Semester Cr. BUS 380 Principles of Marketing .............. 3 Minor Course/Elective ................................... 3 ENG 205 African American Literature........ 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation .................... 2 PSY 201 General Psychology ................... 3 17

-*,I )., Fall Semester Cr. BUS 375 Principles of Management.......... 3 BUS 385 Financial Accounting .................. 3 Minor Course/Elective ................................... 3 HSC 210 Health and Physical Education ............................. 3 ECO 301 Macroeconomics........................ 3 JRS 300 Junior Seminar........................... 1 16

BUS BUS BUS ECO PHS

390 405 410 302 100

Spring Semester Cr. Business Communications......... 3 Operations Management ............ 3 Managerial Accounting............... 3 Microeconomics ........................ 3 Physical Sciences....................... 4 16

4)-*,I )., Fall Semester Cr. BUS 465 International Business Management ........................ 3 BUS 470 Human Resource Management .. 3 BUS 475 Managerial Finance .................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

Spring Semester Cr. BUS 400 Business Law and Ethics............ 3 BUS 480 Management Information Systems ............................... 3 BUS 490 Organizational Behavior.............. 3 BUS 495 Business Policy .......................... 3 BUS 497 Business Research..................... 3 15

75


MORRIS COLLEGE CATALOG

Objectives for Organizational Management

â&#x20AC;˘ To provide non-traditional students with research skills necesVDU\IRUGHĂ&#x20AC;QLQJDQDO\]LQJV\QWKHVL]LQJDQGVROYLQJRUJDQL]DWLRQDO problems. â&#x20AC;˘ To provide non-traditional students with leadership skills, technological skills, oral and written communication skills, and research skills appropriate for professional settings. â&#x20AC;˘ To promote group learning as a vehicle for academic exchange, professional networking, and peer support.

Learning Outcomes for Organizational Management â&#x20AC;˘ Apply management principles and processes and leadership styles that enhance organizational effectiveness. â&#x20AC;˘ Use critical thinking skills and apply ethical principles to analyze domestic and global issues as they relate to wholesaling, retailing, and direct marketing in the global economy. Â&#x2021;'HPRQVWUDWHSURĂ&#x20AC;FLHQWXVHRIWHFKQRORJ\DQGHIIHFWLYHRUDOZULWWHQDQG nonverbal communication skills. â&#x20AC;˘ Conduct research that synthesizes key business concepts, utilizes quantiWDWLYHDQGRUTXDOLWDWLYHGDWDDQGLGHQWLĂ&#x20AC;HVVROXWLRQVWREXVLQHVVSUREOHPV

76


ACADEMIC DIVISIONS AND PROGRAMS REQUIREMENTS FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN ORGANIZATIONAL MANAGEMENT &;HI *A8FGEFDECGF@I /FGF8H<HGDI <FCAI EBI FI =GE=HI F@DHAGFDE6HI DCI D;H DAF?EDECGF@I ?H8AHHI 9AC8AF<:I -DI C77HABI 2CA$EG8I F?=@DBI 2;CI FAHI FDI @HFBDI  5HFABIC@?ID;HIC99CAD=GED5IDCIHFAGIFI0F>>F@F=AHFDHI?H8AHHIEGIFBIB;CADIFIDE<H FBIHE8;DHHGI<CGD;B:I&;HIF>D=F@IDE<HI2E@@I6FA5IF>>CA?EG8IDCID;HIG=<0HAIC7 >AH?EDBI 05I ?EB>E9@EGHI DAFGB7HAAH?:I (@FBBHBI <HHDI 7CAI 7C=AI ;C=AB3I FG?I <FG5 >@FBBHBI<HHDICG@5ICGHIH6HGEG8IHF>;I2HH$: /EGE<=<I>AH?EDBIDAFGB7HAAH?I7AC<I9AH6EC=BI>C@@H8HI2CA$ ::::::::::::::::::::::::::: &AFGB7HAI>AH?EDBIB;C=@?IEG>@=?H )G8@EB;I AF<<FAIFG?I(C<9CBEDECG ::::::::::::::::::::::::::::::::::::: 1 EDHAFD=AH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 1 49HH>; ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 1 FD=AF@I4>EHG>H ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: % (C@@H8HI.@8H0AF ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 1 (C<9=DHAI4>EHG>H (C<9=DHAI.99@E>FDECGB ::::::::::::::::::::::::::  4C>EF@ #H;F6ECAF@I4>EHG>HB:::::::::::::::::::::::::::::::::::::::::::::::::: " /FCAI(C=ABHB :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: *,/I1++ .?=@DI'H6H@C9<HGDIFG?I(FAHHA E7HI.BBHBB<HGD :::::::::::::::::::::::::::::::::::: 1 AC=9IFG?I*A8FGEFDECGF@I#H;F6ECA::::::::::::: 1 *,/I1+" *,/I1+1 *A8FGEFDECGF@I(C<<=GE>FDECG :::::::::::::::::::: 1 *,/I1+% /HD;C?BIC7I,HBHFA>;IFG?I.GF@5BEB:::::::::::::: 1 *,/I1+ ,HBHFA>;IACH>DI4H<EGFAI- ::::::::::::::::::::::::: " *,/I1+ -G7CA<FDECGI45BDH<BI/FGF8H<HGD :::::::::::::: 1 *,/I1+! /FGF8HAEF@I.>>C=GDEG8::::::::::::::::::::::::::::::::: 1 *,/I1" /FGF8HAEF@IEGFG>H:::::::::::::::::::::::::::::::::::::: 1 *,/I%++ =<FGEDEHBIC@EBDE>I.99ACF>; ::::::::::::::::::::: 1 *,/I%+" /FGF8HAEF@I)>CGC<E>B::::::::::::::::::::::::::::::::: 1 *,/I%+ /FGF8HAEF@I/FA$HDEG8::::::::::::::::::::::::::::::::::: 1 *,/I%+% /FGF8HAEF@IAEG>E9@HB::::::::::::::::::::::::::::::::::: 1 *,/I%+ #E0@E>F@IHAB9H>DE6HB :::::::::::::::::::::::::::::::::::: 1 *,/I%+ =<FGI,HBC=A>HI/FGF8H<HGD ::::::::::::::::::: 1 *,/I%+! 4DAFDH8E>I/FGF8H<HGDI :::::::::::::::::::::::::::::::: 1 *,/I%+ H8F@IFG?I)D;E>F@I-BB=HBIEGI/FGF8H<HGD :::: 1 *,/I%+ ,HBHFA>;IACH>DI4H<EGFAI-- :::::::::::::::::::::::: % *D;HAI,H=EAH?I(C=ABHB

,4I1++

=GECA4H<EGFA ::::::::::::::::::::::::::::::::::::::::::::: " )@H>DE6HB :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::+"1I;C=ABIFBIAH=EAH? 6:6<, :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::

77


MORRIS COLLEGE CATALOG CURRICULUM FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN ORGANIZATIONAL MANAGEMENT .I)&, †JRS 300 †ORM 300 †ORM 301 ORM 303 ORM 304 ORM 305

Fall Semester Cr. Junior Seminar I ........................ 1 Adult Development and Career Life Assessment........ 3 Group and Organizational Behavior ............................... 3 Organizational Communication.................... 3 Methods of Research and Analysis......................... 3 Research Project Seminar I........ 1 14

Spring Semester Cr. †ORM 306 Information Systems Management ........................ 3 †ORM 307 Managerial Accounting............... 3 ORM 400 Humanities ................................. 3 †ORM 402 Managerial Marketing................. 3 ORM 404 Managerial Principles................. 3 15 Summer Session Cr. †ORM 312 Managerial Finance .................... 3 ORM 401 Managerial Economics ............... 3 †ORM 405 Biblical Perspectives .................. 3 9

Fall Semester Cr. †ORM 406 Human Resource Management ........................ 3 †ORM 407 Strategic Management ............... 3 ORM 408 Legal and Ethical Issues in Management .................... 3 †ORM 409 Research Project Seminar II....... 4 13 Electives ..................................................................................................... 0-13 Hours as required

4,- I)&, Spring Semester Cr. †JRS 300 Junior Seminar........................... 1 †ORM 300 Adult Development and Career Life Assessment........ 3 †ORM 301 Group and Organizational Behavior ............................... 3 ORM 303 Organizational Communication .. 3 ORM 304 Methods of Research and Analysis..........................3 ORM 305 Research Project Seminar I........ 1 14

Summer Session Cr. †ORM 306 Information Systems Management ........................ 3 †ORM 307 Managerial Accounting............... 3 ORM 400 Humanities ................................. 3 9

Fall Semester Cr. Managerial Finance .................... 3 Managerial Economics ............... 3 Managerial Marketing................. 3 Managerial Principles................. 3 Biblical Perspectives .................. 3 15

Spring Semester Cr. ORM 406 Human Resource Management ........................ 3 ORM 407 Strategic Management ............... 3 ORM 408 Legal and Ethical Issues in Management .................... 3 ORM 409 Research Project Seminar II....... 4 13

ORM ORM ORM ORM †ORM

312 401 402 404 405

Electives ..................................................................................................... 0-13 Hours as required †Courses must be taken concurrently.

78


ACADEMIC DIVISIONS AND PROGRAMS

5/CD,< <0<A4DA'DC,+;75<A4 3CNO ,J;JGJKIO K?O :EBFLMJKIO K??NHGO ALKHGO JIO :LHD<O 8CJDECKKEO :EBFLMJKI7 :DNANIMLH<O :EBFLMJKI7O %NLDMCO 9FJNIFN7O O LIEO .NFHNLMJKIO 5EAJIJGMHLMJKI LIEO GNFKIELH<O NEBFLMJKIO G@NFJLDJLMJKIGO JIO 6JKDK><7O ALMCNALMJFG7 :I>DJGC7O LIEO GKFJLDO GMBEJNG=3CNO ,J;JGJKIO LDGKO LEAJIJGMNHGO MCHNNO G@NFJLD @HK>HLAGO*OMCNO5HA<O.NGNH;NO-??JFNHO3HLJIJI>O8KH@GO.-387O4CJFCOJG LO@HK?NGGJKILDO@HK>HLAOENGJ>INEOMKO@HKEBFNO?BMBHNOK??JFNHGO?KHOMCNO"IJMNE 9MLMNGO5HA<O(OMCNO8KK@NHLMJ;NO:EBFLMJKIO@HK>HLA7O4CJFCONIL6DNGOGMB2 ENIMGO MKO LFBJHNO 4KH&O N@NHJNIFNO 4CJDNO MCN<O LHNO GMJDDO JIO 8KDDN>NO LIEO 0 MCNO 8LDDO +NO +JGMNH O @HK>HLA7O 4CJFCO GNN&GO MKO LMMHLFMO AKHNO AJIKHJMJNGO LG MNLFCNHGO JIO MCNO GMLMN GO @B6DJFO NDNANIMLH<O GFCKKDG=O 3CNO ,J;JGJKIO K@NHLMNG 4JMCJIOMCNO?HLAN4KH&OK?OMCNOJIGMJMBMJKI GO@CJDKGK@C<OK?O@HN@LHJI>OGMBENIMG ?KHO@HK?NGGJKILDOGNH;JFNOJIOMCNO@B6DJFOGFCKKDG7OJIOCNLDMCOGFJNIFNOLIEOHNFHN2 LMJKIO@HK>HLAG7OLIEOJIOMCNOLHANEO?KHFNG=O AB@:**D,B6= 8D>$D9)BDC.12:9=>8D"@B:@:9=>8D"@>=.B@DC"" 3CNO:EBFLMJKIO)HN@LHLMJKIO)HK;JENHO:))OOJGOLEAJIJGMNHNEO4JMCJIOMCNO ,J;JGJKIO K?O :EBFLMJKI=O 3CNO BIJMO CLGO GJO @HK>HLAGO :LHD<O 8CJDECKKEO :EBFL2 MJKI7O:DNANIMLH<O:EBFLMJKI7OJKDK><9NFKIELH<O:EBFLMJKI7O:I>DJGC9NFKIELH<O :EBFLMJKI7O+LMCNALMJFG9NFKIELH<O:EBFLMJKI7OLIEO9KFJLDO9MBEJNG9NFKIELH< :EBFLMJKI=O 8LIEJELMNGO @HN@LHJI>O MKO MNLFCO KIO MCNO GNFKIELH<O DN;NDO LHN ALKHGO JIO MCNJHO FCKGNIO EJGFJ@DJING=O 3CN<O ABGM7O CK4N;NH7O NIHKDDO JIO MCN 3NLFCNHO :EBFLMJKIO )HK>HLA=O 3CNO @HK>HLAO K?O JIGMHBFMJKIO ?KHO LDDO MNLFCNH NEBFLMJKIOALKHGOFKIGJGMGOK?O?KBHOALJIOGN>ANIMGO>NINHLDONEBFLMJKI7O@HK2 ?NGGJKILDONEBFLMJKI7OMCNOG@NFJLDJNEOHNBJHNANIMGOK?OMCNOALKHOLHNL7OLIE NDNFMJ;NG= 5)BD;:8.=.:9BD"@>$=2=B82=B6 3CNO:))OCLGOJENIMJ?JNEO?KBHOFKA@KINIMGOK?OMCNO8KIFN@MBLDOHLAN4KH& 8KA@NMNIM7O 8HJMJFLDO 3CJI&NH7O .N?DNFMJ;NO )HLFMJMJKINH7O LIEO 8LHJI>O LIE M4NIM<O @HK?JFJNIFJNGO MCLMO ABGMO 6NO ENAKIGMHLMNEO 6<O LDDO FLIEJELMNG=O 3CNGN @HK?JFJNIFJNGO LHNO LDJ>INEO 4JMCO MCNO JIGMJMBMJKILDO GMLIELHEG7O MCNO BIJMG FKIFN@MBLDO?HLAN4KH&7OMCNOGMLMN GOMNIO5,:)3O5GGJGMJI>7O,N;NDK@JI>7 LIEO :;LDBLMJI>O )HK?NGGJKILDO 3NLFCJI>O )NH?KHALIFNO 9MLIELHEGO MCN 8KBIFJDO ?KHO 5FFHNEJMLMJKIO K?O 3NLFCNHO )HN@LHLMJKIO GMLIELHEGO 85:)7 LGO 4NDDO LGO MCNO GMLIELHEGO K?O G@NFJLDJNEO LGGKFJLMJKIGO ?KHO 4CJFCO MCNO BIJM CLGO @HK>HLAGO $LMJKILDO 8KBIFJDO ?KHO MCNO 9KFJLDO 9MBEJNGO $899O $LMJKILD 8KBIFJDOK?O3NLFCNHGOK?O:I>DJGCO$83:O$LMJKILDO8KBIFJDOK?O3NLFCNHG K?O +LMCNALMJFGO $83+O MCNO $LMJKILDO 9FJNIFNO 3NLFCNHGO 5GGKFJLMJKI $935O LIEO MCNO $LMJKILDO 5GGKFJLMJKIO ?KHO MCNO :EBFLMJKIO K?O KBI> O 8CJDEHNI $5:8=O O 3CNO O LDJ>IANIMO O JIFDBENGO O MCNO O @HJIFJ@DNGO O K?O MCN O /IMNHGMLMNO $N4 3NLFCNHO5GGNGGANIMOLIEO9B@@KHMO8KIGKHMJBAO/$3598= 5FBJGJMJKIOK?OMCNGNO@HK?JFJNIFJNGO4JDDONIGBHNOMCLMOLDDOBIJMOFKA@DNMNHGO4JDD @KGGNGGO MCNO &IK4DNE>N7O G&JDDG7O LIEO EJG@KGJMJKIGO HNBJHNEO MKO 6NFKAN MNLFCNHGO 4CKO LHNO 8KA@NMNIM7O 8HJMJFLDO 3CJI&NHG7O .N?DNFMJ;NO )HLFMJMJKINHG7 LIEO8LHJI>=O+KHNK;NH7OMCNOFLIEJELMNGO4JDDO6NO@HN@LHNEOMKO?LFJDJMLMNODNLHI2 JI>O MCLMO 4JDDO CL;NO LO @KGJMJ;NO JA@LFMO KIO )2*(O GMBENIMO LFCJN;NANIM=O 3CN @HK?JFJNIFJNGOLHNOLDJ>INEO4JMCOMCNOBIJM GOFKIFN@MBLDO?HLAN4KH&= 79


MORRIS COLLEGE CATALOG +KHHJGO 8KDDN>NO CLGO JA@DNANIMNEO >HLENO G@LIO ENGJ>ILMJKIGO 4CJFCO LHN L@@HK;NEO6<OMCNO9KBMCO8LHKDJILO9MLMNOKLHEOK?O:EBFLMJKIOJIOMCNO@HN@LHL2 MJKIOK?OMNLFCJI>OALKHG=O3CNO>HLENOG@LIOENGJ>ILMJKIGOLHNOLGO?KDDK4G L= :LHD<O8CJDECKKE 6= :DNANIMLH<O:EBFLMJKI F= 9NFKIELH<O

)HN2JIENH>LHMNI2!HLENO0 !HLENGO(2 !HLENGO2*(

C:@*D;)=*.)>>.DC.12:9=>8D3:>@ 9MBENIMGO JIMNHNGMNEO JIO MNLFCJI>O @HN2&JIENH>LHMNIO MCHKB>CO MCJHEO >HLEN GCKBDEO ENFDLHNO LO ALKHO JIO :LHD<O 8CJDECKKEO :EBFLMJKI=O :LHD<O 8CJDECKKE :EBFLMJKIOALKHGOGCKBDEOFKA@DNMNOMCNO>NINHLDONEBFLMJKIO@HK>HLA7OALKH GB6NFMO ALMMNHO HNBJHNANIMG7O @HK?NGGJKILDO NEBFLMJKIO FKBHGNGO LIEO LDDO HNO2 BJHNOANIMGO?KHOFNHMJ?JFLMJKI=O3CNOK6NFMJ;NGOK?OMCNO:LHD<O8CJDECKKEO:EBFL2 MJKIOALKHOLHNOENGJ>INEOMKO@HKEBFNON??NFMJ;NOMNLFCNHGO4CKOLHNOL6DN *= MKO EN;NDK@O LIO BIENHGMLIEJI>O K?O LIEO LIO L@@HNFJLMJKIO ?KHO 6KMCO MCN ?BIFMJKIOLIEOMCNO6NLBM<OK?ODLI>BL>NOLIEOCK4OJMOEN;NDK@G= (= MKO 6BJDEO MCNO ?KBIELMJKIGO K?O ALMCNALMJFGO BIENHGMLIEJI>O MKO JIFDBEN FKBIMJI>7O HNFK>IJMJKIO K?O IBANHLDG7O @HK6DNAO GKD;JI>7O LIEO HNLGKIJI>7 BGJI>OALIJ@BDLMJ;NGOLIEOMNFCIKDK><= 0= MKOEN;NDK@OLIOBIENHGMLIEJI>OK?OLIEOLIOL@@HNFJLMJKIO?KHOMCNO;LHJKBG LHNLGOK?OGFJNIFN7OMKOJIFDBENODJ?NOGFJNIFN7ONLHMCOGFJNIFNOLIEO@C<GJFLD GFJNIFNOLIEOMKONIFKBHL>NOLOG@JHJMOK?OJIBJH<= '= MKO CND@O GMBENIMGO BIENHGMLIEO 4CKO MCN<O LHNO LIEO CK4O MCN<O HNDLMNO MK ?LAJD<7OGFCKKD7OFKAABIJM<7OLIEOMCNODLH>NHOGKFJNM<OCK4OMCNO@LGM7OMCN @HNGNIM7O LIEO MCNO ?BMBHNO LHNO JIMNHFKIINFMNEO LIEO CK4O FBDMBHNGO LHN GJAJDLHOLIEOEJ??NHNIM= = MKOEN;NDK@OLIOBIENHGMLIEJI>OK?OMCNOJA@KHMLIFNOK?O@NHGKILDOC<>JNIN7 CNLDMC7OLIEO@C<GJFLDO?JMINGGOLIEOMKO@HKAKMNO>KKEOCNLDMCOCL6JMGOLIE L@@HK@HJLMNO@C<GJFLDOLFMJ;JM<= = MKO6BJDEOLO?KBIELMJKIO?KHOBIENHGMLIEJI>7OL@@HNFJLMJI>7OLIEO@LHMJFJ@LM2 JI>OJIOMCNO;JGBLDOLIEO@NH?KHAJI>OLHMG= C*B&B89:@DC.12:9=>8D3:>@ 9MBENIMGO 4CKO @DLIO MKO 6NFKANO NDNANIMLH<O MNLFCNHGO GCKBDEO ENFDLHNO L ALKHOJIO:DNANIMLH<O:EBFLMJKIOLIEOABGMOFKA@DNMNOMCNO>NINHLDONEBFLMJKI @HK>HLA7O@HK?NGGJKILDOFKBHGNG7OLIEOLEEJMJKILDOGB6NFMOALMMNHO@HN@LHLMJKI LGOHNBJHNEO?KHOFNHMJ?JFLMJKI=O 3CNO NDNANIMLH<O NEBFLMJKIO @HK>HLAO @DLFNGO NA@CLGJGO KIO MCNO EN;NDK@O2 ANIMO K?O G&JDDGO LIEO MCNJHO L@@DJFLMJKIO MKO MCNO FKIMNIMO LHNLO JIO @HK>HLAGO ?KH >HLENGO M4KO MCHKB>CO GJ=O 3CNO K6NFMJ;NGO K?O MCNO :DNANIMLH<O :EBFLMJKI ALKHOLHNOLGO?KDDK4G *= 3KOEN;NDK@OLIOBIENHGMLIEJI>OK?OMCNOJI?DBNIFNOK?OFKAABIJFLMJKIOKI JIEJ;JEBLDO EN;NDK@ANIM7O LIEO LIO BIENHGMLIEJI>O K?O MCNO @HKFNGGNG JI;KD;NEOJIODNLHIJI>OMKODJGMNI7OG@NL&7OHNLE7OLIEO4HJMNOMCNO:I>DJGCODLI2 >BL>NOFDNLHD<OLIEON??NFMJ;ND<= (= 3KO EN;NDK@O LIO BIENHGMLIEJI>O K?O MCNO DLI>BL>NO K?O ALMCNALMJFG7 ALMCNALMJFLDOG&JDDG7OLIEO@HK6DNAOGKD;JI>OG&JDDG= 0= 3KO@HK;JENOLIOBIENHGMLIEJI>OK?OMCNOGFK@N7OFKIMNIM7OG&JDDGOLIEOANMC2 KEGOK?OGKFJLDOGMBEJNG= 80


ACADEMIC DIVISIONS AND PROGRAMS '= 3KO@HK;JENOLIOL@@HK@HJLMNO@HK>HLAO?KHOGFJNIFN7OCNLDMC7O@C<GJFLDOLIE GL?NM<OINNEGOK?OFCJDEHNI= = 3KO@HK;JENOGMBE<OJIOMCNO?JINOLHMGOGKOMCLMOMCNOMNLFCNHOAL<OEN;NDK@OMCN G&JDDGOINNENEOMKO4KH&OFHNLMJ;ND<O4JMCOFCJDEHNIOJIOMCNOLNGMCNMJFON@NHJ2 NIFNGOJIOABGJF7O;JGBLDOLHMG7OEHLALMJFGOLIEOFHNLMJ;NOELIFN= = 3KO@HK;JENO?KHOMCNOGMBE<OK?OCBALIO>HK4MCOK?O<KBI>O@B@JDGOJIOMCNONDN2 ANIMLH<O>HLENGO4JMCOEJ;NHGNO6LF&>HKBIEG= = 3KO@HK;JENO?KHOGMBE<OK?O@HJIFJ@DNGOK?ODNLHIJI>OLIEOMCNODNLHIJI>ONI;J2 HKIANIMO?KHONDNANIMLH<OFCJDEHNI= 091.B89D-B:@8=8 DA192>&B6D$>@DC:@*D;)=*.)>>.DC.12:9=>8 *=O ,NAKIGMHLMNO &IK4DNE>NO K?O GMBENIMGO LGO EJ;NHGNO DNLHINHGO JIFDBEJI> NFN@MJKILDJMJNG7O DNLHIJI>O GM<DNG7O JIMNDDJ>NIFNG7O GNFKIEO DLI>BL>N LFBJGJMJKIOLIEOMCNOJI?DBNIFNOK?O@HJKHODNLHIJI>ON@NHJNIFNG7OLGO4NDDOLG &IK4DNE>NOK?OMCNODN>JGDLMJKIO>K;NHIJI>OGMBENIMG= (=O5@@D<OMCNOMCNKHNMJFLDO?KBIELMJKIGOK?OCBALIOEN;NDK@ANIM7OCBALIOAKMJ2 ;LMJKIO LIEO CBALIO 6NCL;JKHO JIO MCNO DNLHIJI>O NI;JHKIANIMO MKO GB@@KHM EN;NDK@ANIMLDD<OL@@HK@HJLMNODNLHIJI>= 0=O"GJI>O&IK4DNE>NOK?OMCNO?KBIELMJKIGOK?ODNLHIJI>OLIEOCBALIOEN;NDK@2 ANIM7ONI>L>NOJIODNLHIJI>OLFMJ;JMJNGOMCLMOMNLFCOLBMKIKA<OLIEOJIJMJLMJ;N7 MCNHN6<O @HK;JEJI>O N??NFMJ;NO FDLGGHKKAO ALIL>NANIMO LIEO GMHLMN>JNG MCLMO4JDDO@HKAKMNO@BH@KGN?BDODNLHIJI>= '=O :A@DK<O ALKHO @C<GJFLD7O GKFJLD7O NAKMJKILD7O LIEO FK>IJMJ;NO @HKFNGGNG LGGKFJLMNEO4JMCOFCJDEOEN;NDK@ANIMOMKO@HK;JENOLO4JENOHLI>NOK?OL@@HK2 @HJLMNOJIGMHBFMJKILDOGMHLMN>JNG7OLGO4NDDOLGOLGGNGGANIMOGMHLMN>JNG7OBGJI> LDDOL;LJDL6DNOHNGKBHFNGOMKONICLIFNOGMBENIMODNLHIJI>=O =O 5HMJFBDLMNO MCNO GMN@GO JIO @DLIIJI>O LDDO @CLGNGO K?O MCNO DNLHIJI>O @HKFNGG7 BGJI>OILMJKILD7OGMLMNOLIEODKFLDOGMLIELHEGOMKOJIGBHNOMCLMOEN;NDK@ANIMLD L@@HK@HJLMNINGGOJIOLDDON@NHJNIFNGOJGOALJIMLJINE= =O ,NAKIGMHLMNO L@@DJFLMJKIO LIEO JIMN>HLMJKIO K?O N??NFMJ;NO FKAABIJFLMJKI MNFCIJBNGO6KMCO;NH6LDOLIEOIKI;NH6LDO4JMCOGMBENIMGOLIEO@LHNIMG= =O /A@DNANIMO LO @NHGKILDO >HK4MCO @DLIO MKO JIFKH@KHLMNO @HK?NGGJKILDO EN;ND2 K@ANIMO LIEO BGL>NO K?O FKAABIJM<O HNGKBHFNGO MKO NICLIFNO MCNO DNLHIJI> @HKFNGGO?KHOMCNAGND;NG7OMCNOGMBENIMG7OMCNO@LHNIMG7OLIEOMCNOFKAABIJM< LGOLO4CKDN= =O/IMNH@HNMOLDDOALKHODL4GOHNDLMNEOMKOGMBENIMG OHJ>CMGOLIEOMNLFCNHOHNG@KI2 GJ6JDJMJNGOMKOANNMOMCNOINNEGOK?OLDDOGMBENIMG= 091.B89D-B:@8=8 DA192>&B6D$>@DC*B&B89:@DC.12:9=>8D *=O ,NAKIGMHLMNO &IK4DNE>NO K?O GMBENIMGO LGO EJ;NHGNO DNLHINHGO JIFDBEJI> NFN@MJKILDJMJNG7O DNLHIJI>O GM<DNG7O JIMNDDJ>NIFNG7O GNFKIEO DLI>BL>N LFBJGJMJKIOLIEOMCNOJI?DBNIFNOK?O@HJKHODNLHIJI>ON@NHJNIFNG7OLGO4NDDOLG &IK4DNE>NOK?OMCNODN>JGDLMJKIO>K;NHIJI>OMCNGNOGMBENIMG= (=O5@@D<OMCNOMCNKHNMJFLDO?KBIELMJKIGOK?OCBALIOEN;NDK@ANIM7OCBALIOAKMJ2 ;LMJKIO LIEO CBALIO 6NCL;JKHO JIO MCNO DNLHIJI>O NI;JHKIANIMO MKO GB@@KHM JIEJ;JEBLDOLIEO>HKB@O4KH&OJIOMCNOFDLGGHKKA= 0=O"GJI>O&IK4DNE>NOK?OMCNO?KBIELMJKIGOK?ODNLHIJI>OLIEOCBALIOEN;NDK@2 ANIM7ONI>L>NOJIODNLHIJI>OLFMJ;JMJNGOMCLMOMNLFCOGND?2AKMJ;LMJKI7OMCNHN6< @HK;JEJI>O N??NFMJ;NO FDLGGHKKAO ALIL>NANIMO LIEO GMHLMN>JNGO MCLMO 4JDD @HKAKMNO@BH@KGN?BDODNLHIJI>= 81


MORRIS COLLEGE CATALOG '=O:A@DK<OALKHOFK>IJMJ;NO@HKFNGGNGOLGGKFJLMNEO4JMCOGMBENIMODNLHIJI>OMK @HK;JENOLO4JENOHLI>NOK?OL@@HK@HJLMNOJIGMHBFMJKILDOGMHLMN>JNG7OLGO4NDDOLG LGGNGGANIMOGMHLMN>JNG7OBGJI>OLDDOL;LJDL6DNOHNGKBHFNGOMKONICLIFNOGMB2 ENIMODNLHIJI>=O =O 5HMJFBDLMNO MCNO GMN@GO JIO @DLIIJI>O LDDO @CLGNGO K?O MCNO DNLHIJI>O @HKFNGG7 BGJI>O ILMJKILD7O GMLMNO LIEO DKFLDO GMLIELHEGO MKO JIGBHNO MCLMO N??NFMJ;N 6HJE>NGO6NM4NNIO>KLDGOLIEOGMBENIMG ON@NHJNIFNGOLHNOALJIMLJINE= =O ,NAKIGMHLMNO L@@DJFLMJKIO LIEO JIMN>HLMJKIO K?O N??NFMJ;NO FKAABIJFLMJKI MNFCIJBNGO6KMCO;NH6LDOLIEOIKI;NH6LD= =O /A@DNANIMO LO @NHGKILDO @DLIO MKO JIFKH@KHLMNO @HK?NGGJKILDO EN;NDK@ANIM LIEO BGL>NO K?O FKAABIJM<O HNGKBHFNGO MKO NICLIFNO MCNO DNLHIJI>O @HKFNGG ?KHO MCNAGND;NG7O MCNO GMBENIMG7O MCNO @LHNIMG7O LIEO MCNO FKAABIJM<O LGO L 4CKDN= =O/IMNH@HNMOLDDOALKHODL4GOHNDLMNEOMKOGMBENIMG OHJ>CMGOLIEOMNLFCNHOHNG@KI2 GJ6JDJMJNGOMKOANNMOMCNOINNEGOK?OLDDOGMBENIMG= ;@=9B@=:D$>@D7.&=66=>8D9>D9)BD5B:2)B@DC.12:9=>8D"@> @:& )HN2FLIEJELMNGO4CKOENGJHNOMKONIMNHOMCNOMNLFCJI>O@HK?NGGJKIOLHNOMKOML&N )HLJGO8KHNOIKODLMNHOMCLIOMCNONIEOK?OMCNOGK@CKAKHNO<NLH=O5@@DJFLMJKIO?KH O?KHALDOLEAJGGJKIOMK MCNO3NLFCNHO:EBFLMJKIO)HK>HLAOJGOFKA@DNMNEOKIFNOLDD OFHJMNHJLOLHNOANMO L= O@LGGJI>OGFKHNGOKIOLDDO@LHMGOK?O)HLJGO8KHNO583OGFKHNOK?O('OKHO953OGFKHNO K?O* 1OAL<O6NOGB6GMJMBMNE= 6= FKA@DNMJKIOK?OGJM<O1OCKBHGOK?OFKDDN>NOFHNEJM F= LO>HLENO@KJIMOL;NHL>NOK?O(= OKIOLO'=1OGFLDNO E= FKA@DNMJKIO K?O :,"O (11O /IMHKEBFMJKIO MKO :EBFLMJKI7O 4JMCO LO >HLENO K? 8 OKHO6NMMNH N= ENAKIGMHLMNEO@NHGKILDOLIEOGKFJLDO?JMINGGOLGON;JENIFNEOMCHKB>COMCN -??JFNOK?O9MBENIMO5??LJHGOO ?= ENAKIGMHLMNEO@C<GJFLDOLIEOANIMLDO4NDDINGGO?KHOMCNOMLG&GOMKO6NO@NH2 ?KHANEOIKON;JENIFNOMKOMCNOFKIMHLH< >= LO 4KHE2@HKFNGGNEO KIN2@L>NO NGGL<O N@DLJIJI>O 4C<O <KBO 6NDJN;NO <KB 4JDDO 6NFKANO LIO N??NFMJ;NO MNLFCNH7O GB6AJMMNEO M4KO 4NN&GO 6N?KHNO MCN 5EAJGGJKIG2MK23NLFCNH2:EBFLMJKIO/IMNH;JN4 C= LO 4KHE2@HKFNGGNEO @CJDKGK@C<O K?O NEBFLMJKI7O 4HJMMNIO JIO MCJHEO @NHGKI7 GB6AJMMNEO M4KO 4NN&GO 6N?KHNO MCNO 5EAJGGJKI2MK23NLFCNH2:EBFLMJKI /IMNH;JN4 J= GB6AJGGJKIOK?O?LFBDM<OHNFKAANIELMJKIO?KHAGO?HKAOM4KO?LFBDM<OANA2 6NHGO KINO *O ?HKAO >NINHLDO GMBEJNGO LIEO KINO *O ?HKAO MCNO 3NLFCNH :EBFLMJKIO"IJM = @HNGNIMLMJKIO K?O MCNO @HN2@HK?NGGJKILDO @KHM?KDJK7O HNFNJ;NO LIO LFFN@M2 L6DN O HLMJI>O KIO MCNO @KHM?KDJKO ?HKAO MCNO 3NLFCNHO :EBFLMJKIO .N;JN4 8KAAJMMNNO GB6AJMO MCNO @HN2@HK?NGGJKILDO @KHM?KDJKO MKO MCNO ,JHNFMKHO K? 3NLFCNHO:EBFLMJKIOM4KO4NN&GO6N?KHNOMCNOGFCNEBDNEOJIMNH;JN4= &= FKA@DNMJKIO K?O LO GBFFNGG?BDO 5EAJGGJKI2MK23NLFCNH2:EBFLMJKIO /IMNH2 ;JN47O LO HLMJI>O O K?O O LFFN@ML6DN O 4JMCO MCNO 3NLFCNHO :EBFLMJKIO .N;JN4 8KAAJMMNNOLIEO D= LODNMMNHOK?OL@@HK;LDO?HKAOMCNO,JHNFMKHOK?O3NLFCNHO:EBFLMJKI= )HN2FLIEJELMNGOFL@L6DNOK?OGKBIEOGFCKDLHGCJ@OLIEO@KGGNGGJI>OMCNOFCLH2 LFMNHJGMJFGOINFNGGLH<OMKO4KH&O4NDDO4JMCOKMCNHGOLHNONIFKBHL>NEOMKOL@@D<O?KH 82


ACADEMIC DIVISIONS AND PROGRAMS LEAJGGJKIO MKO MCNO 3NLFCNHO :EBFLMJKIO )HK>HLA=O 5DDO JIMNHNGMNEO @HN2FLIEJ2 ELMNGOLHNO4NDFKANOMKOL@@D<O?KHOLEAJGGJKIOMKOMCJGO@HK>HLA7O6BMOKID<OMCKGN FLIEJELMNGO 4CKO ALJIMLJIO GLMJG?LFMKH<O @NH?KHALIFNO 4JDDO 6NO @NHAJMMNEO MK HNALJIOJIOJM= 3B&B@6)=D:8.D":@9=2=:9=>8D=8D:D"@>$B66=>8:*DA@ :8=:9=>8 )HKG@NFMJ;NOMNLFCNHGOLHNOHNBJHNEOMKO6NFKANOLFMJ;NOANA6NHGOK?OLOHNF2 K>IJNEO@HK?NGGJKILDOLGGKFJLMJKIOLMOMCNODKFLD7OGMLMN7OKHOILMJKILDODN;ND=O3CN 5GGKFJLMJKIO ?KHO 8CJDECKKEO :EBFLMJKIO /IMNHILMJKILDO 58:/7O MCNO 9MBENIM2 9KBMCO 8LHKDJILO :EBFLMJKIO 5GGKFJLMJKIO 3CNO 9298:57O LIEO MCNO )LDANMMK 9MLMNO3NLFCNHGO5GGKFJLMJKIO)9357OMCNO$LMJKILDO8KBIFJDOK?O9KFJLDO9MBE2 JNGO $8997O MCNO $LMJKILDO 8KBIFJDO ?KHO 3NLFCNHGO K?O :I>DJGCO $83:7O MCN 9KBMCO 8LHKDJILO 9FJNIFNO 8KBIFJDO 98(7O LIEO MCNO $LMJKILDO 5GGKFJLMJKIO ?KH MCNO:EBFLMJKIOK?OKBI>8CJDEHNIO$5:8OLHNONLA@DNGOK?OGBFCOLGGKFJL2 MJKIG=O 3NLFCNHO NEBFLMJKIO GMBENIMGO NIHKDDNEO JIO ALKHO LIEO @HK?NGGJKILD NEBFLMJKIOFKBHGNGOMCLMOHNBJHNOLO?JNDEON@NHJNIFNOABGMOKJIOLO@HK?NGGJKILD KH>LIJLMJKI=O3CNO?NNOMKOKJIOLO@HK?NGGJKILDOKH>LIJLMJKIO6NFKANGOLO@LHM K?OMCNOGMBENIM GOMBJMJKIOLIEO?NNG= '=B*.DC B@=B82B6 3KONIGBHNOMCLMOFLIEJELMNGOCL;NOK@@KHMBIJMJNGO?KHO@HLFMJFLDON@NHJNIFNG LGOMCN<OEN;NDK@OJIMKOMNLFCNHGO4CKOLHNOFKA@NMNIM7OFHJMJFLDOMCJI&NHG7OHN?DNF2 MJ;NO @HLFMJMJKINHG7O LIEO FLHJI>7O MCNO MNLFCNHO NEBFLMJKIO @HK>HLAO HNBJHNGO L AJIJABAOK?O*11OCKBHGOK?O?JNDEON@NHJNIFNGO@HJKHOMKOJIMNHIGCJ@=O8LIEJELMNG LHNO MKO FKA@DNMNO MCNJHO @HN2EJHNFMNEO MNLFCJI>O @HLFMJFBAO CKBHGO EBHJI>O MCN ?KDDK4JI>O ?KBHO ?JNDEO N@NHJNIFNGO 3<@NO /O )HLFMJFBAO -6GNH;LMJKIO * CKBHGO 3<@NO //O )HLFMJFBAO 9MHLMN>JNGO LIEO 5FMJ;JMJNGO * O CKBHGOLIE 3<@NO ///O )HLFMJFBA +NMCKEGOLIEO+LMNHJLDGO*12(1OCKBHG=O 3CNOEJHNFMNEOMNLFCJI>OJIMNHIGCJ@OJGOMCNO3<@NOO)HLFMJFBAO-6GNH;LMJKI LIEO ,JHNFMNEO 3NLFCJI>O /IMNHIGCJ@=O 8LIEJELMNGO G@NIEO LO AJIJABAO K?O '1 CKBHGOJIOLO@B6DJFOFDLGGHKKAOGNMMJI>OBIENHOMCNOGB@NH;JGJKIOK?OLOFKK@NHLM2 JI>OMNLFCNH=O3HLIG@KHMLMJKIO?KHOLDDO?JNDEON@NHJNIFNGOJGOMCNOHNG@KIGJ6JDJM<OK? MCNOMNLFCNHONEBFLMJKIO@HN2FLIEJELMN= ;@=9B@=:D$>@D7.&=66=>8D9>D9)BDA6B@:9=>8D:8.D,=@B29B.D5B:2)=8 <89B@86)= )HN@LHLMJKIOJIOMCNO3<@NO/O)HLFMJFBAO-6GNH;LMJKIOLIEO,JHNFMNEO3NLFC2 JI>O /IMNHIGCJ@O KFFBHGO L?MNHO FLIEJELMNGO CL;NO FKA@DNMNEO LDDO MCNJHO FKBHGN HNBJHNANIMGO 4JMCO LO >HLENO @KJIMO L;NHL>NO K?O (= 1O KHO 6NMMNH7O CL;NO @LGGNE LDDO K?O MCNO )HLJGO //O :LAJILMJKIGO MKO JIFDBENO )HJIFJ@DNGO K?O #NLHIJI>O LIE 3NLFCJI>7O LIEO CL;NO HNFNJ;NEO LMO DNLGMO LIO LFFN@ML6DN O HLMJI>O ?HKAO MCN 3NLFCNHO :EBFLMJKIO .N;JN4O 8KAAJMMNNO KIO MCNJHO @HN2EJHNFMNEO MNLFCJI> @KHM?KDJKOLIEOJIMNH;JN4=O 3CNOEJHNFMNEOMNLFCJI>OJIMNHIGCJ@OJGOMCNO@LHMOK?OMCNO@HN2GNH;JFNO@HK>HLA7 4CJFCO 6HJE>NGO MCNO >L@O 6NM4NNIO NEBFLMJKILDO MCNKH<O LIEO FDLGGHKKAO @HLF2 MJFN=O ,BHJI>O MCNO EJHNFMNEO MNLFCJI>O JIMNHIGCJ@7O MCNO FLIEJELMNGO FKA@DNMNO L AJIJABAO K?O '1O CKBHGO JIO LO FDLGGHKKAO 4JMCO LO FKK@NHLMJI>O MNLFCNH=O 3CN FLIEJELMNGO @DLIO LIEO GB@NH;JGNO M<@JFLDO FDLGGHKKAO LFMJ;JMJNGO BIENHO MCN FDKGNO>BJELIFNOK?OMCNOFKK@NHLMJI>OMNLFCNHOLIEOLOFKDDN>NOGB@NH;JGKH=O3CN FLIEJELMNGO 4JDDO DNLHIO AKHNO L6KBMO MCNO N@NFMLMJKIGO EBHJI>O GMBENIMO MNLFC2 83


MORRIS COLLEGE CATALOG JI>O ?HKAO MCNO 8KDDN>NO 9B@NH;JGKHO ?KHO 9MBENIMO 3NLFCNHGO LIEO MCNO        722B9:*BD;@=&=8:*D#:2 @>18.D;)B2 D 3CNO 9KBMCO 8LHKDJILO 9MLMNO KLHEO K?O :EBFLMJKI7O LGO LBMCKHJNEO 6<O 9MLMN DL47OHNBJHNGOMCLMOLOMNLFCNHONEBFLMJKIOFLIEJELMNOCL;NOLIOLFFN@ML6DNOFHJAJ2 ILDO6LF&>HKBIEOFCNF&O6N?KHNOCNOKHOGCNOJGOLDDK4NEOMKOGMBENIMOMNLFCOLIEOMK HNFNJ;NOMCNOJIJMJLDOMNLFCJI>OFNHMJ?JFLMN=O/?OMCNHNOJGOLOENDL<OJIOGMBENIMOMNLFCJI> LIEOMCNOFLIEJELMNOEKNGOIKMOFKA@DNMNOMCNOJIJMJLDOFNHMJ?JFLMJKIO@HKFNGGO4JMCJI NJ>CMNNIOAKIMCGO?HKAOMCNOKHJ>JILDOELMNOK?OMCNO?JI>NH@HJIMJI>OL@@DJFLMJKI7OMCN /O@HKFNGGOABGMO6NOHN@NLMNE= "@>2B.1@B6D$>@DA9:=8=8 D:D;@=&=8:*D#:2 @>18.D;)B2 )HKFNGGJI>O FNIMNHGO CL;NO 6NNIO NGML6DJGCNEO JIO ALKHO @K@BDLMJKIO LHNLG MCHKB>CKBMOMCNOGMLMNOMKOEKOLODJ;NOGFLIOK?OL@@DJFLIMO?JI>NH@HJIMGOLIEOHNFNJ;N JENIMJ?<JI>O JI?KHALMJKIO ?KHO NDNFMHKIJFO GB6AJGGJKIO MKO 9#:,O ?KHO @HKFNGGJI>= 5DDO@HKFNGGJI>O4JDDO6NO@NH?KHANEO6<O9#:,O@NHGKIINDOL?MNHOGB6AJGGJKIO6<O#2 *O GML??O IKO FHJAJILDO CJGMKH<O JI?KHALMJKIO 4JDDO 6NO L;LJDL6DNO MKO #2*=O 9#:,O @NH2 GKIINDO 4JDDO ?KH4LHEO MCNO ?JI>NH@HJIMGO MKO MCNO /7O 4CJFCO 4JDDO FLBGNO LO FHJAJILD 6LF&>HKBIEO HN@KHMO MKO 6NO GNIMO MKO MCNO -??JFNO K?O :EBFLMKHO 8NHMJ?JFLMJKIO MKO 6N BGNEOGKDND<O?KHOMCNOENMNHAJILMJKIOK?ONDJ>J6JDJM<O?KHONEBFLMKHOFNHMJ?JFLMJKI=O3BHI LHKBIEOMJANO?KHOMCNOFHJAJILDO6LF&>HKBIEOHN@KHMOJGOLIMJFJ@LMNEOMKO6NOKINOMK M4KO4NN&G=O3CNHNOJGOLO@HKFNGGJI>O?NN= 5O FLIEJELMNO N@NFMJI>O MKO GMBENIMO MNLFCO EBHJI>O MCNO ?LDDO GNANGMNHO ABGM GB6AJMOMCNO@L@NH4KH&O?KHO?JI>NH@HJIMGO6<ON6HBLH<O* O@HJKHOMKOMCNOGNANGMNH K?O GMBENIMO MNLFCJI>=O 5O FLIEJELMNO N@NFMJI>O MKO GMBENIMO MNLFCO EBHJI>O MCN G@HJI>OGNANGMNHOK?OMCNO?KHMCFKAJI>O<NLHOABGMOFKA@DNMNO/MNAGO5OLIEOO6< BINO* OK?OMCNO@HJKHO<NLH= 8KA@DNMNOKIDJINOHN>JGMHLMJKIOMKOGFCNEBDNOLIOL@@KJIMANIMO4JMCO#2*O:IHKDD2 ANIMO9NH;JFNGO6<OHN>JGMNHJI>OKIDJINOLMO444=#*NIHKDDANIM=FKA=OO5@@DJFLIMG 4JMCKBMO JIMNHINMO LFFNGGO AL<O HN>JGMNHO 6<O FLDDJI>O MCNO #2*O MKDD2?HNNO IBA6NH7 2( '2(0=O 5O @HKFNGGJI>O ?KHAO JGO @HK;JENEO KBMDJIJI>O MCNO HNBJHNEO JI?KH2 ALMJKIOMCLMOMCNOFLIEJELMNOABGMO@HK;JEN= /IO LEEJMJKIO MKO FKA@DNMJI>O MCNO ?JI>NH@HJIMJI>O @HKFNGG7O MCNO FLIEJELMNO ABGM FKA@DNMNO MCNO @HN2GMBENIMO MNLFCJI>O L@@DJFLMJKIO ?KHAO GNFBHNO MCNO ?KHAO ?HKA MCNO 9KBMCO 8LHKDJILO ,N@LHMANIMO K?O :EBFLMJKIO LMO 444=GFMNLFCNHG=KH>O LIE GB6AJMO JMO LDKI>O 4JMCO MCNO HNBJHNEO ?NNO MKO MCNO 9KBMCO 8LHKDJILO ,N@LHMANIMO K? :EBFLMJKI7O -??JFNO K?O :EBFLMKHO 8NHMJ?JFLMJKIO 011O KHNGMO ,HJ;N7O 9BJMNO 11 8KDBA6JL7O 98O ((1'=O N?KHNO ALJDJI>O MCNO @HN2GMBENIMO MNLFCJI>O L@@DJFLMJKI LIEO?NN7OFLIEJELMNGOABGMOGNFBHNOMCNOGJ>ILMBHNOK?OOMCNO,JHNFMKHOK?O3NLFCNH :EBFLMJKI=OO ?B1=@B&B896D$>@D:D?B2>&&B8.:9=>8D$>@D;B@9=$=2:9=>8 *= 5OFLIEJELMNOABGMOALJIMLJIOLOFBABDLMJ;NO(= O>HLENO@KJIMOL;NHL>N= (= 5O FLIEJELMNO ABGMO LFCJN;NO LO >HLENO K?O 8 O KHO 6NMMNHO JIO NLFCO @HK?NG2 GJKILDONEBFLMJKIOFKBHGN= 0= 5O FLIEJELMNO ABGMO LFCJN;NO LO >HLENO K?O 8 O KHO 6NMMNHO JIO NLFCO FKBHGN K??NHNEOMKOANNMO>HLEBLMJKIOHNBJHNANIMGOJIOMCNOALKHO?JNDE= '= 5OFLIEJELMNOABGMO@LGGOMCHNNO5GGJGMJI>7O,N;NDK@JI>7OLIEO:;LDBLMJI> )HK?NGGJKILDO3NLFCJI>O5,:)3OK6GNH;LMJKIG= 84


ACADEMIC DIVISIONS AND PROGRAMS = 5OFLIEJELMNOABGMOL@@D<OMKOMCNO9KBMCO8LHKDJILO,N@LHMANIMOK?O:EBFL2 MJKIO?KHOFNHMJ?JFLMJKI= = $KO L@@DJFLMJKIO ?KHO FNHMJ?JFLMJKIO FLIO 6NO GNIMO 4JMCKBMO @LGGJI>O GFKHNG KI L= )HLJGO/O 6= )HLJGO//O3>@@=6D;>**B BD9B:2)B@DB.12:9=>8D @:.1:9B6D):BD! B@2B89D:66D@:9BD>8D9)BD"@: =6D<<DC :&=8:9=>8%D5=9*BD<<D@B1=@B6D: &=8=&1&D:66D@:9BD>$D DB@2B89% F= 5,:)3O E=O )HJIFJ@DNGOK?O#NLHIJI>OLIEO3NLFCJI>O)#3 = 3CNO FLIEJELMNO ABGMO CL;NO HNFNJ;NEO LIO LFFN@ML6DNO FHJAJILDO 6LF&2 >HKBIEOFCNF&O?HKAOMCNO9KBMCO8LHKDJILO9MLMNO#L4O:I?KHFNANIMO5>NI2 F<O9#:,=O3CJGOFHJAJILDOFCNF&OJGOFKIEBFMNEO@HJKHOMKOMCNO-6GNH;LMJKI LIEO,JHNFMNEO3NLFCJI>O/IMNHIGCJ@= = +KGMOFBHHNIMOMHLIGFHJ@MOABGMO6NOJIFDBENE= = )HK@NHO?NNOABGMO6NONIFDKGNE= /B:*9)D02=B82BD3:>@ 3CNO%NLDMCO9FJNIFNOEN>HNNO@HK>HLAOJGOENGJ>INEO?KHOGMBENIMGOJIMNHNGM2 NEO JIO GNN&JI>O FLHNNHGO MCLMO @HK;JENO ;JMLDO LGGJGMLIFNO MKO JIEJ;JEBLDGO LIE FKAABIJMJNGO JIO LO ;LHJNM<O K?O GNMMJI>G=O %NLDMCO 9FJNIFNO >HLEBLMNGO EN;NDK@7 JA@DNANIM7OLIEON;LDBLMNOCNLDMCO@HK>HLAGOLEAJIJGMNHOCNLDMC2HNDLMNEOGNH2 ;JFNGO KHO @HKAKMNO CLLHE2?HNNO NI;JHKIANIMG=O 8LHNNHO K@@KHMBIJMJNGO LDGK JIFDBENOFKIEBFMJI>OHNGNLHFC7OMNLFCJI>7OFKIGBDMJI>OKHO4KH&JI>OJIOMCNO>HK42 JI>O ?JNDEO K?O GB6GMLIFNO L6BGNO @HN;NIMJKIO LIEO MHNLMANIM=O %NLDMCO 9FJNIFN >HLEBLMNGO FLIO @BHGBNO >HLEBLMNO EN>HNNO @HK>HLAGO JIO @B6DJFO CNLDMC7 ANEJFJINOKHOKMCNHOCNLDMCOHNDLMNEO?JNDEG=O +KGMOFKBHGNGOJIOMCNO%NLDMCO9FJNIFNOALKHOJIFKH@KHLMNOMCNOGN;NIO5HNLG K?O .NG@KIGJ6JDJM<O ?KHO LO %NLDMCO :EBFLMKHO LGO ENDJINLMNEO 6<O MCNO $LMJKILD 8KAAJGGJKIO ?KHO %NLDMCO :EBFLMJKIO 8HNENIMJLDJI>7O /IF=O $8%:87O LIEO LHN JENIMJ?JNEO  O JIO MCNO DJGMO K?O HNBJHNEO FKBHGNG=O 8KA@DNMJKIO K?O LO AJIJABAO K? M4NIM<2?J;NO( OFHNEJMOCKBHGOK?OMCNGNOCNLDMCOGFJNIFNOFKBHGNGO@HN@LHNGOMCN GMBENIMGOMKOGJMO?KHO8NHMJ?JNEO%NLDMCO:EBFLMJKIO9@NFJLDJGMO8%:9OFNHMJ?JFL2 MJKIONLAJILMJKIG=O9MBENIMGO4JMCOLOAJIJABAOK?OLO(=1OLIEOL@@HK;LDO6<OMCN ?LFBDM<OK?OMCNO,J;JGJKIOK?O:EBFLMJKIOABGMOML&NOLIOJIMNHIGCJ@OJIOCNLDMCOGFJ2 NIFNOJIOKHENHOMKOLMMLJIO@HK?NGGJKILDOCLIEG2KION@NHJNIFNO6N?KHNONIMNHJI> MCNO K6O ALH&NM=O 3CNO JIMNHIGCJ@O 4JDDO FKIGJGMO K?O *(1O FDKF&O CKBHGO K?O LFMJ;JM< BIENHOMCNOGB@NH;JGJKIOK?OLO@HK?NGGJKILDOJIOMCNO?JNDEOLIEOMCNOFKDDN>NOJIMNHI2 GCJ@OGB@NH;JGKH=OO%NLDMCO9FJNIFNOALKHGOKIOJIMNHIGCJ@OABGMOKJIOLO@HK?NG2 GJKILDOKH>LIJLMJKIO3CNO9298:5OKHOLOCNLDMCOGFJNIFNOLGGKFJLMJKIO4JMCODJL2 6JDJM<O FK;NHL>N=O 3CNO ?NNO MKO KJIO LO @HK?NGGJKILDO KH>LIJLMJKIO 6NFKANGO L @LHMOK?OMCNOGMBENIM GOMBJMJKIOLIEO?NNG= 3CNO>KLDOK?OMCNO%NLDMCO9FJNIFNOALKHOJGOMLJDKHNEOMKOHN?DNFMOMCNO>KLDGOK? %NLDMC<O)NK@DNO(1*17OLOILMJKILDOCNLDMCO@HKAKMJKIOLIEOEJGNLGNO@HN;NIMJKI JIJMJLMJ;NOO7O4CJFCOLHNOLGO?KDDK4G *=O3KOJIFHNLGNOMCNOG@LIOK?OCNLDMC<O<NLHGO?KHOLDDO5ANHJFLIG= (=O3KOHNEBFNOCNLDMCOEJG@LHJMJNGOLAKI>O5ANHJFLIGO /IOKHENHOMKOLFCJN;NOMCJGO>KLD7OMCNO%NLDMCO9FJNIFNOALKHOCLGOMCNO?KDDK42 JI>OK6NFMJ;NG 85


