Page 1

/7&LQGG




/DVPHMRUHVRIHUWDVSDUD 7DEOHW$,5,6´ ODSDQWDOODPiViJLO\UiSLGDSDUD QDYHJDU &RQpFWDWHFRQHOPXQGRFRQODQXHYD7DEOHW$,5,62QH3$'+'8Q GLVSRVLWLYRTXHLQWHJUDODVIXQFLRQDOLGDGHVGHXQ6PDUWSKRQH\XQSRUWiWLOHQ XQGLVHxR~QLFRGHPHQRVGHNJGHSHVR7XPHMRURSFLyQSDUDHQYLDUWXV IRWRVHVWDUHQFRQWDFWRFRQORVWX\RVHVWDULQIRUPDGRGHODV~OWLPDVQRWLFLDV« \WRGRFRQVyORGHVOL]DUXQGHGRHQVXSDQWDOODFDSDFLWLYDXOWUDVHQVLEOH GH´1DYHJDUiVDWRGDYHORFLGDGSRU,QWHUQHWSRGUiVGHVFDUJDUWHPLOHVGH DSOLFDFLRQHV\MXHJRV\DGHPiVYHUiVWXVSHOtFXODVIRWRJUDItDVYtGHRV« JUDFLDVDVXJUDQFDOLGDGGHLPDJHQ\DVXV*%GH'LVFR'XUR0i[LPD WHFQRORJtDHQODSDOPDGHWXPDQRFRQHOVLVWHPDRSHUDWLYRPyYLOPiV FRPSOHWRFRQPiVGHDSOLFDFLRQHVGLVSRQLEOHVSDUD$QGURLG \FRQFDUFDVDGHDOXPLQLR1RWHODSLHUGDVDKRUDWXQXHYD7DEOHW$,5,6 SRUPXFKRPHQRVGHORTXHLPDJLQDVSRU€VyORGXUDQWHHOPHVGH 6HSWLHPEUH$GHPiVFRPSOpWDODFRQSUiFWLFRVDFFHVRULRVXQDIXQGDGH WUDQVSRUWHRXQVRSRUWHUHSRVDFDEH]DV

1XHYD7DEOHW$,5,6´ OLJHUDPDQHMDEOH\PHQRVGHNJ GHSHVR /DQXHYD7DEOHW$,5,62QH3$'VHFRQYHUWLUi HQWXQXHYRGLVSRVLWLYRGHQDYHJDFLyQ7XQXHYD KHUUDPLHQWDGHWUDEDMR\HQWUHWHQLPLHQWRTXHFXHQWD FRQXQDSDQWDOODFDSDFLWLYD0XOWLWiFWLOSDQRUiPLFD GH´\XQSHVRGHPHQRVGHNJ&RQHOOD WUDEDMDUiV\GLVIUXWDUiVGHWXHQWUHWHQLPLHQWRRJUDFLDV DVXVLVWHPDRSHUDWLYR$QGURLG3RGUiVDFFHGHU D,QWHUQHWUHYLVDUWXFRUUHRGLVIUXWDUGHWXP~VLFD\ SHOtFXODV«7HQGUiVHOUHQGLPLHQWRGHXQSRUWiWLO\OD IXQFLRQDOLGDGGHXQVPDUWKSKRQHHQXQDWDEOHWTXH DKRUDSXHGHVHUWX\DDOPHMRUSUHFLR

´ ´

&$5$&7(5Ë67,&$67e&1,&$6 ‡3DQWDOOD7)70XOWLWiFWLO´FDSDFLWLYDFRQ UHVROXFLyQ[S‡3URFHVDGRU$50 &RUWH[$&RUH9KDVWD*+]‡6LVWHPD RSHUDWLYR$QGURLGDFWXDOL]DEOH‡0HPRULD 5$0*%''5‡'LVFR'XUR*% ‡&RQH[LRQHV[0LQL86%[PLQL+'0,70 /HFWRUGHWDUMHWDVPLFUR6'6'+&VDOLGDGH DXGLR‡:HEFDPWUDVHUD0S[‡:L)L EJQ‡0HGLGDV $[+[) [[FP ‡3HVRJ

7DEOHW´$,5,62QH3$'+'

€

6HSWLHPEUH

6yORKDVWD 393+DELWXDO€

5I

&$5$&7(5Ë67,&$67e&1,&$6 ‡3DQWDOOD7)70XOWL7iFWLO´SDQRUiPLFDFDSDFLWLYDFRQ UHVROXFLyQ[S‡3URFHVDGRU$50&RUWH[$&RUH 9KDVWD*+]‡6LVWHPDRSHUDWLYR$QGURLG DFWXDOL]DEOH‡0HPRULD5$00%‡'LVFR'XUR*% ‡&RQH[LRQHV[0LQL86%[PLQL+'0,70OHFWRUGH WDUMHWDPLFUR6'6'+&‡:L)LEJQ‡0HGLGDV $[+[) [[FP‡3HVRJ

7DEOHW´$,5,62QH3$'

6HSWLHPEUH )XQGD1HRSUHQR$,5,6

€

€

6yORKDVWD 393+DELWXDO€

5I

5I 6RSRUWHGHFRFKHSDUD7DEOHW$,5,6

€

5I



LTC

Aprovecha las ventajas y beneficios 3URGXFWRVVHOHFFLRQDGRVSDUDWXELHQHVWDU

/7&%LQGG

*D 9HU


FHOHEUDU

DxRVFRQWLJR

/DSDUHMDSHUIHFWDGH$,5,61HWERRNWiFWLO´ H%RRN´£FRQ€GHDKRUUR (VWHRWRxRFHOHEUDPRVFRQWLJRQXHVWURJUDQDQLYHUVDULRFRQHVWDRIHUWDH[FOXVLYDGH$,5,68QDSDUHMDGHGLVHxR TXHWHDEULUiODSXHUWDDXQDQXHYDIRUPDGHHQWUHWHQLPLHQWR8Q1HWERRNFRQSDQWDOODWiFWLOGH´\VLVWHPD RSHUDWLYR$QGURLGFRQWRGDVODVDSOLFDFLRQHVSDUDQDYHJDUSRU,QWHUQHWUHSURGXFLUYtGHRVP~VLFDWUDEDMDU MXJDU«HQPHQRVGHNJGHSHVR-XQWRFRQXQH%RRNFRQSDQWDOODDFRORU7)7GH´FRQOD~OWLPDWHFQRORJtD SDUDGLVIUXWDUGHODOHFWXUD\HQWUHWHQLPLHQWRGLJLWDOPHPRULDÀDVKGH*%SXHUWRPLQL86%OHFWRUGHWDUMHWDV 6'«WRGRHQXQWDPDxRH[WUHPDGDPHQWHOLJHUR8QDRIHUWDHVSHFLDOSDUDWLSRUHVWRVDxRVMXQWRDQRVRWURV &RQVLJXHDKRUDODSDUHMDSHUIHFWDGH$LULVSRUVyOR€FRQXQDKRUURGH€

´

´

1HWERRN7iFWLO´$,5,6.,5$ H%RRN´$,5,67$%

€

5I

6yORKDVWD 393+DELWXDO€ &$5$&7(5Ë67,&$67e&1,&$61HWERRNWiFWLO´ ‡3DQWDOOD7)7´SDQRUiPLFDWiFWLOFRQUHVROXFLyQ[S‡3URFHVDGRU$50&RUWH[$&RUH9KDVWD*+] ‡'LVFR'XUR*%‡0HPRULD5$0*%‡&RQH[LRQHV[86%[PLQL+'0,70OHFWRUGHWDUMHWDPLFUR6'6'+& ‡(QWUDGD\VDOLGDGHDXGLR‡:L)LEJQ‡:HEFDPLQWHJUDGD‡%DWHUtD,yQ/LWLR ‡0HGLGDV $[+[) [[FP‡3HVRJ &$5$&7(5Ë67,&$67e&1,&$6H%RRN´ ‡3DQWDOOD7)7DFRORU´FRQUHVROXFLyQ[S‡3URFHVDGRU$50&RUH9KDVWD0+] ‡0HPRULDÀDVK*%‡&RQH[LRQHV[PLQL86%OHFWRUGHWDUMHWDV6'KDVWD*%PLQLMDFNGHDXGLRGH PPSDUDDXULFXODUHV‡%DWHUtDSROtPHURGH/LWLR9P$K‡0HGLGDV $[+[) [[FP ‡3HVRJ

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

902 10 30 10

latiendaencasa.es






APROVECHA TODAS LAS

VENTAJAS Y BENEFICIOS DE COMPRAR EN

LTC

(VWLPDGRFOLHQWH (VWHDxRFHOHEUDPRVQXHVWURDQLYHUVDULRDxRVHQORVTXH /D7LHQGDHQ&DVDKDWUDEDMDGRFRQHO¿QGHRIUHFHUDVXVFOLHQWHVORV PHMRUHVSURGXFWRV\XQVHUYLFLRGHFDOLGDG 3DUDFRQPHPRUDUHVWDIHFKD\DJUDGHFHUOHVX¿GHOLGDGKHPRV SUHSDUDGRXQFDWiORJRHVSHFLDO2WRxR,QYLHUQRGRQGHHQFRQWUDUi RIHUWDVHVSHFLDOHV\PDJQt¿FRV5(*$/26GHDQLYHUVDULR 7HOHYLVRUHVFRQOD~OWLPDWHFQRORJtDGHOPHUFDGR6PDUWSKRQHVGH ~OWLPDJHQHUDFLyQHTXLSRVLQIRUPiWLFRVSDUDFRPHQ]DUOD³9XHOWDDO FROH´WUDWDPLHQWRVGHEHOOH]DPiTXLQDVGHHMHUFLFLRKHUUDPLHQWDVGH EULFRODMHKHPRVVHOHFFLRQDGRSDUDXVWHGORPHMRUGHODVSULPHUDV PDUFDVFRQSUHFLRVH[FOXVLYRV 'LVIUXWHFRQQXHVWUDVSURSXHVWDV\HOLMDORTXHPiVOHJXVWH\DVDEH ORIiFLOTXHHVWHQHUORHQFDVDVLHPSUHFRQODJDUDQWtDTXHVLQRTXHGD VDWLVIHFKROHGHYROYHPRVVXGLQHUR

LTC pone a tu disposiciĂłn una cuidada selecciĂłn de artĂ­culos pensando en tu bienestar y calidad de vida y con la gran ventaja de poder elegir todo lo que necesites pagando en cĂłmodas mensualidades.

COMPRAR ES MUY FĂ CIL A tu servicio las 24 horas del dĂ­a durante los 365 dĂ­as del aĂąo.

Por telĂŠfono: Por internet:

902 10 30 10 latiendaencasa.es

TĂš ELIGES LA FORMA DE PAGO

CĂłmodas mensualidades:

Para facilitarte las compras y beneficiarte en todo lo que podamos.

FinanciaciĂłn a medida. Compra todo lo que quieras y pĂĄgalo en cĂłmodas cuotas, con un importe mĂ­nimo de 30â‚Ź y hasta 36 meses.

Atentamente,

Con tarjeta: Con la tarjeta de TendrĂĄs un control total de tus pagos.

Con tarjeta Regalo de Ricardo Goizueta SagßÊs DIRECTOR DE LA TIENDA EN CASA

VALOR INICIAL

Consulta condiciones a tu operadora o en latiendaencasa.es Con otras tarjetas: Visa, MasterCard, American Express, Diners Club, Red 6000, 4B y JCB.

Contra reembolso: Si lo prefieres, puedes abonar tu pedido en el mismo momento en que lo recibas. Esta modalidad de pago tiene un pequeĂąo suplemento de sĂłlo 1,5â‚Ź

GarantĂ­a de DevoluciĂłn y AtenciĂłn al Cliente: Si cuando usted reciba su pedido no queda completamente satisfecho, tiene un plazo de 7 dĂ­as para devolverlo. Los gastos de envĂ­o y recogida en caso de devoluciĂłn correrĂĄn por cuenta del cliente. Para realizar la devoluciĂłn, el producto debe estar en perfectas condiciones y en su embalaje original. Previa comprobaciĂłn del estado de la mercancĂ­a, se procederĂĄ al reintegro de su importe en la misma modalidad en que se efectuĂł la compra, salvo en efectivo, que se reintegrarĂĄ mediante transferencia bancaria. Para aquellos productos que requieran montaje, la devoluciĂłn sĂłlo se admitirĂĄ en su embalaje original y debidamente desmontado. No se puede realizar cambio ni devoluciĂłn de todos los artĂ­culos de belleza, incluyendo artĂ­culos de tocador, cosmĂŠticos, aseo personal (afeitadoras, depiladoras), accesorios para el cabello, trajes de baĂąo, lencerĂ­a, ropa interior, medias, colchones, edredones fundas/protectores de colchĂłn o almohadas. Los vĂ­deos domĂŠsticos, discos, productos informĂĄticos u otros productos susceptibles de copia inmediata sĂłlo podrĂĄn cambiarse por un tĂ­tulo idĂŠntico. Existen hojas de reclamaciones a disposiciĂłn del cliente, en nuestro domicilio social C/Hermosilla, 112 - 28009 Madrid o en nuestras oficinas de C/Alfonso GĂłmez, nÂş8. GarantĂ­a de calidad y servicio: El plazo de garantĂ­a de todos los productos ofertados en este catĂĄlogo se ajusta al Real Decreto Legislativo 1/2007, de 16 de Noviembre, por el que se aprueba el texto refundido de la Ley General para la Defensa de los Consumidores y Usuarios y otras leyes complementarias. Para hacer uso de la garantĂ­a dentro del plazo legal establecido de los 2 aĂąos siguientes a la entrega del producto es imprescindible la presentaciĂłn del justificante de compra (talĂłn de venta). Pasado este plazo, y para el supuesto que el producto adquirido tenga una garantĂ­a adicional otorgada por el fabricante, deberĂĄ presentarse junto con el justificante de compra (talĂłn de venta) el certificado de garantĂ­a debidamente cumplimentado.

- Todos los precios incluyen IVA. - CatĂĄlogo vĂĄlido desde el 01/09/2012 hasta el -

28/02/2013. EnvĂ­os disponibles a PenĂ­nsula y Baleares. ConsĂşltanos el servicio de instalaciĂłn y puesta en marcha. Solicitaremos tu DNI y la fecha de nacimiento para realizar el envĂ­o. Descuento de personal, no aplicable a financiaciĂłn exclusiva. El Corte InglĂŠs S.A., registrado e inscrito como empresa de venta a distancia (IdentificaciĂłn REBA 25/00), realiza la venta y distribuciĂłn de

/7&LQGG

los productos de este catĂĄlogo.

- Los datos que usted nos proporcione serĂĄn incorporados en un fichero de clientes propiedad de El Corte InglĂŠs S.A. y podrĂĄn ser tratados para hacerle llegar ofertas comerciales del grupo El Corte InglĂŠs. Tiene derecho a acceder a dicha informaciĂłn, recopilada en nuestro fichero de clientes, y cancelarla o rectificarla, dirigiĂŠndose por carta a C/ Hermosilla, 112. 28009 Madrid, Ăł llamando al telĂŠfono 902 302 101 (Ley OrgĂĄnica 15/1999, de 13 de Diciembre).

EL PEDIDO DONDE TĂš QUIERAS Entrega en tu domicilio: Te llevamos el pedido donde tĂş elijas (casa, oficina, etc.) en un plazo de diez dĂ­as laborables. Incluye gastos de preparaciĂłn, manipulaciĂłn, embalaje, envĂ­os y seguro de envĂ­o, por sĂłlo 9,8â‚Ź (por domicilio). EncontrarĂĄs productos con gastos de envĂ­o de 5,90â‚Ź, consulta condiciones a tu operadora o en latiendaencasa.es. En los productos voluminosos, los gastos serĂĄn bajo presupuesto. Avisaremos por SMS o email antes de entregar el pedido. No se sirven pedidos a apartados postales.

ATENCIÓN AL CLIENTE Para resolver cualquier tipo de duda, consulta o incidencia que puedas tener (de lunes a såbado, de 9’00 h a 20’30 h). 902 302 101

CATĂ LOGO GRATIS SolicĂ­talo llamando al telĂŠfono: 902

10 30 10

TOTAL SATISFACCIĂ“N Si el artĂ­culo no es de tu total satisfacciĂłn puedes devolverlo y te devolvemos el dinero, sĂłlo tienes que llamar al 902 302 101.

GARANTĂ?A CALIDAD Y SERVICIO Todos los artĂ­culos que aparecen en el catĂĄlogo han sido sometidos a un riguroso control de calidad y estĂĄn avalados por la garantĂ­a de La Tienda en Casa, DivisiĂłn de Venta a Distancia de




LTC LTC

Icono general

TAMAร‘O faldรณn

:(% /7&LQGG






/7&LQGG


902 10 30 10

latiendaencasa.es






8OWUDERRN&HOHURQ&HOHURQ,QVLGH&RUH,QVLGH,QWHOORJRWLSR,QWHO,QWHO$WRP,QWHO$WRP,QVLGH,QWHO&RUH,QWHO,QVLGHORJRWLSR,QWHO,QVLGH,QWHOY3UR,WDQLXP,WDQLXP,QVLGH3HQWLXP3HQWLXP,QVLGHY3UR,QVLGH;HRQ\;HRQ,QVLGHVRQPDUFDVUHJLVWUDGDVGH ,QWHO&RUSRUDWLRQHQ(VWDGRV8QLGRV\HQRWURVSDtVHV3DUDREWHQHUPiVLQIRUPDFLyQVREUHODYDORUDFLyQGHOSURFHVVDGRU,QWHOFRQVXOWH+<3(5/,1.³KWWSZZZLQWHOHVUDQNLQJ³ZZZLQWHOHVUDQNLQJ

(OHFWUyQLFD

9XHOWDDOFROH

3RUWiWLO+33DYLOLRQ*VV5(*$/20DOHWtQ+3 £3RUVyOR€ (VWHQXHYRFXUVRGHVWDFDUiVHQWRGRHQGLVHxRHQUHQGLPLHQWRHQYHORFLGDG«QRWHSLHUGDVHVWDRIHUWD TXHWHSUHVHQWDPRVSRUTXHKDUiTXHODYXHOWDDOFROHVHDPXFKRPiVIiFLO\GLYHUWLGD(OQXHYRSRUWiWLO+3 3DYLOLRQ*VVGH´FRQ3URFHVDGRU,QWHOŠ&RUH70L0WHGDUiWRGDODSRWHQFLDSDUDWUDEDMDU UHDOL]DUSUHVHQWDFLRQHVRUJDQL]DU\FRPSDUWLUIRWRVFRQHFWDUWHFRQWXIDPLOLD\DPLJRV«8QSRUWiWLOFRQODV IXQFLRQHVHVHQFLDOHVSDUDWXYLGDGLDULDFRQ*%GH'LVFR'XUR*%GHPHPRULD5$0\XQDSDQWDOOD +'/('%ULJKW9LHZGH´TXHWHDSRUWDUiXQDFDOLGDGGHLPDJHQH[FHSFLRQDO7RGRXQFHQWURGHWUDEDMR \GLYHUVLyQDXQSUHFLRUHDOPHQWHDVHTXLEOHDKRUDHQ6HSWLHPEUHSRUVyOR€FRQXQDKRUURGH€ $GHPiVOOpYDWHGH5(*$/2XQPDOHWtQ+3SDUDWHQHUORVLHPSUHFRQWLJR

&$5$&7(5Ë67,&$67e&1,&$6 ‡3URFHVDGRU,QWHOŠ&RUH70L0 ‡*%'LVFR'XUR ‡*%''5 ‡7DUMHWDJUi¿FD$0'5DGHRQ+'0 FRQ*%''5 ‡3DQWDOOD´+'/('%ULKJ9LHZFRQ UHVROXFLyQ[S ‡6RQLGR$OWHF/DQVLQJ ‡*UDEDGRUD'9'6~SHU0XOWLGHGREOHFDSD ‡:HEFDP+3FRQPLFUyIRQR ‡:L)L ‡[+'0,70 ‡[86% ‡0HGLGDV $[+[) [[FP ‡3HVRNJ ‡:LQGRZVŠ+RPH3UHPLXP2ULJLQDO

6Ï/2



81,'$'(6

352&(6$'25,17(/Š&25(70,0 (O3URFHVDGRU,QWHOŠ&RUH70L0WHRIUHFHUiXQDH[SHULHQFLDLQIRUPiWLFDUiSLGDFRQFDSDFLGDGGH UHVSXHVWD\XQJUDQUHDOLVPRYLVXDO*HVWLRQDUiVWRGDVWXVWDUHDVGHODIRUPDPiVH¿FLHQWH\WUDEDMDUiVPXFKR PiVUiSLGRTXHFRQFXDOTXLHURWURRUGHQDGRU

8172'27(55(123$5$78'Ë$$'Ë$ 3DUDWUDEDMDUSDUDWXVFODVHVSDUDGLVIUXWDUGHXQDSHOtFXODKDEODUFRQORVWX\RV«HVWHSRUWiWLOHVSHUIHFWR SDUDWXGtDDGtD&RQXQGLVHxRSHUIHFWRTXHSRGUiVOOHYDUDFXDOTXLHUVLWLR\FRQWRWDOSURWHFFLyQJUDFLDVDVX UHVLVWHQWHFDUFDVD



&203/(7$7818(9225'(1$'25+3&21&8$/48,(5$ 5$7Ð1:,),+3 (VWHUDWyQGH~OWLPDJHQHUDFLyQVHFRQHFWD XWLOL]DQGRHOUHFHSWRU:L)LLQWHJUDGRHQWX HTXLSR8QUDWyQIDEULFDGRWDQWRSDUDGLHVWURV FRPR]XUGRV\FRQFDQWRVGHFDXFKR TXHOHRWRUJDUiXQDJDUUH FyPRGR\VHJXUR

'

7$5-(7$7(/(9,6,Ð1$9(57992/$5*5((1+' 8QVLQWRQL]DGRUGHWHOHYLVLyQFRQHOTXHREWHQGUiV XQDPD\RUUHFHSFLyQGHVHxDOGHORVFDQDOHV7'7 *UDFLDVDVX~OWLPDYHUVLyQGH6RIWZDUH$9(579 SRGUiVGLVIUXWDUGHOYHUGDGHUR+'L HLQFOXVRJUDEDUSURJUDPDVGHWHOHYLVLyQ HQDOWDGH¿QLFLyQ

€0HV PiV

3RU

5I

,PSU PXOW REWHQ 3RGU WUDYp SDQW IRWRV FRUUH GRQG H3ULQ

3RU

€0HV PiV

3RU

5I



/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG

*D 9HU


(OHFWUyQLFD

´

5(*$/2 8QPDOHWtQGHJUDQFDOLGDG\XQERQLWR GLVHxRFRQYDULRVFRPSDUWLPHQWRV SDUDSRGHUOOHYDUWRGRVORVDFFHVRULRV GHORUGHQDGRU8QIDQWiVWLFRPDOHWtQ TXHSXHGHVHUWX\RDODGTXLULUWX QXHYRSRUWiWLO YDORUDGRHQ€

2UGHQDGRU3RUWiWLO+33DYLOLRQ*VV 5(*$/20DOHWtQ+3´ YDORUDGRHQ€

€ 6yORKDVWD

€0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393+DELWXDO€

5I



'((6726$&&(625,263258132&20È6$/0(6

'

08/7,)81&,Ð1+33+27260$57&21&21(;,Ð1:(%3$3(/+3 ,PSULPHFRSLD\HVFDQHDIiFLOPHQWHFRQOD PXOWLIXQFLyQLQDOiPEULFD+33KRWR6PDUW\ REWHQGUiVUHVXOWDGRVGHXQDFDOLGDGLPSUHVLRQDQWH 3RGUiVLPSULPLUFRQWHQLGRVZHEVLQXWLOL]DU3&D WUDYpVGHVXVDSOLFDFLRQHVVLPSOHPHQWHWRFDQGRVX SDQWDOOD+3WiFWLOGHFP$GHPiVSRGUiVHQYLDU IRWRVRGRFXPHQWRVDODLPSUHVRUDDWUDYpVGH FRUUHRHOHFWUyQLFRHLPSULPLUGHVGHFXDOTXLHUOXJDU GRQGHWHHQFXHQWUHVJUDFLDVDVXQXHYDWHFQRORJtD H3ULQW,QFOX\HSDFNGHSDSHOIRWRJUi¿FR+3

€0HV PiV

3RU

5I

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

3ULPHUSURSyVLWRGH6HSWLHPEUH &DPELDUGHRUGHQDGRU £DKRUDFRQXQDKRUURGH€ (PSLH]DHORWRxR\VHJXURTXHHQWXVSODQHVQRIDOWDUHQRYDU WXHTXLSRLQIRUPiWLFR1REXVTXHVPiVSRUTXH+3WHSUHVHQWD XQDRSFLyQWRWDOPHQWHDVHTXLEOH\SDUDGLVIUXWDUWRGDODIDPLOLD HO3&GHVREUHPHVD+33DYLOLRQSHV8QHTXLSRTXH GHVWDFDSRUVXGLVHxRSUHVWDFLRQHVSRWHQFLDDOPDFHQDPLHQWR \¿DELOLGDG/OHJDPiVOHMRVFRQWXVIRWRVSHOtFXODV\P~VLFD JUDFLDVDVX3URFHVDGRU,QWHOŠ&RUHŒL\VXWDUMHWD JUi¿FD$0'5DGHRQ+'FRQ*%GHPHPRULDGHGLFDGD PHMRUDUiODLQWHQVLGDG\UHDOLVPRGHWXVMXHJRV(LQFOXVRSRGUi DFFHGHUYHUHLQWHUDFWXDUFRQORVFRQWHQLGRVDOPDFHQDGRVHQ RWURVGLVSRVLWLYRVGHVGHWXQXHYRRUGHQDGRUGHIRUPDLQDOiPEULFD JUDFLDVDVXIXQFLyQ+3/LQN8S0i[LPRUHQGLPLHQWRHQWXWUDEDMR \GLYHUVLyQJDUDQWL]DGDHQHVWDRIHUWDH[FOXVLYDDKRUDHQ 6HSWLHPEUHSRUVyOR€FRQXQDKRUURGH€ $GHPiVSRGUiVFRPSOHWDUORFRQXQDPXOWLIXQFLyQ:L)L +33KRWR6PDUWRFRQPRQLWRU+3GH´ SHUIHFWRSDUDWXQXHYRRUGHQDGRU 2UGHQDGRUVREUHPHVD +33DYLOLRQ3HV

6HSWLHPEUH

€

6yORKDVWD

€0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393+DELWXDO€

5I

6Ï/2



81,'$'(6

&$5$&7(5Ë67,&$67e&1,&$6 ‡3URFHVDGRU,QWHOŠ&RUHŒL ‡7%'LVFR'XUR‡*%''5 ‡7DUMHWDJUi¿FD$0'5DGHRQ+'0FRQ*%''5 ‡6RQLGR$XGLR$OWD'H¿QLFLyQ ‡*UDEDGRUD'9'6~SHU0XOWLGHGREOHFDSD ‡:L)L‡/HFWRUGHWDUMHWDVHQ ‡[86%‡0HGLGDV $[+[) [[FP ‡3HVRNJ‡:LQGRZVŠ+RPH3UHPLXP2ULJLQDO

&203/(7$7818(9262%5(0(6$+3 08/7,)81&,Ð1+33+27260$57&21 &21(;,Ð1:(%3$3(/+3 ,PSULPHFRSLD\HVFDQHDIiFLOPHQWHFRQODPXOWLIXQFLyQ LQDOiPEULFD+33KRWR6PDUW\REWHQGUiVUHVXOWDGRVGHXQD FDOLGDGLPSUHVLRQDQWH3RGUiVLPSULPLUFRQWHQLGRVZHEVLQXWLOL]DU 3&DWUDYpVGHVXVDSOLFDFLRQHVVLPSOHPHQWHWRFDQGRVXSDQWDOOD +3WiFWLOGHFP$GHPiVSRGUiVHQYLDUIRWRVRGRFXPHQWRV DODLPSUHVRUDDWUDYpVGHFRUUHRHOHFWUyQLFRHLPSULPLUGHVGH FXDOTXLHUOXJDUGRQGHWHHQFXHQWUHVJUDFLDVDVXQXHYDWHFQRORJtD H3ULQW,QFOX\HSDFNGHSDSHOIRWRJUi¿FR+3

€0HV PiV

021,725µ+3/('; 8QPRQLWRUGH´FRQUHWURLOXPLQDFLyQ/('\XQGLVHxRXOWUD¿QR'LVIUXWDUiV GHLPiJHQHVPiVEULOODQWHVPLHQWUDVQDYHJDVSRU,QWHUQHWWUDEDMDVHQWXV SUR\HFWRVRYLVXDOL]DVYtGHRVSHOtFXODV«<SRGUiVPLUDUORGHVGHHOiQJXORTXH SUH¿HUDV\DTXHVHSXHGHDMXVWDUODRULHQWDFLyQ\ODLQFOLQDFLyQGHOVRSRUWH

€0HV PiV

3RU

5I

´

3RU

5I



Comprar es muy fácil $WXVHUYLFLRKRUDVDOGtDGXUDQWHORVGtDVGHODxR

/7&LQGG




(OHFWUyQLFD

0DF%RRN3UR +DFHPiVHQPHQRVWLHPSR /OHJDPiVOHMRVFRQWXQXHYR0DF%RRN3URGH´6X DYDQ]DGR3URFHVDGRU\VXVJUi¿FRVXOWUDUUiSLGRVKDFHQTXHVHD IiFLODFRVWXPEUDUVHDWDQWDSRWHQFLD+DUiVPiVHQPHQRVWLHPSR JUDFLDVDVX3URFHVDGRU,QWHOŠ&RUH70GHWHUFHUDJHQHUDFLyQ FRQPD\RUYHORFLGDG\PHPRULD6XVQXHYRVJUi¿FRVRIUHFHQ XQUHQGLPLHQWRKDVWDXQVXSHULRU\ODWHFQRORJtDGH(6GH DOWDYHORFLGDGWHSHUPLWLUiFRQHFWDUPRQLWRUHV\SHULIpULFRVGHDOWR UHQGLPLHQWRDWUDYpVGHXQVRORSXHUWRDVtFRPRWUDQVIHULUDUFKLYRVD YHORFLGDGGHYpUWLJR1RSLHUGDVHVWDRSRUWXQLGDGHO0DF%RRN3URHV XQJUDQRUGHQDGRU\DKRUDHVPHMRUTXHQXQFD

´

3RUWiWLO$SSOH0DF%RRN3UR0'<$

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

5I 0HGLGDV $[+[) [[FP 3HVRNJ 6Ï/2



&$5$&7(5Ë67,&$67e&1,&$6 ‡3URFHVDGRU,QWHOŠ&RUHŒL ‡6LVWHPDRSHUDWLYR0DF26;/LRQ ‡'LVFR'XUR*% ‡*%''5 ‡7DUMHWDJUi¿FD,QWHO+'*UDSKLFV ‡3DQWDOODUHWURLOXPLQDGD/('´ ‡5HVROXFLyQ[S ‡&iPDUD)DFH7LPH+'DS ‡:L)L ‡[7KXQGHUEROW ‡[)LUH:LUH ‡86% ‡%OXHWRRWKŠ

81,'$'(6

0DF%RRN$LU 0iVOLJHUR\UiSLGRGHORTXHSDUHFH (OSRUWiWLOGH¿QLWLYRSDUDWXGtDDGtDHVD~QPHMRU1RWHSLHUGDVWXQXHYR 0DF%RRN$LUDKRUDFRQOR~OWLPRHQ3URFHVDGRU,QWHOŠJUi¿FRVXQ DOPDFHQDPLHQWRÀDVKKDVWDYHFHVPDVUiSLGRTXHXQ'LVFR'XUR FRQYHQFLRQDO\XQDFiPDUD)DFH7LPH+'GHS7RGRHQXQSRUWiWLO LQFUHtEOHPHQWH¿QR\OLJHUR<VXUHQGLPLHQWRJUi¿FRHVKDVWDXQ PiVYHOR]SDUDTXHKDJDVGHWRGRVLQLQWHUUXSFLRQHV3RUHVRHO 0DF%RRN$LUQRFRUUHYXHOD&RQVtJXHORDKRUDSRUVyOR€DOPHV  VLQHQWUDGD 3RUWiWLO$SSOH0DF%RRN$LU0'<$

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

5I 0HGLGDV $[+[) [[FP 3HVRNJ

6Ï/2



´

&$5$&7(5Ë67,&$67e&1,&$6 ‡3URFHVDGRU,QWHOŠ&RUHŒL ‡6LVWHPDRSHUDWLYR0DF26;/LRQ ‡'LVFR'XUR*% ‡*%''5 ‡7DUMHWDJUi¿FD,QWHO+'*UDSKLFV ‡3DQWDOODUHWURLOXPLQDGD DOWDUHVROXFLyQ/('´ ‡5HVROXFLyQ[ ‡&iPDUD)DFH7LPH+'DS ‡:L)L ‡[7KXQGHUEROW ‡[)LUH:LUH ‡86% ‡%OXHWRRWKŠ

81,'$'(6

&203/(7$7818(920$&%22.&21(6726$&&(625,26 5$7Ð10$*,&0286(

€0HV PiV

$33/(&$5(

€0HV PiV

3RU

3RU

&RQ$SSOH0DF%RRN3UR0'<$5I &RQ$SSOH0DF%RRN$LU0'<$5I

&RQ$SSOH0DF%RRN3UR0'<$5I &RQ$SSOH0DF%RRN$LU0'<$5I

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

£/DPHMRURIHUWDSDUDORVDSDVLRQDGRVDOMXHJR 6REUHPHVD+33DYLOLRQ+3(+HV0RQLWRU/('+3´ (ORUGHQDGRUGHVREUHPHVD*DPLQJ+33DYLOLRQ+3(+HVWHGDUiWRGDODHPRFLyQ\DYHQWXUDTXHQHFHVLWDVSDUDYLYLUDOPiVDOWR QLYHOODHPRFLyQGHOMXHJR8QRUGHQDGRUTXHFXHQWDFRQXQDGHODVPHMRUHVWDUMHWDVJUi¿FDV19,',$Š*H)RUFH*7FRQWHFQRORJtD 3XUH9LGHRŠ+'FRQ*%GHGLFDGDSDUDORVMXHJRVPiVH[LJHQWHVXQLGRDVXSRWHQWH3URFHVDGRU,QWHOŠ&RUHŒLTXHGHVWDFDSRU VXH[WUHPDYHORFLGDG\FRQVXVSXHUWRV86%SRGUiVDFFHGHUDWXVDSOLFDFLRQHVH[WHUQDVIDYRULWDV(VWRMXQWRDXQPRQLWRU/('+3GH´ FRQHOTXHFRQVHJXLUiVXQUHDOLVPRWRWDOSHUFLELHQGRORVPRYLPLHQWRV\GHWDOOHVFRPRVLHVWXYLHUDVHQYLYR\HQGLUHFWRFRQXQH[FHOHQWHVRQLGR %HDWV$XGLR7DQWRVLHUHVXQDSDVLRQDGRGHORVMXHJRVFRPRVLGHVHDVXQRUGHQDGRUTXHGHVWDTXHSRUVXDOWRUHQGLPLHQWRQRSLHUGDVHVWD RSRUWXQLGDG/OpYDWHORDKRUDDOPHMRUSUHFLRFRQXQ£DKRUURGHPiVGH€

