Page 1

The University of Texas at El Paso · September 21, 2010

ʻROCK THE NATIONʼ

Professor’s cultural studies of music shape career ENT • 7

the

prospector assayer of student opinion

MEMPHIS COMES TO TOWN Miners look to make it two in a row

www.utepprospector.com

SPORTS • 15

Career Fair

Fighting for a job BY BEATRIZ A. CASTAÑEDA Ñ The Prospector Times have been tough for some UTEP students, including one who graduated last year and has been unable to find a job. “The fact that it took me a while to graduate is a big disadvantage now because everything I did is somewhat outdated now,” said Andrew Bonney, UTEP alumni with a degree in electronic media. Bonney works at a local bar-restaurant in the El Paso area and has been looking for a job since his graduation. Bonney said it has been discouraging, because he was not able to get the experience in college that would have ultimately prepared him for the real workplace. “My advice for students is to get as much experience as they possibly can,” Bonney said. “I waited a while to graduate and for me, it might be time to go back to school for a master’s degree and hopefully get a job that I want to do.” According to the U.S. Bureau of Labor Statistics, the current national unemployment rate is 9.6 percent compared to 9.7 percent in 2009. The unemployment rate for Texas rose to 8.2 percent compared to only eight percent last year. George Barton, director of the University Career Center, said the fields that employers are hiring for are mostly the same as last year. “We’re beginning to see some progress, things are still tough but some employers are beginning to open up their doors and hire,” Barton said. According to Barton, health professions, accounting, engineering, math and finance jobs are still in demand, but teaching and education professions have been a tough market to get into in the El Paso area. “Students are beginning to realize that they have to hustle and use resources such as the career center to look for jobs,” Barton said. “People need to take advantage of everything that is offered here, we have more help than we’ve ever had for students.” According to the National Association of Colleges and Employers, a 2010 student survey showed that the more frequently a senior used career services, the more likely he/she would receive a job offer. The study also said graduating college seniors who used their campus career center were more likely to get a job offer. Of the seniors taking part in the study, 71 percent of students who used the career center received job offers. Fewer than 29 percent of

Be there!

Career Expo 2

010

s Center Don Haskin p.m. Sept. 23, 9-4 p.m. Sept. 24, 9-1

see JOB on page 4

Students get prepared for job fair BY NICOLE CHÁVEZ The Prospector Dozens of students have made their way to the University Career Center to ask for help in preparing their résumé as the 2010 Career Expo looms ahead. “Students are getting prepared, employers are coming and they are interested in UTEP talents,”

said Betsabe Castro-Duarte, associate director of the UCC. “But they are more selective.” Castro-Duarte said many students are afraid of not catching the attention of employers due to the current economic conditions. “Times are getting worse. When trying to get a job, you are competing against the existing work force, graduates and also unemployed workers,” said Thalia Aguirre, junior criminal justice major.

Some of the UCC recommendations for the career expo are to dress professionally, get your résumé revised and introduce yourself correctly to company representatives. This year, 105 companies will be at the fair compared to 99 from last year. Some of the companies that will have on-site interviews include Texas Instruments, Shell Oil Company and Dell. “Actually, a lot of companies wait until the Expo (to come) to UTEP,” Castro-Duarte said.

Companies such as Microsoft are having different events to attract students and recent graduates. Microsoft plans to have an information session, an interview prep session, workshops and interviews during and after the fair. “Employers, as students, are taking advantage of the fair, they are planning to do what they do in several visits in just one,” Castro-Duarte said.

see EXPO on page 6

You Deserve It! Add us on 70

schustereyecenter.com

1700 Curie, Suite 2400, El Paso, TX 79902 | 533UÎ{È£ Optional 0% financing on bilateral procedures with no previous eye surgery.


PAGE 2

WHAT DO

you think?

This week’s poll question:

THE PROSPECTOR September 21, 2010

PAGE3NEWS

Will you being going to the 2010 Career Expo?

perspectives September 21, 2010

editor-in-chief Aaron Martinez, 747-7477

vote at WWW.UTEPPROSPECTOR.COM

Editorial

High 88 Low 70

El Diario cries out

As the drug-related violence continues to ravage Ciudad JuĂĄrez, emotions are clearly overwhelming for the largest newspaper in the city. After another journalist was shot and killed last week, El Diario de JuĂĄrez ran a front-page editorial pleading with the warring drug cartels to tell the paper what they can do to keep their journalists safe. The editorial comes after gunmen shot down two El Diario photographers Sept. 16, leaving one dead and the other seriously wounded. In the editorial, El Diario not only asked the drug cartel what the paper could do to stop further death or threats to its staff, but also pointed out that the Mexican government has done nothing to protect freedom of the press. Since the editorial ran, it has stirred up major controversy over issues of freedom of speech and the dire situation journalists are in when working for a newspaper in the middle of a drug-war like the one in Mexico. Some critics have already come out and condemned El Diario for not only running the editorial on the front page, but for asking the cartels what they can do to prevent further violence against their journalist. As a student newspaper on the border, we understand how important this issue is and the ethical is-

sues raised by the editorial. We at The Prospector understand why they ran the editorial and sympathize with El Diario. Our reality as journalists in the United States and the reality of Mexican journalists are very different, simply because of the frequency of violence being inflicted by the cartels and the government’s failure to pursue those responsible. Journalists are at the frontline of this issue and they have received little protection from the government. Under Mexican President Felipe Calderón, 22 journalists have been killed and little has been done to investigate or hold responsible the perpetrators. In 2008, a journalist from El Diario was gunned down in his driveway, in front of his daughter. Since then, the Mexican government has not come any closer to punishing those responsible for the atrocious act. So one must understand that if journalists are not being protected, El Diario is obviously backed into a corner, with no help in sight. We see the editorial as a desperate shout for help and an expression of their frustration. However, if you censor the media and take away the voice of the press, then it is clear the drug-cartels are winning the war. El Diario has already been forced to censor some of the coverage of the drug war due to threats against

BY ALEJANDRA MATOS Special to The Prospector WASHINGTON–Hispanic-owned businesses are booming across the United States, specifically in the South. Arkansas had a 160 percent increase in Hispanic-owned business, growing from 2,094 businesses in 2002 to 5,457 in 2007, according to a study released Sept. 14 by the U.S. Census Bureau. “Our Hispanic community has grown significantly,� said Fayetteville Chamber of Commerce President Steve Clark. “That diversity is very good for us. We have a Spanish language radio station now, which is something we would not have had five years ago.� Other Southern states also have increases. In 2007, North Carolina had 21,277 Hispanic-owned businesses, a 135 percent increase from 2002, with 9,043 businesses. Nationally, Hispanic-owned businesses increased by 44 percent, compared to an 18 percent increase in all U.S businesses.

“The diversity is very smart for us. If we want to attract new jobs, you have to have a very culturally and diverse community to do that,� Clark said. North Carolina and Arkansas still have low numbers of Hispanic-owned businesses compared to some other states. California has the highest number of Hispanic-owned businesses, 566,000. Florida had the second-highest number of Hispanic-owned businesses, 450,000, followed by Texas, with 447,000. The boom in business can be attributed to the growth of the Hispanic community in these states. In 2008, 7 percent of North Carolina’s population was Hispanic, up from 4.7 percent in 2000, according to the Census. “We have found one of the biggest reasons people migrate here is education,� said Raul Herrera, vice president of the North Carolina Hispanic Chamber of Commerce. “There is an opportunity for a very good education, and it’s fairly easy to pay off. It’s an opportunity to educate their chil-

 *2(56 1 0,

Story idea: Description:

POLL RESULTS Will the athletic task force result in a referendum?