MORRIS COLLEGE CATALOG *= 3KO EN;NDK@O LIO BIENHGMLIEJI>O K?O MCNO JI?DBNIFNO K?O JIEJ;JEBLDO LIE FKAABIJM<GODJ?NGM<DNOFCHKIJFOLIEOFKAABIJFL6DNOEN;NDK@ANIM (= 3KO EN;NDK@O LIEO BIENHGMLIEO MCNO JA@KHMLIFNO K?O @HN;NIMJ;NO CNLDMC FLHN7OCNLDMCONEBFLMJKI7OLIEOCNLDMCO@HKAKMJKIOJIMNH;NIMJKIG 0= 3KO HNJI?KHFNO LIEO NIFKBHL>NO FKAABIJFLMJKIO LIEO ENFJGJKI2AL&JI> G&JDDGOJIOCNLDMCO@HKAKMJKIOJIMNH;NIMJKIG '= 3KO JA@HK;NO K@@KHMBIJM<O ?KHO FLHNNHO NICLIFNANIMO MCHKB>CO $8%:8 FHNENIMJLDJI>OLIEOFNHMJ?JFLMJKIO =O3KO JA@HK;NO GMBENIMGO L6JDJMJNGO MKO @DLI7O JA@DNANIM7O N;LDBLMNO CNLDMC NEBFLMJKIO@HK>HLAG = 3KO CND@O GMBENIMGO EN;NDK@O LENBLMNO FKA@NMNIFJNGO JIO LGGNGGJI> JIEJ;JEBLD7OLIEOFKAABIJM<OINNEGO?KHOCNLDMCONEBFLMJKI = 3KOEN;NDK@OJIOGMBENIMGODNLENHGCJ@O@KMNIMJLDGOHNBJHNEOK?OLOHNGKBHFN @NHGKIOJIOCNLDMCONEBFLMJKIOO = 3KO @HK;JENO K@@KHMBIJM<O ?KHO GMBENIMGO MKO LFBJHNO LO CLIEG2KIO N@NHJ2 NIFNOMCHKB>COLOGMHBFMBHNEOJIMNHIGCJ@OJIOMCNOCNLMCOGFJNIFNO?JNDE= -B:@8=8 DA192>&B6D$>@D/B:*9)D02=B82B "@KIOFKA@DNMJKIOK?OMCNO%NLDMCO9FJNIFNOEN>HNNO@HK>HLAG7O>HLEBLMNGO4JDD *=O5GGNGGOJIEJ;JEBLDOLIEOFKAABIJM<OINNEGO?KHOCNLDMCONEBFLMJKI (=O)DLIOCNLDMCONEBFLMJKIOGMHLMN>JNG7OJIMNH;NIMJKIG7OLIEO@HK>HLAG 0=O/A@DNANIMOCNLDMCONEBFLMJKIOGMHLMN>JNG7OJIMNH;NIMJKIG7OLIEO@HK>HLAG '=O:;LDBLMNOMCNON??NFMJ;NINGGOK?OCNLDMCONEBFLMJKIO@HK>HLAG =O5EAJIJGMNHOCNLDMCONEBFLMJKIOJIMNH;NIMJKIO@HK>HLAG =O9NH;NOLGOLOHNGKBHFNO@NHGKIOJIO%NLDMCO:EBFLMJKI =O 8KAABIJFLMNO LIEO LE;KFLMNO CNLDMC7O CNLDMCO NEBFLMJKIO INNEG7O LIE CNLDMCOFKIFNHIGOLIEOHNGKBHFNG= ?B2@B:9=>8D7.&=8=69@:9=>8D3:>@ 9MBENIMGO 4CKO ENGJHNO MKO 4KH&O LGO DNJGBHNO G@NFJLDJGMGO JIO LO ;LHJNM<O K?O GNM2 MJI>GOGBFCOLGO@LH&G7OFLA@G7OFHBJGNOGCJ@G7O@DL<>HKBIEG7OHNCL6JDJMLMJKIOFNI2 MNHG7OFKIEKAJIJBAOFKA@DNNG7OHNGMOCKANG7OLIEOHNFHNLMJKIOFNIMNHGOGCKBDE NIHKDDO JIO MCNO HNFHNLMJKIO LEAJIJGMHLMJKIO ALKH=O 9MBENIMGO 4JMCO LO AJIJABA (=1O >HLENO @KJIMO L;NHL>NO LIEO L@@HK;LDO 6<O MCNO ?LFBDM<O K?O MCNO ,J;JGJKIO K? :EBFLMJKIO ABGMO ML&NO LIO JIMNHIGCJ@O JIO .NFHNLMJKIO 5EAJIJGMHLMJKI=O 3CN JIMNHIGCJ@O4JDDOFKIGJGMOK?O'11OFDKF&OCKBHGOK;NHOLO@NHJKEOK?OMNIO4NN&G= .NFHNLMJKIOALKHGOKIOJIMNHIGCJ@OABGMOKJIOLO@HK?NGGJKILDOKH>LIJLMJKI 3CNO9298:5OKHOLOHNFHNLMJKIOLGGKFJLMJKIO4JMCODJL6JDJM<OFK;NHL>N=O3CNO?NN MKOKJIOLO@HK?NGGJKILDOKH>LIJLMJKIO6NFKANGOLO@LHMOK?OMCNOGMBENIM GOMBJMJKI LIEO ?NNG=O 3CNO K6NFMJ;NGO ?KHO MCNO .NFHNLMJKIO 5EAJIJGMHLMJKIO ALKHO LHNO LG ?KDDK4G *= :IL6DNOGMBENIMGOMKOL@@D<OLIOBIENHGMLIEJI>OK?OMCNOHKDNOK?OHNFHNLMJKI JIOLOFCLI>JI>OGKFJNM<= (= ,N;NDK@O LO ANLGBHL6DNO BIENHGMLIEJI>O K?O FKAABIJM<O INNEGO LIE JIMNHNGMGOJIOHNFHNLMJKI= 0= 5HHLI>NON@NHJNIFNGOMKOEN;NDK@OLIOBIENHGMLIEJI>OK?OMCNOG&JDDGOINNE2 NEOJIOMCNO?JNDE= '= )HN@LHNO MCNO >HLEBLMNO MKO @HK;JENO DNLENHGCJ@O 6<O NIFKBHL>JI>O LO GMB2 86


ACADEMIC DIVISIONS AND PROGRAMS ENIMO MKO CL;NO &IK4DNE>NO K?O LO 4JENO ;LHJNM<O K?O LFMJ;JMJNGO 4JMCJIO MCN K;NHLDDO@HK>HLA= = :IFKBHL>NO >HLEBLMNGO MKO AKMJ;LMNO GND?O LIEO KMCNHGO MKO HNFK>IJNO MCN HNDLMJKIOGCJ@OK?OHNFHNLMJKIOLIEODNJGBHNOMKOK;NHLDDOCNLDMC= = ,NAKIGMHLMNOLIOL6JDJM<OMKO6NOLO@HK?NGGJKILDOJIOMCNOHNFHNLMJKIO?JNDE= = 9B@@KHMOLIEO@HKAKMNOGFCKDLHD<OHNGNLHFCOLIEO>HLEBLMNOGMBE<= 091.B89D-B:@8=8 DA192>&B6D$>@D?B2@B:9=>8D7.&=8=69@:9=>8 *=O 9MBENIMGO >HLEBLMJI>O ?HKAO MCNO @HK>HLAO GCLDDO ENAKIGMHLMNO NIMH<2DN;ND &IK4DNE>NOK?OMCNOGFK@NOK?OMCNO@HK?NGGJKIOMCLMOJGOMCNO?KFBGOK?OMCNO@HK2 >HLA7OLDKI>O4JMCO@HK?NGGJKILDO@HLFMJFNGOK?OMCLMO@HK?NGGJKI= (=O 9MBENIMGO >HLEBLMJI>O ?HKAO MCNO @HK>HLAO GCLDDO ENAKIGMHLMNO NIMH<2DN;ND &IK4DNE>NO K?O MCNO CJGMKHJFLD7O GFJNIMJ?JF7O LIEO @CJDKGK@CJFLDO ?KBIELMJKIG K?OMCNO@HK?NGGJKIO?KHO4CJFCOMCNO@HK>HLAO@HN@LHNGOGMBENIMG= 0=O9MBENIMGO>HLEBLMJI>O?HKAOMCNO@HK>HLAOGCLDDOENAKIGMHLMNOMCNOL6JDJM<OMK L@@D<O&IK4DNE>NOK?OMCNO@HK?NGGJKILDO@HLFMJFNOLIEOMCNOCJGMKHJFLD7OGFJNI2 MJ?JF7O LIEO @CJDKGK@CJFLDO ?KBIELMJKIGO K?O MCNO HNDN;LIMO @HK?NGGJKIO ENFJ2 GJKI2AL&JI>= '=O9MBENIMGO>HLEBLMJI>O?HKAOMCNO@HK>HLAOGCLDDOENAKIGMHLMNOMCNOL6JDJM<OMK ENGJ>IO HNFHNLMJKIO LIEO HNDLMNEO N@NHJNIFNGO FDNLHD<O HN?DNFMJI>O L@@DJFL2 MJKIO K?O &IK4DNE>NO ?HKAO HNDN;LIMO ?LFNMGO K?O FKIMNA@KHLH<O @HK?NGGJKILD @HLFMJFN7OGFJNIFN7OLIEO@CJDKGK@C<= =O9MBENIMGO>HLEBLMJI>O?HKAOMCNO@HK>HLAOGCLDDOENAKIGMHLMNOMCNOL6JDJM<OMK ?LFJDJMLMNO HNFHNLMJKIO LIEO HNDLMNEO @HK?NGGJKILDO N@NHJNIFNGO ?KHO EJ;NHGN FDJNIMNDN7OGNMMJI>G7OFBDMBHNG7OLIEOFKIMNMG= =O9MBENIMGO>HLEBLMJI>O?HKAOMCNO@HK>HLAOGCLDDOENAKIGMHLMNOMCNOL6JDJM<OMK N;LDBLMNO HNFHNLMJKIO LIEO HNDLMNEO @HK?NGGJKILDO GNH;JFNO K??NHJI>GO LIEO MK BGNON;LDBLMJKIOELMLOMKOJA@HK;NOMCNOBLDJM<OK?OK??NHJI>G= =O 9MBENIMGO >HLEBLMJI>O ?HKAO MCNO @HK>HLAO GCLDDO 6NO L6DNO MKO HNFK>IJN 6LGJFO ?LFMG7O FKIFN@MG7O @HJIFJ@DNG7O LIEO @HKFNEBHNGO K? ALIL>NANIMLEAJIJGMHLMJKIOJIOHNFHNLMJKIOLIEOHNDLMNEO@HK?NGGJKIG= =O 9MBENIMGO >HLEBLMJI>O ?HKAO MCNO @HK>HLAO GCLDDO 6NO L6DNO MKO L@@D<O NIMH<2 DN;NDO FKIFN@MG7O @HJIFJ@DNG7O LIEO @HKFNEBHNGO K?O ALIL>NANIMLEAJIJG2 MHLMJKIOJIOHNFHNLMJKIOLIEOHNDLMNEO@HK?NGGJKIG= =O9MBENIMGO>HLEBLMJI>O?HKAOMCNO@HK>HLAOGCLDDOENAKIGMHLMN7OMCHKB>COM4K @HLFMJFBAO FKBHGNGO  1O FDKF&O CKBHGO NLFCO LIEO O LO FKA@HNCNIGJ;N JIMNHIGCJ@OK?OIKMODNGGOMCLIO'11OFDKF&OCKBHG7OMCNOL6JDJM<OMKOBGNOEJ;NHGN7 GMHBFMBHNEO 4L<GO K?O MCJI&JI>O MKO GKD;NO @HK6DNAGO HNDLMNEO MKO EJ??NHNIM ?LFNMGO K?O @HK?NGGJKILDO @HLFMJFN7O NI>L>NO JIO LE;KFLF<7O LIEO GMJABDLMN JIIK;LMJKI=

87


MORRIS COLLEGE CATALOG REQUIREMENTS FOR THE BACHELOR OF SCIENCE IN EDUCATION DEGREE WITH A MAJOR IN EARLY CHILDHOOD EDUCATION General Education ......................................................................................61 Major Courses.............................................................................................24 EDU 306 Behavior and Development of the Young Child .............. 3 EDU 310 Curriculum, Instruction and Assessment in Language Development and Communication Skills ................... 3 EDU 311 Curriculum, Instruction and Assessment in Early Childhood Education.................................................. 3 EDU 316 Curriculum, Instruction and Assessment in Mathematics for Early Childhood Education .................................. 3 EDU 318 Curriculum, Instruction and Assessment in Health and Physical Education for Early Childhood Education .... 3 EDU 321 Curriculum, Instruction and Assessment in Visual and Performing Arts for Early Childhood Education ........ 3 EDU 323 Curriculum, Instruction and Assessment in Social Studies for Early Childhood Education .................................. 3  ('8  'LDJQRVLVDQG& RUUHFWLRQRI5HDGLQJ'LIÀFXOWLHV............ 3 Other Required Courses ..............................................................................9 GSC 201 Curriculum, Instruction and Assessment in Science for Early Childhood Education ........................................ 4 HIS 304 American History I .......................................................... 3 OR HIS 305 American History II ........................................................... JRS 300 Junior Seminar................................................................ 1 SSC 100 Contemporary Affairs ...................................................... 1 Professional Education..............................................................................30 EDU 215 Human Development………………………… .................. 3 EDU 251 Foundations of Education ............................................... 3 EDU 302 Educational Psychology ................................................. 3 EDU 304 Educational Assessment and Evaluation ....................... 3 EDU 319 Literature for Children and Adolescents.......................... 3 EDU 400 Curriculum, Instruction and Assessment in Reading ...... 3 EDU 402 Observation and Directed Teaching................................ 9 EDU 405 Educational Seminar....................................................... 3 Electives ........................................................................................................6 TOTAL HOURS .....................................................................................130

88


ACADEMIC DIVISIONS AND PROGRAMS 585,:+/8O,//9/-$9O5$,O).-!.5+9 ;+??<;+-+3D'A?D5/CD#7;/C-A?DA'D0;<C4;CD<4DC,+;75<A4 ,C(?CCD<5/D7D37A?D<4DC7?-D;/<-,/AA,DC,+;75<A4D .:9%+5$O:5. Fall Semester Course Course # Course

CIS ENG FRS HIS MAT SPH

Spring Semester Credit

101 Introduction to Computers ......... 2 103 Fundamentals of Composition.... 3 100 Freshman Seminar ..................... 1 104 World History............................. 3 103 College Algebra .......................... 3 103 Voice and Speech Improvement. 3 TOTAL HOURS 15 Fall Semester

Course Course # Course

BIO ENG MUS GEO HIS FRS

9-)%-+-.:O:5.

ART 101 Art Appreciation ......................... 2 ENG 202 Introduction to Literature........... 3 Foreign Language 201....................................... 3 PHS 100 Physical Sciences....................... 4 REL 201 Old Testament........................... 3 EDU 251 General Psychology ................... 3 TOTAL HOURS 18

Credit

100 Biological Sciences .................... 4 104 Research and Composition ........ 3 101 Music Appriciation .................... 2 201 World Regional Geography ........ 3 106 African American History ........... 3 102 Financial Literacy ....................... 1 TOTAL HOURS 16 Spring Semester

ENG 205 African American Literature........ 3 Foreign Language 202....................................... 3 HSC 210 Health and Physical Education..... 3 American History I ..................... 3 HIS 304 or HIS 305 American History II REL 202 New Testament .......................... 3 PSY 100 Contemporary Affairs ................. 3 TOTAL HOURS 18

"$/-.O:5. Fall Semester Course Course # Course

EDU EDU EDU JRS EDU GSC

Spring Semester Credit

215 302 306

Human Development.................. 3 Educational Psychology ............. 3 Behavior and Development of the Young Child (Birth-Grade 3)....................... 3 300 Junior Seminar........................... 1 400 Curriculum, Instruction and Assessment in Reading .......... 3 201 Science for Early Childhood........ 4 TOTAL HOURS *

Course Course # Course

EDU

323

EDU

318

EDU

311

EDU

304

EDU

303

EDU

320

Credit

Curriculum, Instruction and Assessment in Social Studies in Early Childhood................. 3 Curriculum, Instruction and Assessment in Health & Physical Education in Early Childhood...3 Curriculum, Instruction and Assessment for Early Childhood. 3 Education Assessment and Evaluation.............................3 Literature for Children and Adolescents............................ 3 Performing Arts ..................... 3 TOTAL HOURS

18

9:$/-.O:5. Spring Semester

Fall Semester Course Course # Course

Credit

EDU 316 Curriculum, Instruction and Assessment in Mathematics for Early Childhood................. 3 SSC 100 Contemporary Affairs................. 1 EDU 430 Diagnosis & Correction of Reading Difficulties................ 3 Elective...................................... 3 Elective...................................... 3 GSC 200 Curriculum, Instruction and Assessment in Language Development and Communication Skills..............3 TOTAL HOURS *

Course Course # Course

EDU EDU

Credit

402 Directed Teaching .................... 9 Educational Seminar .................. 3 405 12 TOTAL HOURS

5A57-D>$D!D;@B.=96

89


MORRIS COLLEGE CATALOG REQUIREMENTS FOR THE BACHELOR OF SCIENCE IN EDUCATION DEGREE WITH A MAJOR IN ELEMENTARY EDUCATION General Education ......................................................................................61 Major Courses.............................................................................................21 EDU 301 Curriculum, Instruction and Assessment Elementary Classroom .............................................. 3 EDU 310 Curriculum, Instruction and Assessment in Language Development and Communication Skills ................... 3 EDU 312 Curriculum, Instruction and Assessment in Health and Physical Education for Elementary Education ........... 3 EDU 313 Curriculum, Instruction and Assessment in Social Studies for Elementary Education ............................ 3 EDU 317 Curriculum, Instruction and Assessment in Mathematics for Elementary Education ..................... 3 EDU 320 Curriculum, Instruction and Assessment in Visual and Performing Arts for Elementary Education ................ 3  ('8  'LDJQRVLVDQG& RUUHFWLRQRI5HDGLQJ'LIÀFXOWLHV............ 3 Other Required Courses ..............................................................................9 GSC 200 Curriculum, Instruction and Assessment in Science for Elementary Education................................................ 4 HIS 304 American History I .......................................................... 3 OR HIS 305 American History II ........................................................... JRS 300 Junior Seminar................................................................ 1 SSC 200 Contemporary Affairs ...................................................... 1 Professional Education..............................................................................30 EDU 215 Human Development………………………… .................. 3 EDU 251 Foundations of Education ............................................... 3 EDU 302 Educational Psychology ................................................. 3 EDU 304 Educational Assessment and Evaluation ....................... 3 EDU 319 Literature for Children and Adolescents.......................... 3 EDU 400 Curriculum, Instruction and Assessment in Reading ...... 3 EDU 403 Observation and Directed Teaching................................ 9 EDU 405 Educational Seminar....................................................... 3 Electives ........................................................................................................6 TOTAL HOURS .....................................................................................127

90


ACADEMIC DIVISIONS AND PROGRAMS CURRICULUM FOR THE BACHELOR OF SCIENCE IN EDUCATION DEGREE WITH A MAJOR IN ELEMENTARY EDUCATION FRESHMAN YEAR Fall Semester Course Course# Course

CIS ENG FRS MAT SPH HIS

101 103 100 103 103 104

Spring Semester Credit

Introduction to Computers ............... 2 Fundamentals of Composition ........... 3 Freshman Seminar .......................... 1 College Algebra ............................... 3 Voice and Speech Improvement ........ 3 Voice and Speech Improvement ........ 3

Course Course# Course

BIO ENG MUS HIS GEO FRS

100 104 101 106 201 102

TOTAL HOURS .................................... 15

Credit

Biological Science ........................ 2 Research and Composition ........... 4 Music Appreciation ...................... 3 African American History .............. 3 World Regional Geography............ 3 Financial Literacy ......................... 1 TOTAL HOURS ................................ 18

SOPHOMORE YEAR Fall Semester Course Course# Course

Spring Semester Credit

ART 101 Art Appreciation .............................. 2 ENG 202 Introduction to Literature ................. 3 Foreign Language 201 ......................................... 3 PHS 100 Physical Science ............................. 4 REL 201 Old Testament ................................ 3 EDU 251 Foundations of Education ................ 3 TOTAL HOURS ........................................... 18

Course Course# Course

Credit

ENG 205 African American Literature .......... 3 Foreign Language 202 ...................................... 3 HSC 210 Health & Physical Ed .................... 3 HIS 304 American History I ........................ 3 or HIS 305 American History II REL 202 New Testament ............................. 3 PSY 201 General Psychology.... ...................3 TOTAL HOURS .................................................. 18

JUNIOR YEAR Fall Semester Course Course# Course Credit

Spring Semester Credit

EDU 215 EDU 302 GSC 200

Human Development........................3 Educational Psychology ....................3 Science for the Elementary Classroom.......................................4 Junior 300 Junior Seminar 1 EDU 310 Curriculum, Instruction and Assessment in Language Development and Communication Skills..................3 EDU 400 Curriculum, Instruction and Assessment in Reading ................................. 3 ............................................................

Course Course# Course

EDU 313

EDU

EDU EDU EDU

TOTAL HOURS ................................... 17

Curriculum, Instruction and Assessment in Social Studies for .... Elementary ................................. 3 312 Curriculum, Instruction and Assessment in Health & Physical Education for Elementary ............. 3 301 Curriculum, Instruction and Assessment for Elementary.......... 3 319 Literature for Children and Adolescents.......................... 3 320 Curriculum, Instruction and Assessment in Visual and Performing Arts for Elementary......................... 3 TOTAL HOURS .................................. 15

SENIOR YEAR Fall Semester Course Course# Course

Spring Semester Credit

EDU 317 Curriculum, Instruction and Assessment in Mathematics for Elementary ........ 3 EDU 430 Diagnosis & Correction of Reading DifďŹ culties ...................................... 3 Elective ............................................ 3 Elective ............................................ 3 EDU 304 Educational Assessment and Evaluation . 3 SSC 100 Contemporary Affairs ........................... 1 TOTAL HOURS ................................... 16

91

Course Course# Course

EDU 403 EDU 405

Credit

Observation and Directed Teaching . 9 Educational Seminar ..................... 3

TOTAL HOURS .................................. 12


MORRIS COLLEGE CATALOG ?C+<?C3C450D'A?D5/CD#7;/C-A?DA'D0;<C4;CD,C(?CC <5/D7D37A?D<4 /C7-5/D0;<C4;C (B8B@:*DC.12:9=>8 %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%

!D

3:>@D;>1@6B6%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %98O('1 ,HB>O:EBFLMJKI========================================================0 %98O01* /IMHKEBFMJKIOMKO$BMHJMJKI ===================================0

%98O01( 8CHKIJFOLIEO8KAABIJFL6DNO,JGNLGNG ============0

%98O01' LAJD<O#J?NOLIEO9NO:EBFLMJKI ========================0

%98O01 9MHNGGO+LIL>NANIM ========================================0

%98O0*1 /IMHKEBFMJKIOMKO:@JENAJKDK>< ===========================0

%98O0(1 KBIELMJKIGOK?O%NLDMCO:EBFLMJKI ====================0

%98O'11 %NLDMCO9NH;JFNGO-H>LIJLMJKIO LIEO5EAJIJGMHLMJKIO ==========================================0

%98O'( :MCJFLDOLIEO#N>LDO/GGBNGO?KHO%NLDMC )HK?NGGJKILDG ===============================================0

%98O'( 8KAABIJM<O,N;NDK@ANIMO?KHO%NLDMC================0

%98O'0* .NGNLHFCO+NMCKEG ==========================================*

%98 ' 1 :I;JHKIANIMLDO%NLDMCOLIEO9L?NM< ====================0

%98O'1 %NLDMCO9FJNIFNO9NAJILH ================================== 0 %98O'( /IMNHIGCJ@ ========================================================= 0



A9)B@D?B1=@B.D;>1@6B6 %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% /-OO(11 5ILMKA<OLIEO)C<GJKDK><O?KHO%NLDMCO9FJNIFNG== ' .9O011 BIJKHO9NAJILH ================================================ *



3=8>@ %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%

! D

C*B29=B6 %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%



3-35# ================================================================================

!

?C+<?C3C450D'A?D7D3<4A? <4 /C7-5/D0;<C4;C 9MBENIMGO ALKHJI>O JIO KMCNHO EJGFJ@DJINGO 4CKO 4JGCO MKO AJIKHO JIO %NLDMCO 9FJ2 NIFNOLHNOHNBJHNEOMKOFKA@DNMNOMCNO?KDDK4JI>OFKBHGNG %98O01* %98O010 %98O01' %98O0(1 %98O'( %98O' 1

/IMHKEBFMJKIOMKO$BMHJMJKI 9MHNGGO+LIL>NANIM LAJD<O#J?N9NO:EBFLMJKI KBIELMJKIGOK?O%NLDMCO:EBFLMJKI 8KAABIJM<O,N;NDK@ANIMO?KHO%NLDMC :I;JHKIANIMLDO%NLDMCOLIEO9L?NM<

3-35#

0 0 0 0 0 0 *

5OGMBENIMO4CKOAJIKHGOJIO%NLDMCO9FJNIFNOJGONIFKBHL>NEOMKONIHKDDOJIOGN;NI LEEJMJKILDO FHNEJMO CKBHGO JIO %NLDMCO 9FJNIFN7O KINO K?O 4CJFCO ABGMO 6NO MCNO KIN2 FHNEJMOCKBHO.NGNLHFCO+NMCKEGOFKBHGN=OOCNIOLEENEOMKOMCNONJ>CMNNIOFHNEJM CKBHGODJGMNEOL6K;N7OMCNGNOGN;NIOFHNEJMOCKBHGO4JDDOLDDK4OMCNOGMBENIMOMKOFKA2 @DNMNO MCNO AJIJABAO ( O FHNEJMO CKBHGO HNBJHNEO MKO ML&NO MCNO $8%:8O NLAJIL2 MJKI=

8KBHGNGOMCLMOLEEHNGGOMCNO$8%:8O5HNLGOK?O.NG@KIGJ6JDJM<

92


ACADEMIC DIVISIONS AND PROGRAMS ;+??<;+-+3D'A?D5/CD#7;/C-A?DA'D0;<C4;CD,C(?CC <5/D7D37A?D<4 /C7-5/D0;<C4;C .:9%+5$O:5. CIS 101 ENG 103 FRS 100 HIS 104 MAT 103 SPH 103

Fall Semester Cr. Introduction to Computers ............ 2 Fundamentals of Composition....... 3 Freshman Seminar I ...................... 1 World History ................................ 3 College Algebra ............................. 3 Voice and Speech Improvement ..... 3 15

Spring Semester Cr. Biological Sciences........................ 4 Research and Composition ........... 3 Freshman Seminar II ..................... 1 African American History............... 3 Literature and Religion of the Old Testament ......................... 3 SOC 101 Principles of Sociology.................. 3 or GEO 201 World Regional Geography

BIO ENG FRS HIS REL

100 104 102 106 201

17

9-)%-+-.:O:5. Fall Semester Cr. ART 101 Art Apprciation .............................. 2 HSC 210 Health and Physical Education ...... 3 ENG 202 Introduction to Literature .............. 3 Foreign Languages 201 ................................. 3 REL 202 Literature and Religion of the New Testament........................ 3 Minor Course/Elective ................................... 3

Spring Semester Cr. ENG 205 African American Literature........... 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation........................ 2 PHS 100 Physical Science............................ 4 PSY 201 General Psychology....................... 3 15

17

"$/-.O:5. Fall Semester Cr. BIO 200 Anatomy and Physiology for Health Sciences ................. 4 HSC 302 Chronic and Communicable Diseases ........................................ 3 HSC 320 Foundations of Health Education ................................ 3 HSC 431 Research Methods ........................ 1 JRS 300 Junior Seminar.............................. 1 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

Spring Semester Cr. HSC 301 Introduction to Nutrition................ 3 HSC 304 Family Life and Sex Education .................................. 3 HSC 306 Stress Management ...................... 3 HSC 310 Introduction to Epidemiology ........ 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

9:$/-.O:5. Fall Semester Cr. HSC 400 Health Services Organization and Administration .................. 3 HSC 425 Ethical and Legal Issues for Health Professionals................ 3 HSC 427 Community Development for Health ...................................... 3 HSC 450 Environmental Health and Safety ...................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

93

Spring Semester Cr. HSC 240 Drug Education.............................. 3 HSC 490 Health Science Seminar................. 3 HSC 492 Internship ...................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15


MORRIS COLLEGE CATALOG ?C+<?C3C450D'A?D5/CD#7;/C-A?DA'D0;<C4;CD,C(?CC <5/D7D37A?D<4 ?C;?C75<A4D7,3<4<05?75<A4 (B8B@:*DC.12:9=>8%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%!D)>1@6 3:>@D;>1@6B6%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%!D)>1@6 .:8O(1* /IMHKEBFMJKIOMKO.NFHNLMJKI =============================== 0 .:8O0*1 .NFHNLMJKIO?KHO9@NFJLDO)K@BDLMJKIG ================= 0 .:8O0*( )HK>HLAAJI>O?KHO.NFHNLMJKI =========================== 0 .:8O0(1 8LA@O8KBIGNDJI>OLIEO+LIL>NANIM =============== 0 .:8O0 1 )HLFMJFBAO/O======================================================* .:8O0 * )HLFMJFBAO//O=====================================================* .:8O'10 5EAJIJGMHLMJ;NO8KIFN@MG7O#NLENHGCJ@OLIEO )HLFMJFNGOJIO.NFHNLMJKIO/O=================================0 .:8O'1' 5EAJIJGMHLMJ;NO8KIFN@MG7O#NLENHGCJ@OLIE )HLFMJFNGOJIO.NFHNLMJKIO//O================================0 .:8O'1 LFJDJM<O+LJIMNILIFNOLIEO+LIL>NANIMO ==========0 .:8O'(1 .JG&O+LIL>NANIMOLIEO#N>LDO/GGBNGO==============0 .:8O'0 .NGNLHFCOLIEO:;LDBLMJKIOJIO.NFHNLMJKIO =========0 .:8O''1 /IMNHIGCJ@O ======================================================== .:8O' 1 9NIJKHO9NAJILHO ===============================================0 A9)B@D?B1=@B.D;>1@6B6 %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% D)>1@6 "9O011 /IMHKEBFMJKIOMKOBGJINGGO =================================0 :,"O(* %BALIO,N;NDK@ANIM =======================================0 .9O011 BIJKHO9NAJILH=================================================* 3=8>@D;>1@6B6C*B29=B6%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%! D)>1@6 3-35# ===============================================================================! D)>1@6 ?C+<?C3C450D'A?D7D3<4A? <4D?C;?C75<A4D7,3<4<05?75<A4 9MBENIMGOALKHJI>OJIOKMCNHOEJGFJ@DJINGO4CKO4LIMOMKOAJIKHOJIO.NFHNLMJKI 5EAJIJGMHLMJKIOLHNOHNBJHNEOMKOFKA@DNMNOMCNO?KDDK4JI>OFKBHGNG "9O011 .:8O(1* .:8O0*( .:8O0(1 .:8O'10 .:8O'1

/IMHKEBFMJKIOMKOBGJINGG ==================================0 /IMHKEBFMJKIOMKO.NFHNLMJKI =============================== 0 )HK>HLAAJI>O?KHO.NFHNLMJKI =========================== 0 8LA@O8KBIGNDJI>OLIEO+LIL>NANIM =============== 0 5EAJIJGMHLMJ;NO8KIFN@MG7O#NLENHGCJ@O LIEO)HLFMJFNGOJIO.NFHNLMJKIO/=========================== 0 LFJDJM<O+LJIMNILIFNOLIEO+LIL>NANIM =========== 0

3-35#========================================================================!

94


ACADEMIC DIVISIONS AND PROGRAMS ;+??<;+-+3D'A?D5/CD#7;/C-A?DA'D0;<C4;CD,C(?CC <5/D7D37A?D<4 ?C;?C75<A4D7,3<4<05?75<A4 .:9%+5$O:5. CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 17 BIO ENG FRS HIS REL

100 104 102 106 201

9-)%-+-.:O:5. Fall Semester Cr. ART 101 Art Appreciation ......................... 2 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 HSC 210 Health and Physical Education ... 3 EDU 215 Human Development.................. 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 REC 201 Introduction to Recreation ......... 3 PSY 201 General Psychology 1 ................ 3 18

"$/-.O:5. Fall Semester Cr. JRS 300 Junior Seminar........................... 1 REC 310 Recreation for Special Populations ................................ 3 REC 320 Camp Counseling ...................... 3 REC 350 Practicum I................................. 1 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. REC 312 Programming for Recreation...... 3 BUS 300 Introduction to Business ............ 3 REC 403 Administrative Concepts, Leadership and Practices in Recreation I................................ 3 REC 420 Risk Management and Legal Issues ........................ 3 REC 351 Practicum II ............................... 1 Minor Course/Elective ................................... 3 16

9:$/-.O:5. Fall Semester Cr. REC 404 Administrative Concepts, Leadership and Practices in Recreation II........................... 3 REC 405 Facility Maintenance and Management .............................. 3 REC 435 Research and Evaluation in Recreation .............................. 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

95

Spring Semester Cr. REC 440 Internship................................... 9 REC 450 Senior Seminar .......................... 3 12


MORRIS COLLEGE CATALOG 7?3D?C0C? CDA''<;C?D5?7<4<4(D;A?"0 ?A5;D"?A(?730 3=*=9:@D02=B82B 5HA<O.-38OJGOLOFKNEBFLMJKILDO@HK>HLAOENEJFLMNEOMKO@HKEBFJI>OFKDDN>N2 NEBFLMNEOANIOLIEO4KANIOMKOGNH;NOLGO5HA<O-??JFNHGOJIO@KGJMJKIGOHNBJHJI> LOGNIGNOK?OHNG@KIGJ6JDJM<OLIEOALIL>NHJLDOG&JDDG=O3CNO@HK>HLAONA6KEJNGOMCN FJMJNI2GKDEJNH OFKIFN@M7O4CNHN6<OJIEJ;JEBLDGOAL<OGNH;NOAKGMOK?OMCNJHOAJDJ2 MLH<OK6DJ>LMJKIOJIOHNGNH;NOJIOMCNJHOCKANOFKAABIJM<= AB29=B 5HA<O .-38O JGO LO @HK?NGGJKILDO @HK>HLAO ENGJ>INEO MKO @HKEBFNO ?BMBHNO K??J2 FNHGOMCHKB>C *OEN;NDK@JI>OLOGNIGNOK?OHNG@KIGJ6JDJM<OLIEODNLENHGCJ@OG&JDDG7 (O@HK;JEJI>O@HK?NGGJKILDOAJDJMLH<ONEBFLMJKI7OLIE 0O@HK;JEJI>OFKAAJGGJKINEOK??JFNHGO?KHOMCNO"IJMNEO9MLMNGO5HA<= (B8B@:*D<8$>@&:9=>8 5HA<O .-38O HNBJHNGO M4KO MKO ?KBHO <NLHGO MKO FKA@DNMN7O EN@NIEJI>O KIO GMB2 ENIMOBLDJ?JFLMJKIG=O3CJGOMJANOJGOIKHALDD<O6HK&NIOJIMKOLOM4K2<NLHOIK2K6DJ>L2 MJKIO LGJFO )HK>HLAO LIEO LO M4K2<NLHO FKIMHLFMBLDO 5E;LIFNEO )HK>HLA=O 9MB2 ENIMGO 4JMCO @HJKHO LFMJ;NO EBM<O GNH;JFN7O BIJKHO .-38O KHO $LMJKILDO !BLHEO KH "IJMNEO9MLMNGO5HA<O.NGNH;NOGNH;JFNOAL<OBLDJ?<O?KHOEJHNFMO@DLFNANIMOJIOMCN 5E;LIFNEO )HK>HLA=O 5MO MCNO 6N>JIIJI>O K?O MCNJHO BIJKHO <NLH7O GMBENIMGO 4JMCO LM DNLGMO M4KO <NLHGO HNALJIJI>O 6N?KHNO >HLEBLMJKIO FLIO LDGKO BLDJ?<O ?KHO MCNO 5E2 ;LIFNEO)HK>HLAO6<OLMMNIEJI>OLO?J;N24NN&OLGJFO8LA@OK??NHNEONLFCOGBA2 ANHOLMOKHMOIK7ONIMBF&<=O5DDO.-38OGMBENIMGO@LHMJFJ@LMNOJIOLOHN>BDLHO@HK2 >HLAOK?O@C<GJFLDO?JMINGGOLIEO?JNDEOMHLJIJI>= "?A'C00<A47-D3<-<57?D0;<C4;CD"?A(?73 3CNO "IJMNEO 9MLMNGO 5HA<O .NGNH;NO -??JFNHGO 3HLJIJI>O 8KH@GO )HK?NGGJKILD +JDJMLH<O :EBFLMJKIO )+:O )HK>HLAO NJGMGO MKO NICLIFNO MCNO FLHNNHO EN;NDK@2 ANIMOLIEO@NH?KHALIFNOK?OFLENMGOLGO?BMBHNO5HA<OK??JFNHG= 3CNO )HK?NGGJKILDO +JDJMLH<O :EBFLMJKIO >BJENDJINGO ?KHO 5HA<O .-38O FLENMG LHNOLGO?KDDK4G *= 5DDOFLENMGOABGMOGBFFNGG?BDD<OFKA@DNMNOLOFKBHGNOJIONLFCOK?OMCNO?KDDK42 JI>OLHNLGO@HJKHOMKOFKAAJGGJKIJI> L= 4HJMMNIOFKAABIJFLMJKIG 6= AJDJMLH<OCJGMKH< F= FKA@BMNHODJMNHLF< (= 5DDOFLENMGOLHNONIFKBHL>NEOMKOML&NOLOFKBHGNO?HKAONLFCOK?OMCNO?KDDK4JI> M4KOLHNLGO@HJKHOMKOFKAAJGGJKIJI> L= ALIL>NANIM 6= ILMJKILDOGNFBHJM<OGMBEJNG 9MBENIMGO4JDDOANNMO4JMCOMCNO)HK?NGGKHOK?O+JDJMLH<O9FJNIFN8DLGGO5E;J2 GKHOMKOGNDNFMOMCNGNOFKBHGNG=

96


ACADEMIC DIVISIONS AND PROGRAMS 5)BD02)>*:@6)=D"@> @:& 3CNO 5HA<O .-38O 9FCKDLHGCJ@O )HK>HLAO L4LHEGO ?KBH27O MCHNN27O LIEO M4K2 <NLHO GFCKDLHGCJ@GO MKO NDJ>J6DNO GMBENIMGO KIO LO FKA@NMJMJ;NO 6LGJG=O 3CNO .-38 -??JFNO LFFN@MGO L@@DJFLMJKIGO ?KHO M4K2O LIEO MCHNN2<NLHO .-38O GFCKDLHGCJ@G MCHKB>CKBMOMCNO<NLH=O9MBENIMGOEKOIKMOCL;NOMKO6NONIHKDDNEOJIO.-38OMKOL@@D< ?KHOM4K2OLIEOMCHNN2<NLHOGFCKDLHGCJ@G= :LFCO GFCKDLHGCJ@O @L<GO ?KHO ?BDDO MBJMJKIO LIEO @HK;JENGO ' 1O ?KHO 6KK&G7O LIE LIOLDDK4LIFNO?KHODL6KHLMKH<O?NNGOLIEOKMCNHONEBFLMJKILDON@NIGNG=O3CNOGMB2 ENIMO LDGKO HNFNJ;NGO (11O @NHO AKIMCO ?KHO B@O MKO MNIO AKIMCGO K?O NLFCO GFCKKD <NLHOLIEOCLD?OMCNO6LGNO@L<OK?OLOGNFKIEODJNBMNILIMO4CJDNOLMMNIEJI>OMCNO?J;N2 4NN&O5E;LIFNEO8LA@OLMOKHMO#N4JG7OLGCJI>MKI7OL?MNHOMCNOBIJKHO<NLH= 0=&1*9:8B>16D3B&B@6)=D"@> @:&D03" 3CNO9JABDMLINKBGO+NA6NHGCJ@O)HK>HLAOLDDK4GOLIOJIEJ;JEBLDOMKO6NO6KMC LOANA6NHOK?OMCNO5HA<O.-38OLIEOMCNO5HA<O$LMJKILDO!BLHEO5.$!OKHOMCN "IJMNEO 9MLMNGO 5HA<O .NGNH;NO "95.=O 3CNO GMBENIMO AL<O MCNIO HNFNJ;NO NIMJ2 MDNANIMGO?HKAO6KMCOMCNO.-38OLIEOMCNO5.$!OKHO"95.7OJIFDBEJI>OMCNO$N4 !/OJDDO?KHO.NGNH;JGMG= 3CNO9+)OJGOLO;KDBIMLH<O@HK>HLAOMCLMOHNBJHNGOLFFN@MLIFNO6<OMCNO5.$! KHO "95.=O /?O LO GMBENIMO JGO LFFN@MNEO JIMKO MCNO 9+)O 6<O MCNO 5.$!"95.7 CNGCNO4JDDO6NFKANOLIOK??JFNHOMHLJINNOLIEO6NO@LJEOLGOLOGNH>NLIMO: 7O4CJDN @NH?KHAJI>OEBMJNGOFKAANIGBHLMNO4JMCOMCNOHLI&OK?OGNFKIEODJNBMNILIM= 9+)O@LHMJFJ@LMJKIOJGODJAJMNEOMKOGMBENIMGOJIOMCNO.-38O5E;LIFNEO)HK>HLA= .-38O NIMJMDNANIMGO NBLDO (7 11O MKMLDO EBHJI>O MCNO 5E;LIFNEO )HK>HLAO LIE L@@HKJALMND<O*711OLO<NLHO?HKAOMCNO5.$!OKHO"95.= ;AA"C?75< CDC,+;75<A4D"?A(?73 3CNO 8KK@NHLMJ;NO :EBFLMJKIO )HK>HLAO @HK;JENGO FLHNNHO >BJELIFNO MKO GMB2 ENIMGOLIEOHNDLMNGOLFLENAJFOGMBE<OMKO@HLFMJFLDO4KH&OGJMBLMJKIGO6<OFKKHEJILM2 JI>O?BDD2MJANOFKDDN>NOGMBEJNGO4JMCONA@DK<ANIMOJIO6BGJINGG7OJIEBGMH<7O>K;NHI2 ANIM7OKHOGNH;JFNOKH>LIJLMJKIG= 9MBENIMGOG@NIEOLO@KHMJKIOK?OMCNJHOMJANOJIOMCNOFDLGGHKKAOLIEOLIKMCNHO@KH2 MJKIOJIOK??2FLA@BGO@KGJMJKIGOBGBLDD<OHNDLMNEOMKOMCNJHOALKHOFKBHGNOK?OGMBE<= 3CJGO @HK>HLAONIL6DNGO GMBENIMGO MKO NLHIO4CJDNOMCN<ODNLHI OLIEOK??NHGOMCNA LIOK@@KHMBIJM<OMKO>LJION@NHJNIFNOJIOMCNO4KHDEOK?O4KH&= 5B6D>$D;>>D>@ D766= 8&B896   *= 9MBENIMGOLHNOALMFCNEOMKO8K2K@O@KGJMJKIGOLFFKHEJI>OMKOMCNJHOLFLENAJF ALKHG=O 9MBENIMGO 4KH&O ?BDD2MJANO KHO '1O CKBHGO @NHO 4NN&O JIO LDMNHILMJI> GNANGMNHG=  (=O 3CNO GMBENIMO 4KH&GO M4NIM<O CKBHGO KHO DNGGO @NHO 4NN&O CLD?2EL<O 4KH&JI> LIEOCLD?2EL<OLMMNIEJI>OFDLGGNGO6LGNEOKIOMCNON@HNGGNEOINNEGOK?OMCN NA@DK<NH=    0=O3CNOGMBENIMO4KH&GOKIOLO8K2K@O4KH&OLGGJ>IANIMO?KHOKINO?BDDOGNANGMNHOKH KINO GBAANHO @NHJKEO MKO FKA@DNMNO FHNEJMGO INNENEO ?KHO CJGCNHO LFLENAJF GMBEJNG= 97


MORRIS COLLEGE CATALOG ;@=9B@=:D$>@D091.B89D":@9=2=:9=>8D=8D;>>DC. *= 8KA@DNMJKIOK?OLMODNLGMOKINOGNANGMNHOK?O?BDD2MJANOGMBE<= (= 5FFN@ML6DNOLFLENAJFOGMLIEJI>O4JMCOLMODNLGMOLO(=1O>HLENO@KJIMOL;NHL>N= 0= 8KA@DNMJKIOK?OLO8K2K@OL@@DJFLMJKIOLIEKHOL>NIF<OL@@DJFLMJKI= '= 5BMCKHJLMJKIOMKOLFBJHNOLOFK@<OK?OGMBENIM GOMHLIGFHJ@M= ">*=2=B6D(>B@8=8 D;>>D091.B896 *= 5DDO8K2K@OGMBENIMGOABGMO6NOK??JFJLDD<OHN>JGMNHNEOEBHJI>OMCNOGNANGMNHOK? MCNJHO4KH&ON@NHJNIFN= (= KHOMCJGO8K2K@ON@NHJNIFNOGMBENIMGOAL<OHNFNJ;NOB@OMKOOFHNEJMOCKBHG ?KHOGBAANHO8K2K@O4KH&OLIEOB@OMKOOFHNEJMOCKBHGO?KHOGNANGMNHO8K2K@ 4KH&=O $KO AKHNO MCLIO LO MKMLDO K?O * O CKBHGO K?O 8K2K@O 4KH&O N@NHJNIFN FHNEJMOAL<O6NOL@@DJNEOMK4LHEGO>HLEBLMJKIOHNBJHNANIMG= 0= BDD2MJANO GMBENIMGO 4JDDO 6NO @NHAJMMNEO MKO NIHKDDO ?KHO IKO AKHNO MCLIO MCHNN FHNEJMO CKBHGO FKBHGNO 4KH&O JIO LEEJMJKIO MKO MCNO 8K2K@O CKBHG7O @HK;JENE MCN<OCL;NOLOFBABDLMJ;NO>HLENO@KJIMOL;NHL>NOK?OIKMODNGGOMCLIO0=1=O9MB2 ENIMGONIHKDDNEOJIOMCNO8K2K@O:EO@HK>HLAOAL<OIKMOML&NOLI<OLEEJMJKILD FHNEJMOCKBHGOFKBHGNO4KH&OEBHJI>OMCNOGBAANHOGNGGJKI= '= NMNHLIGOLHNOJINDJ>J6DNOMKOHNFNJ;NO?JILIFJLDOFKA@NIGLMJKIO?HKAOMCNONM2 NHLIGO5EAJIJGMHLMJKIO4CJDNONIHKDDNEOJIOMCNO8KK@NHLMJ;NO:EBFLMJKIO)HK2 >HLA= = 9MBENIMGOABGMOCL;NOFKA@DNMNEO8KK@NHLMJ;NO:EBFLMJKIO*O9NAJILH JIO8KK@NHLMJ;NO:EBFLMJKIO6N?KHNONIHKDDJI>OJIOMCNO8KK@NHLMJ;NO:EBFL2 MJKIO4KH&ON@NHJNIFN= = 5O?NNOK?O0* =11O@NHOFHNEJMOCKBHOK?O8K2K@O:EBFLMJKIO4JDDO6NOFCLH>NE MKONLFCOGMBENIM=O:DJ>J6DNOGMBENIMGOAL<OHNFNJ;NO?JILIFJLDOLGGJGMLIFNOMK EN?HL<OHN>JGMHLMJKIO?NN= = 5MOMCNONIEOK?ONLFCO4KH&ON@NHJNIFN7ONLFCO8K2K@OGMBENIMOJGOHNBJHNE MKO GB6AJMO LO 4HJMMNIO HN@KHMO MKO MCNO ,JHNFMKHO K?O MCNO 8K2K@O )HK>HLAO LIE MCNO8CLJHALIOK?OCJGO,J;JGJKIO6N?KHNOLI<OFHNEJMOJGOLGGJ>INE=O3CJGO 8K2 K@NHLMJ;NO:EBFLMJKIOO :@NHJNIFN OFHNEJMO4JDDO6NOL@@DJNEOMK4LHEO?BD?JDDJI> >NINHLDONDNFMJ;NOHNBJHNANIMG=OKHOENMLJDGOL6KBMOMCJGOFHNEJM7OGNNOFKBHG2 NGOIBA6NHNEO(7O(7O07O07O'7OLIEO'ODJGMNEOBIENHO ,NGFHJ@2 MJKIOK?O8KBHGNG7O8K2K@O:EBFLMJKI=

= LGNEO KIO MCNO @NH?KHALIFNO N;LDBLMJKIO 6<O MCNO 4KH&O GB@NH;JGKH7O MCN 4HJMMNIOHN@KHMOLIEOMCNOILMBHNOK?OMCNO4KH&ON@NHJNIFN7OMCNO,JHNFMKHOLIE MCNO,J;JGJKIO8CLJH@NHGKIO4JDDO?JDNOLO?JILDO>HLENOHN@KHMO?KHONLFCOGMBENIM 4JMCOMCNOO-??JFNOK?O5EAJGGJKIGOLIEO.NFKHEGOLIEOMCNO5FLENAJFO,NLI= ;7--D3CD3<05C?D"?A(?73 3CNO 8LDDO+NO+JGMNH O)HK>HLAOJGOLOILMJKILDOJIJMJLMJ;NOENGJ>INEOMKOJIFHNLGN MCNO @KKDO K?O L;LJDL6DNO MNLFCNHGO ?HKAO EJ;NHGNO FBDMBHNGO LIEO 6LF&>HKBIEGO MK GNH;NO JIO NFKIKAJFLDD<O EJGLE;LIML>NEO LIEO NEBFLMJKILDD<O LM2HJG&O FKAABIJ2 MJNG=O5@@DJFLIMGOABGMO?JHGMOANNMOMCNOLEAJGGJKIOHNBJHNANIMGOK?O+KHHJGO8KD2 DN>NO 6N?KHNO GNN&JI>O LEAJGGJKIO MKO MCNO 8LDDO +NO +JGMNH O @HK>HLA=O )HK>HLA

98


ACADEMIC DIVISIONS AND PROGRAMS LFMJ;JMJNGOLHNOENGJ>INEOMKOLDDK4O +JGMNHG OMKO4KH&OLIEOGMBE<OMK>NMCNHOMKOLM MNIEO AKMJ;LMJKILDO GNGGJKIGO LIEO MKO EJGFBGGO MK@JFGO K?O ABMBLDO JIMNHNGM=O 3CN LAKBIMO K?O MBJMJKIO LIEO KMCNHO AKINMLH<O GB@@KHMO ?KHO @LHMJFJ@LIMGO JIO MCNO 8LD +NO+JGMNH O)HK>HLAO;LHJNGO?HKAO<NLHOMKO<NLH7OEN@NIEJI>OKIOMCNO?BIEGOL;LJD L6DNO?KHOMCLMO@LHMJFBDLHO<NLH

99


MORRIS COLLEGE CATALOG

5/CD,< <0<A4DA' 475+?7-D0;<C4;C0D74,D375/C375<;0 AB29=B6 3CNO,J;JGJKIOK?O$LMBHLDO9FJNIFNGOLIEO+LMCNALMJFGOK??NHGOALKHGOJIO6JKDK2 ><OLIEOALMCNALMJFG=O3CNOFCJN?OK6NFMJ;NGOK?OMCNO,J;JGJKIOLHNOLGO?KDDK4G *=O3KO K??NHO 6LGJFO FKBHGNGO 4CJFCO 4JDDO CND@O @HN@LHNO GMBENIMGO MKO 6NFKAN @HK?NGGJKILDO 6JKDK>JGMGO LIEO ALMCNALMJFJLIGO LIEO MKO NIFKBHL>NO LEEJ2 MJKILDO@HN@LHLMJKIOJIO@C<GJFG7OFCNAJGMH<7OLIEOFKA@BMNHOGFJNIFN= (=O3KO@HN@LHNOGMBENIMGOMKO6NFKANOMNLFCNHGOK?O6JKDK><OLIEOALMCNALMJFG= 0= 3KO @HN@LHNO GMBENIMGO MKO GMBE<O NI>JINNHJI>7O ANEJFJIN7O ENIMJGMH<7O IBHG2 JI>7O@CLHALF<7OLIEOKMCNHOCNLDMC2HNDLMNEOLHNLG= '=O3KO @HK;JENO MCNO >NINHLDO NEBFLMJKIO FKBHGNO HNBJHNANIMGO JIO MCNO ILMBHLD GFJNIFNGOLIEOALMCNALMJFG= =O3KO EN;NDK@O LIEO NIFKBHL>NO L@@HNFJLMJKI7O BIENHGMLIEJI>7O LIEO G&JDD?BD L@@DJFLMJKIOK?OGFJNIFNOMKON;NH<EL<ODJ?N= =O3KOIBHMBHNOLIEONIFKBHL>NOMCNOALGMNH<OK?ODK>JFLDOHNLGKIJI>OINFNGGLH< ?KHOMCNOLILD<MJFLDOL@@HKLFCOBMJDJNEOJIOMCNOGFJNIMJ?JFOANMCKEOK?OJI;NGMJ2 >LMJKI= =O3KO @HK;JENO K@@KHMBIJMJNGO ?KHO JIGMHBFMJKI2HNDLMNEO HNGNLHFC7O @BHNO LIE L@@DJNE7O6<O?LFBDM<OLIEOGMBENIMG= 9MBENIMGO GNN&JI>O LO ALKHO JIO 6JKDK><O ABGMO FKA@DNMNO LO AJIJABAO K?O O 0 CKBHGOK?OALKHOFKBHGNG7O0'OCKBHGOK?OKMCNHOHNBJHNANIMG7OOOCKBHGOK?ONDNF2 MJ;NG7OLIEO OCKBHGOK?O>NINHLDONEBFLMJKI=O3CN<OAL<OLDGKOGNDNFMOLOAJIKHOJI LIKMCNHO EJGFJ@DJIN=O 9MBENIMGO GNN&JI>O LO ALKHO JIO ALMCNALMJFGO ABGMO FKA2 @DNMNOLOAJIJABAOK?O'(OCKBHGOK?OALKHOFKBHGNG7O*(OCKBHGOK?OKMCNHOHNBJHN2 ANIMG7O *'O CKBHGO K?O NDNFMJ;NG7O LIEO *O CKBHGO K?O >NINHLDO NEBFLMJKI=O O 3CN< AL<OLDGKOGNDNFMOLOAJIKHOJIOLIKMCNHOEJGFJ@DJIN=O9MBENIMGO4CKOLHNOJIMNHNGMNE JIOMNLFCJI>OCJ>COGFCKKDO6JKDK><OKHOCJ>COGFCKKDOALMCNALMJFGOABGMOFKA@DNMN '1OCKBHGOK?O@HK?NGGJKILDONEBFLMJKIOJIOLEEJMJKIOMKOMCNOKMCNHOHNBJHNANIMG= 9MBENIMGOGNN&JI>OAJIKHGOJIOOJKDK><7O:I;JHKIANIMLDO9FJNIFN7OKHO+LMCN2 ALMJFGO ABGMO FKA@DNMNO (1O CKBHGO JIO 6JKDK><7O(1OCKBHGOJIONI;JHKIANIMLDOGFJ2 NIFN7OKHO*OCKBHGOJIOALMCNALMJFGOHNG@NFMJ;ND<= 9MBENIMGO LHNO HNG@KIGJ6DNO ?KHO FKA@DNMJI>O MCNO HNBJHNANIMGO LGO GMLMNEO JI MCJGOFLMLDK>=O5E;JGKHGO4JDDO@HK;JENON;NH<O@KGGJ6DNOLGGJGMLIFNOMKONIL6DNOGMB2 ENIMGOMKOANNMOMCNGNOHNBJHNANIMG=

100


ACADEMIC DIVISIONS AND PROGRAMS 5/CD#<A-A(D74,D#<A-A(0C;A4,7?DC,+;75<A4D37A?0 5/CD#<A-A(D"?A(?73 AB29=B6 3CNO-6NFMJ;NGOK?OMCNOJKDK><O)HK>HLAOLHNOLGO?KDDK4G *=O 3KO @HNGNIMO LIO JIMN>HLMNEO FKIFN@MO K?O DJ?NO LGO ALIJ?NGMNEO JIO LIJALDG7 @DLIMG7O LIEO AJFHKKH>LIJGAG=O O 9BFCO LO FKIFN@MO HN;NLDGO FCLHLFMNHJGMJFG FKAAKIOMKOLDDOMCNGNO?KHAGOK?ODJ?NOLIEOLFFNIMBLMNGOMCNJHOEN@NIENIFN KIOKINOLIKMCNH7OEJHNFMD<OKHOJIEJHNFMD<= (=O 3KO ENAKIGMHLMNO MCNO JIMNHHNDLMJKIGCJ@GO K?O DJ;JI>O KH>LIJGAGO 4JMCO MCNJH L6JKMJFONI;JHKIANIM= 0=O 3KO ENAKIGMHLMNO MCLMO KH>LIJLMJKIO LIEO FKKHEJILMJKIO LMO EJ??NHNIMO DN;NDG LHNOGKO;JMLDOMCLMOLI<OEJGHB@MJKIOK?OMCNGNO@HKFNGGNGOAL<OHNGBDMOJIOEJGMBH2 6LIFNOKHON;NIO ENLMC = '=O 3KO @HK;K&NO MCKB>CMO LIEO JIBJH<O FKIFNHIJI>O MCNO N;KDBMJKIO LIEO ANML2 AKH@CKGJGOK?ODJ;JI>O6NJI>GO@HJKHOMKOLFBJHJI>OMCNJHO@HNGNIMO?KHA= =O 3KO @HK;JENO MCNO INFNGGLH<O 6LF&>HKBIEO ?KHO LE;LIFNEO GMBE<O LIEO MCN @HN@LHLMJKIOHNBJHNEO?KHOGMBE<JI>OANEJFJIN7OENIMJGMH<7OIBHGJI>7OKHOLI< KMCNHOHNDLMNEOCNLDMCO@HK?NGGJKI= =O 3KO GMBE<O 6JKDK><O LIEO KMCNHO GFJNIFNGO JIO DJ>CMO K?O HNFNIMO MNFCIKDK>JFLD LE;LIFNGO LIEO HNFK>IJNO MCNO JA@LFMO K?O MCNGNO LMO MCNO CBALI7O NMCJFLD7 LIEONI;JHKIANIMLDODN;NDG= =O 3KO NIL6DNO GMBENIMGO MKO HNFK>IJNO MCNO FKIMHJ6BMJKIGO K?O 6JKDK>JGMGO ?HKA EJ;NHGNOFBDMBHNGOLIEOEJ??NHNIMONHLGOK?OCBALIOCJGMKH<= =O3KO@HN@LHNOJIMNHNGMNEOGMBENIMGO?KHOHNGNLHFC7O>K;NHIANIMLD7OLIEOJIEBG2 MHJLD2MNFCIKDK>JFLDODNLENHGCJ@OHKDNG= -B:@8=8 DA192>&B6D$>@D9)BD#=>*> D"@> @:& "@KIOFKA@DNMJKIOK?OMCNOJKDK><OEN>HNNO@HK>HLA7O>HLEBLMNGO4JDDO *=O9BAALHJNO?BIELANIMLDOFKIFN@MGOJIO6JKDK><OG@LIIJI>OMCNOMCHNN EKALJIGOK?OKH>LIJGAG (=O5ILD<NOELMLOLIEOJIMNH@HNMOMCNAO>HL@CJFLDD< 0=O/IMNH@HNMOLIEOGKD;NO@HK6DNAGOJIOFKIMNIMOLIEOFKIFN@M '=O/IMN>HLMNODL6KHLMKH<OANMCKEKDK><OLIEOMNFCIKDK>< =O,NAKIGMHLMNOMCNOHNDLMJKIGCJ@OK?OMCNOCJGMKH<OLIEO@HKFNGGNGOK?OGFJ2 NIFNO =O"GNOGFJNIMJ?JFOFKAABIJFLMJKIOJIOEJGFBHGJ;NO@HLFMJFNG7O4HJMJI>OLIE KHLD@KGMNHO@HNGNIMLMJKIG =O NO @HN@LHNEO ?KHO >HLEBLMNO LIEO @HK?NGGJKILDO FLHNNHG7O HNGNLHFC7 LIEO>K;NHIANIMLDOLIEOJIEBGMHJLDOMNFCIKDK>JFLDODNLENHGCJ@OHKDNG