( Y , I G F H I D

2

6Ï/2

´

$



81,'$'(6





3

5

2UGHQDGRUVREUHPHVD +33DYLOLRQ+3(+HV 0RQLWRU´+3/(';

€

€

€0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1

5I

&$5$&7(5Ë67,&$67e&1,&$6 ‡7%'LVFR'XUR‡*%''5‡7DUMHWDVLQWRQL]DGRUD79‡5HSURGXFWRU%OXUD\Œ\JUDEDGRUDGH'9'6XSHU0XOWL‡:L)L‡6RQLGR%HDWV$OWD'H¿QLFLyQ‡/HFWRUGHWDUMHWDVHQ‡7HFODGR\ UDWyQLQDOiPEULFR‡0DQGRDGLVWDQFLD+3:LQ0HGLD&HQWHU‡[+'0,Œ‡[86%‡[86%‡0HGLGDV&38 $[+[) [[FP0RQLWRU[[FP ‡3HVR&38NJ0RQLWRUNJ‡:LQGRZVŠ+RPH3UHPLXP

0XpYHWHFRQODWHFQRORJtDGHPRGD+3 /RV1HWERRNVGH+3XOWUDFRPSDFWRVWH RIUHFHUiQWRGRORTXHQHFHVLWDVFRQXQ SURFHVDGRU,QWHOŠ$WRPŒ1'LVFR 'XURGH*%\XQDSUiFWLFD:HEFDPFRQ PLFUyIRQRGLJLWDOLQWHJUDGR(LQFOXVRSRGUiV VLQFURQL]DUWXVGDWRVFRQRWURVGLVSRVLWLYRVGH IRUPDLQDOiPEULFDDWUDYpVGH%OXHWRRWKŠ< FRQVXSDQWDOOD/('DQWLUUHÀHMR+'GH´\ VXWHFQRORJtD%HDWVŒ$XGLRGLVIUXWDUiVGHXQD H[SHULHQFLDGHVRQLGRVLQLJXDO8QRV1HWERRNV DKRUDGLVSRQLEOHVHQURVDD]XO\JULVSRUVyOR €GXUDQWHHOPHVGH6HSWLHPEUH

´ ´ ´

1HWERRN+30LQL

€

6HSWLHPEUH

6yORKDVWD

€0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393+DELWXDO€

5RVDVV5I $]XOVV5I *ULVVV5I



0HGLGDV $[+[)  [[FP 3HVRNJ

7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG

*D 9HU


(OHFWUyQLFD

£6yORDTXt $OWDWHFQRORJtD´+3FRQXQGHVFXHQWRGH€ (VWHRWRxRUHJiODWHODPHMRULQIRUPiWLFD+3FRQHVWDRIHUWDHVSHFLDO$KRUDSRUVyOR€WRGDODSRWHQFLD YHORFLGDG\UHQGLPLHQWRDWXVHUYLFLRSDUDTXHUHDOL]DUWXVWDUHDVVHDPXFKRPiVVHQFLOOR&RQXQUiSLGR3URFHVDGRU ,QWHOŠ&RUHŒL40*%GHPHPRULD5$0\7%GH'LVFR'XURFRQHOTXHSRGUiVDOPDFHQDUPLOHVGH IRWRVSHOtFXODV\P~VLFDDGHPiVGHPHMRUDUHOUHDOLVPRGHWXVMXHJRVJUDFLDVDVXSRWHQWHWDUMHWDJUi¿FDGH*% GHPHPRULDGHGLFDGD7RGRXQFHQWURGHWUDEDMR\GLYHUVLyQFRQWRGDVODVIXQFLRQHVH[FOXVLYDVTXHWHRIUHFH+3 FRPRVXVLVWHPDGHVRQLGR%HDWV$XGLRVXWHFQRORJtDH[FOXVLYD+3&RRO6HQVHTXHHQIUtDHOSRUWiWLODKRUUDQGR HQFRQVXPR\PHMRUDQGRHOUHQGLPLHQWR\VXSURWHFFLyQGHGDWRVKDVWDHQORVSHRUHVDFFLGHQWHVJUDFLDVDVX IXQFLyQ+33URWHFW6PDUW8QHTXLSR~QLFRSDUDWXGtDDGtDTXHDKRUDSXHGHVHUWX\RSRUVyOR€FRQXQ DKRUURGH€ 2UGHQDGRUSRUWiWLO+33DYLOLRQ'9FVV

€

´

€

€0HV FXRWDV6,1(175$'$ 7$(7,1

393)LQDODSOD]RV€

5I

6Ï/2



81,'$'(6

/HFWRU GHKXHOODV GLJLWDOHV &$5$&7(5Ë67,&$67e&1,&$6 ‡7DUMHWDJUi¿FD$0'5DGHRQ+'FRQ*%''5GHGLFDGD‡3DQWDOOD´+'/('%ULJKW9LHZFRQUHVROXFLyQ[S‡6RQLGR%HDWV$XGLR‡/HFWRUGHKXHOODV‡*UDEDGRUD'9'6~SHU0XOWLGH GREOHFDSD‡:HEFDP+37UXH9LVLRQFRQPLFUyIRQRGLJLWDOLQWHJUDGR‡:L)L‡%OXHWRRWKŠFRQ:L'L‡[+'0,70‡[86%‡[86%‡0HGLGDV $[+[) [[FP‡3HVRNJ ‡:LQGRZVŠ+RPH3UHPLXP2ULJLQDO

´

(/,*((/&203/(0(1723(5)(&72 08/7,)81&,Ð1+33+27260$57&21 &21(;,Ð1:(%3$3(/+3 ,PSULPHFRSLD\HVFDQHDIiFLOPHQWHFRQODPXOWLIXQFLyQLQDOiPEULFD+33KRWR6PDUW\REWHQGUiV UHVXOWDGRVGHXQDFDOLGDGLPSUHVLRQDQWH3RGUiVLPSULPLUFRQWHQLGRVZHEVLQXWLOL]DU3&DWUDYpVGHVXV DSOLFDFLRQHVVLPSOHPHQWHWRFDQGRVXSDQWDOOD+3WiFWLOGHFP$GHPiVSRGUiVHQYLDUIRWRVRGRFXPHQWRV DODLPSUHVRUDDWUDYpVGHFRUUHRHOHFWUyQLFRHLPSULPLUGHVGHFXDOTXLHUOXJDUGRQGHWHHQFXHQWUHVJUDFLDVD VXQXHYDWHFQRORJtDH3ULQW,QFOX\HSDFNGHSDSHOIRWRJUi¿FR+3

€0HV PiV

3RU

5I

7$5-(7$7(/(9,6,Ð1$9(5 92/$5*5((1+' 8QVLQWRQL]DGRUGHWHOHYLVLyQ FRQHOTXHREWHQGUiVXQDPD\RU UHFHSFLyQGHVHxDOGHORVFDQDOHV 7'7*UDFLDVDVX~OWLPDYHUVLyQ GH6RIWZDUH$9(579SRGUiV GLVIUXWDUGHOYHUGDGHUR+'L HLQFOXVRJUDEDUSURJUDPDVGH WHOHYLVLyQHQDOWDGH¿QLFLyQ

€0HV PiV

3RU

5I



*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

£7HGDPRVODH[FOXVLYD +37RXFK6PDUWHV8QRUGHQDGRUXQD79XQHTXLSRGHP~VLFD« £\XQRV5(*$/26H[WUDRUGLQDULRV (O+37RXFK6PDUWHVHVPiVLPSUHVLRQDQWHTXHQXQFD8Q³WRGRHQXQR´TXHLQWHJUDODVIXQFLRQHV LQIRUPiWLFDVPiVDYDQ]DGDVWDUMHWDVLQWRQL]DGRUDGH79ODH[FOXVLYDWHFQRORJtD%HDWV$XGLRŒ\XQDLQFUHtEOH FDOLGDGGHLPDJHQ)XOO+'HQ´,QFOXVRSRGUiVWUDQVIHULUWXVDUFKLYRVDWXRUGHQDGRUFRQPXFKDPiVUDSLGH] JUDFLDVDVXFRQH[LyQGHDOWDYHORFLGDG86%\JUDEDUWXVSURJUDPDVIDYRULWRVFXDQGRGHVHHV8QDRIHUWD HVSHFWDFXODUTXHDKRUDYLHQHDFRPSDxDGDGHXQRVIDQWiVWLFRV5(*$/26YDORUDGRVHQ€7RGRHVWRSRU PXFKRPHQRVGHORTXHLPDJLQDVVyOR€DOPHV VLQHQWUDGD1RWHORSLHUGDV 2UGHQDGRUVREUHPHVD+37RXFK6PDUWHV 5(*$/23RUWiWLO+33DYLOLRQ'0VVH,PSUHVRUDH$,2+3'HVNMHW YDORUDGRHQ€

€0HV FXRWDV 6,1(175$'$

393)LQDODSOD]RV € 7$(7,1 393€

´

5I

9(59Ë'(2 ODWLHQGDHQFDVDHV

&$5$&7(5Ë67,&$67e&1,&$6 ‡3URFHVDGRU,QWHOŠ&RUHŒL ‡*%''5 ‡7HUDE\WH'LVFR'XUR ‡3DQWDOOD´:/('SDQRUiPLFDWiFWLO )XOO+'[S ‡*UDEDGRUD'9'6XSHU0XOWL ‡7DUMHWDJUi¿FD,QWHOŠ+' ‡7DUMHWDVLQWRQL]DGRUDGH79 ‡:L)L‡:HEFDP+3FRQPLFUyIRQR ‡[86%‡[86% ‡/HFWRUGHWDUMHWDVHQ ‡:LQGRZVŠ+RPH3UHPLXPRULJLQDO ‡0HGLGDV $[+[) [[FP ‡3HVRNJ

5(*$/2 YDORUDGRHQ€

5(*$/2

3RUWiWLO+33DYLOLRQ'0VV 8QSRUWiWLOTXHWHDFRPSDxDUiGRQGHYD\DV&RQJUDQGHVSUHVWDFLRQHVFRPRVX'LVFR'XURGH*% :HEFDP7UXH9LVLRQ+'SDUDHVDVFRQYHUVDFLRQHVTXHQRSXHGHQHVSHUDU\WHFQRORJtD%HDWV$XGLRΠSDUDGLVIUXWDUGHXQVRQLGRHVSHFWDFXODU8QJUDQSRUWiWLODKRUDGH5(*$/2

´

,PSUHVRUDH$,2+3'HVNMHW ,PSULPHFRSLD\HVFDQHDFRQODPHMRU FDOLGDGGLJLWDO\GHVGHFXDOTXLHUOXJDU JUDFLDVVXWHFQRORJtDH3ULQW





Cómodas mensualidades 7~HOLJHVODIRUPDGHSDJR

/7&LQGG




(OHFWUyQLFD ´

/DSXHUWDGHDFFHVR DWRGRVWXVFRQWHQLGRV

&$5$&7(5Ã&#x2039;67,&$67e&1,&$6 Â&#x2021;[S)XOO+'Â&#x2021;0&,+]Â&#x2021;3URFHVDGRU7ULSOH;'(QJLQH)+'Â&#x2021;'HFRGL¿FDGRU'ROE\'LJLWDO,QWHJUDGR6RQLGR,Q¿QLWH6XUURXQG6\VWHP\&OHDU9RLFH,,Â&#x2021;'/1$Â&#x2021;7LPH6KLIWÂ&#x2021;[86% Â&#x2021;[+'0,70 6LPSOLQN Â&#x2021;5HFHSWRU7'7)XOO+'Â&#x2021;3HDQD*LUDWRULDÂ&#x2021;0HGLGDV $[+[) [[FPFRQSHDQD[[FPÂ&#x2021;3HVRNJFRQSHDQDNJ

'LVIUXWDGHODWHFQRORJtDTXHHVWiUHYROXFLRQDQGRHOPXQGRDXGLRYLVXDOFRQHVWHWHOHYLVRU/*SHUIHFWRSDUDWL3RUVyORâ&#x201A;¬DFFHGHUiVD WRGRXQPXQGRGHFRQWHQLGRV\DSOLFDFLRQHVRQOLQHFRQODTXHSRGUiVGLVIUXWDUGHXQDFDOLGDGGHLPDJHQ)XOO+'\TXHDGHPiVWHRIUHFHOD SRVLELOLGDGGHFRQHFWDUWXVGLVSRVLWLYRV/*HQWUHVL«£\VLQFDEOHV/DPHMRUWHFQRORJtD/('HQ´FRQXQDFDOLGDGGHLPDJHQH[FHSFLRQDO JUDFLDVDVXVLVWHPDGHHVFDQHDGR+]\VXUHVROXFLyQ[S<FXDQGRQRWHQJDVWLHPSRSRGUiVJUDEDUWXVSHOtFXODVIDYRULWDV SDUDUUHWURFHGHUDYDQ]DU\UHSHWLUODVPHMRUHVVHFXHQFLDVGHOD79HQGLUHFWRFXDQWDVYHFHVTXLHUDVJUDFLDVDVXIXQFLyQ7LPH0DFKLQH 5HDG\8QWHOHYLVRUTXHORWLHQHWRGRFDOLGDGGLVHxR\HOPHMRUSUHFLRVyORâ&#x201A;¬GXUDQWHHOPHVGH6HSWLHPEUH /('´6PDUW79/*/66

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD

â&#x201A;¬0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RVâ&#x201A;¬ 7$(7,1 393+DELWXDOâ&#x201A;¬

&RQHVWHDFFHVRULRVLWLHQHVXQWHOHYLVRU/*:L)L5HDG\SRGUiVFRQHFWDUWHDXQ URXWHU:L)L\GHPDQHUDLQDOiPEULFDWHQGUiV,QWHUQHWHQWXWHOHYLVRU\DFFHGHUiV DORVFRQWHQLGRVGHYtGHRIRWRJUDItDV\P~VLFDDOPDFHQDGRVHQHOGLVFRGXURGH WXRUGHQDGRU $GDSWDGRU'RQJOH 86%/*$1:)

â&#x201A;¬

5I

*DVWRVGHHQYtR

¼

5I%

£<DORSXHGHVYHUWRGR*UDEDGRU'9'9+6FRQ7'7LQFRUSRUDGR &RQHOFRPERJUDEDGRUGH/*WHQGUiVHQXQVRORDSDUDWRHODFFHVRDWRGDVWXVSHOtFXODV\WHOHYLVLyQ3RGUiVVLQWRQL]DUOD7'7 JUDEDUGLUHFWDPHQWHORVSURJUDPDVGHODWHOHYLVLyQDO'9'RFRQYHUWLUWXVDQWLJXDVSHOtFXODV9+6D'9'$GHPiVWDPELpQ SRGUiVUHSURGXFLUSHOtFXODV'LY;IRWRJUDItDV\P~VLFDGLUHFWDPHQWHDWUDYpVGHVXSXHUWR86%8QDFRPSOHWDRSFLyQFRQ ODTXHSRGUiVGLVIUXWDUGHWXVSHOtFXODVGHVLHPSUH\GHWRGDVODVQRYHGDGHV\TXHSXHGHVILQDQFLDUVLQHQWUDGDSRUPX\SRFR GLQHURDOPHV  &RPER'9'9+6FRQ 7'7/*5&7+

â&#x201A;¬0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RVâ&#x201A;¬ 7$(7,1 393â&#x201A;¬

5I

0HGLGDV $[+[) [[FP3HVRNJ

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD â&#x201A;¬  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

&RQ

7HFQRORJtD LQWHOLJHQWHHQ ´\´

GLVIUXWD

´´

6LHUHVXQHQWXVLDVWDGHODWHFQRORJtD\XQ DPDQWHGHOFLQHQRWHSLHUGDVHVWRV/(' 6PDUW79GH6DPVXQJ'RVWDPDxRV HQ´\´SDUDFRQVHJXLUHOHTXLOLEULR SHUIHFWRHQWUHFRORUHVLPiJHQHVHQ PRYLPLHQWRDSOLFDFLRQHVH[FOXVLYDVXQD VRUSUHQGHQWHFDSDFLGDGGHFRQH[LyQ\XQ GLVHxRFRQXQPDUFRXOWUDGHOJDGR/D 79LQWHOLJHQWHTXHWHSHUPLWLUiQDYHJDUSRU ,QWHUQHWGHVFDUJDUPLOHVGHDSOLFDFLRQHV FRPR<RX7XEHR)DFHERRNUHDOL]DU OODPDGDVGHYR]DWUDYpVGH6N\SH\ DKRUDFRQODH[FOXVLYDWHFQRORJtD6PDUW &RQWHQWFRQODTXHSRGUiVSRQHUWHHQ IRUPDGLVIUXWDUHQIDPLOLD\HQWUHWHQHUD ORVPiVSHTXHxRV,QFOXVRJUDEDUWXV SURJUDPDVGH79IDYRULWRVFRQHFWDQGR XQDPHPRULD86%RXQGLVFRGXURDO SXHUWR86%GHOWHOHYLVRU$VtVRQHVWRV WHOHYLVRUHV6PDUW79GH6DPVXQJ6yOR WLHQHVTXHHOHJLUWXWDPDxRHQ´R ´\ROYtGDWHGHWRGRORGHPiVSRUTXH DKRUDHQ6HSWLHPEUHWHORRIUHFHPRVDO PHMRUSUHFLRGHVGHVyOR€ &$5$&7(5Ë67,&$67e&1,&$6 ‡[S)XOO+'‡+]&OHDU0RWLRQ5DWH ‡'ROE\'LJLWDO3OXV'ROE\3XOVH‡6567KHDWHU6RXQG ‡6PDUW&RQWHQW‡:L)L'LUHFW‡&RQQHFW6KDUHŒ0RYLH ‡3HUVRQDO9LGHR5HFRUGHU5HDG\‡[+'0,70 ‡[86%‡6LQWRQL]DGRU7'7)XOO+'‡0HGLGDV $[+[) ´[[FPFRQSHDQD [[FP´[[FP FRQSHDQD[[FP‡3HVR´ NJFRQSHDQDNJ´NJFRQSHDQDNJ

/('6PDUW796DPVXQJ8((6 ´8((6

6HSWLHPEUH

€

´8((6

€0HV

€

6HSWLHPEUH

6yORKDVWD

6yORKDVWD

€0HV

393)LQDODSOD]RV€ FXRWDV6,1(175$'$ 7$(7,1 393+DELWXDO€

5I

393)LQDODSOD]RV€ FXRWDV6,1(175$'$ 7$(7,1 393+DELWXDO€

5I

7RGRORTXHWLHQHVTXHYHUUHSURGXFWRU%OXUD\70'6PDUW79

&RQHVWHDFFHVRULRVLWLHQHVXQSURGXFWR 6DPVXQJ:L)L5HDG\SRGUiVFRQHFWDUWHDXQ URXWHU:L)L\GHPDQHUDLQDOiPEULFDWHQGUiV ,QWHUQHWHQWXWHOHYLVRU

'LVIUXWDGHXQDFDOLGDGGHLPDJHQLQLJXDODEOHHQWRGDVWXVSHOtFXODVFRQHVWHUHSURGXFWRU %OXUD\Œ'6PDUW79GH6DPVXQJ'LVIUXWDUiVGHODVPHMRUHVSHOtFXODV%OXUD\ŒHQ'\ DGHPiVWHSHUPLWLUiFRQYHUWLUWXWHOHYLVRUHQXQ6PDUW79GDQGRDFFHVRDDSOLFDFLRQHV H[FOXVLYDVGH6DPVXQJSRUWDOHVGH,QWHUQHW5HSURGXFHPXOWLWXGGHIRUPDWRVGHDXGLR YtGHRHLPDJHQ\FXHQWDFRQHQWUDGDV86%\+'0,ŒSDUDXQDWRWDOFRQHFWLYLGDG 7RGRHQXQGLVHxRFRPSDFWRIiFLOGHLQVWDODU\PDQHMDU

5 6

6

6

5

0HGLGDV $[+[) [[FP 3HVRNJ

$GDSWDGRU:L)L86%6DPVXQJ:,6$%*1;

€

*DVWRVGHHQYtR

¼

5I%



/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG

*D 9HU


D

9

(OHFWUyQLFD

PiVGHODWHOHYLVLyQ

8QPXQGR SHUIHFWRHQ' ,PiJHQHVFDVLUHDOHVTXHVDOHQGHOD SDQWDOODODPHMRUFDOLGDGHQ$OWD'H¿QLFLyQ DFFHVRDFRQWHQLGRVGH,QWHUQHWUR]D ODSHUIHFFLyQFRQHOQXHYRWHOHYLVRU6PDUW 79FRQWHFQRORJtD'GH6DPVXQJ´ \´TXHOOHQDUiQWXVDOyQFRQHOPHMRU GLVHxRHOHJDQWH\XOWUDGHOJDGR\XQDV DSOLFDFLRQHV~QLFDVSDUDGLVIUXWDUGHO HQWUHWHQLPLHQWRFRQWRGDODIDPLOLDDFFHVR DFRQWHQLGRVGH,QWHUQHWFRPR<RX7XEH \)DFHERRNSRGUiVFRPSDUWLUIRWRJUDItDV \YtGHRVGHWXVPRPHQWRVIDPLOLDUHVPiV YDOLRVRVKDFHUHODSUHQGL]DMHGHORV QLxRVPiVGLYHUWLGRFRQ.LGVHLQFOXVR SRGUiVPDQWHQHUWHHQIRUPDFRQODQXHYD DSOLFDFLyQ)LWQHVV(LQFOXVRSRGUiV JUDEDUSDUDU\UHSURGXFLUFXDQGRGHVHHV JUDFLDVDVXIXQFLyQ5HF 3OD\8QRV WHOHYLVRUHVSDUDGLVIUXWDUGHODLPDJHQPiV UHDO\DSDVLRQDQWHDKRUDHQ6HSWLHPEUH DXQRVSUHFLRVHVSHFWDFXODUHV

´´

&$5$&7(5Ë67,&$67e&1,&$6 ‡[3)XOO+'‡'+\SHU5HDO(QJLQH ‡+]&OHDU0RWLRQ5DWH‡'ROE\'LJLWDO3OXV'ROE\3XOVH ‡6567KHDWHU6RXQG‡6PDUW&RQWHQW‡&RQQHFW6KDUHŒ 0RYLH‡3HUVRQDO9LGHR5HFRUGHU5HDG\‡[+'0,70 ‡[86%‡3HDQDJLUDWRULD L]TGHU ‡6LQWRQL]DGRU 7'7)XOO+'‡0HGLGDV $[+[) ´[[ FPFRQSHDQD[[FP´ [[FPFRQSHDQD[[FP ‡8QPXQGRSHUIHFWR'3HVR´NJFRQSHDQD NJ´NJFRQSHDQDNJ

/('6PDUW796DPVXQJ8((6 *DIDV' ´8((6

6HSWLHPEUH

€

6yORKDVWD

´8((6

€

6HSWLHPEUH

6yORKDVWD

€0HV

€0HV

5I

5I

393)LQDODSOD]RV€ 393+DELWXDO€

393)LQDODSOD]RV€ 393+DELWXDO€

FXRWDV6,1(175$'$ 7$(7,1

5HSURGXFWRU%OXUD\70'6PDUW79 6DPVXQJ%'(

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I

(ODFFHVRULRLPSUHVFLQGLEOHSDUDGLVIUXWDUGHO' 6LWLHQHVXQWHOHYLVRU 6DPVXQJFRQWHFQRORJtD'QRWHSXHGHQIDOWDUHVWDV SUiFWLFDVJDIDVFRQODVTXHYLYLUiVDOPi[LPRWXPHMRUH[SHULHQFLDWULGLPHQVLRQDO 6LPSOHPHQWHSyQWHODV\YHUiVFRPRODVLPiJHQHVGHWXVSHOtFXODVVDOHQGHODSDQWDOOD FREUDQGRYLGDSURSLD 3DFNJDIDV')XOO+'6DPVXQJ66*3

€

*DVWRVGHHQYtR

¼

5I% &RPSDWLEOHVFRQWRGRVORVPRGHORV6DPVXQJ/(' '\3ODVPD'GHODVVHULHV'\(6 \

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

7HFQRORJtD\GLVHxRVyORSDUDWXVRMRV /DVQXHYDVWHFQRORJtDVFDGDYH]QRVRIUHFHQPD\RUFDOLGDG\FRPRGLGDGHVORTXHQRVSHUPLWHWHQHUOR~OWLPRSDUDGLVIUXWDUGHOHQWUHWHQLPLHQWR (VWHSUR\HFWRU/*GHXQWDPDxRFRPSDFWR\PRGHUQRQRRFXSDUiQDGDGHHVSDFLRHQWXVDOyQ\WHSHUPLWLUiFUHDUXQHVWLOR~QLFR\GLVIUXWDU GHXQDH[SHULHQFLDPXFKRPiVGLYHUWLGD6XWHFQRORJtD/('RIUHFHPiVGHKRUDVGHXVR\XQDJUDQUHVROXFLyQ\FRQWUDVWHSDUD REWHQHUXQRVFRORUHVGH¿QLGRV\YLYRV'LVIUXWDUiVGHODPi[LPDFDOLGDGGHLPDJHQ'LY;+'HQWXVSHOtFXODVIRWRJUDItDVYLGHRMXHJRV« DGHPiVSRGUiVGHUHSURGXFLUWXVFDQFLRQHVHQ037DPELpQSXHGHVFRQHFWDURWURVGLVSRVLWLYRVH[WHUQRVDWUDYpVGHVX86%\VXVRWUDV FRQH[LRQHV7HQGUiVWRWDOYHUVDWLOLGDGSDUDSUR\HFWDUDORJUDQGHODVPHMRUHVLPiJHQHV\DKRUDHQHVWDRIHUWD~QLFDUHFLELUiVXQDSDQWDOODGH ´GH5(*$/2SDUDHPSH]DUDGLVIUXWDUGHVGHHOSULPHUGtD 3UR\HFWRU/*3%*$(8 5(*$/23DQWDOOD´/*301 YDORUDGRHQ€

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

5I

5(*$/2 3DQWDOODGHSUR\HFFLyQ´/*301 5(*$/2 YDORUDGRHQ¼

´

0HGLGDV $[+[) [[FP 3HVRJ

£'RVHTXLSRVHQXQRGHVGHVyOR€ /('FRQ'9'HQ´\´ 'PWHFKWHRIUHFHVXWHOHYLVRUH[WUDSODQR/('HQ´R´FRQOD~OWLPDWHFQRORJtDSDUDTXHGLVIUXWHVDOPi[LPRGHWRGDVODVRSFLRQHVGH HQWUHWHQLPLHQWRDXGLRYLVXDO8QWHOHYLVRUTXHLQFRUSRUDOHFWRU'9''LY;XQDPDQHUDVHQFLOOD\FyPRGDSDUDGLVIUXWDUFRPRQXQFDGHWXV SHOtFXODVIDYRULWDV3UHVHQWDDGHPiV7'7GH$OWD'H¿QLFLyQ\86%JUDEDGRUTXHWHSHUPLWLUiJUDEDUHVRVSURJUDPDVGHWHOHYLVLyQTXHWDQWR WHJXVWDQHLQFOXVRUHSURGXFLUIRWRJUDItDVYtGHRV\P~VLFD&RQXQVRQLGRHVSHFWDFXODU\XQGLVHxRSHUIHFWRGHVyORFPGHIRQGR(OLMHHO WDPDxRTXHPHMRUWHYHQJD´R´\HOFRORUTXHPiVWHJXVWHHQEODQFRRQHJUR\SiJDORHQFyPRGDVFXRWDV$VtGHIiFLO /('FRQ'9'LQWHJUDGR'PHWFK ´'0/(';+

FXRWDV

€0HV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

´´

1HJUR5I %ODQFR5I ´'0/(';+

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

1HJUR5I %ODQFR5I

&$5$&7(5Ë67,&$67e&1,&$6 ‡5HVROXFLyQ´[S´[S ‡/HFWRU'9''LY; FRPSDWLEOHFRQ'9'&''$ ;9,'03(*9&'69&'.RGDN$9,03 ‡[+'0,70‡[86%JUDEDGRU‡5HFHSWRU7'7 )XOO+'‡0HGLGDV $[+[) ´[[ FPFRQSHDQD[[FP´ [[FPFRQSHDQD[[FP ‡3HVR´NJFRQSHDQDNJ´NJ FRQSHDQDNJ



Recibe el pedido donde tú quieras 7~HOLJHVHOOXJDUGHHQWUHJD

/7&LQGG




(OHFWUyQLFD

,PiJHQHVSDUDYHU\JUDEDU£SRUVyOR€ (VWHRWRxRHVWUHQDLPiJHQHVGHFDOLGDGFRQHOWHOHYLVRU/('+DLHUGH´TXHWHSUHVHQWDPRV3RUVyOR€GLVIUXWDUiVHQ WXKRJDUGHXQGLVHxRHVSHFWDFXODU\GHODWHFQRORJtDPiVDYDQ]DGDSDUDGLVIUXWDUGHDXWpQWLFDVLPiJHQHVFRQWRGDODFDOLGDG TXHVHPHUHFHQHQ$OWD'H¿QLFLyQ$GHPiVLQWHJUDIXQFLyQ7LPH6KLIWTXHWHSHUPLWLUiJUDEDUWXVVHULHVRSURJUDPDV IDYRULWRVHLQFOXVRSDUDUDYDQ]DURUHWURFHGHUODHPLVLyQHQGLUHFWR6LQGXGDXQDJUDQRIHUWD KHFKDSDUDWL /('´+DLHU/(77+)

6HSWLHPEUH

€

´

6yORKDVWD

€0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393+DELWXDO€

5I

&$5$&7(5Ë67,&$67e&1,&$6 ‡[S‡FGP‡ ‡[+'0,70Â[86%UHSURGXFWRUJUDEDGRU ‡5HFHSWRU7'7)XOO+'‡0HGLGDV $[+[)  [[FPFRQSHDQD[[FP ‡3HVRNJFRQSHDQDNJ

3HTXHxRSHURSRWHQWH

£,QWHUQHWHQWXWHOHYLVLyQFRQHO

DGDSWDGRUXQLYHUVDO6PDUW79GH/* <DSXHGHVGLVIUXWDUGHORVFRQWHQLGRVGH,QWHUQHWGLUHFWDPHQWH HQWXWHOHYLVRUFRQHVWHDGDSWDGRUXQLYHUVDO6PDUW79GH/*8Q GLVSRVLWLYRSHUIHFWRSDUDFRQYHUWLUWXWHOHYLVLyQHQXQFHQWUR DXGLRYLVXDOLQWHOLJHQWHFRQDFFHVRD,QWHUQHWVLQQHFHVLGDGGH FRQHFWDUXQRUGHQDGRUGHIRUPDWRWDOPHQWHLQDOiPEULFDFRQHO TXHWDPELpQSRGUiVGLVIUXWDUGHYLGHRFOXEHVDODFDUWDGHWXV VHULHVIDYRULWDV\GHPXOWLWXGGHDSOLFDFLRQHVRQOLQH,QFOXVR SRGUiVDFFHGHUDWXVDUFKLYRVDOPDFHQDGRVHQWXRUGHQDGRUSDUD UHSURGXFLUWXP~VLFDYtGHRVIRWRJUDItDVVLPSOHPHQWHXWLOL]DQGR VXPDQGRDGLVWDQFLD0DJLF&RQWUROTXHWHSHUPLWLUiPDQHMDU HOUHSURGXFWRUGHIRUPDVHQFLOODGLYHUWLGDHLQWXLWLYDFRPRVLIXHUD XQUDWyQLQDOiPEULFR£/DIRUPDPiVVHQFLOODHLQWHOLJHQWHGHYHUOD WHOHYLVLyQ $GDSWDGRUXQLYHUVDO60$5779 /*63

6LOOHYDVWXVFRQWHQLGRVIDYRULWRVDWRGDVSDUWHVHQWXL3KRQHRL3RG ¢SRUTXpQRGLVIUXWDUGHHOORVWDPELpQHQFDVDFRQODPHMRUFDOLGDG" (VWHGRFNLQJ/*WHFRQHFWDGLUHFWDPHQWHFRQWXL3KRQHRL3RG GHIRUPDVHQFLOODDWUDYpVGHVXEDVH\WDPELpQFRQFXDOTXLHU GLVSRVLWLYRDWUDYpVGHVXHQWUDGDGHDXGLRORTXHWHSHUPLWLUi UHSURGXFLUP~VLFDSHOtFXODVRIRWRV(ODOWDYR]LQFRUSRUD%DVV 5pÀH[SDUDXQRVJUDYHVSHUIHFWRV\UHSURGXFHDXGLRFRQXQD FDOLGDGFDOLGH]\QLWLGH]VRUSUHQGHQWHVHQVXFDWHJRUtD7DPELpQ FXHQWDFRQUDGLRUHORM\DODUPD/DGRFNLQJPiVFRPSOHWD\ SRWHQWHSDUDDXPHQWDUWXGLYHUVLyQHQFDVD 0HGLGDV $[+[) [[FP 'RFNLQJFRQUDGLR\ GHVSHUWDGRU/*1'

€

R *DVWRVGHHQYtR

¼

5I%

€

5I

&$5$&7(5Ë67,&$67e&1,&$6 ‡1DYHJDFLyQ/LEUHHQ,QWHUQHW‡)ODVK‡:L)L,QWHJUDGR‡'/1$&,)6SDUDFRPSDUWLUDUFKLYRV FRQ3&‡&RPSDWLEOHFRQUDWRQHV\WHFODGRVLQDOiPEULFRV‡[+'0,70‡[86%SOXV'LY; +'‡0HGLGDV $[+[) [[FP

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

9È/,'27$1723$5$,3+21(2,32' &2023$5$&8$/48,(52752 ',6326,7,92'(0Ò6,&$

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

/('´\´FRQJUDEDGRU £SHUIHFWRVSDUDFXDOTXLHUHVSDFLR $SURYHFKDFXDOTXLHUHVSDFLRSDUDGLVIUXWDUGHODWHOHYLVLyQDKRUDDXQRVSUHFLRVUHDOPHQWHDVHTXLEOHV'HVGHVyOR€ FRQVLJXHHVWRV/('GH´\´13*FRQORVTXHSRGUiVYHUWXVSURJUDPDVIDYRULWRVHQFXDOTXLHUKDELWDFLyQGHWX KRJDUGRUPLWRULRKDELWDFLyQGHORVQLxRVFRFLQDWHUUD]D«8QRVHTXLSRVTXHLQWHJUDQWRGRORQHFHVDULR SDUDUHSURGXFLUORVFRQWHQLGRVFRQWRWDOFDOLGDG7'7GH$OWD'H¿QLFLyQJUDEDGRUGLJLWDOFRQ IXQFLyQ7LPH6KLIWTXHWHSHUPLWLUiJUDEDUHLQFOXVRSDUDUDYDQ]DURUHWURFHGHUOD HPLVLyQHQGLUHFWR\FRQH[LyQ86%SDUDUHSURGXFLUWRGDWXP~VLFDIRWRVR YtGHRVGHVGHXQGLVSRVLWLYRH[WHUQR$SURYHFKDHVWDRSRUWXQLGDG \OOpYDWHWXWHOHYLVRU/('GH´R´FRQWRGDVODV SUHVWDFLRQHV£DKRUDDXQSUHFLRLQFUHtEOH