Drop this form and any additional material at The ProspectorĘźs ofďŹ ce located at Union Building East, Room 105. You can also pitch stories by calling 747-5161 or sending an e-mail to prospector@ utep.edu.

the

prospectorstaff Editor-in-Chief: Aaron Martinez Layout Editor: Sarah A. Burchett Online Editor: Sergio Ramirez Entertainment Editor: Justin Anthony Monarez Sports Editor: Sal Guerrero Multimedia Editor: Herman Rojas Photo Editor: Bob Corral Copy Editor: Vanessa M. Juarez Reporters: Alex Morales, Nicole Chavez, Sarah Garcia Correspondents: Avelyn Murillo, Matthew Munden, Omar Lozano, Anoushka Valodya, Beatriz A. CastaĂąeda Photographers: Luis Jasso, Diego Bedolla, Jesus Perez, Diana Amaro

)250(5-8'*( WK'LVWULFW&RXUW WK'LVWULFW&RXUW

0RQWDQD$YH (O3DVR7[

vol. 96, no. 6 Volunteer Correspondent: David Acosta Cartoonist: Blake Lanham Asst. Director-Advertising: Veronica Gonzalez Ad Representatives: Selene Macias, Alheli Tocoli, Karina Sandoval, Monica Ortiz, Claudia Martinez Student Ad Manager: Fernando Hernandez Senior Ad Designer: Yasmin Marquez Ad Layout Manager: Alejandra Guerrero Ad Designers: Ignacio Esparza Accounting Specialist: Isabel Castillo ClassiďŹ eds: Marcela R. Luna Student Publications Director: Kathleen Flores Editorial Advisor: Lourdes Cardenas Work-studies: Marisa Montilla, Catherine Jones

56% yes

 

  

High 86 Low 64

High 85 Low 63

High 84 Low 63

   

     

     

Hispanic-owned businesses on the rise, Census Bureau ďŹ nds

One year later...

44% no

High 87 Low 66

National

Pitch a story to The Prospector

Contact Information: Name: Phone number: E-mail:

High 87 Low 67

     

          

its journalists, and now that there has been another attack on their staff they are left with little options. El Diario has now lost two staff members in the last two years and their coverage of the biggest issue affecting the country and this border will once again be diminished.

Time frame:

High 86 Low 68

The Prospector wants you! The Prospector is looking for correspondents (sports, entertainment and news) for fall 2010. If interested, please apply at The ProspectorĘźs ofďŹ ce, Union Building East, Room 105 or visit www.utepprospector.com.

SPEAK YOUR MIND

Submit a letter to the editor! Letters will be edited for clarity and brevity. Letters over 250 words are subject to editing to ďŹ t available space. Please include full name, street address and telephone number and e-mail address, plus major, classiďŹ cation and/or title if applicable. Address and phone number will be used for veriďŹ cation only. Write to 105 E. Union, e-mail prospector@utep.edu, call 747-7477 or fax to 747-8031.

The Prospector (USPS 448-020) is published by the Student Publications Board, 105 E. Union, 500 W. University Ave., El Paso, TX 79968. During Fall & Spring semester The Prospector is published twice weekly: Tuesdays and Thursdays, except holidays and when classes are not in session, once a week on Wednesday during the summer session. Subscription rates: $20 per year, $4 taken from fees to pay for student copies. Periodicals postage paid at El Paso, TX. POSTMASTER: Send address changes to The Prospector, 105 E. Union, El Paso, Texas 79968-0622. The Prospector is not responsible for claims made by advertisers. Additional policy information can be obtained by calling The Prospector at 747-5161. Opinions expressed in The Prospector are not necessarily those of the university.

87(3/HFWXUHU &ULPLQDO &LYLO&DVHV

MRVHMXGJH#DROFRP WHO   ID[   FHOO  

dren and themselves that may not be available in another state.� Although Hispanic and other minority-owned businesses are surpassing the average growth rate, revenue produced by minority businesses is significantly lower than non-minority businesses.   In 2007, average gross receipts for minority-owned firms increased to $179,000 from $167,000 in 2002 but remained lower than non-minorityowned firms, which grossed an average of   $490,000, according to the report. “Minority firms are relatively recent to the game. Also there’s a factor of access to capital, which has been an area of frustration for minority-owned firms,� said David Hinson, director of the Minority Business Development Agency, part of the Department of Commerce. “Access to contracts has also been challenging.� Herrera sees these problems every day in North Carolina. His group helps to educate the community to overcome those problems.

Special to The Prospector

According to a study released by the U.S. Census Bureau minorityowned businesses still gross less than non-minority owned firms. “The norm in the Hispanic community is to do things very informally, and that doesn’t help business grow,� Herrera said. “We try to bridge that gap by educating people through workshops.� A recent workshop focused on marketing.

“Some of these business owners don’t realize what the benefits marketing could bring,� he said.  “They are not used to thinking about things like that. They are used to working, so we help them with that.�

see RISE on page 6


PAGE4NEWS JOB from page 1 students who did not use the career center received a job offer. Anne Trahan graduated in December 2009 with a finance degree and recently got hired at a local job for New York Life. “I started looking for a job two months ago and then applied through UTEP’s job portal and the employers called me back a couple of days later for a job interview,” Trahan said.

THE PROSPECTOR September 21, 2010 Trahan said the job does retirement accounts, college education planning, life insurance and basic financial services. “Not all hope is lost, I got hired and I had no experience in the field yet. The company said they are willing to teach me how to do the job,” Trahan said. Another NACE survey conducted, stated employers taking part in the Job Outlook 2011 Fall Preview survey anticipate hiring 13.5 percent more

new college graduates from the class of 2011 than they hired from the class of 2010. The survey also found that fewer than 48 percent of responding employers expect to increase their hiring; 40 percent expect to maintain their hiring levels, bringing on about the same number of 2011 grads as they did from the class of 2010. About 12 percent anticipate cutting college hiring further.

Barton said the job market is still tough and better job opportunities may be gained through graduate school. He said it is a big option for students to consider, especially when the job market is still bleak. “When I graduated, I took the jobs that were offered to me but then I decided to go back to graduate school because I knew it would take me further in the future,” said Luis Loweree, college of education instructional specialist graduate.

In fall 2009, UTEP’s graduate school had 3,570 students enrolled. This year, there are 3,781 students enrolled, a 24.5 total percent increase. “If students get the help that they need, attending workshops and heavily preparing themselves, they are much more likely to find opportunities to get jobs,” Barton said. Beatriz A. Castañeda may be reached at prospector@ utep.edu.

THE PROSPECTOR September 21, 2010

PAGE5NEWS

Campus

Centennialʼs Geology gallery made-over Museum gets fresh paint, new exhibits a little at a time BY VANESSA JUAREZ The Prospector

ESTAEBAN MARQUEZ / The Prospector

The Centennial Museum recently redesigned and added several new exhibits to the Geology Gallery.

The sturdy, stone building sitting quietly atop a perfectly trimmed, grassy hill appears to be serene enough for a natural history museum, but bustling activity on the inside of the Centennial Museum signals changes to its decades-old galleries. The Centennial Museum, which opened in 1937 and is El Paso’s oldest museum, recently redesigned and added several new exhibits to the Geology Gallery and plans are in place to update the three other permanent galleries. “The cases that we have in the Ethnology Gallery are probably about 50 years old,” said Museum Curator Scott Cutler, who has been at the museum since 1993. “They are dated and not very useful for exhibits, ideally we would like to get someone with experience as an exhibit designer to redesign some of those exhibits and update them.” In the Geology Gallery, colorful backdrops with informative text have replaced the stark, white backgrounds in cases that hold various rocks and minerals. “It (redesigning the gallery) happened accidentally, because we just wanted to reorganize the cases in the geology room,” said Marshall CarterTripp, director of the Centennial Museum. “We ended up hiring Victor Mirelles (UTEP graduate) to add some color to the back of the cases and he came up with the idea for the ceilings.”