101


MORRIS COLLEGE CATALOG 5/CD#<A-A(0C;A4,7?DC,+;75<A4D"?A(?73 AB29=B6 3CNOK6NFMJ;NGOK?OMCNOJKDK><9NFKIELH<O:EBFLMJKIO)HK>HLAOLHNOLGO?KD2 DK4G *= )HNGNIMO LIO JIMN>HLMNEO FKIFN@MO K?O DJ?NO LGO ALIJ?NGMNEO JIO LIJALDG7 @DLIMG7OLIEOAJFHKKH>LIJGAG=OO9BFCOLOFKIFN@MOHN;NLDGOFCLHLFMNHJGMJFG FKAAKIOMKOLDDOMCNGNO?KHAGOK?ODJ?NOLIEOLFFNIMBLMNGOMCNJHOEN@NIENIFN KIOKINOLIKMCNH7OEJHNFMD<OKHOJIEJHNFMD<= (= ,NAKIGMHLMNOMCNOJIMNHHNDLMJKIGCJ@GOK?ODJ;JI>OKH>LIJGAGO4JMCOMCNJHOL6J2 KMJFONI;JHKIANIM= 0= ,NAKIGMHLMNOMCLMOKH>LIJLMJKIOLIEOFKKHEJILMJKIOLMOEJ??NHNIMODN;NDGOLHN GKO ;JMLDO MCLMO LI<O EJGHB@MJKIO K?O MCNGNO @HKFNGGNGO AL<O HNGBDMO JIO EJGMBH2 6LIFNOKHON;NIO ENLMC = '= )HK;K&NOMCKB>CMOLIEOJIBJH<OFKIFNHIJI>OMCNON;KDBMJKIOLIEOANMLAKH2 @CKGJGOK?ODJ;JI>O6NJI>GO@HJKHOMKOLFBJHJI>OMCNJHO@HNGNIMO?KHA= = 9MBE<O 6JKDK><O LIEO KMCNHO GFJNIFNGO JIO DJ>CMO K?O HNFNIMO MNFCIKDK>JFLD LE;LIFNGO LIEO HNFK>IJNO MCNO JA@LFMO K?O MCNGNO LMO MCNO CBALI7O NMCJFLD7 LIEONI;JHKIANIMLDODN;NDG= = :IL6DNOMCNOFLIEJELMNOMKOHNFK>IJNOMCNOFKIMHJ6BMJKIGOK?O6JKDK>JGMGO?HKA EJ;NHGNOFBDMBHNGOLIEOEJ??NHNIMONHLGOK?OCBALIOCJGMKH<= = )HN@LHNO MCNO FLIEJELMNO MKO MNLFCO 6JKDK><O LMO MCNO GNFKIELH<O DN;NDO 6< ANNMJI>OMCNO85:)$93OGMLIELHEG= = +L&NO MCNO FLIEJELMNO L4LHNO K?O IN4O EN;NDK@ANIMGO JIO HNGNLHFCO LIE MNFCIKDK><O LIEO BGNO MCNAO MKO NICLIFNO MCNJHO ?BMBHNO GMBENIMG O DNLHIJI> LIEO@NH?KHALIFN= -B:@8=8 DA192>&B6D$>@D9)BD#=>*> D0B2>8.:@DC.12:9=>8D"@> @:& "@KIO FKA@DNMJKIO K?O MCNO JKDK><9NFKIELH<O EN>HNN @HK>HLA7O >HLEBLMNG 4JDD *= IK4O ?BIELANIMLDO FKIFN@MGO JIO 6JKDK><O G@LIIJI>O MCNO MCHNNO EKALJIG K?OKH>LIJGAG (= 5ILD<NOELMLOLIEOJIMNH@HNMOMCNAO>HL@CJFLDD< 0= /IMNH@HNMOLIEOGKD;NO@HK6DNAGOJIOFKIMNIMOLIEOFKIFN@M '= /IMN>HLMNODL6KHLMKH<OANMCKEKDK><OLIEOMNFCIKDK>< = ,NAKIGMHLMNOMCNOHNDLMJKIGCJ@OK?OMCNOCJGMKH<OLIEO@HKFNGGNGOK?OGFJNIFNO = "GNO GFJNIMJ?JFO FKAABIJFLMJKIO JIO EJGFBHGJ;NO @HLFMJFNG7O 4HJMJI>O LIE KHLD@KGMNHO@HNGNIMLMJKIG = NO@HN@LHNEO?KHOMCNO).5/9O//O:LAJILMJKI = NO@HN@LHNEOMKOMNLFCO6JKDK><OLMOMCNOGNFKIELH<OGFCKKDODN;NDO6<OANNM2 JI>OMCNO85:)$935OGMLIELHEG

102


ACADEMIC DIVISIONS AND PROGRAMS ?C+<?C3C450D'A?D5/CD#7;/C-A?DA'D0;<C4;CD,C(?CC <5/D7D37A?D<4D#<A-A( (B8B@:*DC.12:9=>8================================================================================== 3:>@D;>1@6B6 ======================================================================================== /-O(1* NHMN6HLMNO5ILMKA<OLIEO:A6H<KDK>< ========== ' /-O(10 /IMHKEBFMJKIOMKO.NGNLHFCO+NMCKEG =============== ' /-O(1' !NINHLDOKMLI< ============================================ ' /-O(1 !NINHLDO+JFHK6JKDK>< =================================== ' /-O011 8NDDOLIEO+KDNFBDLHOJKDK>< ========================== ' /-O01* !NINHLDO!NINMJFG ========================================= ' /-O01 !NINHLDO:FKDK>< ========================================== ' /-O'1( JKDK><O9NAJILH =========================================== 0 /-O'10 %BALIO)C<GJKDK>< ======================================='

A9)B@D?B1=@B.D;>1@6B6 ======================================================================== 8%+O*1( !NINHLDO8CNAJGMH<O// ====================================' 8%+O(1* -H>LIJFO8CNAJGMH<O/ ===================================== ' 8%+O(1( -H>LIJFO8CNAJGMH<O// ==================================== ' 8%+O'11 JKFCNAJGMH< ================================================' .9O011 BIJKH9NAJILH =============================================* +53O*1' 3HJ>KIKANMH< ================================================0 +53O*1 :DNANIMLH<OBIFMJKIG ==================================0 +53O(1 /IMHKEBFMKH<O)HK6L6JDJM<OLIEO9MLMJGMJFG ==========0 )%O(1* !NINHLDO)C<GJFGO/ =========================================' )%O(1( !NINHLDO)C<GJFGO// ========================================' C*B29=B6 ===============================================================================================

 





3-35#===========================================================================================! ?C+<?C3C450D'A?D7D3<4A?D<4D#<A-A( 9MBENIMGO ALKHJI>O JIO KMCNHO EJGFJ@DJINGO 4CKO 4LIMO MKO AJIKHO JIO JKDK><O LHN HNBJHNEOMKOFKA@DNMNOMCNO?KDDK4JI>OFKBHGNG /-O*10 !NINHLDOKKDK>< ========================================== ' /-O(1' !NINHLDOKMLI< ============================================ ' /-O(1 !NINHLDO+JFHK6JKDK>< =================================== ' /-O01 !NINHLDO:FKDK>< ========================================== ' /-O'10 %BALIO)C<GJKDK>< ======================================= ' 3-35#======================================================================= 

)HN2ANEJFLDOLIEO@HN2IBHGJI>OGMBENIMGOAL<OML&NO/-O(1O%BALIO)C<GJ2 KDK><OLIEO5ILMKA<O//OJIODJNBOK?O/-O'10O%BALIO)C<GJKDK><OL?MNHOFKA@DNMJI> /-O(1O%BALIO)C<GJKDK><OLIEO5ILMKA<O/OKHO/-O(11O5ILMKA<OLIEO)C<G2 JKDK><O?KHO%NLDMCO9FJNIFNG=

9MBENIMGO 4CKO LHNO @DLIIJI>O MKO LMMNIEO >HLEBLMNO GFCKKDO KHO MKO @BHGBNO L HNGNLHFCOFLHNNHOLHNOLE;JGNEOMKOML&NO+53O(1*O8LDFBDBGO/ 103


MORRIS COLLEGE CATALOG ;+??<;+-+3D'A?D5/CD#7;/C-A?DA'D0;<C4;CD,C(?CC <5/D7D37A?D<4 #<A-A( FRESHMAN YEAR BIO 103 CIS 101 ENG 103 FRS 100 HIS 104 MAT 103

Fall Semester Cr. General Zoology ......................... 4 Introduction to Computers ......... 2 Fundamentals of Composition......................... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 16

BIO ENG FRS HIS MAT SPH

204 104 102 106 104 103

Spring Semester Cr. General Botany........................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Trigonometry ............................. 3 Voice and Speech Improvment .. 3 17

SOPHOMORE YEAR ART 101 BIO 201 CHM ENG MUS REL

101 202 101 201

Fall Semester Cr. Art Appreciation ......................... 2 Vertebrate Anatomy and Embryology .... 4 General Chemistry I.................... 4 Introduction to Literature ........... 3 Music Appreciation .................... 2 Literature and Religion of the Old Testament ...................... 3 18

BIO BIO CHM ENG

205 203 102 205

Spring Semester Cr. General Microbiology ................. 4 Research Methods .................... 4 General Chemistry II .................. 4 African American Literature........ 3 15

300 305 202 202

Spring Semester Cr. Cell and Molecular Biology......... 4 General Ecology ......................... 4 Organic Chemistry II .................. 4 General Physics II ...................... 4 16

JUNIOR YEAR BIO CHM JRS MAT

301 201 300 206

PHY 201

Fall Semester Cr. General Genetics ........................ 4 Organic Chemistry I ................... 4 Junior Seminar........................... 1 Introductory Probability and Statistics .............................. 3 General Physics I ....................... 4 16

BIO BIO CHM PHY

SENIOR YEAR BIO CHM HSC MAT REL

403 400 210 105 202

Fall Semester Cr. Human Physiology ..................... 4 Biochemistry .............................. 4 Health and Physical Education ... 3 Elementary Functions................. 3 Literature and Religion of the New Testament .......... 3 17

Spring Semester Cr. BIO 402 Biology Seminar......................... 3 PSY 201 General Psychology ................... 3 SOC 101 Principles of Sociology or GEO 201 World Regional Geography ........3 Electives ...................................................6 15

104


ACADEMIC DIVISIONS AND PROGRAMS REQUIREMENTS FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN BIOLOGY/SECONDARY EDUCATION General Education ......................................................................................55 Major Courses.............................................................................................24 BIO 201 Vertebrate Anatomy and Embryology ............................. 4 BIO 204 General Botany ............................................................... 4 BIO 300 Cell and Molecular Biology ............................................. 4 BIO 301 General Genetics ............................................................ 4 BIO 305 General Ecology ............................................................. 4 BIO 403 Human Physiology .......................................................... 4 Other Required Courses ............................................................................ 11 HIS 304

American History I .......................................................... 3 OR HIS 305 American History II ........................................................... JRS 300 Junior Seminar................................................................ 1 MAT 104 Trigonometry ................................................................... 3 MAT 206 Introductory Probability and Statistics............................. 3 SSC 100 Contemporary Affairs ...................................................... 1 Professional Education..............................................................................33 EDU 215 Human Development………………………… .................. 3 EDU 251 Foundations of Education ............................................... 3 EDU 302 Educational Psychology ................................................. 3 EDU 304 Educational Assessment and Evaluation ....................... 3 EDU 322 Foundations of Reading.................................................. 3 EDU 405 Educational Seminar....................................................... 3 EDU 406 Curriculum, Instruction and Assessment in Secondary School Science ........................................................... 3 EDU 409 Reading and Writing in the Content Areas...................... 3 EDU 412 Observation and Directed Teaching................................ 9 Electives ........................................................................................................6 TOTAL HOURS .....................................................................................129

105


MORRIS COLLEGE CATALOG CURRICULUM FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN BIOLOGY/SECONDARY EDUCATION

ART BIO CIS ENG FRS MAT SSC

BIO EDU ENG HIS SPH

101 103 101 103 100 103 100

201 251 202 106 103

FRESHMAN YEAR Fall Semester Art Appreciation ................................... 2 BIO General Zoology .................................... 4 ENG Introduction to Computers ..................... 2 FRS Fundamentals of Composition ................ 3 GEO Freshman Seminar I .............................. 1 HIS College Algebra .................................... 3 MAT Contemporary Affairs ............................ 1 Total................................................... 16

204 104 102 201 104 104

SOPHOMORE YEAR Fall Semester Vertebrae Anatomy and Embryology ...... 4 ENG 205 Foundations of Education ..................... 3 HSC 210 Introduction to Literature ...................... 3 MAT 206 African American History ...................... 3 MUS 101 Voice and Speech Improvement ........... 3 PSY 201 REL 201 Total ................................................. 16

Spring Semester General Botony ................................. 4 Research and Composition ................ 3 Freshman Seminar II ......................... 1 World Regional Geography ................ 3 World History .................................... 3 Trigonometry .................................... 3 Total............................................... 17

Spring Semester African American Literature ................. 3 Health and Physical Education ............. 3 Introductory Prob. and Statistics ........... 3 Music Appreciation.............................. 2 General Psychology ............................. 3 Literature and Religion of the Old Testament................................ 3 Total ................................................. 17

JUNIOR YEAR BIO EDU EDU EDU HIS

301 215 304 322 304

HIS 305

Fall Semester General Genetics ................................. 4 Human Growth and Development .......... 3 Educational Assessment and Evaluation 3 Foundations of Reading ........................ 3 American History I................................ 3 or American History II

BIO 300 BIO 305 EDU 302 JRS 300 REL202 Elective

Total.................................................... 16

Spring Semester Cell and Molecular Biology .................... 4 General Ecology .................................. 4 Educational Psychology ....................... 3 Junior Seminar ................................... 1 Literature and Religion of the New Testament ..................................... 3 .......................................................... 3 Total ................................................ 18

SENIOR YEAR BIO 403 EDU 406 EDU 409 PHS 100 Elective

Fall Semester Human Physiology ............................... 4 Curriculum, Instruction and Assessment in Secondary School Science ........... 3 Reading and Writing in the Content Area . 3 Physical Sciences ................................ 4 ........................................................... 3

Spring Semester EDU 405 Educational Seminar............................ 3 EDU 412 Observation and Directed Teaching ...... 9

Total.................................................. 17

Total ................................................. 12

106


ACADEMIC DIVISIONS AND PROGRAMS 4,@C736601C:3##@@&1:C+&610+C%63687 3CEEFBK 7CAAJ;JK GD?K H=JK DF+JEBFH2K C9K ,C>H=K 7GECAFDGK 7CAAJ;JK C9K &>EBFD; =G+JK JDHJEJ?K FDHCK GDK GEHF@>AGHFCDK G;EJJ<JDHK H=GHK JDG-AJBK 3CEEFBK 7CAAJ;J BH>?JDHBK HCK HEGDB9JEKHCK H=JK DF+JEBFH2KC9K,C>H=K7GECAFDGKG9HJEK@C<:AJHFD;KG D><-JEKC9K:EJD>EBFD;K@C>EBJBKGHK3CEEFBK7CAAJ;JKGD?KHCKJGEDKGKG@=JACEKC9 ,@FJD@JK )J;EJJK FDK &>EBFD;K GHK ,7K G9HJEK @C<:AJHFD;K H=JK >::JEK ?F+FBFCD D>EBFD;K@C>EBJBKH=JEJI 0DK CE?JEK HCK -JK JAF;F-AJK 9CEK G?<FBBFCDK HCK H=JK &>EBFD;K *EC;EG<K GHK ,7$ 3CEEFBK7CAAJ;JKBH>?JDHB 8I 3>BHK <GFDHGFDK GK @><>AGHF+JK ;EG?JK :CFDHK G+JEG;JK !*6#K C9K .IK CE =F;=JEI .I 3>BHK JGEDK GK ;EG?JK C9K DCK AJBBK H=GDK 7 K CDK GD2K 3CEEFBK 7CAAJ;JK :EJ D>EBFD;K@C>EBJBKHCK-JKHEGDB9JEEJ?KHCK ,7I 4I 7GDK9>= EJ:JGHK<CEJKH=GDKCDJKB@FJD@JKCEKD>EBFD;K@C>EBJK<CEJKH=GD >9BC=?/B FDKCE?JEKHCKJGEDKGK;EG?JKC9K 7I 1=JK9CAAC%FD;KBHF:>AGHFCDBKGABCKG::A2" 8I 1=JK @><>AGHF+JK ;EG?JK :CFDHK G+JEG;JK %FAAK -JK @C<:>HJ?K -GBJ?K CDK ;55 GHHJ<:HBK FDK ;55 @C>EBJBIK 6K FH=?EG%K GFAFD; K ;EG?JK #K GD?K GD

0D@C<:AJHJ K;EG?JK0#K%FAAKJG@=K-JK@CDBF?JEJ?KH=JKBG<JKGBKGK;EG?JKC9

 K9CEKH=JK:>E:CBJKC9K@GA@>AGHFD;KGKBH>?JDHBK;EG?JK:CFDHKG+JEG;JI .I 3CEEFBK7CAAJ;JKBH>?JDHBK?JBFEFD;KHCKHEGDB9JEKHCK ,7BK7CAAJ;JKC9K&>EBFD; <>BHKG::A2K9CEKG?<FBBFCDKG@@CE?FD;KHCKH=JK9CAAC%FD;KB@=J?>AJ" GI ,H>?JDHBK ?JBFEFD;K G?<FBBFCDK HCK H=JK DF+JEBFH2K 9CEK H=JK B:EFD;K HJE< <>BHKG::A2KDCKAGHJEKH=GDK)J@J<-JEK8I -I ,H>?JDHBK?JBFEFD;KG?<FBBFCDKHCKH=JK DF+JEBFH2K9CEKH=JK9GAAKHJE< <>BH G::A2KDCKAGHJEKH=GDK6>;>BHK8I @I ,H>?JDHBK ?JBFEFD;K G?<FBBFCDK HCK H=JK DF+JEBFH2K 9CEK H=JK B><<JE HJE<BK <>BHK G::A2K DCK AGHJEK H=GDK H%CK %JJBK :EFCEK HCK EJ;FBHEGHFCDK 9CE H=JKHJE<I 4I >AB?.9C #;9.-;.B"K ,H>?JDHBK HEGDB9JEEFD;K HCK H=JK ,7&>EBFD;K *ECK ;EG<K %=CK =G+JK DCHK B>@@JBB9>AA2K @C<:AJHJ?K = > 9CEJF;DK AGD;>G;J @C>EBJBK<>BHKHGJKH=JK DF+JEBFH2BKCEJF;DKGD;>G;JK*AG@J<JDHK1JBH GD?K@C<:AJHJK9CEJF;DKAGD;>G;JK@C>EBJBKEJ>FEJ?K-2KH=JKHJBHKEJB>AHBI

107


MORRIS COLLEGE CATALOG 1=JK EJ>FEJ?K :EJD>EBFD;K @C>EBJBK HCK -JK @C<:AJHJ?K GHK 3CEEFBK GEJK H=J 9CAAC%FD;" @9.5?<*C3-1"%3-1/////////////////////////////////////////////////////////////////////////// $ ,?<=>ACC(&.303+.30$$0'&#302).)3!*3-13023-1 023!*3"13023"1 3023&30+.23+'#+.2$. .$3+')02302). ////////////////

?9BC8A=<CC(&.303+.30$$0'&#302).)33-1-3023+'#+.2%333-1023+'#+.2%3023!3,-1%3"-1%3023",13///////////////////////////////////////////////// !

7;=*B/;=?2<C3,1-3&33,13 ////////////////////////////////////////////////// $ @(-2;=?>9C;9(C1>2?;5C12?B92B<CC //////////////////////////////////////////////////////// $ 1CK-JKBJAJ@HJ?K%FH=KG?+FBJ<JDHKGHK ,7 12?B92B< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD ! !3,1-,1,3(2#&'3+.')23*3&3** ///////////////////////3!2)/

*(3,113023 *(3,1 %3 *(3,1 %3 *(31"3023 *( ,1 ///////-,3!2)/ @5B2=?B< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD $$$

&CHJ"K73K858KFBKGK:EJEJ>FBFHJK9CEK73K.58I

108


ACADEMIC DIVISIONS AND PROGRAMS 4,@C784,@7840:1C8+' 784,@7840:11@:3+'86C@'&:8403+C78361 4,@C784,7840:1C%63687 3 B2=?B< 1=JKC- J@HF+JBKC9KH=JK3GH=J<GHF@BK:EC;EG<KGEJKGBK9CAAC%B" 8IK)J+JAC:K:EC9F@FJD@2KFDK@C<:>HGHFCDGAK<GH=J<GHF@BKGD?KFDKH=JK>BJKC9 H=JKB2<-CAF@KAGD;>G;JKC9K<GH=J<GHF@BI .IK/DG-AJKH=JKBH>?JDHKHCKG::A2K<GH=J<GHF@BKHCKGK%F?JKEGD;JKC9K:EC-AJ<B FDKJ+JE2?G2KAF9JKGD?KFDKEJAGHJ?KG@G?J<F@K?FB@F:AFDJBI 4IK)J+JAC:KFDKH=JKBH>?JDHKGDKG::EJ@FGHFCDKC9KH=JKECAJKC9K<GH=J<GHF@BKFD H=JK@>AH>EJKC9KH=JK:GBHKGBK%JAAKGBKH=JK:EJBJDHI (IK*EJ:GEJKH=JKBH>?JDHK9CEK@CDHFD>J?KBH>?2KC9K<GH=J<GHF@BKGHKGD G?+GD@J?KAJ+JAI K*EJ:GEJKFDHJEJBHJ?KBH>?JDHBK9CEKEJBJGE@=$K;C+JED<JDHGA$KGD? FD?>BHEFGAHJ@=DCAC;F@GAKAJG?JEB=F:KECAJBI #B;A9?9.C3-=2>/B<C>AC=*BC7;=*B/;=?2<C%A>.A;/ :CDK@C<:AJHFCDKC9KH=JK3GH=J<GHF@BK?J;EJJK:EC;EG<$K;EG?>GHJBK%FAA 8IK6DGA2 JKGD?KBCA+JK:EC-AJ<BKFDKBJHB$KAC;F@KGD?KGA;J-EGF@KBHE>@H>EJB .IK ,CA+JK <GH=J<GHF@GAK 9>D@HFCDBK :CA2DC<FGA$K J :CDJDHFGAK GD? AC;GEFH=<F@$KHEF;CDC<JHEF@KGD?K<>AHF+GEFG-AJ# 4IK,CA+JKGA;J-EGF@$KGD?KHEF;CDC<JHEF@KJ>GHFCDB (IK 7CDBHE>@HK :ECC9BK FDK BJHB$K FDHJ;JEB$K ;EC>:B$K ;JC<JHEF@K GD?K FD?>@HF+J GD?K?J?>@HF+JK:ECC9B IK J@C;DF JK :GHHJEDBK FDK 9CE<>AGB$K <GH=J<GHF@GAK E>AJBK GD?K ;JC<JHEF@ 9F;>EJB IK )J+JAC:K <GH=J<GHF@GAK <C?JABK FDK :EC-G-FAFH2$K ?F99JEJDHFGAK J>GHFCDB GD?K:=2BF@B IK7C<:EJ=JD?K=FBHCE2$K?F+JEBFH2$K+C@G->AGE2KGD?K<GH=J<GHF@KB2<-CAB IKJK:EJ:GEJ?K9CEK;EG?>GHJ$KEJBJGE@=KGD?K;C+JED<JDHGAKGD?KFD?>BHEFGA HJ@=DCAC;F@GAKAJG?JEB=F:KECAJB

109


MORRIS COLLEGE CATALOG 4,@C784,@7840:11@:3+'86C@'&:8403+C%63687 3 B2=?B<C>C=*BC7;=*B/;=?2<1B2>9(;AC@(-2;=?>9C%A>.A;/ 1=JKC- J@HF+JBKC9KH=JK3GH=J<GHF@B,J@CD?GE2K/?>@GHFCDK:EC;EG<KGEJKGB 9CAAC%B" 8IK 1CK ?J+JAC:K GK BC>D?K >D?JEBHGD?FD;K C9K H=JK -GBF@K @CD@J:HBK GD? <JH=C?BK C9K <GH=J<GHF@BK GD?K =C%K HCK HJG@=K H=JK 8.K ,C>H=K 7GECAFDG 7>EEF@>A><K,HGD?GE?BI .IK 1CK ?J+JAC:K :EC9F@FJD@2K FDK @C<:>HGHFCDGAK <GH=J<GHF@BK GD?K FDK H=JK >BJ C9KH=JKB2<-CAF@KAGD;>G;JKC9K<GH=J<GHF@BI 4IK 1CK JDG-AJK H=JK @GD?F?GHJK HCK G::A2K <GH=J<GHF@BK HCK GK %F?JK EGD;JK C9 :EC-AJ<BKFDKJ+JE2?G2KAF9JKGD?KFDKEJAGHJ?KG@G?J<F@K?FB@F:AFDJBI (IK 1CK ?J+JAC:K FDK H=JK @GD?F?GHJK GDK G::EJ@FGHFCDK C9K H=JK ECAJK C9 <GH=J<GHF@BKFDKH=JK@>AH>EJKC9KH=JK:GBHKGBK%JAAKGBKH=JK:EJBJDHI IK 1CK :EJ:GEJK H=JK @GD?F?GHJK 9CEK @CDHFD>J?K BH>?2K C9K <GH=J<GHF@BK GHK GD G?+GD@J?KAJ+JAI IK1CK:EJ:GEJKH=JK@GD?F?GHJKHCKHJG@=K<GH=J<GHF@BKGHKH=JKBJ@CD?GE2KAJ+JA -2K <JJHFD;K H=JK 9CAAC%FD;K BHGD?GE?B"K 7C>D@FAK 9CEK H=JK 6@@EJ?FHGHFCDK C9 /?>@GHCEK*EJ:GEGHFCDK76/*#KGD?KH=JK&GHFCDGAK7C>D@FAKC9K1JG@=JEBKC9 3GH=J<GHF@BK&713#I IK1CK<GJKH=JK@GD?F?GHJKG%GEJKC9KDJ%K?J+JAC:<JDHBKGD?KHJ@=DCAC;2KFD <GH=J<GHF@BK FDK CE?JEK HCK 9CBHJEK FDK H=J<K H=JK ?JBFEJK 9CEK @CDHFD>C>B AJGEDFD;KH=EC>;=KEJBJGE@=KGD?KJ :JEF<JDHGHFCDI #B;A9?9.C3-=2>/B<C>AC=*BC7;=*B/;=?2<1B2>9(;AC@(-2;=?>9 %A>.A;/ :CDK @C<:AJHFCDK C9K H=JK 3GH=J<GHF@BK ,J@CD?GE2K /?>@GHFCDK ?J;EJJ :EC;EG<$K;EG?>GHJBK%FAA 8I 6DGA2 JKGD?KBCA+JK:EC-AJ<BKFDKBJHB$KAC;F@KGD?KGA;J-EGF@KBHE>@H>EJB .I )JB@EF-JK <GH=J<GHF@GAK 9>D@HFCDBK :CA2DC<FGA$K J :CDJDHFGAK GD? AC;GEFH=<F@$KHEF;CDC<JHEF@KGD?K<>AHF+GEFG-AJ# 4I ,CA+JKGA;J-EGF@$KGD?KHEF;CDC<JHEF@KJ>GHFCDB (I 7CDBHE>@HK :ECC9BK FDK BJHB$K FDHJ;JEB$K ;EC>:B$K ;JC<JHEF@K GD?K FD?>@HF+J GD?K?J?>@HF+JK:ECC9B I J@C;DF JK :GHHJEDBK FDK 9CE<>AGB$K <GH=J<GHF@GAK E>AJBK GD?K ;JC<JHEF@ 9F;>EJB I )J+JAC:K<GH=J<GHF@GAK<C?JABKFDK:EC-G-FAFH2KGD?K:=2BF@B I 7C<:EJ=JD?K=FBHCE2$K?F+JEBFH2$K+C@G->AGE2KGD?K<GH=J<GHF@KB2<-CAB I JK:EJ:GEJ?K9CEKH=JK*60,K00K/ G<FDGHFCD I JK :EJ:GEJ?K HCK HJG@=K <GH=J<GHF@BK GHK H=JK BJ@CD?GE2K B@=CCAK AJ+JAK -2 <JJHFD;KH=JK76/*&713KBHGD?GE?B

110


ACADEMIC DIVISIONS AND PROGRAMS 6@&06@7@+41C 36C4,@C8:,@#36C3 C1:0@+:@C'@6@@ 04,C8C7836C0+ 784,@7840:1 B9BA;5C@(-2;=?>9 DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CC$) 7;>AC:>-A<B< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD C C ! 361K.58 7GA@>A>BK0 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K.54 ,JHK1=JCE2KGD?KC;F@ IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K.5 0DHEC?>@HCE2K*EC-G-FAFH2KGD?K,HGHFBHF@B IIIIIIIIIIIII 4 361K.85 7GA@>A>BK00 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K454 FDJGEK6A;J-EG IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K45( 6-BHEG@HK6A;J-EG IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K485 7GA@>A>BK000 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K4.5 7GA@>A>BK0 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K(58 7CAAJ;JK!JC<JHE2IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K(5. 6?+GD@J?K*EC-G-FAFH2KGD?K,HGHFBHF@B IIIIIIIIIIIIIIII 4 361K(54 )F99JEJDHFGAK/>GHFCDB IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K(5( /AJ<JDHGE2K&><-JEK1=JCE2 IIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K(5 6?+GD@J?K7GA@>A>B IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K(8. 3GH=J<GHF@BK,J<FDGE IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 3=*BAC6B-?AB(C:>-A<B< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD )! 70,K485 0DHEC?>@HFCDKHCK7C<:>HJEK*EC;EG<<FD; IIIIIIIIII 4 ,K455 >DFCEK,J<FDGE IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 8 *K.58 !JDJEGAK*=2BF@BK0 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ( *K.5. !JDJEGAK*=2BF@BK00 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ( @5B2=?B< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD ) 1'16 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII )! 6@&06@7@+41C 36C8C70+36C0+C784,@7840:1 ,H>?JDHBK<G CEFD;KFDKCH=JEK?FB@F:AFDJBK%=CK%GDHKHCK<FDCEKFDK<GH=J<GHF@B GEJKEJ>FEJ?KHCK@C<:AJHJKH=JK9CAAC%FD;K@C>EBJB" 361K85( 1EF;CDC<JHE2 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K85 /AJ<JDHGE2K>D@HFCDB IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K.58 7GA@>A>BK0 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K.54 ,JHK1=JCE2KGD?KC;F@ IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K.5 0DHEC?>@HCE2K*EC-G-FAFH2KGD?K,HGHFBHF@B IIIIIIIIIIIII 4 361K.85K 7GA@>A>BK00 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 1'16 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII K) KKKK REQUIREMENTS FOR A MINOR IN COMPUTER SCIENCE 6WXGHQWVPDMRULQJLQRWK HUGLVFLSOLQHVZK RZDQWWRPLQRULQ& RPSXWHU6FLHQFH are required to complete the following courses: CSC 101: Introduction to Computer Science and Program Logic .. 3 CSC 102: Computer Programming I .................................. 4 CSC 201: Computer Programming II ................................ 4 CSC 202: Data Structures and Algorithms ........................ 3 CSC 310: Operating Systems and Network Fundamentals .. 3 CSC 320: Database Design and Princi ples ...................... 3 TOTAL ...........................................................................20 hours REQUIREMENTS FOR A MINOR IN CYBER SECURITY 6WXGHQWVPDMRULQJLQRWK HUGLVFLSOLQHVZK RZDQWWRPLQRULQ& \EHU6HFXULW\DUH required to complete the following courses: CSS 103: Introduction to Cybersecurity ............................ 3 CSS 104: Python Programming ........................................ 4 CSS 300 Operating Systems ............................................ 3 CSC 320 Database Design and Principles ....................... 3 CSS 420 Computer Security and Networks I ................... 4 CSS 440 Computer Security and Networks II .................. 3 TOTAL ...........................................................................20 hours 111


MORRIS COLLEGE CATALOG :&660:&#&7C 36C4,@C8:,@#36C3 C1:0@+:@C'@6@@ 04,C8C7836C0+ 784,@7840:1 FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar .....................I 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement........................ 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 College Algebra and Trigonometry ....................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 17 BIO ENG FRS HIS MAT

100 104 102 106 104

SOPHOMORE YEAR ART 101 HSC 210 ENG 202 MAT 105 MAT 206 REL 201

Fall Semester Cr. Art Appreciation ......................... 2 Health and Physical Education ............................. 3 Introduction to Literature ........... 3 Elementary Functions................. 3 Introductory Probability and Statistics .............................. 3 Literature and Religion of the Old Testament ...................... 3 17

ENG MAT MAT PSY REL

205 201 203 201 202

Spring Semester Cr. African American Literature........ 3 Calculus I ................................... 3 Set Theory and Logic ................. 3 General Psychology ................... 3 Literature and Religion of the New Testament .................... 3 15

JUNIOR YEAR CIS

310

JRS 300 MAT 210 MAT 303 PHS 100 Elective

Fall Semester Cr. Introduction to Computer Programming ....................... 3 Junior Seminar........................... 1 Calculus II .................................. 3 Linear Algebra ............................ 3 Physical Sciences....................... 4 ...................................................3 17

Spring Semester Cr. MAT 310 Calculus III ................................. 3 MAT 304 Abstract Algebra......................... 3 MUS 402 Advanced Probability and Statistics ....................... 3 MUS 101 Music Appreciation .................... 2 Electives ................................................... 5 16

SENIOR YEAR MAT 320 MAT 401 MAT 403 PHY 201 Elective

Fall Semester Cr. Calculus IV ................................. 3 College Geometry....................... 3 Differential Equations ................. 3 General Physics I ....................... 4 ................................................... 3 16

MAT 404 MAT 405 MAT 412 PHY 202 Elective

112

Spring Semester Cr. Elementary Number Theory........ 3 Advanced Calculus ..................... 3 Mathematics Seminar ................ 3 General Physics II ...................... 4 ................................................... 3 16


ACADEMIC DIVISIONS AND PROGRAMS REQUIREMENTS FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN MATHEMATICS/SECONDARY EDUCATION General Education ......................................................................................61 Major Courses.............................................................................................27 MAT 201 Calculus I ........................................................................ 3 MAT 203 Set Theory and Logic...................................................... 3 MAT 204 Discrete Mathematics ..................................................... 3 MAT 206 Introductory Probability and Statistics............................. 3 MAT 210 Calculus II ....................................................................... 3 MAT 303 Linear Algebra................................................................. 3 MAT 304 Abstract Algebra ............................................................. 3 MAT 401 College Geometry ........................................................... 3 MAT 404 Elementary Number Theory............................................ 3 Other Required Courses ............................................................................12 CIS 310 Introduction to Computer Programming.......................... 3 HIS 304 American History I ............................................................ OR HIS 305 American History II ......................................................... 3 JRS 300 Junior Seminar................................................................ 1 PHY 201 General Physics I............................................................ 4 SSC 100 Contemporary Affairs ...................................................... 1 Professional Education..............................................................................33 EDU 215 Human Growth and Development .................................. 3 EDU 251 Foundations of Education ............................................... 3 EDU 302 Educational Psychology ................................................. 3 EDU 304 Educational Assessment and Evaluation ........................ 3 EDU 322 Foundations of Reading………………………….............. 3 EDU 405 Educational Seminar....................................................... 3 EDU 409 Reading and Writing in the Content Areas...................... 3 EDU 412 Observation and Directed Teaching................................ 9 EDU 413 Curriculum, Instruction and Assessment in Secondary School Mathematics .................................................. 3 Electives ........................................................................................................6 TOTAL HOURS .....................................................................................139

113


MORRIS COLLEGE CATALOG CURRICULUM FOR THE BACHELOR OF SCIENCE DEGREE WITH A MAJOR IN MATHEMATICS/SECONDARY EDUCATION

ART 101 CIS 101 ENG 103 FRS 100 HIS 104 MAT 103 SPH 103 SSC 100

FRESHMAN YEAR Fall Semester Art Appreciation ........................................2 ENG 104 Introduction to Computers .........................2 GEO 201 Fundamentals of Composition ....................3 HIS 106 Freshman Seminar ....................................1 MAT 104 World History ............................................3 MAT 105 College Algebra.........................................3 REL 201 Voice and Speech Improvement .................... 3 Contemporary Affairs ............................ 1 Total 18

Spring Semester Research and Composition ...................3 World Regional Geography ....................3 African American History.......................3 Trigonometry ........................................3 Elementary Functions ...........................3 Literature and Religion of the Old Testament.3

Total

18

BIO 100 EDU 251 ENG 202 FRS 102 MAT 201 MAT 206

SOPHOMORE YEAR Fall Semester Biological Sciences ............................... 4 ENG 205 Foundations of Education ...................... 3 MAT 203 Introduction to Literature ....................... 3 MAT 204 Freshman Seminar II ............................. 1 MUS 101 Calculus ............................................... 3 PSY 201 Introductory Probability and Stat............. 3 REL 202 Total 17

Spring Semester African American Literature ............... 3 Set Theory and Logic ........................ 3 Discrete Mathematics ....................... 3 Music Appreciation ........................... 2 General Psychology…… .................. 3 Literature and Religion of the New Testament 3 Total

17

Summer Session HSC 210 Health and Physical Education ....... 3 Elective .................................................... 3 Elective .................................................... 3 Total 9

JUNIOR YEAR Fall Semester Spring Semester CIS 310 Introduction to Computer Programming. . 3 EDU 215 Human Growth and Development ....... 3 EDU 304 Educational Assessment and Evaluation. 3 EDU 302 Educational Psychology ..................... 3 EDU 322 Foundations of Reading ......................... 3 HIS 304 American History I............................. 3 or MAT 210 Calculus II ............................................ 3 HIS 305 American History II MAT 303 Linear Algebra ...................................... 3 JRS 300 Junior Seminar ................................. 1 MAT 304 Abstract Algebra ............................... 3 PHS 100 Physical Sciences ............................. 4 Total 15 Total 17

EDU 409 EDU 413 MAT 401 MAT 404 PHY 201

SENIOR YEAR Fall Semester Spring Semester Reading and Writing in the Content Areas 3 EDU 405 Educational Seminar ......................... 3 Curriculum, Instruction and Assessment in EDU 412 Observation and Directed Teaching .... 9 Secondary Schools Mathematics ...... 3 College Geometry ................................. 3 Elementary Number Theory ................... 3 General Physics I .................................. 4 Total 16 Total 12

114


ACADEMIC DIVISIONS AND PROGRAMS 7>AA?<C:>55B.BCC&1: %AB@9.?9BBA?9.C%A>.A;/ 6B-?AB(C:>-A<B<C=>CBC:>/5B=B(C;=C7>AA?<C:>55B.B 7;=*B/;=?2<DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD 361K.58" 7GA@>A>BK0IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K.85" 7GA@>A>BK00IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K485" 7GA@>A>BK000IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K4.5" 7GA@>A>BK0IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K(54" )F99JEJDHFGAK/>GHFCDBIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4

)C

&'1/," 361K85K/AJ<JDHGE2K>D@HFCDB#KFBK:EJEJ>FBFHJK9CEK7GA@>A>BK0 361K85(K1EF;CDC<JHE2#KFBK:EJEJ>FBFHJK9CEK361K85 %*<?2<DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD *K.54" 7GA@>A>B-GBJ?K*=2BF@BK8IIIIIIIIIIIIIIIIIIIIIIIIIII ( *K.5(" 7GA@>A>B-GBJ?K*=2BF@BK00IIIIIIIIIIIIIIIIIIIIIIIIIIII (

C

&'1/" *K.58.5.K!JDJEGAK*=2BF@BK0KGD?K00#KGEJK:EJEJ>FBFHJBK9CEK*K.54 :*B/?<=ADDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD )$ CEK6AAK6EJGBKC9K/D;FDJJEFD; 73K858" !JDJEGAK7=J<FBHE2K0IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ( 73K85." !JDJEGAK7=J<FBHE2K00IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ( CEK7=J<F@GAK/D;FDJJEFD;K'DA2 'E;GDF@K7=J<FBHE2K0IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ( 73K.58" 73K.5." 'E;GDF@K7=J<FBHE2K00IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ( &'1/" 73K.58.5.K<G2K-JK>BJ?KGBKJAJ@HF+JBK9CEKFC<J?F@GAK/D;FDJJEFD; #? BA;5C8A=<C;9(C1>2?;5C12?B92B<DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD )))! /D;AFB=KK=C>EB# /&!K854" >D?G<JDHGABKC9K7C<:CBFHFCDIIIIIIIIIIIIIIIIIIII 4 /&!K.5." 0DHEC?>@HFCDKHCKFHJEGH>EJIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 &'1/" /&!K85("KJBJGE@=KGD?K7C<:CBFHFCDKFBK:EJEJ>FBFHJK9CEK/&!K.5. FDJK6EHBK.4K=C>EB#"K'&/KC9KH=JK9CAAC%FD;K@C>EBJB 61K858" 6EHK6::EJ@FGHFCDIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 3 ,K858" 3>BF@K6::EJ@FGHFCDIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 3 ,K..8" 69EF@GDK6<JEF@GDK3>BF@IIIIIIIIIIIIIIIIIIIIIIIIIIIIII ,*K.85" 0DHEC?>@HFCDKHCK1=JGHJEIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ,*K4.5" 3C?JEDK)EG<GIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII

. . 4 4 4

&'1/" 1=JEJKGEJKCH=JEK@C>EBJBKFDKH=FBK@GHJ;CE2KEJ>FEJ?K-2K+GEFC>BKJD;FDJJEFD; :EC;EG<BKGHK ,7KH=GHK+GE2K-2K?J:GEH<JDHI FBHCE2K4K=C>EB#"KGD2K=FBHCE2K@C>EBJIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 1'16K=C>EBKC9KH=JK@C>EBJBKAFBHJ?KG-C+J %FH=C>HK:EJEJ>FBFHJBIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII !) &'1/," 8IK ,H>?JDHBK -J;FDK H=JFEK BH>?FJBK GHK 3CEEFBK 7CAAJ;JK HCK @C<:AJHJK H=JK G-C+J :EJJD;FDJJEFD;K EJ>FEJ<JDHBK GD?K H=JDK HEGDB9JEK HCK H=JK DF+JEBFH2K C9 ,C>H=K7GECAFDGKHCK@C<:AJHJKH=JFEKJD;FDJJEFD;K?J;EJJKEJ>FEJ<JDHBI 115


MORRIS COLLEGE CATALOG .I )J:JD?JDHKCDKH=JFEK=F;=KB@=CCAKEJ@CE?KFDK<GH=J<GHF@BKGD?KH=JK@CAAJ;J :AG@J<JDHKB@CEJKFDK<GH=J<GHF@B$KBH>?JDHBK<G2K=G+JKHCK@C<:AJHJK<CEJK =C>EBK FDK <GH=J<GHF@BK JI;I$K )36K 85885.$K 361K 854$K 85(K GD?K 85# -J9CEJKJDECAAFD;KFDK7GA@>A>BK0I 4I *K.58KGD?K.5.KGEJK:EJEJ>FBFHJBK9CEK*K.54KGD?K.5(I (I 6AAK*EJJD;FDJJEFD;KBH>?JDHBK<>BHK@C<:AJHJK73K858KGD?K73K85.I I 7=J<F@GAK/D;FDJJEDF;KBH>?JDHBK<>BHK@C<:AJHJK73K85885.KGD?K73 .58.5.I I 1=JK @C>EBJBK AFBHJ?K G-C+JK GEJK HEGDB9JEG-AJK HCK ,7K F9K @C<:AJHJ?K %FH= ;EG?JBKC9K7KCEK=F;=JEKGD?KGK!*6KC9KGHKAJGBHK.II I ,H>?JDHBKBJJFD;KG?<FBBFCDKFDHCKH=JK/D;FDJJEFD;K*EC;EG<KGHK ,7K<>BH =G+JK@C<:AJHJ?KGHKAJGBHK45K@EJ?FHK=C>EBKGD?K>:KHCK8K@EJ?FHK=C>EB#KC9 :EJJD;FDJJEFD;K@C>EBJBKAFBHJ?KG-C+J#KGHK3CEEFBK7CAAJ;JK%FH=KGHKAJGBHKG .IK!*6I I /D;FDJJEFD;K:EC;EG<BK@C+JEJ?KFDKH=FBKG;EJJ<JDHKGEJ" KFC@=J<F@GAK/D;FDJJEFD; K7=J<F@GAK/D;FDJJEFD; K7F+FAK/D;FDJJEFD; K7C<:>HJEK/D;FDJJEFD; K/AJ@HEF@GAK/D;FDJJEFD; K3J@=GDF@GAK/D;FDJJEFD;

116


ACADEMIC DIVISIONS AND PROGRAMS 7>AA?<C:>55B.BCC:5B/<>9C%AB@9.?9BBA?9.C%A>.A;/ :*B/?<=ADDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD 73K85885. !JDJEGAK7=J<FBHE2K0KGD?K00 IIIIIIIIIIIIIIIIIIIIII  73K.58.5. 'E;GDF@K7=J<FBHE2K0KGD?K00 IIIIIIIIIIIIIIIIIIIIII 

)$CC

7;=*B/;=?2< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD 361K.58 7GA@>A>BK0IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K.85 7GA@>A>BK00IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K485 7GA@>A>BK000IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K4.5 7GA@>A>BK0 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 361K(54 )F99JEJDHFGAK/>GHFCDB IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4

)CC

%*<?2< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD *K858 0DHEC?>@HFCDKHCK/D;FDJJEFD;K IIIIIIIIIIIIIIIIIIIII 8 *K.54.5( 7GA@>A>B-GBJ?K*=2BF@BK0KGD?K00 IIIIIIIIIIIIIII  *K458 3GH=J<GHF@GAK*=2BF@BIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4

)!CC

@9.5?<*C:>/><?=?>9C;9(C#?=BA;=-ABDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD /&!K854 >D?G<JDHGABKC9K7C<:CBFHFCDIIIIIIIIIIIIIIIIII 4 /&!K85( JBJGE@=KGD?K7C<:CBFHFCD IIIIIIIIIIIIIIIIIIIIII 4 /&!K.5. 0DHEC?>@HFCDKHCKFHJEGH>EJ IIIIIIIIIIIIIIIIIIIIIIIIII 4 /&!K45 6<JEF@GDKFHJEGH>EJK0 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4

)!CC

,-/;9?=?B<1>2?;5C12?B92B<C@5B2=?B< DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD /7'K458 *EFD@F:AJBKC9K/@CDC<F@BK0 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 4 /&!K.5 69EF@GDK6<JEF@GDKFHJEGH>EJ IIIIIIIIIIIIIIIIIIIIIIIIIIII 4

$CC

:>/-=BAC09>A/;=?>9C12?B92B DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD 70,K858 0DHEC?>@HFCDKHCK7C<:>HJEB IIIIIIIIIIIIIIIIIIIIIIIIIIIIII . 70,K485 0DHEC?>@HFCDKHCK7C<:>HJEK*EC;EG<<FD; IIIIIIIII 4 1'16 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII

CC $$

&'1/," 8I )J:JD?FD;K CDK =FB=JEK :AG@J<JDHK B@CEJK FDK <GH=J<GHF@B$K H=JK BH>?JDHK <G2 =G+JK HCK @C<:AJHJK <CEJK =C>EBK FDK <GH=J<GHF@BK JI;IK )36K 858$K 85.$K 361 854$K85(KGD?K85#KH=GDKH=CBJKB=C%DKG-C+JI .IK1=JK=C>EBKAFBHJ?KG-C+JKGEJKHEGDB9JEG-AJKHCK7AJ<BCDK DF+JEBFH2KF9K@C<K:AJHJ? %FH=K;EG?JBKC9K 7 KCEK=F;=JEI 4IK6K BH>?JDHK %FH=K ;EG?JBK DCK AC%JEK H=GDK 7 K FDK ;55C @C>EBJBK EJ>FEJ?K 9CEK H=FB :EC;EG<K GD?K GK !*6K C9K GHK AJGBHK .I(I5K FBK GBB>EJ?K C9K G?<FBBFCDK FDHCK H=J 7AJ<BCDKJD;FDJJEFD;K:EC;EG<KC9K=FB=JEK@=CF@JI (IK1=JKHCHGAKD><-JEKC9K=C>EBKEJ>FEJ?K-2K7AJ<BCDK DF+JEBFH2KEGD;JBK9EC<K84 HCK8(K?J:JD?FD;KCDKH=JK9FJA?KC9KJD;FDJJEFD;KH=JKBH>?JDHK%FAAK9CAAC%IK6EJGB C9KJD;FDJJEFD;K@C+JEJ?KFDKH=FBK:EC;EG<KGEJ"K6;EF@>AH>EGAK/D;FDJJEFD;K6;/$ 84K =EBI#$K 7=J<F@GAK /D;FDJJEFD;K 7=/K 8((K =EBI#K /AJ@HEF@GAK /D;FDJJEFD; /@/$K84K=EBI#$K3J?F@GAK/D;FDJJEFD;K3/$K8(4K=EBI#$K/D;FDJJEFD;K6DGA2BFB /6K 84K =EBI#K GD?K 7JEG<F@K /D;FDJJEFD;K 7E/$K 84K =EBI#K :5B/<>9 %AB?B< IK'DKH=JKG+JEG;J$K7AJ<BCDK/D;FDJJEFD;KBH>?JDHBKHGJK(IK2JGEBKHCK@C<K:AJHJ H=JKEJ>FEJ<JDHBK9CEK;EG?>GHFCDI IK*EJJD;FDJJEFD;K BH>?JDHBK GEJK JD@C>EG;J?K ->HK DCHK EJ>FEJ?#K HCK GHHJD? B><<JEKB@=CCAKGHK7AJ<BCDK9CAAC%FD;KH=JK@C<:AJHFCDKC9KH=JFEK%CEKGHK3CEEFB GD?KHGJK@JEHGFDK-GBF@K JD;FDJJEFD;K@C>EBJBKFDKCE?JEKHCKJGBJKH=JKHEGDBFHFCD FDHCK JD;FDJJEFD;K @C>EBJ%CEK GD?K 9G@FAFHGHJK HF<JA2K @C<:AJHFCDK C9K H=J :EC;EG<I IK,H>?JDHBKB=C>A?KG::A2KHCKH=JK7AJ<BCDK DF+JEBFH2K'99F@JKC9K6?<FBBFCDK9CE G?<FBBFCDKG9HJEK@C<:AJHFD;KH=EJJKBJ<JBHJEBKC9KH=JKG-C+JK@C>EBJBI 117


MORRIS COLLEGE CATALOG '-;5C'B.ABBC%A>.A;/C?9C7;=*B/;=?2<C;9(C@9.?9BBA?9.CB= BB9 7>AA?<C:>55B.BC;9(C+>A=*C:;A>5?9;C8CC4C1=;=BC&9?BA<?= 1=JK )>GAK )J;EJJK *EC;EG<K FDK <GH=J<GHF@BK GD?K JD;FDJJEFD;K -JH%JJD 3CEEFBK7CAAJ;JKGD?K&CEH=K7GECAFDGK6KK1K,HGHJK DF+JEBFH2K&761#K<GJBKFH :CBBF-AJK 9CEK BH>?JDHBK HCK GHHJD?K 3CEEFBK 7CAAJ;JK 9CEK G::EC F<GHJA2K H=EJJ G@G?J<F@K2JGEBKGD?KH=JDKHCKHEGDB9JEKHCK&CEH=K7GECAFDGK6KK1K,HGHJK DF+JEBFH2 9CEK G::EC F<GHJA2K H%CK G@G?J<F@K 2JGEBIK K 69HJEK @C<:AJHFD;K H=JK G@G?J<F@ EJ>FEJ<JDHBKC9KH=JKH%CKFDBHFH>HFCDB$KH=JKBH>?JDHBK%FAAK-JKG%GE?J?KGKG@=JACE C9K ,@FJD@JK ?J;EJJK FDK <GH=J<GHF@BK 9EC<K 3CEEFBK 7CAAJ;JK GD?K GK G@=JACEK C9 ,@FJD@JK ?J;EJJK FDK JD;FDJJEFD;K 9EC<K &761IK K ,H>?JDHBK :>EB>FD;K H=JK )>GA )J;EJJK*EC;EG<K<G2K-JK CFDHA2KJDECAAJ?KGHK-CH=KFDBHFH>HFCDBI )>GAK)J;EJJK*EC;EG<KBH>?JDHBK%FAAK-JKJAF;F-AJKHCK:>EB>JKGKI,IK?J;EJJ GHK&761KFDKGD2KC9KH=JK9CAAC%FD;KGEJGBKC9KJD;FDJJEFD;" K6E@=FHJ@H>EGAK/D;FDJJEFD; K7C<:>HJEK/D;FDJJEFD; KFCAC;F@GAK/D;FDJJEFD; K/AJ@HEF@GAK/D;FDJJEFD; K7=J<F@GAK/D;FDJJEFD; K0D?>BHEFGAK/D;FDJJEFD; K7F+FAK/D;FDJJEFD; K0DHJE?FB@F:AFDGE2K!JDJEGAK/D;FDJJEFD; K3J@=GDF@GAK/D;FDJJEFD; '-;5C'B.ABBC%A>.A;/C8(/?<<?>9C6B-?AB/B9=<C;=C7>AA?<C:>55B.B 1CK-JKG@@J:HJ?KFDHCKH=JK)>GAK)J;EJJK*EC;EG<$KGKBH>?JDH"K<>BHK=G+JKGK  G+JEG;JKFDK<GH=J<GHF@BKGD?KGK4I5K!*6KGHKH=JKJD?KC9K=FBKK=JEK9FEBHK2JGEKGH 3CEEFBK7CAAJ;JI 8C'-;5C'B.ABBC%A>.A;/C<=-(B9=C/-<=C2>/5B=BC=*BC>55> ?9. AB-?AB/B9=<C;=C7>AA?<C:>55B.B 8#KK5K=C>EBKC9K;JDJEGAKJ?>@GHFCDK@C>EBJB .#KK((K=C>EBKC9K<G CEKGD?KCH=JEK@C>EBJBKEJ>FEJ?K9CEKGK<G CEKFD 4#KK<GH=J<GHF@B 4#KK8.K=C>EBKC9KJAJ@HF+JBKK09KGKBH>?JDHK%FB=JBKHCKBHGEHK=FB=JEKJD;FDJJEFD; 4#KK@C>EBJBKGHK&761KG9HJEK@C<:AJHFD;KH=JK;JDJEGAKJ?>@GHFCDKGD?K<G CE 4#KKEJ>FEJ<JDHBKGHK3CEEFBK7CAAJ;J$K=JB=JK<G2KHGJKH=JKH%JA+JK=C>EBKC9 4#KKJAJ@HF+JBKGHK&761KGD?KHEGDB9JEKH=J<K-G@KHCK3CEEFBI#K 6?<FBBFCDKHCKH=JK&761K/D;FDJJEFD;K*EC;EG<K%FAAK-JK;EGDHJ?KHCKGK)>GA )J;EJJK*EC;EG<KBH>?JDHK%=C"K 8#KK=GBK@C<:AJHJ?K3CEEFBK7CAAJ;JK@C>EBJKEJ>FEJ<JDHB .#KK=GBK<GFDHGFDJ?KGK<FDF<><KC9K4I5K!*6 4#KKFBKDCHKCDKBC@FGAKCEKG@G?J<F@K:EC-GHFCDKGHKH=JKHF<JKC9KH=JKHEGDB9JE (#KK=GBKDCHK-JJDKB>B:JD?J?KCEK?EC::J?K9EC<KGDCH=JEKFDBHFH>HFCDK 8#KKF9K=JKKB=JK=GBKGHHJD?J?KGDCH=JEKFDBHFH>HFCD# #KK=GBKB>-<FHHJ?KHCK&761KH=JK9CAAC%FD;K?C@><JDHB" 8#KK6#KK&761BKBHGD?GE?K>D?JE;EG?>GHJKG::AF@GHFCD 8#KK#KKJ@C<<JD?GHFCDKAJHHJEK9EC<K3CEEFBK7CAAJ;JKC99F@FGA 8#KK7#KK'99F@FGAKHEGDB@EF:HK9EC<K3CEEFBK7CAAJ;J 8#KK)#KK6::AF@GHFCDK9JJ 0D?F+F?>GABK FDHJEJBHJ?K FDK 9>EH=JEK FD9CE<GHFCDK G-C>HK H=JK 3CEEFB 7CAAJ;J&CEH=K 7GECAFDGK 61K )>GAK )J;EJJK *EC;EG<K <G2K @CDHG@HK H=J )F+FBFCDKC9K&GH>EGAK,@FJD@JBKGD?K3GH=J<GHF@BKGHK3CEEFBK7CAAJ;JI

118


ACADEMIC DIVISIONS AND PROGRAMS THE DIVISION OF RELIGION, HUMANITIES AND SOCIAL SCIENCES 7K H'LYLVLRQRI5HOLJLRQ+ XPDQLWLHVDQG6RFLDO6FLHQFHVRIIHUVPDMRUV LQHOHYHQÃ&#x20AC;HOGVRIVWXG\7K HVHDUH& K ULVWLDQ(GXFDWLRQ& ULPLQDO-XVWLFH English, English/Secondary Education, History, Liberal Studies, Mass Communications, Pastoral Ministry, Political Science, Social Studies/Secondary Education and Sociology. In addition, students may also pursue minor concentrations in the aforementioned areas (except for English/Secondary Education and Social Studies Secondary Education), as well as in Criminal Forensic Studies, Gerontology, International Relations, Minority Studies, Music, Psychology and Religion. Academic and co-curricular experiences within the Division of Religion, Humanities and Social Sciences combine humanistic, interpretive and quantitative approaches to the development of knowledge with rigorous intellectual preparation for advanced studies as well as professional careers. Toward these ends, the Division aspires to achieve the following goals relative to its students: 1. To cultivate critical thinking, reasoning and related intellectual skills QHFHVVDU\WRH[SORUHPDMRUDVSHFWVRIWK HK XPDQFRQGLWLRQ 2. To develop strong communication skills (e.g., listening, speaking, reading and writing). 3. To develop an appreciation of the importance of creative ideas and expression as part of the human experience in areas such as art, literature and music; 7RVWLPXODWHDQDZDUHQHVVDQGFODULÃ&#x20AC;FDWLRQRIYDOXHVOHDGLQJWRD workable philosophy of life;  7RGHYHORSIRXQGDWLRQDONQRZOHGJHRIPDMRUFRQFHSWVWK HRULHVSHUVRQDOLWLHVDQGVXEMHFWPDWWHUDVVRFLDWHGZLWK WK HK XPDQLWLHVOLEHUDO DUWVDQGVRFLDOVFLHQFHVDVVSHFLDOL]HGÃ&#x20AC;HOGVRIVFK RODUO\LQTXLU\ 6. To encourage inquiry into the nature of human interaction and social SK HQRPHQDWK URXJK XVHRIWK HVFLHQWLÃ&#x20AC;FPHWK RG 7. To cultivate competence in utilizing qualitative, quantitative and computer-based methods to conduct research on social, moral, ethical and aesthetic issues; 8. To prepare interested students to teach social studies at the secondary school level; 9. To help students prepare for graduate study and professional careers based upon their interests and aptitudes.