´´

/('´13*1/++%

/('´13*1/++%

5I

5I

€

€

3DJRDSOD]DGR 6,1(175$'$ &RQV~OWDQRV

&$5$&7(5Ë67,&$67e&1,&$6 ‡5HVROXFLyQ´[S´[S‡%ULOOR´ FGP´FGP‡7LPH6KLIW‡[+'0,70‡[86% JUDEDGRU‡0HGLGDV $[+[) ´[[FP FRQSHDQD[[FP´[[FPFRQ SHDQD[[FP‡3HVR´NJFRQSHDQD NJ´NJFRQSHDQDNJ

3RUVyOR€GLVIUXWDGHOPHMRU FLQH£GRQGHTXLHUDV

8QVRQLGRHVSHFWDFXODUXQ SUHFLRIDQWiVWLFR

$KRUDGLVIUXWDUGHOPHMRUFLQHHQFXDOTXLHUOXJDUVLQFDEOHV\ VLQLQVWDODFLRQHVHVSRVLEOHFRQHVWHUHSURGXFWRUSRUWiWLO8Q UHSURGXFWRUGH'9'GH´FRQSDQWDOODJLUDWRULDžTXH WHSHUPLWLUiFRORFDUORHQHOPHMRUiQJXORSDUDXQDYLVXDOL]DFLyQ SHUIHFWD3RGUiVYHUWXVIRWRJUDItDVHVFXFKDUP~VLFDVLQWRQL]DUOD UDGLR\UHSURGXFLUWXVSHOtFXODVFRQODPHMRUFDOLGDG$GHPiVLQFOX\H IXQFLyQGHJUDEDFLyQGH7'7DWUDYpVGHXQGLVSRVLWLYRH[WHUQR< SDUDHYLWDUVDOWRVGXUDQWHODUHSURGXFFLyQLQFOX\HVLVWHPDDQWLVKRFN V\VWHP7RGDVODVFRPRGLGDGHVHQXQUHSURGXFWRUSRUWiWLOTXHVyOR WHFRVWDUi€

13*WHRIUHFHXQDRIHUWDVHQVDFLRQDOSDUDWRGRVDTXHOORVTXHTXLHUHQ WUDQVIRUPDUVXVDOyQHQXQDVDODGHFLQH8QDRIHUWDFRPSXHVWD SRUXQDEDUUDGHVRQLGRGHHVSHFWDFXODUGLVHxRTXHPHMRUDUiHO VRQLGRGHWXWHOHYLVRU\FRQDPSOL¿FDGRULQWHJUDGRGHFDQDOHV SRWHQFLDGH:\GLVSOD\/('SDUDFRQWURODUWRGDVVXVIXQFLRQHV 8QSHTXHxRHTXLSRFRQXQVRQLGRIDQWiVWLFRTXHVHUHIXHU]DFRQ HO6XEZRRIHUTXHWHSUHVHQWDPRV/DVHQVDFLyQVHUiPiVTXH HPRFLRQDQWHJUDFLDVDVXHVSHFWDFXODUVDOLGDGHJUDYHV8QD RSRUWXQLGDG~QLFDHQXQDRIHUWDWDQVRUSUHQGHQWHWDQWRSRUVXVRQLGR FRPRSRUVXSUHFLRSRUVyOR€

´ '9'SRUWiWLO´JLUDWRULDž JUDEDGRUFRQ7'713*3'7,5

€

5I 0HGLGDV[[FP 3HVRJ

,1&/8<( ‡0DQGRPXOWLIXQFLyQ‡$QWHQDSRUWiWLO‡%DWHUtDUHFDUJDEOH/L,RQP$K 'XUDFLyQK±PRGRUHSURGXFFLyQ'9'KPRGR7'7 ‡$GDSWDGRUSDUDFRFKH ‡%ROVDGHWUDQVSRUWH



%DUUDGHVRQLGR13*$&% 6XEZRRIHU13*6:&%

€

5I

 &$5$&7(5Ë67,&$67e&1,&$6 ‡$OWDYRFHVEDUUDIURQWDOHV ´[ [VXEZRRIHU ´[ ‡3RWHQFLDWRWDOEDUUD: IURQWDOHV:[ VXEZRRIHU:‡0HGLGDV $[+[) EDUUD[[FP VXEZRRIHU[[FP‡3HVREDUUDNJVXEZRRIHUNJ

7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG




(OHFWUyQLFD

,QDXJXUDODQXHYDWHPSRUDGDGHFLQHHQ' /('6PDUW79´\´/*FRQWHFQRORJtD'£GHVGHVyOR€

(OFLQHHQ'HVXQDH[SHULHQFLDLQROYLGDEOH<DKRUDWLHQHVODSRVLELOLGDGGHGLVIUXWDUORHQSDQWDOODJUDQGHHQWXKRJDUFRQWXVIDPLOLDUHV \DPLJRV\DXQSUHFLRUHDOPHQWHHFRQyPLFR(OHQWUHWHQLPLHQWRHPSLH]DFRQHVWRVWHOHYLVRUHV/('6PDUW79GH/*GH´\´ 6LpQWDWHSRQWHFyPRGR\GLVIUXWDGHLPiJHQHVTXHUHDOPHQWHVDOHQGHODSDQWDOODFRQODWHFQRORJtD'PiVLQQRYDGRUD$FFHGHD,QWHUQHWVLQ QHFHVLGDGGHFRQHFWDUXQRUGHQDGRUGLVIUXWDGHYLGHRFOXEHVDODFDUWDGHWXVVHULHVIDYRULWDVGHPLOHVGHDSOLFDFLRQHVRQOLQH«<FXDQGRQR WHQJDVWLHPSRXWLOL]DHOSXHUWR86%JUDEDGRUFRQXQ'LVFR'XURH[WHUQR\JUDEDWXVSHOtFXODVIDYRULWDVSDUDUHWURFHGHDYDQ]D\UHSLWHODV PHMRUHVVHFXHQFLDVGHOD79HQGLUHFWRFXDQWDVYHFHVTXLHUDV7RGRHVWRFRQXQGLVHxRGLJQRGHDGPLUDU1RSLHUGDVHVWDRSRUWXQLGDGHVWUHQD ODQXHYDWHPSRUDGDGHFLQHHQ'DKRUDHQ6HSWLHPEUHDOPHMRUSUHFLR$GHPiVGH5(*$/2UHFLELUiVJDIDV'/*\XQPDQGR 0DJLF&RQWUROTXHSRGUiVPDQHMDUFRPRXQUDWyQLQDOiPEULFR6yORVHOHFFLRQDKD]FOLFNRJHVWLFXOD\XWLOL]DODUXHGDSDUDQDYHJDUPiV FyPRGDPHQWHSRU,QWHUQHWRFDPELDUPiVUiSLGRGHFDQDO

´´

/('6PDUW79&LQHPD'/*/06 5(*$/2JDIDV'JDID'FOLS2Q\PDQGR0DJLF&RQWURO ´/06 393727$/

€

´/06 393727$/

€

6HSWLHPEUH

6HSWLHPEUH

6yORKDVWD

6yORKDVWD

€0HV

€0HV

393+DELWXDO€

393+DELWXDO€

5I

5I

5(*$/2 JDIDV' JDID'FOLS2Q \PDQGR0DJLF&RQWURO

),1$1&,$&,Ï1(;&/86,9$ FXRWDV6,1,17(5(6(6 7$(7,1

&$5$&7(5Ë67,&$67e&1,&$6 ‡[S)XOO+'‡0&,+]‡3URFHVDGRU7ULSOH;'(QJLQH)+''‡6RQLGR,Q¿QLWH'6XUURXQG\&OHDU9RLFH,,‡:L)L,QWHJUDGR‡'/1$‡'XDO3OD\HU5HDG\‡7LPH6KLIW‡[+'0,Œ ‡[86%‡3HDQD*LUDWRULD‡5HFHSWRU7'7)XOO+'‡0HGLGDV $[+[) ´[[FPFRQSHDQD[[FP´[[FPFRQSHDQD[[FP ‡3HVRNJFRQSHDQDNJ´NJFRQSHDQDNJ

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD $OWDGH¿QLFLyQSDUDWXVVHQWLGRV 'XUDQWHHOPHVGH6HSWLHPEUHSRQHPRVDWXGLVSRVLFLyQODSDUHMDSHUIHFWDSDUDTXHGLVIUXWHVGHWRGRVWXVFRQWHQLGRV DXGLRYLVXDOHV(VWRVDXULFXODUHV(OEHFRQXQDOFDQFHGHP HQFDPSROLEUH SURSRUFLRQDQXQVRQLGRVLHPSUHQtWLGR \DTXHGLVSRQHGHXQHPLVRUGHUDGLRIUHFXHQFLDGH0+]\WUHVFDQDOHVGHWUDQVPLVLyQSDUDHYLWDULQWHUIHUHQFLDV <DGHPiVHVWHUHSURGXFWRU'9'FRQ7'7HVXQDRSFLyQFyPRGD\SUiFWLFDSDUDGLVIUXWDUGHWRGDVWXVSHOtFXODVHQ FDVLWRGRVORVIRUPDWRV,QWHJUDFRQH[LyQ86%OHFWRUGHWDUMHWDV\VDOLGD+'0,70SDUDUHSURGXFLUWXVDUFKLYRVGHRWURV GLVSRVLWLYRVIRUPDVHQFLOODFRQODPHMRUFDOLGDG£8QDFRPELQDFLyQGHSHOtFXOD 5HSURGXFWRU'9'FRQ 7'7(OEH'9'7'7

6Ï/2



$XULFXODU$85) 5DGLRIUHFXHQFLD(OEH

€

€

81,'$'(6

*DVWRVGHHQYtR

¼

5I%

*DVWRVGHHQYtR

6yORKDVWD 393+DELWXDO€

¼

5I% 6yORKDVWD 393+DELWXDO€

I

0HGLGDVDXULFXODU $[+[) [[FPEDVH[[FP FRQMXQWR[[FP3HVRDXULFXODUJEDVHJFRQMXQWRJ

0HGLGDV $[+[) [[FP3HVRNJ

/DYLGHRFiPDUD7ULSOHGH6DPVXQJ ]RRPySWLFR[´/&'\KRUDVGHDXWRQRPtD /DYLGHRFiPDUD7ULSOHXQQXHYRFRQFHSWRGH6DPVXQJTXHLQWHJUD ODWHFQRORJtDPiVDYDQ]DGDSDUDUHDOL]DUXQDVJUDEDFLRQHVSHUIHFWDVHQ FXDOTXLHUFLUFXQVWDQFLD7HFQRORJtD)XOO+'SDUDLPiJHQHVWDQSHUIHFWDVFRPR ODUHDOLGDGFRQSDQWDOODWiFWLO/&'GH´]RRPySWLFR[\XQDEDWHUtD GHXQDGXUDFLyQGHKRUDVODSULPHUDTXHGXUDWDQWRWLHPSRFRQWLQXDGR SDUDTXHQRVHFRUWHODJUDEDFLyQHQORVPRPHQWRVPiVLPSRUWDQWHV/DQXHYD GHILQLFLyQGHYLGHRFiPDUDVHV7ULSOHGH6DPVXQJ&RQVtJXHODDKRUDVLQ HQWUDGDSRUVyOR€DOPHV 

/ 

6

6



9LGHRFiPDUD)XOO+'6DPVXQJ+0;+

€

3 7 3

€

€0HV FXRWDV6,1(175$'$

5

393)LQDODSOD]RV€ 7$(7,1 ´

1HJUD5I 5RMD5I 0HGLGDV $[+[) [[FP3HVRJ

6Ï/2



81,'$'(6

6Ï/2



81,'$'(6

7UDQVPLWHODVVHxDOHVDRWURVWHOHYLVRUHV£VLQLQWHUIHUHQFLDV (OQXHYR$93OXV,,,SXHGHWUDQVPLWLUFXDOTXLHUVHxDOGHDXGLR\YtGHRGHXQWHOHYLVRUDRWUR£VLQFDEOHV<DKRUDFRQXQDIUHFXHQFLDPiVDOWD GH*+]TXHQRSURYRFDQLQJ~QWLSRGHLQWHUIHUHQFLDFRQWXUHG:L)LQLFRQRWURVDSDUDWRVHOHFWUyQLFRV6LWLHQHV'LJLWDO,PDJHQLR SRGUiVYHUWXVSURJUDPDVIDYRULWRVHQFXDOTXLHUWHOHYLVRUGHFDVDVLPSOHPHQWHFRQHFWDQGRHOHPLVRUDWXGHFRGLILFDGRU\HOUHFHSWRUHQOD KDELWDFLyQTXHSUHILHUDV7DPELpQSRGUiVYHUODSURJUDPDFLyQGHOD7'7)XOO+'HQHOWHOHYLVRUTXHHOLMDVRYHUSHOtFXODVGHWX'9'HVFXFKDU ODP~VLFDGHWXHTXLSRHLQFOXVRYHUODVLPiJHQHVGHWXFiPDUDGHYtGHR/OpYDWHHOSDFNFRPSXHVWRSRUHPLVRU\UHFHSWRUSRU€\ SRUVROR€XQUHFHSWRUDGLFLRQDO

8

1 ' F S

7UDQVPLVRU$9LQDOiPEULFR*+]$Y3OXV,,, 09 LQFOX\HHPLVRU\UHFHSWRU 

€

5I 5HFHSWRUDGLFLRQDO$Y3OXV,,,*+]

€

5I

TDT SAT TV CABLE VCR/DVD CAMERA

RECEPTOR

EMISOR



Atención al cliente $WXGLVSRVLFLyQSDUDFXDOTXLHUFRQVXOWD

/7&LQGG

*D 9HU


(OHFWUyQLFD

2WUDPDQHUDGHYHUWHOHYLVLyQ





7HFQRORJtD/('',QWHUQHW-XHJRV«HQ´ 6DPVXQJWHRIUHFHXQDQXHYDGLPHQVLyQGHOHQWUHWHQLPLHQWRFRQVXWHOHYLVRU/('6PDUW79' HQ´8QDDWUDFWLYDIRUPDGHGLVIUXWDUGHWXVSHOtFXODVVHULHVGHSRUWHV«\WDPELpQ GH,QWHUQHWGLUHFWDPHQWHHQWXVDOyQ&RQXQGLVHxRFRQPDUFR XOWUDGHOJDGRHVWHWHOHYLVRUWHSHUPLWLUi HQWUHWHQHUWHFRQODVDSOLFDFLRQHV GHUHGHVVRFLDOHVHLQFOXVR PDQWHQHUWHHQIRUPD\KDFHU GLVIUXWDUDORVPiVSHTXHxRVFRQ VXIXQFLyQ6PDUW&RQWHQW3HUR DGHPiVSRGUiVJUDEDUSDUDU\ UHSURGXFLUJUDFLDVDVXIXQFLyQ 5HF 3OD\7RGRFRQXQDVHULHGH IXQFLRQHVTXHWHSURSRUFLRQDUiQ XQDLPDJHQ\DXGLRPiV QtWLGRV\GHWDOODGRVHQ$OWD 'H¿QLFLyQ1RWHORV SLHUGDVSRUTXHDKRUD OD~OWLPDWHFQRORJtD DXGLRYLVXDOGH 6DPVXQJSXHGH VHUWX\D

´

/('´6PDUW79'6DPVXQJ8((6 *DIDV'

â&#x201A;¬

6HSWLHPEUH

6yORKDVWD

â&#x201A;¬0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RVâ&#x201A;¬ 7$(7,1 393+DELWXDOâ&#x201A;¬

5I

&$5$&7(5Ã&#x2039;67,&$67e&1,&$6 Â&#x2021;5HVROXFLyQ[S)XOO+'Â&#x2021;'+\SHU5HDO(QJLQHÂ&#x2021;+]&OHDU0RWLRQ5DWHÂ&#x2021;'ROE\'LJLWDO3OXV'ROE\3XOVHÂ&#x2021;6567KHDWHU6RXQGÂ&#x2021;:L)L'LUHFWÂ&#x2021;3HUVRQDO9LGHR5HFRUGHU5HDG\ 3935 Â&#x2021;$OO6KDUHÂ&#x2021;[+'0,70Â&#x2021;[86%Â&#x2021;3HDQDJLUDWRULD L]TGHU Â&#x2021;6LQWRQL]DGRU7'7+'Â&#x2021;0HGLGDV $[+[) [[FPFRQSHDQD[[FP Â&#x2021;3HVRNJFRQSHDQDNJ

8QQLYHOVXSHULRUHQLPDJHQ\VRQLGR 

1RWHSLHUGDVHVWH+RPH&LQHPDGH6DPVXQJ(OPHMRUFRPSOHPHQWRDXGLRYLVXDOSDUDWXKRJDUFRQHOTXHGLVIUXWDUiVGHWXVSHOtFXODVHQ '9'FRQXQDFDOLGDGVXSHULRU8Q+RPH&LQHPDFRQ:GHSRWHQFLD%':LVH$Q\QHW6DOLGD+'0,70VRQLGR'ROE\'LJLWDO\ FRPSDWLEOHFRQIRUPDWRVGHDXGLR\YtGHR$GHPiVVXGLVHxRPiVTXHSHUIHFWRKDUiTXHOX]FDHQWXKRJDUFRPRXQDREUDGHDUWH1R SLHUGDVHVWDRSRUWXQLGDGODPHMRUFDOLGDGGHLPDJHQ\VRQLGRHQWXVPDQRV

U

+RPH&LQHPD6DPVXQJ+7(

â&#x201A;¬

6HSWLHPEUH

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I 0HGLGDV $[+[) [[FP3HVRNJ

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD â&#x201A;¬  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

6DPVXQJ*DOD[\PiVDSOLFDFLRQHVPiVGLYHUVLyQ 7HSUHVHQWDPRVXQRVVPDUWSKRQHVFRQORVTXHSRGUiVFRQHFWDUWHFRPSDUWLU\GHVFXEULUOR~OWLPRHQWHFQRORJtDPyYLO1RWHSLHUGDVHO6DPVXQJ *DOD[\0LQLFRQPHMRUYLVXDOL]DFLyQPiVFDSDFLGDG\XQGLVHxRPiVIUHVFR\PRGHUQR&RQXQDSDQWDOOD7)7GH´PiVJUDQGHQtWLGD \EULOODQWHFiPDUDGHPHJDSt[HOHV*%GHFDSDFLGDG\XQSRWHQWHSURFHVDGRUGH0+]TXHWHDVHJXUDUiXQUiSLGRLQLFLRHQODV DSOLFDFLRQHV\XQDPD\RUÃ&#x20AC;XLGH]DODKRUDGHQDYHJDU3RGUiVGHVFDUJDUWHWRGDVODVDSOLFDFLRQHVGH*RRJOHPDQWHQHUWHHQFRQWDFWRFRQWXVDPLJRV HVFXFKDUP~VLFD«3HURVLWRGDYtDTXLHUHVPiVSUHVWDFLRQHVWXRSFLyQHVHO6DPVXQJ*DOD[\6,,,&DUDFWHUtVWLFDVFRPRPDQWHQHUVXSDQWDOOD HQFHQGLGDYLQFXODUODVIRWRVGHWXiOEXPDORVSHU¿OHVGHUHGHVVRFLDOHVGHWXVDPLJRVVRQVyORDOJXQDVGHVXVIXQFLRQDOLGDGHV8QVPDUWSKRQHFRQ VLVWHPDRSHUDWLYR$QGURLG\*%GHFDSDFLGDGTXHSRGUiVPDQHMDUFRQWXSURSLDYR]<ORPHMRUGHWRGRHQVXSDQWDOODWiFWLO6~SHU $02/('+'GH´SRGUiVYHUXQYtGHR+'HQXQDYHQWDQDDOPLVPRWLHPSRTXHHVFULEHVXQPHQVDMHGHWH[WRRXQHPDLO(OLJHWXPRGHOR\ SiJDORHQFyPRGDVFXRWDV 6PDUWSKRQHOLEUH6DPVXQJ*DOD[\6,,,

â&#x201A;¬0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RVâ&#x201A;¬ 7$(7,1 393â&#x201A;¬

6PDUWSKRQHOLEUH6DPVXQJ*DOD[\0LQL

%ODQFR5I&71 $]XO5I&7-

â&#x201A;¬

6HSWLHPEUH

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I&/&

'LVSRQLEOHWDPELpQHQD]XO

0HGLGDV $[+[) [[FP 3HVRJ

0HGLGDV $[+[) [[FP3HVRJ

5HFXSHUDODHVHQFLDGHOWHOpIRQRFDOLGDG\FRPRGLGDG +DEODSRUWHOpIRQRGHXQDPDQHUDPiVFyPRGD\FRQPD\RUFDOLGDGFRQHOLQQRYDGRUH3XUH0RELOHHOWHOpIRQRSHUIHFWRSDUDGLVIUXWDUGH ODVPHMRUHVOODPDGDVHQFDVDH3XUH0RELOHHVXQDPH]FODGHGLVHxRWUDGLFLRQDO\PRGHUQRFRQXQDWHFQRORJtDGHYDQJXDUGLDTXHWH SURSRUFLRQDUiPD\RUFRPRGLGDG\XQDFDOLGDGVXSHULRUGHVRQLGR6RORWLHQHVTXHFRQHFWDUWXWHOpIRQRPyYLOWDEOHWR3&DH3XUH0RELOH \KDEODUSRUHODXULFXODUGHXQDIRUPDPXFKRPiVFyPRGD\EHQH¿FLRVDSDUDODVDOXG\DTXHUHGXFHODFDQWLGDGGHUDGLDFLyQTXHUHFLEH HOFXHUSRDOGLULJLUODVRQGDVGHOWHOpIRQRPyYLOOHMRVGHODFDEH]D(VWiQGLVSRQLEOHVGRVPRGHORVH3XUH0RELOHFRQFDEOH\H3XUH0RELOH LQDOiPEULFRTXHLQFRUSRUDDGHPiVRWUDVIXQFLRQHVFRPRPDQRVOLEUHVSDQWDOODGH´\(FR0RGHTXHUHGXFHODSRWHQFLDGHHPLVLyQ (OLJHHOWX\R\UHFXSHUDODFRPRGLGDGGHWXVOODPDGDV

$XULFXODUFRQFDEOH 6ZLVVYRLFH&+ *DVWRVGHHQYtR

¼

â&#x201A;¬

5RVD5I% $]XO5I% 9HUGH5I%

'LVSRQLEOHWDPELpQHQYHUGH\D]XO $XULFXODULQDOiPEULFR 6ZLVVYRLFH(385(

L3KRQHQRLQFOXLGR

â&#x201A;¬

%ODQFR5I 1HJUR5I

0HGLGDV $[+[) &+[[FP (SXUH[[FP 3HVRJ



'LVSRQLEOHWDPELpQ HQEODQFR

/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG




(OHFWUyQLFD

3ULPHURVSODQRVIRWRJUDItDVSDQRUiPLFDV FDOLGDGUpÀH[\WHFQRORJtDGLJLWDO 'DHOSULPHUSDVRHQHOPXQGRGHODIRWRJUDItDFRQ&DQRQ(26'8QDFiPDUDUpÀH[GLJLWDODYDQ]DGDTXHLQWHJUDWRGDVODV SUHVWDFLRQHVSDUDFRQVHJXLUUHVXOWDGRVSURIHVLRQDOHVGHODIRUPDPiVVHQFLOOD,QWHJUDXQVHQVRU&026 GHPHJDSt[HOHVSDUDUHDOL]DUIRWRJUDItDVUHDOPHQWHEULOODQWHVFRQGHWDOOHVLPSUHVLRQDQWHV\XQ SURFHVDGRUGHLPDJHQ',*,&TXHWHSURSRUFLRQDUiHQFDGDLPDJHQXQRVFRORUHVPXFKRPiVYLYRV \GH¿QLGRV$WUDYpVGHVXSDQWDOOD/&'GH´SRGUiVDFFHGHUUiSLGDPHQWHDVXPHQ~\ DWUDYpVGHVXVIXQFLRQHVHVSHFLDOHVSRGUiVGDUULHQGDDWXFUHDWLYLGDG\VRUSUHQGHU FRQHVFHQDVGLYHUWLGDV\RULJLQDOHV7DPELpQJUDEDYtGHRV+'\SRGUiVFRPSDUWLU WXVSHOtFXODVDWUDYpVGHVXVDOLGD+'0,Œ1RSLHUGDVHVWDRSRUWXQLGDGWX QXHYDFiPDUD&DQRQMXQWRFRQXQREMHWLYRPPRGREOH REMHWLYRDXQSUHFLRLQVXSHUDEOH<VHDFXDO VHDWXHOHFFLyQWHOOHYDUiVWDPELpQXQRV5(*$/26PX\ HVSHFLDOHV

&iPDUD5HÀH['LJLWDO(26' 5(*$/26%ROVDWUDQVSRUWH7DUMHWD*%/LEUR ³/DVPHMRUHVLPiJHQHV´'9'/HQWHV YDORUDGRHQ€

2EMHWLYR

6HSWLHPEUH

€

6yORKDVWD

€0HV

393)LQDODSOD]RV€ 393+DELWXDO€

1HJUR5I 0DUUyQ5I 2EMHWLYRV\

€

6HSWLHPEUH

6yORKDVWD

€0HV

5(*$/26 5(*$/2

393)LQDODSOD]RV€ 393+DELWXDO€

%ROVDWUDQVSRUWH7DUMHWD*%/LEUR³/DVPHMRUHVLPiJHQHV´ '9'/HQWHV YDORUDGRHQ¼

5I FXRWDV6,1(175$'$ 7$(7,1

´

&$5$&7(5Ë67,&$67e&1,&$6 ‡6HQVRU&026PS[‡6HQVLELOLGDG,62‡3DQWDOOD7)7´‡3URFHVDGRU',*,&‡0RGR(260RYLHSDUDJUDEDFLRQHVGHYtGHR+'‡0HGLGDV $[+[) [[FP 3HVRJ

8QDFiPDUDSHUIHFWDSDUDHOGtDDGtD 'LVIUXWDGHODVPHMRUHVIRWRJUDItDVFRQHVWDFiPDUD&DQRQODFRPSDFWDSHUIHFWDSDUDOOHYDUDOOiGRQGHYD\DV'HXQGLVHxRGHOJDGRIiFLOGH PDQHMDU\GLVSRQLEOHHQFRORUHVPX\DWUDFWLYRVLQFRUSRUDP~OWLSOHVIXQFLRQHVSDUDFDSWXUDULPiJHQHVH[WUDRUGLQDULDVHQWRGRVORVHVFHQDULRV (TXLSDGDFRQXQVHQVRU&026GHPHJDSt[HOHV\',*,&FRQVLJXHUHVXOWDGRVDVRPEURVRVLQFOXVRFRQSRFDOX]HLQWHJUDXQREMHWLYR JUDQDQJXODUGHPPFRQ]RRPySWLFR[6XSDQWDOOD/&'GH´\St[HOHVWHSHUPLWLUiFDSWDUFXDOTXLHUHVFHQDFRQFRPRGLGDG IRWRJUDItDVRYtGHRVHQ)XOO+'8QDFiPDUDTXHWHEULQGDUiGLYHUVLyQ\FDOLGDG\TXHDGHPiVHQHVWDRIHUWDLQFOX\HGH5(*$/2XQDIXQGD \XQDWDUMHWDGH*%

&iPDUDFRPSDFWD,;869XN 5(*$/26%ROVDWUDQVSRUWH7DUMHWD*% YDORUDGRHQ€

€

5(*$/26 5(*$/2

6HSWLHPEUH

%ROVDWUDQVSRUWH7DUMHWD*% YDORUDGRHQ¼

6yORKDVWD

€0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393+DELWXDO€

5RMD5I $]XO5I 5RVD5I 9HUGH5I

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

0HGLGDV $[+[) [[FP 3HVRJ

902 10 30 10

latiendaencasa.es






(OHFWUyQLFD

(OVHFUHWRGHODIRWRJUDItD ´ 8QDIRWRJUDItDSHUIHFWD GHVGHFXDOTXLHUiQJXOR 1RWHSLHUGDVODLQQRYDGRUD6DPVXQJ0XOWL9LHZ09DKRUDHQ 6HSWLHPEUHSRUVyOR€8QDFiPDUDFRPSDFWDFRQXQDQRYHGRVD SDQWDOODWiFWLODEDWLEOHGH´TXHWHSHUPLWLUiFDSWDULQVWDQWiQHDVGHVGH FXDOTXLHUiQJXORVLQHVIXHU]R5HDOL]DUiVODVIRWRJUDItDVPiVGLYHUWLGDV DXWRUUHWUDWRVIRWRJUDItDVDQLYHOGHVXHORRGHOFLHOR«VLPSOHPHQWHFRQ PRYHUODSDQWDOODGHVGHžDž&RQPHJDSt[HOHV]RRPySWLFR [\XQREMHWLYRGHJUDQDQJXODUGHPP &iPDUDGHIRWRV6DPVXQJ09

€

6HSWLHPEUH

6yORKDVWD 393+DELWXDO€

%ODQFD5I 5RMD5I 1HJUD5I 0HGLGDV $[+[) [[FP 3HVRJ

'REOHSDQWDOODQXHYDVDSOLFDFLRQHV«£ODFiPDUDPiVGLYHUWLGD /DFiPDUDGREOHSDQWDOOD6DPVXQJ'9LQFRUSRUDXQDSDQWDOODIURQWDO /&'GH´SDUDKDFHUDXWRUUHWUDWRVFDSWDUODPHMRUVRQULVDGHORVQLxRV RLQPRUWDOL]DUWXPHMRUVDOWR&RQPHJDSt[HOHVGHUHVROXFLyQJUDQ DQJXODUGHPP]RRPySWLFR[\XQDSDQWDOODWUDVHUD/&'GH´ 7DPELpQSRGUiVJUDEDUYtGHRHQ+'8QGLVHxR~QLFRXOWUDFRPSDFWRDKRUD SRUVyOR€\XQDWDUMHWDGHPHPRULDGH*%GH5(*$/2 &iPDUDGHIRWRV6DPVXQJ'91HJUD 5(*$/27DUMHWDPLFUR6'*%

€

€

5I

Ò/7,0$6

´



81,'$'(6

5(*$/2 7DUMHWDPLFUR6' GH*% 0HGLGDV $[+[)  [[FP

3RUVyOR€ODIRWRJUDItDSHUIHFWDHQWXVPDQRV /OpYDWHODPHMRURIHUWDGH)XML¿OPFRPSOHWDDXQSUHFLRH[FHSFLRQDOVRORGXUDQWHHOPHV GH6HSWLHPEUH(VWDFiPDUDGLJLWDOFRPSDFWDWHGDUiXQDUHVROXFLyQLQFUHtEOHJUDFLDV DVXVHQVRUGHPHJDSt[HOHV\]RRPySWLFR[,QFRUSRUDXQDSDQWDOOD/&'GH ´\FXHQWDFRQPXOWLWXGGHIXQFLRQHVTXHWHD\XGDUiQDREWHQHUXQDIRWRJUDItD SHUIHFWDVLQHVIXHU]RFRPRUHHQFXDGUHGHLPiJHQHVHVWDELOL]DFLyQGH LPDJHQUHFRQRFLPLHQWRGHURVWURV«\WDPELpQSRGUiVVXELUWXVIRWRJUDItDV GHIRUPDVHQFLOODD,QWHUQHW(OLJHWXFRORU\FRQVtJXHODHQHVWDRIHUWDTXH LQFOX\HWDPELpQXQDIXQGD\XQDWDUMHWDGHPHPRULD6'GH*% &iPDUDGHIRWRV)XML¿OP-; 5(*$/2)XQGD7DUMHWD*%

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5(*$/2 )XQGD\WDUMHWD*%

3ODWD5I 1HJUD5I $]XO5I 5RVD5I 0RUDGD5I 5RMD5I 0HGLGDV $[+[) [[FP 3HVRJ



Total satisfacción 6LQRTXHGDVVDWLVIHFKRWHGHYROYHPRVWXGLQHUR

/7&LQGG




(OHFWUyQLFD

1XHYDVHPRFLRQHVQXHYRVUHWRVFRQ3OD\6WDWLRQŠ (VWHRWRxRQRWHSLHUGDVODIRUPDPiVLUUHVLVWLEOHGHHQWUHWHQLPLHQWRTXHKHPRVSUHSDUDGRSDUDWL/D3OD\6WDWLRQŠGH*% ODFRQVRODGH6RQ\PiVDWUDFWLYDSDUDYLYLUORVMXHJRVGHXQDIRUPDDSDVLRQDQWHHQXQDRIHUWDTXHLQFOX\HGH5(*$/2XQVHJXQGR PDQGR'XDO6KRFNSDUDGLVIUXWDUGHOMXHJRGHXQDPDQHUDPiVLQWHQVD\UHDO<VLORSUH¿HUHVFDPELDWXIRUPDGHMXJDUFRQ369LWD* :L)LFRQSDQWDOODWiFWLO2/('GH´TXHWHSHUPLWLUiLQWHUDFWXDUGHXQDIRUPDFRPSOHWDPHQWHQXHYD*UDFLDVDVXSDQHOWiFWLOWUDVHUR H[FOXVLYRGH369LWDSRGUiVMXJDUWDPELpQGHVGHODSDUWHWUDVHUD£DOJRQXQFDYLVWRKDVWDDKRUD<VXFRQH[LyQ*:L)LWHSHUPLWLUi FRQHFWDUWHD,QWHUQHWHQFXDOTXLHUOXJDUHQODFDOOHDXWRE~V«\QRSHUGHUWHQLXQPLQXWRGHMXHJR&RQVtJXHODDKRUDMXQWRFRQ*UDYLW\5XVK XQMXHJRTXHWHOOHYDUiDOIXWXUR\WHGDUiSRGHUHVVREUHQDWXUDOHV'RVRSFLRQHVSDUDYLYLUODLQWHQVLGDG3OD\6WDWLRQŠ£DOPHMRUSUHFLR 36*% 5(*$/2ž0DQGR'XDO6KRFN YDORUDGRHQ€ VRORKDVWDHO

369,7$*:L)L-XHJR*UDYLW\5XVK

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1

393€

5(*$/2

5I

5I

6HJXQGR0DQGR'XDO6KRFN YDORUDGRHQ€

6yORKDVWD



6Ï/2

6Ï/2





81,'$'(6

81,'$'(6

6HDFXDOVHDWXHVWLORDSUHQGHFRQHOPpWRGR PiVFRPSOHWR 'LVSRQLEOH WDPELpQHQ FRORUQHJUR \WRVWDGR

6LWHJXVWDODJXLWDUUDDKRUDSXHGHVDSUHQGHUDWRFDUWXHVWLORIDYRULWRFRQHVWRVFRPSOHWRV SDFNV6LWHJXVWDHOHVWLORFOiVLFRWHSURSRQHPRVODJXLWDUUDHVSDxROD'XTXHVD(VWXGLR IDEULFDGDFRQORVPHMRUHVPDWHULDOHVSRU$WDOD\D0XVLFDOGH*UDQDGD6LWHJXVWDHOURFN QRWHSLHUGDVODJXLWDUUDHOpFWULFD(VWUDWRFDVWHU+HDYHQXQPRGHORGHH[FHOHQWHGLVHxR \DFDEDGRFRPSXHVWDSRUWUHVSDVWLOODLQGLYLGXDOHVYROXPHQ\VHOHFWRUGHSDVWLOODVGHFLQFR SRVLFLRQHV(OLJHWXHVWLOR\OOpYDWHGH5(*$/2XQFRPSOHWRFXUVRLQWHUDFWLYRHQ'9' \XQOLEUHWRFRQSDUWLWXUDV 3DFNDSUHQGL]DMHJXLWDUUDHOpFWULFD (VWUDWRFDVWHU+HDYHQ$WDOD\DDFFHVRULRV