Mirelles thought it would liven up the galleries to paint the ceiling of the Geology Gallery as a light blue sky, punctuated with wispy, white clouds. The popularity of the Geology Gallery’s paint job has led to plans for the

three other galleries to also be painted with an appropriate sky, and on Oct. 13, which is National Fossil Day, the Centennial plans to unveil the

> LUN CH SPECIALS: Monday - Friday from 12 to 2 > MON DAY S & TH URSDAY S from 3 to 6 All Rolls $6.50 (except special rolls) W W W.E AT SU SH IE X P R E SS.C OM 5700 N. MESA STE. F/ NEXT TO PLANET FITNESS P 581.3841/ 581.3513

see GALLERY on page 6


PAGE6NEWS RISE from page 3 Thirty percent of Hispanic-owned businesses are in construction, repair and maintenance. However, Cindy Ramos-Davidson, CEO of the El Paso (Texas) Hispanic Chamber of Commerce, said other sectors are growing. “Although many of our new, growing Hispanic business are in the service industry, we are noticing a trend of businesses opening their doors in the medical, transportation and de-

PAGE 7

THE PROSPECTOR September 21, 2010 fense arenas, among others,” RamosDavidson said. Clark said Arkansas also has a large number of Hispanic-owned businesses in the retail sector, and business in accounting and real estate are growing. “We expect to see this continue,” Clark said. “We are very excited about it because it is very positive for our community.” Alejandra Matos, junior multimedia journalism major, participated in Scripps Howard Foundationʼs Semester In Washington program this summer.

EXPO from page 1 According to Castro-Duarte, employers interested in engineering and computer science majors will make up the majority of companies at the fair, but companies such as HE-B, Vector Marketing, Peace Corps and The Boeing Company are not looking for specific majors. “I’m not sure about going, there is no real job at the fair for majors others than engineering and science,” said Hilda Campos, sophomore education major. At the fair, companies will be offering full time, part time, co-ops and internship positions. Students of all classifications and majors are encouraged to attend the fair. “No matter if students are freshmen or sophomore, they need to start looking (for) a way in,” CastroDuarte said. The UCC is offering a workshop titled “How to Navigate a Career Fair” from 11 a.m. to noon, Sept. 21 at the UCC Training Room. Registration is available through JobMine. For questions about the Career Expo, getting résumés or cover letters revised, contact the University Career Center at 747-5640. Nicole Chávez may be reached at prospector@utep. edu.

GALLERY from page 5 Paleontology Gallery’s new, stormy ceiling. “One day I was driving on Mesa Street and there is a place where you can see that wide expanse into New Mexico. A big storm was coming and it looked exactly like this ceiling,” Carter-Tripp said, as she pointed to the painted ceiling. “We got it.” Several UTEP art students have worked on painting the new ceilings, including Irene O’Leary and Lacey Mills, senior painting majors, and Marcela Varona, interdisciplinary studies graduate. The ceiling, painted with dark blue, purple and orange hues, tries to capture what scientists think the sky may have looked like when dinosaurs walked the earth. Varona, along with Mills, has been working on the Paleontology ceiling since mid-May and expects to be done by the end of September. “I think it (the ceiling) has improved the museum a lot because it makes the room more attractive and exciting to be in,” Varona said. “People who pass by the gallery are always peeking in, wanting to see what’s going on. So, people are excited.” Dinosaur footprints will lead museum visitors, over half of which are school-aged children, through the Geology Gallery and into the Paleontology Gallery. According to Carter-Tripp,

the ceiling in the Mammal and Bird Gallery may resemble what people see when they are in the Rio Bosque Wetlands Park. In addition to colorful ceilings, the Centennial Museum added an interactive kiosk that teaches visitors about earthquakes, tectonic movements and more. A new interactive exhibit that shows the ability of certain rocks and mineral to glow under various types of light has been a crowd favorite. In the Geology Gallery, a new case depicting the history of train transportation, the mining industry in El Paso and the importance of the railroad along with a video produced by the History Channel about how the earth was made are also new additions to the gallery. According to Cutler, the Centennial Museum is working to modernize its galleries on a shoe-string budget. “The renovations we’ve made so far have come from the existing budget… but we’ve done a lot of the work ourselves,” Cutler said. “And by doing that we’re saving a lot of money.” The Centennial Campaign for UTEP, which officially launched Sept. 14 at the fall convocation, has made the Centennial Museum a priority. According to the campaign’s website, “modernizing its permanent galleries would bring it up to a standard that matches a national research university” and offers two ways that alumni and friends of the university can help to improve the permanent exhibits. One way is to reconfigure the Ethnology Gallery as a Habitat and Society Gallery, which has a price tag of $300,000, according to the website at campaignforutep.org. Carter-Tripp became the director of the Centennial about four years ago and under her administration, completely renovated the first-floor, temporary exhibit galleries starting in 2006. The galleries, now accented by deep, teal paint on the walls and hardwood floors, used to have walls covered with carpet and seemed stuck in the past. “I think Marshall (Carter-Tripp) has been instrumental in turning that museum around,” said associate professor of art Anne Giangiulio, who is also working with the Centennial as an exhibition designer. “It was like a time capsule, I mean some of the dioramas on that second floor are so old that the Native American hair has actually bleached blonde. She’s painted and livened up the space because it had a very dated 70s mentality to it.” Giangiulio has worked with the Centennial in the past as an exhibition designer for temporary exhibits like “UTEP at the Poles”, but is now working with Carter-Tripp on a brand new exhibition that will become part of the permanent collection in the Ethnology Gallery. “Marshall’s idea is to do these two native plant cases, one dealing with plants used for food, like ‘nature’s grocery store’, and the other with plants that have medicinal values or practical uses, like using hemp to make twine or yucca leaves to weave sandals,” Giangiulio said. In the Mammal and Bird Gallery, Carter-Tripp plans to use some of Cutler’s nature photos as backdrops for the black and grizzly bears, mountain lion, eagles and other desert animals. “Right now those animals are in cases that are just white,” Carter-Tripp said. “We have blow-ups (large photos) of the habitats for each animals that are being produced right now and then the installation will take place.” Cutler hopes that the renovations and new additions to The Centennial’s permanent galleries will be more useful for students and allow them to learn about the natural history of the region. “I think this has been long overdue, I’ve seen it just kind of stay static in a way… and I don’t think the exhibits have been as effective as they could be,” Cutler said. “So that’s what excites me, the opportunity to have some real first class, creative exhibits.” Vanessa Juarez may be reached at prospector@utep.edu.

entertainment September 21, 2010

editor Justin Anthony Monarez, 747-7442

Miners of the moment

Professorʼs route brings him back home BY JUSTIN ANTHONY MONAREZ The Prospector John Lennon sang the famous line, “Life is what happens to you while you’re busy making other plans,” and newly arrived communication professor Roberto Avant-Mier relates. “I never planned it,” Avant-Mier said. “I think some people have a master plan, good for them. Mine was accidental, so when I hear that line, that’s how I think my life went. You think you’re going to do this, and then, you know, this job opens up over here.” His interpretation of the line narrates the El Paso native’s career path, from leaving the Westside for the Marines to teaching in the collegiatelittered city of Boston. Recently, his career has led him back home. “I had dreams of like coming back to El Paso, maybe being a professor at UTEP,” Avant-Mier said. In his first semester at UTEP this fall, Avant-Mier is teaching Methods of Research in Communication and Communication and Popular Culture. Avant-Mier was born to a Mexican household in Smelter town, near ASARCO, during the remaining years of the settlement in the 1970s. His family was later displaced and had to move.