119


MORRIS COLLEGE CATALOG ,* 9 6-465 0;: %,5 4670;/ 5 79 78$)283 2?G .AG 8@F8C@FG 4@C;9CDF>G 5A@G =C@FF@>G C>G ;E@F=DA@>G A5G +<@E>DECBG F;9=CDEAB 8@A4@C7>GEBG=<9@=<F>-G=C78>-G@FD@FCD>-GCB;G=AB,FBDEAB>? #?G.AG8@F8C@FG4@C;9CDF>G5A@G4@C;9CDFGCB;G8@A5F>>EABC:G>=<AA:>? 6?G .AG 8@A,E;FG 7FCBEB459:G EBDF@B><E8>G 5A@G 8@C=DE=C:G C88:E=CDEABG CB;G >E:: ;F,F:A87FBD? ?G .AG FB<CB=FG =A779BE=CDEABG >E::>G EBG D<FG C@FC>G A5G @FC;EB4-G '@EDEB4>8FCEB4GCB;G=@EDE=C:GD<EBEB4? ?G.AG8@A,E;FGCG'E;FG@CB4FGA5G=A9@>F>GD<CDG'A9:;G4E,FG>D9;FBD>GCG8CBGAG @C7E=GCB;GEB;F8D<G,EF'GA5GD<FG;E>=E8:EBF? &8(1+2+;7')$.83;.1;,123)2(+;:'$()2.+ 8ABG=A78:FDEABGA5GD<FG+<@E>DECBG3;9=CDEABG;F4@FFG8@A4@C7-G4@C;9CDF> 'E:: 2?G%F7AB>D@CDFGCGBA':F;4FGA5GC>E=G=AB=F8D>GEBGD<FG,C@EA9>GD<FA:A4EF> A5GD<FG :;GCB;GD<FG!F'G.F>DC7FBD? #?G (::9>D@CDFG CBG 9B;F@>DCB;EB4G A5G ,C@EA9>G C;7EBE>D@CDE,FG 59B=DEAB>G CB; ;9DEF>G C>G 'F::G C>G D<FG F:F7FBD>G A5G F55F=DE,FG :FC;F@><E8G 'ED<EBG D<F C8DE>DG+<9@=<? 6?G %F5EBFG =<9@=<G 8A:ED1G 'ED<G CG >8F=EC:G F78<C>E>G ABG D<FG 8@EB=E8:F> 4A,F@BEB4GD<FGC8DE>DG+<9@=<? ?G (;FBDE51G D<FG 8@A8<FD>G A5G (>@CF:G CB;G C@DE=9:CDFG D<FG E78C=DG A5G D<FE@ 8@A8<FDE=G8@EB=E8:F>? ?G $F>FC@=<G CB;G =A78A>FG =@EDE=C:G CB;G CBC:1DE=C:G '@EDEB4>G ABG ,C@EA9> DA8E=>-GD<F7F>-GCB;G7ADE5>?  %F7AB>D@CDFG CG BA':F;4FG A5G D<FG <E>DA@1-G D<FA@EF>-G CB;G C>E= 8@EB=E8:F>G A5G +<@E>DECBED1-G D<FG +<@E>DECBG +<9@=<-G CB;G +<@E>DECB F;9=CDEAB?  %F7AB>D@CDFG CBG 9B;F@>DCB;EB4G A5G D<FG 8@C=DE=C:G C88:E=CDEABG A5G D<F 7CA@G=A9@>FG=ABDFBD?G

120


ACADEMIC DIVISIONS AND PROGRAMS 9:%69:/:04-;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579;60 ,*96-4650;:%,54670 8+81(;:'$()2.+ """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! /(.1;,.'1383 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" 

$3&G6// (BD@A;9=DEABGDAG+<@E>DECBG3;9=CDEAB ???????????????? 6 $3&G6/2 +<9@=<G E>DA@1???????????????????????????????????????????????? 6 $3&G6/# @EB=E8:F>GA5G A@><E8?????????????????????????????????????? 6 $3&G6/6 .<FG@A8<FD> ?????????????????????????????????????????????????? 6 $3&G6/ .<FA:A41GA5GD<FG :;G.F>DC7FBD ?????????????????????? 6 $3&G6/ .<FA:A41GA5GD<FG!F'G.F>DC7FBD ???????????????????? 6 $3&6/ :C=G+<9@=<G0D9;EF> ????????????????????????????????????? 6 $3&G622 +<9@=<G);7EBE>D@CDEAB ???????????????????????????????????? 6 $3&G62# @EB=E8:F>GA5G+<@E>DECBG3;9=CDEAB???????????????????? 6 $3&G62 C8DE>DGA:ED1??????????????????????????????????????????????????? 6 $3&G62 .<FA:A41GCB;G+<@E>DECBG.<A94<D ???????????????????? 6 $3&G/# +<@E>DECBG&FC;F@><E8G0F7EBC@ ???????????????????????? 6 $3&G2 (BDF@B><E8???????????????????????????????????????????????????????? 6 7)81;98'218;,.'1383 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" 3!"G62/ );,CB=F;G+A78A>EDEABGCB;G$<FDA@E= ????????????? 6 $0G6// 9BEA@0F7EBC@ ??????????????????????????????????????????????? 2 *0G66/ +<9@=<G*9>E= ????????????????????????????????????????????????? 6



/2+.1 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! :8$)283 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""  . .)&G ???????????????????????????????????????????????????????????????????????????????????? !!

121


MORRIS COLLEGE CATALOG ,%996,%&%/;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579;60 ,*96-4650;:%,54670 FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 17 BIO ENG FRS HIS REL

100 104 102 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 Foreign Language 202................................... 3 PSY 201 General Psychology ................... 3 Minor Course/Elective ................................... 3 18

JUNIOR YEAR Fall Semester Cr. JRS 300 Junior Seminar........................... 1 REL 300 Introduction to Christian Education .............. 3 REL 301 Church History ........................... 3 REL 302 Principles of Worship................. 3 REL 304 Theology of the Old Testament .. 3 Minor Course/Elective ................................... 3 16

Spring Semester Cr. Minor Course/Elective ...................................3 MUS 330 Church Music............................. 3 REL 303 The Prophets.............................. 3 REL 305 Theology of the New Testament . 3 REL 306 Black Church Studies ................. 3 REL 312 Principles of Christian Education ............................. 3 18

SENIOR YEAR Fall Semester Cr. REL 311 Church Administration ............... 3 REL 315 Baptist Polity .............................. 3 REL 318 Theology and Christian Thought.. 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

Spring Semester Cr. ENG 310 Advanced Grammar and Composition .................. 3 REL 402 Christian Leadership Seminar................................ 3 REL 415 Internship................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

122


ACADEMIC DIVISIONS AND PROGRAMS 1&'5%&:*5$/%+%:7'&!. 5,:./:2/+ +%$:',&+!5: 3BAE<B83;D@CBAEB0E@5DE/=C8CA?;E9>@C<DE:D1=DDE3=B1=?8!E1=?:9?@D>E#C;; ,6E "D8BA>@=?@DE AB#;D:1DE B0E 8?B=E @D=8>E ?A:E :D0CAC@CBA>E 9>D:E CAE @5D >@9:2EB0E<=C8DE?A:E@5DE<=C8CA?;E9>@C<DE>2>@D86 6E -:DA@C02E @5DE 3=CA<C3?;E @5DB=CD>E BAE @5DE <?9>D>E B0E <=C8DE ?A:E @5DE 8?B= <BA<D3@>E9>D:ECAE@5DE>@9:2EB0E@5DE<=C8CA?;E9>@C<DE>2>@D86 46E -:DA@C02E @5DE '?=CB9>E 3?=@>E B0E @5DE <=C8CA?;E 9>@C<DE >2>@D8E ?A:E @5D 09A<@CBAEB0ED?<5E3?=@6 +6E*33;2E<BA<D3@>!E@5DB=2E?A:E>3D<C0C<E3=?<@C<D>E9>D:ECAE<=C8CA?;E9>@C<D #C@5CAE?E#B=3;?<DEDA'C=BA8DA@6 6E DE ?;DE @BE =D;?@DE @5DB=2!E <BA<D3@>E ?A:E 3=?<@C<D>E @BE <9==DA@E C>>9D>E CA @5DE 0CD;:E B0E <=C8CA?;E 9>@C<DE @5=B915E <BA:9<@CA1E <B839@D=?>D:E ?A: 9?A@C@?@C'DE=D>D?=<56E 6E "D8BA>@=?@DE >900C<CDA@E ;D'D;>E B0E ?<?:D8C<E 3=D3?=?@CBAE ?A:E =D;?@D: >C;;>E@BE>9<<D>>09;;2E39=>9DE3=B0D>>CBA?;ED83;B28DA@ 89(689-9031:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 286-604*:(13629 5%5/$:9'!$&+.%

"

-$./:2.'/,5, /%E4.. -A@=B:9<@CBAE@BE/=C8CA?;E9>@C<D 6666666666666666666666 4 /%E4., ?#E$A0B=<D8DA@E72>@D8>66666666666666666666666666666 4 /%E4. /B==D<@CBA>!E)=B?@CBA!E)?=:BAE ?A:E)?=B;DE72>@D8> 666666666666666666666666666666666666 4 /%E4.4 9:C<C?;E72>@D8>666666666666666666666666666666666666666666666 4 /%E4.+ /=C8CA?;E?#666666666666666666666666666666666666666666666666666 4 /%E4. /=C8CAB;B12 6666666666666666666666666666666666666666666666666666 4 /%E+.. 9'DAC;DE"D;CA9DA<2 6666666666666666666666666666666666666 4 /%E+., /=C8CA?;E-A'D>@C1?@CBA 6666666666666666666666666666666666666 4 /%E+. 73D<C?;E)=B;D8>ECAE *:8CAC>@=?@CBAEB0E9>@C<D 66666666666666666666666666666 4 /%E+.4 -A@D=A>5C366666666666666666666666666666666666666666666666666666666 4 /%E+.+ /=C8CA?;EB=DA>C<>6666666666666666666666666666666666666666664



7& 5/:85 '+/5:2.'/,5, %7E4.. 9ACB=E7D8CA?= 66666666666666666666666666666666666666666666666 , )7/E4.+ *8D=C<?AE?@CBA?;EB'D=A8DA@ 666666666666666666666 4 77/E+., -A@=B:9<@CBAE@BE7B<C?;E%D>D?=<5 666666666666666666666 4



-+%./:2.'/,5,

"

95!&+5,  &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 "

123


MORRIS COLLEGE CATALOG 89(689-9031:#78:4:-6078:60:286-604*:(13629 7@9:DA@>E 8?B=CA1E CAE B@5D=E :C><C3;CAD>E #5BE #?A@E @BE 8CAB=E CAE /=C8CA?; 9>@C<DE?=DE=D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> /%E4.. -A@=B:9<@CBAE@BE/=C8CA?;E9>@C<D 6666666666666666666666 4 /%E4., ?#E$A0B=<D8DA@E72>@D8>66666666666666666666666666666 4 /%E4. /B==D<@CBA>!E)=B?@CBA!E)?=:BAE?A:E )?=B;DE72>@D8> 6666666666666666666666666666666666666666666 4 /%E4.+ /=C8CA?;E?#666666666666666666666666666666666666666666666666666 4 /%E+.. 9'DAC;DE"D;CA9DA<2 6666666666666666666666666666666666666 4 /%E+. 73D<C?;E)=B;D8>ECA*:8CAC>@=?@CBA B0E9>@C<D 66666666666666666666666666666666666666666666666666666 4 &(&* 666666666666666666666666666666666666666666666666666666666666666666666666666666666 " REQUIREMENTS FOR A MINOR CRIMINAL FORENSIC STUDIES 6WXGHQWVPDMRULQJLQRWKHUGLVFLSOLQHVZKRZDQWWRPLQRULQ& ULPLQDO)RUHQsic Studies are required to complete the following courses: CFS 300 CFS 301 CFS 302 CFS 303 CFS 401 CFS 402 TOTAL

Introductory Survey of Forensic Studies ........... 3 Crime Scene Forensics .................................... 3 Criminalistics I: Impression Evidence .............. 3 Criminalistics II: Trace Evidence ....................... 3 Forensic Evidence and Ethics .......................... 3 Special Topics in Criminal Forensics ................ 3 .................................................................................18

124


ACADEMIC DIVISIONS AND PROGRAMS 2(8862(*(-:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 286-604*:(13629 FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 16 BIO ENG FRS HIS REL

100 104 102 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 PSY 201 General Psychology ................... 3 15

JUNIOR YEAR Fall Semester Cr. CRJ 300 Introduction to Criminal Justice.................................. 3 CRJ 301 Law Enforcement Systems......... 3 CRJ 302 Corrections, Probation, Pardon and Parole Systems .............. 3 PSC 304 American National Government.. 3 Minor Course/Elective ................................... 3 JRS 300 Junior Seminar........................... 1 16

Spring Semester Cr. CRJ 303 Judicial Systems ........................ 3 CRJ 304 Criminal Law .............................. 3 CRJ 305 Criminology................................ 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. CRJ 400 Juvenile Delinquency.................. 3 CRJ 401 Criminal Investigation ................ 3 CRJ 404 Criminal Forensics ..................... 3 SSC 401 Introduction to Social Research ..................... 3 Minor Course/Elective ................................... 3 15

125

Spring Semester Cr. CRJ 402 Special Problems in Administration of Justice ..... 3 CRJ 403 Internship................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15


MORRIS COLLEGE CATALOG 9:%69:/:04-;#79;5;/6079;60;9:&6 670 0D9;FBD>G7CA@EB4GEBGAD<F@G;E>=E8:EBF>G'<AG'CBDGDAG7EBA@GEBG$F:E4EABGC@F @F9E@F;GDAG=A78:FDFGD<FG5A::A'EB4G=A9@>F>? $3&G6/# @EB=E8:F>GA5G A@><E8?????????????????????????????????????? 6 $3&G6/ .<FA:A41GA5GD<FG :;G.F>DC7FBD ?????????????????????? 6 $3&G6/ .<FA:A41GA5GD<FG!F'G.F>DC7FBD ???????????????????? 6 $3&G6/ :C=G+<9@=<0D9;EF> ????????????????????????????????????? 6 $3&G622 +<9@=<G);7EBE>D@CDEAB ???????????????????????????????????? 6 $3&G62 .<FG0A=EC:G.FC=<EB4>GA5GF>9> ?????????????????????? 6 . .)&??????????????????????????????????????????????????????????????????????? ! :0 &6-*;/579 78$)283 2?G.AG 8@A;9=FG 8@A5E=EFB=1G EBG D<@FFG =A78ABFBD>:CB49C4F-G :EDF@CD9@FCB;G =A78A>EDEABD<CDG 'E::G C>>9@FG >9==F>>G EBG 4@C;9CDFG >D9;1G A@G C =C@FF@? #?G.AGFB=A9@C4FGFBD<9>EC>7G5A@G@FC;EB4G4@FCDG'A@>GA5G:EDF@CD9@FG5@A7GC:: DE7FG8F@EA;>GCB;G8:C=F>? 6?G.AG=9:DE,CDFGD<FGCE:ED1GDAGC88:1GC>E=G8@EB=E8:F>GA5G:CB49C4F-G:EDF@CD9@FCB;G=A78A>EDEABGDAG=ABDF78A@C@1G:E5F? ?G.AGA@EFBDG>D9;FBD>GDAGD<FGEB5:9FB=F>-GE;FC>-GCB;G7A,F7FBD>GD<CDG<C,F C55F=DF;G'@EDF@>G5@A7GCG'E;FG,C@EFD1GA5G=9:D9@F>? ?G.AGFB=A9@C4FG>D9;1GA5GD<FG:CB49C4FGCB;G:EDF@CD9@FGA5GAD<F@G=9:D9@F>? ?G.AG C@@CB4FG F8F@EFB=F>-G AD<G =9@@E=9:C@G CB;G =A=9@@E=9:C@-G D<CDG C55A@; FB@E=<7FBDGEBGC@FC>G@F:CDF;GDAG:CB49C4F-G:EDF@CD9@F-GCB;G=A78A>EDEAB C@D-G79>E=-G<E>DA@1-GA@CDA@1-G8<E:A>A8<1-G8>1=<A:A41-GCB;GD<FCD@F? ?G.AG 5A>DF@G DF=<BE9F>G A5G C>>A=ECDEB4G D<FG 8C>DG CB;G D<FG 8@F>FBDG EB :CB49C4F-G:EDF@CD9@F-GCB;G=A78A>EDEAB? ?G.AG @F=A4BEFG D<@A94<G @AC;G @FC;EB4G D<FG 9BE,F@>C:G BCD9@FG A5G D<F <97CBGF8F@EFB=F? ?G.AG ><A'G >D9;FBD>G <A'G DAG 7ADE,CDFG D<F7>F:,F>G CB;G AD<F@>G DAG 89@>9F C;,CB=F;G:F,F:>GA5G:FC@BEB4GCB;G>=<A:C@><E8? 2/?G.AG >988A@DG CB;G 8@A7ADFG @F:CDF;G :EDF@C@1G C=DE,EDEF>G >9=<G C>G ;@C7CDE= 8F@5A@7CB=F>-G8C@DE=E8CDEABGEBG;E>=9>>EAB>-GCB;G>=<A:C@:1GF=<CB4F? &8(1+2+;7')$.83;.1;:+23 8ABG=A78:FDEABGA5GD<FG3B4:E><G;F4@FF 8@A4@C7-G4@C;9CDF>G'E:: 2?G %F7AB>D@CDFG CG BA':F;4FG A5G ;E,F@>FG :EDF@CD9@FG CB;G 4FB@F>G 5@A7G D<F )B=EFBDG A@:;GDAGD<FG#2>DG+FBD9@1? #?G )BC:1FG :EDF@C@1G 'A@>G >977C@EFG CB;G F,C:9CDFG :EDF@C@1G =ABDFBD8F@EA;>-G:CB49C4F-GCB;G:A=CDEAB>G=A78C@FGCB;G=ABD@C>DG:EDF@CD9@FG'ED< >E7E:C@G'A@>G5@A7G,C@EA9>GDE7F>GCB;G:A=CDEAB>? 6?G 3,C:9CDFG CG 'A@G A5G :EDF@CD9@FG 'ED<EBG D<FG 5@C7F'A@G A5G D<FG C9D<A@ > EBDFBDG'ED<A9DG7CEB4G7A@C:G9;47FBD>?

126


ACADEMIC DIVISIONS AND PROGRAMS ?G DE:EFG C>E=G :E@C@1G >E::>G EBG D<FG =A78A>EDEABG A5G F>>C1>-G @F>FC@=< 8C8F@>-GCB;GAD<F@G'@EDDFBGC>>E4B7FBD>? ?G )@DE=9:CDFG A@C::1G CB;G =:FC@:1G 5C=D9C:G EB5A@7CDEAB-G E;FC>-G CB;G A8EBEAB> @F4C@;EB4G:EDF@CD9@FGCB;GD<FG3B4:E><G:CB49C4F?

127


MORRIS COLLEGE CATALOG 9:%69:/:04-;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579 60 :0 &6-* 8+81(;:'$()2.+ """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! /(.1;,.'1383 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""  3!"G6/ )7F@E=CBG&EDF@CD9@FG( ?????????????????????????????????????? 6 3!"G6/ )7F@E=CBG&EDF@CD9@FG(( ????????????????????????????????????? 6 3!"G6/ A@:;G&EDF@CD9@FG( ???????????????????????????????????????????? 6 3!"G6/ A@:;G&EDF@CD9@FG(( ??????????????????????????????????????????? 6 3!"G62/ );,CB=F;G+A78A>EDEABGCB;G$<FDA@E= ????????????? 6 3!"G622  E>DA@1GA5GD<FG3B4:E><G&CB49C4F ???????????????????? 6 3!"G62# *A;F@BG3B4:E><G"@C77C@ ?????????????????????????????? 6 3!"G/ 0<CF>8FC@F ?????????????????????????????????????????????????? 6 3!"G2# @EDE><G&EDF@CD9@FG( ??????????????????????????????????????????? 6 3!"G26 @EDE><G&EDF@CD9@FG(( ?????????????????????????????????????????? 6 3!"G2 &EDF@C@1G+@EDE=E>7????????????????????????????????????????????? 6 3!"G/ 3B4:E><G0F7EBC@ ????????????????????????????????????????????? 6 7)81;98'218;,.'1383 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" 3!"G6/ *CA@G!A,F:> ?????????????????????????????????????????????????? 6 3!"G6## .'FBDEFD<G+FBD9@1G&EDF@CD9@F ?????????????????????????? 6 $0G6// 9BEA@G0F7EBC@ ??????????????????????????????????????????????? 2 0 G#/2 9:E=G08FCEB4?????????????????????????????????????????????? 6

!

/2+.1 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! :8$)283 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""



. .)&G ???????????????????????????????????????????????????????????????????????????????????? !! 9:%69:/:04-;#79;5;/6079;60;:0 &6-* 0D9;FBD>G7CA@EB4GEBGAD<F@G;E>=E8:EBF>G'<AG'CBDGDAG7EBA@GEBG3B4:E><GC@F @F9E@F;GDAG=A78:FDFGD<FG5A::A'EB4G=A9@>F> 3!"G62/ );,CB=F;G+A78A>EDEABGCB;G$<FDA@E= ????????????? 6 3!"G622  E>DA@1GA5GD<FG3B4:E><G&CB49C4F ???????????????????? 6 3!"G62# *A;F@BG3B4:E><G"@C77C@ ?????????????????????????????? 6 0F:F=DGD<@FFGA5GD<FG5A::A'EB4 3!"G6/ 3!"G6/ 3!"G6/ 3!"G6/ 3!"G6## 3!"G/ 3!"G2# 3!"G26 3!"G2

)7F@E=CBG&EDF@CD9@FG( ?????????????????????????????????????? 6 )7F@E=CBG&EDF@CD9@FG(( ????????????????????????????????????? 6 A@:;G&EDF@CD9@FG( ???????????????????????????????????????????? 6 *CA@G!A,F:> ?????????????????????????????????????????????????? 6 .'FBDEFD<G+FBD9@1G&EDF@CD9@F ?????????????????????????? 6 0<CF>8FC@F ?????????????????????????????????????????????????? 6 @EDE><G&EDF@CD9@FG( ??????????????????????????????????????????? 6 @EDE><G&EDF@CD9@FG(( ?????????????????????????????????????????? 6 &EDF@C@1G+@EDE=E>7????????????????????????????????????????????? 6

. .)&??????????????????????????????????????????????????????????????????????? !

128


ACADEMIC DIVISIONS AND PROGRAMS ,%996,%&%/;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579;60 :0 &6-* FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 17 BIO ENG FRS HIS REL

100 104 102 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 PSY 201 General Psychology ................... 3 15

JUNIOR YEAR Fall Semester Cr. ENG 305 American Literature I.................. 3 ENG 307 World Literature I ....................... 3 ENG 310 Advanced Composition and Rhetoric......................... 3 ENG 312 Modern English Grammar .......... 3 JRS 300 Junior Seminar........................... 1 Minor Course/Elective ................................... 3 16

Spring Semester Cr. ENG 306 American Literature II ................ 3 ENG 308 World Literature II...................... 3 ENG 311 History of the English Language ............................. 3 SPH 201 Public Speaking ......................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. ENG 309 Major Novels .............................. 3 ENG 322 Twentieth Century Literature ...... 3 ENG 405 Shakespeare............................... 3 ENG 412 British Literature I ...................... 3 Minor Course/Elective ................................... 3 15

129

Spring Semester Cr. ENG 413 British Literature II ..................... 3 ENG 415 Literary Criticism........................ 3 ENG 490 English Seminar ......................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18


MORRIS COLLEGE CATALOG :0 &6-* -:,7059 ;:%,54670 78$)283 2? .AG8@F8C@FG>F=AB;C@1G>=<AA:G=CB;E;CDF>GDAGDFC=<GF55F=DE,F:1GD<FGD<@FF =A78ABFBD>G A5G D<FG >F=AB;C@1G 3B4:E><G =9@@E=9:97G CB;G D<FG 0A9D< +C@A:EBCG2#G3B4:E><G&CB49C4FG)@D>G+9@@E=9:97G0DCB;C@;>? #? .AG 8@F8C@FG =CB;E;CDF>G '<AG =CBG F55F=DE,F:1G DFC=<G '@EDEB4G >E::>G CB; ;F7AB>D@CDFG C=9E>EDEABG A5G D<FG !CDEABC:G +A9B=E:G A5G .FC=<F@>G A5 3B4:E><G!+.3G0DCB;C@;>G2#? 6? .AG EBD@A;9=FG =CB;E;CDF> DAG D<FG F8F@EFB=F>-G E;FC>-G CB;G CDDED9;F>G A5 '@EDF@>G CB;G D<EBF@>G A5G ,C@EA9>G =9:D9@C:G C=4@A9B;>G CB;G <F:8G D<F7 :FC@BG DAG C88@F=ECDFG D<F>FG '@EDF@>G D<@A94<G ;E>=9>>EAB>-G :F=D9@F>EB;E,E;9C:GCB;G4@A98G8@AF=D>GCB;G@F>FC@=<? ? .AG F78<C>EFG D<FG @F:F,CB=FG A5G :EB49E>DE=G CB;G :EDF@C@1G >D9;1G EB 9B;F@>DCB;EB4G =ABDF78A@C@1G :E5FG 1G @F:CDEB4G :EB49E>DE=G CB; =A779BE=CDEABGD<FA@1GDAG8@C=DE=C:G:E5FG>ED9CDEAB>? ? .AG ><A'G =CB;E;CDF> D<FG 9BED1G CB;G ;E,F@>ED1G A5G <97CBG F8F@EFB=F 8A@D@C1F;GEBG,C@EA9>G'A@>GA5G:EDF@CD9@F? ? .AG C=9CEBDG =CB;E;CDF> 'ED<G D<FG @A:F>G CB;G @F>8AB>EE:EDEF>G A5G D<F DFC=<EB4G8@A5F>>EAB? ? .AG C=9CEBDG DFC=<F@G =CB;E;CDF>G 'ED<G @F>FC@=<G D@FB;>G =AB>E>DFBDG 'ED< =9@@FBDG 8@C=DE=F>G CB;G '<E=<G 8@A7ADFG >=<AA:G F55F=DE,FBF>>? -)'8+);&8(1+2+;7')$.83;.1;:+23 -8$.+(1;:'$()2.+ 2? (;FBDE51-G EBDF@8@FD-G 9B;F@>DCB;-G CB;G ;F,F:A8G C88@AC=<F>G DAG DFC=<EB4 7CA@G'A@>GA5G:EDF@CD9@F?G #? B;F@>DCB;G D<FG 8@EB=E8:F>-G <E>DA@1-G F:F7FBD>-G =AB,FBDEAB>-G CB; ;F,F:A87FBDGA5G:CB49C4FGCB;G:EB49E>DE=>? 6? B;F@>DCB;-G F,C:9CDF-G CB;G DFC=<G F:F7FBD>G A5G =A78A>EDEABG CB; @<FDA@E=? ? )BC:1FG:EDF@CD9@FGCB;GF,C:9CDFG@<FDA@E=C:G5FCD9@F>GEBG:EDF@C@1GF>>C1

130


ACADEMIC DIVISIONS AND PROGRAMS REQUIREMENTS FOR THE BACHELOR OF ARTS DEGREE WITH A MAJOR IN ENGLISH/SECONDARY EDUCATION General Education ......................................................................................61 Major Courses.............................................................................................27 ENG 305 American Literature I ...................................................... 3 ENG 306 American Literature II ..................................................... 3 ENG 307 World Literature I ............................................................ 3 ENG 310 Advanced Composition and Rhetoric ............................. 3 ENG 312 Modern English Grammar............................................... 3 ENG 405 Shakespeare................................................................... 3 ENG 412 British Literature I............................................................ 3 ENG 413 British Literature II........................................................... 3 ENG 415 Literary Criticism ............................................................. 3 Other Required Courses ...............................................................................9 BIO 303 Environmental Science ................................................... 4 HIS 304 American History I .......................................................... 3 OR HIS 305 American History II ........................................................... JRS 300 Junior Seminar................................................................ 1 SSC 100 Contemporary Affairs ...................................................... 1 Professional Education..............................................................................33 EDU 215 Human Growth and Development .................................. 3 EDU 251 Foundations of Education ............................................... 3 EDU 302 Educational Psychology ................................................. 3 EDU 304 Educational Assessment and Evaluation ........................ 3 EDU 322 Foundations of Reading………………………. ................ 3 EDU 405 Educational Seminar....................................................... 3 EDU 409 Reading and Writing in the Content Areas................. 3 EDU 412 Observation and Directed Teaching................................ 9 EDU 415 Curriculum, Instruction and Assessment in Secondary School English ..................................... 3 Electives ........................................................................................................6 TOTAL HOURS .....................................................................................136

131


MORRIS COLLEGE CATALOG CURRICULUM FOR THE BACHELOR OF ARTS DEGREE WITH A MAJOR IN ENGLISH/SECONDARY EDUCATION

CIS ENG FRS HIS MAT REL

101 103 100 104 103 201

SPH 103

FRESHMAN YEAR Fall Semester Introduction to Computers ..................... 2 ART Fundamentals of Composition ................ 3 BIO Freshman Seminar I .............................. 1 ENG World History ........................................ 3 FRS College Algebra .................................... 3 HIS Literature and Religion of the MUS Old Testament ................................. 3 MUS Voice and Speech Improvement ............. 3 SOC

Spring Semester Art Appreciation ................................ 2 Biological Sciences ........................... 4 Research and Composition ................ 3 Freshman Seminar II ......................... 1 African American History ................... 3 Music Appreciation ........................... 2 Music Appreciation ........................... 2 Principles of Sociology ...................... 3 or GEO 201 World Regional Geography Total............................................... 18

Total................................................... 18

101 100 104 102 106 101 101 101

SOPHOMORE YEAR Fall SemesterSpring Semester EDU 251 Foundations of Education ..................... 3 EDU 215 Human Growth and Development ....... 3 ENG 202 Introduction to Literature ...................... 3 ENG 205 African American Literature ............... 3 Foreign Language 201 ......................................... 3 Foreign Language 202....................................... 3 HIS 304 American History ................................. 3 PHS 100 Physical Sciences ............................. 4 or PSY 201 General Psychology........................... 3 HIS 305 American History II SSC 100 Contemporary Affairs ........................ 1 GSC 200 Science in Elementary School ............... 4 or BIO 303 Environmental Science Total ................................................. 16 Total............................................... 17

JUNIOR YEAR EDU EDU ENG ENG ENG

304 322 305 310 312

Fall Semester Educational Assessment and Evaluation. 3 Foundations of Reading ........................ 3 American Literature I............................ 3 Advanced Composition and Rhetoric ..... 3 Modern English Grammar ..................... 3

ENG 412 British Literature I ................................ 3 Total.................................................. 18

EDU ENG ENG JRS REL

302 306 307 300 202

Elective

Spring Semester Educational Psychology ....................... 3 American Literature II .......................... 3 World Literature I ................................ 3 Junior Seminar ................................... 1 Literature and Religion of the New Testament. ............................. 3 .......................................................... 3 Total ................................................. 16

SENIOR YEAR EDU 409 EDU 415 ENG 405 ENG 413 ENG 415 Elective

Fall Semester Reading and Writing in the Content Areas. 3 Curriculum, Instruction and Assessment in Secondary School English ............ 3 Shakespeare ....................................... 3 British Literature II................................ 3 Literary Criticism.................................. 3 .......................................................... 3 Total.................................................. 18

Spring Semester EDU 405 Educational Seminar............................ 3 EDU 412 Observation and Directed Teaching ...... 9 HSC 210 Health and Physical Education ............. 3

Total ................................................. 15

132


ACADEMIC DIVISIONS AND PROGRAMS *5$/%+%:7'&!. 5,:./:)+,&./: 3BAE<B83;D@CBAEB0E@5DEC>@B=2E:D1=DDE3=B1=?8!E1=?:9?@D>E#C;; ,6 -:DA@C02E >C1AC0C<?A@E C:D?>E ?A:E ?<5CD'D8DA@>E B0E >D'D=?;E 8?B= <C'C;C ?@CBA>E@5=B915B9@E598?AE5C>@B=26 6 "D8BA>@=?@DEAB#;D:1DEB0ED2E@D=8>!E<BA<D3@>E?A:E@5DB=CD>E9>D:ECA @5DE5C>@B=C<?;E8D@5B:EB0ECA9C=26 46 -:DA@C02ED2ED'DA@>ECAE@5DE:D'D;B38DA@EB0E@5DEAC@D:E7@?@D>E0=B8E@5D <B;BAC?;ED=?E@BE@5DE3=D>DA@6 +6 DE?;DE@BE9>DE9?;C@?@C'DE?A:E<B839@D=?>D:E=D>D?=<5EBAE@B3C<>EB0 5C>@B=C<?;E>C1AC0C<?A<D6 6 "D8BA>@=?@DE >900C<CDA@E ?<?:D8C<E ?A:E =D;?@D:E >C;;>E @BE >9<<D>>09;;2 39=>9DE3=B0D>>CBA?;ED83;B28DA@EB=E1=?:9?@DE>@9:26 89(689-9031:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 )61378 5%5/$:9'!$&+.%

"

-$./:2.'/,5, -7E4.+ *8D=C<?AEC>@B=2E- 666666666666666666666666666666666666666666 4 -7E4. *8D=C<?AEC>@B=2E-- 66666666666666666666666666666666666666666 4 -7E4. *8D=C<?AE$<BAB8C<EC>@B=2 666666666666666666666666666 4 -7E4,, /;?>>C<?;E?A:E D:CD'?;E/C'C;C ?@CBA>666666666666666 4 -7E4, $?=;2E B:D=AE$9=B3D 6666666666666666666666666666666666666 4 -7E4, %D<DA@E$9=B3D?AEC>@B=2 6666666666666666666666666666666 4 -7E4, BAD>@D=AE*=D?E7@9:CD>66666666666666666666666666666 4 -7E+ C>@B=2E7D8CA?= 6666666666666666666666666666666666666666666666 4



B9=E<B9=>D>E0=B8E@5DE>D;D<@CBA>E;C>@D:ED;B# -7E4,. C>@B=2EB0E@5DE/C'C;E%C15@>E B'D8DA@ 6666666666666 4 -7E+. &#DA@CD@5E/DA@9=2EAC@D:E7@?@D>66666666666666666666 4 -7E+.4 C>@B=2E?A:E)=CA<C3;D>EB0E@5D *8D=C<?AE/BA>@C@9@CBA 666666666666666666666666666666666666 4 -7E+. C>@B=2EB0E7B9@5E/?=B;CA? 6666666666666666666666666666666 4 -7E+, $'B;9@CBAEB0E?=0?=D 666666666666666666666666666666666666666 4 7& 5/:85 '+/5:2.'/,5, %7E4.. 9ACB=E7D8CA?= 66666666666666666666666666666666666666666666666 , -+%./:2.'/,5, 95!&+5,

" "

95!&+5, &(&*E 6666666666666666666666666666666666666666666666666666666666666666666666666666666

133

" "


MORRIS COLLEGE CATALOG 2(8862(*(-:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 )61378 FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar ..................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 African American History ........... 3 Literature and Religion of the Old Testament ........................ 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 16 BIO ENG HIS REL

100 104 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 SMS 200 Sophomore Seminar .................. 1 15

Spring Semester Cr. ENG 205 African American Literature........ 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 PSY 201 General Psychology ................... 3 15

JUNIOR YEAR Fall Semester Cr. HIS 304 American History I ..................... 3 HIS 307 American Economic History ....... 3 HIS 311 Classical and Medieval Civilizations ............................ 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 JRS 300 Junior Seminar........................... 1 16

Spring Semester Cr. HIS 305 American History II .................... 3 HIS 312 Early Modern Europe.................. 3 HIS 317 Recent European History............ 3 HIS 321 Non-Western Area Studies ......... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. History Elective.............................................. 3 History Elective.............................................. 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

Spring Semester Cr. History Elective ............................................. 3 History Elective ............................................. 3 HIS 499 History Seminar ......................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

134


ACADEMIC DIVISIONS AND PROGRAMS 89(689-9031:#78:4:-6078:60:)61378 7@9:DA@>E 8?B=CA1E CAE B@5D=E :C><C3;CAD>E #5BE #?A@E @BE 8CAB=E CAE 5C>@B=2E ?=D =D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> -7E4.+ -7E4. -7E4,, -7E4, -7E+. -7E+.4

*8D=C<?AEC>@B=2E- 666666666666666666666666666666666666666666 4 *8D=C<?AEC>@B=2E-- 66666666666666666666666666666666666666666 4 /;?>>C<?;E?A:E D:CD'?;E/C'C;C ?@CBA>666666666666666 4 $?=;2E B:D=AE$9=B3D 6666666666666666666666666666666666666 4 &#DA@CD@5E/DA@9=2EAC@D:E7@?@D>66666666666666666666 4 C>@B=2E?A:E)=CA<C3;D>EB0E@5DE *8D=C<?AE/BA>@C@9@CBA 66666666666666666666666666666666 4 &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666

135

"


MORRIS COLLEGE CATALOG 9:%69:/:04-;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579;60 &6:95&;-4%6:&8(1+2+;7')$.83;.1;&281(;-)'283 8ABG=A78:FDEABGA5GD<FG&EF@C:G0D9;EF>G;F4@FF 8@A4@C7-G4@C;9CDF>G'E:: 2?G%F7AB>D@CDFGCGBA':F;4FGA5GC>E=G=AB=F8D>GEBGD<FG,C@EA9>GD<FA:A4EF> A5GD<FG :;GCB;GD<FG!F'G.F>DC7FBD? #?G(;FBDE51GDF@7>GCB;G=AB=F8D>G@F:CDF;GDAGD<FG>D9;1GA5G,C@EA9>G;E>=E8:EBF> EBG<97CBEDEF>? 6?G%E>=9>>G>A=EC:GE>>9F>G@F:CDEABC::1-G:A4E=C::1-G@FC>ABC:1GCB;G=@EDE=C::1GEB 5A@7C:GCB;GEB5A@7C:G>ED9CDEAB>? ?G.<EBG7A@FG=@EDE=C::1GCB;GF<EEDGCG=9:DE,CDF;G>8E@EDGA5GEB9E@1? ?G)@DE=9:CDFGCBG9B;F@>DCB;EB4GA5GCB;GCBGC88@F=ECDEABG5A@GD<FG'C1G,C@EA9> ;E>=E8:EBF>G C@FG =ABBF=DF;G CB;G =ABD@E9DFG DAG D<FG FB:E4<DFB7FBDG A5 7CBEB;? ?G %F7AB>D@CDFG CBG 9B;F@>DCB;EB4G A5G D<FG ,C@EA9>G =C@FF@G CB;G 4@C;9CDF >=<AA:GA8DEAB>GC>>A=ECDF;G'ED<GCG:EF@C:G>D9;EF>G7CA@? 8+81(;:'$()2.+ """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""

!

/(.1;,.'1383 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""



)G7EBE797GA5GFE4<DFFBG<A9@>GFC=<G5@A7GD<FG=A9@>FGA55F@EB4>GA5GCB1GD'A A5GD<FG5A::A'EB4G=A9@>FG4@A98> !CD9@C:G0=EFB=F>GCB;G*CD<F7CDE=> 0A=EC:G0=EFB=F> $F:E4EABGCB;G 97CBEDEF> 0()'1(;-$28+$83;(+;/()8()2$3 ( G#// )BCDA71GCB;G<1>EA:A41G5A@G  FC:D<G0=EFB=F> ?????????????????????????????????????????????  ( G#/ "FBF@C:GADCB1 ??????????????????????????????????????????????  ( G#/ "FBF@C:G*E=@AEA:A41 ?????????????????????????????????????  *).G#/ (BD@A;9=DA@1G@ACE:ED1GCB;G0DCDE>DE=> ???????????? 6 0F:F=DGD<@FFGC;;EDEABC:G<A9@>G5@A7GD<F BCD9@C:G>=EFB=F>GCB;G7CD<F7CDE=> G=A9@>FG4@A98> =A9@>F>G'ED<G( -G+ *-G+0+-G*).-G  G8@F5EF> -.$2(;-$28+$83  (0G/# .'FBDEFD<G+FBD9@1GBEDF;G0DCDF>???????????????????? 6 0+G6/ 0DCDFGCB;G&A=C:G"A,F@B7FBD?????????????????????????? 6 0 G/2 )88:EF;G>1=<A:A41 ???????????????????????????????????????? 6 0 G/# @4CBECDEABC:GCB;G(B;9>D@EC:G>1=<A:A41 ?????? 6 0F:F=DG>EGC;;EDEABC:G<A9@>G5@A7GD<FG>A=EC:G>=EFB=F> =A9@>FG4@A98>G=A9@>F>G'ED<G+$-G (0-G0+-G0 0 +-G00+G8@F5EF>

136


ACADEMIC DIVISIONS AND PROGRAMS 9822.+;(+;*'(+2)283 3!"G62/ );,CB=F;G+A78A>EDEABGCB;G$<FDA@E= ????????????? 6 3!"G2 &EDF@C@1G+@EDE=E>7????????????????????????????????????????????? 6 *3%G6// *C>>G+A779BE=CDEAB> ??????????????????????????????????? 6 *3%G/2 9:E=G$F:CDEAB>?????????????????????????????????????????????? 6 0F:F=DG>EGC;;EDEABC:G<A9@>G5@A7GD<FG@F:E4EAB CB;G<97CBEDEF> =A9@>FG4@A98> =A9@>F>G'ED<G8@F5EF>G)$.-G3!"-G*3%-G*0-G$3&-G0  7)81;98'218;,.'1383 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""  *G// &EF@C:G0D9;EF>G0F7EBC@ ????????????????????????????????? 6 $0G6// 9BEA@G0F7EBC@ ??????????????????????????????????????????????? 2

; ; ; ; ; /2+.1 ;,.'1383 :8$)283 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""

!

:8$)283 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""

. .)&G ???????????????????????????????????????????????????????????????????????????????????? !

137


MORRIS COLLEGE CATALOG ,%996,%&%/;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579;60 &6:95&;-4%6:FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 17 BIO ENG FRS HIS REL

100 104 102 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 Foreign Language 202................................... 3 PSY 201 General Psychology ................... 3 15

JUNIOR YEAR Fall Semester Cr. JRS 300 Junior Seminar........................... 1 Major Courses ...............................................12 Minor Course/Elective ................................... 3 16

Spring Semester Cr. Major Courses ...............................................12 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. Natural Sciences and Mathematics................ 6 Religion and Humanities Social Sciences Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

Spring Semester Cr. Natural Sciences and Mathematics................ 6 Religion and Humanities Social Sciences HUM 400 Liberal Studies Seminar ............. 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

138


ACADEMIC DIVISIONS AND PROGRAMS 48;/(33;,.'+2$().+3;/(.1 .<FG7CA@GEBG*C>>G+A779BE=CDEABGCDDF78D>GDAG5E::GCG;F5EBEDFGBFF;GEBGA9@ 8@F>FBDG=A779BE=CDEAB>=AB>=EA9>G>A=EFD1?G0D9;FBD>GEBGD<FG7CA@G8@F8C@F 5A@G8@A5F>>EABC:G'A@GA@G4@C;9CDFG>D9;1GD<@A94<GEB;F8D<G=A9@>FG'A@GCB; <CB;>ABGF8F@EFB=F? 78$)283 2? .AG4E,FG>D9;FBD>GCBG9B;F@>DCB;EB4GEBGD<FE@G5EF:;GA5GFB;FC,A@? #? .AG 8@F8C@FG >D9;FBD>G 5A@G 8@A5F>>EABC:G F8F@EFB=F>G 1G 4E,EB4G D<F7G C D<A@A94<G4@A9B;EB4GEBGD<FE@G5EF:;GA5GFB;FC,A@? 6? .AG8@F8C@FG>D9;FBD>G5A@G4@C;9CDFG>D9;1GEBGD<FGC@FCGA5GD<FE@G=<AE=F? ? .AG<F:8G>D9;FBD>G>8FCGCB;G'@EDFGF55F=DE,F:1? ? .AG 8@A7ADFG >D9;FBD> G 8@A5F>>EABC:G 4@A'D<G D<@A94<G EBDF@B><E8>G CB; F8A>9@FGDAG8@A5F>>EABC:GA@4CBECDEAB>? ? .AG<F:8G>D9;FBD>GDAGC88@F=ECDFGD<FG,C@EA9>G9>F>GA5G,E>9C:GCB;G,F@C: 7F;EC? ? .AG <F:8G >D9;FBD>G FDDF@G 9B;F@>DCB;G D<FG 8@A=F>>F>G A5G <97CBG =A7G 79BEG=CDEAB? &8(1+2+;7')$.83;.1;/(33;,.'+2$()2.+3 8ABG =A78:FDEABG A5G D<FG *C>>G +A779BE=CDEAB>G ;F4@FFG 8@A4@C74@C;9CDF>G'E:: 2?G %F7AB>D@CDFG CBG 9B;F@>DCB;EB4G A5G 7C>>G =A779BE=CDEAB>G D<FA@EF>59B=DEAB>-GCB;GEB5:9FB=F>GABGEB;E,E;9C:>GCB;GD<FG89:E=? #?G (::9>D@CDFG D<FG ,C@EA9>G @F>FC@=<G 7FD<A;>G EBG 7C>>G 7F;ECG CB;G C88:1 D<A>FG7FD<A;>GEBGD<FG8@F8C@CDEABGA5G7F;ECG@F>FC@=<G>D9;EF>? 6?G @F8C@FG BF'>8C8F@ G C;,F@DE>F7FBD>-G @C;EAG CB;G DF:F,E>EAB =A77F@=EC:>-GBF'>:FDDF@>-GCB;G8@A7ADEABC:G8C=C4F>? ?G%F>=@EFGDF=<BE9F>GCB;G8@EB=E8:F>GA5GF55F=DE,FGCBBA9B=EB4? ?G@AA5@FC;-GF;ED-GCB;G;F>E4BG:C1A9D>G5A@G89:E=CDEAB>? ?G"CD<F@GBF'>GCB;G'@EDFGCB;G@F8A@DGBF'>G>DA@EF>G5A@G8@EBDGCB;GF:F=D@ABE= 7F;EC? ?G)@DE=9:CDFGFD<E=C:G=AB>E;F@CDEAB>GEBG7C>>G7F;EC? ?G %F7AB>D@CDFG CBG 9B;F@>DCB;EB4G A5G D<FG 8@C=DE=C:G C88:E=CDEABG A5G D<F 7CA@G=A9@>FG=ABDFBD?

139


MORRIS COLLEGE CATALOG 9:%69:/:04-;#79;4*:;5,*:&79;7#;#60:;594-;: 9:: 64*;5;/579;60 /5--;,7//%06,546708+81(;:'$()2.+ """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! /(.1;,.'1383 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""  *3%G6// *C>>G+A779BE=CDEAB> ??????????????????????????????????? 6 *3%G6/# !F'>G @EDEB4GCB;G3;EDEB4 ??????????????????????????????? 6 *3%G6/ );,F@DE>EB4?????????????????????????????????????????????????????? 6 *3%G6#/ .F:F,E>EABG@A;9=DEAB ????????????????????????????????????? 6 *3%G62 @AC;=C>DG)BBA9B=EB4 ??????????????????????????????????? 6 *3%G62 @EDEB4G5A@GD<FG*F;EC ?????????????????????????????????????? 6 *3%G6/ C>E=G0A9B;G$F=A@;EB4 ?????????????????????????????????? 6 *3%G62 *F;ECG&C'GCB;G3D<E=> ???????????????????????????????????? 6 *3%G6# *F;ECG$F>FC@=<G*FD<A;> ?????????????????????????????? 6 *3%G/2 9:E=G$F:CDEAB>?????????????????????????????????????????????? 6 *3%G2/ );,CB=F;G*F;ECG@AF=D ???????????????????????????????? 6 *3%G/ (BDF@B><E8???????????????????????????????????????????????????????? 6 7)81;98'218;,.'1383 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" $0G6// 9BEA@G0F7EBC@ ??????????????????????????????????????????????? 2 *3%G662 C>E=G<ADA4@C8<1 ????????????????????????????????????????? 6

/2+.1 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! :8$)283 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""



. .)&G ???????????????????????????????????????????????????????????????????????????????????? ! 0.)8;-'83)8;:8$)283 *3%G6/  E>DA@1GA5GA9@BC:E>7?????????????????????????????????????????? *3%G6#2G );,CB=F;G. G@A;9=DEAB??????????????????????????????????? *3%G66/ 0=@E8D'@EDEB4??????????????????????????????????????????????????????? *3%G66# );,CB=F;G<ADA4@C8<1????????????????????????????????????? *3%G6/ $C;EAG@A4@C77EB4GCB;G@A;9=DEAB?????????????????? *3%G/# );,CB=F;G!F'>G @EDEB4GCB;G3;EDEB4?????????????????? *3%G/ !F'>8C8F@G @4CBECDEAB???????????????????????????????????

140

6 6 6 6 6 6 6


ACADEMIC DIVISIONS AND PROGRAMS ,%996,%&%/;#79;4*:;5,*:&79;7#;#60:;594-;: 9:: 64*;5;/579;60 /5--;,7//%06,54670FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

ART BIO ENG FRS HIS REL

101 100 104 102 106 201

Spring Semester Cr. Art Appreciation ......................... 2 Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 16

SOPHOMORE YEAR Fall Semester Cr. HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 MED 300 Mass Communications.............. 3 REL 202 Literature and Religion of the New Testament .................... 3 Foreign Language 201................................... 3 15

Spring Semester Cr. ENG 205 African American Literature........ 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 PSY 201 General Psychology ................... 3 Foreign Language 202................................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 18

JUNIOR YEAR JRS MED MED MED MED MED

300 302 331 351 360 361

Fall Semester Cr. Junior Seminar........................... 1 Basic Photography ..................... 3 News Writing and Editing......... 3 Writing for the Media ................. 3 Basic Sound Recording.............. 3 Media Law and Ethics ................ 3 16

Spring Semester Cr. MED 304 Advertising ................................. 3 MED 320 Television Production................. 3 MED 341 Broadcast Announcing ............... 3 MED 362 Media Research ......................... 3 MED 401 Public Relations ......................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. MED 490 Internship................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

141

Spring Semester Cr. MED 410 Advanced Media Project............. 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 12


MORRIS COLLEGE CATALOG 9:%69:/:04-;#79;5;/6079 60;/5--;,7//%06,546700D9;FBD>G'<AGC@FG7CA@EB4GEBGAD<F@G;E>=E8:EBF>G'<AG'CBDGDAG7EBA@GEBG*C>> +A779BE=CDEAB>GC@FG@F9E@F;GDAG=A78:FDFGD<FG5A::A'EB4G=A9@>F> *3%G6//G *C>>G+A779BE=CDEAB>????????????????????????????????? 6 *3%G6/# !F'>G @EDEB4GCB;G3;EDEB4??????????????????????????????? 6 *3%G6/ );,F@DE>EB4?????????????????????????????????????????????????????? 6 *3%G6#/ .F:F,E>EABG@A;9=DEAB????????????????????????????????????? 6 *3%G62 @AC;=C>DG)BBA9B=EB4??????????????????????????????????? 6 *3%G/2 9:E=G$F:CDEAB>?????????????????????????????????????????????? 6 . .)&????????????????????????????????????????????????????????????????????????????!

142


ACADEMIC DIVISIONS AND PROGRAMS 4*:;/579;60; 5-4795&;/606-49 78$)283 2? .AG 8@F8C@FG >D9;FBD>G 5A@G =C@FF@>G EBG 7EBE>D@1G CB;G DAG ;F,F:A8G D<F7G C> F55F=DE,FG7EBE>DF@>? #? .AG 8@F8C@FG >D9;FBD>G 'ED<G D<FG 8@A8F@G 5A9B;CDEABG 5A@G 4@C;9CDFG CB; 8@A5F>>EABC:G>D9;1? 6? .AG <F:8G C==F:F@CDFG 8@A5F>>EABC:G 4@A'D<G 5A@G 8@C=DE=EB4G 7EBE>DF@>G CB; =<C8:CEB>? ? .AG 8@A,E;FG 7FCBEB459:G EBDF@B><E8>G 5A@G 8@C=DE=C:G C88:E=CDEABG CB;G >E:: ;F,F:A87FBD? ? .AG FB<CB=FG =A779BE=CDEABG >E::>G EBG D<FG C@FC>G A5G @FC;EB4-G '@EDEB4>8FCEB4GCB;G=@EDE=C:GD<EBEB4? ? .AG8@A,E;FGCG'E;FG@CB4FGA5G=A9@>F>GD<CDGA55F@>G>D9;FBD>GCG8CBA@C7E= CB;GEB;F8D<G,EF'GA5GD<FG;E>=E8:EBF? &8(1+2+;7')$.83;.1; (3).1(;/2+23)1 8ABG=A78:FDEABGA5GD<FGC>DA@C:G*EBE>D@1G;F4@FFG8@A4@C7-G4@C;9CDF>G'E:: 2?G%F7AB>D@CDFGCGBA':F;4FGA5GC>E=G=AB=F8D>GEBGD<FG,C@EA9>GD<FA:A4EF> A5GD<FG :;GCB;G!F'G.F>DC7FBD? #?G %F>=@EFG =<9@=<G 8A:ED1-G D<FG ,C@EA9>G C;7EBE>D@CDE,FG 59B=DEAB>G CB; ;9DEF>-GCB;GD<FGF:F7FBD>GA5GF55F=DE,FG:FC;F@><E8G'ED<EBGD<FG+<9@=<? 6?G )@DE=9:CDFG D<FG >A=EC:G DFC=<EB4>G A5G F>9>G CB;G D<FG 8@EB=E8:F>G CB; 8@C=DE=F>GA5G'A@><E8G'ED<EBGD<FG@ADF>DCBDGD@C;EDEAB? ?G $F>FC@=<G CB;G =A78A>FG =@EDE=C:G CB;G CBC:1DE=C:G '@EDEB4>G ABG ,C@EA9> DA8E=>-GD<F7F>-GCB;G7ADE5>? ?G %F7AB>D@CDFG CBG 9B;F@>DCB;EB4G A5G +<@E>DECBG FD<E=>-G D<FG F,A:9DEABG A5 FD<E=>GEBG+<@E>DECBG<E>DA@1-GCB;GD<FGC88:E=CDEABGA5G7A@C:G>DCB;C@;>GD<CD ><A9:;G FG C88:EF;G '<FBG FB4C4F;G EBG 7CEB4G +<@E>DECBG FD<E=C: ;F=E>EAB>? ?G 38:CEBG D<FG BFF;G 5A@G EBDFB>FG >8E@ED9C:G CB;G =A4BEDE,FG 8@F8C@CDEABG 5A@ F55F=DE,FG 8@FC=<EB4-G D<FG F8F=DCDEAB>G A5G CG 8C>DA@G EBG @F4C@;G DAG C =AB4@F4CDEAB-GCB;GD<FGC>E=G8@EB=E8:F>G9B;F@4E@;EB4G8C>DA@C:G=C@FGCB; =A9B>F:EB4? ?G 0FD=<G D<FG <E>DA@1-G D<FA@EF>-G CB;G C>E=G8@EB=E8:F>G A5G +<@E>DECBED1-G D<F +<@E>DECBG+<9@=<-GCB;G+<@E>DECBGF;9=CDEAB? ?G %F7AB>D@CDFG 9B;F@>DCB;EB4G A5G D<FG 8@C=DE=C:G C88:E=CDEABG A5G 7CA@ =A9@>FG=ABDFBD?