€

7RVWDGR5I 1HJUR5I 5RMR5I 3DFNDSUHQGL]DMHJXLWDUUD 'XTXHVD$WDOD\D(VSDxROD DFFHVRULRV

€

5I

*UDEDWXVFLQWDVGH FDVHWHHQIRUPDWR03 $KRUDSXHGHVUHFXSHUDUWRGDODP~VLFDGHWXVFLQWDV GHFDVHWH\FRQVHUYDUODVHQIRUPDWR03&RQHVWD JUDEDGRUDGHFDVHWHGH/DXVRQVHUiPX\VHQFLOOR 6LPSOHPHQWHWLHQHVTXHLQWURGXFLUODFLQWDFRQHFWDUOD JUDEDGRUDDWXRUGHQDGRUPHGLDQWH86%\HQSRFRV VHJXQGRVWHQGUiVWXVFDQFLRQHVHQ03 3RGUiVYROYHUDHVFXFKDUHVDVFLQWDVTXHWHQtDV ROYLGDGDVDKRUDSRUPXFKRPHQRVGHORTXHLPDJLQDV *DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

*UDEDGRUD&DVHWHVD03 /DXVRQ&5

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

0HGLGDV $[+[) [[FP

902 10 30 10

*DVWRVGHHQYtR

¼

5I%

latiendaencasa.es






(OHFWUyQLFD

(TXLSDFLyQ1DWLRQDO*HRJUDSKLFŒ

,QFOX\HRFXODUHV PPPPPP HUHFWLQJOHQV 0HGLGRUGHGLVWDQFLD[ 1DWLRQDO*HRJUDSKLF

&DUJDGRUVRODUHQ 1DWLRQDO*HRJUDSKLF

5I0(','25

5I

€

,QFOX\H%ROVD GHWUDQVSRUWH

7HOHVFRSLRDVWURQyPLFR %ROVDGHWUDQVSRUWH2FXODUHV 6RIWZDUH$VWURQRPtD 1DWLRQDO*HRJUDSKLF

€

€

5I

0iVFHUFDGHOFLHOR\GHODWLHUUD

1DWLRQDO*HRJUDSKLFŒSRQHDWXDOFDQFHORVDFFHVRULRVSHUIHFWRVSDUDREVHUYDU GHFHUFDWRGRVORVVHFUHWRVGHODQDWXUDOH]D3DUDWXVH[FXUVLRQHVWHUUHVWUHVFRPR VHQGHULVPRFD]DRSHVFDHOWHOpPHWURWHRIUHFHUiXQDPHGLFLyQUiSLGD\VHQFLOODJUDFLDVDXQDUHÀH[LyQOiVHULQIUDUURMD3RGUiVREWHQHUOD PHGLFLyQH[DFWDGHFXDOTXLHUREMHWRTXHREVHUYHVKDVWDPHWURVGHGLVWDQFLD6LTXLHUHVDO]DUODYLVWDKDFLDHOFLHORFRQHOWHOHVFRSLR UHIUDFWRU$=FRQVXVWUHVRFXODUHVTXHSHUPLWHQKDVWDDXPHQWRVSRGUiVYHUODVPDUDYLOODVGHODOXQD\ORVSODQHWDV$GHPiV WDPELpQSHUPLWHREVHUYDFLRQHVWHUUHVWUHV<SDUDFRPSOHWDUHVWHNLWQRYLDMHVVLQHOFDUJDGRUVRODUHQ8QDEDWHUtD\TXHLQWHJUDSUiFWLFDV IXQFLRQHVOLQWHUQDIXQFLyQGHDYLVR626SDQHOGHOX]SDQHOGHOX]\DGHPiVSRGUiVFDUJDUXQDJUDQYDULHGDGGHGLVSRVLWLYRVPyYLOHV 7RGRFRQODJDUDQWtDGH1DWLRQDO*HRJUDSKLFŒ

/RVVHFUHWRVGHOXQLYHUVR PiVFHUFD 3HQWDÀH[WHRIUHFHXQWHOHVFRSLRUHIUDFWRUSDUDTXHGHVFXEUDVWRGD ODEHOOH]DGHODVHVWUHOODV\SODQHWDV'RWDGRGHXQIRFDOGHPP \XQREMHWLYRGHPPWHSHUPLWLUiODREVHUYDFLyQDVWURQyPLFD [ \ODWHUUHVWUH [ (TXLSDGRFRQGRVRFXODUHV + PP7PP \EXVFDGRU[$GHPiVGH5(*$/2UHFLELUiVXQ PLFURVFRSLRGHKDVWDDXPHQWRVFRQWRGRVORVDFFHVRULRV\ XQSULVPiWLFR[FRQHVWXFKHSDUDVXWUDQVSRUWH 7HOHVFRSLR$VWURQyPLFRWHUUHVWUH7HOPLF 5(*$/20LFURVFRSLR$FFHVRULRV 3ULVPiWLFRV(VWXFKH'9'

€

*DVWRVGHHQYtR

5(*$/2

7XKLMRVLHPSUHFHUFD 3DUDTXHVLHPSUHHVWpVDOWDQWRGHORTXHKDFHWXKLMRWHSUHVHQWDPRV HVWHYLJLODEHEpVLQDOiPEULFRGH%HXUHUFRQYLVLyQQRFWXUQD(VWi FRPSXHVWRSRUXQDFiPDUDTXHJLUDž\XQDEDVHRUHFHSWRU GHVGHGRQGHSRGUiVFRQWURODUTXHKDFHHOQLxRHQWRGRPRPHQWR LQFOXVRHQODRVFXULGDG\DTXHLQWHJUDOX]LQIUDUURMD(PLWHVHxDO KDVWDXQDGLVWDQFLDGHPHWURV\QRSURGXFHLQWHUIHUHQFLDV 3RGUiVFRQWURODUHODXGLRHLQFOX\HVRQLGRVUHODMDQWHVSDUD TXHHOEHEpHVWiUHODMDGR(OGLVSRVLWLYRPiVSUiFWLFRDKRUDHQ 6HSWLHPEUHSRUVyOR€ 0HGLGDV $[+[) %DVH[[FP&iPDUD[FP $OLPHQWDFLyQSLODV$$$ QRLQFOXLGDV 

YDORUDGRHQ€

¼

5I%



´

9LJLODEHEpVLQDOiPEULFR GLJLWDO%HXUHU-%< ,QFOX\HXQ'9'FRQ PDQXDODXGLRYLVXDO GHPDQHMRGHO WHOHVFRSLR\GHO PLFURVFRSLR

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I



7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG




(OHFWUyQLFD

£9XHOYHQORVDxRV 6LVLHPSUHKDVTXHULGRGLVIUXWDUGHODP~VLFDHQXQDRULJLQDOJUDPRODDKRUDWLHQHVODRSRUWXQLGDGFRQHVWDIDQWiVWLFD-XNHER[8Q GLVHxR~QLFRFRQOXFHVQHyQDOPiVHVWLORDxRVFRQODWHFQRORJtDPiVDYDQ]DGDJUDEDGRUGHYLQLORDO86%RWDUMHWD6'OHFWRUGH &'03HLQFOXVRUDGLR<VLTXLHUHVUHFXSHUDUODPDJLDGHORVWRFDGLVFRV/DXVRQWHRIUHFHODWHFQRORJtDGHOVRQLGRPiVDFWXDOXQLGRDO GLVHxRFOiVLFRTXHWHJXVWD3RGUiVGLVIUXWDUGHIRUPDWRV&'03YLQLORFDVHWHHLQFOXVRSRGUiVJUDEDU HQXQDPHPRULD86%RWDUMHWD6'(OLJHODRSFLyQTXHPiVWHJXVWH\OOpYDWHGH5(*$/2XQRV $XULFXODUHV/DXVRQ3+YDORUDGRHQâ&#x201A;¬VyORGXUDQWH6HSWLHPEUH&XPSOHSRU¿QHO VXHxRGHYROYHUDGLVIUXWDUGHORVDxRV -XNHER[/DXVRQ&/ 5(*$/2$XULFXODUHV/DXVRQ3+ YDORUDGRHQâ&#x201A;¬

5DGLR&ODVVLF1RWDOJLF/DXVRQ&/ 5(*$/2$XULFXODUHV/DXVRQ3+ YDORUDGRHQâ&#x201A;¬

â&#x201A;¬0HV FXRWDV

â&#x201A;¬0HV FXRWDV

6,1(175$'$ 7$(7,1 393)LQDODSOD]RVâ&#x201A;¬

6,1(175$'$ 393)LQDODSOD]RVâ&#x201A;¬ 7$(7,1

393â&#x201A;¬

393â&#x201A;¬

5I

5I

0HGLGDV UDGLR  $[+[) [[FP 3HVRNJ

0HGLGDV $[+[)  [[FP 3HVRNJ

$JXMDUHFDPELR$*

â&#x201A;¬

5I

5(*$/2 $XULFXODUHV /DXVRQ3+ YDORUDGRHQâ&#x201A;¬

6yORKDVWD

8QRVDOWDYRFHVTXH FRQHFWDQFRQWRGDWXP~VLFD

&'0386%L3KRQHL3RG« 7XP~VLFDDWRGRYROXPHQ (VFXFKDWXP~VLFDHQWRGRVORVIRUPDWRVFRQHVWDPLFURFDGHQDGH (OEH8QHTXLSRTXHGLVSRQHQRVyORGHUHSURGXFWRUGH&'03 \86%VLQRWDPELpQGHUHSURGXFWRU\FDUJDGRUGHL3KRQH\L3RG 7RGRHQXQGLVHxRH[TXLVLWRFRQXQDFDOLGDGGHVRQLGRVLQLJXDO 3RGUiVFRORFDUORHQFXDOTXLHUHVSDFLRHLQFOXVRFROJDUORHQODSDUHG <SDUDWRWDOFRPRGLGDGGLVSRQHGHPDQGRDGLVWDQFLD\GLVSOD\ /&'D]XOSDUDYLVXDOL]DUODLQIRUPDFLyQGHWXVFDQFLRQHVHQWRGR PRPHQWR8QGLVHxRSDUDWXP~VLFDTXHVHGXFHORVVHQWLGRV 0LFURFDGHQD(OEH+L)L,3

â&#x201A;¬

'RFNLQJ(QHUJ\ 6\VWHP

5I 0HGLGDV $[+[) [[FP

â&#x201A;¬

5I 0HGLGDV $[+[) [[FP 3HVRNJ

&RQODQXHYD'RFNLQJGH(QHUJ\6\VWHP HVFXFKDUiVWXVFDQFLRQHVIDYRULWDVGH WXL3RGL3KRQHFRQVyORFRQHFWDUORVREUH VXEDVH'LVIUXWDUiVGHXQHVSHFWDFXODU VRQLGRFRQWUHVYtDVGHSRWHQFLDUHDO GH:3RGUiVVLQWRQL]DUODUDGLR)0 \DOPDFHQDUWXVHPLVRUDVIDYRULWDVH LQFOXVRUHSURGXFLUWXVSHOtFXODV\YtGHRVGHWX L3RGL3KRQHJUDFLDVDVXVDOLGDGHYtGHR RFRQHFWiQGRORDO798QHTXLSRUHDOL]DGRHQ PDGHUDTXHWDPELpQSXHGHVFRQHFWDUOR DWX'9'0379«\XVDUORFRPRXQRV SRWHQWHVDOWDYRFHV7RGRXQPXQGRGH SRVLELOLGDGHVTXHDKRUDQRSXHGHVGHMDU HVFDSDUSRUVyORâ&#x201A;¬ *DVWRVGHHQYtRLQFOXLGRVHQODFXRWD â&#x201A;¬  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

$XULFXODUHV%ODQFR (OEH$8%/ *DVWRVGHHQYtR

â&#x201A;¬

¼

5I%

902 10 30 10

latiendaencasa.es






$XWRPyYLO %ULFRODMH

+DEODDxRVFRQODPLVPDEDWHUtD

&RPSUXHED HOSHVRGHWXHTXLSDMH ¢&XiQWDVYHFHVKDVWHQLGRTXHSDJDUSRUH[FHVR GHHTXLSDMH"$KRUDSXHGHVFRPSUREDUFXiQWRSHVD WXPDOHWDDQWHVGHYLDMDUFRQHVWDEiVFXODGHYLDMH FyPRGD\IiFLOGHPDQHMDU&XHQWDFRQXQDSDQWDOOD /&'GHIiFLOOHFWXUDXQÀH[yPHWUR\XQDUHVLVWHQWH FRUUHDSDUDQRGDxDUODPDOHWD3XHGHVRSRUWDUKDVWD NJGHSHVR\WDPELpQFDOFXODHOSHVRHQOLEUDV JUDPRV\RQ]DV

7HSUHVHQWDPRVXQSURGXFWRQRYHGRVR\PX\~WLOSDUD OOHYDUHQWRGRVWXVYLDMHV6SDUH2QHHO~QLFRPyYLO TXHIXQFLRQDFRQXQDSLOD$$\TXHSXHGHSHUPDQHFHU FDUJDGRGXUDQWHDxRV\KDVWDKRUDVVHJXLGDV KDEODQGR/DPD\RUtDGHORVPyYLOHVWLHQHQEDWHUtDVGHSRFD GXUDFLyQSRUHVRHQWXVYLDMHVH[FXUVLRQHVDFDPSDGDV GHSRUWHVGHULHVJR«QHFHVLWDVXQPyYLOTXHWHJDUDQWLFH VLHPSUHODFRPXQLFDFLyQ(OPyYLO6SDUH2QHIXQFLRQDFRQXQDWDUMHWD6,0WLHQH XQERWyQGHOODPDGDGLUHFWDDHPHUJHQFLDV\ERWRQHVGHPDUFDGRUiSLGR UHSURJUDPDEOH3RUWXVHJXULGDGQRWHVHSDUHVGHpO 0HGLGDV $[+[) [[FP 3HVRJ

%iVFXODGLJLWDOGHPDOHWDV%HXUHU/6

6HSWLHPEUH

€

*DVWRVGHHQYtR

¼

6yORKDVWD 393+DELWXDO€

5I%

7HOpIRQRGHHPHUJHQFLD6SDUH2QH

€

*DVWRVGHHQYtR

¼

5I%('2 6RSRUWDKDVWD NJGHSHVR

6yORKDVWD 393+DELWXDO€

/DFDUWHUDPiVVHJXUDSDUDSURWHJHUWRGDVWXVWDUMHWDV ¢1RVDEHVGyQGHJXDUGDUWXVWDUMHWDVGHFUpGLWR"¢4XLHUHVHYLWDUTXHUREHQWXVGDWRV"<DSXHGHVHVWDUWUDQTXLORFRQODFDUWHUD&DUGKROGHU(V SUiFWLFD\HVWiUHDOL]DGDHQXQDUHVLVWHQWH\OLJHUDDOHDFLyQGHDOXPLQLRIXQGLGRDSUHVLyQGHXQDJUDQUHVLVWHQFLD8QGLVHxRXOWUD¿QR\ HOHJDQWHUHVLVWHQWHDODJXDFRQVLVWHPDGHDSHUWXUDHQXQVRORFOLFNGRQGHSRGUiVRUGHQDU\RUJDQL]DUWXVELOOHWHV\WXVWDUMHWDVGHFUpGLWR FRQWRWDOFRPRGLGDG\VHJXULGDG7DPELpQWLHQHHVSDFLRVX¿FLHQWHSDUDOOHYDUGLQHURVXHOWROODYHV\FRPRHVWDQSHTXHxDSXHGHVOOHYDUODHQ FXDOTXLHUSDUWHEROVREROVLOORRFKDTXHWD8QDFDUWHUDSHUIHFWDSDUDHOYHUDQRWXVYLDMHVRSDUDWXGtDDGtDGLVSRQLEOHHQYDULRVFRORUHV(OLJH WXGLVHxRSUHIHULGR\HQHVWDRIHUWDHVSHFLDOGH5HEDMDV£OOpYDWHODFDUWHUDDOGHGHVFXHQWR 0HGLGDV $[+[) [[FP 3HVRJ &DUWHUD $OXPLQLXP &DUGKROGHU

*DVWRVGHHQYtR

¼

€

3ODWD5I% $]XO5I% 1HJUD5I% 5RMD5I%

XQLGDG

 GHVFXHQWR



Total garantía de calidad y servicio $YDODGRSRUODJDUDQWtDGH/D7LHQGDHQ&DVD

/7&LQGG




$XWRPyYLO%ULFRODMH /DVKHUUDPLHQWDVLPSUHVFLQGLEOHV GHOEULFRODMH +D]WXVWDUHDVGHEULFRODMHPXFKRPiVIiFLOHV\H¿FDFHVFRQHVWHFRPSOHWR PDOHWtQ,QFRUSRUDKHUUDPLHQWDVHOpFWULFDVEiVLFDVSDUDUHDOL]DUORVWUDEDMRV PiVKDELWXDOHVHQFDVDWDODGURDPRODGRUDFRQGLVFRGHPPOLMDGRUD RUELWDO\VLHUUDGHFDODU8QDVKHUUDPLHQWDVGHXQDJUDQSRWHQFLDTXHLQFOX\HQ DGHPiVXQFRPSOHWRVHWGHDFFHVRULRVSDUDREWHQHUXQDPD\RUFDOLGDGGH XVR6LWHJXVWDHOEULFRODMH£FRQVLJXH\DHVWHPDOHWtQ $&&(625,26 Â&#x2021;7DODGURPDQJRDX[LOLDUWRSHGHSURIXQGLGDG OODYHSRUWDEURFDVPPVXUWLGRGHEURFDV FDEH]DOHVGHOLMDGRSXQWDVGHVWRQLOODGRUSRUWDSXQWDV Â&#x2021;6LHUUDVLHUUDVGHUHSXHVWR Â&#x2021;$PRODGRUDPDQJRDX[LOLDUOODYHGLVFRVGHFRUWHGHPHWDO Â&#x2021;/LMDGRUDRUELWDOOLMDVGH &$5$&7(5Ã&#x2039;67,&$67e&1,&$6 Â&#x2021;7DODGUR:'HDUSP Â&#x2021;$PRODGRUD:PPUSP Â&#x2021;/LMDGRUD:USP Â&#x2021;6LHUUDGHFDODU:USP

0DOHWtQKHUUDPLHQWDVHOpFWULFDV

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I

(OPHMRUUHJDORSDUDORVPDQLWDVGHODFDVD &RQHVWHPDOHWtQWHQGUiVWRGRORQHFHVDULRSDUDUHDOL]DUWXVDUUHJORV GHFDVDFRQODPHMRUFDOLGDG(VWiFRPSXHVWRSRUSLH]DVGH DFHURGHFDUERQRPiVDFFHVRULRVOODYHLQJOHVDPDUWLOORPHWUR GHVWRUQLOODGRUHV XQRGHHOORVFRQFDMDGHSXQWDVLQWHUFDPELDEOHV  QLYHODOLFDWHVMXHJRGHGHVWRUQLOODGRUHVGHSUHFLVLyQMXHJRGHOODYHV ³PXOWLORFN´FXWWHU\XQDFDMDGHWDFRV\WRUQLOORV$SURYHFKDHOPHV GH6HSWLHPEUHSDUDFRQVHJXLUORDXQSUHFLRLQFUHtEOHVyORâ&#x201A;¬ 0HGLGDV $[+[)  [[FP

0DOHWtQ KHUUDPLHQWDV

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I

£(ODVSLUDGRUHOpFWULFRSDUDFKLPHQHDV \EDUEDFRDV 5HFRJHWRGDODVXFLHGDGGHIRUPDH¿FD]FRQHVWHDVSLUDGRUHOpFWULFR GHFHQL]DV(DNR8QDVSLUDGRUGHXQDJUDQSRWHQFLDGH:\ FRQXQGHSyVLWRGH/GHFDSDFLGDGTXHWHSURSRUFLRQDUiXQD ODUJDDXWRQRPtD8QDKHUUDPLHQWDSUiFWLFD\VHQFLOODGHXWLOL]DU TXHWHSHUPLWLUiDVSLUDUJUDQGHVFDQWLGDGHVGHFHQL]DIUtDGHOD FKLPHQHDRODEDUEDFRD8QDIRUPDVHQFLOOD\UiSLGDGHUHDOL]DUXQD OLPSLH]DFRPSOHWD(TXtSDWHFRQOR~OWLPRHQOLPSLH]DSDUDHOKRJDU \OOpYDWHDGHPiVXQ¿OWURGHUHSXHVWRH[WUDSDUDOLPSLDUGXUDQWH PiVWLHPSR

$VSLUDGRU GHFHQL]DV(DNR

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I

902 10 30 10 /7&LQGG

latiendaencasa.es






$XWRPyYLO%ULFRODMH $PSOLWXG\FRPRGLGDG HQWXKRJDU

$KRUUDGLQHUR\SLQWDGHIRUPD UiSLGD

3RQRUGHQHQWXFDVDFRQHVWRVSUiFWLFRVPXHEOHV3DUD WHQHUHOEDxRSHUIHFWDPHQWH UHFRJLGRGHFyUDOR\GDOHHVWLOR FRQHVWHHOHJDQWHPXHEOH UHVLVWHQWH\IXQFLRQDO FRPSXHVWRSRUXQDEDOGD\ XQDUPDULRFRQWLUDGRUHVSDUD WRGRVWXVSURGXFWRVGHEHOOH]D <SDUDWRGRVWXVXWHQVLOLRV GHOLPSLH]DWHSURSRQHPRV XQDUPDULRGHGRVSXHUWDV FRQHVWDQWHVLQWHULRUHV\ HVFREHURGRQGHSRGUiVGDU FDELGDDWRGRVWXVSURGXFWRV 8QRVGLVHxRVSHUIHFWRVSDUD WHQHWRGRVLHPSUHDPDQR

&RQODQXHYDSLVWRODGHSXOYHUL]DFLyQGHSLQWXUD3DLQW%XOOHW SLQWDUQXQFDIXHWDQIiFLO&RQVHJXLUiVXQRVUHVXOWDGRVSHUIHFWRV \DKRUUDUiVWLHPSR\GLQHUR6yORWLHQHVTXHUHOOHQDUHOGHSyVLWR HQFHQGHUODPiTXLQD\DSUHWDUXQERWyQ(VPX\OLJHUD\IiFLOGHXVDU \HVLGHDOSDUDODGULOORFHPHQWRHVWXFRPDGHUDYLGULRVXSHU¿FLHV UXJRVDVFXUYDVROLVDVYDOODVGHPDGHUDPRELOLDULRGHH[WHULRU SDUHGHVLQWHULRUHV\H[WHULRUHV«\FRQVHJXLUiVROYLGDUWHSRU¿QGH URGLOORV\EURFKDV3iVDWH\DDODIRUPDPiVIiFLOFyPRGD\SUiFWLFD GHSLQWDUFRQ3DLQW%XOOHWWXPHMRUDOLDGR 3LVWRODGHSLQWXUD3DLQW%XOOHW

â&#x201A;¬

5I $OLPHQWDFLyQ5HG 3HVRNJ

0XHEOHGHEDxRFRQ DUPDULR-RFFD

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

,QFOX\H Â&#x2021;'HSyVLWRGHSLQWXUD GHP/ Â&#x2021;9DVRPHGLGRUGH YLVFRVLGDGGHODSLQWXUD Â&#x2021;&OLSGHOLPSLH]D Â&#x2021;PXHOOHVGHUHFDPELR Â&#x2021;%RTXLOODGHUHFDPELR Â&#x2021;/ODYHGHERTXLOOD

5I 0HGLGDV $[+[)  [[FP

,QFRUSRUDXQFDEOHGHPHWURVSDUDTXHOOHJXHVDWRGRVORVULQFRQHV

8QDPHVDFRQP~OWLSOHVIXQFLRQHV 6LQHFHVLWDVXQDPHVDH[WUDHVDSUiFWLFDPHVLWD GHXQGLVHxRDFWXDOVHFRQYHUWLUiHQODVROXFLyQ SHUIHFWDSDUDFRPHUWUDEDMDUOHHU«GHODIRUPD PiVFyPRGD5HDOL]DGDHQ0')LQFRUSRUDXQD OiPSDUD/('Ã&#x20AC;H[LEOH\VHUHJXODHQGLIHUHQWHV iQJXORVSDUDTXHSXHGDVGLEXMDU RWUDEDMDUFRQHORUGHQDGRUHQXQD SRVWXUDFRUUHFWD£/OpYDWHODD FXDOTXLHUKDELWDFLyQ 0HGLGDV $[+[)  [[FP

.LWDUPDULR UHVLQDHVFREHUR 5I 0HGLGDV $[+[) [[FP 3HVRNJ



6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

0HVDFRQ/('

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

*DVWRVGHHQYtR

¼

5I%

/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG




$XWRPyYLO%ULFRODMH $KRUUDGRUGHHQHUJtD-RFFD DKRUUDHQWXVIDFWXUDVVLQOLPLWDUWXFRQVXPR $KRUDHVSRVLEOHDKRUUDUHQWXVIDFWXUDVVLQOLPLWDUHOFRQVXPR FRQHODKRUUDGRUGHHQHUJtDGH-RFFD8QGLVSRVLWLYRWHVWDGR\ FHUWL¿FDGRTXHWHD\XGDUiDJDVWDUPHQRVDOPLVPRWLHPSRTXH SURWHJHUiWRGRVWXVDSDUDWRVHOpFWULFRVGHVREUHFDUJDV\VXELGDVGH WHQVLyQ&RQODPLVPDSRWHQFLDSXHGHVOOHJDUDUHGXFLUKDVWDXQ HQWXIDFWXUD(VHIHFWLYRFRQDLUHVDFRQGLFLRQDGRVODYDGRUDV WHOHYLVRUHVHTXLSRVGHP~VLFDVyORWHQGUiVTXHFRQHFWDUORDODUHG \QRWHOOHYDUiVVRUSUHVDVHQODIDFWXUD$SURYHFKDHVWDRIHUWD\ OOpYDWHGRVXQLGDGHVSRUVyORâ&#x201A;¬

7RGRVWXV]DSDWRVHQRUGHQ &UHDHOHVSDFLRPiVFyPRGR\SUiFWLFRSDUDRUGHQDU WXV]DSDWRVFRQHVWHPXHEOH]DSDWHUR9LYH]D5HDOL]DGR HQPHODPLQDFRORUZHQJXp\39&EODQFRWHSHUPLWLUiWHQHUWX FDO]DGRVLHPSUHDPDQR8QPRGHORGHFXDWURSXHUWDVFRQWLUDGRUHV SDUDPD\RUFRPRGLGDGTXHRIUHFHXQDFDSDFLGDGPtQLPDSDUHV &RQVtJXHORDKRUDHQXQDRIHUWDHVSHFLDO

$KRUUDGRUGHHQHUJtD-RFFD

[ /OpYDWHSRUVyOR

â&#x201A;¬

*DVWRVGHHQYtR

¼

5I% $OLPHQWDFLyQ5HG

=DSDWHUR SXHUWDVDEDWLEOHV 5I

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

0HGLGDV $[+[) [[FP

8QDGHFRUDFLyQGHIRUPDV JHRPpWULFDV

&RQpFWDORDODUHG\ HPSLH]DDDKRUUDU

3HUVRQDOL]DWXFDVD 7XFDVDWLHQHXQHVWLOR~QLFR\HVRVHREVHUYDHQWRGRVORVULQFRQHV 3RUHVRWHSURSRQHPRVHVWDVHVWDQWHUtDVPRGHUQDVTXHSRGUiV GHFRUDUFRQWXVIRWRVIDYRULWDV5HDOL]DGDVHQPDWHULDOHVGH FDOLGDGVRQSHUIHFWDVSDUDFRORFDUWXVREMHWRVGHGHFRUDFLyQ £(OLJHWXIDYRULWD\OOpYDWHODHQ6HSWLHPEUHDOPHMRUSUHFLR

%XVFDXQDGHFRUDFLyQSHUVRQDO\GLIHUHQWHSDUDWXKRJDU&RQHVWD RULJLQDOHVWDQWHUtDGHIRUPDVJHRPpWULFDVGDUiXQWRTXHRULJLQDOD FXDOTXLHUHVSDFLR\ORKDUiQD~QPiVIXQFLRQDO5HDOL]DGDHQPDWHULDO UHVLVWHQWHHVSHUIHFWDSDUFRORFDUWXVOLEURVGLVFRVSHOtFXODV REMHWRV«HQXQOXJDUSUHIHUHQWH£\FRQPXFKRHVWLOR (VWDQWHUtD=HWD 5I%

6HSWLHPEUH

*DVWRVGHHQYtR

¼

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

0HGLGDV $[+[) [[FP

0HGLGDV $[+[) [[FP







(VWDQWHFXERSDUDIRWRV 5RMR5I% %ODQFR5I% 1HJUR5I%

6HSWLHPEUH

â&#x201A;¬

*DVWRVGHHQYtR

¼

6yORKDVWD 393+DELWXDOâ&#x201A;¬

902 10 30 10 /7&LQGG

latiendaencasa.es






+RJDU (PLVRUGLJLWDO+DYHUODQG 5&(

6HSWLHPEUH

€

393+DELWXDO€

5I 0HGLGDV $[+[) [[FP 3RWHQFLD: 5&(

+DYHUODQGODWHFQRORJtDLQWHOLJHQWH TXHKDUiWXKRJDUPiVFRQIRUWDEOH (VWDWHPSRUDGDGLVIUXWDUiVGHODWHPSHUDWXUDLGHDOFRQORVHPLVRUHVWpUPLFRVGLJLWDOHVGH+DYHUODQG 8QRVVLVWHPDVGHFDOHIDFFLyQTXHLQFRUSRUDQHOPHMRUGLVHxRSDUDDGDSWDUVHDFXDOTXLHUDPELHQWH &XHQWDQFRQSRWHQFLDV\SRUTXHQRWRGRVORVGtDVVRQLJXDOHVFXHQWDQFRQSURJUDPDVHVSHFt¿FRV TXHVHDGDSWDUiQDWXVQHFHVLGDGHV7HPSHUDWXUD&RQIRUWSHQVDGRSDUDDTXHOORVTXHSDVDQODPD\RU SDUWHGHOWLHPSRHQFDVD7HPSHUDWXUD(FRQyPLFDSDUDHYLWDUJDVWRVLQQHFHVDULRV\2SFLyQ$QWLKLHOR SDUDSHULRGRVODUJRVGHDXVHQFLD$GHPiVLQFRUSRUDSURJUDPDVSUHGH¿QLGRVWHFODGRGHIiFLO DFFHVR\GLVSOD\GLJLWDOFRQSURJUDPDFLyQVHPDQDO8QDRSFLyQSHUIHFWDSDUDROYLGDUWHGHOIUtRDKRUDD XQSUHFLRLQPHMRUDEOH

6HSWLHPEUH

€



3DJRDSOD]DGR 6,1(175$'$ &RQV~OWDQRV

393+DELWXDO€

5I 0HGLGDV $[+[) [[FP 3RWHQFLD: 5&(



6HSWLHPEUH



€

393+DELWXDO€

5I 0HGLGDV $[+[) [[FP 3RWHQFLD: 5&(

 

6HSWLHPEUH

€

393+DELWXDO€

5I 0HGLGDV $[+[) [[FP 3RWHQFLD: 5&(

6HSWLHPEUH

€

393+DELWXDO€

5I 0HGLGDV $[+[) [[FP 3RWHQFLD: 6yORKDVWD

-RFFDFDORUGHKRJDU -RFFDWHRIUHFHVXELRFOLPDWL]DGRUFRPSDFWRTXHDGHPiVGHFDOHQWDU KXPLGL¿FDUHQXHYDHODLUH\WDPELpQUHIULJHUD8QDSDUDWRSHUIHFWR SDUDFDOHQWDUWXKRJDUTXHQRQHFHVLWDLQVWDODFLyQ\WLHQHFRQPRGRV GHUiIDJDTXHRULHQWDQHOPRYLPLHQWRGHODLUH&XHQWDFRQXQDFDSDFLGDG GHGHSyVLWRGH/\XQWHPSRUL]DGRUGHKDVWDKRUDV\PHGLD 8QDSDUDWRPDQHMDEOH\SRUWiWLOTXHSRGUiVFRORFDUHQODKDELWDFLyQTXH SUH¿HUDVFRQWRWDOFRPRGLGDG$GHPiVLQFOX\HXQSUiFWLFRPDQGRD GLVWDQFLD(VWHRWRxRFRQVLJXHODPHMRUWHPSHUDWXUDGHIRUPDVHQFLOOD \DOPHMRUSUHFLR %LRFOLPDWL]DGRU FDORUIUtR-RFFD

€

6HSWLHPEUH

6yORKDVWD 393+DELWXDO€

5I-2& 0HGLGDV $[+[) [[FP 3HVRNJ 3RWHQFLD:



LTC

Aprovecha las ventajas y beneficios 3URGXFWRVVHOHFFLRQDGRVSDUDWXELHQHVWDU

/7&LQGG




+RJDU 0DQWDHOpFWULFDGHVRIi £HQ6HSWLHPEUHSRU VyOR€ $SURYHFKDHVWDRSRUWXQLGDGSDUDORVGtDVPiVIUtRV GHOLQYLHUQR6yORGXUDQWHHOPHV6HSWLHPEUH SRGUiVFRQVHJXLUODPDQWDHOpFWULFDGHVRIi,PHWHF SRUVyOR€2EWHQGUiVHOPi[LPRFRQIRUW JUDFLDVDVXVXDYHWHMLGR\DVXWHFQRORJtD$)7GH FDOHQWDPLHQWRUiSLGR$GHPiVFXHQWDFRQ: GHSRWHQFLDQLYHOHVGHWHPSHUDWXUDPDQGR HUJRQyPLFR\IXQFLyQDXWRDSDJDGRSDUDHYLWDU VREUHFDOHQWDPLHQWRV'LVIUXWDGHOPD\RUELHQHVWDUHQ 6HSWLHPEUHDKRUDDXQSUHFLRGHDQLYHUVDULR€ 0DQWDHOpFWULFDGHVRIiGH,0(7(&

€

*DVWRVGHHQYtR

¼

5I% 7HMLGRVXDYH\ WHFQRORJtD$)7 GHFDOHQWDPLHQWR UiSLGR

6yORKDVWD 393+DELWXDO€

$OLPHQWDFLyQ5HG 0HGLGDV $[/ [FP 3RWHQFLD:

(OFRMtQTXHVHFRQYLHUWH HQXQFiOLGRHGUHGyQ

'\VRQKRWŒ(OFDOHIDFWRU PiVLQQRYDGRUGH'\VRQ

¢4XLHUHVHVWDUFyPRGRVLQSDVDUIUtR"7HSUHVHQWDPRVODVROXFLyQ SHUIHFWDHOFRMtQHGUHGyQGH-RFFD8QFRMtQTXHHVFRQGHXQ VHFUHWRLQFUHtEOHVHFRQYLHUWHHQXQHGUHGyQ£HQVHJXQGRV6yOR WLHQHVTXHGHVDEURFKDUODFUHPDOOHUD\GLVIUXWDUiVGHODVHQVDFLyQ PiVFiOLGD\DJUDGDEOH&RPRFRMtQHVFRQIRUWDEOH<FRPR HGUHGyQHVVXDYHDJUDGDEOH\PX\FiOLGR(VSHUIHFWRSDUDOHHU YHUODWHOHYLVLyQSDUDODFDPDGHORVLQYLWDGRVRFRPRHGUHGyQH[WUD SDUDODVIUtDVQRFKHVGHLQYLHUQR<FXDQGRQRORQHFHVLWHVGyEODOR IiFLO\UiSLGDPHQWH\WHQGUiVGHQXHYRXQFRMtQ/DVROXFLyQPiV YHUViWLO\SUiFWLFDSDUDHVWDUFyPRGRVLQSDVDUIUtR

'\VRQ+RWŒHVXQUHYROXFLRQDULRFDOHIDFWRUTXHFRQVHJXLUi FDOHQWDUUiSLGDPHQWHFXDOTXLHUKDELWDFLyQFRQPXFKDPiV SRWHQFLD\SUHFLVLyQ6XIXQFLRQDPLHQWRVHEDVDHQODWHFQRORJtD $LU0XOWLSOLHUŒTXHDPSOL¿FDYHFHVHODLUHGHDOUHGHGRUSDUD FRQVHJXLUXQDPD\RUGLIXVLyQGHOFDORU\FDOHQWDUFXDOTXLHUHVSDFLR PiVUiSLGRJHQHUDQGRDGHPiVXQDSRWHQWHFRUULHQWHGHDLUHVXDYH \FRQWLQXDVLQUiIDJDV&RQVXPDQGRDGLVWDQFLDSRGUiVDMXVWDUOD WHPSHUDWXUDODYHORFLGDGGHOÀXMRGHDLUH\HOPRGRGHRVFLODFLyQ SDUDTXHHOFDORUHQYXHOYDWRGDODKDELWDFLyQ8QGLVHxR~QLFR VLQUHMLOODVQLDVSDV\FRQSODFDVFHUiPLFDVGH37&TXHQXQFD VREUHSDVDQORVž&\HYLWDQHORORUDTXHPDGR

&RMtQHGUHGyQ-RFFD XQLGDGHV  5I%

*DVWRVGHHQYtR

¼

&DOHIDFWRUGLJLWDO$0

€0HV FXRWDV

[ /OpYDWHSRUVyOR

€ 0HGLGDVDELHUWR $[/  [FP 0HGLGDVFHUUDGR $[/  ;FP

6,1,17(5(6(6

7$(7,1 7RWDODSDJDU€

393€

5I 6HWUDQVIRUPDHQ FRMtQHQSRFRV VHJXQGRV



),1$1&,$&,Ð1

RSDJDHO 6yORKDVWD

70

/DWHFQRORJtD$LU0XOWLSOLHUŒ DFHOHUDHODLUHDWUDYpVGHXQD DSHUWXUDFLUFXODUDHURGLQiPLFD FDQDOL]DQGRVXGLUHFFLyQ\ DPSOL¿FDQGRHOÀXMRGHDLUHYHFHV

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  *DVWRVGHHQYtR € \GHJHVWLyQ € LQFOXLGRVHQODFXRWD 9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

0HGLGDV +[' [FP

latiendaencasa.es






+RJDU 5HOD[SDUDWXHVSDOGD GHVFDQVRSDUDWXFXHUSR

/DVHVLyQPiVUHODMDQWHGH PDVDMH\FDORU£SRU€

'HVFXEUHHOGLVHxRPiVSUiFWLFRSDUDGLVIUXWDUGHXQPDVDMH UHODMDQWH\HVWLPXODQWHDODYH]TXHOHHVXQOLEURRYHVOD WHOHYLVLyQ(VWHUHSRVDHVSDOGDUHOD[VHDGDSWDSHUIHFWDPHQWHD FXDOTXLHUVLWLRHOVRIiODFDPD&XHQWDFRQXQD]RQDGHPDVDMH DOWD\RWUDEDMDIXQFLyQFDORUTXHWHD\XGDUiDDOLYLDUORVGRORUHV PiVFRPXQHVGHHVSDOGD\GRVQLYHOHVGHPDVDMHVXDYHSDUD UHODMDUWHRIXHUWHSDUDGHVWHQVDUORVP~VFXORV$GHPiVLQFRUSRUDXQD OiPSDUDGHOHFWXUDGLULJLEOHGRVEROVLOORVODWHUDOHVSDUDJXDUGDU WXVOLEURVRUHYLVWDV\VHPDQHMDIiFLOPHQWHGHVGHHOUHSRVDEUD]RV

6LFUHtDVTXHGLVIUXWDUGHXQDXWpQWLFRPDVDMHUHOD[HVWDEDDODOFDQFH GHPX\SRFRVHVWDEDVHTXLYRFDGR$KRUDREWHQGUiVXQDVHQVDFLyQ GHELHQHVWDUSRUWRGRHOFXHUSRDXQSUHFLRLQFUHtEOHSRUVyOR €\HQFyPRGDVFXRWDV7~PEDWHHQHVWHVLOOyQFRQQLYHOHV GHLQWHQVLGDG\PRGRVGHPDVDMHUHSDUWLGRVSRUODHVSDOGDHO DVLHQWR\HOUHSRVDSLpV TXHSXHGHVVHOHFFLRQDULQGHSHQGLHQWHPHQWH  TXHLQFOX\HDGHPiVXQDIXQFLyQHVSHFLDOFRQFDORUSDUDDOLYLDUHOGRORU WDQFRP~QHQORVOXPEDUHV6LPSOHPHQWHVHOHFFLRQDWXRSFLyQFRQVX PDQGRDGLVWDQFLDRDFWLYDVXWHPSRUL]DGRUSDUDXQDUHODMDFLyQWRWDO£7H PHUHFHVXQGHVFDQVR 6LOOyQ5HOD[-RFFD

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

5I

%UD]RVDEDWLEOHVSDUD PD\RUFRPRGLGDG EROVLOORVODWHUDOHV \PDQGRGHFRQWURO LQFRUSRUDGR

5HSRVDHVSDOGDPDVDMHFDORU -RFFD5HJDORIXQGD

€

0HGLGDVVLOOyQ $[+[) [[FP 0HGLGDVUHSRVDSLpV $[+[) [[FP

5I

'LVHxDGRSDUDWXFRPRGLGDG $PXHEODUWXFDVDQRWLHQHSRUTXpVHUXQDWDUHDGLItFLO\FRVWRVD $TXtWHSURSRQHPRVXQDVROXFLyQYHUViWLOFyPRGD\PX\SUiFWLFD SDUDJXDUGDUWXURSD(VWHDUPDULRGHWHODGHXQGLYHUWLGRGLVHxRD UD\DVVHPRQWDIiFLOPHQWH\HVSHUIHFWRSDUDFXDOTXLHUKDELWDFLyQ RSDUDOOHYDUDXQDVHJXQGDYLYLHQGD8QDUPDULRPX\DPSOLRFRQ FXHUSRV\EDOGDVSDUDFRORFDUGHVGHFDMDVDURSDGHFDPD\XQ HVSDFLRHVSHFLDOSDUDTXHSXHGDVFROJDUWXVFDPLVDVFKDTXHWDVR SDQWDORQHV8QDVROXFLyQSHUIHFWDUiSLGD\VHQFLOODSDUDWHQHUWXURSD VLHPSUHRUGHQDGD 0HGLGDV $[+[)  [[FP

/OpYDWHHODUPDULRDODKDELWDFLyQTXHPiVWHDSHWH]FDFRQHVWH SUiFWLFRSDUDEiQFRQUXHGDV8QDPDQHUDFyPRGDGHJXDUGDU WXURSD\PX\VHQFLOORGHPRQWDUTXHLQFRUSRUDGRVEDUUDVGH DOWXUDUHJXODEOHSHUIHFWDVSDUDFROJDUWXVFKDTXHWDVFDPLVDV SDQWDORQHVXQDEDOGDGRQGH SRGUiVFRORFDUWXV]DSDWRV\ FDMRQHVLGHDOHVSDUD FDPLVHWDVMHUVH\VRURSD GHFDPD8QGLVHxR IXQFLRQDOTXHWHSURSRUFLRQDUi WRGRHOHVSDFLRTXHQHFHVLWDV SDUDPDQWHQHURUGHQDGDVWRGDV WXVSUHQGDV

6Ï/2

6Ï/2





81,'$'(6

81,'$'(6

$UPDULRGHUD\DV FRQSDUWHV

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I



0iVHVSDFLRSDUDFRORFDUWXURSD

3DUDEiQFDMRQHV GHFRORUHV

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I

7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG




+RJDU

'LVHxRSDUDHOKRJDUUHOD[SDUDWXFXHUSR &RQVLJXHXQDVHQVDFLyQ~QLFDGHELHQHVWDUHQWXFDVDFRQHVWHPDJQt¿FRVLOOyQGHPDVDMH(FR'HŠ8QGLVHxRHOHJDQWHIDEULFDGR HQSLHOGHYDFXQRGHDOWDFDOLGDGFRQODWHUDOHV\SDUWHWUDVHUDSROLSLHOTXHWHSURSRUFLRQDUiWRWDOFRPRGLGDGDOPLVPR WLHPSRTXHGLVIUXWDUiVGHXQHVWXSHQGRPDVDMH3RGUiVUHODMDUWRGRWXFXHUSRFXHOORHVSDOGDULxRQHV\SLHUQDVHOHJLUHQWUHQLYHOHVGH LQWHQVLGDGHLQFOXVRGLVIUXWDUGHXQWUDWDPLHQWRFRQFDORUOXPEDU6HSXHGHUHFOLQDUHQSRVLFLyQKRUL]RQWDORJLUDUORKDVWDžEDODQFHDUOR\ FRQWURODUORVGLVWLQWRVPDVDMHVFRQVXPDQGRDGLVWDQFLD 6LOOyQUHOD[(&2'(Š FRQPDVDMHFDORU

6LVWHPDžTXHOH SHUPLWHJLUDUVREUHVt PLVPRFRQIDFLOLGDG 6LVWHPD%DODQFtQ

FXRWDV

€0HV

6,1,17(5(6(6

7$(7,1 393727$/€

&KRFRODWH5I 1HJUR5I ),1$1&,$&,Ï1(;&/86,9$

0DQGRDGLVWDQFLDSDUD UHJXODUODLQWHQVLGDGGH PDVDMH\HOFDORU

6XSDODQFDODWHUDOWH SHUPLWLUiUHFOLQDUORSDUD GDUWHODVHQVDFLyQGH JUDYHGDG]HUR

)DEULFDGRHQSLHO GHYDFXQRGHDOWDFDOLGDG /DWHUDOHV\SDUWHWUDVHUD SROLSLHO 0HGLGDV $[+[) [[FP

7XVSLHVVHPHUHFHQXQGHVFDQVR &DGDGtDORVSLHVWLHQHQTXHVRSRUWDUWRGDODIXHU]DGHQXHVWURFXHUSR6RQQXHVWURVSULQFLSDOHVSXQWRVGHDSR\R\QROHVSUHVWDPRVWRGDOD DWHQFLyQTXHQHFHVLWDQ7HQHPRVTXHFXLGDUORV\PLPDUORV\ODIRUPDPiVVHQFLOODHVGDUOHVXQGHVFDQVRFRQHVWHUHSRVDSLpV)DEULFDGRHQ PDGHUDFRQDFDEDGRFDREDHVUHJXODEOHDDOWXUDVSDUDIDYRUHFHUDOPi[LPRWXGHVFDQVR7HD\XGDUiDPHMRUDUORVSUREOHPDVFLUFXODWRULRV \WDPELpQDUHGXFLUODIDWLJDHQHVSDOGD\FXHOOR,QFOX\HGRVIXQGDVLQWHUFDPELDEOHV\ODYDEOHVSDUDFRPELQDUODVFRPRW~TXLHUDV(OPHMRU GHVFDQVRSDUDIDYRUHFHUODVDOXGGHWXVSLHV 5HSRVDSLpVSOHJDEOH-RFFD XQLGDGHV  5I%

[ /OpYDWHSRUVyOR

€

0HGLGDV $[+[)  $ELHUWR[[FP &HUUDGR[[FP

*DVWRVGHHQYtR

¼

5HJXODEOHDWUHVDOWXUDV

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






+RJDU

&ROFKyQ (&2'(ยŠ'

FRQYLVFRHOiVWLFD\PDVDMH ยฃHOPiVEHQHยฟFLRVRSDUDWXFXHUSR &RQHOFROFKyQ(&2'(ยŠ'VHQWLUiVODVHQVDFLyQGHGRUPLU \GHVFDQVDUSOiFLGDPHQWH/DFRPELQDFLyQGHPDWHULDO YLVFRHOiVWLFR\WHMLGR'PDQWHQGUiODFRUUHFWDDOLQHDFLyQ GHODFROXPQD\HOFXHUSRGXUDQWHWRGRHOGHVFDQVR GLVPLQX\HQGRORVSXQWRVGHSUHVLyQ(OFROFKyQ(&2'(ยŠ 'IDFLOLWDHOPRYLPLHQWRGHODLUHHPSOHDQGRQXHVWUDSURSLD LQHUFLDFXDQGRQRVJLUDPRVRFDPELDPRVGHSRVWXUD\VX WHMLGR'UHJXODHODLUHODKXPHGDG\ODKLJLHQHJUDFLDVDVX WUDWDPLHQWRDQWLiFDURVKLSRDOHUJpQLFR\WUDQVSLUDEOH6XV FPGHPDWHULDOYLVFRHOiVWLFRGHDOWDGHQVLGDGDSRUWDQXQD LQFRPSDUDEOHVHQVDFLyQGHLQJUDYLGH]TXHIDFLOLWDHOGHVFDQVR (VWRVHWUDGXFHHQXQDPHMRUFLUFXODFLyQGHODVDQJUH\HQ XQDPHMRUFDOLGDGGHOVXHxR5HFRPHQGDGRHVSHFLDOPHQWH SDUDSHUVRQDVFRQUHXPDWLVPRDUWULWLVHVFROLRVLVFLIRVLV\WRGR WLSRGHGROHQFLDVTXHUHTXLHUHQXQGHVFDQVRDGHFXDGR/OpYDWH HOFROFKyQTXHPHMRUVHDGDSWHDWXVQHFHVLGDGHV\SiJDORHQ FyPRGDVFXRWDVVLQHQWUDGD\VLQLQWHUHVHVยฃ)HOLFHVVXHxRV /DVGRVSDUWHVVRQLQGHSHQGLHQWHV\ SXHGHVUHQRYDUODVSRUVHSDUDGRORTXH WHSHUPLWLUiYROYHUDWHQHUXQFROFKyQ QXHYRDGTXLULHQGRHO7RSSHUVLQ QHFHVLGDGGHFDPELDUWRGRHOFROFKyQ OHUHFRPHQGDPRVFDPELDU HOWRSSHUFDGDDxRV 

<DKRUDWDPELpQFRQIXQFLyQ PDVDMHFDORU

&ROFKyQ(&2'(ยŠ0DVDMHFDORU FP

โ‚ฌ

393727$/

6HSWLHPEUH

6yORKDVWD

FP 393727$/

6HSWLHPEUH

โ‚ฌ

6yORKDVWD

โ‚ฌ0HV

โ‚ฌ0HV

5I

5I

FP

FP

393+DELWXDOโ‚ฌ

393+DELWXDOโ‚ฌ

โ‚ฌ

393727$/

6HSWLHPEUH

6yORKDVWD

โ‚ฌ0HV

393727$/

6HSWLHPEUH

(OFROFKyQ(&2'(ยŠ'LQFRUSRUDDGHPiVIXQFLyQPDVDMH \FDORU,QWHJUDKDVWDYLEURPRWRUHVGHDOWDWHFQRORJtD SDUDHOFXHOOR]RQDOXPEDUGRUVDO\SLHUQDV3RGUiV VHOHFFLRQDUKDVWDSURJUDPDVDXWRPiWLFRVQLYHOHVGH LQWHQVLGDG\DGHPiVSRGUiVFRPELQDUORFRQXQWUDWDPLHQWR GHFDORUOXPEDU

โ‚ฌ

6yORKDVWD

โ‚ฌ0HV

393+DELWXDOโ‚ฌ

393+DELWXDOโ‚ฌ

5I

5I ),1$1&,$&,ร1(;&/86,9$ FXRWDV6,1,17(5(6(6 7$(7,1

ยฃ'LVIUXWDGHORVVXHxRVPiVFiOLGRV $KRUD(GUHGyQQyUGLFR5(*$/2-XHJRGHViEDQDV (VWDQXHYDWHPSRUDGDDtVODWHGHOIUtRFRQXQHGUHGyQOLJHURVXDYH\TXHPDQWLHQHODWHPSHUDWXUD FRUSRUDOGHODPDQHUDPiVQDWXUDO/D7LHQGDHQ&DVDWHRIUHFHGLVIUXWDUGHORVVXHxRVPiV FiOLGRVFRQHVWHHGUHGyQQyUGLFRFRPSXHVWRSRUSOXPyQ\SOXPDGHRFDEODQFD DKRUDFRQXQMXHJRGHViEDQDVGHSLH]DVGH5(*$/26XVUHPDWHVFRQFRVLGRGLUHFWRHYLWDQ HOPRYLPLHQWRGHODVSOXPDVHQVXLQWHULRUGHIRUPDTXHHOHGUHGyQVLHPSUHTXHGDUiXQLIRUPH(VWi GLVSRQLEOHHQWDPDxRVSDUDTXHHOLMDVVHJ~QWXVQHFHVLGDGHV (GUHGyQ1RUGLFR2VOR3ODWD 5(*$/2MXHJRGHViEDQDV &DPD

&DPD

&DPD

&DPD

6HSWLHPEUH

6HSWLHPEUH

393+DELWXDOโ‚ฌ

โ‚ฌ

6HSWLHPEUH

393+DELWXDOโ‚ฌ

โ‚ฌ

6HSWLHPEUH

393+DELWXDOโ‚ฌ

โ‚ฌ

5I

5I

5I

5I

โ‚ฌ

5(*$/2 5(*$/2 -XHJRGHViEDQDV

393+DELWXDOโ‚ฌ

6yORKDVWD



Comprar es muy fรกcil $WXVHUYLFLRKRUDVDOGtDGXUDQWHORVGtDVGHODxR

/7&LQGG




+RJDU

/DVROXFLyQPiVSUiFWLFDSDUDGLVIUXWDUGHOGHVFDQVR 6LTXLHUHVRIUHFHUXQDFDPDFyPRGDDWXVLQYLWDGRVDODYH]TXHDKRUUDVHVSDFLRHQFDVD\DKRUUDVGLQHURWHSUHVHQWDPRVHVWDFDPD SOHJDEOH-RFFD8QGLVHxRFyPRGR\FRQIRUWDEOHFRQXQFROFKyQGHFHQWtPHWURVUHDOL]DGRHQSROLXUHWDQR\XQDIXQGDUHDOL]DGD HQSROLpVWHUSHUIHFWDSDUDSURWHJHUODFXDQGRHVWpSOHJDGD8QDRSFLyQSUiFWLFDSDUDWHQHUFRPRFDPDH[WUDFRQODYHQWDMDGHTXHFXDQGR QRODXWLOLFHVSRGUiVSOHJDUODSDUDTXHQRRFXSHHVSDFLR\JXDUGDUODGRQGHTXLHUDV\DTXHWLHQHUXHGDVSDUDPRYHUODFRQIDFLOLGDG\VLQ HVIXHU]RV$GHPiVFXHQWDFRQSRVLFLRQHVHQODSDUWHGHODQWHUDTXHSXHGHVDMXVWDUSDUDOHHUYHUODWHOHYLVLyQGHIRUPDPiVFyPRGD/D PHMRUVROXFLyQSDUDGLVIUXWDUGHXQGHVFDQVRVLQOLPLWDFLRQHVGHHVSDFLRTXHSXHGHVHUWX\DDXQSUHFLRLQPHMRUDEOH &DPDSOHJDEOH$OPRKDGDYLVFRHOiVWLFD-RFFD

3RGUiVSOHJDUODHQ VHQFLOORVSDVRV SDUDJXDUGDUOD RFXSDQGRHO PtQLPRHVSDFLR

â&#x201A;¬

5I 0HGLGDV $[+[) [[FP FHUUDGD $[+[) [[FP SRVLFLRQHVHQ ODSDUWHGHODQWHUD TXHSXHGHVDMXVWDU SDUDOHHUYHUOD WHOHYLVyQHWF

$OPRKDGD YLVFRHOiVWLFD HUJRQyPLFD

/DPHVDPiVYHUViWLOGHOPXQGR

$OLYLR\GHVFDQVRSDUDWXVSLHUQDV 3LHUQDVFDQVDGDVPDODFLUFXODFLyQDKRUDSXHGHVDOLYLDUHVWDV PROHVWLDVFRQHOFRMtQGHVFDQVR5HOD[GH-RFFD(OFRMtQGHVFDQVR 5HOD[UHGXFH\PHMRUDODVHQVDFLyQGHSHVDGH]HQODVSLHUQDV\ D\XGDDDOLYLDUORVSUREOHPDVFLUFXODWRULRVFRPRODVYDULFHVRORV SLHVLQÃ&#x20AC;DPDGRV\WHSHUPLWHPDQWHQHUXQDSRVWXUDFRUUHFWDGHOD FROXPQDYHUWHEUDO,QFRUSRUDVXDYHIXQGDODYDEOHDWHUFLRSHODGD\ PHPRU\IRDPGHDOWDFDOLGDGTXHKDFHTXHHOFRMtQUHFXSHUHODIRUPD LQPHGLDWDPHQWHWUDVGHVDSDUHFHUODSUHVLyQ'LVIUXWDGHXQUHSDUDGRU GHVFDQVRVLHPSUHTXHORQHFHVLWHV

6LUHDOPHQWHTXLHUHVXQDPHVDFyPRGD\YHUViWLOQRWHSLHUGDV HVWDPHVDPXOWLXVRV*UDFLDVDOGLVHxRGHVXVSDWDVTXHQRVRQ FUX]DGDVWHDVHJXUDPD\RUPRYLOLGDG\SXHGHVDFHUFDUODDOPi[LPR KDFLDWLSDUDHYLWDUPDODVSRVWXUDV(VUHJXODEOHHQDOWXUDV\HQ SRVLFLRQHVGLVWLQWDVHVOLJHUDSHURVRSRUWDKDVWDNJGHSHVR 3DUDFRPHUPLHQWUDVYHVODWHOHYLVLyQOHHURWUDEDMDUFRQHORUGHQDGRU SLQWDURLQFOXVRSDUDOOHYDUHQWXVYLDMHV£HVODPHVDSHUIHFWD

0HVDPXOWLXVRV-RFFD 5(*$/2UHYLVWHURSRUWDPDQGRV

&RMtQGHVFDQVRUHOD[-RFFD

â&#x201A;¬

*DVWRVGHHQYtR

¼

[ /OpYDWHSRUVyOR

5I%

â&#x201A;¬

*DVWRVGHHQYtR

¼

5I%

9(59Ã&#x2039;'(2 ODWLHQGDHQFDVDHV

5(*$/2 5HYLVWHUR SRUWDPDQGRV

0HGLGDV $[+[) [[FP

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD â&#x201A;¬  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

0HGLGDV $[)  [FP

latiendaencasa.es






+RJDU

£(FKDDORVURHGRUHVHLQVHFWRVGHWXFDVDFRQ3HVW5HMHFW ¢%XVFDVXQDVROXFLyQH¿FD]SDUDGHVKDFHUWHGHORVURHGRUHV\ELFKRVGHWXFDVD"3HVW5HMHWHVXQDSDUDWRTXHXWLOL]DODDYDQ]DGDWHFQRORJtD GHOHOHFWURPDJQHWLVPR\XOWUDVRQLGRSDUDUHSHOHUDODVUDWDVUDWRQHVHVFDUDEDMRVFXFDUDFKDV«2WURVDSDUDWRVWLHQHQXQDOFDQFHOLPLWDGR SHURFRQXQVROR3HVW5HMHFWSXHGHVSURWHJHUXQDFDVDGHKDVWDP\VLQXWLOL]DUSURGXFWRVTXtPLFRVQRFLYRVSDUDODVDOXG\SDUDHO PHGLRDPELHQWH6RORWLHQHVTXHHQFKXIDUORDODUHG\IXQFLRQDUiODVKRUDVGHOGtDORVGtDVGHODxR8QDVROXFLyQHIHFWLYDSUREDGD HQPLOORQHVGHKRJDUHVHQWRGRHOPXQGRTXHDKRUDSXHGHVFRQVHJXLUHQXQDRIHUWDHVSHFLDOFRQODXQLGDGDOXQSUHFLR~QLFRDVtSRGUiV OOHYDUORDWXVYLDMHVRDRWUDYLYLHQGD£3UXpEDOR $KX\HQWDGRU3HVW5HMHFW XQLGDG 

€

*DVWRVGHHQYtR

¼

5I% /OpYDWHSRUVyOR

€ PiV

*DVWRVGHHQYtR

¼

5I%

9(59Ë'(2 ODWLHQGDHQFDVDHV

$6Ë'()È&,/6,13,/$66,1 0$17(1,0,(172 3HVW5HMHFWIXQFLRQDFRQODHOHFWULFLGDGGHWXFDVD WUDEDMDODVKRUDVORVGtDVGHODxRSDUD SURWHJHUWHDWL\DORVWX\RVVLQQLQJ~QWLSRGH PDQWHQLPLHQWR

HIHFWLYR\VHJXUR6LQSURGXFWRVTXtPLFRVWy[LFRVR YHQHQRVRVFRQWUDWRGRVORVLQVHFWRVUDWRQHV\FXFDUDFKDV

$KRUUDHVSDFLRHQWXDUPDULR $KRUDTXHVHDFHUFDHORWRxRKD\TXHKDFHUVLWLRHQHODUPDULRSDUD JXDUGDUODURSDGHYHUDQR(VWDVSUiFWLFDVEROVDVDKRUUDHVSDFLR WHSHUPLWLUiQUHGXFLUHOYROXPHQGHWXVSUHQGDVKDVWDXQ 6yORWLHQHVTXHPHWHUODURSDHQODVEROVDV\H[WUDHUHODLUHFRQXQ DVSLUDGRUGHIRUPDTXHTXHGDUiVHOODGRKHUPpWLFDPHQWH$GHPiV GHRFXSDUHOPtQLPRHVSDFLRORJUDUiVPDQWHQHUWRGDWXURSDOLPSLD\ SURWHJLGDGHSROYRHLQVHFWRV$SURYHFKDDKRUD\OOpYDWHXQVHWGH EROVDV\GH5(*$/2XQSOHJDGRUGHURSDSDUDGREODUWXVSUHQGDV HQVHJXQGRV

5(*$/2

6HWEROVDVDKRUUDHVSDFLR 5(*$/23OHJDGRU

6HSWLHPEUH

€

3OHJDGRUGHURSD 'REODWXURSDHQ VHQFLOORVPRYLPLHQWRV

5HOiMDWHFRQHOVRQLGRGHODJXD 7HRIUHFHPRVHOFRPSOHPHQWRSHUIHFWRTXHIDOWDEDHQWXMDUGtQSDUD GDUOHXQWRTXHGHHVWLORHVWDRULJLQDOIXHQWHHOpFWULFDHQIRUPDGH FDVFDGD(VWiUHDOL]DGDHQUHVLQDGHDOWDFDOLGDGUHVLVWHQWHDOD LQWHPSHULHFRQFLUFXLWRFHUUDGRGHDJXDHLQFRUSRUDOXFHVSDUD TXHWDPELpQSXHGDVLOXPLQDUWXVQRFKHVFRQXQHVWLORH[FOXVLYR 'LVIUXWDGHOUHODMDQWHVRQLGRGHODJXD )XHQWHHOpFWULFDGHUHVLQDOXFHV

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I 0HGLGDV $[+[) [[FP

)XHQWHHOpFWULFDGHUHVLQDOXFHV

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I 0HGLGDV $[+[) [[FP

6yORKDVWD 393+DELWXDO€

5I 0HGLGDV $[/ [FP

&RQVHJXLUiVDKRUUDUXQGHHVSDFLR

6Ï/2

6Ï/2





81,'$'(6



81,'$'(6

/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG




+RJDU

/LPSLH]DDYDSRUHQ 3iVDWHDODOLPSLH]DDYDSRUFRQHVWDPiTXLQDHQ+2;TXHOLPSLDGHVLQIHFWDHKLJLHQL]DWRGDVODV VXSHU¿FLHV\VXHORVGHWXKRJDU/DPRSD+2;HOHYDODOLPSLH]DDYDSRUDORPiVDOWRFRQVyORSXOVDUXQ ERWyQ\HQPHQRVGHVHJXQGRVFRQYHUWLUiHODJXDIUtDHQYDSRUSDUDOLPSLDUDž(VOLJHUDVHQFLOODGH PDQHMDU\V~SHUSRWHQWHFRQ:GHSRWHQFLD&RQVyORDSUHWDUXQERWyQVHGHVPRQWDFRQYLUWLpQGRVHHQ XQSRWHQWHDSDUDWRGHYDSRUDPDQRFRQWRGRVORVDFFHVRULRVSDUDTXHDGHPiVSXHGDVOLPSLDUYHQWDQDV SHUVLDQDV\HOLPLQDUDUUXJDVGHODURSD6LQXVDUSURGXFWRVTXtPLFRVHVFDSD]GHHOLPLQDUKDVWDHO GHJpUPHQHV\EDFWHULDV6LQGXGDODOLPSLH]DDYDSRUPiVSRWHQWHDKRUDDOPHMRUSUHFLR$GHPiVGH 5(*$/2OOpYDWHXQDFFHVRULRHVSHFLDOFRQSDxRGHPLFUR¿EUDSDUDHOLPLQDUODVDUUXJDVGHODURSD 0RSDGHYDSRU+2;5HFDPELR FXRWDV

€0HV

6,1,17(5(6(6

7$(7,1 393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

$OLPHQWDFLyQ5HG &DSDFLGDGGHGHSyVLWRP/ 3HVRNJ 3RWHQFLD:

/LPSLDGRUSDUDVXHORV

9DSRUL]DGRUPDQXDO

9DSRUL]DGRUSDUDDOIRPEUDV

/LPSLDGRUGHYHQWDQDV

9DSRUL]DGRUSDUDWHMLGRV

5(*$/2 3DxRGHPLFUR¿EUDHVSHFLDOSDUD HOLPLQDUODVDUUXJDVGHODURSD\ OLPSLDUFRUWLQDV\WDSLFHUtD

9(59Ë'(2 ODWLHQGDHQFDVDHV

,1&/8<( ‡0RSDFRQFDEH]DOWULDQJXODU ‡$FFHVRULRWULDQJXODUHVSHFLDOSDUDDOIRPEUDV\PRTXHWDV ‡0DQJXHUDGHH[WHQVLyQGHFP ‡'RVL¿FDGRUFRQFHSLOORVGHQ\ORQ ‡$FFHVRULRHVSHFLDOSDUDYHQWDQDVSXHUWDVGHGXFKDRHVSHMRV ‡9DVRGRVL¿FDGRU±PHGLGRUGHP/ ‡3DxRWULDQJXODUGHPLFUR¿EUD ‡3DxRGHPLFUR¿EUDSDUDYHQWDQDVFULVWDOHV ‡3DxRGHPLFUR¿EUDSDUDTXLWDUHOSROYRDEULOODQWDUOLPSLDUHOHFWURGRPpVWLFRV«

902 10 30 10 /7&LQGG

latiendaencasa.es






+RJDU

7RGRORTXHQHFHVLWDVSDUDHOFXLGDGRGHWXURSD 7XURSDQHFHVLWDXQFXLGDGRHVSHFLDO6LTXLHUHVFRQVHUYDUODFRPRHOSULPHUGtD\YHVWLUVLHPSUHLPSHFDEOHQRWHSLHUGDVHVWRVSUiFWLFRV DFFHVRULRVTXHWHKDUiQPiVIiFLOWXWDUHDGHSODQFKDU\ODYDU2EWHQGUiVUHVXOWDGRVH[FHOHQWHVFDVLVLQHVIXHU]R\GHODIRUPDPiV FyPRGD

6XHODSDUDSODQFKDV

â&#x201A;¬

0DOOD ODYDOHQFHUtD *DVWRVGHHQYtR

¼

â&#x201A;¬

0DOOD ODYDFDO]DGR

*DVWRVGHHQYtR

¼

â&#x201A;¬

5I%

5I%

*DVWRVGHHQYtR

¼

5I%

7DEODGHSODQFKDU 3ODQFKDPDQJDV

â&#x201A;¬

¼

â&#x201A;¬

â&#x201A;¬

5I

*DVWRVGHHQYtR

¼

5I%

/DYDFRUEDWDV

â&#x201A;¬

*DVWRVGHHQYtR

&ROJDGRU WDEOD\SODQFKD

*DVWRVGHHQYtR

¼

5I%

5I%

$QWHVGHODYDU« *XDUGDWXURSDHQHVWHSUiFWLFRFHVWRHOGLVHxRPiV SUiFWLFRSDUDGHMDUSUHSDUDGDWXURSDDQWHVGHPHWHUODHQOD ODYDGRUD(VWiUHDOL]DGRHQEDPE~FRQIRUURLQWHULRUGHWHOD HLQFRUSRUDWDSDFRQDVDSDUDHYLWDUTXHODURSDHVWpDOD YLVWD\HYLWDURORUHV&ROyFDORHQHOEDxRHQODKDELWDFLyQGHO SODQFKDGR«TXHGDUiELHQHQFXDOTXLHUVLWLR(VWiGLVSRQLEOH HQFRORUEODQFR\QDWXUDO$SURYHFKDODRIHUWDHVSHFLDOGH 6HSWLHPEUH\OOpYDWHHOWX\RSRUVyORâ&#x201A;¬ 0HGLGDV[FP GLiPHWUR 

&RPRGLGDGH¿FDFLD \UHVXOWDGRVLQFUHtEOHV 'HVFXEUHODIXHU]DGHOYDSRUFRQHVWDSODQFKD YHUWLFDO6DLYRG8QDSODQFKDPX\VHQFLOODGHXWLOL]DU SDUDHOSODQFKDGROLPSLH]D\HVWHULOL]DFLyQGHWRGDWXURSD TXHFDVLGHXQDVRODSDVDGDGHMDUiWXVSUHQGDVVLQDUUXJDV \SUHSDUDGDVSDUDYHVWLU&RQXQGHSyVLWRGHOLWURV\ XQDSRWHQFLDGH:VHFDOLHQWDHQVRORVHJXQGRV\ SURSRUFLRQDYDSRUFRQWLQXRGXUDQWHPLQXWRV,QFOX\HXQD SLQ]DSDUDORVSDQWDORQHV\XQDFFHVRULRUtJLGRSDUDSODQFKDU \DGHPiVSDUDWRWDOVHJXULGDGLQFRUSRUDWHFQRORJtDGH DXWRDSDJDGR£3iVDWHDOSODQFKDGRIiFLO 3ODQFKDGRYHUWLFDO 6XSHUVWHDPSURIHVLRQDO6DLYRG