He spent most of his childhood in the Westside’s Town and Country subdivision, a working class neighborhood nestled between the wealthy foothills of the Franklin Mountain and the Upper Valley. “They assume that you’re a rich kid. My experience was not that,” AvantMier said. “I was born into the projects, so when people call me a rich kid from Coronado, I’m like ‘urgh’.” He attended Oran Roberts Elementary, Lincoln Middle School and Coronado High School. Avant-Mier was a self-admitted metal head in high school, and he was passionate about music at an early age. Avant-Mier said he did not reach his potential in school and he admits that he did not know what college was or that it was an option. “Never had anybody in my family gone to college. Never had anybody told me to go to college,” Avant-Mier said. “I didn’t know what college was. I was a dumb kid from a very modest, working-class neighborhood at best.” Many of his friends dropped out, got into trouble or had to get jobs, and they didn’t go to college, he said. After high school, he wanted to be successful so he enlisted in the Marines at 17 years old.

“I just figured the best thing I could do was get out of my neighborhood and get a job,” AvantMier said. “If I got a job and survived, that would be sort of successful.” As an enlistee, he noticed small differences between the officers and soldiers. The main difference was a degree. “The Marine Corps was both a good opportunity and it pushed him to go back to school,” UTEP communication professor Samuel Riccillo said. After serving five years, deployment and traveling around the world, he decided to return to school. He sped through college in three years. “I started to think that I wasn’t less than these guys (officers),” AvantMier said. “So my whole, big plan was to go to college and come back to the

LUIS JASSO / The Prospector

New professor Robert Avant-Mier, who arrived from Boston College, authored “Rock the Nation.”

see Rock on page 10

Grad student pushes contemporary art in EP BY OMAR LOZANO The Prospector Utilizing a multitude of creative mediums and unconventional methods, UTEP art education graduate student Brenda Perry creates the type of deeply conceptual artwork that is mostly lacking in the Sun City’s contemporary art scene. Perry’s art and installations have seen the walls of many exhibitions from New York City to Chicago, El Paso to London. The El Paso native is currently finishing her master of art education at UTEP after receiving her BFA from Columbia Art College in Chicago. Her current role as a creative producer, she said, happened serendipitously as a result of her early exposure to forms of art. “I didn’t really suddenly decide I (was) going to be an artist, I felt like it chose me,” Perry said. Starting off with a fascination of the camera lens and early experimentation with photography, Perry’s work has evolved to include a fuller spectrum of artistic mediums, such as painting, printmaking and sometimes even technological tools. “(The use of more mediums) helps dramatically because I don’t limit myself. I’m able to communicate on many

different levels whether it be video or painting,” Perry said. Her most recent exhibitions have demonstrated this creative mixture. The UTEP Glass Gallery recently housed works by Perry, including many vibrant back-lit glass and oil paint pieces and a separate exhibit that used blown-up images of intricate fingerprints to reflect on issues of identity. Perry has also experimented with screen printing on perishable items such as bread or tortillas to spell out powerful phrases or words. “It’s part of the installation, that they decay and crumble, just like us. We live our lives and then we die some day,” Perry said. Some of her other work has relied heavily on early photographic techniques, such as the piece entitled “Sleep Cycles.” “I do a lot of 19th century photography processes where you use natural sunlight to make a natural image,” Perry said. “With this series I thought it would be a good idea to take a nap on the actual light sensitive material and have it [record] my movements.” The series of images document positions and movements of her body to produce patterns of silhouettes tossing and turning, which Perry said is meant to represent the myriad number of cycles in human existence.

LUIS JASSO / The Prospector

The art of Brenda Perry, art education graduate, has been displayed on walls around the world, from New York City to Chicago, El Paso to London. Though most of the themes in Perry’s work have been based on self-introspection and observations of human universals, her most current projects have taken on other forms of artistic discourse. “Lately my work has taken a turn mostly toward socio-political issues such as human suffering, social injustice and environmental awareness,”

Perry said. “I just think that there is too much going on in the world right now to make art just about me.” Providing her own artistic perspective to the current violent state of Ciudad Juárez, Perry used obscure photographs of recent Cd. Juárez murders and placed them on small square steel sheets using another 19th century photographic technique called “tintyping.”

The process gives the images an ancient appearance, an effect which Perry uses as metaphorical representation for how quickly the images are forgotten in society and discarded in to the past. In addition to Perry’s role in producing art, she has taught art and photography at various schools and programs around the country.

see ART on page 11


PAGE8ENTERTAINMENT

THE PROSPECTOR September 21, 2010

Symphony

Two dayĘźs of classical to kick off ďŹ ve-month series BY SARAH GARCIA The Prospector It’s been said that classical music increases the intelligence of listeners. The El Paso Symphony Orchestra offers an opportunity to take a break from radio, rap and rock and let a trilogy of musical masters maximize your brainpower. The music of Ludwig Van Beethoven, Johannes Brahms and Wilhelm Richard Wagner will be brought to life during a two-day event at the Plaza Theatre, starting at 7:30 p.m. Sept. 24-25. The event will begin EPSO’s five-month music series extravaganza. “That’s something everybody can enjoy, especially Beethoven’s fifth,â€? said Francisco Ramos, a recent graduate of music education. “I think it’s awesome they are playing ‘Ride of The Valkries’ because people are only familiar with the beginning of it, and this will allow them to experience the whole thing.â€? EPSO Music Director Sarah Ioannides will lead the ensemble in Beethoven’s quintessential “Symphony No. 5,â€? Wagner’s “Ride of the

Special to The Prospector

Music Director Sarah Ioannides will conduct the El Paso Symphony Orchestra for her final season. Valkries,� and Brahms’ “Piano Concerto No. 2.� “Each work we perform has very different qualities. Beethoven’s Fifth is a powerful work. Wagner has a different power, but is equally strong and very direct,� Ioannides said. “For me,

O9JJ9FLK7LJ9>>A;LA;C=LK7 *HW<RXUZDUUDQWVFOHDUHG \RXUWLFNHWVGLVPLVVHG

&DOO 5XG\3HUH]

$WWRUQH\DW/DZ 0RQWDQDÂ&#x201D;(O3DVR7;

,QMXUHGLQDQ$XWR$FFLGHQW" ´*HWWKHPRQH\\RXGHVHUYH¾

7%Â?(!.$,%Â? !,,Â?#)49Â?0/,)#%

3(%2)&&Â?!.$Â?$03 4)#+%43 Â?$7)3Â?!.$ -)3$%-%!./2 /2Â?&%,/.9Â?!22%343

5HVXOWVREWDLQHGGHSHQGRQWKHIDFWVRIHDFKFDVH

Brahms is more intimate, but words cannot speak greater than the music itself. The message is in the listening.â&#x20AC;? Though this will be her sixth and final season, Ioannides continues to be passionate about her role in the EPSO and is dedicated to directing

the highest quality show for her performers and audience alike. â&#x20AC;&#x153;I feel my primary role is to inspire the musicians to one common interpretation which is faithful to the composer, yet remains alive and is clear to the listener,â&#x20AC;? Ioannides said.

Ioannides and EPSO will be accompanied by Ukrainian pianist Valentina Lisitsa, who critics hail as an â&#x20AC;&#x153;electrifying pianist,â&#x20AC;? and plays like an â&#x20AC;&#x153;angel.â&#x20AC;? Assistant Conductor Andres Moran will also lead a discussion about the eveningâ&#x20AC;&#x2122;s program at 6:30 p.m. prior to both performances in the Philanthropy Theatre. Ticket prices range from $13-$39. There is a 10 percent active military discount available. Discounted student tickets costs $8-$10. Tickets can be purchased by calling the El Paso Symphony office at 5323776, online at www.epso.org, or at any Ticketmaster outlet. The El Paso community, like education graduate Israel Gallegos, who is planning on attending the event, may nod their heads and tap their feet to these classical beats resuscitated from the past. This mosaic of music will most certainly quench the thirst of the musically dehydrated. â&#x20AC;&#x153;Music is life and like string theory, all music is frequency and thatâ&#x20AC;&#x2122;s what life is, a big wave of frequency matter,â&#x20AC;? Gallegos said. â&#x20AC;&#x153;In reality, we are all music manifested.â&#x20AC;? Sarah Garcia may be reached at the prospector@utep. edu.