143


MORRIS COLLEGE CATALOG 9:%69:/:04-;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579;60; 5-4795&;/606-49 8+81(;:'$()2.+ """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! /(.1;,.'1383 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" 

$3&G6/# @EB=E8:F>GA5G A@><E8?????????????????????????????????????? 6 $3&G6/ .<FA:A41GA5GD<FG :;G.F>DC7FBD ?????????????????????? 6 $3&G6/ .<FA:A41GA5GD<FG!F'G.F>DC7FBD ???????????????????? 6 $3&G6/ :C=+<9@=<G0D9;EF> ????????????????????????????????????? 6 $3&G622 +<9@=<G);7EBE>D@CDEAB ???????????????????????????????????? 6 $3&G62 C8DE>DGA:ED1??????????????????????????????????????????????????? 6 $3&G62 .<FG0A=EC:G.FC=<EB4>GA5GF>9> ?????????????????????? 6 $3&G62 .<FA:A41GCB;G+<@E>DECBG.<A94<D ???????????????????? 6 $3&G62 :C=G.<FA:A41 ??????????????????????????????????????????????? 6 $3&G// +<@E>DECBG3D<E=> ?????????????????????????????????????????????? 6 $3&G/2  A7E:FDE=> ??????????????????????????????????????????????????????? 6 $3&G/ C>DA@C:G+C@FGCB;G+A9B>F:EB4 ??????????????????????? 6 $3&G2 (BDF@B><E8???????????????????????????????????????????????????????? 6 7)81;98'218;,.'1383 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" 3!"G62/ );,CB=F;G+A78A>EDEABGCB;G$<FDA@E= ????????????? 6 $0G6// 9BEA@G0F7EBC@ ??????????????????????????????????????????????? 2 *0G66/ +<9@=<G*9>E= ????????????????????????????????????????????????? 6



/2+.1 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ! :8$)283 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""



. .)&G ???????????????????????????????????????????????????????????????????????????????? !!

*0G#/6 *0G#/ *0G##2 *0G66/ *0G66 *0G6

98'2188+)3;.1;(;/2+.1;2+;/'32$ !;*.'13 *9>E=G.<FA@1G ?????????????????????????????????????????????????# *9>E=G.<FA@1G(( ???????????????????????????????????????????????# )5@E=CBG)7F@E=CBG*9>E= ??????????????????????????????????6 +<9@=<G*9>E=??????????????????????????????????????????????????6 *9>E=G E>DA@1G( ????????????????????????????????????????????????6  E>DA@1G((??????????????????????????????????????????????????????????6

5+ *0G222GECBA????????????????????????????????????????????????????????????????2 *0G22#GECBA????????????????????????????????????????????????????????????????2 71 .'AG<A9@>GA5G+<AE@GDAGEB=:9;FGD<FG5A::A'EB4 *0G2//G+<AE@ ????????????????????????????????????????????????????????????????2 *0G2/#G+<AE@ ????????????????????????????????????????????????????????????????2 *0G#//G+<AE@ ????????????????????????????????????????????????????????????????2 *0G#/#G+<AE@ ????????????????????????????????????????????????????????????????2 *0G6//G+<AE@ ????????????????????????????????????????????????????????????????2 *0G6/#G+<AE@ ????????????????????????????????????????????????????????????????2G *0G//G+<AE@ ????????????????????????????????????????????????????????????????2 *0G/#G+<AE@ ????????????????????????????????????????????????????????????????2 . .)&G ???????????????????????????????????????????????????????????????????????! 144


ACADEMIC DIVISIONS AND PROGRAMS ,%996,%&%/;#79;4*:;5,*:&79;7#;594-;: 9:: 64*;5;/579;60

5-4795&;/606-49 FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar I ................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement. 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 17 BIO ENG FRS HIS REL

100 104 102 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 Foreign Language 202................................... 3 PSY 201 General Psychology ................... 3 Minor Course/Elective ................................... 3 18

JUNIOR YEAR JRS 300 REL 302 REL 304 REL 311 REL 315 REL 318

Fall Semester Cr. Junior Seminar........................... 1 Principles of Worship................. 3 Theology of the Old Testament ................ 3 Church Administration ............... 3 Baptist Polity .............................. 3 Theology and Christian Thought.. 3 16

Spring Semester Cr. MUS 330 Church Music............................. 3 REL 305 Theology of the New Testament .................... 3 REL 306 Black Church Studies ................. 3 REL 316 The Social Teaching of Jesus ..... 3 REL 319 Black Theology........................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. ENG 310 Advanced Composition and Rhetoric......................... 3 REL 400 Christian Ethics .......................... 3 REL 401 Homiletics .................................. 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

145

Spring Semester Cr. REL 404 Pastoral Care and Counseling .... 3 REL 415 Internship................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 12


MORRIS COLLEGE CATALOG *5$/%+%:7'&!. 5,:./:.+&+!$:1!+5%!5 3BAE<B83;D@CBAEB0E@5DE)B;C@C<?;E7<CDA<DE:D1=DDE3=B1=?8!E1=?:9?@D>E#C;; ,6 -:DA@C02E?A:E:D0CADE@5DE8?B=E@D=8>E?A:E<BA<D3@>E9>D:ECAE@5DE>@9:2EB0 3B;C@C<?;E35DAB8DA?6 6 "D8BA>@=?@DE ?AE 9A:D=>@?A:CA1E B0E 8?B=E @5DB=CD>E 9>D:E @BE D3;?CA 3B;C@C<?;ED5?'CB=6 46 -:DA@C02E >C8C;?=C@CD>E ?A:E :C00D=DA<D>E @5?@E DC>@E ?8BA1E 8?B=E 3B;C@C<?; >2>@D8>E@5=B915B9@E@5DE#B=;:6 +6 $3;?CAE@5DE>@=9<@9=DE?A:E09A<@CBAEB0E8?B=E3B;C@C<?;ECA>@C@9@CBA>ECAE@5D AC@D:E7@?@D>6 6 >DE<B839@D=?>D:E@D<5AB;B12E?A:E9?A@C@?@C'DE8D@5B:>E@BE<BA:9<@ =D>D?=<5EBAE3B;C@C<?;EC>>9D>6 6 "D8BA>@=?@DE >900C<CDA@E ?<?:D8C<E ?A:E =D;?@D:E >C;;>E @BE >9<<D>>09;;2 39=>9DE3=B0D>>CBA?;ED83;B28DA@EB=E1=?:9?@DE>@9:26

89(689-9031:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 7*63624*:1269029 5%5/$:9'!$&+.%

"

-$./:2.'/,5, )7/E4.. -A@=B:9<@CBAE@BE)B;C@C<?;E7<CDA<D 666666666666666666666 4 )7/E4.+ *8D=C<?AE?@CBA?;EB'D=A8DA@ 666666666666666666666 4 )7/E4. /BA>@C@9@CBA?;E?# 666666666666666666666666666666666666666666 4 )7/E4. 7@?@DE?A:EB<?;EB'D=A8DA@66666666666666666666666666 4 )7/E4, /B83?=?@C'DEB'D=A8DA@ 666666666666666666666666666666 4 )7/E4, *8D=C<?AEB=DC1AE)B;C<2 66666666666666666666666666666666 4 )7/E+., -A@D=A?@CBA?;E%D;?@CBA>666666666666666666666666666666666666 4 )7/E+.+ )9;C<E*:8CAC>@=?@CBAE?A:E)9;C<E)B;C<2 666666666 4 E E )7/E+. )B;C@C<>EB0E"D'D;B3CA1E?@CBA> 666666666666666666666666 4 )7/ +. 7DACB= 7D8CA?= CA )B;C@C<?; 7<CDA<D6666666666666666 4 E E E &5B915@6666666666666666666666666666666666666666666664 E )7/E+,. )B;C@C<?; 77/E+., -A@=B:9<@CBAE@BE7B<C?;E%D>D?=<5 666666666666666666666 4



7& 5/:85 '+/5:2.'/,5, %7E4.. 9ACB=E7D8CA?= 66666666666666666666666666666666666666666666666 , -+%./:2.'/,5, 95!&+5,

:

"

:"

95!&+5, " &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 "

146


ACADEMIC DIVISIONS AND PROGRAMS 89(689-9031:#78:4:-6078:60:7*63624*:1269029 7@9:DA@>E 8?B=CA1E CAE B@5D=E :C><C3;CAD>E #5BE #?A@E @BE 8CAB=E CAE )B;C@C<?; 7<CDA<DE?=DE=D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> )7/E4.. -A@=B:9<@CBAE@BE)B;C@C<?;E7<CDA<D 66666666666666666666666 4 )7/E4.+ *8D=C<?AE?@CBA?;EB'D=A8DA@66666666666666666666666 4 )7/E4. 7@?@DE?A:EB<?;EB'D=A8DA@ 666666666666666666666666666 4 )7/E4, /B83?=?@C'DEB'D=A8DA@66666666666666666666666666666666 4 )7/E+,. )B;C@C<?;E&5B915@66666666666666666666666666666666666666666666666 4 77/E+., -A@=B:9<@CBAE@BE7B<C?;E%D>D?=<5 66666666666666666666666 4 &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 "

147


MORRIS COLLEGE CATALOG 2(8862(*(-:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 7*63624*:1269029 FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar ..................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement........................ 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 16 BIO ENG HIS REL

100 104 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 PSY 201 General Psychology ................... 3 SMS 200 Sophomore Seminar .................. 1 16

JUNIOR YEAR Fall Semester Cr. PSC 300 Introduction to Political Science ................... 3 PSC 304 American National Government ......................... 3 PSC 305 Constitutional Law ..................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 JRS 300 Junior Seminar........................... 1 16

Spring Semester Cr. PSC 306 State and Local Government ...... 3 PSC 351 Comparative Government........... 3 PSC 361 American Foreign Policy............. 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. PSC 401 International Relations ............... 3 PSC 402 International Law ....................... 3 PSC 403 Political Theory .......................... 3 PSC 404 Public Administration and Public Policy ........................ 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

Spring Semester Cr. PSC 407 Politics of Developing Nations.... 3 PSC 408 Senior Seminar in s Political Science ................... 3 SSC 401 Introduction to Social Research ................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

148


ACADEMIC DIVISIONS AND PROGRAMS 17264*:13(691 1927048:9(243670 75!&+5, ,6E&BE 3=D3?=DE CA@D=D>@D:E >@9:DA@>E @BE @D?<5E >B<C?;E >@9:CD>E ?@E @5D >D<BA:?=2E;D'D;E@BE?E:C'D=>DE1=B936 6E&BE CA@D1=?@DE @5DE >@9:2E B0E ?A@5=B3B;B12!E D<BAB8C<>!E 1DB1=?352! 1B'D=A8DA@ 3B;C@C<?;E><CDA<D!E5C>@B=2!E35C;B>B352!E3>2<5B;B12!E=D;C1CBA ?A:E>B<CB;B12ECAE?E>2>@D8?@C<E#?2E@BE5D;3E>@9:DA@>E9A:D=>@?A:E#5?@EC@ 8D?A>E@BEDE598?AE?A:E5B#!E?>E598?AEDCA1>!E#DE?=DE8D8D=>EB0 >B<CD@26 46E&BE3=D3?=DE?AED:9<?@D:E<C@C DA=2E@BE;C'DE>9<<D>>09;;2ECAE?E:D8B<=?@C< >B<CD@26 +6E&BE5D;3E<?A:C:?@D>E?A?;2 DE#5BE@5D2E?=DE?A:E5B#E@5D2E=D;?@DE@BE@5DC= <B889AC@CD>!E@5DEA?@CBA!E?A:E@5DE1;B?;E<B889AC@26 6E&BE>@9:2E5B#E@5DE3?>@!E3=D>DA@!E?A:E09@9=DE?=DECA@D=<BAAD<@D:6 6E&BE 5D;3E <?A:C:?@D>E 9A:D=>@?A:E <9;@9=?;E :C'D=>C@2E ?A:E 8DD@E @5D <5?;;DA1D>EB0E@5DE#B=E#B=;:E?A:E<B889AC@CD>6  6E&BE B9@;CADE @5DE CA:>E B0E 3=B0D>>CBA?;E :D'D;B38DA@E @BE C83=B'DE @5D @D?<5CA1E?A:E;D?=ACA1EB0E>B<C?;E>@9:CD>6

6E&BE5D;3E<?A:C:?@D>E:D'D;B3E@D<5AB;B1C<?;E?A:E=D>D?=<5E>C;;>E@BE@5CA <=C@C<?;;2E?A:E8?DE:D<C>CBA>E?B9@E=D;?@D:E>B<C?;EC>>9D>6 6E&BE3=D3?=DE<?A:C:?@D>E@BE8DD@E@5DEADD:>EB0E@5DC=E>@9:DA@>E#5BE;D?=A CAE:C00D=DA@E#?2>E?A:E#5BE<B8DE0=B8E:C'D=>DE?<1=B9A:>6 ,.6E&BE @D?<5E <?A:C:?@D>E @BE E 9>DE ?E '?=CD@2E B0E ?>>D>>8DA@E >@=?@D1CD>E @B 8D?>9=DE>@9:DA@E3=B1=D>>6 1&'5%&:*5$/%+%:7'&!. 5,:./:1.!+$:1&'+5, 15!.%$/:9'!$&+.%: 3BAE <B83;D@CBAE B0E @5DE 7B<C?;E 7@9:CD> 7D<BA:?=2E $:9<?@CBAE :D1=DD 3=B1=?8!E1=?:9?@D>E#C;; ,6 "D8BA>@=?@DE AB#;D:1DE B0E ?>C<E @D=8>E ?A:E <BA<D3@>E 9>D:E CAE @5D >@9:2E B0E ?A@5=B3B;B12!E D<BAB8C<>!E 1DB1=?352!E 1B'D=A8DA@E ?A: 3B;C@C<>!E5C>@B=2!E35C;B>B352!E3>2<5B;B12!E=D;C1CBAE?A:E>B<CB;B12E?@E@5D CA@=B:9<@B=2E;D'D;6 6 $3;?CAE?>C<ED;D8DA@>EB0E@5DE0B=8?;ED:9<?@CBAE3=B<D>>E?A:EC@>E3;?<D CAE>B<CD@26 46 "D8BA>@=?@DE AB#;D:1DE B0E ?>C<E 8D@5B:>E 0B=E @5DE @D?<5CA1E B0E 7B<C?; 7@9:CD>ECAE?E>D<BA:?=2E><5BB;E>D@@CA16 +6 -:DA@C02E ?A:E D3;?CAE '?=CB9>E 8D@5B:>E :D>C1AD:E @BE 8D?>9=DE ?A: ?>>D>>E>@9:DA@E;D?=ACA16 6 >DE <B839@D=?>D:E ?A:E 9?A@C@?@C'DE 8D@5B:>E @BE <BA:9<@E =D>D?=<5 BAE@B3C<>ECAE@5DE7B<C?;E7<CDA<D>6 6 "D8BA>@=?@DE >900C<CDA@E ?<?:D8C<E AB#;D:1DE ?A:E =D;?@D:E >C;;>E @B >9<<D>>09;;2E39=>9DE3=B0D>>CBA?;ED83;B28DA@EB=E1=?:9?@DE>@9:26

149


MORRIS COLLEGE CATALOG REQUIREMENTS FOR THE BACHELOR OF ARTS DEGREE WITH A MAJOR IN SOCIAL STUDIES/SECONDARY EDUCATION General Education ......................................................................................61 Major Courses.............................................................................................34 ECO301 Principles of Economics I................................................ 3 GEO 401 Cultural Geography......................................................... 3 HIS 304 American History I .......................................................... 3 HIS 305 American History II ......................................................... 3 HIS 311 Classical and Medieval Civilizations ............................... 3 HIS 317 Recent European History................................................ 3 HIS 321 Non-Western Area Studies ............................................. 3 PSC 304 American National Government...................................... 3 PSC 306 State and Local Government .......................................... 3 SOC 302 Social Problems .............................................................. 3 SSC 100 Contemporary Affairs ...................................................... 1 SSC 400 Social Science Seminar .................................................. 3 Other Required Courses ...............................................................................5 BIO 303 JRS 300

Environmental Science ................................................... 4 Junior Seminar................................................................ 1

Professional Education 33 EDU 215 Human Development ...................................................... 3 EDU 251 Foundations of Education ............................................... 3 EDU 302 Educational Psychology.................................................. 3 EDU 304 Educational Assessment and Evaluation ........................ 3 EDU 322 Foundations of Reading……………………… ................. 3 EDU 405 Educational Seminar....................................................... 3 EDU 407 Curriculum, Instruction and Assessment in Secondary School Social Studies ................................................ 3 EDU 409 Reading and Writing in the Content Areas...................... 3 EDU 412 Observation and Directed Teaching................................ 9 Electives ........................................................................................................6 TOTAL HOURS .....................................................................................139

150


ACADEMIC DIVISIONS AND PROGRAMS CURRICULUM FOR THE BACHELOR OF ARTS DEGREE WITH A MAJOR IN SOCIAL STUDIES/SECONDARY EDUCATION

CIS ENG FRS HIS HSC MAT SPH

101 103 100 104 210 103 103

FRESHMAN YEAR Fall Semester Introduction to Computers ..................... 2 ART Fundamentals of Composition ................ 3 BIO Freshman Seminar................................ 1 ENG World History ........................................ 3 FRS Health and Physical Education…… ....... 3 HIS College Algebra 3 MUS Voice and Speech Improvement ............. 3 SOC

Total................................................... 18

Spring Semester Art Appreciation ................................ 2 Biological Sciences ........................... 4 Research and Composition ................ 3 Freshman Seminar II ......................... 1 African American History ................... 3 Music Appreciation ........................... 2 Principles of Sociology ...................... 3 or GEO 201 World Regional Geography Total............................................... 18 101 100 104 102 106 101 101

SOPHOMORE YEAR Fall Semester Spring Semester EDU 251 Foundations of Education ..................... 3 EDU 215 Human Development ......................... 3 ENG 202 Introduction to Literature ...................... 3 ENG 205 African American Literature ............... 3 Foreign Language 201 ......................................... 3 Foreign Language 202....................................... 3 HIS 304 American History ................................. 3 HIS 305 American History II ............................ 3 PSY 201 General Psychology.............................. 3 PHS 100 Physical Sciences ............................. 4 REL 201 Literature and Religion of the SSC 100 Contemporary Affairs ........................ 1 Old Testament ................................ 3 Total ................................................. 18 Total............................................... 17

ECO 301 EDU 304 EDU 322 HIS 311 HIS 321 PSC 304

BIO 303 EDU 407 REL 202 SSC 400 Elective

JUNIOR YEAR Fall Semester Principles of Economics I ...................... 3 EDU 302 Educational Assessment and Evaluation. 3 EDU 409 Foundations of Reading ........................ 3 GEO 401 Classical and Medieval Civilizations ...... 3 JRS 300 Non-Western Area Studies.................... 3 PSC 306 American National Government ............. 3 SOC 302 Total................................................... 18 SENIOR YEAR Fall Semester Environmental Science ......................... 4 EDU 405 Methods of Teaching Social Studies ....... EDU 412 in the Secondary School .................. 3 HIS 317 Literature and Religion of the Elective New Testament ............................... 3 Social Science Seminar ........................ 3 .......................................................... 3 Total................................................... 18

151

Spring Semester Educational Psychology ....................... 3 Reading and Writing in the Content Areas .. 3 Cultural Geography ............................. 3 Junior Seminar ................................... 1 State and Local Government ................ 3 Social Problems .................................. 3 Total............................................... 16

Spring Semester Educational Seminar............................ 3 Observation and Directed Teaching ...... 9 Recent European History ..................... 3 .......................................................... 3

Total............................................... 18


MORRIS COLLEGE CATALOG 1&'5%&:*5$/%+%:7'&!. 5,::./:1.!+..: 3BAE<B83;D@CBAEB0E@5DE7B<CB;B12E:D1=DDE3=B1=?8!E1=?:9?@D>E#C;; ,6 "D0CADE8?B=E@D=8>E?A:E<BA<D3@>E9>D:ECAE>B<CB;B1C<?;ECA9C=26 6 $3;?CAE @5DE >@=9<@9=DE ?A:E 3=C8?=2E 09A<@CBA>E B0E 598?AE >B<C?; CA>@C@9@CBA>6 46 -:DA@C02E >C1AC0C<?A@E >C8C;?=C@CD>E ?A:E :C00D=DA<D>E ?8BA1E 598?AE >B<C?; CA>@C@9@CBA>ECAE'?=CB9>E<9;@9=D>E?=B9A:E@5DE#B=;:6 +6 -:DA@C02E @5DE 8?B=E @23D>E B0E >B<C?;E 3=B;D8>E @5?@E DC>@E ?8BA1E 598?A >B<CD@CD>6 6 "C>@CA19C>5E ?8BA1E @5DE 8?B=E >B<CB;B1C<?;E @5DB=CD>E =D;?@D:E @BE 5B# 598?AE>B<CD@CD>E?=DEB=1?AC D:!E09A<@CBAE?A:ED3D=CDA<DE<5?A1D6 6 >DE <B839@D=?>D:E ?A:E 9?A@C@?@C'DE @D<5AC9D>E CAE <BA:9<@CA1 =D>D?=<5EBAE>B<CB;B1C<?;EC>>9D>6  6 "D8BA>@=?@DE >900C<CDA@E ;D'D;>E B0E ?<?:D8C<E ?A:E =D;?@D:E >C;;>E @B >9<<D>>09;;2E39=>9DE3=B0D>>CBA?;ED83;B28DA@EB=E1=?:9?@DE>@9:26 89(689-9031:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 17267*7 5%5/$:9'!$&+.%

"

-$./:2.'/,5, 7(/E4., 7B<C?;E)>2<5B;B12 666666666666666666666666666666666666666666 4 7(/E4. 7B<C?;E)=B;D8> 666666666666666666666666666666666666666666666 4 7(/E4. /B9=@>5C3!E ?==C?1DE?A:E?8C;2 666666666666666666666 4 7(/E4,. /9;@9=?;E*A@5=B3B;B12 6666666666666666666666666666666666666 4 7(/E+.. -A@=B:9<@CBAE@BE7B<C?;ED;0?=D 666666666666666666666666 4 77/E+., -A@=B:9<@CBAE@BE7B<C?;E%D>D?=<5 666666666666666666666 4 7(/E+. 7B<C?;E&5DB=2 6666666666666666666666666666666666666666666666666 4 7(/E+.4 $@5AC<E CAB=C@2E=B93> CAE*8D=C<?AE7B<CD@26666666666666666666666666666666666666666 4 7(/E+.+ =?AE7B<CB;B12 666666666666666666666666666666666666666666666 4 77/E4. )B;C@C<?;E$<BAB82E?A:E7B<CD@2 666666666666666666666664 77/E+.. 7B<C?;E7<CDA<DE7D8CA?= 77/E4. -A@=B:9<@CBAE@BE7B<C?;E7@?@C>@C<> 6666666666666666666666 4 77/E+. 7B<C?;E7<CDA<DE-A@D=A>5C3 6666666666666666666666666666666 4



7& 5/:85 '+/5:2.'/,5, %7E4.. 9ACB=E7D8CA?= 66666666666666666666666666666666666666666666666 , -+%./:2.'/,5, "

"

95!&+5,  &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 "

152


ACADEMIC DIVISIONS AND PROGRAMS 89(689-9031:#78:4:-6078:60:17267*7 7@9:DA@>E 8?B=CA1E CAE B@5D=E :C><C3;CAD>E #5BE #?A@E @BE 8CAB=E CAE 7B<CB;B12 ?=DE=D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> 7(/E4. 7B<C?;E)=B;D8> 666666666666666666666666666666666666666666666 4 7(/E4. /B9=@>5C3!E ?==C?1DE?A:E?8C;2 666666666666666666666 4 7(/E4,. /9;@9=?;E*A@5=B3B;B12 6666666666666666666666666666666666666 4 77/E+., -A@=B:9<@CBAE@BE7B<C?;E%D>D?=<5 666666666666666666666 4 7(/E+. 7B<C?;E&5DB=2 6666666666666666666666666666666666666666666666666 4 7(/E+.+ =?AE7B<CB;B12 666666666666666666666666666666666666666666666 4 &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 "

153


MORRIS COLLEGE CATALOG 89(689-9031:#78:3)9:42)9*78:7#:4831:9899 63):4:-478:60 17267*7 FRESHMAN YEAR CIS ENG FRS HIS MAT SPH

101 103 100 104 103 103

Fall Semester Cr. Introduction to Computers ......... 2 Fundamentals of Composition.... 3 Freshman Seminar ..................... 1 World History............................. 3 College Algebra .......................... 3 Voice and Speech Improvement........................ 3 15

Spring Semester Cr. Biological Sciences .................... 4 Research and Composition ........ 3 Freshman Seminar II.................. 1 African American History ........... 3 Literature and Religion of the Old Testament ...................... 3 SOC 101 Principles of Sociology .............. 3 or GEO 201 World Regional Geography 17 BIO ENG FRS HIS REL

100 104 102 106 201

SOPHOMORE YEAR Fall Semester Cr. ART 101 Art Appreciation ......................... 2 HSC 210 Health and Physical Education ............................. 3 ENG 202 Introduction to Literature ........... 3 Foreign Language 201................................... 3 REL 202 Literature and Religion of the New Testament .................... 3 Minor Course/Elective ................................... 3 17

Spring Semester Cr. ENG 205 African American Literature........ 3 Foreign Language 202................................... 3 MUS 101 Music Appreciation .................... 2 PHS 100 Physical Sciences....................... 4 PSY 201 General Psychology ................... 3 15

JUNIOR YEAR Fall Semester Cr. JRS 300 Junior Seminar........................... 1 SOC 301 Social Psychology ...................... 3 SOC 302 Social Problems ......................... 3 SSC 302 Political Economy and Society ... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 16

Spring Semester Cr. SOC 309 Courtship, Marriage and Family .................................. 3 SOC 310 Cultural Anthropology ................ 3 SSC 350 Introduction to Social Statistics.................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

SENIOR YEAR Fall Semester Cr. SOC 400 Introduction to Social Welfare................................. 3 SSC 401 Introduction to Social Research .............................. 3 SOC 404 Urban Sociology......................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 18

Spring Semester Cr. SOC 402 Social Theory ............................. 3 SOC 403 Ethnic Minority Groups in American Society ................... 3 SSC 450 Social Science Internship ........... 3 Minor Course/Elective ................................... 3 Minor Course/Elective ................................... 3 15

154


ACADEMIC DIVISIONS AND PROGRAMS 89(689-9031:#78:4:-6078:60:987037*7 7@9:DA@>E8?B=CA1ECAEB@5D=E:C><C3;CAD>E#5BE#?A@E@BE8CAB=ECAED=BA@B;B12 ?=DE=D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> 7(/E4.. -A@=B:9<@CBAE@BED=BA@B;B12 6666666666666666666666666666 4 7(/E4.4 7B<CD@?;E%D>3BA>D>E@BE*1CA1 6666666666666666666666666 4 7(/E4, D=BA@B;B1C<?;E"D'D;B38DA@E ?A:E7B<C?;E)B;C<2 66666666666666666666666666666666666666666 4 7(/E4+. 7B<C?;EB=E D@5B:>ECAE98?A 7D='C<D>6666666666666666666666666666666666666666666666666666666 4 7(/E+. &D<5AC9D>EB0E ?A?1D8DA@E CAE*1CA1E*1DA<CD>6666666666666666666666666666666666666666 4 7(/E+. )=?<@C<98 6666666666666666666666666666666666666666666666666666666 4 &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 " 89(689-9031:#78:4:-6078:60:603980436704*:89*436701 7@9:DA@>E8?B=CA1ECAEB@5D=E:C><C3;CAD>E#5BE#?A@E@BE8CAB=ECAE-A@D=A?@CBA?; %D;?@CBA>E?=DE=D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> )7/E4.. -A@=B:9<@CBAE@BE)B;C@C<?;E7<CDA<D 666666666666666666666 4 )7/E4.+ *8D=C<?AE?@CBA?;EB'D=A8DA@ 666666666666666666666 4 )7/E4, /B83?=?@C'DEB'D=A8DA@ 666666666666666666666666666666 4 )7/E4, *8D=C<?AEB=DC1AE)B;C<2 66666666666666666666666666666666 4 )7/E+., -A@D=A?@CBA?;E%D;?@CBA>666666666666666666666666666666666666 4 )7/E+.4 )B;C@C<?;E&5DB=2 66666666666666666666666666666666666666666666666 4 &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 " 89(689-9031:#78:4:-6078:60:-607863:13(691 7@9:DA@>E 8?B=CA1E CAE B@5D=E :C><C3;CAD>E #5BE #?A@E @BE 8CAB=E CAE CAB=C@2 7@9:CD>E?=DE=D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> -7E+., B:D=AE797?5?=?AE*0=C<? 666666666666666666666666666 4 )7/E4. $@5AC<E CAB=C@2E=B93E)B;C@C<> 666666666666666666666666 4 7(/E4,. /9;@9=?;E*A@5=B3B;B12 6666666666666666666666666666666666666 4 7(/E+.4 $@5AC<E CAB=C@2E=B93>ECAE*8D=C<?AE7B<CD@2 66 4 7(/E+.+ =?AE7B<CB;B12 666666666666666666666666666666666666666666666 4 77/E4., B8DA>E%B;DECAE?E/5?A1CA1E7B<CD@2 666666666666 4 &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 " 89(689-9031:#78:4:-6078:60:12)7*7 7@9:DA@>E8?B=CA1ECAEB@5D=E:C><C3;CAD>E#5BE#?A@E@BE8CAB=ECAE)>2<5B;B12 ?=DE=D9C=D:E@BE<B83;D@DE@5DE0B;;B#CA1E<B9=>D> )7 E4., )7 E4. )7 E4. )7 E4.

*AB=8?;E)>2<5B;B126666666666666666666666666666666666666 4 &5DB=CD>EB0E)D=>BA?;C@266666666666666666666666666666666666 4 &D>@>E?A:E D?>9=D8DA@> 6666666666666666666666666666666 4 )>2<5B;B12EB0E@5DE*0=C<?AE*8D=C<?AE $3D=CDA<D 6666666666666666666666666666666666666666666666666 4 )7 E+., *33;CD:E)>2<5B;B12 6666666666666666666666666666666666666666 4 )7 E+. (=1?AC ?@CBA?;E)>2<5B;B12 66666666666666666666666666666 4 &(&*E 66666666666666666666666666666666666666666666666666666666666666666666666666666666 " 155


COURSE DESCRIPTIONS ART ART 101 Art Appreciation (2) Art Appreciation is designed to expand awareness and appreciation of art through exploration of media, theory, and history of art. ART 110 Ceramics (1) Ceramics deals with basic issues of aesthetics and techniques developed through the direct manipulation of clay. A variety of forming techniques is explored and demonstrated: pinch, coiling, slab, and hand-building construction and decorating, JOD]LQJDQGĂ&#x20AC;ULQJWHFKQLTXHV ART 201 Fundamentals of Art (3) Fundamentals of Art is a study of the art process through the exploration of the elements, concepts, media materials, and methods used to produce art. ART 210 Basic Design (3) Basic Design is a course designed to develop comprehension and manual dexterity in two- and three-dimensional media. ART 211 Basic Drawing (3) Basic Drawing is an introduction to materials and basic techniques of drawing. Emphasis is placed on observation, organization, and development of manual control. ART 221 African American Artists (3) African American Artists is a survey course that presents historical and critical DQDO\VHVRIPDMRU$IULFDQ$PHULFDQZRUNVRIDUWSHULRGVVW\OHVDQGWKHPHVIURP the eighteenth century to the present. Topics include Slavery and Emancipation; the Harlem Renaissance; the Civil Rights Movement; the lives of African American artists; and collecting African American Art. BIOLOGY BIO 100 Biological Sciences (4) Biological Sciences is a survey of the fundamentals of life sciences which focuses on biological principles as they appear in animals, plants, and microorganisms ranging IURP WKH VXEFHOOXODU WR WKH RUJDQLVPLF OHYHO  0 DMRU WRSLFV LQFOXGH LQWURGXFWLRQV WR cell biology, evolution, ecology, and genetics. Special emphasis is placed on human reproduction, nutrition, and current human biological concerns. Three lecture hours and one two-hour laboratory per week. BIO 103 General Zoology (4) General Zoology treats basic principles of living things and surveys the lower and KLJKHUIRUPVRIWKHDQLPDONLQJGRPZLWKUHIHUHQFHWRWKHLUPRUSKRORJ\FODVVLĂ&#x20AC;FDWLRQ evolution, methods of reproduction, inheritance, and relationship to man. The historical aspects of zoology are studied, especially with reference to evolution. Three lecture hours and one two-hour laboratory per week. BIO 200 Anatomy and Physiology for Health Sciences (4) Anatomy and Physiology for Health Sciences is designed to provide basic information on the structure and function of the human body: the skeletal, articular, nervous, muscular, circulatory, respiratory, digestive, urinary, endocrine, and reproductive systems. Three lecture hours and one two-hour laboratory per week. Open only to students who have earned at least 56 semester hours of college-level credits. Prerequisite: BIO 100 or BIO 103 BIO 201 Vertebrate Anatomy and Embryology (4) Vertebrate Anatomy and Embryology covers basic principles of sex cell maturation, fertilization, and embryonic cell differentiation leading to the formation of the vertebrate embryo and its development to a highly complex form. The course also presents a

156


MORRIS COLLEGE CATALOG study of adult vertebrates: their organ-systems, anatomy, evolution, specialization, behavior, and reproductive activities. Three lecture hours and one two-hour laboratory per week. Prerequisite: BIO 103 or BIO 204 BIO 203 Introduction to Research Methods (4) Introduction to Research Methods is an introduction to methods of investigation that prepare students to participate in meaningful undergraduate research. Included in these methods are microscopy, measurements, centrifugation, electrophoresis, spectrophotometry, and chromatography. In addition, experimental design, statistical treatment of data, literature search, technical writing, and preparation of manuscripts, posters, grant proposals, and oral presentations are covered. Three lecture hours and one two-hour laboratory per week. Prerequisites: BIO 103, BIO 204, BIO 204 General Botany (4) General Botany is a functional introductory survey of microorganisms and lower and higher plants including their morphology, histology, physiology, reproduction, inheritance, and relationship to man. The history of botany is covered, with special reference to contributions of early civilizations. Three lecture hours and one two-hour laboratory per week. BIO 205 General Microbiology (4) General Microbiology emphasizes the fundamental concepts of microbiology, including morphology, ultra structure, reproduction, cultivation, and metabolism of microorganisms and their role in nature in relation to man. The history of the development of microbiology and the contributions of microbiologists from diverse cultures are studied. Three lecture hours and one two-hour laboratory per week. Prerequisites: BIO 103 or BIO 204 BIO 207 Human Anatomy and Physiology I (4) + XPDQ$QDWRP\DQG3K\VLRORJ\,LVWKHĂ&#x20AC;UVWFRPSRQHQWRIDWZRVHPHVWHUVHTXHQFH that examines the structure and function of the human body. It covers human cells and tissues and their embryonic origins as well as a study of the integumentary, skeletal, muscular and nervous systems. Three lecture hours and one two-hour laboratory per week. Recommended for pre-nursing and other pre-health professions students. BIO 200 may be taken in lieu of BIO 207. Prerequisites: BIO 100 or BIO 103 BIO 208 Human Anatomy and Physiology II (4) Human Anatomy and Physiology II is a continuation of Human Anatomy and Physiology I. It covers the study of the endocrine, cardiovascular, lymphatic, immune, respiratory, digestive, excretory and reproductive systems. Special emphasis is placed on the mechanisms of action of the integrated human organ systems. Three lecture hours and one, two-hour laboratory per week. Recommended for pre-nursing and other pre-health professions students. BIO 403 may be taken in lieu of BIO 208 Prerequisites: BIO 207 BIO 300 Cell and Molecular Biology (4) Cell Biology and Molecular Biology involves the study of the structure and function of cells, emphasizing their physiology and biochemistry. Topics include energy production and utilization; membrane structure and transport; physiological responses to external signals such as hormones or other cells; genome organization, replication, transcription, and translation; and cell growth, division, and differentiation. Ethical, human, and technological implications of biotechnology are studied in light of DGYDQFHVLQWKHĂ&#x20AC;HOG7KUHHOHFWXUHKRXUVDQGRQHWZRKRXUODERUDWRU\SHUZHHN Prerequisite: BIO 205, CHM 101 BIO 301 General Genetics (4)

157


MORRIS COLLEGE CATALOG General Genetics deals with the general principles of heredity in animals, plants, and microorganisms and the interrelationships between heredity and the environment concerning the phenotypic expression of traits. It covers Mendelian, molecular, and population genetics. The history of genetics is studied. Three lecture hours and one two-hour laboratory per week. Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisites: BIO 103 or BIO 204 BIO 305 General Ecology (4) General Ecology provides the principles governing living organisms and their environment and the principles of interaction of these organisms with one another. Emphasis is placed on the human environment and ethical and technological problems related to various types of pollution and human populations. Three lecture hours and one two-hour laboratory per week. Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisite: BIO 103 or BIO 204 BIO 402 Biology Seminar (3) % LRORJ\ 6HPLQDU LV WKH FDSVWRQH FRXUVH IRU % LRORJ\ PDMRUV DQG LQYROYHV UHYLHZ of previously learned concepts, exploration of current topics and recent advances in biology, and preparation for standardized tests required for graduation (senior exit examination) and for graduate and professional schools (GRE, MCAT, PCAT, DAT, etc.).. Current topics and advances in biology include biotechnology, genetic engineering, genomics, proteomics, glycomics, stem cell research, cloning, behavioral and environmental sciences that affect the human condition and the study of the moral and ethical impact of these advances on society. Students are required to conduct LQGHSHQGHQWOLWHUDWXUHUHVHDUFKUHYLHZDQGVXPPDUL]HVFLHQWLÃ&#x20AC;FDUWLFOHVSUHVHQWRUDO reports, write a scholarly term paper, and engage in weekly standardized practice WHVWV$FRPSUHKHQVLYHVHQLRUH[LWH[DPLQDWLRQFRYHULQJVXEMHFWPDWWHULQWKHÃ&#x20AC;HOGLV incorporated into this course. Prerequisites: BIO 300 and BIO 301 or BIO 305 BIO 403 Human Physiology (4) Human Physiology introduces the functioning of the human body as a whole and the interrelationships among the various organs and systems. The interrelationships of physiology, physics, and chemistry in the various body systems are demonstrated. Ethical and technological aspects and the impact of technology are studied in light RIDGYDQFHVLQWKHÃ&#x20AC;HOG7KUHHOHFWXUHKRXUVDQGRQHWZRKRXUODERUDWRU\SHUZHHN Prerequisites: BIO 201, CHM 102 BIO 406 Special Topics in Biology (3) 6SHFLDO 7RSLFV LQ % LRORJ\ PD\ EH WDNHQ DV DQ LQGHSHQGHQW UHVHDUFK SURMHFW RU LQ FRQMXQFWLRQZLWKDIDFXOW\UHVHDUFKSURMHFW BUSINESS ADMINISTRATION BUS 200 Basic Money Management (3) % DVLF0 RQH\0 DQDJHPHQWLVDÃ&#x20AC;QDQFLDOOLWHUDF\FRXUVHGHVLJQHGWRSURYLGHVWXGHQWV with practical guidance making wise money management decisions that affect their GDLO\ DQG ORQJWHUP Ã&#x20AC;QDQFLDO SRVLWLRQV DV FRQVXPHUV  3UDFWLFDO WRSLFV FRYHUHG ZLOO include budgeting, savings, investing, credit card debt, loans, spending decisions, FRPSDULVRQ VKRSSLQJ FUHGLW SUREOHPV DQG VHUYLFHV PRUWJDJH Ã&#x20AC;QDQFLQJ DQG retirement planning. Student will develop money management skills thorough LQWHUDFWLYHÃ&#x20AC;QDQFLDOSODQQLQJH[HUFLVHVWKDWGHDOZLWKUHDOOLIHVFHQDULRV BUS 300 Introduction to Business (3) Introduction to Business provides basic background information related to the scope of business activities and methods for solving business problems. The topics cover PDQDJHPHQW PDUNHWLQJ Ã&#x20AC;QDQFH HFRQRPLFV DFFRXQWLQJ SURGXFWLRQ LQVXUDQFH transportation, and computer science.

158


DESCRIPTION OF COURSES BUS 305 Keyboarding (3) Keyboardng is a study of the principles and practices of touch typing using computer software, with emphasis upon both personal and vocational use. Minimum speed requirement is 30 GWPM (Gross Words per Minute). BUS 370 PC Systems and Application Software (3) PC Systems and Application Software is an introduction to computer applications which covers the following areas: computers (components), disk operating system (DOS) commands, the Internet, word processing, and spreadsheets. Students use the various software packages to process information and generate different types of documents. BUS 375 Principles of Management (3) Principles of Management looks at the functions of business organizations and the role management plays in all types of business enterprises. Emphasis is given to the YDULRXVEXVLQHVVVWUXFWXUHVWKHOHYHOVRIGHFLVLRQPDNLQJWKHĂ&#x20AC;[LQJRIUHVSRQVLELOLWLHV and the synchronization of work by divisions, departments and individuals. Open only to students who have earned at least 56 semester hours of college-level credit. BUS 380 Principles of Marketing (3) Principles of Marketing is a study of various interacting business activities designed to plan, promote, and distribute products and services to consumers. Students evaluate and develop a practical marketing plan. BUS 390 Business Communications (3) Business Communications is a study of the procedures and practices of written and oral communication in business professions. Students develop skills in writing business letters, preparing informal and formal reports, and making oral presentations. Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisite: ENG 104 BUS 385 Financial Accounting (3) Financial Accounting covers the procedures and methodology used by the accountant WR GHWHUPLQH WKH QHW LQFRPH DQG WKH Ă&#x20AC;QDQFLDO SRVLWLRQ RI D EXVLQHVV HQWHUSULVH the single proprietorship, the partnership, and the corporation. Students complete practical exercises and application problems to demonstrate their accounting skills. BUS 395 Statistics (3) Statistics includes descriptive statistics, statistical inference, probability theory, and the fundamentals of modern statistical methods. Emphasis is on methods of data production and analysis. Tabular and graphical presentation of data relevant to practical business and social problem solving will be covered. BUS 400 Business Law and Ethics (3) Business Law and Ethics involves a study of contracts, property rights, business transactions, negotiable instruments, credit transactions, sales, mergers, acquisitions, and insurance. Students use the case method to analyze legal and ethical issues in business. BUS 405 Operations Management (3) Operations Management covers business strategies used to effectively produce goods and services. Students examine techniques for improving decision making in relation WR MRE GHVLJQ FDSDFLW\ LQYHQWRU\ ORFDWLRQ OD\RXW DQG VFKHGXOLQJ  6SUHDGVKHHW applications are used to solve practical application problems. Prerequisite: BUS 395 BUS 410 Managerial Accounting (3) Managerial Accounting is the analysis of accounting data used in the planning, control, and decision-making activities of business. Topics include but are not limited to Ă&#x20AC;QDQFLDOVWDWHPHQWVĂ RZRIIXQGVFRVWYDOXHSURĂ&#x20AC;WUHODWLRQVKLSEXGJHWDU\SODQQLQJ

159


MORRIS COLLEGE CATALOG and control, cost consideration in decision making, and the use of quantitative techniques as an instrument of control and proper planning. Prerequisite: BUS 385 BUS 435 Marketing Management (3) Marketing Management incorporates an analytical decision making approach to formulating solutions to marketing problems. Emphasis is placed on the following areas of marketing management: production, distribution, pricing, and promotional strategies. Students enrolled in the course develop a total marketing plan for a product of their choice. Prerequisite: BUS 380 BUS 450 Federal Income Tax (3) Federal Income Tax reviews the laws and procedures incorporated in the current income tax structure. Students prepare individual income tax returns. BUS 465 International Business Management (3) International Business Management is a study of the various management practices of multinational corporations. Students analyze the dynamic, complex political environment that contributes to the success or the failure of international businesses. Prerequisite: BUS 375 BUS 470 Human Resource Management (3) Human Resource Management deals with the process of integrating people into situations that motivate them to work together cooperatively and productively by developing proper psychological attitudes. The course helps students to understand and solve human relations problems in business. Prerequisite: BUS 375 BUS 475 Managerial Finance (3) 0 DQDJHULDO )LQDQFH LV DQ LQWURGXFWLRQ WR Ă&#x20AC;QDQFLDO PDQDJHPHQW 7RSLFV LQFOXGH DQDO\VLV DQG XVHV RI Ă&#x20AC;QDQFLDO VWDWHPHQWV FDVK Ă RZ PDQDJHPHQW WLPH YDOXH RI money; analysis of risks and expected rates of return; stocks, bonds and their YDOXDWLRQ\LHOGWRPDWXULW\DQGĂ&#x20AC;QDQFLDOUDWLRVDQGWKHLUXVHV(PSKDVLVLVRQFDVK budgeting, retained earnings, dividend policy, capital budgeting, net present values DQGRSWLPDOFDSLWDOVWUXFWXUH6WXGHQWVDUHUHTXLUHGWRH[DPLQHĂ&#x20AC;QDQFLDOVWDWHPHQWV DQDO\]HĂ&#x20AC;QDQFLDOUDWLRVDQGHYDOXDWHWKHFDSLWDOEXGJHWRIDQ\)RUWXQH FRPSDQ\ of their choice. Prerequisite: BUS 385 BUS 480 Management Information Systems (3) Management Information Systems deals with the planning, development, management, and use of information technology tools to help people perform tasks UHODWHG WR KXPDQ UHVRXUFH PDQDJHPHQW PDUNHWLQJ Ă&#x20AC;QDQFH DQG PDQDJHPHQW Students work individually and in groups with hands-on information technology SURMHFWV,QIRUPDWLRQWHFKQRORJ\SURMHFWDFWLYLWLHVIRFXVRQFDUHHUVJOREDOEXVLQHVV and various industry settings. Prerequisites: BUS 375, CIS 101 BUS 485 Small Business Management (3) Small Business Management emphasizes the procedures and the knowledge required WRHVWDEOLVKĂ&#x20AC;QDQFHDQGVXFFHVVIXOO\PDQDJHDVPDOOEXVLQHVVHQWHUSULVH6WXGHQWV analyze the special problems confronted by small business owners in the day-to-day operation of their enterprises. BUS 490 Organizational Behavior (3) Organizational Behavior is a study of group behavior and the way in which group LQWHUDFWLRQ DIIHFWV RUJDQL]DWLRQDO HIIHFWLYHQHVV  6WXGHQWV ZLOO IRFXV RQ FRQĂ LFW management and group decision-making. Prerequisite: BUS 375

160


DESCRIPTION OF COURSES BUS 495 Business Policy (3) Business Policy is designed to integrate and utilize the knowledge acquired in various courses in business and economics. Students formulate solutions to practical business problems through the use of case analysis. Prerequisites: BUS 375, BUS 380, BUS 385 BUS 497 Business Research (3) Business Research is a capstone course that provides students with a forum for GLVFXVVLRQ UHĂ HFWLRQ DQG DQDO\VLV RI FXUUHQW EXVLQHVV HYHQWV DQG FRQWHPSRUDU\ business issues. Students are required to conduct research, write scholarly business papers, and participate in personal and professional development activities. A review IRU WKH 6HQLRU ([LW ([DPLQDWLRQ FRYHULQJ VXEMHFW PDWWHU LQ WKH YDULRXV EXVLQHVV disciplines is incorporated into this course. Prerequisites: BUS 465, BUS 475, ECO 301 CRIMINAL FORENSIC STUDIES CFS 300 Introductory Survey of Forensic Studies (3) Introductory Survey of Forensic Studies familiarizes students with the basic principles DQGXVHVRIIRUHQVLFVFLHQFHLQWKHFULPLQDOMXVWLFHV\VWHPLQWKH8 QLWHG6WDWHVLQFOXGLQJ its practical capabilities and limitations. Applications of biological, physical, chemical, medical, and behavioral sciences to questions of evidence and law in criminal matters will be emphasized. Students are encouraged to complete an introductory course in Criminal Justice, e.g., CRJ 300, either prior to or concurrent with this course. Prerequisites: BIO l00, MAT 103, PHY 100 or equivalents CFS 301 Crime Scene Forensics (3) Crime Scene Forensics provides an overview of techniques and procedures involved in the recognition, collection, preservation, and analysis of physical evidence related to criminal matters. Students are encouraged to complete an introductory course in Criminal Justice, e.g., CRJ 300, either prior to or concurrent with this course. Prerequisites: BIO l00, MAT 103, and PHY 100 or equivalents CFS 302 Criminalistics I: Impression Evidence (3) Criminalistics I: Impression Evidence familiarizes students with basic elements of collecting, process, and analyzing trace, biological, and impression evidence LQ FULPLQDO PDWWHUV  0 DMRU WRSLFV LQFOXGH EORRG DQG Ă XLG LGHQWLĂ&#x20AC;FDWLRQ  Ă&#x20AC;QJHUSULQWV  IRRWZHDU  WLUH PDUNV  DQG RWKHU IRUPV RI LPSUHVVLRQ HYLGHQFH Students are encouraged to complete an introductory course in Criminal Justice, e.g., CRJ 300, either prior to or concurrent with this course. Prerequisites: BIO l00, MAT 103, PHY 100 or equivalents CFS 303: Criminalistics II: Trace Evidence (3) Criminalistics II: Trace Evidence is designed to provide students with a basic understanding of the analysis of trace evidence, including the principles and concepts on which trace analysis is based. Methods of analysis for various W\SHVRIWUDFHHYLGHQFH LQFOXGLQJKLDUV Ă&#x20AC;EHUV JODVV VRLO SDLQWV DQGPHWDOV will be emphasized. Prerequisites: BIO l00, MAT 103, PHY 100 or equivalents CFS 401 Forensic Evidence and Ethics (3) Forensic Evidence and Ethics is designed to acquaint students with the application RIVFLHQWLĂ&#x20AC;FPHWKRGVLQWKHLQYHVWLJDWLRQRIFULPLQDOPDWWHUVDVWKH\UHODWHWRWKHOHJDO SURFHVV  7KH UROH RI IRUHQVLF VFLHQFH LQ WKH DGPLQLVWUDWLRQ RI MXVWLFH DQG UXOHV RI HWKLFVDQGFRGHVRISURIHVVLRQDOFRQGXFWIRUSUDFWLWLRQHUVLQWKHĂ&#x20AC;HOGDUHHPSKDVL]HG Prerequisites: CFS 300 and CFS 301

161


MORRIS COLLEGE CATALOG CFS 402 Special Topics in Criminal Forensics (3) Special Topics in Criminal Forensics provides and examination of selected issues currently affecting the practice of criminal forensics. Besides lectures, this course LQFOXGHV DVVLJQHG UHDGLQJV SUHVHQWDWLRQV DQG D PDMRU SDSHU RU RWKHU VSHFLDOL]HG SURMHFWVDVDVLJQLĂ&#x20AC;FDQWSDUWRIWKHLQVWUXFWLRQDOSURFHVV Prerequisites: CFS 300, CFS 301, and CFS 302 CHEMISTRY CHM 101 General Chemistry I (4) General Chemistry I treats the modern aspects of quantitative and qualitative chemistry. Generally, the following topics are covered in this course: measurements, symbols, chemical equations, stoichiometry, atomic structure, periodic law and chemical bonding, gas, liquid, and solid states, solutions, acids, bases and salts. Topics relevant to environmental issues will be presented. The history of chemistry is also introduced. Three lecture hours and one two-hour laboratory per week. CHM 102 General Chemistry II (4) General Chemistry II is a continuation of Chemistry I. The following topics are covered in this course: properties of acids, bases and salts, pH and hydrogen ion concentration, properties of solutions of electrolytes and non electrolytes, rates of chemical reactions, solubility products, chemical equilibria, ionic equilibria, electrochemistry, oxidationreduction reactions, and thermodynamics. Topics relevant to environmental issues will be presented. The history of chemistry is also introduced. Historical aspects of chemistry are also studied. Three lecture hours and one two-hour laboratory per week. Prerequisite: CHM 101 CHM 201 Organic Chemistry I (4) Organic Chemistry I is designed to provide a broad treatment of carbon compounds. 7KHHPSKDVLVLVSODFHGRQQRPHQFODWXUHVWUXFWXUHPHFKDQLVPVDQGWKHLGHQWLĂ&#x20AC;FDWLRQ of various organic groups. The following groups are covered: alkanes, alkenes, alkynes, dienes, alicyclic and aromatic hydrocarbons, arenes, alcohols, aldehydes, ketones, and ethers. Spectroscopic methods as well as stereochemical properties are EULHĂ \GLVFXVVHG+ LVWRU\RIWKHGLVFRYHU\RIYDULRXVFRPSRXQGVLVLQFOXGHG7KUHH lecture hours and one two-hour laboratory per week. Prerequisite: CHM 101 CHM 202 Organic Chemistry II (4) Organic Chemistry II is a continuation of Organic Chemistry I. Emphasis is placed on QRPHQFODWXUHVWUXFWXUHPHFKDQLVPVDQGWKHLGHQWLĂ&#x20AC;FDWLRQRIYDULRXVRUJDQLFJURXSV The following groups are covered: carboxylic acids, esters, amides, anhydrides, acid halides, and amines. The organic chemistry of proteins, nucleic acids, and their FRQVWLWXHQWVLVEULHĂ \GLVFXVVHG7KHODERUDWRU\SURYLGHVH[SHULPHQWVLQYROYLQJWKH LGHQWLĂ&#x20AC;FDWLRQ SUHSDUDWLRQ DQG FKDUDFWHUL]DWLRQ RI RUJDQLF FRPSRXQGV ZLWK VSHFLDO reference to their discovery and their effects on living organisms. Three lecture hours and one two- hour laboratory per week. Prerequisite: CHM 201 . CHM 400 Biochemistry (4) Biochemistry provides an introduction to the biological chemistry and biological processes at the molecular level. Catabolism and biosynthesis of carbohydrates, lipids, proteins, and nucleic acids are studied. Metabolic processes such as glycolysis, citric acid cycle, oxidative phosphorylation, and photosynthesis are also studied; and their relationship to the laws of thermodynamics are explored. Gene expression and gene manipulation constitute a portion of this course. Three lecture hours and one two-hour laboratory per week. Prerequisites: CHM 201

162


DESCRIPTION OF COURSES COMPUTER INFORMATION SYSTEMS CIS 101 Introduction to Computers (2) Introduction to Computers covers the role, concepts, history, social-ethical issues, DQG DSSOLFDWLRQV RI WKH FRPSXWHU + DUGZDUH VRIWZDUH Ã&#x20AC;OH PDQDJHPHQW RSHUDWLQJ systems, and security will also be covered. Students will have extensive hands-on experience. Computer application preparation activities include word processing, spreadsheets, presentation packages, and Internet communications. CIS 300 Systems Analysis and Design (3) Systems Analysis and Design is the study of systems integration, the analysis of existing systems, and the design of new systems. Students review each stage of the System Development Life Cycle (SDLC) and solve practical SDLC data management SUREOHPV3URMHFWVDUHUHTXLUHG Prerequisite: CIS 101 CIS 310 Introduction to Computer Programming (3) Introduction to Computer Programming covers problem solving, program formulation, logic, and the development of good programming techniques. The course involves SURMHFWDQGH[WHQVLYHKDQGVRQH[SHULHQFHZLWKDQDSSURSULDWHFRPSXWHUODQJXDJH to write programs. Prerequisite: CIS 101 CIS 320 Business Telecommunications (3) Business Telecommunications is the analysis of technical and management problems Business Telecommunications is the analysis of technical and management problems and issues associated with telecommunications systems using microcomputers. Included are telecommunication theory, infrastructure (including digital communication hardware and software), information services, and the Internet. Personal, business, VRFLDODQGHWKLFDOLPSOLFDWLRQVDUHVWUHVVHG3URMHFWVDUHUHTXLUHG Prerequisite: CIS 101 CIS 400 Database Design (3) Database Design focuses on software design and programming in a data base environment. Among the topics covered are data models, query languages, and relational database design using normal forms. Problems will be assigned using UHODWLRQDOGDWDEDVHPDQDJHPHQWV\VWHPVDQG6WUXFWXUHG4XHU\/DQJXDJH3URMHFWV are required. Prerequisite: CIS 300 CIS 440 Information Resource Management (3) Information Resource Management (IRM) is a seminar in information systems management, with emphasis on planning, organizing, and controlling user services and managing the recommended systems development process. Students apply IRM PHWKRGRORJLHVWRPDQDJHUHDOLVWLFSUREOHPVIDFHGE\EXVLQHVVÃ&#x20AC;UPVDQGFRPSXWHU XVLQJRUJDQL]DWLRQV3URMHFWVDUHUHTXLUHG Prerequisite: CIS 101 CIS 460 Technology Management Trends and Issues (3) Technology Management Trends and Issues covers topics on robotics, automation, computer-integrated manufacturing, and computer-aided design. Ethical, legal, and social issues in new technology management are also examined. Prerequisite: CIS 101 COOPERATIVE EDUCATION COE 199 Cooperative Education Seminar (1) Cooperatie Education Seminar introduces students to cooperative education concepts DQGSUHSDUHVWKHPIRUSDLGÃ&#x20AC;HOGH[SHULHQFHVZLWKLQDFDGHPLFPDMRUV6WXGHQWVDUH involved in career exploration.