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I $OLPHQWDFLyQ5HG

*DVWRVGHHQYtR

3RQJRWRGRGHEDPE~SOHJDEOH

¼

â&#x201A;¬

6HSWLHPEUH

6yORKDVWD 393+DELWXDOâ&#x201A;¬

%ODQFR5I% 1DWXUDO5I%



/DUD\DGHO SDQWDOyQVLHPSUH SHUIHFWD

Cómodas mensualidades 7~HOLJHVODIRUPDGHSDJR

/7&LQGG




+RJDU 'HVFXEUHXQ QLYHOGHSRWHQFLDVXSHULRU $KRUD5RZHQWDWHGDPiV&RQHOQXHYR DVSLUDGRUVLQEROVD$LU)RUFHREWHQGUiV PD\RUSRWHQFLDUDSLGH]\H¿FDFLDSDUD DWUDSDUWRGRWLSRGHVXFLHGDG&RPRHV LQDOiPEULFRSRGUiVPRYHUWHSRUWRGRVORV HVSDFLRVIiFLOPHQWH6XPRWRUHVXQ PiVSRWHQWH\JUDFLDVDVXWHFQRORJtD &\FORQLFVLHPSUHPDQWLHQHWRGRVX UHQGLPLHQWR,QFRUSRUDXQQRYHGRVRFHSLOOR HOpFWULFRGHDOWDYHORFLGDGH[WUDtEOH\IiFLO GHOLPSLDU\XQDQXHYDERTXLOOD'HOWD8OWUD 6OLPTXHWHSHUPLWLUiOOHJDUORVULQFRQHV PiVGLItFLOHV7DPELpQKDDXPHQWDGRVX DXWRQRPtDDPLQXWRV \KDUHGXFLGRVXWLHPSR GHUHFDUJDKDVWD XQ'HVFXEUH HQWXVSURSLDVPDQRV WRGDODIXHU]DGHOD DVSLUDFLyQ$LU)RUFH $VSLUDGRU $LU)RUFH5+

€

'\VRQ'LJLWDO6OLP ODDVSLUDGRUDVLQFDEOHTXHQRSLHUGH SRWHQFLDGHVXFFLyQ /DQXHYDDVSLUDGRUDGHHVFRED\PDQR'\VRQFXHQWDFRQHOGREOH GHSRWHQFLDGHVXFFLyQTXHFXDOTXLHURWUDDVSLUDGRUD(VWiHTXLSDGD FRQHOH[FOXVLYRPRWRUGLJLWDO'\VRQHOPiVSRWHQWHGHOPHUFDGR \JUDFLDVDVXWHFQRORJtDSDWHQWDGD5RRW&\FORQHŒFDSWXUDPiV SROYRTXHFXDOTXLHURWUDDVSLUDGRUDVLQSHUGHUVXFFLyQ7XVVXHORV TXHGDUiQLPSHFDEOHVLQFOXVRHQDOIRPEUDV\VXHORVGXURVJUDFLDV DVXFHSLOORPRWRUL]DGRFRQFHUGDVGH¿EUDGHFDUERQR<FXDQGR QHFHVLWHVOLPSLDUWXVVRIiVDUPDULRVFRFKH«VHFRQYHUWLUiHQXQD FRPSDFWDDVSLUDGRUDGHPDQR)DEULFDGDFRQPDWHULDOHVUREXVWRV \UHVLVWHQWHVEDWHUtDGHQtTXHOPDQJDQHVR\FREDOWRFRQPiV FDSDFLGDG\VLQHIHFWRPHPRULDSDUDQRSHUGHUSRWHQFLDGH VXFFLyQ&RQWRGDODJDUDQWtDGH'\VRQ $VSLUDGRU'\VRQ6WLFN '&$QLPDOSUR

€0HV FXRWDV

 6,1,17(5(6(6

7$(7,1 7RWDODSDJDU€

393€

5I67,&.$1



),1$1&,$&,Ð1

RSDJDHO 6yORKDVWD

$OLPHQWDFLyQ%DWHUtDUHFDUJDEOH

5I5+5 3DJRDSOD]DGR 6,1(175$'$ &RQV~OWDQRV

70

/RV~QLFRVFHQWURVGHSODQFKDGRVLQFDOGHUtQ£VRQGH6RODF

5HQGLPLHQWR HTXLYDOHQWH

7HFQRORJtD &\FORQLFPDQWLHQH HOUHQGLPLHQWRGH DVSLUDFLyQ

6RODFWHSUHVHQWDORV~QLFRVFHQWURVGHSODQFKDGRVLQFDOGHUtQTXHFRQXQDSRWHQFLDGH :WHRIUHFHQORVPHMRUHVUHVXOWDGRVGHSODQFKDGR6XVQXHYDVVXHODV³0DJQHVLXP´ IDEULFDGDVHQPDJQHVLRWHDSRUWDUiQXQDOLJHUH]D\GHVOL]DPLHQWRH[FHSFLRQDOHVFRQXQD WHPSHUDWXUDXQLIRUPHTXHHYLWDUiQTXHODVSUHQGDVVHSHJXHQ$GHPiVFXHQWDQFRQXQ QXHYRGLVHxRGHJHQHUDGRUGHYDSRUPiVH¿FD]\GXUDGHUR6XDXWRQRPtDLOLPLWDGDJHQHUD YDSRUGHIRUPDLQPHGLDWDSDUDXQSODQFKDGRPXFKRPiVUiSLGR(OLJHWXPRGHORHO6HQVRU 7DFWLOH(YROXWLRQFRQSDQWDOODWiFWLOTXHDFWLYDRGHVDFWLYDODIXQFLyQYDSRUFRQVyORWRFDUORR HOPRGHOR6HQVRU'\QDPLF(YROXWLRQFRQUHJXODFLyQGHWHPSHUDWXUDHOHFWUyQLFD1RWDUiVOD GLIHUHQFLD &HQWURGHSODQFKDGRFRPSDFWR6RODF 6HQVRU7DFWLOH(YROXWLRQ&9*

€

5I $OLPHQWDFLyQ5HG &HQWURGHSODQFKDGRFRPSDFWR6RODF 6HQVRU'\QDPLF(YROXWLRQ&9*

€

5I $OLPHQWDFLyQ5HG

&HSLOORGH DOWDYHORFLGDG

6LQFDEOH

&$5$&7(5Ë67,&$67e&1,&$6 ‡$XWRQRPtDLOLPLWDGD‡9DSRUK~PHGRSDUDODVDUUXJDVPiV GLItFLOHV‡6LVWHPDGHVHJXULGDGDXWRSDXVH‡$YLVDGRU DF~VWLFR‡:Pi[SRWHQFLD‡&HUWL¿FDGR:RROPDUN ‡9DSRUYHUWLFDO‡1XHYRGLVHxRJHQHUDGRUGHYDSRU

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  *DVWRVGHHQYtR € \GHJHVWLyQ € LQFOXLGRVHQODFXRWD 9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






+RJDU



(OURERWDVSLUDGRUPiVSRWHQWHGHOPHUFDGR

£/LEpUDWHGHWXVWDUHDVGRPpVWLFDV(OURERWDVSLUDGRULQWHOLJHQWH1HDWRHVHOPiVSRWHQWH GHWRGRVVHGHVSOD]DDXWRPiWLFDPHQWHSRUWRGDVODVVXSHU¿FLHV PDGHUDEDOGRVDV PRTXHWD« \DVSLUDHQSURIXQGLGDGHOSROYR\ODVXFLHGDG*UDFLDVDVX H[FOXVLYRVLVWHPDGHYLVLyQSRUOiVHU\JHQHUDFLyQGHPDSDV1HDWR FUHDXQPDSDGHWRGRORTXHOHURGHDFRPRORVPXHEOHVREMHWRV\ SXHUWDVDVtSXHGHGHVSOD]DUVHHYLWDQGRWRGRVORVREVWiFXORV SHURVLQGHMDUQLQJXQD]RQDVLQOLPSLDULQFOXLGR ODVHVTXLQDV\GHEDMRGHORVPXHEOHV3RGUiVSURJUDPDU FXiQGRTXLHUHVTXHOLPSLHSDUDTXHW~SXHGDVKDFHU RWUDVFRVDV\FXDQGRWHUPLQDFRQXQDKDELWDFLyQ YXHOYHDXWRPiWLFDPHQWHDVXEDVHGHFDUJD 1HDWRHVHOURERWPiVSRWHQWH\H¿FD]£UHDOPHQWH DVSLUD3UXpEDOR\GLVIUXWDGHWXWLHPSROLEUH 5RERWGHDVSLUDFLyQ1HDWR;9

€0HV FXRWDV

 6,1,17(5(6(6

7$(7,1 7RWDODSDJDU€

393€

5I



),1$1&,$&,Ð1

RSDJDHO 6yORKDVWD ,1&/8<( ‡¿OWURV ‡%DVHGHUHFDUJD ‡&HSLOOR

9XHOYH DXWRPiWLFDPHQWH DODEDVHSDUD UHFDUJDUVH

6HDMXVWD DXWRPiWLFDPHQWH DDOIRPEUDV \VXHORVGXURV

/tPSLDFRQ FXLGDGR DOUHGHGRUGHORV REVWiFXORV

6XSHU¿OEDMR OHSHUPLWH OLPSLDUEDMR ORVPXHEOHV

£(OPRYLPLHQWRFRQWUDODVXFLHGDG +D]TXHWXOLPSLH]DVHDPXFKRPiVVHQFLOODFRQ9LURELGH9LOHGD 8QDPRSDUREyWLFDTXHOLPSLDHOVXHORGHIRUPDDXWRPiWLFD\HOLPLQD ODVXFLHGDGVLQTXHWHQJDVTXHKDFHUHVIXHU]RDOJXQR6XSRGHUGH OLPSLH]DURWDWLYROLPSLDWRGRWLSRGHVXSHU¿FLHVGXUDVLQFOXVRHQODV HVTXLQDV\GHEDMRGHORVPXHEOHV6LPSOHPHQWHWHQGUiVTXHHOHJLUHO WLSRGHSURJUDPDTXHTXLHUDV FRUWRGHPLQXWRVRODUJRGHPLQXWRV  \FDPELDUVXJDPX]DHOHFWURHVWiWLFDFXDQGRWHUPLQHVGHOLPSLDU/D IRUPDPiVUiSLGD\FyPRGDSDUDWHQHUWXKRJDULPSHFDEOHDKRUDFRQGRV MXHJRVGHUHFDPELRV 0RSDUREyWLFD9LOHGD9LUREL SDFNGHUHFDPELRV

€

*DVWRVGHHQYtR

0HGLGDV $[+[) [[FP

8QDODERUGHVLHPSUHFRQODVIDFLOLGDGHV GHKR\ /DPiTXLQDGHFRVHU1H[WGH$OIDHVOD~QLFDHQHOPHUFDGRFRQ PD\RUVXSHU¿FLHGHWUDEDMR\DFFHVLELOLGDGTXHKDUiTXHWXV ODERUHVGHFRVWXUDWHUHVXOWHQPXFKRPiVFyPRGDV\IiFLOHV&XHQWD FRQEUD]ROLEUHSDUDHOFRVLGRGHSUHQGDVWXEXODUHVGREOHDOWXUD GHSUHQVDWHODVSDUDJpQHURVJUXHVRV\GLVHxRVGHSXQWDGD FRQPXOWLWXGGHSRVLELOLGDGHV'HHQKHEUDGRVHQFLOORSHUIHFWDPHQWH VHxDOL]DGRVLVWHPDGHERELQDGRDXWRPiWLFRFRVHERWRQHVKDFH RMDOHVSXQWDGDVUHFWDVSXQWDGDVHQ]LJ]DJ«WRGRORTXHTXLHUDV 8QDPiTXLQDTXHWHIDFLOLWDUiWXVODERUHVGHFRVWXUDXQSUHFLRPiV TXHDVHTXLEOHDKRUDHQ6HSWLHPEUHSRUVyOR€FRQWRGDOD JDUDQWtDGH$OID 0iTXLQDGH FRVHU$OID1H[W 5I $OLPHQWDFLyQ5HG 0HGLGDV[[FP

¼

5I% $OLPHQWDFLyQ1,0+UHFDUJDEOH $XWRQRPtDPLQ

&DPELDDXWRPiWLFDPHQWH GHGLUHFFLyQFXDQGRGHWHFWD SDUHGHVXREMHWRV

9(59Ë'(2 ODWLHQGDHQFDVDHV

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€



7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG




+RJDU

ÒOWLPDWHFQRORJtDSDUDODOLPSLH]D DXWRPiWLFDPiVH¿FD]HQWXKRJDU 1RWHSLHUGDVHOURERWTXHOLPSLD\IULHJDWXVVXHORVGHIRUPDWRWDOPHQWHDXWRPiWLFD FRQVLJXLHQGRXQRVUHVXOWDGRVLPSHFDEOHV(OIULHJDVXHORV6FRRED FRQVHJXLUiOLPSLDUFHSLOODU\UHWLUDUHODJXDVXFLDGHOVXHOR8WLOL]DXQ DYDQ]DGRVLVWHPDGHOLPSLH]DSDWHQWDGRHQIDVHVTXHUHWLUDHODJXD VXFLDGHOVXHOR\ODVHSDUDGHODJXDOLPSLDGHMDQGRWXVVXHORVUHDOPHQWH LPSHFDEOHV)XQFLRQDHQVXHORVGHEDOGRVDVD]XOHMRVOLQyOHR PDGHUD/DWHFQRORJtDGHOLPSLH]DGHVXHORVPiVDYDQ]DGDHQXQ WDPDxRUHGXFLGRDKRUDHQ6HSWLHPEUHDOPHMRUSUHFLR 5RERW)ULHJDVXHORV6FRRED

6HSWLHPEUH

€

6yORKDVWD

€0HV

FXRWDV6,1,17(5(6(6 7$(7,1 7RWDODSDJDU€

393+DELWXDO€

5I



),1$1&,$&,Ð1

RSDJDHO 6yORKDVWD



 &$5$&7(5Ë67,&$67e&1,&$6 ‡6LVWHPDSDWHQWDGRGHOLPSLH]D HQIDVHV ‡+DVWDPSRUFLFORGHOLPSLH]D ‡/LPSLH]DDXWRPiWLFDJUDFLDVD VXVLVWHPDGHQDYHJDFLyQL$GDSW ‡,QFOX\HSDUHGYLUWXDODGDSWDGRU GHFRUULHQWHEDWHUtD6FRRED VRSRUWHSDUD6FRRED VREUHVGHVROXFLyQGHOLPSLH]D



6,67(0$'(/,03,(=$3$7(17$'2 (1)$6(6 /DYDHOVXHOR &HSLOOD\UHFRJHODVXFLHGDG 5HWLUDHODJXDVXFLDGHOVXHOR \ODVHSDUDGHODJXDOLPSLD

0HGLGDV +[' [FP 3HVRNJ

3RWHQFLDTXHVHYHVXFLHGDGTXHGHVDSDUHFH (ODVSLUDGRUPXOWLFLFOyQLFR,Q¿QLW\([FHOOGH'LUW'HYLOHVXQD\XGDQWHSRWHQWHH LQGLVSHQVDEOHSDUDFRQVHJXLUXQKRJDUOLPSLR\VLQSROYR&RQVXWHFQRORJtDPXOWLFLFOyQ FRQFLQFRQLYHOHVDVSLUDKDVWDODVSDUWtFXODVPLFURVFySLFDVDXQDSRWHQFLDFRQVWDQWH GH:\VLQSpUGLGDGHVXFFLyQ8QGLVHxRPRGHUQRSHQVDGRSDUDWX FRPRGLGDG\DTXHGLVSRQHGHDVDGHWDFWRVXDYHTXHWHD\XGDUiDWUDQVSRUWDUOR VLQHVIXHU]R$GHPiVHVWHDVSLUDGRUSHUPLWHLQWHJUDUHQVXHVWUXFWXUDOD ERTXLOODSDUDUDQXUDV\HOSLQFHOSDUDPXHEOHVXQDLGHDPX\SUiFWLFD\D TXHHVWDUiQVLHPSUHDPDQR7DPELpQLQFOX\HFHSLOORPLQLWXUER\FHSLOOR SDUDVXHORGXUR<GH5(*$/2UHFLELUiVXQNLWGHDFFHVRULRVGH OLPSLH]DSDUDHOFRFKH/OpYDWHXQSURIHVLRQDOGHODOLPSLH]D $VSLUDGRU0XOWLFLFOyQLFR'LUW'HYLO0 5(*$/2NLWGHOLPSLH]DSDUDFRFKH

€

5I $OLPHQWDFLyQ5HG

5(*$/2 .LWGHOLPSLH]DSDUDHOFRFKH YDORUDGRHQ¼

7(&12/2*Ë$08/7,&,&/Ï1 1,9(/(6<327(1&,$&2167$17( /DIXHU]DFHQWUtIXJDGHOFLFOyQSULQFLSDOH[SXOVDODV SDUWtFXODVGHVXFLHGDGJUDQGHV\HOSROYRGHODLUHDVSLUDGR (OWRUEHOOLQRHQORVFLFORQHVDX[LOLDUHVVHSDUDODV SDUWtFXODVGHSROYRPiV¿QDVGHODFRUULHQWHGHDLUH \(O¿OWURGXDOGHGRVFDSDVTXHSURWHJH HOPRWRU¿OWUDSDUWtFXODVPLFURVFySLFDVGHODLUH (O¿OWURKLJLpQLFRVHHQFDUJDGHTXHHODLUHH[SXOVDGRVHD PiVOLPSLRTXHHODLUHGHODHVWDQFLD

0HGLGDV $[+[) [[FP

*DVWRVGHHQYtR € \GHJHVWLyQ € LQFOXLGRVHQODFXRWD 9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






&RFLQD

$QWLDGKHUHQWH UHVLVWHQWH\DSWDSDUD WRGDVODVVXSHU¿FLHV (TXLSDWXFRFLQDFRQXQDVDUWpQUHVLVWHQWH\GHJUDQFDOLGDG IDEULFDGDHQDOXPLQLRFRQUHFXEULPLHQWRGHFHUiPLFD *UDFLDVDVXVXSHU¿FLHDQWLDGKHUHQWHSRGUiVFRFLQDU VLQTXHVHSHJXHQORVDOLPHQWRV\GLVWULEXLUHOFDORUGH IRUPDKRPRJpQHD7HSHUPLWLUiIUHtUFRQPXFKDPHQRV JUDVDFRQVHUYDQGRWRGRHOVDERUYLWDPLQDV\QXWULHQWHV GHORVDOLPHQWRV)XQFLRQDHQWRGRWLSRGHFRFLQDV JDVLQGXFFLyQYLWURFHUiPLFDRHOpFWULFDV\WDPELpQ HVDSWDSDUDHOKRUQR\HOODYDYDMLOODV\DTXHUHVLVWHDOWDV WHPSHUDWXUDV,QFOX\HWDSDGHFULVWDOFRQVDOLGDGHYDSRU \SURWHFFLyQDQWLURWXUD\SDUDPD\RUVHJXULGDGGLVSRQH GHPDQJRGHVOL]DQWH\UHVLVWHQWHDOFDORU(OLJHODRIHUWD TXHPiVVHDGDSWHDWLXQDVDUWpQGHFPRHOSDFN FRPSXHVWRSRUXQDVDUWpQGHFP\FPTXHLQFOX\H GH5(*$/2XQDVDUWpQPiVGHFP

6DUWpQGH&HUiPLFD &HUDPLFRUHFP FRQWDSD

€

*DVWRVGHHQYtR

¼

5I%

3DFNVDUWHQHVGH &HUiPLFD&HUDPLFRUH FPFP FRQWDSD 5(*$/2VDUWpQFPVLQWDSD

€

*DVWRVGHHQYtR

¼

5I%

9(59Ë'(2 ODWLHQGDHQFDVDHV



Recibe el pedido donde tú quieras 7~HOLJHVHOOXJDUGHHQWUHJD

/7&LQGG




&RFLQD

£$OULFRKHODGR /OHJDDWXFRFLQDODPiTXLQDGHKHODGRV<RQDQDVGH3ULQFHVV 8QDPiTXLQDTXHWHSHUPLWLUiKDFHUKHODGRVHQFDVD QDWXUDOHVVyORFRQIUXWDFRQJHODGD1RQHFHVLWDUiVQLOiFWHRVQL GHULYDGRV'LVIUXWDUiVGHKHODGRVFUHPRVRVEDMRVHQFDORUtDV\ FRQXQDOWRFRQWHQLGRHQ¿EUD,UUHVLVWLEOHSDUDORVTXHVHFXLGDQ\ SDUDORVQLxRV7HQGUiVLQ¿QLGDGGHKHODGRVGHSOiWDQRIUHVD SLxDPDQJRQDUDQMDPHORFRWyQLQFOXVRSRGUiVDxDGLU FKRFRODWHRFRRNLHV(VLGHDOSDUDGLHWDVHVSHFLDOHVVLQOHFKH VLQD]~FDURVLQJOXWHQ<HVPX\IiFLO\UiSLGRVyORWLHQHVTXH LQWURGXFLUODIUXWDFRQJHODGDHQ<RQDQDVSUHVLRQDU\VXSRWHQWH PRWRUFRQYHUWLUiODIUXWDFRQJHODGDHQXQFUHPRVRKHODGROLVWRSDUD WRPDU$GHPiVYLHQHDFRPSDxDGRGHXQSUiFWLFRUHFHWDULRFRQ RULJLQDOHVFRPELQDFLRQHVGHKHODGR 0iTXLQDGHKHODGRV<RQDQDV

â&#x201A;¬

*DVWRVGHHQYtR

¼

5I% $OLPHQWDFLyQ5HG 0HGLGDV $[+[) [[FP 3HVRNJ 3RWHQFLD:

+HODGRVFUHPRVRV QDWXUDOHV

0HQDMHGHFRFLQD£DOPHMRUSUHFLR

&RFLQDIiFLOFRQ-RFFD &RQODH[FOXVLYDROODHOpFWULFDGH-RFFDWDQVyORWHQGUiVTXH LQWURGXFLUORVDOLPHQWRVSURJUDPDU\OLVWR&RQXQDFDSDFLGDGGH FRFFLyQXQVXSHULRUDOGHODFRFLQDHOpFWULFDWUDGLFLRQDO\XQ WHPSRUL]DGRUSURJUDPDEOHFRQKRUDVGHDQWHODFLyQ/DRSFLyQ SHUIHFWDFRQODTXHWHROYLGDUiVGHFRFLQDU\GLVIUXWDUiVPiVGHWX WLHPSROLEUH 2OODHOpFWULFDSURJUDPDEOH-RFFD

â&#x201A;¬

5I $OLPHQWDFLyQ5HG &DSDFLGDG/ 3RWHQFLD:

9(59Ã&#x2039;'(2 ODWLHQGDHQFDVDHV

/DPHMRUFDOLGDGSDUDXQMXHJRGHVDUWHQHVFRQWRGDODJDUDQWtD GH%RUERQL&XHQWDQFRQUHYHVWLPLHQWRDQWLDGKHUHQWHGHDOWD FDOLGDGGHJUDQHVSHVRU\H[WHULRUHQFRORUQHJUR&RPSXHVWDSRU XQDVDUWpQGH\FP\DSWDVSDUDWRGRWLSRGHFRFLQDV H[FHSWRFRFLQDVGHLQGXFFLyQ(TXLSDWXFRFLQDFRQHOPHMRU FRQMXQWRDXQSUHFLRLUUHVLVWLEOHGXUDQWHHOPHVGH6HSWLHPEUH VyORâ&#x201A;¬ /RWHGHVDUWHQHV%RUERQL

6HSWLHPEUH

â&#x201A;¬

*DVWRVGHHQYtR

6yORKDVWD 393+DELWXDOâ&#x201A;¬

¼

5I%

,1&/8<( Â&#x2021;2OODHOpFWULFD Â&#x2021;9DVRPHGLGRU Â&#x2021;&XFKDUD Â&#x2021;/LEURGHLQVWUXFFLRQHV

902 10 30 10 /7&LQGG

latiendaencasa.es






&RFLQD

,QGLVSHQVDEOHVHQWXFRFLQDDOPHMRUSUHFLR $FFHVRULRVSDUDDKRUUDUHVSDFLR +D]WXFRFLQDPXFKRPiVSUiFWLFD\FyPRGDFRQHVWRV RULJLQDOHVDFFHVRULRVFRQORVTXHSRGUiVRUGHQDUWRGRV WXVXWHQVLOLRV7HSURSRQHPRVXQRVFROJDGRUHVHVSHFLDOHV SDUDWD]DV\XQHVSHFLHURKRUL]RQWDOSDUDFRORFDUHQORV DUPDULRV\SDUDWXVXWHQVLOLRVGHOLPSLH]DXQDHVWDQWHUtD TXHVHFRORFDEDMRHOIUHJDGHURORPHMRUSDUDDSURYHFKDU DOPi[LPRWRGRHOHVSDFLR

&ROJDGRU SODWRV\WD]DV

€

&ROJDGRUWDSDV

€

*DVWRVGHHQYtR

¼

*DVWRVGHHQYtR

¼

5I%

5I%

(VSHFLHUR KRUL]RQWDO *DVWRVGHHQYtR

€

¼

5I%

7XFXEHUWHUtDGHWRGRVORVGtDV

(OFXERPiV SUiFWLFRSDUDUHFLFODU

5I

&XERGHEDVXUD FRPSDUWLPHQWRV

6Ï/2



81,'$'(6

¼

*DVWRVGHHQYtR

¼

5I%

&XEHUWHUtDSLH]DV

€

*DVWRVGHHQYtR

€

5I%29(

(VWDQWHH[WHQVLEOH EDMRIUHJDGHUR

€

&ROJDGRU WD]DV\FRSDV

6HSWLHPEUH

+ D S Q \ F 

€

6yORKDVWD 393+DELWXDO€

5I &DSDFLGDG/ 0DWHULDO$FHURLQR[LGDEOH 0HGLGDV $[+[) [[FP

6Ï/2 3,(=$6'($&(52,12;,'$%/( ‡FXFKDUDVGHPHVD‡WHQHGRUHVGHPHVD ‡FXFKLOORVFKXOHWHURV‡FXFKDULOODVGH FDIp‡FXFKDULOODVGHPRND‡WHQHGRUHV GHSHVFDGR‡FXFKLOORVGHSHVFDGR ‡FXFKLOORVOXQFK‡WHQHGRUHVOXQFK ‡FD]RGHVRSD‡FDFLOORGHVDOVD‡SDODGH WDUWD‡FXFKDUyQGHOHJXPEUHV‡WHQHGRU GHOHJXPEUHV



81,'$'(6

(VWXFKHGHGLVHxR FOiVLFR\HOHJDQWH

/DYDMLOODPiVFRPSOHWD £SLH]DVSRUVyOR€ 9DMLOOD6HWSLH]DV

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

7DPELpQGLVSRQLEOHHQ 6Ï/2

6Ï/2





81,'$'(6

81,'$'(6

5RMR

%HLJH

%HLJH5I 5RMR5I 9HUGH5I 6Ï/2



81,'$'(6

,1&/8<( ‡SODWRVOODQRV ‡SODWRVGHSRVWUH ‡EROV ‡WD]DV



/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG


6

&RFLQD 3DUDFRFLQDUFRQYLVWDV 7HSUHVHQWDPRVHVWDEDWHUtDGHFRFLQD6RODFFRQWDSDGHFULVWDOTXHWHSHUPLWLUiFRQWURODUHQWRGR PRPHQWRWXVJXLVRV(VWiUHDOL]DGDHQDFHURLQR[LGDEOH\FXHQWDFRQIRQGRGLIXVRU81,7+(50TXH UHSDUWHXQLIRUPHPHQWHHOFDORU6HFRPSRQHGHXQDROODGHFPROODGHFPFDFHURODGHFPFDFHUROD GHFP\FD]R8QDEDWHUtDTXHSRGUiVXWLOL]DUFRQWRGRWLSRGHIXHJRVJDVHOpFWULFRYLWURFHUiPLFDHLQGXFFLyQ &RQVtJXHODDKRUDHQHVWDRIHUWDHVSHFLDOSRUVyOR€VyORGXUDQWHHOPHVGH6HSWLHPEUH

5(*$/2 5(*$/2 6HOODGRUGHEROVDV

%DWHUtDGHFRFLQDSLH]DV6RODF 5(*$/26HOODGRUGHEROVDV

€

*DVWRVGHHQYtR

¼

5I% 6yORKDVWD 393+DELWXDO€

(OVDERU\ODIUHVFXUDGHWXVDOLPHQWRVDKRUDGXUDQPiV +D]TXHWXVDOLPHQWRVPDQWHQJDQWRGRHOVDERU\ODIUHVFXUDGXUDQWHPiVWLHPSRFRQHVWRVSUiFWLFRVDFFHVRULRVTXHWHSUHVHQWDPRV8QDHQYDVDGRUD DOYDFtRPX\~WLOSDUDFRQVHUYDUSODWRVSUHSDUDGRVFRQJHODUHQYDVDUDOYDFtR«6yORWLHQHVTXHLQWURGXFLUHODOLPHQWRHQODEROVD\TXHGDUiQ SHUIHFWDPHQWHHQYDVDGRVQRWHQGUiVTXHKDFHUQDGDPiV\DTXHHVFRPSOHWDPHQWHDXWRPiWLFD<FXDQGRVDOJDVGHYLDMH QRWHSXHGHIDOWDUHVWHSUiFWLFRVHWGHHQYDVHVDOYDFtRPX\~WLOHVSDUDHOIULJRUt¿FRFRQJHODGRUPLFURRQGDV« \TXHLQFRUSRUDXQDERPEDGHDLUHSDUDH[WUDHUWRGRHODLUHGHOHQYDVH\SURORQJDUVXFRQVHUYDFLyQ FRQXQDUXHGDHQODWDSDSDUDLQGLFDUHOGtD\HOPHVGHOHQYDVH$GTXLHUH\DWXHQYDVDGRUD\VHWGH HQYDVHVDOPHMRUSUHFLR$GHPiVVLORDGTXLHUHVWRGRMXQWRREWHQGUiVXQGHVFXHQWRHVSHFLDO

/OpYDWHORVSRUVyOR

€

5I

0iTXLQDGHHQYDVDU DOYDFtR97/DLFD

6HWHQYDVHVFRQ %RPEDGHYDFtR

€

,1&/8<( ‡UROORGHHQYDVDGR [FP

‡7XERDVSLUDGRUSDUDWDUURV

€

5I $OLPHQWDFLyQ5HG

5I

¢$JXDIUtDRGHOWLHPSR" 6LTXLHUHVWHQHUVLHPSUHDPDQRXQYDVRGHDJXDWHSUHVHQWDPRVHVWHSUiFWLFRGLVSHQVDGRUGHDJXDSHUIHFWR SDUDXWLOL]DUHQFDVDRHQODR¿FLQD8QGLVSHQVDGRUFyPRGROLPSLR\IiFLOGHUHOOHQDUTXHLQFOX\HXQGHSyVLWR UHIULJHUDQWHGH/TXHHVFDSD]GHHQIULDUKDVWDž&3RGUiVXWLOL]DUVXGHSyVLWRRDFRSODUERWHOODV GHDJXDGHGLIHUHQWHVWDPDxRV\DTXHVHDMXVWDQGHIRUPDFyPRGD\VHJXUD3DUDXQDOLPSLH]DDGHFXDGD WDPELpQLQFOX\HEDQGHMDUHFRJHJRWDVH[WUDtEOH5HIUpVFDWHUiSLGDPHQWHFRQHOGLVSHQVDGRUGHDJXD-RFFD

'LVSHQVDGRUGHDJXD FRQGHSyVLWR-RFFD

€

5I $OLPHQWDFLyQ5HG

<VL\DWLHQHVXQGLVSHQVDGRUGHDJXDSXHGHVOOHYDUWH ~QLFDPHQWHHOGHSyVLWRGH/ 'HSyVLWRGH DJXD-RFFD

€

5I

902 10 30 10

latiendaencasa.es






&RFLQD

&RUWDUDOODWURFHD£HQODPLWDGGHWLHPSR $KRUDSRGUiVSUHSDUDUODVUHFHWDVPiVHODERUDGDVUiSLGDPHQWH\VLQQLQJ~QHVIXHU]R1LFHU'LFHU3OXVFRUWD SLFD\WURFHDORVDOLPHQWRVPiVYDULDGRV(VWiGLVHxDGRFRQXQDVFXFKLOODVGHDFHURLQR[LGDEOHGHGLVWLQWRV WDPDxRVTXHSHUPLWHQYDULRVWLSRVGHFRUWH&RQVRORSRQHUODSLH]DTXHTXLHUHVFRUWDU\SUHVLRQDUWRGR TXHGDGHQWURGHOUHFLSLHQWH\VLQHQVXFLDUQDGD,QFOX\HWRGRVORVDFFHVRULRVSDUDFRUWDUHQGDGRVHQWLUDV UHFWDQJXODUHVFRQJURVRUJDMRVFXDUWRV«LQ¿QLGDGGHSRVLELOLGDGHV£HQODPLWDGGHWLHPSR<GH5(*$/2 UHFLELUiVXQ/LEURGHUHFHWDVSDUDTXHUHDOLFHVORVPHMRUHVSODWRVWRGRSRUVyOR€£3tGHOR\D 1LFHU'LFHU5(*$/2/LEURGHUHFHWDV

€

*DVWRVGHHQYtR

¼

5I%

<325€0È6 3HODGRU &XFKLOODWULDQJXODU 5DOODGRU $FHLWHGHROLYD/

*DVWRVGHHQYtR

¼

5I%

5(*$/2 /LEURGHUHFHWDV

9(59Ë'(2 ODWLHQGDHQFDVDHV

/DFRFLQDTXHPiVJXVWDDWRGDODIDPLOLD

/DVUHFHWDVDOYDSRUPiVVDEURVDV

3DOVRQWHRIUHFHHVWDEDUEDFRD&RORUDGRSDUDGLVIUXWDUGHODXWpQWLFR VDERUDODSDUULOODGHXQDIRUPDPiVVDOXGDEOHFRQXQDJUDQ FDSDFLGDGGH[FP\SDUULOODGHPHWDOGHIiFLOOLPSLH]DTXH HYLWDUiTXHVHPH]FOHQORVVDERUHV8QHOHFWURGRPpVWLFRSHUIHFWRSDUD GLVIUXWDUHQIDPLOLDTXHDGHPiVWHSHUPLWLUiOOHYDUORGLUHFWDPHQWHDOD PHVDSDUDVHUYLUODFRPLGDHQVXSXQWR

&RFLQDUDOYDSRUHVXQKiELWRVDOXGDEOH\DTXHD\XGDDTXHORV DOLPHQWRVFRQVHUYHQVXVQXWULHQWHVLQWDFWRVDODYH]TXH PDQWLHQHQWRGRVXVDERUFRQVLVWHQFLD\FRORUQDWXUDO$KRUD WHQGUiVWRGDVHVWDVYHQWDMDVHQWXFRFLQDFRQHVWHVLVWHPDGHFRFFLyQ DOYDSRU&RQXQDSRWHQFLDGH:SRGUiVFRFLQDUKDVWDSODWRV DODYH]JUDFLDVDVXVFHVWDVDSLODEOHVGH/FDGDXQDFRQ WHPSRUL]DGRUGHPLQXWRVHLQGLFDGRUH[WHUQRGHOQLYHOGH DJXD$GHPiVLQFOX\HXQDFHVWDHVSHFLDOSDUDDUUR]\HVDSWDSDUDHO ODYDYDMLOODV