Game review

â&#x20AC;&#x2DC;Halo: Reachâ&#x20AC;&#x2122; is a relic of a forgotten generation

BY MATTHEW MUNDEN The Prospector When the original â&#x20AC;&#x153;Haloâ&#x20AC;? was released on Microsoftâ&#x20AC;&#x2122;s Xbox, it nor-

malized first person shooters on consoles. However, time has passed and series like â&#x20AC;&#x153;Halo: Reachâ&#x20AC;? feel like relics. The aim is awkward and the controls get in the way when the game begins. It takes awhile to reformat your brain to stop thinking of the left trigger, used as the grenade button in the original, as the button to aim down the weapon, which is the norm for most modern shooters. The aim assist is extremely noticeable to the point that the guns seem to just lock on to enemies and reticules are oversized to assure that no matter what the enemies get hit. Reach feels like something that is nearly a decade old. It is not too odd to say that. The original is about ten years old and little has been done to change up the base mechanics of the game. The head-up display has changed a little since the original and Halo 2 & 3 added the ability to hold dual weapons, which was something removed from â&#x20AC;&#x153;Halo 3: ODSTâ&#x20AC;? and Reach. But the game play is largely the same thing. In a world where the â&#x20AC;&#x153;Call of Dutyâ&#x20AC;? and â&#x20AC;&#x153;Battlefieldâ&#x20AC;? series exist, Reach feels like it is lacking something special. The story in Reach is interesting but badly paced. It tells the tale of the fall of the planet Reach. The alien Covenant army launches a surprise attack and, over the next eight hours of game time, a team of Spartans, which are super soldiers, try to help the human army fight the aliens off. The game is interesting in that it lets the player know from the first minute that this is going to end badly for the Spartans. It gives a feeling of hopelessness to all of the events, but the story told in the actual game lacks any urgency. The cut scenes are well done and add drama, but the game play feels so slow and has no momentum to a point that it seems the invasion is of no threat.

As a prequel, Reach falls into the same problems that all prequels fall into. While it tries hard to connect everything to the original game, the introduction of a few enemies that were not in the original game felt a little baffling. This game also felt more trial and error than any Halo had in the past. Sometimes I would walk down a hallway and turn to find a kamikaze Grunt waiting to kill me. I would return to the checkpoint and try again knowing what lies ahead. The team A.I. has not improved much either. Whenever, I saw that the game wanted me to get into the gunner position as a team member drove, I would often get killed because they would flip the vehicle over or drive it off a cliff. As with all Halo games, multiplayer will probably be the deciding factor for many. It has far more options to customize armor and game types than any of the previous games. Yet, when I would click on the quick match button, I would often be placed into a slayer match. I would search in custom matches to try to find something else, but all I could find were the generic slayer matches. The Forge option also returned as well and it seems to have more functionality than before. I was able to build maps and set off Rube Goldberg style mechanisms without much trouble. Reach had the number one entertainment launch of the year. It totaled $200 million. I am sure most Halo fans will be satisfied with it. It is just what everyone expects it to be, yet that was just not enough for me. 3 out of 5

Matthew Munden may be reached at prosepector@ utep.edu.


PAGE10ENTERTAINMENT Rock from page 7 Marineâ&#x20AC;&#x2122;s as an officer and show them that I can give orders as well.â&#x20AC;? He graduated and, subsequently, registered in graduate courses while

dating his future wife, Olga. They married, and he received his masters, ultimately, derailing plans to return to the military. â&#x20AC;&#x153;I said â&#x20AC;&#x2DC;you already paid your dues and now itâ&#x20AC;&#x2122;s the time for yourself to

THE PROSPECTOR September 21, 2010 developâ&#x20AC;&#x2122;,â&#x20AC;? said Riccillo, who hired him as a teaching assistant and directed his mastersâ&#x20AC;&#x2122; thesis. Riccillo urged and helped him to apply for doctoral programs. AvantMier was accepted into several

BahĂĄâ&#x20AC;&#x2122;uâ&#x20AC;&#x2122;llĂĄh Collaborative Study for Social Transformation

Drawing extensively on quotations from the Writings of BahĂĄâ&#x20AC;&#x2122;uâ&#x20AC;&#x2122;llĂĄh such as

â&#x20AC;&#x153;The betterment of the world can be accomplished through pure and goodly deeds, through commendable and seemly conduct,â&#x20AC;? this collective learning features a series of workbooks designed to draw out human qualities promoting positive personal and social change. The ďŹ rst workbook is entitled â&#x20AC;&#x2DC;ReďŹ&#x201A;ections on the Life of the Spirit.â&#x20AC;&#x2122; Developed to create an understanding of the Sacred Writings, the workbook is part of a sequence of courses that are widely used around the world to advance constructive individual and community transformation. Using an interactive, question-and-answer format, the workbooks foster a participatory learning process in which the entire group develops a new capacity for individual and social action. The study circles are led by a â&#x20AC;&#x2DC;tutorâ&#x20AC;&#x2122; or â&#x20AC;&#x2DC;facilitator.â&#x20AC;&#x2122; The tutor simply serves as a guide to assist participants to come to their own understandings and to generate new knowledge about themselves and their communities. Learn more:

(800) 22-UNITE www.elpasobahais.org

schools but chose the University of Utah. â&#x20AC;&#x153;I wanted to study music, so to me, my degree wasnâ&#x20AC;&#x2122;t worth anything if I couldnâ&#x20AC;&#x2122;t study music,â&#x20AC;? Avant-Mier said. â&#x20AC;&#x153;So when I got the chance to go to Utah and they had a program in communication and cultural studies, I knew that I could do music.â&#x20AC;? His research focuses on identity and nationalism through an intercultural lens. He particularly deals with issues in Latino popular music, such as Rock en EspaĂąol and Chicano music. He has published articles on race, ethnicity and whiteness. Avant-Mier recently published his book, â&#x20AC;&#x153;Rock The Nation.â&#x20AC;? The book examines Latino and Chicano identity in popular rock music today. On the side of his academics, he maintained a steady practice of the art. During the 1990s, he played in a band called Liquid Lunch. He also fronted a Black Sabbath-tribute band called Irony Man. â&#x20AC;&#x153;For the record, we were pretty damn good. We played every Black Sabbath song note-for-note,â&#x20AC;? AvantMier said. After receiving his Ph.D, he applied for an assistant professor of communication position at Boston College. He was hired in 2004 and stayed there for six years. â&#x20AC;&#x153;We didnâ&#x20AC;&#x2122;t know anybody, so we moved there on our ownâ&#x20AC;Ś We moved to Boston sort of on a whim,â&#x20AC;? Avant-Mier said. â&#x20AC;&#x153;We took a chance.â&#x20AC;? Avant-Mier said his field of study met the job description. â&#x20AC;&#x153;They needed me for what they wanted. The job they were offering was what I did, so I got kind of lucky that I fit their job description,â&#x20AC;? Avant-Mier said. Avant-Mier nearly turned in his tenure application before he heard about the position at UTEP. He gave UTEP another chance.

Maldonado in La Union, NM

â&#x20AC;&#x153;After six years of Boston, I thought it wasnâ&#x20AC;&#x2122;t going to happen. I gave up hope,â&#x20AC;? Avant-Mier said. â&#x20AC;&#x153;The day the applications were due, like on Dec. 2, I sent in my application. Why not take the chance?â&#x20AC;? The position at UTEP allowed his family to reunite with family and friends, live cheaper and avoid big city issues, such as public education. â&#x20AC;&#x153;Its good to hear a Chicano professor wants to facilitate learning for Hispanic students,â&#x20AC;? said Abril Perez, junior multimedia major. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m glad he wants to shine some light on our education and our Hispanic people.â&#x20AC;? Justin Anthony Monarez may be reached at prospector@ utep.edu. Sarah Garcia contributed to this story.