163


MORRIS COLLEGE CATALOG

COE 298 Part-Time Cooperative Education Experience I (3) Part-Time Cooperative Education Experience I provides a semester of work/study experience in business, industry, government, or a social agency. The student is engaged in part-time employment in an area related to his academic program. Prerequisite: COE 199 COE 299 Full-Time Cooperative Education Experience I (6) Full-Time Cooperative Education Experience I provides a semester of work/study experience in business, industry, government, or a social agency. The student is engaged in full-time employment in an area related to his academic program. Prerequisite: COE 199 COE 398 Part-Time Cooperative Education Experience II (3) 3DUW7LPH& RRSHUDWLYH(GXFDWLRQ,,LVDVHFRQGRUMXQLRUOHYHOZRUNVWXG\H[SHULHQFH LQSDUWWLPHHPSOR\PHQWUHODWHGWRWKHVWXGHQW路VDFDGHPLFVWXGLHV Prerequisite: COE 298 COE 399 Full-Time Cooperative Education Experience II (6) )XOO7LPH& RRSHUDWLYH(GXFDWLRQ([SHULHQFH,,LVDVHFRQGRUMXQLRUOHYHOZRUNVWXG\ H[SHULHQFHLQIXOOWLPHHPSOR\PHQWUHODWHGWRWKHVWXGHQW路VDFDGHPLFVWXGLHV Prerequisite: COE 299 COE 498 Part-Time Cooperative Education III (3) Part-Time Cooperative Education III is a third- or senior-level work/study experience in SDUWWLPHHPSOR\PHQWUHODWHGWRWKHVWXGHQW路VDFDGHPLFVWXGLHV Prerequisite: COE 398 COE 499 Full-Time Cooperative Education Experience III (6) Full-Time Cooperative Education Experience III is a third- or senior-level work/study H[SHULHQFHLQIXOOWLPHHPSOR\PHQWUHODWHGWRWKHVWXGHQW路VDFDGHPLFVWXGLHV Prerequisite: COE 399 CRIMINAL JUSTICE CRJ 200 Forensics for the Everyday Citizen (3) Forensics for the Everyday Citizen provides an introductory exploration of forensic VFLHQFH DQG LWV YDULRXV XVHV LQ WKH FULPLQDO MXVWLFH SURFHVV IRU D JHQHUDO FROOHJH audience. Lectures and discussion on the basic elements of forensic science as well as demonstrations and supervised hand-on applications of basic laboratory WHFKQLTXHVLQWKHFULPLQDOMXVWLFHSURFHVVZLOOEHHPSKDVL]HG Prerequisites: BIO 100 or BIO 103, MAT 103 CRJ 300 Introduction to Criminal Justice (3) ,QWURGXFWLRQWR& ULPLQDO-XVWLFHLVDQRYHUYLHZRIWKHFULPLQDOMXVWLFHV\VWHPLQFOXGLQJ personnel and agencies. The course also examines criminal behavior from cultural and political viewpoints, and includes an orientation to the use of laboratory techniques in the crime-solving process. CRJ 301 Law Enforcement Systems (3) Law Enforcement Systems is a study of personnel, agencies, processes, and activities in law enforcement, with emphasis on enforcement responsibilities of the local and state police in the United States. CRJ 302 Correction, Probation, Pardon and Parole Systems (3) Correction, Probation, Pardon, and Parole Systems is a study of historical background, agencies, and facilities of corrections systems, with emphasis on contemporary problems in administration. The course also addresses the way that the system FRRUGLQDWHVDFWLYLWLHVZLWKFULPLQDOMXVWLFHFRPSRQHQWV

164


DESCRIPTION OF COURSES

CRJ 303 Judicial Systems (3) -XGLFLDO6\VWHPVLVDVWXG\RIWKH8 QLWHG6WDWHVMXGLFLDOV\VWHPLQFOXGLQJWKHIHGHUDO state and local courts and their personnel, procedures, policies, and decisions. Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisite: CRJ 300 CRJ 304 Criminal Law (3) & ULPLQDO /DZ LV YLHZHG DV D PHDQV RI LQĂ XHQFLQJ KXPDQ EHKDYLRU ZLWK LQWHQVLYH analysis made of various principles which apply to virtually every criminal case: MXVWLĂ&#x20AC;FDWLRQ DWWHPSW FRQVSLUDF\ SDUWLHV WR FULPH LJQRUDQFH PLVWDNH LPPDWXULW\ insanity, and intoxication. Some common law statutes of South Carolina are studied. Open only to students who have earned at least 56 semester hours of collegelevel credit. Prerequisite: CRJ 300 CRJ 305 Criminology (3) Criminology is designed to introduce students to the basic concepts of crime FDXVDWLRQDQGFULPLQDOEHKDYLRU0 DMRUDWWHQWLRQLVJLYHQWRWKHELRORJLFDOHFRQRPLF VRFLRORJLFDODQGSV\FKRORJLFDOFDXVHVRIFULPH7KHPDMRUVFKRROVRIFULPLQRORJLFDO thought are also studied. Prerequisite: CRJ 300 CRJ 400 Juvenile Delinquency (3) JJuvenile Delinquency addresses biological, economic, psychological, and sociological IDFWRUVUHODWHGWRWKHFDXVHVRIMXYHQLOHGHOLQTXHQF\7KHFRXUVHHPSKDVL]HVWKHRULHV DQGWUHQGVUHODWHGWRWKHSUHYHQWLRQDQGWUHDWPHQWRIMXYHQLOHGHOLQTXHQF\ Prerequisite: CRJ 300 CRJ 401 Criminal Investigation (3) Criminal Investigation is a study and practical application of investigative methods, with emphasis on carrying out investigations and presenting and reporting on material discovered. Students are also provided an introduction to the use of laboratory-based techniques used in the investigation of crime. Prerequisite: CRJ 300 CRJ 402 Special Problems in the Administration of Justice (3) Special Problems in the Administration of Justice is the capstone course for students PDMRULQJLQ& ULPLQDO-XVWLFH,WFRPELQHVDVWXG\RIFRPSOH[IDFWRUVLQYROYHGLQWKH DGPLQLVWUDWLRQRIMXVWLFHLQ$PHULFDQVRFLHW\ZLWKDV\QWKHVLVRIWKHRU\DQGFRQWHQW knowledge relative to various facets of Criminal Justice. A comprehensive exit H[DPLQDWLRQDVZHOODVDPDMRUUHVHDUFKSDSHUDUHLQFOXGHGDVSDUWRIWKHUHTXLUHPHQWV for this course. Prerequisite: CRJ 300 CRJ 403 Internship (3) Internship provides a practical application of concepts, classroom theory, and content knowledge in Criminal Justice within a formal workplace setting. Classroom lectures and discussion are combined with 120 clock hours of supervised work experience WKURXJK VWXGHQW SODFHPHQW LQ RUJDQL]DWLRQ VHWWLQJV UHODWHG WR WKH Ă&#x20AC;HOG RI & ULPLQDO Justice. Information regarding career opportunities as well as preparation for DGYDQFHGVWXG\LQ& ULPLQDO-XVWLFHUHODWHGĂ&#x20AC;HOGVLVDOVRLQFRUSRUDWHGLQWRWKHVXEMHFW matter for this course. Prerequisites: CRJ 300, CRJ 301, CRJ 304, CRJ 305 CRJ 404 Criminal Forensics (3) & ULPLQDO )RUHQVLFV LV WKH DSSOLFDWLRQ RI VFLHQWLĂ&#x20AC;F DQDO\WLFDO PHWKRGV WR SK\VLFDO evidence associated with a setting where criminal activity has occurred. In this course, laboratory exercises are used to provide students with an understanding

165


MORRIS COLLEGE CATALOG of basic concepts, techniques and procedures in forensic science as utilized in the FULPLQDO LQYHVWLJDWRU\ SURFHVV 7RSLFV ZLOO LQFOXGH FULPH VFHQH DQDO\VLV Ă&#x20AC;QJHUSULQW and impression evidence, ballistics, DNA/Serology and drug/trace analysis. Course enrollment is limited to twelve students. Prerequisite: CRJ 300 COMPUTER SCIENCE CSC 101 Introduction to Computer Science and Program Logic (3) Introduction to Computer Science and Program Logic covers the fundamentals of organizing and operating the computer system. Computer arithmetic: binary, hexadecimal and decimal number conversions, binary number arithmetic and Institute RI(OHFWULFDODQG(OHFWURQLFV(QJLQHHUV ,((( ELQDU\Ă RDWLQJSRLQWQXPEHUVWDQGDUG Basic Computer logic: gates, combination circuits, sequential circuits, adders, arithmetic logic unit (ALU), static random-access memory (SRAM) and dynamic random-access memory (DRAM). Introduction to assembly language programming, machine language set design and the design of single cycle central processing unit (CPU). The millions instructions per second (MIPS) based computers are used as example architecture, and alternative architectures are also discussed. Three lecture hours per week. Prerequisite: CIS 101 CSC 102 Computer Programming I (4) & RPSXWHU 3URJUDPPLQJ , LQWURGXFHV WKH EDVLF SURJUDPPLQJ FRQVWUXFWV DQG REMHFW oriented programming techniques. The focus of this course is learning programming ODQJXDJHV\QWD[VHPDQWLFVDQGGHYHORSLQJVWXGHQWV¡DELOLWLHVWRDSSO\WKHNQRZOHGJH in transforming algorithms into code. Additional topics include: enhancing program design skills, program debugging, and promoting good programming styles. The laboratory provides time to gain experience writing programs and becoming familiar with the programming interface and environment. Three lecture hours and one, twohour, laboratory session per week. Prerequisite: CSC 101 CSC 201 Computer Programming II (4) & RPSXWHU3URJUDPPLQJ,,LQWURGXFHVGDWDVWUXFWXUHVDOJRULWKPVDQGEXLOGLQJREMHFWV Topics include linked lists, stacks and queues trees and recursion. An introduction to C programming in a UNIX environment will also be covered. The laboratory provides time to gain experience writing programs in C++ and C Programming within the UNIX environment. Three lecture hours and one, two-hour, laboratory session per week. Prerequisite: CSC 102 CSC 202 Data Structures and Algorithms (3) Data Structures and Algorithms is an analysis of data structures and algorithms using C++ as the implementation language. Topics include a detailed examination of lists, KHDSV WUHHV JUDSKV Ă&#x20AC;OH VWUXFWXUHV DQG WKH XVH RI IRUPDO PHWKRGV (PSKDVLV LV placed on the fundamentals, development and the basics of algorithms analysis. Prerequisite: CSC 201 CSC 310 Operating Systems and Network Fundamentals (3) Operating Systems and Network Fundamentals provides fundamental conceptual knowledge about operating systems. It covers the basic concepts of operating systems. Students will concentrate on the Linux and Windows operating system architecture environments. Topics in structure, scheduling, inter-process communication, PXOWLSURJUDPPLQJ PHPRU\ PDQDJHPHQW Ă&#x20AC;OH V\VWHPV LQSXW DQG RXWSXW GHYLFHV will also be covered. The course also covers the network protocols, hardware and standard network communication application layers. Prerequisite: CSC 201 CSC 320 Database Design and Principles (3) Database Design and Principles is an introductory course emphasizing the basic concepts and principles of database systems. Topics include an introduction to

166


DESCRIPTION OF COURSES database systems and databases, different database system models, basic system and language support (SQL-Structured Query Language) for database systems, relational modes, relational algebra, an introduction to relational database design as well as an overview of common database system issues. Three lecture hours per week. Prerequisite: CSC 102 or CSC 103 or CIS 300 CYBERSECURITY CSS 103 Introduction to Cybersecurity (3) Introduction to Cybersecurity will introduce students to topics relating to access, active attack, blacklist, bot, cloud computing, critical infrastructure, cryptography, data breach, digital forensics, enterprise risk management, information assurance, intrusion detection, malware, passive attack, penetration testing, phishing, software assurance, virus and whitelist. Prerequisite: CIS 101 CSS 104 Python Programming (4) 3\WKRQ3URJUDPPLQJLVWKHĂ&#x20AC;UVWFRXUVHLQFRPSXWHUSURJUDPPLQJWKDWLQWURGXFHVWKH basic python programming constructs and scripting programming techniques. The focus of this course is learning python programming language syntax and semantics DQGGHYHORSLQJVWXGHQWV¡DELOLWLHVWROHDUQWRWKLQNFRPSXWDWLRQDOO\DQGZULWHSURJUDPV to tackle useful problems. Additional topics include: enhancing program design skills, program debugging, and promoting good programming styles. The laboratory provides time to gain experience writing programs in python and becoming familiar with the programming interface and environment. Three lecture hours and one, twohour, laboratory session per week Prerequisite: CIS 101 CSS 300 Operating Systems (3) Operating Systems provides fundamental conceptual knowledge about operating systems. It will cover the basic concepts of operating systems. Topics include the history and evolution of operating systems, the concepts and structure of various operating systems, process scheduling, inter-process communication, input and RXWSXW PXOWLSURJUDPPLQJ PHPRU\ PDQDJHPHQW DQG Ă&#x20AC;OH V\VWHPV7KH FRXUVH ZLOO include a thorough review of computer hardware and software, with emphasis on the application of current and appropriate computing safety and environmental practices. 7KHREMHFWLYHLVWRHYDOXDWHLQVWDOOFRQĂ&#x20AC;JXUHPDLQWDLQDQGWURXEOHVKRRWFRPSXWHU hardware components and operating systems. Three lecture hours per week. Prerequisite: CSS 104 CSS 420 a Computer Security and Networks I (4) Computer Security and Networks I is designed for information technology (IT)and computer professionals to learn computer and network security theories and practices WKDW FDQ EH XVHG WR VLJQLĂ&#x20AC;FDQWO\ UHGXFH WKH VHFXULW\ YXOQHUDELOLW\ RI FRPSXWHUV RQ internal networks or the Internet. The course assumes some familiarity with various operating systems and computer networks. Topics include cryptography, program security, operating systems security, database security, network security, security administration, computer ethics, and legal issues. The laboratory provides time to gain experience performing networking administration and security tasks, practicing security monitoring procedures, and performing basic network intrusions and defense tasks. Three lecture hours and one, two-hour, laboratory session per week Prerequisite: CSS 300 CSC 440 Computer Security and Networks II (3) Computer Security and Networks II is the second course in network security that LQWURGXFHVGRPDLQVSHFLĂ&#x20AC;FQHWZRUNLQJDQGVHFXULW\WKHRU\WRVWXGHQWV7RSLFVLQFOXGH corporate network security, industrial cyber security systems, medical network security, and an introduction to ethical hacking. Three lecture hours per week. Prerequisite: CSS 420

167


MORRIS COLLEGE CATALOG DEVELOPMENTAL STUDIES All developmental students (reading, English, and mathematics) are required to complete weekly computer lab assignments in addition to the classroom work, and WKHFRPSXWHUODEJUDGHFRQVWLWXWHV SHUFHQWRIWKHĂ&#x20AC;QDOFRXUVHJUDGH DEG 101 Developmental English I (3) Developmental English I emphasizes sentence-level skills and paragraph-length assignments based on personal experience. The course includes an extensive review of skills in grammar, sentence structure, word usage and punctuation, in addition to paragraph writing. Also, emphasis is placed on outlining drafting, revising, editing, and the writing process. Special attention will be given to the rules of Standard Written English. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. DEG 102 Developmental English II (3) Developmental English II emphasizes paragraphing skills and simple multi-paragraph assignments. Special attention is given to the rules of Standard Written English, patterns of paragraph development, and basic essay structure. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. DMA 101 Developmental Mathematics I (3) Developmental Mathematics I is a review of whole numbers, fractions, decimals, ratios and proportions, percents, and basic operations with integers. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. DMA 102 Developmental Mathematics II (3) Developmental Mathematics II is a continuation of Developmental Mathematics I. Topics include operations with integers, exponents, polynomials, linear equations and inequalities with applications, factoring trinomials, tables, charts, graphs, measurement and basic geometry, and basic statistics. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. DRD 101 Developmental Reading I (3) Developmental Reading I emphasizes the development of skills in word attack, vocabulary development, comprehension, reading-study, library usage, expressive oral reading, and listening. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. DRD 102 Developmental Reading II (3) Developmental Reading II is based on the needs and interests of individual students, with emphasis on vocabulary development, word attack skills, higher order comprehension skills, and reading rate. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. ECONOMICS ECO 301 Macroeconomics (3) Macroeconomics topics includes the basic function of an economic system, law of VXSSO\ DQG GHPDQG EXVLQHVV F\FOHV FRQVXPSWLRQ VDYLQJV PRQHWDU\ DQG Ă&#x20AC;VFDO policy, and money and the banking system. Emphasis is on production, employment, DQGWKHHVWLPDWLRQRILQĂ DWLRQDQGXQHPSOR\PHQWUDWHV ECO 302 Microeconomics (3) Microeconomics includes application of supply and demand elasticity, the market structure under American capitalism, price and output determination of the individual Ă&#x20AC;UPXQGHUYDU\LQJFRPSHWLWLYHPDUNHWVWUXFWXUHVDQGSULFLQJRIIDFWRUVRISURGXFWLRQ Students evaluate the comparative advantage among nations as it relates to global competition and international trade.

168


DESCRIPTION OF COURSES EDUCATION DME 102 Developmental Mathematics for Praxis Core Preparation (3) Developmental Mathematics for Praxis Core Preparation will focus on the strands of mathematics covered on the Praxis Core Mathematics Test outline by ETS and the strands of mathematics covered in the DMA 101 and 102 and MAT 103 courses. Topics include whole numbers, fractions, decimals, ratios and proportions, percentages, and basic operations with integers; operations with integers, exponents, polynomials; linear equations and inequalities with applications; factoring trinomials, tables, charts, graphs, and measurement, basic geometry; and basic statistics. The course will require lab work to practice skills learned in class. . All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. The course is open only to prospective Teacher Education majors EDU 215 Human Development (3) Human Development includes a study of human growth and development covering the periods of conception, prenatal, neonatal, early childhood, childhood, adolescence, old age and death. Emphasis is placed on the interrelationship between actual growth, PDWXUDWLRQDOSURFHVVHVDQGHQYLURQPHQWDOLQĂ XHQFHV7KHVWXG\RIWKHUHODWLRQVKLS of teaching and learning to physical, social, intellectual, and emotional development is essential. EDU 251 Foundations of Education (3) Foundations of Education focuses on the nature of education in general and provides an understanding of the historical, philosophical, sociological, legal, governance and VRFLHWDOLQĂ XHQFHVRQ$PHULFDQDQGLQWHUQDWLRQDOHGXFDWLRQ7KHFRXUVHDGYDQFHV the knowledge and skills of prospective education candidates though teaching about diverse peoples and cultures of selected industrialized countries of the world. It includes an emphasis on the role, development and organizations of public education in the United States and in other industrialized countries. Students conduct a comparative analysis of education and educational systems in the United States with those of other countries. It emphasizes the legal status of teachers and students, including federal and state laws and regulations, schools as social organizations, contemporary issues in education, the foundations of instructional design, and the growth and improvement RI NQRZOHGJH LQ WKH Ă&#x20AC;HOG RI HGXFDWLRQ 'LYHUVLW\ DQG WHFKQRORJ\ DUH LQWHJUDWHG WKURXJKRXW WKH FRXUVH$ Ă&#x20AC;IWHHQKRXU SUDFWLFXP DQG Ă&#x20AC;IWHHQ KRXUV RI SUHSDUDWLRQ IRU Praxis Core are required. EDU 301 Curriculum, Instruction and Assessment in Elementary Education (3) Curriculum, Instruction and Assessment in Elementary Education familiarizes the SURVSHFWLYH HOHPHQWDU\ VFKRRO WHDFKHUV ZLWK FXUUHQW PDMRU SURJUDPV DQG GHYHORSV skills in the selection, organization, and use of materials and methods for elementary LQVWUXFWLRQ  0 DMRU FRQVLGHUDWLRQV LQFOXGH WKH FKDQJLQJ HOHPHQWDU\ VFKRRO WKH WHDFKHU¡V LQVWUXFWLRQDO DQG SURIHVVLRQDO UROH SODQQLQJ IRU OHDUQLQJ FODVVURRP PDQDJHPHQW FRPPXQLW\ UHVRXUFHV FRQĂ LFW UHVROXWLRQ VNLOOV FDUHHU H[SORUDWLRQ parental involvement, nature of child growth and development, and orientation to instruments used in evaluating teaching (PRAXIS, ADEPT, PET, etc.). A twenty- hour practicum is required. Open only to students who have been admitted to the Teacher Education Program. EDU 302 Educational Psychology (3) Educational Psychology is designed to study the nature of educational processes based on psychological concepts, principles, and theories related to classroom teaching. Emphasis is given to the discussion of such important topics as learning styles, diversity, intelligence, motivation, personality, and career education. Required RIDOOHDUO\FKLOGKRRGHOHPHQWDU\DQGVHFRQGDU\HGXFDWLRQPDMRUV EDU 304 Educational Assessment and Evaluation (3) Educational Assessment and Evaluation is concerned with the history, development, analysis, assessment and evaluation and the application of tests used in public and SULYDWH FODVVURRPV 0 RUH VSHFLĂ&#x20AC;FDOO\ LW LV FRQFHUQHG ZLWK WKH VWXGHQW RI WHVWV DQG

169


MORRIS COLLEGE CATALOG measurements as they relate to classroom situations. Special emphasis is placed on the study, selection, and use of carious standardized and teacher-made measuring devices and on simple methods of interpreting and presenting test results. The course is designed to help students improve their skills in taking standardized tests and to assist them in developing their critical thinking, problem solving, and performance skills. EDU 306 Behavior and Development of the Young Child (3) 7KLV FRXUVH IRFXVHV RQ XQGHUVWDQGLQJ DQG DQDO\]LQJ \RXQJ FKLOGUHQ¡V EHKDYLRU while fostering healthy social and emotional development in the main types of early education settings (early school grades, child-care settings, and homes and Head Start programs). The course will provide students with strategies for creating theorybased, individualized, child-centered interventions, and for establishing nurturing classroom learning communities in which all children feel safe, valued, and genuinely respected. A ten-hour practicum is required Open only to students who have been admitted to the Teacher Education Program. EDU 309 Principles of Guidance (3) Principles of Guidance explores the philosophy and functions of guidance; the study of EDVLFVNLOOVDQGWHFKQLTXHVRIJXLGDQFHVXFKDVREVHUYDWLRQFDVHVWXGLHVSURMHFWLYH techniques, records; and the study and evaluation of the role of the administrator, teacher, and counselor. Students are involved in career exploration and counseling initiatives. EDU 310 Curriculum, Instruction and Assessment in Language Development and Communication Skills (3) Curriculum, Instruction and Assessment in Language Development and Communication Skills focuses on an understanding of the principles of learning, teaching methods, and assessment to promote student learning as it relates to understanding of language development and communication skills, the relationships among curriculum, instruction and assessment. Analysis of the curricular program used in the state of South Carolina to meet the needs of students will be incorporated. 0 RUH VSHFLĂ&#x20AC;FDOO\ WKH FRXUVH IRFXVHV RQ WKH GHYHORSPHQW RI ODQJXDJH DUWV IURP birth through the elementary school years. Students are acquainted with activities which are appropriate in developing the language arts skills of listening, speaking, reading, and writing A ten-hour practicum is required in language development and communication skills. EDU 311 Curriculum, Instruction and Assessment in Early Childhood Education Curriculum, Instruction and Assessment in Early Childhood Education acquaints students with methods and materials appropriate for the content areas that are a part of the curriculum for early childhood education. Basic concepts in curriculum development are emphasized, and several early childhood programs are examined. & DUHHU RSSRUWXQLWLHV IRU (DUO\ & KLOGKRRG PDMRUV DUH H[SORUHG $ WZHQW\ KRXU practicum is required. Open only to students who have been admitted to the Teacher Education Program. EDU 312 Curriculum, Instruction and Assessment in Health and Physical Education for Elementary Education (3) Curriculum, Instruction and Assessment in Health and Physical Education for (OHPHQWDU\(GXFDWLRQIRFXVHVRQWKHRULHVSUDFWLFHVREMHFWLYHVFRQWHQWDQGPHWKRGV of presenting and assessing health and physical education in the secondary school curriculum. Analysis of the curricular program used in the state of South Carolina to meet the needs of students will be incorporated. Instruction will be supplemented by REVHUYDWLRQDQGSDUWLFLSDWLRQLQSXEOLFDQGSULYDWHVFLHQFHVHWWLQJV0 RUHVSHFLĂ&#x20AC;FDOO\ LWSUHSDUHVFODVVURRPWHDFKHUVLQWKHĂ&#x20AC;HOGRIKHDOWK7KHWKUHHSKDVHVRIWKHVFKRRO health program, school health services, health instruction, and healthful school living, are treated. Special attention is given to the health status of school children, common

170


DESCRIPTION OF COURSES health problems, and the role of the school in handling such problems. Exposing children to careers in health is essential. The importance of physical activities for Pk-6 grades is highlighted. Movement Education and activities to encourage active movement is emphasized. A ten- hour practicum is required in a physical education classroom. Open only to students who have been admitted to the Teacher Education Program. EDU 313 Curriculum, Instruction and Assessment in Social Studies for Elementary Education (3) Curriculum, Instruction and Assessment in Social Studies for Elementary Education DOVR IRFXVHV RQ WKHRULHV SUDFWLFHV REMHFWLYHV FRQWHQW DQG PHWKRGV RI SUHVHQWLQJ and assessing social studies in the early childhood and elementary school curriculum. Analysis of the curricular program used in the state of South Carolina to meet the needs of students will be incorporated. Instruction will be supplemented by observation DQGSDUWLFLSDWLRQLQSXEOLFDQGSULYDWHVFLHQFHVHWWLQJV0 RUHVSHFLĂ&#x20AC;FDOO\LWDFTXDLQWV early childhood and elementary school students exploring the meaning of social studies, teaching and learning strategies for social studies; planning for instruction; content of social science (anthropology, economics, geography, history, sociology, and political science); values and human relationships, inquiry and problem solving; research methods; strategies for making and interpreting maps; current events; career exploration; games and simulations for social studies; and skill building in social studies. A twenty- hour practicum is required. Open only to students who have been admitted to the Teacher Education Program. EDU 314 Introduction to Exceptional Children (3) Introduction to Exceptional Children is a study of the characteristics and needs of exceptional children, including the gifted and talented. An overview of the competencies needed to work with this population, appropriate educational programs, and delivery of services is incorporated into this course. EDU 316 Curriculum, Instruction and Assessment in Mathematics for Early Childhood Education (3) Curriculum, Instruction and Assessment in Mathematics for Early Childhood Education is a study of sets, counting numbers, numeration systems, properties of the fundamental operations, elementary number theory, the rational number systems, decimal representation, the set of real numbers, informal algebra, and plane and solid geometry. A twenty-hour practicum is required. Prerequisite: MAT 103 Open only to students who have been admitted to the Teacher Education Program. EDU 317 Curriculum, Instruction and Assessment in Mathematics for Elementary Education (3) Curriculum, Instruction and Assessment in Mathematics for Elementary Education is a study of the rational number system, decimal representation, the set of real numbers, informal algebra, and plane and solid geometry. A twenty-hour practicum is required. Prerequisite: MAT 103 Open only to students who have been admitted to the Teacher Education Program. EDU 318 Curriculum, Instruction, and Assessment in Health and Physical Education for Early Childhood Education (3) Curriculum, Instruction and Assessment in Health and Physical Education for Early Childhood Education is designed to develop instructional techniques as related to health and physical education, movement education theory and the integration of early childhood studies through movement experiences; included in an examination of health concepts and health programs. $Ă&#x20AC;IWHHQKRXUSUDFWLFXPLVUHTXLUHGLQDSK\VLFDOHGXFDWLRQFODVVURRP

171


MORRIS COLLEGE CATALOG EDU 319 Literature for Children and Adolescent (3) Literature for Children and Adolescents deals with literature for children and adolescents and with criteria for selecting and evaluating works of special interest to children and adolescents. Open only to students who have been admitted to the Teacher Education Program. Diversity and the use of technology will be infused throughout the course. EDU 320 Curriculum, Instruction, and Assessment in Visual and Performing Arts for Elementary Education (3) Curriculum, Instruction and Assessment in Visual and Performing Arts for Elementary (GXFDWLRQ IRFXVHV RQ WKHRULHV SUDFWLFHV REMHFWLYHV FRQWHQW DQG PHWKRGV RI presenting and assessing visual and performing arts in the elementary school curriculum. Analysis of the curricular program used in the state of South Carolina to meet the needs of students will be incorporated. Instruction will be supplemented E\REVHUYDWLRQDQGSDUWLFLSDWLRQLQSXEOLFDQGSULYDWHVHWWLQJV0 RUHVSHFLĂ&#x20AC;FDOO\WKH course focuses on current curriculum models that permit candidates to gain insight into the role of the arts in our schools and in our lives. The course allows candidates the opportunity to create and to maintain a network of community arts and cultural institutions that support all teachers and st udents success and immersion in the arts are closely linked. The course also addresses multiple intelligences, creative thinking, cultural diversity, technology and special needs as they relate to the arts. Emphasis LVJLYHQWRWKHLQWHJUDWLRQRIWKHDUWVLQWRWKHFRQWHQWVXEMHFWDUHDVZLWKVSHFLDOIRFXV RQ PXVLF GDQFH DQG GUDPD DV ZHOO DV WKH YLVXDO DUWV$ Ă&#x20AC;IWHHQKRXU SUDFWLFXP LV required. Open only to students who have been admitted to the Teacher Education Program. EDU 321 Curriculum, Instruction, and Assessment in the Visual and Performing Arts for Early Childhood Education (3) Candidates examine basic arts concepts and skills, factual or contextual learning about the arts in history and culture, and higher order to critical thinking skills relating to dance, drama/theatre, music, and the visual arts. The course consists of study and experiences in each art form through four curricular components: aesthetic perception, creative expression, historical and cultural heritage and aesthetic valuing. $Ă&#x20AC;IWHHQKRXUSUDFWLFXPLVUHTXLUHG Open only to students who have been admitted to the Teacher Education Program EDU 322 Foundations of Reading (3) )RXQGDWLRQV RI 5HDGLQJ IRFXVHV RQ WKH PDMRU FRPSRQHQWV RI WKH UHDGLQJ SURFHVV including linguistic, psychological, physiological and sociological factors affecting HDFKVWDJHRIWKHGHYHORSPHQWRIWKHSURFHVV,WLGHQWLĂ&#x20AC;HVWKHFRPSRQHQWVRIUHDGLQJ and familiarizes students with trends and issues in reading education. Prospective WHDFKHUVDSSO\WKHSULQFLSOHVRIVFLHQWLĂ&#x20AC;FDOO\EDVHGUHDGLQJUHVHDUFKDVWKHIRXQGDWLRQ RIFRPSUHKHQVLYHLQVWUXFWLRQ$WZHQW\Ă&#x20AC;YHKRXUSUDFWLFXPLVUHTXLUHG. Open only to students who have been admitted to the Teacher Education Program. EDU 323 Curriculum, Instruction and Assessment in Social Studies for Early Childhood Education (3) Curriculum, Instruction and Assessment in Social Studies for Early Childhood Education introduces students to all facets of the P-3 social studies experiences needed to guide early childhood school students on the path to responsible citizenship. The course focuses on the highly integrative and multidisciplinary nature of the social studies. Particular emphasis is placed on the integration of history, geography and civics education with other areas of the curriculum. A twenty- hour practicum is required. Open only to students who have been admitted to the Teacher Education Program.

172


DESCRIPTION OF COURSES EDU 400 Curriculum, Instruction, and Assessment in Reading (3) Curriculum, Instruction and Assessment in Reading focuses on an understanding of the principles of learning, teaching methods, and assessment to promote student learning as it relates to understanding reading theories, instructional strategies and DVVHVVPHQW WDVNV  0 RUH VSHFLĂ&#x20AC;FDOO\ WKH FRXUVH IRFXVHV RQ KHOSLQJ FDQGLGDWHV develop skills in the facilitation of effective learning experiences for learners in literacy. Focus will be on the study of reading curriculum, instructional strategies and methods, and assessment of students, materials and classroom procedures and evaluation techniques to facilitate reading in the content areas. Students will use a variety of teaching strategies which are applicable to all grades. These strategies will promote FULWLFDO WKLQNLQJ WKURXJK DQDO\VLV DQG UHĂ HFWLRQ ZKLOH WKH XVH RI FUHDWLYH WKLQNLQJ practices help educators align content, processes and assessment to increase student achievement in the areas of literacy and reading. Course participants will HQJDJHLQFODVVURRPGLVFXVVLRQUHVHDUFKDQGUHĂ HFWLRQREVHUYDWLRQDQGSUDFWLFXP experiences. A twenty-hour practicum is required. Open only to students who have been admitted to the Teacher Education Program. EDU 402 Observation and Directed Teaching (Early Childhood Education) (9) Observation and Directed Teaching is a course required of all early childhood HGXFDWLRQPDMRUVSUHSDULQJWRWHDFKLQSXEOLFVFKRROVZLWKGLYHUVHOHDUQHUV,QDGGLWLRQ to classroom work prior to and after the student teaching period, the prospective teacher is required to perform twelve weeks of observation and actual teaching in the area of his specialization in the public school. Open only to students who have been admitted to the Teacher Education Program. EDU 403 Observation and Directed Teaching (Elementary Education) (9) 2EVHUYDWLRQ DQG 'LUHFWHG 7HDFKLQJ LV UHTXLUHG RI DOO HOHPHQWDU\ HGXFDWLRQ PDMRUV preparing to teach in public schools with diverse learners. In addition to classroom work prior to and after the student teaching period, the prospective teacher is required to perform twelve weeks of observation and actual teaching in the area of his specialization in the public school. Open only to students who have been admitted to the Teacher Education Program. EDU 405 Educational Seminar (3) Educational Seminar is the capstone course designed to summarize and synthesize the knowledge accumulated in the early childhood, elementary, and senior high school curricula. Current innovations in methods, materials and procedures especially related WRWKHFRQFHSWXDOIUDPHZRUNRISUHSDULQJFRPSHWHQWFULWLFDOWKLQNLQJUHĂ HFWLYHDQG caring teachers are explored. Directed of the course. Classroom demonstrations, web-based instruction, guest lecturers, and research enable the candidate to gain a V\VWHPDWLFYLHZRIWKHZKROHĂ&#x20AC;HOGRIHGXFDWLRQ& DQGLGDWHVDOVREHFRPHDFTXDLQWHG with various technologies and diversity related issues, assessment and instructional strategies, and equipment through the use of the Bobby Leroy Brisbon Curriculum Resource Room. Candidates also become involved in communication for the workplace, career development, and professional collegiality. This course is taken concurrently with EDU 412, EDU 402 or EDU 403 Observation and Directed Teaching. Open only to students who have been admitted to the Teacher Education Program. EDU 406 Curriculum, Instruction, and Assessment in Secondary School Science (3) Curriculum, Instruction and Assessment in Secondary School Science focuses on the REMHFWLYHVRIVFLHQFHWHDFKLQJWKHQDWXUHRIVFLHQFHWKHSURFHVVRIOHDUQLQJVFLHQFH curriculum developments and trends in biology, physics, chemistry, physical science, earth science, and general science; the history of science; the psychology of learning and its implication for science teaching; the place of experiments, demonstrations, audio-visual aids, instructional media, lecture, and discussion and questioning techniques in science programs; facilities for science teaching; reading in science programs; providing for individual differences; planning science lessons and units;

173


MORRIS COLLEGE CATALOG planning environmental studies; patterns in the use of laboratory techniques and procedures; and using science textbooks, notebooks, workbooks, excursions, science FOXEV VFLHQFH SURMHFWV IDLUV DQG FRQJUHVVHV DQG WHVWLQJ DQG HYDOXDWLRQV LQ WKH VFLHQFHSURJUDP$WKLUW\Ă&#x20AC;YHKRXUSUDFWLFXPLVUHTXLUHG Open only to students who have been admitted to the Teacher Education Program EDU 407 Curriculum, Instruction, and Assessment in Secondary School Social Studies (3) Curriculum, Instruction and Assessment in Secondary School Social Studies focuses on curriculum, instruction and assessment in Social Studies at the Secondary School level. It acquaints students with a short history of the trends in social studies. Patterns of curriculum with organization; instructional units and lesson planning; diagnosing DQG DVVHVVLQJ VWXGHQWV¡ OHDUQLQJ XWLOL]LQJ YDULRXV PRGDOLWLHV DQG LQVWUXFWLRQDO techniques; decision making; cultural heritage studies and law-focused studies; moral education; utilizing the local community; integrating the social studies disciplines (history, geography, political science, economics, sociology and psychology); career exploration; and the characteristics of social studies teachers are analyzed in this FRXUVH$WKLUW\Ă&#x20AC;YHKRXUSUDFWLFXPLVUHTXLUHG Open only to students who have been admitted to the Teacher Education Program EDU 409 Reading and Writing in the Content Areas (3) Reading and Writing in the Content Areas focuses on curriculum, instruction, assessment and evaluation of teaching, reading and writing in the content areas. 0 RUHVSHFLĂ&#x20AC;FDOO\LWLQFOXGHVVWUDWHJLHVDQGPDWHULDOVWKDWIDFLOLWDWHVWXGHQWV¡UHDGLQJ writing, and study skills. It examines the relationship between literacy instruction and content area study and includes adaptation to culturally diverse and exceptional VWXGHQWV$WZHQW\Ă&#x20AC;YHKRXUSUDFWLFXPLVUHTXLUHG Open only to students who have been admitted to the Teacher Education Program. EDU 412 Observation and Directed Teaching (Secondary Education) (9) Observation and Directed Teaching is a course required of all secondary education specializations preparing to teach in public schools with diverse learners. In addition to classroom work prior to and after the student teaching period, the prospective teacher is required to perform twelve weeks of observation and actual teaching in the area of his specialization in the public school. Open only to students who have been admitted to the Teacher Education Program. EDU 413 Curriculum, Instruction, and Assessment in Secondary School Mathematics (3) Curriculum, Instruction and Assessment in Secondary School Mathematics deals with the history of mathematics, the principles for planning and directing effective learning experiences in mathematics, and the selection and utilization of appropriate materials for instruction in the secondary school. The course includes instruction in technology in mathematical problem solving and applications. Use of the tools of geometry, FRPSDVVHVWKHSURWUDFWRUDQGWKHUXOHULVHPSKDVL]HG$WKLUW\Ă&#x20AC;YHKRXUSUDFWLFXP is required. Open only to students who have been admitted to the Teacher Education Program. EDU 415 Curriculum, Instruction, and Assessment in Secondary School English (3) Curriculum, Instruction and Assessment in Secondary School English focuses on an understanding of curriculum, instruction and assessment of English in the secondary schools. It concentrates on the roles and responsibilities of the English teacher; effective classroom techniques; and procedures in the teaching of literature, language, and composition. A thirty- hour practicum is required. Diversity and the use

174


DESCRIPTION OF COURSES of technology will be infused through the course. Open only to students who have been admitted to the Teacher Education Program. (' 8 'LDJQRVLVDQG&RUUHFWLRQRI5HDGLQJ'LIĂ&#x20AC;FXOWLHV 

'LDJQRVLV DQG & RUUHFWLRQ RI 5HDGLQJ 'LIĂ&#x20AC;FXOWLHV LQYROYHV WKH VHOHFWLRQ RI VXLWDEOH materials and desirable techniques. It also embodies practice in analyzing and diagnosing individual needs for corrective and remedial treatment. Open only to students who have been admitted to the Teacher Education Program. ENGLISH ENG 103 Fundamentals of Composition (3) Fundamentals of Composition emphasizes writing in essay format. Classroom activities and assignments involve expository, critical, persuasive, and research-based writing. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to pass the course. ENG 104 Research and Composition (3) Research and Composition emphasizes research-based writing. Special attention is given to the acquisition and employment of research skills. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to pass the course. Prerequisite: ENG 103 ENG 201 Creative Writing (3) Creative Writing emphasizes the principles of creative writing, with emphasis on HVVD\VVKRUWĂ&#x20AC;FWLRQDQGSRHWU\ ENG 202 Introduction to Literature (3) Introduction to Literature introduces literary and critical approaches to literature and UHIHUHQFHWRROV,WGHYHORSVXQGHUVWDQGLQJDQGDSSUHFLDWLRQRISRHWU\GUDPDĂ&#x20AC;FWLRQ and the essay. Prerequisite: ENG 104 ENG 205 African American Literature (3) African American Literature is a critical and historical survey of literary works by African American writers from the Colonial period to the modern period. Critical interpretation of the literature is related to socio-historical forces and African American literary traditions. Prerequisite: ENG 104 ENG 301 Critical Thinking and Reasoning (3) The goal of Critical Thinking and Reasoning is to provide the student with skills necessary to read and think in an analytical manner. Topics to be reviewed include critical thinking, vocabulary, word parts, and word origins, as well as drawing inferences and skimming and scanning. This course involves the learner in developing advanced reading and writing skills. ENG 305 American Literature I (3) $PHULFDQ/LWHUDWXUH,FRYHUVPDMRUZULWLQJVLQ$PHULFDQ/LWHUDWXUHIURPWKHVHYHQWHHQWK century through the middle of the nineteenth century. ENG 306 American Literature II (3) $PHULFDQ/LWHUDWXUH,,FRYHUVPDMRUZULWLQJVLQ$PHULFDQ/LWHUDWXUHIURPWKHPLGGOHRI the nineteenth century to the present. Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisite: ENG 305 ENG 307 World Literature I (3) World Literature I covers masterpieces of world literature in translation from the

175


MORRIS COLLEGE CATALOG Ancient World to the French Neo-Classic period. It includes works by European, Asian, and African writers. ENG 308 World Literature II (3) World Literature II covers masterpieces of World Literature in translation from the Neo-Classic period to the Modern period. It consists of works by American, European, African, and Asian writers. Prerequisite: ENG 307 ENG 309 Major Novels (3) 0 DMRU1RYHOVHPSKDVL]HVPDMRUGHYHORSPHQWVLQWKHQRYHOIURPLWVEHJLQQLQJWRWKH present in the areas of style, theory, and philosophy. ENG 310 Advanced Composition and Rhetoric (3) Advanced Composition and Rhetoric stresses competency in the expression of ideas with organization, clarity, and effectiveness. It involves written analysis of classical and contemporary rhetorical devices and their effect on communication. ENG 311 History of the English Language (3) History of the English Language is a study of the sounds and structure of the English language in the various stages of its development and a survey of the external and LQWHUQDOLQĂ XHQFHVWKDWDIIHFWODQJXDJH7KHFRXUVHLQFOXGHVDQDO\VHVRIWH[WVLQ2OG Middle, and Modern English. ENG 312 Modern English Grammar (3) Modern English Grammar is a study of the grammar of the language. It emphasizes syntactic analysis and applies the methods of traditional grammar, structural grammar, and transformational-generative grammar. ENG 313 African American Poets (3) $IULFDQ$PHULFDQ3RHWVH[DPLQHVDQGFULWLFDOO\DQDO\]HVPDMRUSHULRGVNH\WKHPHV and key works of African American poets from the early eighteenth center to the present. ENG 315 Technical Writing (3) Technical Writing introduces students to models of technical writing, ranging from memos and summaries to detailed formal reports and proposals. Attention is given to the strategies of research, design, and rhetoric necessary for effective communication. ENG 321 History of the Theater (3) History of the Theater is a study of dramatic theory and literature from the Greeks to the present day, with emphasis on the Greek theater; the English theater of the Renaissance period; the mid-eighteenth-century theater; and recent developments in realism, naturalism, and expressionism. ENG 322 Twentieth Century Literature (3) 7ZHQWLHWK& HQWXU\/LWHUDWXUHFRYHUVWKHPDMRUOLWHUDU\WUHQGVRIWKHWZHQWLHWKFHQWXU\ $WWHQWLRQLVSDLGWRWKHPDMRUJHQUHVRIWKHSHULRGDQGLQFOXGHV& RQWLQHQWDODVZHOO as English and American literature. Open only to students with 56 semester hours of college-level credit. Open only to students who have earned at least 56 semester hours of collegelevel credits. ENG 330 African American Drama (3) African American Drama is a study of the development of African American drama, with emphasis on the Harlem Renaissance and contemporary periods. ENG 360 Literature Studies (3) Literature Studies is a study of one or more European, Asian, African, British, or American authors, genres, or literature periods.

176


DESCRIPTION OF COURSES ENG 405 Shakespeare (3) Shakespeare is a study of selected comedies, tragedies, historical dramas, and poetry by Shakespeare. It covers his development as a dramatist and poet, with attention to each of these genres. ENG 412 British Literature I (3) % ULWLVK/LWHUDWXUH,FRYHUVWKHZRUNVRIPDMRUZULWHUVJHQUHVDQGPRYHPHQWVIURPWKH medieval period to the Age of Johnson. ENG 413 British Literature II (3) British Literature II is a survey course from the Romantics to the present. Emphasis is RQPDMRUZULWHUVJHQUHVDQGPRYHPHQWVIURPWKHODWWHUSDUWRIWKHHLJKWHHQWKFHQWXU\ to the present. Prerequisite: English 412 ENG 414 Nineteenth Century British Literature (3) Nineteenth Century British Literature is a study of British Literature from the beginning of the Romantic period through the Victorian period, with emphasis on writers, movements, and genres. ENG 415 Literary Criticism (3) /LWHUDU\& ULWLFLVPLVDQLQWURGXFWLRQWRFULWLFDODSSURDFKHVWROLWHUDWXUHDQGWKHPDMRU critical theories from Aristotle to the present. ENG 422 Contemporary Literature (3) & RQWHPSRUDU\ /LWHUDWXUH LV D VWXG\ RI PDMRU WUHQGV ZULWHUV DQG PRYHPHQWV VLQFH 1945, including English, American, and world literatures. ENG 490 English Seminar (3) English Seminar is the capstone course for English majors. It offers a systematic UHYLHZ RI PDMRU OLWHUDU\ FRQFHSWV Ã&#x20AC;JXUHV DQG KLVWRULFDO SHULRGV DV ZHOO DV theories of language development and use. Students prepare a semester-long research project and professional career portfolio. A comprehensive senior H[LW H[DPLQDWLRQ FRYHULQJ VXEMHFW PDWWHU LQ WKH Ã&#x20AC;HOG LV LQFRUSRUDWHG LQWR WKLV course.. FRENCH FRE 101 Elementary French I (3) Elementary French I provides an introduction to the four basic language skills: listening, speaking, reading, and writing. It includes a limited study of French history, culture, and national identity. FRE 102 Elementary French II (3) Elementary French II is a continuation of Elementary French I and the basic language skills. It includes a broader study of French history, culture, and national identity. Prerequisite: FRE 101 FRE 201 Intermediate French I (3) Intermediate French I is designed for students who have completed Elementary French I and II. It is designed to further develop skills in conversation and writing, with emphasis on grammar review, more complex structures, vocabulary expansion, and French culture. FRE 202 Intermediate French II (3) Intermediate French II is designed to enable students to further develop basic skills so that they can converse and write more effectively in the language. Continued emphasis will be placed on grammar; more complex structures; vocabulary expansion; and francophone cultures, histories, and national identity. Prerequisite: FRE. 201

177


MORRIS COLLEGE CATALOG FRESHMAN SEMINAR FRS 100 Freshman Seminar I: Instrodution to College (1) Freshman Seminar provides comprehensive guidance to students in the process of PDNLQJ VXFFHVVIXO DGMXVWPHQW WR FROOHJH OLIH  ,W LQFOXGHV XQLWV RQ GHYHORSPHQW RI productive study habits, sound academic planning, increased test sophistication, and career awareness. FRS 102 Freshman Seminar II: Financial Literacy (1) Freshman Seminar II: Financial Literacy provides students with information about PDQDJLQJ WLPH PRQH\ DQG Ă&#x20AC;QDQFLDO DLGORDQ GHEW DQG KHOSV WKHP RUJDQL]H WKHLU SHUVRQDO Ă&#x20AC;QDQFHV ZKLOH WKH\ DUH HQUROOHG LQ FROOHJH DQG DIWHU WKH\ JUDGXDWH $OO students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. GEOGRAPHY GEO 201 World Regional Geography (3) :RUOG5HJLRQDO*HRJUDSK\LVDVXUYH\RIWKHPDMRUHFRQRPLFVRFLDOSROLWLFDODQG SK\VLFDOFKDUDFWHULVWLFVRIWKHZRUOG¡VHFRQRPLFDOO\GHYHORSHGQDWLRQVDQGWKHZRUOG¡V economically developing nations. Students engage in considerable amounts of map preparation work for every region of the world. GEO 401 Cultural Geography (3) Cultural Geography deals with the relationship between land and people. It examines cultural patterns of linguistic, religious, ethnic, and popular geographic differentiation as well as spatial and environmental concerns. GENERAL SCIENCE GSC 200: Curriculum Instruction and Assessment in Science for Elementary Education (4) Science for the Early Childhood and Elementary Classrooms (PK-6) emphasizes selected topics from the Physical Sciences, Earth and Space Sciences, Biological Sciences, Science as Inquiry, Science and Technology, Science in Personal and Social Practices, and the History and Nature of Science. The methods of applying these topics to classroom situations are taught as essential to a successful educator. The Constructivist approach is highlighted as the most current technique in science WHDFKLQJ$Ă&#x20AC;IWHHQKRXUSUDFWLFXPLVUHTXLUHG Open only to students who have been admitted to the Teacher Education Program. Prerequisites: BIO 100 and PHS 100 GSC 201 Curriculum, Instruction and Assessment in Science for Early Childhood Education (4) This course is designed for the study and practice of teaching methods and materials for science at the early childhood school levels, grades P-3. Emphasis is placed on concept development through questioning techniques, critical thinking, multimedia/ WHFKQRORJ\ DQG LQTXLU\ WHDFKLQJ WR PHHW JURXS DQG LQGLYLGXDO QHHGV$ Ă&#x20AC;IWHHQKRXU practicum is required. Prerequisites: BIO 100 and PHS 100 Open only to students who have been admitted to the Teacher Education Program. HISTORY HIS 104 World History (3) World History examines the history of the world from 1500 to the present. It deals

178


DESCRIPTION OF COURSES ZLWK VLJQLĂ&#x20AC;FDQW GHYHORSPHQWV HYHQWV SHRSOH LQVWLWXWLRQV DQG JOREDO LQWHUDFWLRQ and includes social, economic, political, military, religious, aesthetic, legal, and WHFKQRORJLFDOIDFWRUVWKDWFRQWULEXWHWKHVWXGHQW¡VXQGHUVWDQGLQJRIWKHPRGHUQZRUOG HIS 106 African-American History (3) $IULFDQ$PHULFDQ+ LVWRU\LVDVXUYH\RIPDMRUGHYHORSPHQWVRIWKH$IULFDQ'LDVSRUD in its American context from African heritage to the present. Particular emphasis is placed on the African way of life, the beginning of slavery, the era of the Civil war and Reconstruction, African-American leadership and organizations, the struggle for civil rights, and contemporary issues and concerns. HIS 304 American History I (3) American History I is the study of the colonization of America, the establishment of American independence, the formation of the federal republic, the growth of the American nation, and the Civil War up to 1865. Open only to students who have earned at least 56 semester hours of college-level credit. HIS 305 American History II (3) American History II is the study of modern America; the impact of World War I, World War II, and the Civil Rights Movement; and industrial and political changes, with emphasis on economic, social, and intellectual developments from 1865 to the present. Open only to students who have earned at least 56 semester hours of collegelevel credit. HIS 307 American Economic History (3) American Economic History covers historical development in agriculture, industry, communication, transportation, banking and credit, commerce, and government economic policies. HIS 310 History of the Civil Rights Movement (3) History of the Civil Rights Movement examines the contributions of African-American leaders of the Civil Rights era. It evaluates the origins of the movement, the struggles, DQG WKH SURWHVWV RI WKH  ¡V DQG WKH ¡V WKH YDULHW\ RI VWUDWHJLHV DQG WDFWLFV HPSOR\HGE\WKHPRYHPHQW¡VOHDGHUVDQGWKHOHJDF\RIWKHUHIRUPPRYHPHQW HIS 311 Classical and Medieval Civilizations (3) Classical and Medieval Civilizations covers developments in North Africa, Southwest Asia, and Europe before 1500. It includes topics on ancient Egyptian, Mesopotamian, Hebrew, early Persian, Greek, Roman, Germanic, Celtic, Byzantine, Slavic, and Medieval European history. It also examines Judaism, Christianity, and Islam from a historical perspective. HIS 312 Early Modern Europe (3) Early Modern Europe is a study of European history that begins with the Renaissance through the French Revolution and Napoleonic eras. Attention is given to the Protestant Reformation, the emergence of â&#x20AC;&#x153;modern states,â&#x20AC;? the origins of modern science, the expansion of Europe, and the Enlightenment. The course offers an overview of recent European development. HIS 317 Recent European History (3) Recent European History deals with a study of recent European development and process with a study of European history from the Congress of Vienna through the Common Market. Emphasis is placed on both national and â&#x20AC;&#x153;Europeanâ&#x20AC;? movements, ideas, and institutions that have shaped the course of the modern world. HIS 321 Non-Western Area Studies (3) 1RQ:HVWHUQ $UHD 6WXGLHV LV DQ LQWHUGLVFLSOLQDU\ DSSURDFK WR WKH VWXG\ RI PDMRU non-western areas of the world from the aspects of culture, religion, politics, and economics.