%DUEDFRDHOpFWULFD3DOVRQ&RORUDGR

€

5I $OLPHQWDFLyQ5HG 0HGLGDV $[) [FP 3RWHQFLD:

&$5$&7(5Ë67,&$67e&1,&$6 ‡5HVLVWHQFLDGHJUDQWDPDxRSDUDXQDVDGRXQLIRUPH ‡3DUULOODGHPHWDO‡%DQGHMDUHFRJHJUDVDV ‡/X]LQGLFDGRUDGHIXQFLRQDPLHQWR‡$VDVGHWDFWRIUtR ‡6LVWHPDGHVHJXULGDGDXWRDSDJDGR



6LVWHPDGHFRFFLyQ/DXVRQ$)6

€

5I

0HGLGDV $[+[) [[FP 3RWHQFLD:

Atención al cliente $WXGLVSRVLFLyQSDUDFXDOTXLHUFRQVXOWD

/7&LQGG




&RFLQD

(OMDPyQHQWHUR\VLQKXHVR 'LVIUXWDGHOH[TXLVLWRVDERUGHXQMDPyQFXUDGR(VWLUSH 6HUUDQDGHXQDIRUPDWRWDOPHQWHGLVWLQWD$UJDOWHRIUHFH HVWHMDPyQHQWHURVLQKXHVRWRWDOPHQWHSUHSDUDGRSDUD FRUWDU\GLVIUXWDUVLHPSUHGHODFDOLGDGGHXQMDPyQUHFLpQFRUWDGR 3URFHGHQWHGHMDPRQHVVHOHFFLRQDGRVSDUDREWHQHUHOPHMRUERXTXHW KDVLGRVRPHWLGRDXQSHULRGRGHFXUDFLyQGHPHVHVHQERGHJDV \VHFDGHURVQDWXUDOHVORTXHOHFRQ¿HUHXQDWH[WXUD\XQVDERU LQLJXDODEOHV8QMDPyQTXHHTXLYDOHDXQDSLH]DGHNLORVSHUR FRQODFRPRGLGDGGHTXHHVWiWRWDOPHQWHGHVKXHVDGDSDUDTXHOR DSURYHFKHVWRGR(O~QLFRMDPyQIiFLOGHFRUWDUHQFDVDTXHLQFOX\HHQ HVWDRIHUWDXQMDPRQHURH[FOXVLYRGH5(*$/2SDUDTXHSXHGDV UHDOL]DUORVPHMRUHVFRUWHVGHODPDQHUDPiVVHQFLOOD'LVIUXWDGHOMDPyQ FRPRPiVWHJXVWDHQWHUR\VLQKXHVR ‡-DPyQHQWHURVLQKXHVR ‡(TXLYDOHDXQDSLH]DFRQKXHVRGHNJ ‡MDPyQ6LQGHVSHUGLFLRV ‡(O~QLFRIiFLOGHFRUWDUHQFDVD

$UJDO72'2XQ-$0Ï1

€

5I

5(*$/2 -DPRQHURH[FOXVLYR YDORUDGRHQ€

&XFKLOORMDPRQHURQRLQFOXLGR

%RVFKWHHFKDXQD³PDQR´

&XFKLOORVWDQD¿ODGRVFRPRHOSULPHUGtD

'LVIUXWDGHWXVSURSLRVFyFWHOHVEDWLGRVSRVWUHV«FRQHVWDEDWLGRUD GH%RVFK8QDSRWHQWHEDWLGRUDFRQUHJXODGRUGHSRWHQFLDFRQWLQXR HPSXxDGXUDHUJRQyPLFDSXOVDGRUGHGREOHIXQFLyQ\FXFKLOODVGHDFHUR LQR[LGDEOHFRQWULQFKDGRUHVYHUWLFDOHVDGLFLRQDOHV,QFOX\HYDVRGH PH]FODVFRQWDSDYDULOODEDWLGRUDSLFDGRUXQLYHUVDO\FXFKLOODHVSHFLDOSDUD SLFDUKLHOR,PSUHVFLQGLEOHHQWXFRFLQD<DKRUDDOPHMRUSUHFLRVyOR€ GXUDQWHHOPHVGH6HSWLHPEUH

$¿ODWXVFXFKLOORVGHIRUPDUiSLGD\VHQFLOODFRQHVWHD¿ODGRU HOpFWULFR0XOWL6KDUSHQHUGH3ULQFHVV(ODFFHVRULRPiV ~WLOSDUDWXFRFLQDFRQXQDSRWHQFLDGH:HVDSWRSDUD D¿ODUFXFKLOORVGHVLHUUD\GHKRMDOLVD8QDSDUDWRYHUViWLO \DTXHLQFOX\HXQGLVFRD¿ODGRULQWHUFDPELDEOHSDUDTXH WDPELpQSXHGDVXWLOL]DUORFRQWXVWLMHUDVGHVWRUQLOODGRUHV\RWUDV KHUUDPLHQWDVSHTXHxDV'LVIUXWDVLHPSUHGHOPHMRUFRUWHGHOD PDQHUDPiVFyPRGD\SRUVyOR€£7HQGUiVORVFXFKLOORV FRQODPLVPDFDOLGDGGHOSULPHUGtD

%DWLGRUD%RVFK0603(

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I $OLPHQWDFLyQ5HG 3RWHQFLD:

0XOWLD¿ODGRUHOpFWULFR 3ULQFHVV0XOWL6KDUSHQHU

€

*DVWRVGHHQYtR

¼

5I% $OLPHQWDFLyQ5HG

$¿ODFXFKLOORVWLMHUDV GHVWRUQLOODGRUHV\RWUDV KHUUDPLHQWDVSHTXHxDV

902 10 30 10 /7&LQGG

latiendaencasa.es






&RFLQD &KHI20DWLF3URODKHUUDPLHQWDGHFRFLQDHQ 6LWHHQFDQWDODEXHQDFRPLGDSHURQRWLHQHVWLHPSRSDUDFRFLQDUSiVDWHD&KHI20DWLF3UR&RQVRORSXOVDUXQERWyQVHWUDQVIRUPDUi HQXQDDUURFHUDXQDFD]XHODXQZRNXQDYDSRUHUDXQKRUQRXQDSDUULOODXQDROODH[SUpVXQDFDFHURODXQUHFLSLHQWHSDUDIRQGXHV\XQD VDUWpQ£(VFRPRWHQHUXWHQVLOLRVGHFRFLQDHQ(OVHFUHWRHVWiHQODWHFQRORJtDLQWHOLJHQWHTXHGHWHFWDHOFRQWHQLGRGHDJXD\HO SHVRGHFDGDWLSRGHDOLPHQWRSDUDFRFLQDUVLHPSUHFRQHOWLHPSR\WHPSHUDWXUDSHUIHFWRV6yORWLHQHVTXHLQWURGXFLUORVDOLPHQWRV SXOVDUHOERWyQ\OLVWR6yORVHGHWHQGUiFXDQGRODFRPLGDHVWpOLVWD\ODPDQWHQGUiFDOLHQWHKDVWDHOPRPHQWRGHVHUYLUOD<DSXHGHV SUHSDUDUUHFHWDVGHOLFLRVDV\VDOXGDEOHVHQSRFRVPLQXWRVVRSDVJXLVRVDUURFHVSDVWDVDVDGRVIULWXUDVSRVWUHV£\PXFKRPiV(OLJHWX FDSDFLGDGGH/R/\HPSLH]DDFRFLQDU &KHI20DWLF3UR 5(*$/2$FHLWH /

â&#x201A;¬

5I /

â&#x201A;¬

5I $OLPHQWDFLyQ5HG

9(59Ã&#x2039;'(2 ODWLHQGDHQFDVDHV

5(*$/2 /GHDFHLWH GHROLYD³´ &DOLGDGYLUJHQ H[WUD&RPDUFDGH 2VXQD 6HYLOOD

,1&/8<( Â&#x2021;&KHI20DWLF3UR/R/Â&#x2021;2OODLQWHULRUDQWLDGKHUHQWHÂ&#x2021;%DQGHMDHVSHFLDOFRFLQDDOYDSRU Â&#x2021;0DQXDOGHLQVWUXFFLRQHVÂ&#x2021;9DVRPHGLGRUÂ&#x2021;&XFKDUD&KHI20DWLFÂ&#x2021;(VSiWXOD&KHI20DWLF Â&#x2021;6RSRUWHODWHUDOSDUDFXFKDUD\HVSiWXODÂ&#x2021;5HFHWDULRFRQODVUHFHWDVSUHIHULGDV &KHI20DWLFODVUHFHWDVSUHIHULGDVGH&DWK\0LWFKHOO

*DQDHQVDERU\DKRUUDWLHPSR &RPSOHWDWXPHQDMHGHFRFLQDFRQHVWD VHOHFFLyQGHROODVDSUHVLyQGHDFHUR LQR[LGDEOHGH\/GHFDSDFLGDGFRQWDSD \FHVWRSDUDFRFLQDUDOYDSRU3RGUiVSUHSDUDU UiSLGDPHQWHWXVPHMRUHVJXLVRVHQFXDOTXLHU WLSRGHFRFLQDJDVHOpFWULFDYLWURFHUiPLFD HLQGXFFLyQ&XHQWDQFRQUHJXODGRUGH SUHVLyQDEDUHV\EDUVHJXULGDG GHDSHUWXUD\IRQGRGLIXVRU8QLWKHUP 8QFRQMXQWRGHJUDQFDOLGDGDKRUDHQ 6HSWLHPEUHSRUVyORâ&#x201A;¬ 6HWGH2OODV/6RODF

6HSWLHPEUH

â&#x201A;¬

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I

'LVWULEX\HHOFDORU GHIRUPDUiSLGD \XQLIRUPH



6HJXULGDGWRWDO WULSOHVLVWHPDGH VHJXULGDG

5HGXFHHOWLHPSR GHFRFFLyQKDVWD XQ

7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG




&RFLQD

/DVKHUUDPLHQWDVTXHWHKDUiQFFLQDUPHMU 7HSURSRQHPRVXQDVHOHFFLyQHVSHFLDOGHHOHFWURGRPpVWLFRVGHJUDQFDOLGDGORVDXWpQWLFRVTXHXWLOL]DQORVSURIHVLRQDOHVGH &DQDO&RFLQD\TXHWHSHUPLWLUiQSUHSDUDUODVUHFHWDVPiVYDULDGDVGHXQDIRUPDVHQFLOOD\UiSLGD/DVKHUUDPLHQWDVSHUIHFWDVSDUD FRFLQDUGHXQDIRUPDGLIHUHQWH\GHOLFLRVD

3DJRDSOD]DGR 6,1(175$'$ &RQV~OWDQRV

+RUQRGHPHVD7<

5DFOHWWH3ODQFKDGH$VDU5*

3ODQFKDGHDVDU7HSDQ\DNL

5I

5I

5I

0LQLKRUQRFRPSDFWRGHOLWURVUHDOL]DGR HQDFHURLQR[LGDEOHFRQXQVHOHFWRUGH WHPSHUDWXUDGHž&ž&,GHDOSDUD JUDWLQDUDVDU\WRVWDU

3HUPLWHFRFLQDUDOJULOORDODSLHGUD\SUHSDUDU GHOLFLRVDVUHFHWDVFRQTXHVRIXQGLGR\HPEXWLGR ,QFRUSRUDFDSDVOD~OWLPDSDUDPDQWHQHUOD FRPLGDWHPSODGDHLQFOX\HPLQLEDQGHMDVSDUD TXHVR\HVSiWXODVGHPDGHUD

&RPSXHVWDSRUXQDH[FOXVLYDPHPEUDQD XOWUDGHOJDGD\FULVWDOFHUiPLFRXOWUDUHVLVWHQWH SDUDFRUWDUVREUHpO&RFLQDFDUQHVSHVFDGRV YHUGXUDV«FXHQWDFRQ]RQDVFRQWHUPRVWDWRV LQGHSHQGLHQWHV\VHOHFWRUHVHOHFWUyQLFRVWiFWLOHV

€

€

€

3HTXHxVTXHKDFHQJUDQGHVWXVUHFHWDV 'LIHUpQFLDWHHQODFRFLQDFRQHVWRVSUiFWLFRVXWHQVLOLRVORVDXWpQWLFRVTXHXWLOL]DQHQ&DQDO&RFLQDTXHWH IDFLOLWDUiQODSUHSDUDFLyQGHWXVPHMRUHVUHFHWDV7HGDUiQPD\RUYHUVDWLOLGDGFRPRGLGDG\UDSLGH]HQ WRGDVWXVWDUHDV£/OpYDWHORVDOPHMRUSUHFLR

/RWHFXFKLOORVGHFHUiPLFD FP 5I%

7DFRSDUDFXFKLOORV 5I%

6HSWLHPEUH

€

*DVWRVGHHQYtR

¼

6yORKDVWD 393+DELWXDO€

€

6yORKDVWD 393+DELWXDO€

€

*DVWRVGHHQYtR

¼

6yORKDVWD 393+DELWXDO€

*DVWRVGHHQYtR

¼

6HSWLHPEUH

€

*DVWRVGHHQYtR

¼

'HODQWDODOJRGyQ 5I%

€

*DVWRVGHHQYtR

¼

6yORKDVWD 393+DELWXDO€

902 10 30 10 /7&LQGG

6HSWLHPEUH

6yORKDVWD 393+DELWXDO€

/RWHFDUURFRPSUD %ROVD 5I%

/RWHXWHQVLOLRV 5I%

6HSWLHPEUH

6HSWLHPEUH

/RWHPROGHVVLOLFRQD SDUDKRUQR 5I%

6HSWLHPEUH

€

*DVWRVGHHQYtR

¼

6yORKDVWD 393+DELWXDO€

latiendaencasa.es






%HOOH]D \6DOXG

+L0RGHO)DFHFRQiFLGRKLDOXUyQLFR DxRVPHQRVHQGtDV

5HGXPRGHOPDUFDSLRQHUDHQODLQYHVWLJDFLyQDOVHUYLFLRGHODEHOOH]DVDOXG\ELHQHVWDUWHRIUHFHHVWDFRPSOHWDOtQHDFRVPpWLFD +L0RGHO)DFH&RQVHJXLUiVUHVXOWDGRVYLVLEOHVGHODIRUPDPiVFyPRGD\HFRQyPLFD6XVIyUPXODVEDVDGDVHQ$OWDV&RQFHQWUDFLRQHVGH SULQFLSLRVQDWXUDOHVWHSURSRUFLRQDUiQORVPHMRUHVUHVXOWDGRVHQODFRPRGLGDGGHWXKRJDU8QSDFNDQWLHGDGFRPSXHVWRSRUXQDFUHPDGH GtDTXHKLGUDWDWXSLHOKRUDVSURGXFLHQGRXQHIHFWRWHQVRUXQDFUHPDGHQRFKHTXHLQFUHPHQWDODDFFLyQUHJHQHUDGRUDXQVpUXPGH iFLGRKLDOXUyQLFRSDUDHOWUDWDPLHQWRLQWHQVLYR\SURIXQGRGHODVDUUXJDV\SRU~OWLPRXQDPDVFDULOODSDUDPDQWHQHUXQDSLHOOLPSLD\UDGLDQWH TXHDOPLVPRWLHPSRHOHYD\UHOOHQDWXURVWUR1RORGXGHVVHFRQYHUWLUiHQWXWUDWDPLHQWRGH¿QLWLYRDKRUDHQHVWDRIHUWDHQH[FOXVLYDSDUD WLSRUVyOR€0LOHVGHSHUVRQDVKDQFRPSUREDGR\DVXH¿FDFLD 7UDWDPLHQWRIDFLDO+L0RGHO)DFH

€

5I ,1&/8<( ‡&UHPDGHGtD+L0RGHO)DFH PO

‡&UHPDGHQRFKH+L0RGHO)DFH PO

‡6HUXP+L0RGHO)DFH PO  ‡PDVFDULOODVIDFLDOHV+L0RGHO)DFH PO

3UREDEOHPHQWHODPHMRUGHSLODGRUDGHOPXQGR 7ULD%HDXW\WHSUHVHQWDHOGHSLODGRUOiVHU75,$70FUHDGRSRUORVPLVPRVFLHQWt¿FRVTXHLQYHQWDURQODGHSLODFLyQOiVHUSURIHVLRQDO75,$70 FXHQWDDKRUDFRQMXOLRVGHSRWHQFLDVLHQGRHOVLVWHPDGHGHSLODFLyQSDUDXVRHQHOKRJDUPiVSRWHQWHGHOPHUFDGR\QLYHOHVGH SRWHQFLDSDUDXQDPD\RUUDSLGH]\FRPRGLGDG8QVLVWHPDFOtQLFDPHQWHSUREDGRVHJXUR\H¿FD]TXHRIUHFHORVPLVPRVUHVXOWDGRVTXH ODGHSLODFLyQOiVHUSURIHVLRQDO6LTXLHUHVROYLGDUWHGHODGHSLODFLyQ\OXFLUXQDSLHOVXDYH\VHGRVDSDUDVLHPSUHHQODFRPRGLGDGGHWXKRJDU DGTXLHUHHOQXHYRVLVWHPDGHGHSLODFLyQOiVHU75,$70\OOHYiWHORDKRUDSRUVyOR€R€DOPHV VLGHVHDVSDJDUORHQFyPRGRVSOD]RV

¢&Ï02)81&,21$" /LPSLDUDVXUD\VHFD FXLGDGRVDPHQWH ODSLHO

'HSLODGRU75,$70 5(*$/21HFHVHU

€0HV FXRWDV

 6,1,17(5(6(6

7$(7,1 7RWDODSDJDU€

6Ï/2



81,'$'(6

393€

5I 6HOHFFLRQDHQWUHORV QLYHOHVGHHQHUJtD HOTXHPHMRUVHDGDSWH DWL $SR\DODSXQWDGHOOiVHU HQODSLHO\XQSLWLGR WHLQGLFDUiTXHVHKD HPLWLGRFRUUHFWDPHQWH XQSXOVROiVHU



),1$1&,$&,Ð1

RSDJDHO 6yORKDVWD

5(*$/2 1HFHVHU

,1&/8<( ‡/iVHU75,$70‡&DUJDGRU‡0DQXDOGHXVR ‡'9'H[SOLFDWLYR‡(VWXFKH &$5$&7(5Ë67,&$67e&1,&$6 ‡/iVHUGLRGRGHFODVHGHQP ‡1LYHOHVGHHQHUJtD-FP ‡'XUDFLyQGHOGLVSRVLWLYRPiVGHSXOVRV

(QWDQVyOR WUDWDPLHQWRV QXQFDPiVWHQGUiV TXHGHSLODUWH



Total satisfacción 6LQRTXHGDVVDWLVIHFKRWHGHYROYHPRVWXGLQHUR

/7&LQGG




%HOOH]D\6DOXG

8QWUDWDPLHQWR SDUDFXHUSR\URVWUR £SRUXQDSLHOPiVMRYHQ ¢4XLpQQRKDVRxDGRFRQSHUPDQHFHU VLHPSUHMRYHQ\ERUUDUODVKXHOODVGHOSDVR GHOWLHPSR"$KRUDWLHQHVDODOFDQFHGHWX PDQRODVROXFLyQTXHHVWDEDVEXVFDQGR :HOOER[Š8QFRPSOHWRWUDWDPLHQWRSDUD FXHUSR\URVWURFRQHOTXHGLVIUXWDUiVGH XQDSLHOPiVMRYHQ\UDGLDQWH6XVHFUHWR UDGLFDHQVXLQQRYDGRUDWHFQRORJtDGH HVWLPXODFLyQFHOXODUXQDWpFQLFDQR DJUHVLYDTXHWHD\XGDUiDPHMRUDUOD FLUFXODFLyQGH¿QLUWXVLOXHWD\FRQVHJXLUXQDPD\RU ¿UPH]D\HODVWLFLGDGHQWXURVWUR8QFRPSOHWRDSDUDWRFRQ FDEH]DOHVLQWHUFDPELDEOHVSDUDHOFXHUSRTXHHVWLPXODQ ODSLHO\FRPEDWHQODVJUDVDVORFDOL]DGDVPiVUHVLVWHQWHV TXHQRVHHOLPLQDQQLFRQODGLHWDQLFRQHOHMHUFLFLR<RWURV FDEH]DOHVSDUDHOURVWURTXHDFW~DQVREUHODSLHOPHGLDQWH PLFURSXOVDFLRQHVFRQVLJXLHQGRXQDSLHOPiVMRYHQVLQDUUXJDV \FRQFRQWRUQRVUHD¿UPDGRV$SURYHFKDQXHVWUDRIHUWDGH DQLYHUVDULR\GLVIUXWDGHXQFRPSOHWRWUDWDPLHQWRHQWXSURSLR KRJDUSRUPX\SRFRGLQHURDOPHV(QWUDUiVHQODQXHYDHUD GHOELHQHVWDUFRQ:HOOER[Š

(67,08/$&,Ï1&(/8/$5 3$5$(/&8(532 /DHVWLPXODFLyQFHOXODU:HOOER[ŠDFW~D FRPRDFWLYDGRUPHFiQLFRVREUHHO DGLSRVLWRODFpOXODUHVSRQVDEOHGHO DOPDFHQDPLHQWRGHJUDVD FRQVLJXLHQGRHVWLOL]DUOD ¿JXUD\PROGHDUOD

(67,08/$&,Ï1&(/8/$53$5$(/526752 /DWHFQRORJtDGHHVWLPXODFLyQFHOXODU:HOOER[ŠDFWLYDODSURGXFFLyQ GHFROiJHQR\HODVWLLQDFUHDQGRXQHIHFWRGHUHGHQVL¿FDFLyQHQ URVWURFXHOOR\HVFRWH7XSLHOHVWDUiYLVLEOHPHWHPiVMRYHQ

:(//%2;(67È(483$'2&21 ‡8QLGDGGHWUDWDPLHQWR:HOOER[Š ‡7XERÀH[LEOHGHFRQH[LyQDORVFDEH]DOHV ‡+HUUDPLHQWDVSDUDGHVPRQDUORVFDEH]DOHV/LIW ‡¿OWURVGHUHSXHVWR ‡&DMDGHWRDOOLWDVGHOLPSLH]DFRQVROXFLyQEDFWHULFLGD YLUXFLGD\IXQJLFLGD ‡*XtDGHLQVWDODFLyQ ‡0DQXDOGHLQVWUXFFLRQHV ‡DGDSWDGRUHVHOpFWULFRVTXHSHUPLWHQVX XVRHQWRGRHOPXQGR ‡$OLPHQWDFLyQSULQFLSDOHQWUDGD 9$&+]VDOLGD9&'

7UDWDPLHQWRSDUDHOFXHUSR\URVWUR:HOOER[Š

€ 6yORKDVWD

€0HV

FXRWDV6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393+DELWXDO€

'LVHxRFRPSDFWR\ HOHJDQWHTXHGDUiSHUIHFWR HQFXDOTXLHUVLWLRFXDQGR QRORXWLOLFHV

5I

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  *DVWRVGHHQYtR € \GHJHVWLyQ € LQFOXLGRVHQODFXRWD 9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

9(59Ë'(2 ODWLHQGDHQFDVDHV

latiendaencasa.es






%HOOH]D\6DOXG

£7UHVWDOODVPHQRV DODPLWDGGHSUHFLR &RQVLJXHKDVWDWDOODVPHQRVFRQODH[FOXVLYDIDMD6OLP /LIW$LUH 0iVFyPRGDTXHODVDQWHULRUHVHVWiIDEULFDGDFRQHOQXHYRWHMLGR $LU/LJKWXOWUDÀH[LEOH\WUDQVSLUDEOHTXHVHDGDSWDUiDWXFXHUSRD ODSHUIHFFLyQSDUDTXHQDGLHQRWHTXHODOOHYDVSXHVWD,QFRUSRUDGRFH ]RQDVUHGXFWRUDVLQWHUFRQHFWDGDVGHVGHODURGLOODKDVWDGHEDMR GHOSHFKRTXHWHDVHJXUDUiQXQFXHUSRHVEHOWR\¿UPHDGHPiVGH XQDVEDQGDVWULDQJXODUHVHVSHFLDOHVSDUDUHGXFLUODWULSD\XQD EDQGDHQIRUPDGH9HQODSDUWHWUDVHUDSDUDVXELUOLJHUDPHQWH ORVJO~WHRV£3RGUiVGLVLPXODUKDVWDNLORVPHQRV\YHVWLUKDVWDWUHV WDOODVPHQRVGHYHVWLGR$SURYHFKDHVWDRIHUWDHVSHFLDO\OOpYDWH WXIDMD6OLP /LIW$LUHHQFRORUEHLJHSRUVyOR€\DGHPiV UHFLELUiVRWUDIDMDHQFRORUQHJURGH5(*$/2

V

6 % % \ \ & V G 2 G G Q S

)DMD6OLP /LIW$LUHEHLJH

5(*$/2)DMDQHJUD 'LVSRQLEOHHQWDOODV 0  /   ;/  ;;/  

[ /OpYDWHSRUVyOR

€

5(*$/2

*DVWRVGHHQYtR

)DMDFRORUQHJUR

¼

5I%7-;;

9(59Ë'(2 ODWLHQGDHQFDVDHV

<DKRUD[€

)DMDEHLJHIDMDQHJUD FRPELQDFLyQEHLJH

$SURYHFKDHVWDRIHUWD\SRUVyOR€OOpYDWH IDMDVODQXHYDFRPELQDFLyQ6OLP /LIW$LUH HQFRORUEHLJH

€

3



3256Ð/2

5

*DVWRVGHHQYtR

¼

& ' 6

5I%$<5;;

&UHDGDSDUDSRQpUVHODGHIRUPDVGLVWLQWDVHQODFLQWXUDGHEDMR GHOSHFKR\HQFLPDGHOSHFKR

(OLPLQDODFHOXOLWLVFRQHO HIHFWRWULSOHDFFLyQGHVRODF (OLPLQDODFHOXOLWLVGHXQDYH]SRUWRGDVFRQ 6FXOSWXUDOGH6RODFHOVLVWHPD OLSRPROGHDGRUWULSOHDFFLyQTXHFRPELQD PDVDMHFLUFXODUSUHVLyQQHXPiWLFDH LQIUDUURMRVIDYRUHFLHQGRODHOLPLQDFLyQGH WR[LQDV\ODUHGXFFLyQGHJUDVDDFXPXODGD (VWiFRPSXHVWRSRUFDEH]DOHV LQWHUFDPELDEOHVTXHLQFOX\HQFRPR QRYHGDGXQQXHYRFDEH]DOGHVXSHU¿FLH SODQDGHVLOLFRQDSDUDODFHOXOLWLVPiV GRORURVD\RWURSDUDPXVORV\JO~WHRV ,QFOX\HDGHPiVXQQHFHVHUGH5(*$/2

5

$QWLFHOXOtWLFR6RODF 6FXOSWXUDO0( 5(*$/21HFHVHU

& ' 6

€

5I $OLPHQWDFLyQ5HG



3



5(*$/2 1HFHVHU FDEH]DOHVGHWUDWDPLHQWR LQWHUFDPELDEOHVTXHSHUPLWHQ DGDSWDUHOPDVDMHDFDGD SUREOHPD

/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG


%HOOH]D\6DOXG

¢&RPIRUWLVVH%UDŠ VLQFRVWXUDVVLQFLHUUHV\VLQDURV

D H

6LpQWHWHFyPRGD\VHJXUDFRQHOH[FOXVLYRVXMHWDGRU&RPIRUWLVVH %UDŠ8QDUHYROXFLyQHQURSDLQWHULRUFRQWHFQRORJtD&RPIRUWLVVH %UDŠLQFRUSRUDGDTXHSHUPLWHFRQVWUXLUHOVXMHWDGRUVLQDURV \VLQFRVWXUDV\DTXHHVWiUHDOL]DGRFRQXQWHMLGRH[WUDVXDYH \PX\ÀH[LEOHVLQFLHUUHVVLQPDUFDV\VLQLQFyPRGRVWLUDQWHV &RPIRUWLVVH%UDŠVHDGDSWDDODIRUPDGHOSHFKR\SURSRUFLRQD VXMHFLyQSDUDWRGRVORVWDPDxRV\DTXHWLHQHXQHVFRWHHQIRUPD GH9\DQFKRVWLUDQWHVSDUDJDUDQWL]DUHOPi[LPRFRQIRUW 2EWHQGUiVXQDPD\RUVXMHFLyQ\FRPRGLGDGFRQFXDOTXLHUWLSR GHSUHQGDGHSRUWLYDGHYHVWLULQFOXVRSXHGHVXWLOL]DUORSDUD GRUPLU$GHPiVHVWLOL]DUiWX¿JXUDUHDO]DQGRWXSHFKRGHIRUPD QDWXUDO8QDRSRUWXQLGDGSDUDVHQWLUWHFyPRGDVHJXUD\OXFLUHO SHFKRTXHVLHPSUHKDVVRxDGR

3DFN6XMHWDGRUHV&RPIRUWLVVH%UDŠEiVLFR

€

€

*DVWRVGHHQYtR

¼

5I%;,;;

&RORUHVQHJUREHLJH\EODQFR 'LVSRQLEOHHQWDOODV 6  0  /  ;/  ;;/  



3DFN6XMHWDGRUHV&RPIRUWLVVH%UDŠFRORU

€

€

*DVWRVGHHQYtR

¼

5I%;,;;

&RORUHVD]XOOLOD\URVD 'LVSRQLEOHHQWDOODV 6  0  /  ;/  ;;/  

žSDFN

 GHVFXHQWR

$SURYHFKDHVWDRIHUWD HVSHFLDO\OOpYDWH XQVHJXQGRSDFN &RQIRUWLVVH%UDŠ (OLJHWXFRPELQDFLyQ SUHIHULGDGHWDOODV \FRORUHV

902 10 30 10

9(59Ë'(2 ODWLHQGDHQFDVDHV

latiendaencasa.es






%HOOH]D\6DOXG

6RQL['Ò2%HOOH]DSRUXOWUDVRQLGR 7HFQRYLWDE\%+WHRIUHFHOR~OWLPRSDUDFRPEDWLUORVVLJQRVGHHQYHMHFLPLHQWR FRQ6RQL['Ò2XQGLVSRVLWLYRTXHXWLOL]DODWHFQRORJtDGHXOWUDVRQLGRVGHDOWD IUHFXHQFLDSDUDFUHDUHQWXURVWURXQHIHFWROLIWLQJ(VWDWHFQRORJtDUHJHQHUDOD HODVWLQDDFWLYDODR[LJHQDFLyQGHODVFpOXODV\HVWLPXODODSURGXFFLyQGHFROiJHQR /RVEHQH¿FLRVVRQLQPHGLDWRV\VHQWLUiVWHUVXUD\VXDYLGDGHQWXSLHO'LVSRQHGH QLYHOHVGHLQWHQVLGDGFRQPRGRVGHHPLVLyQFRQWLQXD\SXOVDGDHLQFOX\H DFFHVRULRVGHGLIHUHQWHVWDPDxRVTXHVHDGDSWDUiQSHUIHFWDPHQWHDODV]RQDV GLItFLOHV8QGLVSRVLWLYRTXHLQWHQVL¿FD\SRWHQFLDHOHIHFWRGHDEVRUFLyQGHODVFUHPDV DQWLDUUXJDVTXHXWLOL]DVGLDULDPHQWH\TXHUHYLWDOL]DUiWXSLHODOLQVWDQWH1RORSLHQVHV SiVDWHDODUHYROXFLyQGHODFRVPpWLFDFRQ6RQL['Ò2

¢ L X

7UDWDPLHQWR)DFLDO6RQL['~R

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

,1&/8<( ‡'LVSRVLWLYR6RQL['Ò2 ‡*HOGHXOWUDVRQLGRIDFLDO P/

‡6HU~PDQWLDUUXJDVFRQDFHLWHGHDUJiQ P/

‡0DQXDOGHLQVWUXFFLRQHV

5I

\

&$5$&7(5Ë67,&$67e&1,&$6 ‡8OWUDVRQLGRV IUHFXHQFLD 0+] ‡3RWHQFLDGHVDOLGDD:DWWV VHJ~QHOSURJUDPD  ‡$OLPHQWDFLyQ5HG 9  ‡0HGLGDV $[+[/ [[FP ‡3HVRNJ

$ Z

\

%

1 % 0 3

&DYLVOLPPROGHDGRVHJXUR\H¿FD]GHOD¿JXUD /DFDYLWDFLyQHVXQDWpFQLFDQRLQYDVLYDSDUDPROGHDUHOFXHUSRTXHUHGXFHYROXPHQHOLPLQDQGRODFHOXOLWLV\ORVGHSyVLWRVGH JUDVDORFDOL]DGD8QDWpFQLFDTXHVHOOHYDDSOLFDQGRGHIRUPDPX\H[WHQGLGDHQORVFHQWURVGHEHOOH]D\DKRUD7HFQRYLWDE\%+ SRQHDWXDOFDQFHFRQHODSDUDWRGHFDYLWDFLyQ&DYLVOLP8QDWpFQLFDGHSUREDGDH¿FDFLDLQGRORUDVHJXUDHLQPHGLDWDTXH XWLOL]DODHPLVLyQGHXOWUDVRQLGRVSDUDGHVWUXLUODVFpOXODVGHJUDVDORFDOL]DGDORTXHFRQOOHYDXQDSpUGLGDDXWRPiWLFDGH YROXPHQ8QPRGHORFRQVLVWHPDGHHPLVLyQ'XDO$FWLRQTXHLQFOX\HSURJUDPDVGHSXOVRGLVFRQWLQXR\XQTXLQWR SURJUDPDPiVLQWHQVRLGHDOSDUD]RQDVFRQDOWDDFXPXODFLyQGHJUDVDRFHOXOLWLVUHEHOGH3RGUiVGHFLGLUTXH SDUWHGHOFXHUSRGHVHDVPROGHDUVyORDEGRPHQJO~WHRVEUD]RVÀDQFRVFDGHUDVRPXVORV6XVUHVXOWDGRV VRQLQPHGLDWRVVLQUHFXUULUDODFLUXJtDRSHUDFLyQRSLQFKD]RV<VXVEHQH¿FLRVVRQDVRPEURVRVHOLPLQDOD FHOXOLWLVSLHOGHQDUDQMDUHGXFHYROXPHQ\HVFXOSHOD¿JXUD3iVDWHDODFDYLWDFLyQ

¢ P S V I $ £

,1&/8<( ‡&DYLVOLP<6 ‡0DQXDOGH,QVWUXFFLRQHV ‡'9'FRQYtGHRH[SOLFDWLYR ‡*HOGHFDYLWDFLyQP/ ‡6HUXPUHD¿UPDQWHP/ ‡6HUXPDQWLFHOXOtWLFRP/