Special to the Prospector

Professor Robert Avant-Mier reads the first chapter from his book, â&#x20AC;&#x153;Rock the Nation,â&#x20AC;? at Barnes and Noble.

PETNN

PAGE11ENTERTAINMENT

THE PROSPECTOR September 21, 2010

Open mic

Monthly series promotes spoken creativity BY OMAR LOZANO The Prospector This monthâ&#x20AC;&#x2122;s installment of the Barbed Wire Open Mic Series will continue to offer El Paso a diverse look at its unique body of creative citizens, free of charge. A former brainchild of UTEPâ&#x20AC;&#x2122;s Creative Writing department and the Bilingual Creative Writing MFA program, the series has since shifted from university studentâ&#x20AC;&#x2122;s control, to operating under funding from El Pasoâ&#x20AC;&#x2122;s Museum and Cultural Affairs Department (MCAD) via Border Senses, a non-profit literary organization. â&#x20AC;&#x153;When it started a few years ago, it was limited to the UTEP crowd and writing students, over time the program has become much more community oriented,â&#x20AC;? said Amit Ghosh, co-founding director of Border Senses and lecturer for the computer science program at UTEP. â&#x20AC;&#x153;Border Senses is strictly a community organization, [this] allows for folks to come in and not feel that they cannot participate [in the open mic] if they are not part of UTEP.â&#x20AC;? Though the seriesâ&#x20AC;&#x2122; focus in the past was primarily centered on featuring professional literary talent and helping the community understand and vent itself in various literary ways, it has since then evolved into including an eclectic range of musical talents. â&#x20AC;&#x153;We have had full bands come in, we have musicians, artists and dancers even, so itâ&#x20AC;&#x2122;s really open to any type of artistic expression,â&#x20AC;? said Rob-

ert Santos, UTEP alumni, host and organizer of the Barbed Wire Open Mic Series. This monthâ&#x20AC;&#x2122;s installment plans to emphasize the diverse blend of these creative mediums by bringing together some of El Pasoâ&#x20AC;&#x2122;s underground talent. The series will feature Luna de Fuego, which is an experimental flamenco group with afro-latin influences, underground local hip-hop heads, Secret Levels and guest DJ, Ed Chalacy. In addition to the musical acts, the event will feature about 20 to 25 open mic participants sprinkled throughout the night. â&#x20AC;&#x153;Hosting an open mic [is] a gamble, you never know whoâ&#x20AC;&#x2122;s gonna show up,â&#x20AC;? Santos said. â&#x20AC;&#x153;What I really love about it is that the event is made up by the community, whoever comes in from off the street and signs up, thatâ&#x20AC;&#x2122;s who the show is about.â&#x20AC;? Santos said that the event has seen everything from last minute artists coming in and wooing the crowd, to even having Wu-Tang Clan veteran affiliate, Killah Priest, coming though the doors to rock the mic. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s like a hub for the arts,â&#x20AC;? Santos said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s [also] a great networking opportunity. We have had a lot of people come through, you see them perform alone at a show and at the next show they are teamed up with someone else that they met there.â&#x20AC;? Regular spoken-word performer Alfredo Gutierrez said artist, musician and poet participation is important for the community.



140#<'

Open From M-F 9am-1:45pm w/appointment For more info call (915) 203-0515 from 5pm-10pm to general public Saturday 10am-10pm Sunday 12pm-6pm www.cornmaze.com

UHIXVHWKHRUGLQDU\

LUIS JASSO / The Prospector

Brenda Perryâ&#x20AC;&#x2122;s Solo Master Thesis Exhibition will be on display at the Glass Gallery from Oct. 7-25. ART from page 7

$VLPSOHFOLFNFODFNDQGWKLVFRPIRUWDEOHVRIDEHFRPHVD FRPIRUWDEOHEHGIRUWZR5HGEHLJHRUEODFNLPLWDWLRQOHDWKHU

10HVD(O3DVRÂ&#x2021;

This past summer Perry was involved in the UTEP and Rubin Center sponsored, Summer Programs for Youth and Families, which invited children and community members to participate in art education and artwork creation. â&#x20AC;&#x153;Brenda was really good with working with young children and sharing her love of art with the children and their families,â&#x20AC;? said Kerry Doyle, assistant director of the Rubin Center. Perry said it is a good thing to break the stigma of the artist serving no purpose in society, by participating in programs with community benefit. â&#x20AC;&#x153;My artwork affecting the community in a positive way and bringing up awareness of social issues makes me feel like a useful member of society,â&#x20AC;? Perry said. â&#x20AC;&#x153;It makes me feel like [Iâ&#x20AC;&#x2122;m] validating my existence.â&#x20AC;? This fall Perry plans to finish her graduate studies at UTEP with her Solo Masterâ&#x20AC;&#x2122;s Thesis Exhibition entitled, â&#x20AC;&#x153;Homage.â&#x20AC;? It will showcase Perryâ&#x20AC;&#x2122;s photography of trees photographed in

a lumber yard before they where cut. Using 19th century photographic techniques, the images of the trees will be placed on the exact pieces of commercial wood they produced. Contrary to what would be imagined as an environmental protest, Perry said, the images are meant to pay tribute to the living trees by use of their respective materials as an art form. After her time at UTEP, Perry plans to continue her studies and pursue a second masterâ&#x20AC;&#x2122;s degree in art programs in New York and Boston. â&#x20AC;&#x153;I see myself involved in academia long term, whether as a professor or an educator of sorts,â&#x20AC;? Perry said. â&#x20AC;&#x153;My future plans as an artist are to continue making work, either here in El Paso or wherever I may go.â&#x20AC;? Perryâ&#x20AC;&#x2122;s Solo Master Thesis Exhibition will be on display from Oct. 7 â&#x20AC;&#x201C; 25 at the Glass Gallery, located on the third floor of the Fox Fine Arts Building. Omar Lozano may be reached at prospector@utep.edu.

Special to The Prospector

Writers, musicians and other artists around the community participate in the monthly Barbed Wire Open Mic Series, which takes place at the Percolator. â&#x20AC;&#x153;The greatest faculty that a human being has is to be creative. When people exercise their creativity they are moving with the hand of the universe,â&#x20AC;? Gutierrez said. â&#x20AC;&#x153;Just the fact that they are out there as artists, poets and musicians performing and doing something beautiful and creative helps with the general ambience of the community.â&#x20AC;? This installment of the Barbed Wire Open Mic Series will take place at 7 p.m. Sept. 25 at the Percolator, located on 217 N. Stanton St. It is a free event and, for early birds, free coffee will be served at 6 p.m. For more information, visit www. barbedwire.bordersenses.com. Omar Lozano may be reached at prospector@utep.edu.


PAGE 13

WHAT WAS THE SCORE? SOCCER: UTEP 12, ALABAMA A&M 1

sports

VIDEO Visit The Prospectorâ&#x20AC;&#x2122;s online multimedia section to watch Mondayâ&#x20AC;&#x2122;s Mike Price press conference

September 21, 2010

editor Sal Guerrero, 747-7445

Column

Not done yet BY ALEX MORALES The Prospector

!"#



VIRGINIA

CAMPBELL

 

   TEXAS

720 TEXAS AVE. 532.5322

The Miners open up conference play against UAB at 7 p.m. Sept. 24 at University Field. Days later at 1 p.m. Sept 26 UTEP plays host to Memphis. Sal Guerrero may be reached at prospector@utep.edu.

Alex Morales may be reached at prospector@utep.edu.