179


MORRIS COLLEGE CATALOG HIS 401 Modern Sub-Saharan Africa (3) Modern Sub-Saharan Africa deals with the legacy of colonialism in Africa, the transition to nationalism in the independent states of Black Africa, and the search for D3DQ$IULFDQIXWXUH0 DMRUSROLWLFDODQGFXOWXUDOFKDQJHVDQGUHJLRQDOHFRQRPLFDQG political groupings will be discussed. HIS 402 Twentieth Century United States (3) Twentieth Century United States is a study of the economic, political, social, and diplomatic affairs of the United States in the twentieth century. HIS 403 History and Principles of the American Constitution (3) History and Principles of the American Constitution is an inquiry into the historical GHYHORSPHQWRIWKH$PHULFDQFRQVWLWXWLRQDOV\VWHPZLWKHPSKDVLVRQWKHMXGLFLDU\LQ the interpretation of the Constitution. HIS 407 Evolution of Warfare/ American Military Experience (3) Evolution of Warfare/ American Military Experience provides an overview of the American military experience, with emphasis on the principles of warfare and the KLVWRULFDO WKUHDGV RI FRQWLQXLW\ 6WXGHQWV UHYLHZ EDWWOHV IURP HYHU\ PDMRU SHULRG RI history, particularly those relevant to the evolution of warfare. Students are expected WREHDEOHWRFRQGXFWDV\VWHPDWLFEDWWOHDQDO\VLV$EDWWOHĂ&#x20AC;HOGYLVLWLVUHTXLUHG HIS 409 History of South Carolina (3) History of South Carolina deals with the growth and development of South Carolina, with emphasis on the current, social, political, and economic problems. HIS 499 History Seminar (3) + LVWRU\6HPLQDULVWKHFDSVWRQHFRXUVHIRUVWXGHQWVPDMRULQJLQ+ LVWRU\,WSURYLGHV a basic foundation in historiography and research methods directed toward the preparation and preparation of a scholarly paper. An overview of current issues and concerns within the discipline, a comprehensive Exit Examination, as well as a consideration of professional development skills and career opportunities related to WKHĂ&#x20AC;HOGDUHDOVRLQFOXGHGLQWKHLQVWUXFWLRQDOIRUPDW HONORS PROGRAM HON 110 Honors Seminar (2) Honors Seminar 110 introduces and prepares students toward the development of leadership skills, potential and style. This seminar will also enhance and facilitate student success, honing study skills, professionalism, and interpersonal skills, thereby equipping and preparing students for advanced academic study. (Second Semester Freshman) HON 210 Honors Seminar (2) + RQRUV6HPLQDUIRFXVHVRQFULWLFDOWKLQNLQJVNLOOVUHĂ HFWLQJVRFLHWDOHGXFDWLRQDO and collegiate issues, building upon cultural awareness. This seminar will also involve DFWLYH VWXGHQW SDUWLFLSDWLRQ LQ DFWLYLWLHV DQG SURMHFWV WKDW IRFXV RQ FLYLFFRPPXQLW\ involvement designed to enhance leadership and service awareness, skills, and experiences. (First Semester Sophomore) HON 220 Honors Seminar (2) Honors Seminar 220, a continuation from HON 210, will offer students the opportunity to deliver presentations, discuss contemporary issues, host forums, conduct debates and participate in panel discussions. This seminar will also guide students toward post-graduate as well as topic formulation toward their senior thesis. (Second Semester Sophomore) Prerequisite: HON 210 HON 310 Honors Seminar (2) Honors Seminar 310 is interdisciplinary in nature and emphasizes active student

180


DESCRIPTION OF COURSES involvement in the analysis of social issues, presentations/discussions, and the development of leadership skills. Prerequisite: HON 220 HON 320 Honors Seminar (2) + RQRUV6HPLQDURIIHUVWKHRSSRUWXQLW\IRUMXQLRUVZKRE\WKHLUSDVWSHUIRUPDQFH have indicated high academic promise for continued self development. A selfWKHPDWLF DSSURDFK LV XVHG WR IRFXV RQ VLJQLÃ&#x20AC;FDQW DVSHFWV RI FXOWXUDO KHULWDJH DQG identity. Participants engage in research, formal lectures, informal discussions, and co-curricular activities. Prerequisite: HON 310 HON 410 Honors Seminar (2) Honors Seminar 410 introduces the student to advanced study in both research and WKHIRUPXODWLRQRILGHDVUHODWHGWRWKHVWXGHQW·VVSHFLÃ&#x20AC;FDFDGHPLFDUHD$SURSRVDOIRU WKHVHQLRUWKHVLVPXVWEHDSSURYHGE\WKHHQGRIWKHÃ&#x20AC;UVWVHPHVWHU Prerequisite: HON 320 HON 420 Honors Seminar (2) In Honors Seminar 420, a senior thesis is required of all Honors Program students who desire to graduate as members of the program. The thesis must be related to the VWXGHQW·VDFDGHPLFDUHDRIFRQFHQWUDWLRQDQGLWPXVWPHHWWKHDSSURYDORIDVHOHFWHG faculty advisor and the Director of the Honors Program. All theses must be presented EHIRUHDVHOHFWHGFRPPLWWHHSULRUWRWKHVWXGHQWV·JUDGXDWLRQ Prerequisite: HON 410 HEALTH SCIENCE HSC 210 Health and Physical Education (3) + HDOWK DQG 3K\VLFDO (GXFDWLRQ PDNHV FROOHJH VWXGHQWV DZDUH RI PDMRU KHDOWK DQG wellness issues confronting young adults as they enter society. Such topics as holistic health, nutrition, diet and weight control, drugs and alcohol, heredity and disease, birth control and sexually transmitted disease as well as aging and dying are discussed. 6SHFLDO HPSKDVLV LV SODFHG RQ WKH LPSRUWDQFH RI H[HUFLVH DQG SK\VLFDO Ã&#x20AC;WQHVV DV they relate to lifestyles, stress, and cardiovascular disease. A physical activity lab is required. HSC 240 Drug Education (3) 'UXJ (GXFDWLRQ HQKDQFHV WKH VWXGHQW·V NQRZOHGJH RI DGGLFWLYH DJHQWV VXFK DV alcohol, drugs, and other items associated with misuse in the population. Observation DQGLQWHUDFWLRQZLWKSURIHVVLRQDOVLQWKHÃ&#x20AC;HOGZLOORFFXUDQGWKHODWHVWUHVHDUFKDQG data are available. HSC 301 Introduction to Nutrition (3) Introduction to Nutrition includes a study of the nutrients essential to human well being, their function in metabolic processes, their sources in food, and the application of information about nutrition to the study of the relationship between dietary habits and health. HSC 302 Chronic and Communicable Disease (3) Chronic and Communicable Disease investigates the etiology of disease, with emphasis on cardiovascular disease, cancer, diabetes, and sexually transmitted diseases and the risk factors associated with these diseases. Preventive and educational programs are developed and presented by the class through research of current data. HSC 303 Stress Management (3) Stress Management examines physiological and psychological stressor and their underlying effects on health. Effective strategies for preventing and/or alleviating attendant symptoms of stress are explored. Learning activities in this course are

181


MORRIS COLLEGE CATALOG both theoretical and experiential. Open only to students who have earned at least 56 semester hours of college-level credit. HSC 304 Family Life and Sex Education (3) Family Life and Sex Education examines the family structure and the importance of sex education, including the moral and ethical foundations. The value of communityand family-based education programs will be presented and developed. HSC 310: Introduction to Epidemiology (3) Introduction to Epidemiology provides an overview of epidemiological principles and practices related to the study, prevention, and control of health-related conditions in the human population. Emphasis will be on understanding the principal concepts of epidemiology, including aspects of disease etiology, distribution and determinants, descriptive and analytic epidemiologic methods and study designs, and application of epidemiologic data to develop, implement and evaluate health programs, administer health-related services or promote hazard-free environments. Class format includes lecture and small group seminars to improve student skills necessary for changing unhealthy behaviors, creating healthful environments, and achieving optimal health. This course helps prepare Health Science minor students who complete seven (7) additional Health Science credit hours to meet the competencies delineated in the National Commission for Health Education Credentialing (NCHEC) Areas of 5HVSRQVLELOLW\DQGIRU& HUWLĂ&#x20AC;HG+ HDOWK(GXFDWLRQ6SHFLDOLVW & + (6 FHUWLĂ&#x20AC;FDWLRQ HSC 312 Health Care Systems and Programs (3) Health Care Systems and Programs examines the United States health care system and its multi- faceted delivery system. Students develop strategies to access the health care system and the many governmental programs available. HSC 320 Foundations of Health Education (3) Foundations of Health Education is a study of the historical, philosophical, sociological, SV\FKRORJLFDODQGVFLHQWLĂ&#x20AC;FIRXQGDWLRQVRIKHDOWKHGXFDWLRQ& RQVLGHUDWLRQLVJLYHQ WR WKH LQGLYLGXDO DQG VRFLHWDO IDFWRUV ZKLFK FRQWULEXWH WR DQGRU LQĂ XHQFH SK\VLFDO social, emotional, spiritual, and intellectual health. Open only to students who have earned at least 56 semester hours of collegelevel credit. HSC 400 Health Services Organization and Administration (3) Health Services Organization and Administration examines the multiple facets of UXQQLQJDQHIIHFWLYHDQGHIĂ&#x20AC;FLHQWKHDOWKFDUHSURJUDP3URJUDPHYDOXDWLRQ)HGHUDO UHJXODWLRQV XQLRQV VWDIĂ&#x20AC;QJ IXQGLQJ VRXUFHV DQG FXUUHQW LVVXHV ZLOO EH GLVFXVVHG and researched. HSC 425 Ethical and Legal Issues for Health Professionals (3) Ethical and Legal Issues for Health Professionals deals with the complex legal issues IDFHGE\KHDOWKSURIHVVLRQDOVLQWRGD\¡VVRFLHW\DQGZLWKOHJDODQGPHGLFDOWHUPLQRORJ\ Students will be able to discuss and interpret legal and medical terminology. HSC 427 Community Development for Health (3) Community Development for Health familiarizes students with concepts, principles, and techniques underlying the organization of community resources for health action. HSC 431 Research Methods in Health Science (1) Research Methods in Health Science introduces the student to the study and practical application of research design as it applies to the health sciences. Emphasis will be on the necessary skills and competencies required to develop an acceptable research proposal. HSC 450 Environmental Health and Safety (3) Environmental Health and Safety examines the physical, biological, chemical, and socio-behavioral factors that affect our environment. The effects of population growth, vector control, and consumer information about the environment will be discussed.

182


DESCRIPTION OF COURSES The class participates in educational and promotional activities. HSC 490 Current Health Issues Seminar (3) This is a capstone course designed to focus on synthesizing, utilizing, and researching public health concepts, methods, theories, interventions, implementations, and evaluation of research designs on a current public health issue and/or problem. 7KH DSSOLFDWLRQ RI VWXGHQW·V UHVHDUFK ZLOO EH FRQGXFWHG WKURXJK DQ DVVHVVPHQW and literature review, data collection, development, and planning, culminating in a VHQLRUUHVHDUFKSURMHFW7KHFRXUVHIRFXVHVRQWKHRU\DVLWUHODWHVWRSUDFWLFHDQG H[SHULHQFH DQG HPSKDVL]HV UpVXPp ZULWLQJ LQWHUYLHZ FRPPXQLFDWLRQ DQG RWKHU professional and technological methods and skills. Through weekly discussions and interactions, students develop a comprehensive, in-depth overview of the profession as a whole. This culmination of ideas leads to professional growth and a broader understanding of the total public health profession. Prerequisites: HSC 320, HSC 310, HSC 427 and HSC 450 492 Internship (3) ,QWHUQVKLSLVWKHFXOPLQDWLRQRIWKHVWXGHQW·VHGXFDWLRQDOH[SHULHQFHLQKHDOWKVFLHQFH Students select an agency for internship and spend 120 hours in the internship experience. Prerequisites: HSC 310, HSC 320, HSC 427, HSC 450 HUMANITIES HUM 310 Literature, Film, and Visual Arts (3) Literature, Film, and Visual Arts covers principles, theories, and elements of literature, motion pictures, and visual arts. Attention is placed on interdisciplinary approaches to the analysis and interpretation of the arts. HUM 400 Liberal Studies Seminar (3) /LEHUDO6WXGLHV6HPLQDULVWKHFDSVWRQHFRXUVHIRU/LEHUDO6WXGLHVPDMRUVLQWHJUDWLQJ all aspects of liberal arts education, the arts, and issues related to the unity and diversity of human knowledge. This course incorporates a semester-long thesis and a professional career portfolio. A comprehensive senior exit examination covering VXEMHFWPDWWHULQWKHÃ&#x20AC;HOGLVLQFRUSRUDWHGLQWRWKLVFRXUVH HUM 430 Arts Management (3) Arts Management covers the general aspects of arts management as it involves the artists, producers, exhibitors, and promoters. Various arts organizations and resources, methods of fund-raising and proposal writing, effective public relations, audience building, and copyright regulations are also introduced. JUNIOR SEMINAR JRS 300 Junior Seminar (1) Junior Seminar is designed to help students who are beginning course work in their PDMRU Ã&#x20AC;HOG WR EH VXFFHVVIXO LQ WKH SXUVXLW RI WKHLU FKRVHQ SURJUDP RI VWXG\ 7KH EDVLF HOHPHQWV RI WKLV FRXUVH DUH GHVLJQHG WR HQKDQFH WKH VWXGHQW·V RUDO OLWHUDF\ formal writing, and research and computer skills, with emphasis on their classroom applications. Additional features of the course include reviewing strategies through which students can improve their academic planning, career awareness, and testtaking skills, as well as undertaking the initial preparation for the capstone course in WKHPDMRUWKDWLVWDNHQGXULQJWKHVHQLRU\HDU Open only to students who have earned at least 56 semester hours of collegelevel credit.

183


MORRIS COLLEGE CATALOG MATHEMATICS MAT 103 College Algebra (3) College Algebra is the study of linear and polynomial functions, rational functions, prime factorization of polynomials, solving word problems, and proportions, exponential functions and systems of equations, quadratic equations, and the theory of equations. Students explore rational and real number concepts, understanding number systems. Students are introduced to the language and symbols of mathematics and problem solving techniques. All students must receive a grade of â&#x20AC;&#x153;Câ&#x20AC;? or better in order to successfully pass the course. MAT 104 College Algebra and Trigonometry (3) Trigonometry is the study of angles, trigonometric functions, inverse trigonometric functions, circular functions, trigonometric identities, applications of trigonometry, SRSXODU FRRUGLQDWHV DQG 'H0 RLYUH¡V 7KHRUHP XVLQJ UDWLRQDO DQG UHDO QXPEHU concepts. Problem solving techniques (such as Polya) are applied to the study of trigonometry and applied to problems by machinists and surveyors.as well as applications to physics. Prerequisite: MAT 103. MAT 105 Elementary Functions (3) Elementary Functions is a study of the properties and graphs of polynomials and trigonometric, exponential, and logarithmic functions. Prerequisite: MAT 103 MAT 201 Calculus I (3) Calculus I is an introduction to analytic geometry, limits, continuity, derivatives DQG LQWHJUDOV RI DOJHEUDLF IXQFWLRQV 9HQQ 'LDJUDPV DQG (XOHU¡V FLUFOHV 5HOHYDQW mathematics symbols are introduced. In addition, the history of mathematics studied in this course permeates the contribution of mathematicians from other cultures (Greek, French, German, Arabic). Prerequisite: MAT 104, MAT 105.

MAT 203 Set Theory and Logic (3) Set Theory and Logic introduces set theory, symbolic logic, truth tables, inductive proofs, deductive reasoning, relations, functions and related problem solving, 9HQQ 'LDJUDPV DQG (XOHU¡V FLUFOHV 5HOHYDQW PDWKHPDWLF V\PEROV DUH LQWURGXFHG Candidates research the history of a mathematician who made contributions to the Ă&#x20AC;HOGRIVHWWKHRU\ Prerequisite: MAT 103. MAT 204: Discrete Mathematics (3) Discrete mathematics is the study of discrete structures that include sets, relations, functions, graphs, trees and networks. Other topics include enumeration, SHUPXWDWLRQVFRPELQDWLRQVLWHUDWLRQUHFXUVLRQDQGĂ&#x20AC;QLWHGLIIHUHQFH7KHFRXUVHDOVR covers propositional and predicate logic and the applications of discrete structures WKDW LQFOXGH PRGHOLQJ DQG GHVLJQLQJ GDWD VWUXFWXUHV  & RQWULEXWLRQV RI VLJQLĂ&#x20AC;FDQW western mathematicians and those from diverse cultures are also studied. Required RI0 DWKHPDWLFV6HFRQGDU\(GXFDWLRQ0 DMRUV Prerequisite: MAT 103 MAT 206 Introductory Probability and Statistics (3) Introduction to Probability and Statistics includes descriptive statistics, graphical and numerical measures of central tendency, measures of variability, introductory SUREDELOLW\XQLYDULDWHDQGELYDULDWHUDQGRPYDULDEOHV6XEMHFWLYHYVUHODWLYHIUHTXHQF\ DQGHPSLULFDOYHUVXVWKHRUHWLFDOSUREDELOLW\VDPSOLQJWHFKQLTXHVFRQĂ&#x20AC;GHQFHLQWHUYDOV and hypothesis testing. Students learn key concepts of sample versus population, which leads from descriptive to inferential statistics. Probability models are developed and applied to biology, physics, education, and economics. Relevant mathematics

184


DESCRIPTION OF COURSES V\PEROVDUHLQWURGXFHG& DQGLGDWHVVWXG\LPSRUWDQWKLVWRULFDOÃ&#x20AC;JXUHVLQVWDWLVWLFVIURP diverse cultures. Prerequisite: MAT 103. MAT 210 Calculus II (3) Calculus II explores conic sections: techniques of integration; applications of the GHÃ&#x20AC;QLWH LQWHJUDO 3RODU FRRUGLQDWHV SDUDPHWULF HTXDWLRQV VHTXHQFHV RI VHULHV differentiation: and integration of trigonometric, exponential, and logarithmic functions. The history of mathematics and information about the lives of mathematicians are included. Prerequisite: MAT 201. MAT 303: Linear Algebra (3) Linear Algebra emphasizes the study of solutions of systems of linear equations, vectors, vector spaces, linear transformations, matrices, determinants, inverses eigenvalues, and eigenvectors and their applications with applicators in optimization theory and statistics. Prerequisite: MAT 104, MAT 105 MAT 304 Abstract Algebra (3) Abstract Algebra emphasizes the study of sets, mappings, equivalence relations, JURXSV ULQJV Ã&#x20AC;HOGV DQG LGHDOV ZLWK HPSKDVLV RQ WKH WHFKQLTXHV RI SURRIV Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisite: MAT 203 MAT 310 Calculus III (3) Calculus III is a study of advanced integration techniques, quadratic surfaces, polar FRRUGLQDWHV LQÃ&#x20AC;QLWH VHULHV DQG VHTXHQFHV 7D\ORU 6HULHV DQG 0 F/DXULQ 6HULHV vectors. and parametric equations The history of mathematics and information about the lives of important mathematicians are included. Prerequisite: MAT 210 MAT 320 Calculus IV (3) Calculus IV is the study of vectors and vector calculus, partial derivatives and their applications, multivariable calculus, and multiple integrals in rectangular and other FRRUGLQDWH V\VWHPV OLQH DQG VXUIDFH LQWHJUDOV *UHHQ·V 7KHRUHP DQG 6WRNH·V Theorem. Prerequisite: MAT 310 MAT 401 College Geometry (3) College Geometry is a study of axiomatic methods and proofs. Topics from Euclidean geometry include lines, angels, triangles, congruent and similar triangles, and polygons. Students are taught to use construction as a method of proof. The course also includes an introduction to the topics of two and three dimension non-Euclidean geometry and compares non-Euclidean geometry with Euclidean geometry. Geometric transformations in three dimensions, proofs by contradiction and counter example and proof by induction are new components of this course. Prerequisite: MAT 104, MAT 105 MAT 402 Advanced Probability and Statistics (3) Advanced Probability and Statistics deals with probability, discrete continuous random variables, moments, special distributions, sampling, limit theorems, the normal GLVWULEXWLRQFRQÃ&#x20AC;GHQFHLQWHUYDOVWHVWLQJK\SRWKHVHVDQGVWDWLVWLFDOGHFLVLRQWKHRU\ Prerequisite: MAT 206, MAT 210 MAT 403 Differential Equations (3) 'LIIHUHQWLDO(TXDWLRQVLVDVWXG\RIPHWKRGVRIVROYLQJÃ&#x20AC;UVWRUGHUGLIIHUHQWLDOHTXDWLRQV OLQHDU GLIIHUHQWLDO HTXDWLRQV ZLWK FRQVWDQW FRHIÃ&#x20AC;FLHQWV YDULDWLRQ RI SDUDPHWHUV DQG series solutions and applications. Prerequisite: MAT 210

185


MORRIS COLLEGE CATALOG MAT 404 Elementary Number Theory (3) Elementary Number Theory is a study of divisibility properties, prime numbers, congruencies, primitive roots, quadratic residues, Fibonacci numbers, and the distribution of primes. Number systems include rational, irrational, real and complex numbers. Algorithms of numbers and number systems are emphasized with respect to their use in computer technology. Students research the history of a mathematician ZKRFRQWULEXWHGWRWKHĂ&#x20AC;HOGRIQXPEHUWKHRU\ Prerequisite: MAT 304 MAT 405 Advanced Calculus (3) This course is a rigorous treatment of the derivative and the integral, general theorems RQSDUWLDOGLIIHUHQWLDWLRQLPSOLFLWIXQFWLRQWKHRUHPVLQĂ&#x20AC;QLWHVHULHV)RXULHUVHULHVDQG Fourier integrals. Prerequisite: MAT 310 MAT 412: Mathematics Seminar (3) 0 DWKHPDWLFV6HPLQDULVWKHFDSVWRQHFRXUVHIRU0 DWKHPDWLFVPDMRUV,WLVDUHYLHZ RIPDMRUFRQFHSWVLQFRQWHPSRUDU\PDWKHPDWLFVLQFOXGLQJFRPSOH[YDULDEOHVQXPEHU theory, numerical analysis methods, calculus-level probability and statistics, advanced calculus and topics in differential equations. Students are required to conduct independent library research, present oral reports, write a scholarly term paper and prepare for and pass the senior exit exam. Preparation for the Graduate Record Examination (GRE) is emphasized for students planning to attend graduate school. Prerequisites: MAT 203, MAT 206, MAT 403 MAT 490 Introduction to Topology (3) Topics covered in this course include topological spaces, metric spaces, continuity, connectedness, and compactness. This course may be used as an elective by students who plan to attend graduate school. Prerequisites: MAT 203, MAT 320 MEDIA ARTS MED 300 Mass Communications (3) Mass Communications surveys various topics of mass media such as newspapers, UDGLR WHOHYLVLRQ Ă&#x20AC;OP DQG DGYHUWLVLQJ 7KH SULPDU\ IRFXV RI WKLV FRXUVH LV PDVV FRPPXQLFDWLRQ WKHRULHV IXQFWLRQV DQG LQĂ XHQFHV RI VSHFLĂ&#x20AC;F PHGLD IRUPV DV WKH\ interact with individuals and the public. MED 302 News Writing and Editing (3) News Writing and Editing covers aspects of news gathering, reporting, and editing for newspapers, radio, and television. Students will cover news stories during the semester and edit them for publication and/or broadcasting. Prerequisite: MED 300 MED 304 Advertising (3) Advertising covers principles of advertising and public relations. Students gain experience in the preparation of newspaper advertisements, radio and television commercials, news releases, and editing newsletters. MED 305 Film History (3) )LOP+ LVWRU\H[SORUHVWKHHYROXWLRQDQGGHYHORSPHQWRIĂ&#x20AC;OPIRUPVDQGVW\OHV,WWUDFHV WKHEDVLFĂ&#x20AC;OPVWUXFWXUHVIURPWKHHDUOLHUZRUNVRI/XPLqUHDQG0 HOLHVWR*ULIĂ&#x20AC;WKDQG Eisenstein. MED 307 History of Journalism (3) + LVWRU\ RI -RXUQDOLVP VXUYH\V WKH KLVWRU\ RI MRXUQDOLVP IURP DQFLHQW WLPHV WR WKH present. Emphasis is on the media revolution of the twentieth century. Prerequisite: MED 300

186


DESCRIPTION OF COURSES MED 320 Television Production (3) Television Production emphasizes both theory and practice of television production. Students are involved in the production of programs of broadcast quality. Prerequisite: MED 300 MED 321 Advanced Television Production (3) Advanced Television Production provides instruction in the creation, preparation, and production of advanced television programs. Students are involved in scripting and editing original programs. Prerequisite: MED 320 MED 330 Scriptwriting (3) Scriptwriting critically evaluates continuity in structure, form, characterization, action, DQGGLDORJXH,WDQDO\]HVWKHIRUPDWIRUĂ&#x20AC;OPDQGWHOHYLVLRQ Prerequisite: MED 300 MED 331 Basic Photography (3) Basic Photography covers fundamentals of digital camera and digital darkroom techniques. Students will learn to shoot and edit digital images. MED 332 Advanced Photography (3) Advanced Photography covers the techniques for outdoor, indoor, and tabletop photography. Students analyze camera lenses and effective lighting. Prerequisite: MED 331 MED 341 Broadcast Announcing (3) Broadcast Announcing covers the principles and techniques of broadcast announcing. Students analyze the various roles and functions of announcing. Prerequisite: MED 300 MED 350 Radio Programming and Production (3) Radio Programming and Production covers techniques and procedures in the creation, production, and direction of radio programs. Students are involved in handson experiences. Prerequisite: MED 300 MED 351 Writing for the Media (3) Writing for the Media covers writing for the media, with emphasis on script formats for motion pictures, live television, radio drama presentations, and television commercials. Students write one adaptation and one original script. Prerequisite: MED 300 MED 360 Basic Sound Recording (3) Basic Sound Recording covers principles and practices of recording, mixing, and editing. Students gain a knowledge of audio terminology and learn the use of basic recording and editing equipment. Prerequisite: MED 300 MED 361 Media Law and Ethics (3) Media Law and Ethics introduces students to law and ethics as they apply to the media. The course emphasizes standards of behavior for the profession in addition to law and ethics case studies and current issues. Open only to students with 56 semester hours of college-level credit. Open only to students who have earned at least 56 semester hours of college-level credits. Prerequisite: MED 300 MED 362 Media Research Methods (3) Media research Methods introduces methods of research used in mass media. Students will study content, questionnaires, interviews, and surveys and design and conduct qualitative and quantitative research studies. Open only to students with 56

187


MORRIS COLLEGE CATALOG semester hours of college-level credit. Open only to students who have earned at least 56 semester hours of collegelevel credits. Prerequisite: MED 300 MED 401 Public Relations (3) Public Relations deals with the principles of public relations. Experiences in the preparation of news releases, newsletters, and promotional packages are provided. MED 402 Advanced News Writing and Editing (3) Advanced News Writing and Editing adds news gathering to the news writing and editing activities of MED 302. Students submit their stories for publication or broadcasting. Prerequisite: MED 300, MED 302 MED 405 Newspaper Organization (3) 1HZVSDSHU2UJDQL]DWLRQLQFRUSRUDWHVDVHPHVWHUORQJSURMHFWWKDWHPSKDVL]HVWKH relationship and dynamics of copy editing, news writing, and newspaper layout. Prerequisite: MED 300, MED 303 MED 410 Advanced Media Project (3) $GYDQFHG 0 HGLD 3URMHFW LV WKH FDSVWRQH FRXUVH IRU 0 DVV & RPPXQLFDWLRQV PDMRUV 7KLV FRXUVH LQWHJUDWHV WKH PDMRU FRQFHSWV LQ WKH GLVFLSOLQH VXFK DV ZULWLQJ IRU the media, broadcasting, programming, recording, photography, and production. 6WXGHQWV ZLOO SUHSDUH D VHPHVWHUORQJ SURMHFWSDSHU DQG D SURIHVVLRQDO FDUHHU SRUWIROLR$FRPSUHKHQVLYHVHQLRUH[LWH[DPLQDWLRQFRYHULQJVXEMHFWPDWWHULQWKHÃ&#x20AC;HOG is incorporated into this course. Prerequisite: MED 300 MED 490 Internship (3) ,QWHUQVKLS SURYLGHV VWXGHQWV ZLWK ZRUN H[SHULHQFH LQ D QHZVSDSHU RIÃ&#x20AC;FH D photography studio, and/or a radio or television station. Prerequisites: MED 300 , MED 302, MED 351 MILITARY SCIENCE ARMY RESERVE OFFICER TRAINING CORPS (ROTC) MSC 101 Fundamentals of Military Science (2) Fundamentals of Military Science is designed to develop leadership, management, and communications skills. It emphasizes map reading, land navigation, and study/ time management techniques. The course requires one lecture and one laboratory per week. MSC 102 Introduction to the Army (2) Introduction to the Army explores the history, organization, mission, and role of the United States Army in national defense. It examines the components of total army structure, with an emphasis on group dynamics and communication skills. The course requires one lecture and one laboratory per week. MSC 201 Fundamentals of Military Leadership (3) Fundamentals of Military Leadership includes the study of oral and written military communications and planning and organizing techniques. It examines current military leadership doctrine and application and emphasizes combined arms concepts, organizations, and tactics. The course requires two lectures and one laboratory per week. MSC 202 Fundamentals of Military Decision Making (3) Fundamentals of Military Decision Making includes a study of soldier skills, including map reading and land navigation. It introduces Army troop-leading procedures

188


DESCRIPTION OF COURSES through practical exercises and principles of war using historical events. The course requires two lectures and one laboratory per week. MSC 301 Advanced Military Decision Making (4) Advanced Military Decision Making emphasizes small group leadership through practical applications. Its focus is the development of individual leadership skills through problem analysis, decision formation, and steps in the decision-making process. The course requires two lectures and one laboratory each week. MSC 302 Applied Military Leadership (4) Applied Military Leadership continues the development of leadership competencies DQG FRQÃ&#x20AC;GHQFH ,W LQFOXGHV WDFWLFDO WUDLQLQJ H[HUFLVHV WR HQKDQFH OHDGHUVKLS development. The course requires two lectures and one laboratory each week. Prerequisite: MSC 301 MSC 401 Leadership and Management Seminar I (4) Leadership and Management Seminar I is a study of current Army leadership, tactical, and training doctrine. It examines military law in context of peacekeeping/enforcement RSHUDWLRQVDQGLQFOXGHVDQRYHUYLHZRIWKH$UP\·VUROHLQMRLQWRSHUDWLRQV7KHFRXUVH requires three lectures and one laboratory each week. Prerequisite: MSC 302 MSC 402 Leadership and Management Seminar II (4) Leadership and Management II involves the application of current Army leadership, tactical, and training doctrine. It emphasizes the evolution of military professionalism, FLYLOPLOLWDU\ UHODWLRQV SHUVRQDO DQG SURIHVVLRQDO HWKLFV DQG WKH PLOLWDU\ MXVWLFH system. The course requires three lectures and one laboratory each week. Prerequisite: MSC 401 MSC 407 Evolution of Warfare/American Military Experience (3) Evolution of Warfare/American Military Experience Is an historical overview of the American military experience. It covers military principles, strategy and tactics from the 6HYHQWHHQWK& HQWXU\XQWLOWKHSUHVHQW,WLQFOXGHVVWDIIULGHVDQGV\VWHPDWLFEDWWOHÃ&#x20AC;HOG exercises. The evolution of strategy, tactics, and military technology is examined, and the course provides lessons in leadership. MUSIC MUS 100, 102, 200, 202, 300, 302, 400, 402 Choir (1) 0 8 6    DQG  FRQVLVW RI HQVHPEOH VLQJLQJ RI D YDULHW\ RI WKH Ã&#x20AC;QHVW choral literature from the Renaissance to the present, with emphasis on vocal techniques, conducting, repertoire, and choir organization. MUS 101 Music Appreciation (2) 0 XVLF$SSUHFLDWLRQLVGHVLJQHGWRDFTXDLQWVWXGHQWVZLWKPDMRUIDFWRUVLQYROYHGLQWKH intelligent listening to and the importance of music as an art. The course covers music from the Middle Ages to the present. MUS 111 Piano (1) MUS 111 consists of basic keyboard fundamentals and technical skills. MUS 112 Piano (1) MUS 112 is a continuation of MUS 111, with the addition of multi-key reading. Prerequisite: MUS 111 MUS 123 Voice (1) MUS 123 is the study of the fundamentals of singing, with emphasis on tone production, diction, and interpretation.

189


MORRIS COLLEGE CATALOG

MUS 124 Voice (1) MUS 124 is a continuation of MUS 123, with a survey of literature for the solo voice. Prerequisite: MUS 123 MUS 203 Music Theory I (2) Music Theory I is an introduction to the basic fundamentals of music theory and composition, including notation, scales, melody rhythm, intervals, and chord building. MUS 204 Music Theory II (2) Music Theory II, a continuation of Music Theory I, is an introduction to functional diatonic harmony and melody. This course includes techniques of harmonization, analysis, part writing, keyboard, and sight singing skills. Prerequisite: MUS 203 MUS 211 Piano (1) 0 8 6FRQVLVWVRIWKHSOD\LQJRIPDMRUVFDOHVVLJKWUHDGLQJDQGEXLOGLQJUHSHUWRLUH Prerequisite: MUS 112 or placement test MUS 212 Piano (1) MUS 212 is a continuation of MUS 211, with the addition of playing minor scales, sight reading, building scales, and building repertoire. Prerequisite: MUS 211 or placement test MUS 221 African American Music (3) African American Music is a survey of music created by African Americans, with VSHFLDOHPSKDVLVRQEOXHVMD]]JRVSHODQGSRSPXVLF Prerequisite: MUS 101 MUS 223 Voice (1) MUS 223 is the development of a vocal repertoire of songs in English, French, Italian, Spanish, and German. Prerequisite: MUS 124 or placement test MUS 224 Voice (1) MUS 224 is a continuation of Voice 223, with emphasis on performing as a soloist in recitals and choral concerts. Prerequisite: MUS 223 or placement test MUS 231 Sight Singing and Ear Training I (1) Sight Singing and Ear Training I is the study of basic rhythmic reading, sight singing, dictation, and other oral and written skills. Prerequisites: MUS 111, MUS 112 MUS 232 Sight Singing and Ear Training II (1) Sight Singing and Ear Training II, a continuation of Sight Singing and Ear Training I, is the study of advanced rhythmic reading, sight singing, dictation, and other oral and written skills. Prerequisites: MUS 111, MUS 112, MUS 231 or placement test MUS 303 Music Theory III (2) Music Theory III consists of analytic studies of triadic structures, harmony and voice leading, and musical forms. Emphasis is on the harmonic language of the Eighteenth and Nineteenth Centuries. MUS 304 Music Theory IV (2) Music Theory IV is a continuation of Music Theory III, with greater emphasis on form, analysis, Twentieth Century techniques, and creative writing. Prerequisite: MUS 303

190


DESCRIPTION OF COURSES MUS 330 Church Music (3) Church Music is a study of church music organization and administration, handbell choir techniques, and choral literature, with emphasis on Black hymnody and sacred music. MUS 421 Choral Conducting (1) Choral Conducting is an investigation of choral literature of varying styles and genres, with emphasis on conducting techniques and score analysis. MUS 433 Music History I (3) Music History I is a general survey of the development of music from antiquity to the Baroque Period. Prerequisite: MUS 101 MUS 434 Music History II (3) Music History II is a general survey of the development of music from the Classical Period to the present. Prerequisite: MUS 101 ORGANIZATIONAL MANAGEMENT ORM 300 Adult Development and Career Life Assessment (3) Adult Development and Career Life Assessment introduces the student to adult development theory and links these concepts to life through a process of individual UHĂ HFWLRQ% RWKFODVVLFDODQGFRQWHPSRUDU\DGXOWGHYHORSPHQWWKHRULHVDUHH[DPLQHG These theories then provide the paradigm for self-analysis and life assessment and provide the basis for understanding individuals within organizations. ORM 301 Group and Organizational Behavior (3) Group and Organizational Behavior is a study of group behavior and the way in which group functioning affects organizational effectiveness. Emphasis is placed on decisionPDNLQJDQGUHVROYLQJFRQĂ LFWLQJURXSV6WXGHQWVGHYHORSVWUDWHJLHVIRUHIĂ&#x20AC;FLHQWDQG productive group management and determine which tasks are best handled by groups and which are best handled by individuals. Open only to students who have earned at least 56 semester hours of collegelevel credit. ORM 303 Organizational Communication (3) Organizational Communication investigates communication and relationships in creating a productive work environment. Effectiveness in personal and social relationships is also covered through readings and exercises involving nonverbal FRPPXQLFDWLRQFRQVWUXFWLYHIHHGEDFNGHDOLQJZLWKDQJHUDQGUHVROYLQJFRQĂ LFWV ORM 304 Methods of Research and Analysis (3) Methods of Research and Analysis is an introduction to research and its tools for the student as both a consumer and a producer of statistics and research. It covers the analysis and evaluation of a problem in the workplace or in a vocational environment ZKLFKWKHVWXGHQWKDVVHOHFWHGIRUDQLQGHSHQGHQWVWXG\SURMHFW ORM 305 Research Project Seminar I (1) 5HVHDUFK3URMHFW6HPLQDU,LVDPDMRUUHVHDUFKHIIRUWGHVLJQHGWRHQKDQFHNQRZOHGJH LQDQDUHDUHODWHGWRWKHVWXGHQW¡VZRUNRUFRPPXQLW\6WXGHQWDFWLYLWLHVZLOOIRFXVRQ the improvement of writing skills, presentation skills, research skills, and decisionmaking skills. ORM 306 Information Systems Management (3) Information Systems Management introduces students to the impact of information technologies and systems on various business processes throughout the enterprise. Students work individually and in groups using various application skills and managing

191


MORRIS COLLEGE CATALOG related resources such as systems personnel, software applications, databases, networks and computer hardware. This course is aimed at developing the nontechnical skills that business school graduates need to make appropriate decisions DERXWWKHGHSOR\PHQWRILQIRUPDWLRQV\VWHPVWKURXJKRXWWKHĂ&#x20AC;UP Prerequisite: CIS 101 ORM 307 Managerial Accounting (3) Managerial Accounting is the analysis of accounting data used in the planning, control, and decision-making activities of an enterprise. Students learn and build on Ă&#x20AC;QDQFLDO DFFRXQWLQJ FRQFHSWV DQG SULQFLSOHV 0 DQDJHULDO$FFRXQWLQJ WRSLFV LQFOXGH EXWDUHQRWOLPLWHGWRĂ&#x20AC;QDQFLDOVWDWHPHQWVĂ RZRIIXQGVFRVWYDOXHSURĂ&#x20AC;WUHODWLRQVKLS budgetary planning and control, cost consideration in decision making, and the use of quantitative techniques as an instrument of control and proper planning. Emphasis is on reading and understanding accounting documents rather than on their preparation. ORM 312 Managerial Finance (3) 0 DQDJHULDO)LQDQFHLVDQLQWURGXFWLRQWRĂ&#x20AC;QDQFLDOPDQDJHPHQW6WXGHQWVH[SORUHWKH Ă&#x20AC;QDQFLDOWRROVDYDLODEOHIRUSODQQLQJDQGDQDO\VLVDVZHOODVKRZWKRVHWRROVDUHXWLOL]HG WR PDQDJH FDVK Ă RZV DQG Ă&#x20AC;QDQFLDO UHVRXUFHV DQG WR HYDOXDWH IXWXUH LQYHVWPHQW RSSRUWXQLWLHV0 DLQWRSLFVLQFOXGHSODQQLQJDQGDQDO\VLVRIĂ&#x20AC;QDQFLDOVWDWHPHQWVFDVK Ă RZPDQDJHPHQWWLPHYDOXHRIPRQH\DQDO\VLVRIULVNVDQGH[SHFWHGUDWHVRIUHWXUQ VWRFNV ERQGV DQG WKHLU YDOXDWLRQ \LHOG WR PDWXULW\ Ă&#x20AC;QDQFLDO UDWLRV DQG WKHLU XVHV Emphasis is on cash budgeting, retained earnings, dividend policy, capital budgeting, net present values and optimal capital structure. Prerequisite: ORM 307 ORM 400 Humanities: A Holistic Approach (3) + XPDQLWLHV $ + ROLVWLF $SSURDFK  SURPRWHV WKH LQYHVWLJDWLRQ RI D VSHFLĂ&#x20AC;F DUHD RI the humanities often not previously explored by the student. It is designed to foster knowledge and understanding of the literature of the Judeo-Christian heritage and to relate it to life relationships and to the world in which we live. ORM 401 Managerial Economics (3) Managerial Economics focuses on the principles of economics as they need to EH XQGHUVWRRG DQG XVHG E\ PDQDJHUV DQG VXSHUYLVRUV LQ DOO Ă&#x20AC;HOGV  ,Q WKLV HUD RI â&#x20AC;&#x153;downsizingâ&#x20AC;? or â&#x20AC;&#x153;rightsizingâ&#x20AC;? brought on by international competition and globalization of every part of the American way of life, it is crucial that managers at every level understand and use the principles of economics to aid in making sound decisions. 7KHREMHFWLYHRIWKLVFRXUVHLVWRSURYLGHVWXGHQWVZLWKDVRXQGIRXQGDWLRQRIHFRQRPLF principles and theory that can be used in making managerial decisions that relate to resource allocation. ORM 402 Managerial Marketing (3) Managerial Marketing focuses on the principles of marketing that need to be understood by managers in all areas in order to develop and utilize effective marketing SUDFWLFHV7KHFRQFHSWVRIDJOREDOHFRQRP\LQFOXGLQJPDMRUVRFLDOSV\FKRORJLFDO DQGSROLWLFDOLQĂ XHQFHVDUHH[SORUHGDQGWKHLUPDUNHWLQJLPSOLFDWLRQVFRQVLGHUHGIURP WKHPDQDJHU¡VSHUVSHFWLYH ORM 404 Managerial Principles (3) Managerial Principles examines motivational theory and its application to individual and group functioning in work and home situations. Leadership styles related to particular circumstances are analyzed. Negotiation is covered through readings and class practice, with an analysis of the effect on productivity. Open only to students who have earned at least 56 semester hours of collegelevel credit. ORM 405 Biblical Perspectives (3) Biblical Perspectives is an overview of the literary, historical, and religious dimensions

192


DESCRIPTION OF COURSES of the Old and New Testaments. Special attention is given to the themes of covenant, UHGHPSWLRQ MXVWLFH ULJKWHRXVQHVV UHFRQFLOLDWLRQ HVFKDWRORJ\ DQG KRSH 6WXGHQWV are guided in an examination of Biblical faith and the integration of faith, learning, and living. ORM 406 Human Resource Management (3) Human Resource Management explores the values and perceptions of selected groups affecting social and economic life through an analysis of policies and practices of recruitment, selection, training, development, and compensation of employees. 6SHFLDO DWWHQWLRQ LV JLYHQ WR (TXDO 2SSRUWXQLW\ DQG 2IÃ&#x20AC;FH RI 6DIHW\ DQG + HDOWK Administration legislation through a series of case studies and simulations. ORM 407 Strategic Management (3) Strategic Management introduces the student to various management planning models and techniques and applies these to business cases. Students formulate solutions to practical business problems through the use of case analysis. ORM 408 Legal and Ethical Issues in Management (3) Legal and Ethical Issues in Management involves a study of contracts, property rights, business transactions, negotiable instruments, credit transactions, sales, mergers, acquisitions and insurance. Students will study the foundations of the U.S. legal system, the public and international environment, the private environment and the regulatory environment. This course also focuses on values formation, selfunderstanding in an ethical context, and the construction of a personal model of ethical decision making congruent with personal values. ORM 409 Research Project Seminar II (4) 5HVHDUFK 3URMHFW ,, LV WKH FDSVWRQH FRXUVH IRU 2UJDQL]DWLRQDO 0 DQDJHPHQW PDMRUV (Advance Program) and is designed to integrate content from various management and business courses. Each student who enrolls in the Advance Program is assigned DUHVHDUFKDGYLVRUGXULQJKLVRUKHUÃ&#x20AC;UVWVHPHVWHUDWWKH& ROOHJH6WXGHQWVJDWKHU and analyze data, draw conclusions, and present solutions or recommendations to practical management or business problems. In addition, students are required to SUHVHQWWKHLUUHVHDUFKSURMHFWVWRDUHVHDUFKFRPPLWWHH$FRPSUHKHQVLYHVHQLRUH[LW H[DPLQDWLRQFRYHULQJVXEMHFWPDWWHULQWKHÃ&#x20AC;HOGLVLQFRUSRUDWHGLQWRWKLVFRXUVH Prerequisites: ORM 305, ORM 406, ORM 407, ORM 408 PHILOSOPHY PHI 302 History of Philosophy (3) History of Philosophy gives the student a general knowledge of ancient, medieval, and PRGHUQSKLORVRSK\HDFKSHULRG·VRXWVWDQGLQJSKLORVRSKHUVDQGWKHLUFRQWULEXWLRQVWR civilization. PHYSICAL SCIENCES PHS 100 Physical Sciences (4) Physical Sciences deals with the fundamental aspects of physical sciences including WKH VFLHQWLÃ&#x20AC;F PHWKRG FKHPLVWU\ DWRPV SHULRGLF ODZ FKHPLFDO UHDFWLRQV  SK\VLFV (energy, electricity and magnetism, waves); earth science; astronomy (universe, solar system and stars); oceanography; meteorology (atmosphere, weather systems, climate); and geology (minerals, rocks, plate tectonics, earth quakes, and historical geology).. Three lecture hours and one two-hour laboratory per week. PHYSICS PHY 101 Introduction to Engineering I (1) Introduction to Engineering develops skills with dimensions, units, calculators, and

193


MORRIS COLLEGE CATALOG technical communications and emphasizes engineering ethics. Career guidance is SURYLGHGLQFOXGLQJVXUYH\VRIWKHSURIHVVLRQDOĂ&#x20AC;HOGVRIHQJLQHHULQJWKHHQJLQHHULQJ curricula, and engineering departments. PHY 201 General Physics I (4) General Physics I is an introductory course in physics. Emphasis is on the basic physical ideas and how they are manifested in the world around us, both in nature and in technology. Topics include mechanics, wave motion, sound and heat. Topics relevant to environmental issues will be introduced. The history of physics and its relationship to the other natural sciences are also studied. Three one-hour lectures and one two-hour laboratory per week. Prerequisite: MAT 103 PHY 202 General Physics II (4) General Physics II is a continuation of PHY 201, with topics in electricity, magnetism, relativity, and quantum, atomic and nuclear physics. The ethical aspects of atomic and nuclear weapons and their effects on nature and humanity are explored. Topics relevant to environmental issues will be introduced. Three one-hour lectures and one two-hour laboratory per week. Prerequisite: PHY 201 PHY 203 Calculus-Based Physics I (4) & DOFXOXV% DVHG3K\VLFV,LVWKHĂ&#x20AC;UVWFRXUVHRIDWZRVHPHVWHUFDOFXOXVEDVHGSK\VLFV sequence for students following the pre-engineering track. Topics include vectors, kinematics and dynamics, gravitation, conservation laws, systems of particles, rigid ERG\VWDWLFDQGHODVWLFLW\ZDYHVĂ XLGPHFKDQLFVDQGWKHUPRG\QDPLFV7KUHHRQH hour lectures and one two-hour laboratory per week. Prerequisite: MAT 201, PHY 202 PHY 204 Calculus-Based Physics II (4) Calculus-Based Physics is the second course of a two-semester calculus-based physics sequence for student following the pre-engineering track. Topics include: HOHFWULFLW\ DQG PDJQHWLVP HOHFWURPDJQHWLF ZDYHV 0 D[ZHOO¡V HTXDWLRQV '& $&  circuits, light interference and diffraction, relativity, and quantum mechanics. Three one-hour lectures and one two-hour laboratory per week. Required of pre-engineering track students. Prerequisites: PHY 202, MAT 210 PHY 301 Mathematical Physics (3) The aim of Mathematical Physics is to apply mathematics to physics. Topics include vectors, matrices, differential and integral calculus, complex numbers, differential equations, and the laws of probability. Required of the pre-engineering track students. Prerequisites: PHY 203, MAT 206, MAT 303, MAT 310 POLITICAL SCIENCE PSC 300 Introduction to Political Science (3) Introduction to Political Science is a study of the elements of the discipline, its terminology, philosophy, and methodology, with a balance of treatment of political thoughts and theories and applied politics. Required of all those who plan to minor in political science. PSC 302 Ethnic and Minority Group Politics (3) Ethnic and Minority Group Politics is a survey of the political development and activities of ethnic and minority groups in the United States, with African-Americans, Native Americans, Latino Americans, Asian-Americans, Arab-Americans, White Ethnics, and women representing ethnic and political minority groups to be specially featured.

194


DESCRIPTION OF COURSES PSC 303 Community Politics and Social Change (3) Community Politics and Social Change is an introduction to politics at the community level. It conducts a historical and contemporary survey of communities as unique socio-economic entities, highlighting the nature of community power structures and the interaction of various interest in pursuit of social change at the local level. PSC 304 American National Government (3) American National Government is a study of American government institutions at the national level, with special emphasis on the structure and processes of the executive, OHJLVODWLYHDQGMXGLFLDOEUDQFKHVRIWKHJRYHUQPHQW PSC 305 Constitutional Law (3) Constitutional Law introduces the student to legal philosophy. It examines the legal basis of Constitutional Law and selected decisions of the Supreme Court and their impact on government. Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisite: PSC 304 PSC 306 State and Local Government (3) State and Local Government is a study of state political systems, including their administration, local sub-systems, intergovernmental relationships, and policy outputs. 6SHFLĂ&#x20AC;FDWWHQWLRQLVJLYHQWRWKHVWDWHRI6RXWK& DUROLQD2SHQRQO\WRVWXGHQWVZLWK 56 semester hours of college-level credit. Open only to students who have earned at least 56 semester hours of collegelevel credit. PSC 351 Comparative Government (3) Comparative Government introduces the student to comparative political analysis LQ WKH Ă&#x20AC;HOG RI JRYHUQPHQW  ,W RIIHUV D IXQFWLRQDO DSSURDFK WR D QXPEHU RI VSHFLĂ&#x20AC;F constitutional structures and processes in contemporary democratic, authoritarian, and developing political systems in different countries. PSC 361 American Foreign Policy (3) American Foreign Policy is a study of the principles and machinery of the conduct of IRUHLJQUHODWLRQV0 DMRUHPSKDVLVLVRQWKH8 QLWHG6WDWHV¡IRUHLJQSROLF\VLQFH:RUOG War I. PSC 401 International Relations (3) International Relations is a survey of principles of international relations and of the institutions created by man to achieve and preserve peace, with special emphasis on the United Nations and its specialized agencies. The course includes a discussion of WKHIRUHLJQSROLFLHVRIWKHPDMRUSRZHUVDQGWKHLQWHUQDWLRQDOUROHRIQHZO\LQGHSHQGHQW countries in Asia and Africa. PSC 404 Public Administration and Policy (3) Public Policy is an interdisciplinary approach to the study of public issues of health, energy, welfare, education, housing, the environment, and related areas. Critical thinking is emphasized. PSC 405 Senior Seminar in Legal Studies (3) Senior Seminar in Legal Studies is designed for senior students, who participate in a V\VWHPDWLFLQWHUGLVFLSOLQDU\LQTXLU\LQWRPDMRULVVXHVRIODZDQGOHJDODGPLQLVWUDWLRQ Students may be required to submit a comprehensive research paper. PSC 407 Politics of the Developing World (3) Politics of the Developing World is a survey of historical as well as contemporary social, economic, and political issues as they affect the processes of government and nation-building in the developing states of Africa, Latin America, and Asia. Problems associated with socio-economic and political modernization in these societies and the impact of global integration on their future development will be especially emphasized.

195


MORRIS COLLEGE CATALOG PSC 408 Senior Seminar in Political Science (3) 6HQLRU6HPLQDULQ3ROLWLFDO6FLHQFHLVWKHFDSVWRQHFRXUVHIRUVWXGHQWVPDMRULQJLQ SROLWLFDO VFLHQFH DQG SURYLGHV D V\QWKHVLV RI LPSRUWDQW LVVXHV LQVLGH WKH Ă&#x20AC;HOG DV D VSHFLDOL]HGDUHDRIVWXG\0 DMRUFRQFHSWVWKHRUHWLFDODSSURDFKHVSHUVRQDOLWLHVDQG matters related to the practical application of specialized knowledge and skills within the discipline are emphasized. A scholarly research papers that will be presented in a public setting and critiqued by a panel of evaluators is required. Professional development skills and a comprehensive exit examination covering a broad range of VXEMHFWPDWWHUIURPWKHĂ&#x20AC;HOGRISROLWLFDOVFLHQFHDUHDOVRLQFRUSRUDWHGLQWRWKLVFRXUVH PSC 410 Political Thought (3) 3ROLWLFDO 7KRXJKW V\QWKHVL]HV UHĂ HFWLRQ E\ PDMRU DQFLHQW PHGLHYDO DQG PRGHUQ thinkers regarding the nature and purpose of the state with issues pertaining to the actual workings of political and governmental institutions. Professional development issues within the discipline are also considered as a feature of this course for students LQWHQGLQJWRSXUVXHIXUWKHUVWXG\LQWKHĂ&#x20AC;HOG3UHUHTXLVLWHV36& 36& DQG PSC 305 PSYCHOLOGY PSY 201 General Psychology (3) General Psychology presents an introduction to the fundamentals of psychology. Principal topics included are the scope and goals of psychology, movements that shaped modern psychology, principles that guide psychological research, fundamental learning processes, and psychology in relation to social problems. PSY 301 Abnormal Psychology (3) $EQRUPDOSV\FKRORJ\FRQGXFWVDVXUYH\RIWKHĂ&#x20AC;HOGRIPDODGDSWLYHDQGGLVRUGHUHG EHKDYLRULQKXPDQV,WVREMHFWLYHLVWRGHYHORSDQXQGHUVWDQGLQJEHWZHHQREVHUYHG human behavior and theories of personality development and disorder. The Diagnostic DQG6WDWLVWLFDO0 DQXDORI0 HQWDO'LVRUGHUDVDFODVVLĂ&#x20AC;FDWLRQV\VWHPDGRSWHGE\PHQWDO health professionals will be emphasized. PSY 302 Theories of Personality (3) 7KHRULHVRI3HUVRQDOLW\IHDWXUHVDQH[DPLQDWLRQRIPDMRUSHUVRQDOLW\WKHRULHVWKDWDUH PRVWLQĂ XHQWLDOLQFOLQLFDOSUDFWLFH:RUNVE\SHUVRQVVKDSLQJWKHĂ&#x20AC;HOGRISHUVRQDOLW\ theory, and how those theories are applied in actual therapy settings are covered. PSY 305 Tests and Measurements (3) Tests and Measurements is an exploration of the theory and practice of psychological assessment in measuring mental abilities, achievement, personality and psychopathology. Topics will include construction, validation and use of psychological tests in a variety of settings. PSY 306 Psychology of the African American Experience (3) Psychology of the African American Experience is the study of psychological theories and methods applied to the experience of people of African ancestry. The role of cultural retention in relation to identity formation, adaptive behaviors as well as the impact of institutionalized racial discrimination and other historical phenomena is explored. PSY 401 Applied Psychology (3) Applied Psychology provides students with an opportunity to understand the role of psychology in everyday life. Emphasis is directed toward the application of psychology to the understanding of social issues and problems. PSY 402 Organizational and Industrial Psychology (3) Organizational and Industrial Psychology is an introduction to the theory, research and application of psychology as they relate to human behavior in organizations. The

196


DESCRIPTION OF COURSES PDMRUFRQWULEXWLRQVRIRUJDQL]DWLRQDODQGLQGXVWULDOSV\FKRORJ\WRXQGHUVWDQGLQJKRZ people function in the world of work will be explored. RECREATION REC 101 Seasonal Activities (1) 6HDVRQDO $FWLYLWLHV LV GHVLJQHG WR SURYLGH DQ RULHQWDWLRQ WR WKH REMHFWLYHV QHHGV values, and activities of physical education and to teach activities that may be engaged in by students in their leisure time. REC 201 Introduction to Recreation (3) Introduction to Recreation provides an overview of the recreation movement and profession. It examines foundations, historical perspectives, and the development of recreation as a prime facet of society. The formulation of a personal philosophy of recreation is also covered. The recreation system and scope are discussed, with an emphasis on career exploration. REC 310 Recreation for Special Populations (3) Recreation for Special Populations is designed to provide a study of the concepts in program planning, leadership and adaptation of recreation activities for special populations: the physically and mentally handicapped, the incarcerated, the aged, and disadvantaged groups. The course includes twenty hours of practicum. Open only to students who have earned at least 56 semester hours of collegelevel credit. REC 312 Programming for Recreation (3) Programming for Recreation is designed to provide an overview of recreation programs in various settings such as rural, urban, medical, and industrial. REC 320 Camp Counseling and Management (3) Camp Counseling and Management addresses the role of organized camping. The course involves the study of principles and methods of camp development, management, and staff relations and expands on responsibilities of camp counselors and their functions for the campers. REC 350 Practicum I (1) A supervised learning experience in a workplace-based, professional setting designed WR DSSO\ WKH SULQFLSOHV RI UHFUHDWLRQ 7KLV FRXUVH UHTXLUHV Ã&#x20AC;IW\    FORFN KRXUV RI RQVLWH REVHUYDWLRQ LQ WKH SULYDWH VHFWRU D YROXQWDU\ DJHQF\ RU D QRQSURÃ&#x20AC;W JURXS providing specialized direct service. Prerequisite: REC 201 REC 351 Practicum II (1) A supervised learning experience in a workplace-based, professional setting designed WRDSSO\SULQFLSOHVRIUHFUHDWLRQ7KLVFRXUVHUHTXLUHVÃ&#x20AC;IW\   FORFNKRXUVRIRQVLWH observation in the public sector with an agency operating in part or totally from taxbased funding. Prerequisite: REC 201 REC 403 Administrative Concepts, Leadership and Practices in Recreation I (3) Administrative Concepts, Leadership and Practices in Recreation I includes the examination, analysis, and interpretation of principles and methods for administering a recreation agency. Problem solving techniques, personnel recruitment and VXSHUYLVLRQ SXEOLF UHODWLRQV Ã&#x20AC;QDQFLQJ DQG OHDGHUVKLS LQ WKH SULYDWH VHFWRU ZLOO EH explored. Prerequisites: REC 201; REC 301; REC 312

197


MORRIS COLLEGE CATALOG REC 404 Administrative Concepts, Leadership and Practices in Recreation II (3) Administrative Concepts, Leadership and Practices in Recreation II is a continuation of REC 401, with special emphasis on the concepts, principles, and skills of administration and leadership in the public sector. Topics include management theory, techniques for leisure service delivery, requisitions, records, and development of desirable goals and procedures. Prerequisites: REC 201, REC 301, REC 312 REC 405 Facility Maintenance and Management (3) Facility Maintenance and Management establishes maintenance and management principles for indoor and outdoor recreation areas. It examines standards, legalities, SHUVRQQHOZRUNRUGHUVUHFRUGNHHSLQJODQGVFDSLQJVXUIDFHW\SHVDQGWUDIÃ&#x20AC;FSDWWHUQ implications. REC 420 Risk Management and Legal Issues (3) Risk Management and Legal Issues examines sports, recreational, and environmental safety. It views accident prevention in relation to risk taking in recreation and explores sports medicine and rehabilitative techniques. Open only to students who have earned at least 56 semester hours of collegelevel credit. REC 435 - Research and Evaluation in Recreation (3) This course focuses on problem-solving for decision-making in recreation, with special emphasis on program evaluation, needs assessment, research methods, and the GHYHORSPHQWRIDUHVHDUFKSURMHFW4XHVWLRQQDLUHVDUHGHYHORSHGDQGDGPLQLVWHUHG research data are evaluated and interpreted, and standards for writing research reports are explored. Prerequisites: REC 401; REC 403 REC 440 Internship (1) The recreation administration internship is a practical administrative/managerial/ OHDGHUVKLSH[SHULHQFHWKDWLVDQLQWHJUDOSDUWRIWKHVWXGHQW·VHGXFDWLRQDOSUHSDUDWLRQ for a professional career. Students participate in supervised settings designed to provide opportunities to apply principles learned in the classroom and develop SURIHVVLRQDO DQG SHUVRQDO JURZWK WKURXJK ´RQWKHMREµ H[SHULHQFHV LQ UHFUHDWLRQ administration. This course requires a minimum of ten weeks (400 hours) of supervised experience in a recreation or recreation-related agency. Prerequisites: REC 401; REC 403; REC 420; REC 435 REC 450 Senior Seminar (3) This is a capstone course designed to provide a summary review and evaluation of SULQFLSOHVOHDUQHGLQDOOSULRUPDMRUFRXUVHV7KHUHDUHGLVFXVVLRQVRIFXUUHQWLVVXHV LQ WKH SURIHVVLRQ DORQJ ZLWK FDUHHU H[SORUDWLRQ UpVXPp ZULWLQJ LQWHUYLHZLQJ DQG the development of research papers. The course prepares the student to enter the UHFUHDWLRQÃ&#x20AC;HOGDVDFRPSHWHQWGHYHORSLQJSURIHVVLRQDO$FRPSUHKHQVLYHVHQLRUH[LW examination is incorporated into this course. Prerequisites: REC 201, REC 312, REC 310, REC 340, REC 405 RELIGION REL 201 Literature and Religion of The Old Testament (3) /LWHUDWXUHDQG5HOLJLRQRIWKH2OG7HVWDPHQWJLYHVWKHVWXGHQWÃ&#x20AC;UVWKDQGNQRZOHGJH of the cultural and religious heritage of the Hebrew-Christian tradition. The course enables the student to evaluate carefully and to appreciate the moral and spiritual values of the Old Testament.

198


DESCRIPTION OF COURSES REL 202 Literature and Religion of the New Testament (3) Literature and Religion of the New Testament is a survey of the cultural and religious life of the Hebrew in the Greco-Roman world and points out the main events which prepared the way for the establishment of the Religion and Literature of the New Testament. REL 203 World Religions (3) :RUOG5HOLJLRQVLVGHVLJQHGWRLQWURGXFHWKHVWXGHQWVWRQLQHPDMRUZRUOGUHOLJLRQV 7KH VWXGHQW ZLOO EH DEOH WR LGHQWLI\ WKH PDMRU UHOLJLRQV RI WKH ZRUOG WKHLU IRXQGHUV WKHLURULJLQVDQGSUHVHQWPHPEHUVKLSVDQGWKHLUEHOLHIVWUXFWXUHVDQGLQĂ XHQFHV7KH VWXGHQWV ZLOO DOVR EH DEOH WR FRPSDUH DQG FRQWUDVW WKH WHQHWV RI WKH ZRUOG¡V PDMRU religions and give rationale for religious pluralism and coexistence. REL 300 Introduction to Christian Education (3) ,QWURGXFWLRQ WR & KULVWLDQ (GXFDWLRQ LV D VXUYH\ RI WKH Ă&#x20AC;HOG RI & KULVWLDQ (GXFDWLRQ Attention is given to biblical basis and current philosophies of Christian education as well as the goals and organization of educational programs, including those that LQĂ XHQFHSK\VLFDOPHQWDOHPRWLRQDODQGVSLULWXDOKHDOWK REL 301 Church History (3) & KXUFK+ LVWRU\LVGHVLJQHGWROHDGWKHVWXGHQWWKURXJKDVHULRXVVWXG\RIWKH& KXUFK¡V several stages of historical development, with emphasis on the Great Councils. Effort LVPDGHWROLQNHDUOLHUSURQRXQFHPHQWVZLWKWRGD\¡VHFFOHVLRORJLFDOVKDSHV REL 302 Principles of Worship (3) Principles of Worship is a study of the principles and practices of worship in the Protestant tradition. The concern for liturgical order and impact is examined. Open only to students with 56 semester hours of college-level credit. Open only to students who have earned at least 56 semester hours of college-level credits. REL 303 The Prophets (3) 7KH 3URSKHWV LV DQ LQWHQVLYH VWXG\ RI WKH PDMRU (LJKWK DQG 6HYHQWK & HQWXU\ % &  Prophets of Israel, including Amos, Micah, Isaiah, Jeremiah, Hosea, and Ezekiel. Both the literature and the historical contexts of these powerful personalities are shared with the student. REL 304 Theology of The Old Testament (3) Theology of the Old Testament is an intensive study of the development of the doctrine of God, man, sin, and redemption in the Old Testament. This course also emphasizes Prophetic and Exodus themes. REL 305 Theology of The New Testament (3) Theology of the New Testament is a comparative investigation of the theological concepts of the New Testament. Emphasis includes exegesis and content. Pre-Requisite: REL 304 REL 306 Black Church Studies (3) % ODFN& KXUFK6WXGLHVDGGUHVVHVVXFKVXEMHFWVDVWKHKLVWRU\WKHSUHVHQWVWDWHDQG the future missions of the Black Church in the increasingly pluralistic religious society of the Twenty-First Century. Open only to students with 56 semester hours of collegelevel credit. Open only to students who have earned at least 56 semester hours of collegelevel credits. REL 311 Church Administration (3) & KXUFK$GPLQLVWUDWLRQLVDVWXG\RIWKHSDVWRU¡VUROHDVDQDGPLQLVWUDWRU,WKLJKOLJKWV WKHQHHGWRIRVWHUYLVLRQWHDPVSLULWFXOWXUHFULWLTXHLQWHJULW\SK\VLFDOĂ&#x20AC;WQHVVDQG mental alertness.

199


MORRIS COLLEGE CATALOG REL 312 Principles of Christian Education (3) Principles of Christian Education is a study of the most effective methods of teaching religion in the church school and other religious organizations. The course is vital to WKHPDMRU REL 315 Baptist Polity (3) % DSWLVW 3ROLW\ LV DQ H[DPLQDWLRQ RI WKH GHĂ&#x20AC;QLWLRQ RI FKXUFK SROLW\ ZLWK VSHFLDO emphasis on the principles governing the Baptist Church. The probe goes back to the Anabaptists. REL 316 The Social Teachings of Jesus (3) The Social Teachings of Jesus is a course which examines three areas in which one has inescapable responsibilities: to oneself, to fellow humans, and to God. The VWXGHQWZLOOĂ&#x20AC;QGWKDWWKHVWXG\RI-HVXVRI1D]DUHWKWKURZVJUHDWOLJKWRQTXHVWLRQVLQ the three areas of concern by His teachings and actions. REL 318 Theology and Christian Thought (3) 7KHRORJ\ DQG & KULVWLDQ 7KRXJKW H[DPLQHV WKH PDMRU LVVXHV LQ FODVVLFDO DQG contemporary Christian Thought. In an effort to give the student an understanding of the Christian religion, the course will focus on what the Christian Church believes, teaches, and confesses, with emphasis given to beliefs that Christians hold in common ZKLOHH[SORULQJVXFKGRFWULQHVDV*RG& KULVWWKH+ RO\6SLULWVDOYDWLRQMXVWLĂ&#x20AC;FDWLRQ ecclesiology, and eschatology. REL 319 Black Theology (3) Black Theology, in both of its phases from Richard Allen to James H. Cone, has been both a corrective and a protest by the Black Church as it faced racism in America, a phenomenon not yet totally eliminated. This course leads the student to raise and ponder the question as to whether the God of the Christian faith and racism are compatible in either theory or practice. REL 400 Christian Ethics (3) Christian Ethics deals with the origin and development of moral standards in Christian ethics, pointing out the underlying forces contributing to the development of the various moral standards. The course explores the concept of agape, which undergirds all Christian Ethics. REL 401 Homiletics (3) Homiletics is a study of the art of sermon construction, with special emphasis on the purpose of preaching, the selection of the text, and the organization and presentation of material. Each student is required to prepare and deliver one sermon. REL 402 Christian Leadership Seminar (3) Christian Leadership Seminar is the capstone course for the Christian Education Program, integrating the basic theoretical concepts and the ways in which they are DSSOLHGRULPSOHPHQWHG7KHPDMRUSULQFLSOHVRIWKH& KULVWLDQIDLWKUHJDUGLQJWHDFKLQJ and the proven theories from education are blended to assure effective training of Christian educators. This course incorporates a semester-long senior thesis and a professional career portfolio. A comprehensive senior exit examination covering VXEMHFWPDWWHULQWKHĂ&#x20AC;HOGLVLQFRUSRUDWHGLQWRWKLVFRXUVH REL 404 Pastoral Care and Counseling (3) Pastoral Care and Counseling is the capstone course for the Pastoral Ministry program, integrating theological, ethical, and biblical principles into church vocation, training, and the development of a congregation that is mentally, emotionally, physically, and spiritually sound. This course incorporates a semester long thesis and a professional FDUHHUSRUWIROLR$FRPSUHKHQVLYHVHQLRUH[LWH[DPLQDWLRQFRQYHUJLQJVXEMHFWPDWWHU LQWKHĂ&#x20AC;HOGLVLQFRUSRUDWHGLQWRWKHFRXUVH

200


DESCRIPTION OF COURSES REL 415 Internship (3) The Internship provides a thorough involvement in the work of ministry under the supervision of a pastor, chaplain, Director of Religious Education, or CEO of an agency DSSURYHG DV D Ã&#x20AC;HOG LQVWUXFWRU E\ WKH GLYLVLRQ 7KH LQWHUQVKLS H[SHULHQFH SURYLGHV the student with the necessary direct and hands-on involvement with the world of ZRUN6WXGHQWVDUHHQFRXUDJHGWRZRUNZLWKWKHÃ&#x20AC;HOGLQVWUXFWRULQWKHGHYHORSPHQW of programs and ministries, when applicable, that will address the mental, emotional, physical, and spiritual wellness of constituencies associated with the church or agency. 3UHUHTXLVLWHV5(/5(/  & KULVWLDQ(GXFDWLRQDQG3DVWRUDO0 LQLVWU\0 DMRUV  5(/5(/ & KULVWLDQ(GXFDWLRQ0 DMRUV 5(/5(/ 3DVWRUDO0 LQLVWU\ PDMRUV  SOCIOLOGY SOC 101 Principles of Sociology (3) Principles of Sociology is an introduction to the concepts and methods of sociology. The course includes examination of diverse methods of socialization, group processes, PDMRUVRFLDOLQVWLWXWLRQVDQGVRFLDOFKDQJH SOC 300 Introduction to Gerontology (3) Introduction to Gerontology is an introduction to the areas of biological, psychological, DQGVRFLRORJLFDOFRQWULEXWLRQVWRWKHÃ&#x20AC;HOGRI*HURQWRORJ\ZLWKDQHPSKDVLVRQSHUVRQDO awareness of myths, problems, and solutions relating to the older person in America. Prerequisite: SOC 101 SOC 301 Social Psychology (3) Social Psychology analyzes the interrelationship between society, culture, and personality. Emphasis is placed on the concepts of motivation, self perception, personality, crowds, groups and propaganda. Prerequisite: SOC 101 SOC 302 Social Problems (3) 6RFLDO 3UREOHPV LV D FULWLFDO UHYLHZ RI PDMRU VRFLDO SUREOHPV VXFK DV FULPH DQG MXYHQLOH GHOLQTXHQF\ DGROHVFHQW SUHJQDQF\ DQG GUXJ DEXVH DQG WKHLU LPSDFW RQ diverse populations in American society. Open only to students who have earned at least 56 semester hours of college-level credits. Prerequisite: SOC 101 SOC 303 Societal Responses to Ageing (3) Societal Responses to Aging is a study of the ways in which aging, as a dimension of social organization, touches every life, every home, every community, and every relationship. Prerequisite: SOC 101 SOC 307 Community Organization (3) Community Organization is a study of processes, integration, and change in the community and analysis and comparison of rural and urban communities with respect to structural features, communications processes, and basic institutions. The course examines changing roles of the local community in the total society. Prerequisite: SOC 101 SOC 308 Political Sociology (3) Political Sociology is a study of various government institutions and the way in which their social structures operate to conform to various political philosophies (at the international level). Social forces that created various political systems are also a focus of study. Prerequisite: SOC 101

201


MORRIS COLLEGE CATALOG SOC 309 Courtship, Marriage and Family (3) Courtship, Marriage and Family concerns mate selection: the meaning of love; HQJDJHPHQWDQGWKHSK\VLFDOSV\FKRORJLFDODQGVRFLDODGMXVWPHQWVLQPDUULDJHWKH past, present and future of marriage; and the analysis of the family institution as a background for the study of family interactions, family crises, and problems. Prerequisite: SOC 101 SOC 310 Cultural Anthropology (3) Cultural Anthropology focuses on the nature of culture and society and involves the study of a variety of cultures on different developmental levels, including social, economic, political, education, and religious systems and their interrelationships and includes a comparison of preliterate and contemporary societies. Open only to students who have earned at least 56 semester hours of college-level credit. Prerequisite: SOC 101 SOC 315 Gerontological Development and Social Policy (3) Gerontological Development and Social Policy focuses on national awareness, historical growth, and policy development in response to Gerontology in the United 6WDWHV 6SHFLÃ&#x20AC;F H[DPSOHV O LQFOXGH VRFLDO DQG KHDOWK LQVXUDQFH :KLWH + RXVH FRQIHUHQFHVOHJLVODWLRQDGPLQLVWUDWLRQRQDJLQJQDWLRQDOLQVWLWXWHRQDJLQJVFLHQWLÃ&#x20AC;F DQGDSSOLHGJURXSVDQGÃ&#x20AC;QDQFLQJSURJUDPV Prerequisite: SOC 101 SOC 340 Social Work Methods in Human Services (3) Social Work Methods in Human Services introduces students to the generalist method of social work practice. Course content includes helping students to learn basic interviewing and intervention skills, case recording, and analyzing. Emphasis is placed on working with diverse populations, including children, older persons, and adolescents. Prerequisite: SOC 101 SOC 400 Introduction to Social Welfare (3) Introduction to Social Welfare is a study of social work as both an art and a science, WKHHYROXWLRQRIVRFLDOVHUYLFHVWKHÃ&#x20AC;HOGRIVRFLDOZRUNDGPLQLVWUDWLRQRISXEOLFZHOIDUH and voluntary social agencies, and social work as a discipline as a profession. Prerequisite: SOC 101 SOC 402 Social Theory (3) Social Theory is a synthesis that combines an overview and assessment of the works of leading contemporary sociologists with critical analysis centering on the nature of VRFLRORJLFDOH[SODQDWLRQ)RUVWXGHQWVLQWHQGLQJWRSXUVXHIXUWKHUVWXG\LQWKHÃ&#x20AC;HOG various professional development issues are also considered. A comprehensive VHQLRU H[LW H[DPLQDWLRQ FRYHULQJ VXEMHFW PDWWHU LQ WKH Ã&#x20AC;HOG LV LQFRUSRUDWHG LQWR WKLV course. Prerequisites: SOC 101, SOC 302, SOC 309 and SOC 310 SOC 403 Ethnic Minority Groups in American Society (3) Ethnic Minority Groups in American Society is a study of the historical and social VLJQLÃ&#x20AC;FDQFH RI WKH SUHVHQFH RI GLYHUVH HWKQLF JURXSV LQ WKH $PHULFDQ QDWLRQ DQ analysis of the structure and dynamics of race relations and their relationship to the meaning of the American theory of equality. Prerequisite: SOC 101 SOC 404 Urban Sociology (3) Urban Sociology examines the city as a social phenomenon in the modern world and analyzes urban trends, characteristics, functions, and social organization. Prerequisite: SOC 101

202


DESCRIPTION OF COURSES

SOC 405 Techniques of Management in Aging Agencies (3) Techniques of Management in Aging Agencies is an overview of basic management WKHRU\DQGSUDFWLFH7KHVWXGHQWZLOOOHDUQWKHIHGHUDOVWDWHIXQGLQJSURFHVVĂ&#x20AC;QDQFLDO SODQQLQJDQGEXGJHWLQJDQGEDVLFDFFRXQWLQJFRQFHSWVXVHGLQQRQSURĂ&#x20AC;WDJHQFLHV Prerequisite: SOC 101 SOC 406 Practicum in Gerontology (3-12) Practicum in Gerontology provides an opportunity in the world of work for the student WR JDLQ H[SHULHQFH ZLWKLQ WKH Ă&#x20AC;HOG RI *HURQWRORJ\  (DFK VWXGHQW ZLOO FRPSOHWH RQH summer or one semester in an agency planning or administering program for older people. Prerequisites: SOC 303, 315, and 340 SPANISH SPA 101 Elementary Spanish I (3) Elementary Spanish I provides an introduction to the four basic language skills: listening, speaking, reading, and writing. It includes a primary study of Spanish culture and history. SPA 102 Elementary Spanish II (3) (OHPHQWDU\6SDQLVK,,LVGHVLJQHGWRIXUWKHUWKHVWXGHQWV¡NQRZOHGJHOHYHOLQWKHIRXU basic language skills and of Spanish history and culture. Prerequisite: SPA 101 SPA 201 Intermediate Spanish I (3) Intermediate Spanish I enables students to improve on the basic skills already learned in order to use the language in conversation and writing. A review of grammar, more complex structures, and vocabulary expansion are introduced, as well as histories, FXOWXUHVDQGQDWLRQDOLGHQWLWLHVRI6SDLQDQGPDMRU/DWLQVSHDNLQJQDWLRQV SPA 202 Intermediate Spanish II (3) ,QWHUPHGLDWH 6SDQLVK ,, LV DOVR GHVLJQHG WR HQKDQFH WKH VWXGHQWV¡ NQRZOHGJH LQ conversation, reading, and writing. Greater emphasis is placed on grammar, more complex structures, and vocabulary expansion, along with histories, cultures, and QDWLRQDOLGHQWLWLHVRI6SDLQDQGPDMRU/DWLQVSHDNLQJQDWLRQV Prerequisite: SPA 201 SPEECH AND THEATER SPH 103 Voice and Speech Improvement (3) Voice and Speech Improvement is designed to acquaint students with various formal and public communication situations and provide practical opportunities to demonstrate HIIHFWLYH RUDO WHFKQLTXHV  7KLV FRXUVH DOVR DVVLVWV LQ UHĂ&#x20AC;QLQJ LQWHUSHUVRQDO DQG business communications skills, equipping students to enter the public and private VHFWRUVDQGPDNLQJWKHPFRPSHWLWLYHLQFXUUHQWDQGIXWXUHMREPDUNHWV SPH 201 Public Speaking (3) Public Speaking covers the fundamentals of public speaking, including organization and delivery of speeches for various occasions. Prerequisite: SPH 103 SPH 202 Voice and Diction (3) Voice and Diction includes instruction and practice in voice production and articulation. ([HUFLVHV LQ VWUHQJWK Ă H[LELOLW\ DQG VHQVLWLYLW\ LQ WKH XVH RI WKH YRLFH DQG VSHHFK mechanism are utilized.

203


MORRIS COLLEGE CATALOG

SPH 210 Introduction to the Theater (3) Introduction to the Theater is an introduction to dramatic modes, play production, acting, directing, and theater management. SPH 220 Oral Interpretation (3) Oral Interpretation is a study of the oral interpretation of literary pieces. Students are assigned poems, scenes from plays, and segments of other literary works for interpretation and speech practice. Prerequisite: SPH 103 SPH 310 Play Production (3) Play Production provides students the opportunity to produce a theatrical presentation. It involves participation in at least one of the areas of production: design, acting, makeup, stage managing, stage lighting, and set construction. SPH 320 Modern Drama (3) Modern Drama is a study of dramatic theory and literature from the Greeks to the present day. It explores the Greek theater; the English theater of the Renaissance period; mid-eighteenth century theater; and recent developments in realism, naturalism, and expressionism. SOCIAL SCIENCES SSC 100 Contemporary Affairs (1) Contemporary Affairs is a course designed for analytical, critical, and creative examination of contemporary social, political, and economic issues. Emphasis is on social sciences skills and application through discussions, essays, and special SURMHFWV SSC 200 Pre-Law Seminar (2) Pre-Law Seminar is a study of selected areas of federal and state legal history, constitutional law, and the legal profession. SSC 201 Computers and Society (3) Computers and Society is an interdisciplinary introduction to the study of computer impact. It includes historical interplay between technology and society, the present and future role of computers as they affect individuals, and their impact on society as a whole. 66&:RPHQ·V5ROHLQD&KDQJLQJ6RFLHW\ 

:RPHQ·V5ROHLQD& KDQJLQJ6RFLHW\LVGHVLJQHGWRVHQVLWL]HVWXGHQWVWRWKHKLVWRULFDO role of women in various parts of the world and to the changing role of women in contemporary society. The course examines the impact of culture and society on gender roles, including socialization and identity formation, as expressed in various lifestyles. SSC 302 Political Economy and Society (3) Political Economy and Society is an introductory study of how political and economic IRUFHVLQWHUDFWWRLQÁXHQFHSXEOLFGHFLVLRQPDNLQJDVZHOODVSULYDWHDFWLYLW\UHODWLYHWR the allocation and utilization of material resources in the pursuit of societal well-being. Theory as well as analysis with regard to how factors such as culture, ideology, race, gender and distribution of power shape macroeconomic behavior is emphasized in this course. SSC 350 Introduction to Social Statistics (3) Introduction to Social Statistics provides an introduction to the fundamentals and uses of modern statistics and quantitative methods in the social sciences. It includes descriptive statistics, statistical inference, and probability theory. Prerequisite: MAT 103

204


MORRIS COLLEGE CATALOG

SSC 400 Social Science Seminar (3) 6RFLDO 6FLHQFH 6HPLQDU LV WKH FDSVWRQH FRXUVH IRU VWXGHQWV PDMRULQJ LQ 6RFLRORJ\ ,WIRFXVHVRQGLVFXVVLRQVDQGWRSLFVWKDWV\QWKHVL]HVLJQLÃ&#x20AC;FDQWLVVXHVDQGFRQFHUQV LQVLGHWKHÃ&#x20AC;HOGRIVRFLRORJ\DVDVSHFLDOL]HGDUHDRIVWXG\0 DMRUFRQFHSWVWKHRUHWLFDO approaches, personalities, and matters related to practical application of knowledge and skills within the discipline are emphasized. A scholarly research papers that will be presented in a public setting and critiqued by a panel of evaluators is required. Professional development skills and a comprehensive examination covering a broad UDQJH RI VXEMHFW PDWWHU IURP WKH Ã&#x20AC;HOG RI VRFLRORJ\ DUH DOVR LQFRUSRUDWHG LQWR WKLV course. SSC 401 Introduction to Social Research (3) ,QWURGXFWLRQWR6RFLDO5HVHDUFKGHDOVZLWKGHÃ&#x20AC;QLQJDQGGHOLPLWLQJDVRFLDOSUREOHP choosing a design, gathering and analyzing data, and reviewing other research studies. Prerequisite: SOC 101 SSC 450 Internship (3) Internship includes practical experience for social science students in a professional setting. Students are required to work 120 hours under the supervision of professionals, who provide them with valuable experience and the opportunity to apply principles learned in the classroom setting.

205


MORRIS COLLEGE CATALOG ADMINISTRATIVE OFFICERS 2016-2017 LUNS C. RICHARDSON, President LEROY STAGGERS, Academic Dean ROBERT EAVES, Director of Business Affairs JUANA L. DAVIS-FREEMAN, Dean of Student Affairs DOROTHY CHEAGLE, Director of Planning and Governmental Relations ROY GRAHAM, Director of Business Support Services and Personnel MELVIN MACK, Director of Institutional Advancement and Church 5HODWLRQV2IÃ&#x20AC;FHU

ADMINISTRATIVE STAFF 2016-2017 Robyn B. Hall-Agent, M.S, Catalog Librarian Paula Alston, B.S., Computer Laboratory Assistant Carolyn Anderson, B.A., Graphics Center Coordinator Dorshay Epps Brown, M.A., Writing Laboratory Tutor Deborah C. Calhoun, M.Ed., Director of Admissions and Records Gail J. China, Ed.S., Director of Quality Enhancement Plan (QEP) Vacant, Director of Teacher Education Janet Clayton, M.A., Director of Learning Resources Center Anika V. Cobb, B.A., Director of Public Relations Patrice M. Cooper, B.A., Reading Center Assistant/Quality Enhancement Plan (QEP) Altoya A. Felder-Deas, M.Ed., Director of Alumni Affairs Mary E. Dow, M.L.I.S, Serials Librarian Carol L. Fleury, M.S.L.S, Reference Librarian Alston Freeman, B.S., Coordinator of Student Activities Glenda C. Fulwood, B.A., Volleyball Coach (Part-Time) Gloria P. Gibbons, B.S., Computer Center Assistant, Management Information Systems Philip L. Gibbons, B.A., Supplemental English Instructor, Student Support Services 206


ADMINISTRATIVE STAFF Sandra S. Gibson, M.Ed., Director of Financial Aid Vacant, M.Ed., Activity Director/Director of Developmental Programs Lewis P. Graham, Jr., Ph.D., Director of Assessment Shawn L. Hair, M.M.Ed., College and Chorale Accompanist (Part-time) Denise V. Haynes, B.S., Supplemental Mathematics Instructor, Student Support Services Dorothy Hazel, A.A., Network Administrator Oliver T. Hill, D. Min., 'LUHFWRURI0LQLVWHULDO&HUWLÀFDWH([WHQVLRQ&ODVVHV (Part-time) Clarence M. Houck, B.A., 'LUHFWRURI$WKOHWLFVDQG+HDG0HQ·V%DVNHWEDOO and Baseball Coach Bernice Lewers Irby, B.S., Chief Accountant Venessa F. Jefferson, M. A., Director of Residential Life Vacant, Director of Management Information Systems Barbara Jones, M.A., Counselor, Upward Bound Joseph B. Jones, M.P.A., Director of Student Support Services Leisha J. Lloyd, B.S., Computer Laboratory Assistant

Cheryl W. Mack, M.S., Reading Center Assistant/Quality Enhancement Plan (QEP) Daniel McCowan, M.A, Mathematics Laboratory Tutor Georthia M. Moses, M.I.S., Computer Laboratory Assistant Margaret Mukooza, M.L.I.S., Assistant Director of Learning Resources Center Charles Pee, D. Min., College Minister (Part-time) Dianna C. Pringle, M.A., Academic Success Center Coordinator Kay M. Rhoads, Ph.D., Director of Academic Administrative Services (Parttime) Lorenzo Rivers, B.S, Admissions Counselor Johnell Rogers, LPN, Director of Health Services 207


MORRIS COLLEGE CATALOG Elmira Rutherford, M.Ed., Director of Organizational Management Program Lutricia Rutledge, M.S., Counselor, Student Support Services Gloria M. Scriven, M.S., Assistant Director of Admissions and Records Quanda D. Sims, M.Ed., Director of Counseling Subira W. Smalls, M.S., Director of Student Health and Wellness Center Carlotta C. Stackhouse, M.S., Director of Forensics Center Tiffany McCants Walters, B.A., Admissions Counselor Rudolph Wheeler, M.Ed., Director of Upward Bound Program Marguerite D. Wilder, M.S., Assistant Director of Financial Aid Gilbert Wilson, B.A, :RPHQ¡V%DVNHWEDOO&RDFKDQG+HDG6RIWEDOO&RDFK (Part-time) Gloria Seabrook Wright, Ed.D., Director of Career Planning, Cooperative Education and Placement Vacant, Laboratory Assistant and Database Manager

FACULTY 2016-2017 Luns C. Richardson, President A.B., Benedict College; M.A. Teachers College, Columbia University; L.H.D., Morris College; Ped. D., Benedict College; Litt. D., Coker College; D.D., Simmons Bible College. Further study: Rutgers University of New Jersey, University of Tennessee, South Carolina State University.

Leroy Staggers, Academic Dean and Professor of English (Appointed August 1993) B. S., Voorhees College; M.A. and D.A., Atlanta University.

Radman M. Ali, Chairperson, Division of Natural Sciences and Mathematics and Professor of Biology (Appointed September 1966) B.A. and M.S., Miami University of Ohio; Ph.D., Clemson University.

Jacob E. Butler, Jr., Chairperson, Division of Social Sciences and Professor of Political Science (Appointed July 2000) B.A., South Carolina State University; M.A. and Ph.D., Atlanta University.

Cathine Gilchrist Scott, Chairperson, Division of Education and Professor of Education (Appointed January 2015) B.S., Virginia State College; M.Ed., University of Maryland; Ph.D, American University.

Cedric L. Stone,Chairperson, Division of Business Administration and Assistant Professor (Appointed January 2016) B.S., The Ohio State University; MBA, Miami University of Ohio; Ed.D., University of North Carolina at Charlotte.

Robert J. Zalimas, Chairperson, Division of General Studies and Assistant Professor of History (Appointed August 2000) B.A. and M.A., Arizona State University. Further study: Ohio State University.

208


FACULTY Patricia G. Ali, Professor of History (Appointed January 1967) B.A., Skidmore College; M.A., Clemson University; Ph.D., University of South Carolina..

Ayo Awosanya, Associate Professor of Mathematics (Appointed August 2005 B. S., Florida A&M University; M.S., Clark Atlanta University; Ph.D., FloridaState University

Dorothy Bishoff, Associate Professor of Biology (Appointed January 2005) A.B., Occidental College; Ph.D., University of North Carolina.

Carol F. Black, Associate Professor of Criminal Justice (Appointed August 2014) B.A., M.S., and Ph.D, Purdue University.

Elaine Bunche, Assistant Professor of Art (Appointed August 1992) B.A., Benedict College; M.A., Miami University of Ohio.

Walter Butler, Assistant Professor of Religion (Appointed August 2009) % 6& ODĂ LQ& ROOHJH% '0 RUULV& ROOHJH0 'LY,7& 6HPLQDU\'0 LQ+ RRG6HPLQDU\. Robert Carter, Associate Professor of Sociology (Appointed August 2008) B.A, Howard University; M. Phil. and Ph.D., Columbia University.

Deborah Crawford, Professor of Biology (Appointed August 2003) B.S., Voorhees College; Ph.D., Atlanta University.

John H. Day, Assistant Professor of Physics (Appointed August 2014) B/S/. Bethune- Cookman College; M.S. and Ph.D., Howard University.

3DXO1(]HMLAssociate Professor of Health Science (Appointed August 1994) B.S., M.S. and Ph.D., Southern Illinois University at Carbondale.

Shawn Hair, Instructor of Music (Appointed August 2009) B.A., Newberry College; M. M. Ed., University of South Carolina.

Cherry Harmond-Early, Associate Professor of English (Appointed August 2004) B. A., Tuskegee Institute; M.Ed., Oklahoma University, Ph.D, Indiana University of Pennsylvania.

Sherrie Harvin, Assistant Professor of Reading (Appointed August 2004) B.S., Bay Ridge Christian College; M.Ed., Prairie View A & M University.

.DUHQ+ pEHUW Assistant Professor of Spanish (Appointed August 2014) B.A., Iowa State University; M.A., Florida International University; Further study: University of Illinois at Chicago.

James Ibe, Professor of Business Administration (Appointed January 1993) B.S., Northern Michigan University; M.A., University of Texas; MBA, Amber University; Ph.D., University of Texas. Further study: University of South Carolina.

Keith L. Johnson, Associate Professor of Mathematics (Appointed August 1997) B.S., Gannon University; M.A. (Statistics), M.A. (Mathematics) and Ph.D., Pennsylvania State University.

Catherine Kapi, Associate Professor of French (Appointed August 2008) % $DQG0 $8 QLYHUVLWp/DYDO3K'/RXLVLDQD6WDWH8 QLYHUVLW\

Daniel Lackey, Assistant Professor of English (Appointed August 2004) B.A., Trinity University; M.A., Texas Tech University; Ph.D., Boston University. Further study: State University of New York.

209


MORRIS COLLEGE CATALOG Joon Lee, Associate Professor of Recreation Administration (Appointed August 2013) B.A., PaiChai University; M.S., University of Wisconsin-Stout; Ph.D. Clemson University.

Lorne Lee, Instructor of Music (Appointed August 2010) B. Mus., University of Central Oklahoma; M.M.Ed., Howard University.

Deloris McBride, Assistant Professor of Computer Information Science (Appointed January 2000) B.S. Morris College; M. S., Ohio State University; M.S., Webster University.

Elaine McClure, Associate Professor of Education (Appointed August 2004) B.A., University of South Carolina; M.A., University of Alabama; Ph.D., University of South Carolina.

David Magnin, Associate Professor of Chemistry (Appointed August 2005) B. S., University of Wisconsin-Eau Claire; Ph. D., University of South Carolina. Further study: Duke University.

Joshua Oyekan, Professor of Psychology (Appointed August 2008) B.A., William Carey College; M.Sc., PhD. University of Jos; Ed.D, University of Tennessee. Priscilla Patten, Instructor of English (Appointed January 2013) B.A.., Voorhees College; M.A., Ohio State University.

Charles M. Pee, Assistant Professor of Religion (Appointed August 1987) B.S., Francis Marion College; M.Div., Duke University.

Joseph Popoola, Assistant Professor of Speech (Appointed August 2008) B.A., University of Ibadan; M.A., Indiana University; Ph.D., Howard University.

Ivana Popovic, Assistant Professor of Mass Communications (Appointed August 2009) B.A., William Woods University.; M.S., Boston University.

Lynnette Richardson, Associate Professor of Voice and Speech (Appointed August 2016) B.S., Benedict College; M.A., South Carolina State University; Ed.D., University of South Carolina.

John R. Rooks, Professor of English (Appointed August 1989) B.A., University of East Anglia (Great Britain); M.Litt., University of New Castle (Great Britain); Ph.D., University of York (Great Britain).

LaVon Simpson, Instructor of Business Administration (Appointed August 2000) B.S., South Carolina State University; MBA, Winthrop University.

Ann E. Trahanovsky-Orletsky, Associate Professor of Mathematics (Appointed August 1998) B.S., University of Pittsburgh; M.Ed., and Ph.D., Pennsylvania State University.

Valerie Warner, Instructor of Computer Information Science (Appointed August 2003) B.S., Limestone College; M.A., Webster University.

Thoma Williams, Instructor of English (Appointed August 1998) B.A., Winthrop University; M.Ed, University of South Carolina.

210


FACULTY PART-TIME FACULTY 2016-2017 Mary J. Brooks, Instructor of Organizational Management (Appointed August 2015) 

$60 LOOHU0 RWWH7HFKQLFDO& ROOHJH% 60 RUULV& ROOHJH0 % $& ODĂ LQ8 QLYHUVLW\0 67UR\8 QLYHUVLW\ DBA, Argosy University.

Gail June China, Instructor of Education (Appointed August 2004) B.A., Benedict College; M.Ed., Cambridge College. Further study: University of South Carolina.

Gwen L. China, Instructor of Computer Information Science (Appointed August 2015) A.A.S., Central Carolina Technical College; B.S, Morris College; M.A., Webster University.

Janet Clayton, Instructor of Instructional Media (Appointed January 1987) B.A., Clark (Atlanta) College; M.A., George Washington University.

Franklin Colclough, Instructor of Organizational Management and Religion (Appointed June 1997) B.A., Johnson C. Smith University; B.D., Johnson C. Smith Seminary; D.Min., McCormick Theological Seminary.

Anthony Dennis, Instructor of Criminal Justice (Appointed August 2007) B.S., St. Leo University; M. S., Troy University.

Charisma Floyd, Instructor of English (Appointed August 2016) B.S., South Carolina State University; M.A.,, Southern New Hampshire University

Larry Foote, Instructor of Organizational Management (Appointed February 1997) B.A., Clark College; MBA, Atlanta University. Oliver T. Hill, Instructor of Religion (Appointed August 1996) B.A., Morris College; M.Div., Duke University

Maritza Hogan, Assistant Professor of Psychology (Appointed August 2005) B.A., C. W. Post College; Ph.D., State University of New York.

James A. Jamison, Instructor of Religion (Appointed January 2001) B.S., Benedict College: M.Div., Interdenominational Theological Center.

Carla King, Instructor of Mathematics (Appointed August 2011) B.S., M.Ed., Ed.S, South Carolina State University.

Cheryl Williams Mack, Instructor of General Studies (Appointed August 2013) B.S., Morris College; MSM, Troy State University.

Terrence McCants, Instructor of Business (Appointed August 2016) 

% 66RXWK& DUROLQD6WDWH8 QLYHUVLW\0 % $& ODĂ LQ8 QLYHUVLW\

Clarissa Suzette McClellan, Instructor of Health Science (Appointed August 2010) B.S., College of Charleston; M.S., University of South Carolina.

Michael R. McCormick, Associate Professor of History (Appointed August 1988) B.S., M.A., Southern Illinois University; Ph.D., Ohio State University.

Jerome McCray, Assistant Professor of Health Science (Appointed August 2008) B.A. Limestone College; M.Ed., East Tennessee State University.

211


MORRIS COLLEGE CATALOG William S. Owens, Instructor of Mathematics (Appointed August 2016) B.S., United States Military Academy; M.A., Webster University; M.A., Chapman College. Further study: Francis Marion University

Elmira Rutherford, Instructor of Organizational Management (Appointed June 2014) B.A., Columbia College; M.Ed., University of South Carolina

Craig S. Parker, Assistant Professor of Political Science (Appointed August 2012) 

% $6W$XJXVWLQH·V& ROOHJH0 $8 QLYHUVLW\DW$OEDQ\6WDWH8 QLYHUVLW\RI1HZ<RUN

Barrington Pierson, Instructor of Mathematics (Appointed January 2002) B.S., Morris College; M.Ed., University of South Carolina. Further study: South Carolina State University, College of Charleston, Atlanta University, Princeton University.

Lucretia Rutledge, Instructor of General Studies (Appointed August 2016 B. A., Coker College; M.S., Columbus State University.

Angelia Scott-Jackson, Instructor of Organizational Management (Appointed January 2015) B.S., Limestone College; MBA, Webster University.

Glories Scriven, Assistant Professor of Reading (Appointed August 2000) B.S., Morris College; M.Ed., University of South Carolina. Further study: University of South Carolina.

Keya Simon, Assistant Professor of Business Administration (Appointed January 2015) % 6/LPHVWRQH& ROOHJH·0 6:HEVWHU8 QLYHUVLW\3K' $UJRV\8 QLYHUVLW\

Max Weber, Instructor of Biology (Appointed January 2007) B. S., Clemson University; M.A.T., Biology.

Jordan D. White, Assistant Professor of Criminal Justice (Appointed August 2005) B.A., Wofford College; J.D., University of Florida Law School.

FACULTY AND STAFF EMERITI 2016-2017 -AJEL-CL3AE8B ':849-:567892.9*7,/:479+..8653 3C@CBL ;IFFJDL 9IAAK6K,L ;C:CBL :I?H<L 9EFIAJGEL :HEHKL 2GJ5KFDJH>CL ?FH<KFL DH?=>L 2GJ5KFDJH>L I7L %<I=KL !DAEG=BL K IFL2GJ5KFDJH>BL9IA?0#JEL2GJ5KFDJH>BL2GJ5KFDJH>LI7L:I?H<L9EFIAJGEC

;EF6EFKHL"CL/E5JDB +3321687:9$52.:33259-:567892.9/,187624 @C3CBL ;IFFJDL 9IAAK6K,L ;C-=CBL K04AKL 2GJ5KFDJH>CL ?FH<KFL DH?=>L :I?H<L 9EFIAJGEL :HEHKL 2GJ5KFDJH>BL "KDHKFG 9EFIAJGEL2GJ5KFDJH>BL-EDHKFGLKGH?8>L2GJ5KFDJH>C

?KKGL"JAAJE0DL:4EGGBL'65:17259-:567892.9+/-6336243984/9%:125/3 3C@CBL;IFFJDL9IAAK6K,L;C-=CBL2GJ5KFDJH>LI7L:I?H<L9EFIAJGEC

STAFF 2016-2017 Barbara A. Abrams, Data Entry Clerk, Admissions and Records Joe E. Adger, &DPSXV6DIHW\2IÃ&#x20AC;FHU Ulessly Alston, Residence Hall Assistant 212


STAFF JoAnn B. Anderson, Media Assistant/Clerk, Learning Resources Center Linell Anderson, Assistant Residence Hall Director Victor Atlas, Residence Hall Assistant (Part-Time) Janet Awosanya, Residence Hall Assistant (Part-time) Bryant Bailey, Residence Hall Assistant Gloria D. Baker, Residence Hall Assistant (Part-time) Milton L. Bell, Jr., Residence Hall Assistant (Part-time) Harry J. Bennett, &DPSXV6DIHW\2IÀFHU Gloria J. Billie, Library Assistant, Learning Resources Center Ashanta Bradley, Maintenance Employee Eddie J. Bradley, Mechanic Helper Terrecenia Bristol, Residence Hall Assistant (Part-time) Brandon J. Brown, Residence Hall Assistant (Part-time) JoAnn W. Brown, Residence Hall Assistant Bernadette F. Clayton, Secretary, Careers Services Center Tanaporn K. Cockerill, Data Entry Clerk, Organizational Management Program Lewis Dargan, Maintenance Assistant Frances Davis, Residence Hall Assistant Louella Davis, Maintenance Employee Lucille W. Davis, Student Accounts Assistant, Business Affairs Lula J. Dawson, Secretary-Cashier, Business Affairs JoAnn L. Dennis, Maintenance Employee Gloria W. Dozier, Secretary, Counseling and Testing Center Gloria Evans, Loan Management Coordinator, Financial Aid Gloria D. Frederick, Residence Hall Director Flora Fulmore, Maintenance Employee Cindy Gaymon, Personnel Assistant, Business Support Services Carolyn George, Maintenance Employee LeShawn D. Green, &DPSXV6DIHW\2IÀFHU Thelma Grice, Residence Hall Assistant (Part-time) Julius Hannibal, Maintenance Assistant Thomas Harris, &DPSXV6DIHW\2IÀFHU Vernon Harvin, Maintenance Assistant Anthony Hayes, &DPSXV6DIHW\2IÀFHU 213


MORRIS COLLEGE CATALOG Ternice B. Haynesworth, Maintenance Employee Eva M. Hickman, Media Assistant, Media Center Kyeeniah N. Hickmon, Switchboard Operator-Receptionist Lauretta Hilton, 'DWD(QWU\&OHUN2IĂ&#x20AC;FHRI,QVWLWXWLRQDO$GYDQFHPHQW2IĂ&#x20AC;FH of the President Jeanette Moses-Holmes, Bookstore Manager and Mailroom Supervisor Veronica C. Jackson, Secretary, Financial Aid James Jenkins, Supervisor of Custodial and Grounds Services Andrea N. Johnson, Data Entry Clerk, Division of Business Administration Barbara Jones, Secretary, Upward Bound Otis Jones, Assistant Residence Hall Director Vivian Leaf, Secretary, Student Affairs ) HOLVKD* 0 DMRUAssistant Residence Hall Director LaKeesha Martin, Residence Hall Assistant (Part-time) Barbara Brown-McBride, Senior Secretary, Division of General Studies and Honors Program Terrence L. McCants, Library Assistant in Cataloging, Learning Resources Center Delores C. McFadden, Secretary to the Academic Dean Shirley W. McMillian, Library Assistant, Learning Resources Center Clarence Mitchell, Assistant Residence Hall Director Ruthell A. Muldrow, Secretary, Physical Plant Arswanette L. Myers, Data Entry Clerk/Quality Enhancement Plan (QEP) Todd Owens, &DPSXV6DIHW\2IĂ&#x20AC;FHU Lou E. Ceasar-Parrott, Default Management Coordinator, Financial Aid Rhonda Pearson, Secretary, Division of Natural Sciences and Mathematics Sarah H. Pearson, Residence Hall Director Daniel Piram, Jr., &DPSXV6DIHW\2IĂ&#x20AC;FHU Calvin Prince, Maintenance Assistant Horace Pugh, Residence Hall Assistant (Part-Time) Michael Ragin, Residence Hall Assistant (Part-Time) Carolyn W. Richardson, Maintenance Employee Linda Richbow, Residence Hall Director Mary Richbow, Assistant Residence Hall Director Wayne C. Richbow, &DPSXV6DIHW\2IĂ&#x20AC;FHU 214


STAFF Edward Rogers, Residence Hall Director Angela M. Ruth, Secretary (NNSA) National Nuclear Security Administration Cybersecurity Program Vacant, Purchasing Clerk-Secretary, Business Affairs Stanley Scriven, Residence Hall Director Wendy M. Sharper, Accounts Payable Clerk, Business Affairs Ella Ree Sherod, Residence Hall Assistant Denise R. Stewart, Residence Hall Assistant (Part-time) Luke Stewart, Jr., Maintenance Assistant Tracy P. Stewart, Assistant Residence Hall Director Henrietta M. B. Temoney, Secretary, Student Support Services Hasker Thomas, Jr., &DPSXV6DIHW\2IĂ&#x20AC;FHU Pamela Smalls Tolbert, Library Assistant, Learning Resources Center Ashley Vaughn, Residence Hall Assistant (Part-Time) Demetrius L. Vaughn, Residence Hall Director Betty B. Washington, Title III Program and Institutional Research Assistant Eunice Clea-Webb, Secretary, Division of Social Sciences Angelia Wheeler, Residence Hall Assistant (Part-Time) Gwendolyn Wiggins, Secretary-Property Control Clerk (Half-Time), Army ROTC Bernard Williams, &DPSXV6DIHW\2IĂ&#x20AC;FHU Lucille W. Williams, Coordinator of Campus Safety Services Sandra L. Williams, Senior Secretary, Division of Education Ada M. Wilson, Maintenance Employee Darryl Witherspoon, Residence Hall Assistant Loleta Woods, 6HFUHWDU\2IĂ&#x20AC;FHRIWKH3UHVLGHQW

215


MORRIS COLLEGE CATALOG OFFICE OF ADMISSIONS AND RECORDS COMPARATIVE ENROLLMENT REPORT 2016 - 2017 ACADEMIC TERMS First Semester

Second Semester

SENIORS

MEN 55

WOMEN 95

TOTAL 150

MEN 75

WOMEN 113

TOTAL 188

JUNIORS

61

75

136

48

70

118

SOPHOMORES

69

105

174

66

103

169

127

177

304

95

134

229

SPECIAL

3

1

4

3

0

3

TRANSIENT

0

0

0

0

0

0

FRESHMEN

TOTALS: 315 453 768 287 420 ******************************************************************************** 2016 SUMMER SCHOOL SESSIONS

707

MEN WOMEN TOTAL Summer Session ------------------------------------------------------------------------65 101 166 ******************************************************************************** MEN WOMEN TOTAL First-time Freshmen (first semester) 91 136 227 Transfers (first semester) 20 23 43 Special Student (first semester) 2 1 3 First-time Freshmen (second semester) 10 12 22 Transfers (second semester) 6 12 18 Returning students (second semester) 13 12 25 Special Student (second semester) 3 0 3 Transient (second semester) 0 0 0 Total College-Credit Enrollment (head count) ----

867

ENROLLMENT OF PART-TIME STUDENTS ACADEMIC TERMS 2016-2017 First Semester

Second Semester

SENIORS

MEN 4

WOMEN 7

TOTAL 11

MEN 7

WOMEN 12

TOTAL 19

JUNIORS

0

1

1

1

2

3

SOPHOMORES

2

2

4

0

0

0

FRESHMEN

0

1

1

2

0

2

SPECIAL

3

0

3

3

0

3

9

11

20

13

14

27

TOTALS:

216


217



 

 

                   

     

 

      

                        

             

 



 #

  #  " #               

"

!$

           "  !

  !   

 

"

    $ "        

!    " 

!!

$

     $ !      !        !



 





#

    

  "  $  !      # ! 

#

       

     

  $  



 #

!!

  $    !     !  

 $  # 

$

  "  !        #        



   





                    



                    



%&#

"$

$  $ # # "  "  !#  !! !     $ #       $        

  "   



  

!

    "                

    

        " !#" !$



!!

           # "      "  



#$

  #       $  !         !



 



"

 

   

    $  !      $

"

       

  #         



 



#

"#

"     " 

!           

"

 "

#    #        $     

   



                    





                    



 

%"#

"

""   #    "  "  ! "     $  




218

0

0

NORTH CAROLINA

OHIO

PENNSYLVANIA

TOTALS:

ENROLLMENT TOTAL:

327

169

2

WISCONSIN

158

0

0

0

1

0

VIRGINA

VIRGIN ISLANDS

0

2

TEXAS

0

0

143

1

2

5

0

2

0

0

0

1

2

0

0

1

0

0

1

0

0

F

TENNESSEE

136

8

NEW YORK

SOUTH CAROLINA

0

0

NEW JERSEY

0

0

0

MISSISSIPPI

NEVADA

4

MISSOURI

3

MICHIGAN

11

GEORGIA

MARYLAND

1

FLORIDA

1

0

DIST. OF COLUMBIA

0

0

CONNECTICUT

LOUISIANA

0

CALIFORNIA

ILLINOIS

0

M

FRESHMEN

ALABAMA

STATES

74

0

0

1

0

0

56

0

0

1

0

0

0

0

0

0

0

0

0

9

6

1

0

0

0

M

166

92

0

0

0

0

0

76

0

0

3

0

2

1

0

0

0

4

1

0

4

0

1

0

0

0

F

SOPHOMORES

58

0

0

3

0

0

43

0

0

2

1

2

0

0

0

0

0

0

0

4

0

1

0

2

0

M

142

84

0

0

0

0

0

72

0

0

2

0

0

0

0

1

0

0

1

0

7

0

0

0

1

0

F

JUNIORS

FIRST SEMESTER

158

66

0

0

0

0

0

54

3

0

0

1

2

0

0

0

0

0

0

0

5

0

0

0

0

1

M

1

0

0

0

0

F

92

0

0

1

0

0

71

1

0

2

1

4

0

0

0

0

0

0

0

11

SENIORS

2

0

0

0

0

0

2

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

M

2

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

F

795

795

2

0

6

2

0

653

5

2

23

3

12

1

0

1

5

9

2

1

52

8

3

1

3

1

SPECIAL TOTAL

251

126

0

0

1

0

107

0

0

5

0

0

0

0

0

4

0

0

0

8

1

0

0

0

0

M

125

0

0

0

0

109

0

3

6

0

2

0

0

0

1

2

0

0

1

0

1

0

0

0

F

FRESHMEN

ENROLLMENT BY STATES ACADEMIC TERMS 2015-2016

66

0

1

0

0

46

0

0

4

0

0

0

0

0

0

1

0

1

8

4

1

0

0

0

M

155

89

0

0

0

0

76

0

0

3

0

2

0

0

0

0

4

1

0

1

0

0

1

0

1

F

SOPHOMORES

0

4

0

57

0

41

0

0

2

2

132

0

0

0

0

0

0

0

0

4

2

1

0

1

0

M

75

0

0

0

0

66

0

0

0

0

0

0

0

1

0

0

1

0

7

0

0

0

0

0

F

JUNIORS

SECOND SEMESTER

78

0

1

0

0

62

2

0

0

1

3

0

0

0

0

0

0

0

6

1

0

0

1

1

M

185

107

0

1

0

0

82

1

0

4

1

3

0

0

0

0

0

0

0

14

0

0

0

1

0

F

SENIORS

2

0

0

0

0

2

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

M

2

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

0

F

SPECIAL

725

725

0

7

1

0

591

3

3

24

4

10

0

0

1

5

7

2

1

49

8

3

1

3

2

TOTAL

MORRIS COLLEGE CATALOG


          

      !  

  



   

     

                

   

            

    

 







                        

  

             

  ! "

                !   !           !

  





  #    " " !     !        # !   "   "   

219


INDEX Criminal Justice Courses ................161, 164-165 Major.............................123-125 Cultural Enrichment .......................46 Dean’s List .....................................59 Degrees Offered ............................50 Determination of Degree Requirements ............................59 Developmental Studies.........167-168 Dropping Courses ..........................56

Academic Calendar .........................7 Academic Clubs........................30-31 Academic Classification .................58 Academic Honors ..........................59 Academic Honesty....................61-62 Academic Grievance Procedure ....62 Academic Probation, Suspension and Dismissal ............................57 Academic Regulations ...................53 Accreditation ....................................5 Administrative Officers.................20 Administrative Staff...............206-208 Admissions Categories .............................16 Procedures ............................19 Requirements ...................16-20 Army Reserve (ROTC) Programs......................96 Affiliations ......................................13 Art ................................................156 Athletic Organizations ....................34 Auditing Courses ...........................59 Biology Courses ........................156-158 Major.............................101-106 Block “M” Club ...............................32 Board of Trustees ............................2 Buildings ...................................14-15 Business Administration Courses ........................158-161 Major.................................71-75 Career Services Center .................63 Change of Major ............................58 Chemistry Courses ......................162 Christian Education (Religion) Courses ........................198-200 Major.............................120-122 Civic Organizations ........................33 Class Attendance...........................55 Classroom Disruption ....................61 Computer Information Systems.............162-163, 166-167 Cocurricular Activities ....................30 Contact Information .........................5 Cooperative Education......................97-99, 165 Counseling Services ......................46 Course Descriptions .............157-205 Credit by Examination....................58 Credit Hour Load ...........................53

Academic Divisions and Programs Division of Business Administration ........................71 Division of Education .................79 Division of General Studies ........66 Division of Natural Sciences and Mathematics .................100 Division of Religion, Humanities and Social Sciences ............119 Early Childhood Education Courses ........................168-174 Major .....................80-82, 88-91 Economics ...................................168 Elementary Education Courses ........................168-174 Major .....................80-82, 90-91 English Courses ........................174-177 Major.............................126-132 Enrollment Statistics .............216-219 Examinations Final .......................................58 Faculty..................................208-21 Financial Information Fee Schedule ...................21-22 Financial Aid .....................23-29 Refund Policy.........................23 Foreign Language..........................68 French..........................................177 Freshman Orientation Program .....63 Freshman Seminar ......................177 General Education ....................50-53 General Science Courses ............178 Geography ............................177-178 Grades and Financial Eligibility..24-28 Grade Point Average .....................55 Grading System ........................54-55 Graduation Honors ...................................60 Requirements ...................60-61

220


INDEX Political Science Courses ........................194-195 Major.............................146-148 Pre-Engineering....................115-118 Pre-Nursing ..........................107-108 Presidents of the College...............12 Presidentâ&#x20AC;&#x2122;s List ..............................59 Prizes and Awards....................34-39 Probation, Suspension, Dismissal ...................................57 Psychology ...........................195-196 Publication Groups ........................34 Recreation Administration Courses ........................196-198 Major...........................86-87, 94 Recreational and Development Organizations.........................33 Registration....................................53 Religion.................................198-200 Religious Life .................................45 Religious Organizations .................33 Repeated Courses .........................54 Residence Halls .............................46 Scholarships .............................39-45 Service Fraternity...........................32 Service Learning Program .............63 Social Sciences ....................203-204 Social Studies/Secondary Education Courses ........................204-205 Major.............................149-151 Sociology Courses ........................200-202 Major.............................152-154 Spanish ........................................202 Speech and Theatre ....................203 Staff.....................................21-21 Student Conduct ............................47 Student Affairs and Services ....30-47 Student Government Association ..30 Student Support Services ..............63 Summer School .............................63 Teacher Education Program.....................79-85, 88-91 Textbook Policy .............................61 Transcripts .....................................59 Transfer Students ..........................17 Transient Enrollment......................56 Upward Bound ...............................64 Vehicle Registration .......................47 Veterans Affairs .............................48 Withdrawal from College................56

Greek Letter Organizations............33 Health Policy Statement ................47 Health Science Courses ........................181-182 Major .....................85-86, 92-93 History Courses ........................178-180 Major.............................133-135 History of College .....................11-12 Honors Program ............................68 Courses ...............................180 Honor Societies .............................32 Humanities............................182-183 Information Technology Resources ..64 Intercollegiate Teams ....................34 Junior Seminar.............................183 Learning Resources Center ...........64 Liberal Studies Major.............................136-138 Location of the College ..................14 Major, Change of ...........................58 Major, Declaration of......................58 Mass Communications (Media Arts) Courses ....................... 185-187 Major.............................139-142 Mathematics Courses ....................... 183-185 Major.............................109-114 Media Arts ............................186-187 Military Science ................96-97, 188 Mission Statement .........................13 Morris College Scholars.................60 Music ...........................................189 Music Groups.................................33 NEONS ..........................................33 Nondiscrimination Policy................14 Organization of Academic Programs ...................................50 Organizational Management Courses ........................190-192 Major.................................76-78 O. R. Reuben Scholars ..................60 Pastoral Ministry (Religion) Courses ........................197-199 Major.............................143-145 Philosophy ...................................192 Physical Sciences ........................193 Physics .................................193-194 Placement Testing and Developmental Studies ..............67

221


%( 80

222


%( 80

223


%( 80

224


131724_Covers_Quark_2016.qxp_Cover 6/21/17 11:45 AM Page 1

Morris College

MORRIS COLLEGE

2017-2018 CATALOG

2017-2018 CATALOG

2017 2018 morris academic catalog  
Read more
Read more
Similar to
Popular now
Just for you