Miners stomp Aggies 42-10 BOB CORRAL / The Prospector

Senior quarterback Trevor Vittatoe completed 19-30 passes for 246 yards and five touchdowns helping orchestrate a win against rival NMSU Sept 18 at the Sun Bowl. BY ALEX MORALES The Prospector For the fourth time in his career, senior quarterback Trevor Vittatoe threw for five touchdowns in a single game as he led the Miners past New Mexico State 42-10 Sept. 18 at the Sun Bowl. UTEP (2-1, 0-1 Conference USA) had a field day through the air as they retained the Silver Spade and  Brass Spittoon against a winless NMSU team. â&#x20AC;&#x153;We put two and two together finally tonight,â&#x20AC;? Vittatoe said. â&#x20AC;&#x153;We played

all sides of the ball, offense and defense especially. We really stepped up and came together as a team.â&#x20AC;? Besides his five touchdowns through the air, Vittatoe completed 19 of 30 passes for 246 yards. He also  showed his running ability for the first time this season as he rushed the ball three times for 54 yards. Senior receiver Kris Adams almost had another 100-yard game but came up short, finishing the day with three catches for 86 yards and two touchdowns. He did, however, have the longest play from  scrimmage when Vittatoe hit him in stride for a 68-

yard bomb in the third quarter to put UTEP up 35-10.  â&#x20AC;&#x153;That kind of helped my confidence again, because last year was kind of a bad year for me,â&#x20AC;? Adams said. â&#x20AC;&#x153;I just got back into a groove and I think we are ready to go.â&#x20AC;?  The Miner defense allowed NMSU to score their only points in the second quarter, giving up a  touchdown and a field goal. They gained 153 yards in the second quarter alone and gained only 143 yards the rest of the game. UTEP was able to apply constant pressure on NMSUâ&#x20AC;&#x2122;s quarterback

Matt Christian all night. They forced the only interception of the game when Royzell Smith stepped in front of a Christian pass in the fourth quarter and returned it 13 yards to the Miner 48. â&#x20AC;&#x153;Anytime you can hold an offense like that to 10 points, you have had a successful night,â&#x20AC;? Smith said. â&#x20AC;&#x153;To play fast and physical like we did, I was really happy about that.â&#x20AC;? El Paso native and NMSU transfer Julio Lopez had his first catch of the year, which resulted in a touchdown.

see STOMP on page 14

Soccer

&$//)25025( ,1)250$7,21

DOWNTOWN

The Miners have played three games this year, with two of those games played against pretenders and one against a contender. To say the least, there havenâ&#x20AC;&#x2122;t been any surprises this season, so far. UTEP is 2-1 this year and a lot of us knew that is where they would be sitting after three games. Now, a 3-0 Miners record would certainly be a surprise. If the Miners were sitting 3-0 no one would be complaining and the Sun Bowl would draw a lot more fans than just 39,000 for a rivalry game. Come on El Paso! But we are not undefeated, so we have to move on. Trevor Vittatoe has played well to start off the season, completing 66 of 111 passes for 815 yards with eight touchdowns and only one interception. Kris Adams has bounced back from a disappointing 2009 campaign with 12 grabs for 248 yards and three touchdowns. His streaky play has helped the Minersâ&#x20AC;&#x2122; receiver core, which lost its biggest playmaker in Jeff Moturi. UTEP has not established a running game after their contest against Arkansas-Pine Bluff, which they were expected to dominate.  Yes, they did have 254 yards rushing against NMSU, but not a single back had 100 yards rushing in the game or let alone all season. Plus, we were playing the Aggies, who arenâ&#x20AC;&#x2122;t exactly a top defense. Our defense struggled against Houston, but has dominated the two other games, which were at home. On the road, the Miners allowed the Cougars to rack up 54 points on a total of 658 yards on offense. UTEP gave up 308 yards on the ground and 348 yards through the air.   Plus, senior Braxton Amy, the biggest playmaker on defense, was lost for the year. Simply, the defense has to find a way to fill the void that has been left by his injury. UTEPâ&#x20AC;&#x2122;s real season starts on Sept. 25 against Memphis at the Sun Bowl. The Miners have never beaten the Tigers, even when they were terrible.  Memphis is not going to be an easy game. They are under a new head coach (Larry Porter) and Eric Price, who was the former offensive coordinator for UTEP, is also new to the coaching staff.

Monday 8 a.m. -2 p.m. (for new donors only) Tuesday - Friday 7 a.m. - 7 p.m. Saturday 7 a.m. - 4 p.m

Double-digit win catapults conďŹ dence BY SAL GUERRERO The Prospector Frankly speaking, soccer is a sport that is not known for high-scoring affairs. But the Miners threw that notion out the door with their 12-1 shellacking of Alabama A&M Sept. 19 at University Field. UTEP (7-1) completely dominated the contest against a winless Lady Bulldogs team who, in the game against the Miners, scored their second goal of the season. â&#x20AC;&#x153;We came out of the game healthy. Hopefully we gave some people some confidence, we reversed some roles today,â&#x20AC;? head coach Kevin Cross said. â&#x20AC;&#x153;Players that play less minutes got to play a lot of minutes. That will give them more confidence going into conference play.â&#x20AC;? Six different Miners scored against Alabama A&M. Freshman Jade Babcock led the way with the hat trick scoring her first goal at the 32nd minute and the other two in the second half. â&#x20AC;&#x153;All my goals are a team effort. We work hard in practice and it comes out in the game,â&#x20AC;? Babcock said. â&#x20AC;&#x153;(The hat trick) felt pretty good but if it wasnâ&#x20AC;&#x2122;t for my team, I wouldnâ&#x20AC;&#x2122;t have scored.â&#x20AC;? Along with Babcock, four of her teammates scored twice in the contest. Brittany Kindzierski, Katie Dor-

man, Tori Martyn and Gina Soto all had two goals apiece. â&#x20AC;&#x153;I feel pretty good. I havenâ&#x20AC;&#x2122;t scored in a while so it feels really nice. It was pretty sweet,â&#x20AC;? Soto said. â&#x20AC;&#x153;I know we are good and weâ&#x20AC;&#x2122;re a strong team and next weekend we are going to play tough.â&#x20AC;? Soto said their performance this weekend proved they are ready to open up conference play. The Miners capped off their weekend home-series in good fashion. On Sept. 17 UTEP faced Lamar University and dismantled the Cardinals 6-1. Sophomore Tess Hall recorded a hat trick scoring three times against Lamar. Dorman registered two goals of her own and Kinzierski scored one on the night. Cross said the contest against Lamar was one of the toughest games his team has ever played. The Cardinals registered four yellow cards and one red card while committing 10 fouls throughout the match. While UTEP recorded two wins during the weekend series, they were not without a loss. Senior Anoop Josan injured her ankle against Lamar and was seen walking around in a brace. Junior Brittany Thornton tore a tendon in her knee last week but is said to be probable for the conference opener. â&#x20AC;&#x153;Hopefully the soccer gods will be good to us. Thornton tore her menis-

File Photo

Junior midfielder Jessie Pettit helped lead the Miners to victories over Lamar and Alabama A&M. cusâ&#x20AC;Śit was a little disappointing because she was playing her best soccer,â&#x20AC;? Cross said. â&#x20AC;&#x153;Anoop Josan got kicked on Friday. She has a swollen ankle and the trainer is optimistic he can get her well by Friday.â&#x20AC;?


PAGE14SPORTS

THE PROSPECTOR September 21, 2010

PAGE15SPORTS

THE PROSPECTOR September 21, 2010

Football

UTEP looks to make it two in a row against Memphis BY ALEX MORALES The Prospector

BOB CORRAL/ The Prospector

UTEP celebrated their 42-10 win against I-10 rival NMSU Sept. 18 at the Sun Bowl.

On the first drive of the game Lopez caught an 18-yard pass in the back corner of the end zone for the opening score. The Miners played statistically well on offense, going nine of 14 on third down conversions. They  scored on six of seven drives and the only drive they did not score on was because they were called for two holding penalties, stalling the drive. For the third consecutive week, UTEP was without their star tailback Donald Buckram, who was held out due to injury. Buckramâ&#x20AC;&#x2122;s knee is still not 100 percent and head coach Mike

Price said he needs to practice more to see the field. â&#x20AC;&#x153;I had a good feeling on Thursday that (Buckram) might not play because he was not 100 percent,â&#x20AC;? Price said. â&#x20AC;&#x153;He had a good Friday and a great warm-up, the best he has had, but he just didnâ&#x20AC;&#x2122;t practice enough.â&#x20AC;? Up next for the Miners is a showdown with Memphis at 7:05 p.m. Sept. 25 at the Sun Bowl. This game will mark the first father-son showdown between Tigers offensive coordinator Eric Price and Miners coach Price. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s going to be a new experience for us, me and my family, first time ever,â&#x20AC;? Mike Price said.

while Smith a transfer from the University of Miami, has only played in two. Williams has completed 43 of 70 passes for four touchdowns and two interceptions. Smith has connected on 13-21 passes for 130 yards and a touchdown. The Tigers also have a new offensive coordinator in Eric Price, who is the son of UTEP head coach Mike Price. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;ll be real different. To say the least, itâ&#x20AC;&#x2122;s going to be weird,â&#x20AC;? Price said. â&#x20AC;&#x153;Eric text me Sunday night and said â&#x20AC;&#x2DC;This is weirdâ&#x20AC;&#x2122;.â&#x20AC;? Running back Donald Buckramâ&#x20AC;&#x2122;s ability to play against Memphis is still a question. Price said there will be no word on Buckramâ&#x20AC;&#x2122;s status until he can evaluate his practices during the week. The Miners take on Memphis at 7:05 p.m. Sept. 25 at the Sun Bowl. Alex Morales may be reached at prospector@utep.edu.

ESTEBAN MARQUEZ / The Prospector

39,214 fans filled the Sun Bowl to watch UTEP take on rival NMSU on Sept. 18

7KH%HVW%XUULWRVLQ7RZQ

12:

23(1

0RQ6DW )URPDPWRSP 6DWXUGD\V )URPDPWRSP 6XQGD\V )URPDPWRSP

Alex Morales may be reached at prospector@utep.edu.

ͥͥͤ͢  

STOMP from page 13

After coming off a victory against I-10 rival New Mexico State, UTEP looks to make it two in a row as they welcome Memphis to the Sun Bowl, a team they have never beaten. UTEP (2-1, 0-1 Conference USA) is over .500 after carving up NMSU 42-10 Sept. 18. Senior quarterback Trevor Vittatoe threw for five touchdown passes and had a total of 300 all-purpose yards. â&#x20AC;&#x153;Vittatoe threw the ball well and we caught the ball well,â&#x20AC;? head coach Mike Price said. â&#x20AC;&#x153;He did an excellent job scrambling and running with the football, he really showed good speed.â&#x20AC;? Even though the Miners have two wins on the year, they are still winless in conference play. The Tigers are coming off their first win of the season and have never lost to the Miners in C-USA play. â&#x20AC;&#x153;Now weâ&#x20AC;&#x2122;re in C-USA play. The tapes we look at of Memphisâ&#x20AC;Śthey are very athletic. Theyâ&#x20AC;&#x2122;re big strong and physical,â&#x20AC;? Price said. â&#x20AC;&#x153;They are one good football team.â&#x20AC;? In the three meetings in conference play, Memphis is 3-0 against the Miners. Every time the two have played, Memphis has handed the Miners their first loss in conference or it was the Miners last loss of the season. â&#x20AC;&#x153;It will be a super challenge for us to take (Memphis) on,â&#x20AC;? Price said. â&#x20AC;&#x153;We know the importance of this conference game and how it falls in our schedule.â&#x20AC;? Last year, Memphis ran all over UTEP en route to a 35-20 victory. The Tigers rushed for 270 yards and threw for another 216 yards.

Memphis (1-2, 0-1 C-USA) got their first win of the season after they beat Middle Tennessee State 24-17 in their home opener. The Tigers are led by a two-headed running attack in senior Gregory Ray and true freshman Jerrell Rhodes. Ray has carried the ball 44 times for 175 yards and two touchdowns. Rhodes has rushed the ball 39 times for a 131 yards with no touchdowns. â&#x20AC;&#x153;They are shoveling two tail backsâ&#x20AC;Śtheyâ&#x20AC;&#x2122;re working hard to get continuity,â&#x20AC;? Price said. â&#x20AC;&#x153;They play really hard, they play with two backs.â&#x20AC;? Memphis has also rotated quarterbacks due to the lack of experience this season. True freshman Ryan Williams and red shirt sophomore Cannon Smith have been sharing the play calling this season. Williams has seen the most work as he played in all three games,



Ǥ

10HVD &ORVHWR&KDQQHO

<($562)(;3(5,(1&(


gkh][lg j h w ] ` l *()( j KLM<=FLK

WIN AN IPOD TOUCH! Register your vote in the 2010 Students’ Choice Awards brought to you by The Prospector. Make your opinion heard today! One grand prize of one iPod Touch will be awarded to one entry to be selected at random. Entry deadline October 29th at 5 p.m. Results will be published in The Prospector’s 2010 Students’ Choice Awards Issue on November 16th. One entry per student. At least 15 blanks must be filled in to be counted or entered for prize. By entering you agree to have your name published in The Prospector (print and online editions). Please send or drop off completed entry to: Students’ Choice Awards, c/o The Prospector, 105 Union East, El Paso, TX 79968-0622, or drop them off at Student Publications office located at 105 Union East. Name ________________________________________ Email ________________________________________ Class level ___________________________________ Phone Number ________________________________

;@GA;=9O9J<K

EAT & DRINK Best Place to Dance_______________________________________ Best Sports Bar__________________________________________ Best Drink Specials ______________________________________ Bar to end the night________________________________________ Best Margaritas___________________________________________ Best Wings _____________________________________________ Best Coffee______________________________________________ Best International Food____________________________________ Best Mexican Food_________________________________________ Best Chinese Food ________________________________________ Best Vegetarian Food ______________________________________ Best Late-night food________________________________________ Best Sushi________________________________________________ Best Pizza________________________________________________ Best Burritos______________________________________________ Best Buffett_____________________________________________ Best Fast Food ___________________________________________ Best Breakfast Place_______________________________________ Best Spot for a Romantic Dinner ____________________________

PLAY & SHOP Best Car Shop___________________________________________ Best Bike Shop__________________________________________ Best Hair Salon__________________________________________ Best Shopping Center/ Mall _______________________________ Best Gym_______________________________________________ Best Spa/ Massage ________________________________________ Best Movie Theater _______________________________________ Best Place to Bowl_________________________________________ Best Billiards_____________________________________________ Favorite Store ____________________________________________ Best Car Wash ___________________________________________

CAMPUS & CLASSES How do you find out about events on campus? ______________________________________________ _____________________________________________ How often do you read The Prospector? ______________________________________________ ______________________________________________ Do you prefer The Prospector printed edition or utepprospector.com? ______________________________________________ ______________________________________________ What is your favorite section of The Prospector? ______________________________________________ _____________________________________________

Favorite Mode of Transportation _____________________________ Best Professor___________________________________________ Best Department _________________________________________ Best Major______________________________________________ Best Make-out Spot on Campus____________________________ Best Place to Catch a Nap ________________________________ Best Place to Park on Campus_______________________________ Best Place to Work on Campus____________________________ Best Place to Eat on Campus ______________________________ Best Place to Hangout on Campus __________________________ Best Place to Study on Campus ____________________________ Best Place to Tailgate_____________________________________

SERVICES Best Place to Work ________________________________________ Best Phone Service _______________________________________ Best Customer Service_____________________________________ Best Supermarket_________________________________________ Best Bakery______________________________________________ Best Tattoos______________________________________________ Best Bank________________________________________________ Best Place to Buy Textbooks ________________________________

The Prospector 09/21/2010  

The Sept. 21 issue of The Prospector.

Read more
Read more
Similar to
Popular now
Just for you