&DYLVOLP<6

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

5I 7$0%,e1',6321,%/(02'(/2<6 <5(&$0%,26&216Ò/7$126



9(59Ë'(2 ODWLHQGDHQFDVDHV

Total garantía de calidad y servicio $YDODGRSRUODJDUDQWtDGH/D7LHQGDHQ&DVD

/7&LQGG

* 9HU


%HOOH]D\6DOXG

HOFDPLQRKDFLDXQDYLGDPiVVDQD ¢7HJXVWDUtDUHXQLUHQXQPLVPROXJDUWRGDODLQIRUPDFLyQUHODWLYDDWXVKiELWRVGHVDOXG\SRGHUFRQVXOWDUODDWUDYpVGHWX6PDUWSKRQH L3KRQHRHQODZHE"&RQHOVLVWHPD)LWELW\VXVLQQRYDGRUHVSURGXFWRVSRGUiVFDSWXUDU\DQDOL]DUIiFLOPHQWHWXUXWLQDGLDULD\GLULJLUODKDFLD XQDIRUPDGHYLGDPiVVDOXGDEOH\DFWLYD£'HVF~EUHOR

%iVFXODLQWHOLJHQWH:L)L ODPHMRUPRWLYDFLyQSDUDSHUGHUSHVR ¢7HJXVWDUtDOOHYDUXQFRQWUROGHWXSHVRDODUJRSOD]R"¢7HQHU ODVKHUUDPLHQWDVSDUDVXSHUDUWHFDGDGtD\FRPSDUWLUORVGDWRV HQWXRUGHQDGRUL3KRQHR6PDUW3KRQH"/DEiVFXODLQWHOLJHQWH GH)LWELWDGHPiVGHPHGLUWXSHVRSURSRUFLRQDGDWRVSUHFLVRV VREUHODVPDVDVJUDVDV\PXVFXODUHVGHWXFXHUSR\ DWUDYpVGH:L)LWHSHUPLWHFUHDUXQDEDVHGHGDWRV GRQGHREWHQGUiVWRGDODLQIRUPDFLyQGHWXSHVRFRQWDEODV \JUi¿FRV6HFRQ¿JXUDGHIRUPDVHQFLOODGLUHFWDPHQWHD ODUHGLQDOiPEULFDGHWXKRJDU\FDGDYH]TXHXWLOLFHVOD EiVFXODVHFDUJDODLQIRUPDFLyQGHIRUPDDXWRPiWLFD $GHPiVSRGUiVGHVFDUJDUWHJUi¿FRV\DSOLFDFLRQHVSDUD ZHE\PyYLOJUDWLVSDUDFRQWURODUWXHYROXFLyQHQFXDOTXLHU PRPHQWR<ORPHMRUSRGUiVFRPSDUWLUODKDVWDFRQSHUVRQDV &RQODEiVFXODLQWHOLJHQWHVHUiPXFKRPiVIiFLOOOHYDUXQFRQWURO GHWXSHVRHOGHWXIDPLOLDRDPLJRV (OLJHWXFRORUIDYRULWR\£HPSLH]D \DDFXLGDUWH

$SOLFDFLRQHVSDUD ZHE\PyYLO L3KRQH \$QGURLG JUDWLV &DUJDVSRU:L)LHQ ¿WELWFRP

%iVFXODLQWHOLJHQWH:L)L)LWELW$ULD

€

1HJUD5I %ODQFD5I 0HGLGDV $[+[) [[FP 3HVRNJ

6LVWHPDVRSHUDWLYRV0DF26; ;39LVWD:LQGRZV&RQ¿JXUDFLyQPyYLO L3KRQHL3RG7RXFKL3DGFRQL26

&RQWLJRHQFDGDPRPHQWRGHOGtD\GHODQRFKH ¢6DEHVFXiQWRWHPXHYHVHQWXGtDDGtD"6LFUHHVTXHQHFHVLWDVKDFHUPiVHMHUFLFLRWHSURSRQHPRVXQDVROXFLyQVHQFLOODGHPHGLUWXV PRYLPLHQWRV(OPRQLWRULQDOiPEULFR)LWELW8OWUDWHD\XGDUiDPDQWHQHUWHHQIRUPD\WHPRWLYDUiSDUDOOHYDUXQDYLGDPiVVDQD(VWH SHTXHxRGLVSRVLWLYRTXHSXHGHVOOHYDUHQFXDOTXLHUEROVLOORRFLQWXUyQFRQWDELOL]DORVSDVRVUHDOL]DGRVODGLVWDQFLDUHFRUULGDORVHVFDORQHV VXELGRV\ODVFDORUtDVFRQVXPLGDVHQHOGtDPHGLDQWHVXVHQVRUGHPRYLPLHQWR'\DOWtPHWURLQFRUSRUDGRV7XVGDWRVVHFDUJDQGH IRUPDLQDOiPEULFDHQ¿WELWFRPGRQGHSRGUiVYHUFyPRPHMRUDUWXDFWLYLGDGItVLFD\DGHPiVSRGUiVGHVFDUJDUWHDSOLFDFLRQHVSDUDL3KRQH\ $QGURLG<SDUDPHMRUDUWXFDOLGDGGHOVXHxRFRQODSXOVHUD)LWELWFRPSUREDUiVFXiQWDVKRUDVGXHUPHV\FXiQWDVYHFHVWHGHVSLHUWDV £$VtSRGUiVGHVFXEULUFyPRGRUPLUPHMRU)LWELWHVHOSDVRKDFLDWXPHMRUIRUPDItVLFD£3UXpEDOR 0RQLWRUGHDFWLYLGDGGLDULD 6XHxR)LWELW8OWUD

€

$]XO5I 5RVD5I 0HGLGDV $[+[) [[FP 3HVRJ

&DUJDODLQIRUPDFLyQGHWXDFWLYLGDGItVLFDHQ¿WELWFRP PHGLDQWHWHFQRORJtDLQDOiPEULFD

0RQLWRUL]DOD DFWLYLGDGGLDULD

&RQWURODHOFLFOR GHOVXHxR

*DVWRVGHHQYtR € \GHJHVWLyQ € LQFOXLGRVHQODFXRWD 9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

3HTXHxR \GLVFUHWR

902 10 30 10

latiendaencasa.es






%HOOH]D\6DOXG +D]EDODQFHGHWXSHVR &XtGDWH\OOHYDXQFRQWUROGHWXGLHWDFRQHVWDEiVFXOD GHEDxRFRQFiOFXORGHODFRPSRVLFLyQFRUSRUDO8Q GLVHxRHQEODQFRGHOtQHDVHOHJDQWHV\6HQVRU 7HFKTXHFRQXQVRORWRTXHHQFLHQGHOD EiVFXOD\TXHDGHPiVGHWXSHVRWHSHUPLWH FDOFXODUHOSRUFHQWDMHGHPDVD\DJXD SUHVHQWHHQHOFXHUSRODVFDORUtDV\ODPDVD PXVFXODUHQIXQFLyQGHODDOWXUDODHGDG\HO VH[R8QDPHGLFLyQFRPSOHWD\SUHFLVDTXH WHD\XGDUiDFRQWURODUWX¿JXUD7DPELpQHVWi GLVSRQLEOHHQFRORUPDOYD£HOLJHHOWX\R

*DVWRVGHHQYtR

%iVFXODEDxR/DLFD36

6HSWLHPEUH

¼

€

6yORKDVWD 393+DELWXDO€

%ODQFD5I% 0DOYD5I%

&$5$&7(5Ë67,&$67e&1,&$6 ‡&DSDFLGDGNJOEVWOEVW ‡'LYLVLyQJOEOE ‡*UDQGLVSOD\/&'GHIiFLOOHFWXUD ‡'RWDGDGHIXQFLyQPHPRULDKDVWDSHUVRQDV ‡3ODWDIRUPDGHFULVWDOWHPSODGRPPGHJURVRU ‡)XQFLyQVHOHFFLyQXQLGDGGHPHGLGDNJOLEUDVRVWRQH ‡$OLPHQWDFLyQSLODVDOFDOLQDVWLSR9$$$ ‡&RQWDGRUGHWLHPSRGHDSDJDGRDXWRPiWLFR ‡0HGLGDV $[+[/ [[FP

0LQLVRQLFGH6DLYRGHOFHSLOOR GHGLHQWHVTXHQRRFXSDHVSDFLR 7XERFDVLHPSUHIUHVFDGRQGH\FXDQGRTXLHUDVFRQHOQXHYRFHSLOOR GHGLHQWHV0LQLVRQLFGH6DLYRG'LVHxDGRSDUDSURSRUFLRQDUWH XQDERFDOLPSLD\IUHVFDHQFXDOTXLHUOXJDUJUDFLDVDVXWHFQRORJtD VyQLFDFRQRVFLODFLRQHVSRUPLQXWR\JUDFLDVDVXUHGXFLGR WDPDxRSRGUiVOOHYDUORHQHOEROVRVLQRFXSDUHVSDFLR8QFHSLOORGH GLHQWHVSHUIHFWRSDUDOOHYDUFXDQGRFRPHVIXHUDGHFDVDRGHVSXpV GHXQDVHVLyQGHJLPQDVLR)XQFLRQDFRQSLODVHLQFOX\HWDSD SURWHFWRUDSDUDPDQWHQHUORVLHPSUHOLPSLRHKLJLpQLFR&RQVLJXH DKRUDWXQXHYRFHSLOORGHGLHQWHV0LQLVRQLFGH6DLYRGMXQWRFRQ FDEH]DOHVGHUHFDPELRSRUVyOR€(VWiGLVSRQLEOHHQGRV FRORUHVIXFVLD\WLWDQLXP(OLJHHOTXHPHMRUYD\DFRQWXHVWLOR &HSLOORGLHQWHV6DLYRG0LQLVRQLF UHFDPELRV

€

*DVWRVGHHQYtR

¼

8QDEiVFXODPLQLSDUDQRSHUGHU HOFRQWURO 6LQHFHVLWDVFRQWURODUWXSHVRLQFOXVRHQWXVYLDMHVQRWHSLHUGDVOD EiVFXODPiVPDQHMDEOHGH6DLYRG'HXQDVGLPHQVLRQHVSHUIHFWDV SDUDOOHYDUDWRGDVSDUWHVGLVSRQHGHXQGLVSOD\/('LQYLVLEOHGH PP\XQFULVWDOGHPP\UHDOL]DPHGLFLRQHVGHHQJ KDVWDXQPi[LPRGHNJ3RGUiVWUDQVSRUWDUODIiFLOPHQWH\DGHPiVWH VHUYLUiWDPELpQSDUDSHVDUPDOHWDV8QDRSFLyQSRUWiWLOTXHSXHGHVHOHJLU HQYDULRVFRORUHV\DXQSUHFLRH[FHSFLRQDO %iVFXODEDxRPLQL6DLYRG

€

*DVWRVGHHQYtR

¼

)XFVLD5I% %ODQFD5I% $OLPHQWDFLyQSLODV$$$ 0HGLGDV $[+[) [[FP

)XFVLD5I% 7LWDQLXP5I% $OLPHQWDFLyQSLOD$$$ 0HGLGDV $[' [FP

%/$1&$ 6Ï/2



81,'$'(6

)8&6,$ 6Ï/2



81,'$'(6



7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG




%HOOH]D\6DOXG

'LVIUXWDGHXQDSLHOVXDYH WRGRVORVGtDV &RQODQXHYD3KLOLSV/XPHDFRQVHJXLUiVXQDSLHOVXDYH\VLQYHOORHQHOFXHUSR\HQODFDUDWRGRV ORVGtDVVLQHVIXHU]R\FyPRGDPHQWHGHVGHFDVD3KLOLSV/XPHDXWLOL]DOD/X]3XOVDGD,QWHQVDXQD WHFQRORJtDTXHGHELOLWDHOIROtFXORSLORVRSRUPHGLRGHOLJHUDVSXOVDFLRQHVGHOX]HYLWDQGRDVtHO FUHFLPLHQWRGHOYHOOR8QVLVWHPDGHHOLPLQDFLyQGHOYHOORHPSOHDGRHQVDORQHVGHEHOOH]DSURIHVLRQDOHV \TXHDKRUDHVWiDWXDOFDQFHSRUPX\SRFRGLQHURDOPHV&XHQWDFRQSRVLFLRQHVGHOX]DMXVWDEOHV SDUDJDUDQWL]DUXQWUDWDPLHQWRVXDYHSHURH¿FD]VLPSOHPHQWHWUDVRWUDWDPLHQWRVFDGDGRVVHPDQDV HYLWDUiVTXHHOYHOORUHDSDUH]FD7DPELpQLQFOX\HXQFDEH]DOGHSUHFLVLyQGLVHxDGRSDUDHOURVWURFRQ XQ¿OWUR89LQWHJUDGRDGLFLRQDOSDUDSURWHJHU\HOLPLQDUHOYHOORHQODV]RQDVPiVGHOLFDGDV$SURYHFKDHVWD RIHUWDHVSHFLDO\FRQVtJXHODGXUDQWHHOPHVGH6HSWLHPEUHDXQSUHFLRLQFUHtEOH 6LVWHPDGHHOLPLQDFLyQGHOYHOOR ,3/3KLOLSV/XPHD

6HSWLHPEUH

€

6Ï/2

6yORKDVWD

€0HV

7$(7,1

FXRWDV6,1,17(5(6(6 7RWDODSDJDU€



81,'$'(6

393+DELWXDO€

5I



),1$1&,$&,Ð1 RSDJDHO

6yORKDVWD

&$5$&7(5Ë67,&$67e&1,&$6 ‡%RPELOODGHDOWRUHQGLPLHQWR PiVGHSXOVDFLRQHV ‡%DWHUtDUHFDUJDEOH ‡ÈUHDGHDSOLFDFLyQFXHUSR FPSUHFLVLyQFP ‡,QFOX\H'9'GHPRVWUDWLYR ‡1RQHFHVLWDUHFDPELRV

(O~QLFRFHSLOORTXH GHVHQUHGDVLQGDUWLURQHV /DVDOXGGHQXHVWURFDEHOORHPSLH]DSRUXQEXHQFHSLOOR3RUHVRHV LPSRUWDQWtVLPRXWLOL]DUXQRTXHVHDGDSWHDODVFDUDFWHUtVWLFDVGHWX FDEHOOR(OQXHYRFHSLOORGH0LFKHO0HUFLHUHVHO~QLFRGHOPHUFDGR TXHGHVHQUHGDVLQGDUWLURQHVDODYH]TXHUHGXFHODSpUGLGDGH FDEHOOR/RTXHORKDFHGLIHUHQWHVRQVXVFHUGDVGHGLVWLQWD DOWXUDTXHGLVSHUVDQODSUHVLyQTXHVHDSOLFDVREUHHOFDEHOORDO SHLQDUOR(VLGHDOSDUDWRGDODIDPLOLD\ODVROXFLyQSHUIHFWDSDUDHYLWDU HOGRORUDOGHVHQUHGDU\HOVWUHVVTXHVXIUHQVREUHWRGRODVPDGUHVFRQ VXVKLMDVSHTXHxDV3UXpEDOR\QRWDUiVORVUHVXOWDGRVGHVGHHOSULPHU PRPHQWR(VWiGLVSRQLEOHHQWUHVPRGHORVGLIHUHQWHVSDUDDWHQGHUD ODQHFHVLGDGGHWUHVWLSRVGHFDEHOORV¿QRQRUPDORJUXHVR(OLJH HOWX\R\OOpYDWHORSRUVyOR€<DKRUDHQHVWDRIHUWDHVSHFLDO GH6HSWLHPEUHSRGUiVFRQVHJXLUXQLGDGHVSRUVyOR€FRQXQ GHVFXHQWRGHPiVGHOHQODVHJXQGDXQLGDG(OLJHWXFRPELQDFLyQ \DSURYHFKDHVWDRIHUWDH[FOXVLYD &HSLOOR3URIHVLRQDOVLQWLURQHV0LFKHO0HUFLHU

€

&DEHOOR¿QR URVD 5I% &DEHOORQRUPDO YHUGH 5I% &DEHOORJUXHVR D]XO 5I%

*DVWRVGHHQYtR

¼

6HSWLHPEUH

€

XQLGDGHV 6yORKDVWD

*DVWRVGHHQYtR € \GHJHVWLyQ € LQFOXLGRVHQODFXRWD 9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






%HOOH]D\6DOXG &DORUSRUORVFXDWURFRVWDGRV 5HOiMDWH\GLVIUXWDGHXQDDJUDGDEOHVHVLyQGHFDORUFRQHVWD DOPRKDGLOODFHUYLFDOGRUVDOGH,PHWHF/RPHMRUSDUDWUDWDUHQ FXDOTXLHUPRPHQWRORVGRORUHVFHUYLFDOHV\GHHVSDOGD \DTXHDEDUFDOD]RQDOXPEDUFHUYLFDO\WRGDODHVSDOGD(VWi UHDOL]DGDHQPLFUR¿EUDGHIHOSDXQWHMLGRPX\VXDYHSDUD HOFXHUSRLQFRUSRUDQLYHOHVGHLQWHQVLGDG\XQVLVWHPDGH VHJXULGDGGHDXWRDSDJDGRSDUDHYLWDUTXHWHTXHGHVGRUPLGR FRQHOFDORU6HODYDGLUHFWDPHQWHHQODODYDGRUDORPiV FyPRGR\UiSLGR6LORSUH¿HUHVWDPELpQHVWiQGLVSRQLEOHVGRV DOPRKDGLOODVUHFWDQJXODUHVHQGRVWDPDxRVHOLJHHOWX\R\ DOLYLDWXVGRORUHV

6

( S X \ P H ' H Y

7

0DQGRDGLVWDQFLD FRQQLYHOHVGH LQWHQVLGDG $OPRKDGLOODUHFWDQJXODU 5HOD[\,PHWHF 3HTXHxD [FP 

*UDQGH [FP 

€

€

5I

5I



5 $ 

$OPRKDGLOODFHUYLFDOGRUVDO 5HOD[\,PHWHF [FP 

€

5I

(OFXLGDGRPiVFRPSOHWR GH0HGLVDQDŠ£SRU€ 'HMDTXH0HGLVDQDŠFXLGHGHWL\GHORVWX\RVFRQ HVWRVSUiFWLFRVSURGXFWRVTXHQRSXHGHQIDOWDUHQWX ERWLTXtQ8QWHQVLyPHWURGHEUD]RFRQXQDPSOLR PRQLWRUSDUDXQDOHFWXUDIiFLO\FyPRGDTXHWH LQGLFDUiORVYDORUHVGHVtVWROHGLiVWROHSXOVR IHFKD\KRUDGHODPHGLFLyQ\FRQPHPRULDVGH PHGLFLyQYiOLGRSDUDGRVXVXDULRV$FRPSDxDQGR SRUXQWHUPyPHWURGLJLWDOSDUDVDEHUHQWRGR PRPHQWRFXiOHVWXWHPSHUDWXUDGHIRUPDSUHFLVD\ UiSLGDVyORHQVHJXQGRV8QSDFNUHFRPHQGDGR SDUDWXVDOXGTXHSXHGHVFRQVHJXLUDOPHMRUSUHFLR SRUVyOR€

3 D

O

6 F W G H V P P R G

7HQVLyPHWUR 7HUPyPHWUR

3256Ð/2

*DVWRVGHHQYtR

¼

€

5I% $OLPHQWDFLyQWHQVLyPHWUR3LODV$$ $OLPHQWDFLyQWHUPyPHWUR3LOD$$

7



£7HPHUHFHVXQPDVDMH &XDQGROOHJXHVDFDVDUHOiMDWH\GLVIUXWDGHXQDXWpQWLFRPDVDMH FRQHVWHSUiFWLFRHLQQRYDGRUFROFKyQPDVDMHGH-RFFD&RQ PRWRUHVPRGRVGHPDVDMHGHLQWHQVLGDG\]RQDV SDUDFXHOORSLHUQDV]RQDOXPEDU\GRUVDODGHPiVGHWHUDSLDGH FDORUTXHWHDSRUWDUiXQDVHQVDFLyQFDOPDQWH\UHODMDQWH6yOR WHQGUiVTXHHOHJLUFRQVXPDQGRDGLVWDQFLDOD]RQDODLQWHQVLGDG \GLVIUXWDUGHODVHQVDFLyQTXHWHDSRUWDXQPDVDMHGHYHUGDG &RQVLJXHDKRUDWXFROFKyQPDVDMHDOPHMRUSUHFLR &ROFKyQPDVDMH-RFFD

€

5I 0HGLGDV $[+  [FP 0DQGRD GLVWDQFLD

5 $

P

/ \ R H F U H

6 % 6HSOLHJD IiFLOPHQWH



LTC

Aprovecha las ventajas y beneficios 3URGXFWRVVHOHFFLRQDGRVSDUDWXELHQHVWDU

/7&LQGG



5 $


H

%HOOH]D\6DOXG

%(//(=$<6$/8'3$5$72'$/$)$0,/,$ 6LQDUUXJDVSLHOSHUIHFWD (OPDVDMHDGRUDQWLDUUXJDVXOWUDVyQLFRGH%HXUHUHVXQGLVSRVLWLYRTXHWHSHUPLWLUiPDQWHQHUXQD SLHOMRYHQ\VLQDUUXJDV6XWHFQRORJtDGHXOWUDVRQLGRVFRQVLJXHXQWULSOHHIHFWRSURSRUFLRQD XQDJUDGDEOHPDVDMHHQODVFDSDVLQWHUQDVFUHDHIHFWRFDORUSDUDPHMRUDUODSRURVLGDG \HODVWLFLGDG\PHMRUDODDEVRUFLyQGHODVVXVWDQFLDVDFWLYDV\GHODKXPHGDG8QPpWRGR PX\XWLOL]DGRHQORVVDORQHVGHEHOOH]DTXHGDUiIUHVFRUDWXURVWURKLGUDWDFLyQ\PLQLPL]DUi HVDVSHTXHxDVDUUXJDV7DPELpQLQFOX\HXQDFUHPDHVSHFLDOSDUDORJUDUXQHIHFWRSHUIHFWR 'HVFXEUHWRGDVVXVSURSLHGDGHV\OXFHXQDSLHOPiVVXDYHFRQHOPDVDMHDGRUDQWLDUUXJDVTXHHQ HVWDRIHUWDLQFOX\HGH5(*$/2XQHVSHMRFRVPpWLFRFRQOX]SHUIHFWRSDUDOOHYDUHQHOEROVR\ YHUWHVLHPSUHUDGLDQWH 7UDWDPLHQWRIDFLDOXOWUDVRQLGRV%HXUHU)& 5(*$/2HVSHMRGHEROVLOORFRQOX]

€

5(*$/2 (VSHMRFRQOX] YDORUDGRHQ€

5I $OLPHQWDFLyQ5HFDUJDEOH PLQXWRVGHDXWRQRPtD

3DVR DSOLFDUODFUHPD

3DVR WUDWDPLHQWRIDFLDO

3DVR GLVIUXWDUGHXQDSLHOQXHYD

7HQVLyPHWURGHEUD]R%0 ODSUHYHQFLyQHOPHMRUVHJXURGHWXVDOXG 6LQHFHVLWDVFRQWURODUWXWHQVLyQIUHFXHQWHPHQWHPHMRUWHQHUVLHPSUHHQ FDVDXQDSDUDWRSUHFLVR\UiSLGRFRQHOTXHFRQRFHUORVUHVXOWDGRV(VWH WHQVLyPHWURGHEUD]RFXHQWDFRQLQGLFDGRUGHOD2UJDQL]DFLyQ0XQGLDO GHOD6DOXG\SHUPLWHXQPDQHMR\XQDIiFLOOHFWXUDJUDFLDVDVXIRUPD HUJRQyPLFD\DVXJUDQSDQWDOOD;/LOXPLQDGDHQD]XO0LGHODWHQVLyQ VDQJXtQHD\GHSXOVDFLRQHVDXWRPiWLFDPHQWHFDOFXODORVYDORUHV PHGLRVGHODPDxDQD\ODQRFKH\WDPELpQGHWHFWDDUULWPLDV&RQVX PHPRULDGH[PHGLFLRQHVSRGUiVJXDUGDUWXVGDWRV\ORVGH RWUDVSHUVRQDVDGHPiVLQFOX\HGRVEUD]DOHWHVSDUDFRQWRUQRV GHEUD]RGHFP\FP 7HQVLyPHWURGHEUD]R%0

€

5I $OLPHQWDFLyQ3LODV$$$

3URWHJHWXVSLHV\PDQRVFRQHO PHMRUFXLGDGRSURIHVLRQDO /DVPDQRV\ORVSLHVHVWiQH[SXHVWRVDDJUHVLRQHVH[WHUQDVTXHORVGDxDQ \ORVGHWHULRUDQGtDDGtD+D\TXHSURWHJHUORV\FXLGDUORV\SDUDHOORWH RIUHFHPRVHVWHVHWGHPDQLFXUD\SHGLFXUDSURIHVLRQDO&RQXQGLVHxR HUJRQyPLFRFRQPDQJRDQWLGHVOL]DQWH\JLURKDFLDODGHUHFKDHL]TXLHUGD FXHQWDFRQXQDYHORFLGDGUHJXODEOHGHUSPUSP<SDUDXQ UHVXOWDGRSURIHVLRQDOLQFOX\HDFFHVRULRVGH]D¿URLQWHUFDPELDEOHV HVSHFt¿FRVSDUDFDGD]RQD£(OPHMRUFXLGDGRSDUDWXVSLHV\PDQRV

6HWGHPDQLFXUDSHGLFXUDSURIHVLRQDO %HXUHU03DFFHVRULRV

€

5I $OLPHQWDFLyQ5HG

902 10 30 10

latiendaencasa.es






%HOOH]D\6DOXG

7HFQRORJtDDYDQ]DGDSDUDFRPEDWLUODVYDULFHV (OLQVWLWXWR(WHUQHOOH3KDUPDKDGHVDUUROODGR/LYiUL]XQWUDWDPLHQWRGXDOSDUDODHOLPLQDFLyQGHYDULFHVTXHORJUDUiUHGXFLUODVHQWDQ VyORVHPDQDVFRQUHVXOWDGRVSURJUHVLYRV\JDUDQWL]DGRV8WLOL]DODH[FOXVLYDWHFQRORJtDFULRJpQLFDHQGRVHWDSDVSDUDFUHDUXQHIHFWR UHIUHVFDQWHDž&DFWXDQGRHQODVXSHU¿FLHDQLYHOVXEFXWiQHRGHODSLHO\KDFLHQGRTXHODVDQJUHÀX\DGHIRUPDDGHFXDGD8QWUDWDPLHQWR FRPSXHVWRSRUXQVSUD\TXHWHDSRUWDUiXQDVHQVDFLyQGHIUHVFXUDOLJHUH]D\DOLYLR\XQDFUHPDUHDFWLYDQWH$GHPiVDKRUDWH REVHTXLDPRVFRQXQSDFNGHSDUFKHVGHGHVFDQVR\UHOD[SDUDWXVSLHUQDV /LYiUL]FUHPDUHDFWLYDQWH VSUD\FULRDFWLRQ 5(*$/23DFNSDUFKHV GHGHVFDQVR

€ 

€

*DVWRVGHHQYtR

5(*$/2

¼

3DFNGH3DUFKHV GHGHVFDQVR YDORUDGRHQ€

5I%

6SUD\FULRDFWLRQDGLFLRQDO

€

9(59Ë'(2 ODWLHQGDHQFDVDHV

*DVWRVGHHQYtR

¼



/ F + G E U D U  S U I S D £

5I%

([FOXVLYDWHFQRORJtDFULRJpQLFD FDSD]GLVLPXODUODDSDULHQFLD GHODVDUDxDVYDVFXODUHVHQ WDQVyORVHPDQDV

$

XQLGDG

 GHVFXHQWR

$SURYHFKDHVWD RIHUWD\OOpYDWH XQDVHJXQGD XQLGDGGH/LYDUt]

,162/,$ŠOXFHWDFRQHV (OFDO]DGRGHWDFyQDOWRSURYRFDTXHHOÀXMRGHOSHVRFRUSRUDOVHGHVSODFHGHOWDOyQKDFLDHODQWHSLpOR TXHRULJLQDGRORUSRVWXUDVLQFRUUHFWDV\XQDJUDQLQHVWDELOLGDGHQORVWRELOORV\URGLOODV6HJXURTXHKDV SUREDGRSODQWLOODVGHVLOLFRQDVLQUHVXOWDGRVVDWLVIDFWRULRVSHURHVWHSUREOHPDVHDFDEyFRQ,162/,$Š XQVLVWHPDSDWHQWDGR\GHVDUUROODGRSRUXQSRGyORJRGHUHQRPEUHPXQGLDO\XQFLHQWt¿FRGHO0,7 (VSHUIHFWRSDUDOXFLUWXWDFyQDOWRVLQUHQXQFLDUDOELHQHVWDUQRVyORDOLYLD\UHGXFHODSUHVLyQHQ HODQWHSLpVLQRTXHFRQYLHUWHHODFWRGHDQGDUFRQWDFyQDOWRHQDOJRPDUDYLOORVR,QVROLDŠGHVSOD]D HOSHVRFRUSRUDOGHODQWHSLpKDFLDHOWDOyQIDYRUHFHHOSXQWRGHHTXLOLEULR\D\XGDDUHGLVWULEXLU HOSHVR/RVUHVXOWDGRVVRQUHDOPHQWHDVRPEURVRVUHGXFHODIDWLJDHQSLHUQDV\HVSDOGDUHVXHOYHHO SUREOHPDGHODSUHVLyQ\DPRUWLJXDHOLPSDFWRGHODVSLVDGDV9ROYHUiVDVDFDUHO WDFyQDOWRGHODUPDULRVLQVHQWLUWXVSLHVFDQVDGRV6LQGXGDWLHQHVTXHSUREDUOR &RQVLJXHDKRUDSRUVyOR€XQSDFNGHWUHVSDUHVGH,QVROLDŠHQODWDOODTXH HOLMDV6R0 0RYLPLHQWRGH WRELOORFRQ\VLQ ,QVROLDŠ

8WLOL]DVLVWHPDV SDWHQWDGRVTXH FHUWL¿FDQOD FRUUHFFLyQGHO GHVSOD]DPLHQWRGHO SHVRFRUSRUDO

9(59Ë'(2 ODWLHQGDHQFDVDHV

3DFNSDUHVGHSODQWLOODV WDFyQDOWR,QVROLDŠ *DVWRVGHHQYtR

€

¼

7DOOD65I% 1~PHURV



*DVWRVGHHQYtR

€

¼

7DOOD05I% 1~PHURV

*DODUGRQDGRFRQHOVHOOR GHOD$VRFLDFLyQ0pGLFDGH 3RGRORJtDGH((88

/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG

*D 9HU


%HOOH]D\6DOXG

£$FWLYDWX

FLUFXODFLyQ  4XLHQPXHYHODV SLHUQDVPXHYHHOFRUD]yQ /DIDOWDGHPRYLOLGDG\HOVHGHQWDULVPRSURYRFDQJUDYHV FRQVHFXHQFLDVSDUDODVDOXG/DPiTXLQDGHDQGDUVHQWDGR +DSS\OHJVFRQVXVLVWHPDPRQLWRUL]DGREDVDGRHQHOSULQFLSLRQDWXUDO GHFDPLQDUPXHYHODVSLHUQDVGHIRUPDDOWHUQDREWHQLHQGRQXPHURVRV EHQH¿FLRVGHIRUPDVHQFLOOD\VLQHVIXHU]R(OPRYLPLHQWRGH+DSS\OHJV UHDFWLYDODFLUFXODFLyQVDQJXtQHDGHVGHODVSLHUQDVKDVWDHOFRUD]yQ\D\XGD DIRUWDOHFHUORVP~VFXORVGHODVSLHUQDVDVtFRPRDHOLPLQDUODLQÃ&#x20AC;DPDFLyQHQ URGLOODV\WRELOORV<DKRUDWLHQHXQQXHYRGLVHxRFRQXQPRWRUPiVVLOHQFLRVRFRQ YHORFLGDGHVTXHSRGUiVVHOHFFLRQDUGHSHQGLHQGRGHODLQWHQVLGDGGHHMHUFLFLRTXH SUH¿HUDV7DPELpQLQFRUSRUDPDQGRDGLVWDQFLDSDUDPDQHMDUORFyPRGDPHQWH\SDWDV UHJXODEOHVTXHWHSHUPLWLUiQDMXVWDUORDODDOWXUDTXHGHVHHV+DSS\OHJVHVXQSURGXFWR IDEULFDGRHQ(VSDxDGHJUDQGXUDELOLGDG\GLVHxDGRSDUDXQXVRFRQWLQXDGR5HFRPHQGDGR SRUHVSHFLDOLVWDVHQVDOXGFDUGLRYDVFXODUSUHYLHQHODDSDULFLyQGHYDULFHV\WURPERVLV\D\XGD DFRPEDWLUP~OWLSOHVHQIHUPHGDGHVVREUHSHVR+LSHUWHQVLyQVtQGURPHGHIDWLJDFUyQLFDHWF £$FWLYDWXFLUFXODFLyQ

0iTXLQDGHDQGDUVHQWDGR+DSS\OHJV

â&#x201A;¬0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RVâ&#x201A;¬ 7$(7,1 393â&#x201A;¬

$OLPHQWDFLyQ5HG WUDQVIRUPDGRU9 

5I

$XPHQWDHOULHJRVDQJXtQHRUHDFWLYDQGR ODFLUFXODFLyQGHODVDQJUH

$OLDGRH¿FD]FRQWUD ODFHOXOLWLV

&RQKRUDVDOGtD UHVXOWDGRVYLVLEOHV HQVHPDQDV

9(59Ã&#x2039;'(2 ODWLHQGDHQFDVDHV

0HMRUDODVDOXGGHWXVPDQRV (OPDVDMHDGRU³0DQRV6DQDV´HVXQDVROXFLyQH¿FD]TXHUHDFWLYDODFLUFXODFLyQVDQJXtQHDGH WXVPDQRVIiFLO\GHIRUPDQDWXUDO6XVXDYHPDVDMHDOLYLDGROHQFLDVWDQKDELWXDOHVFRPROD WHQGLQLWLVWHQVLRQHVPXVFXODUHVHQORVGHGRVDUWURVLV\HYLWDVtQWRPDVFRPRPDQRVGRUPLGDVR IUtDV3RGUiVVHOHFFLRQDUGLVWLQWRVQLYHOHVGHSUHVLyQ\PDVDMHDQGRFDGDGHGRGLDULDPHQWHGH DYHFHVGXUDQWHVRORPLQXWRVREWHQGUiVHQSRFDVVHPDQDVXQPD\RUDJLOLGDG\PHMRUDHQWXV PDQRV³0DQRV6DQDV´HVXQSURGXFWRSDWHQWDGR\IDEULFDGRHQ(VSDxD\HVWiUHFRPHQGDGRSRU OD)XQGDFLyQ=RQDV&DUGLR£3UHVXPDGHXQDVPDQRVERQLWDV\VDOXGDEOHVFRQ³0DQRV6DQDV´ 0DVDMHDGRUGHGHGRV +DSS\OHJV+/*

6HSWLHPEUH

â&#x201A;¬

9(59Ã&#x2039;'(2 ODWLHQGDHQFDVDHV

6yORKDVWD 393+DELWXDOâ&#x201A;¬

5I

0DVDMHDFDGDGHGRGHDVHJXQGRV \PHMRUDUiVODFLUFXODFLyQGHODVDQJUH

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD â&#x201A;¬  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

902 10 30 10

latiendaencasa.es






'HSRUWH /DRSFLyQ(FR0RGHSDUDWX HQWUHQDPLHQWR 8QHQWUHQDPLHQWRLQWHQVLYRGHQWURGHFDVDHVSRVLEOHFRQHVWDFRPSOHWD FLQWDGHFRUUHU%+)LWQHVV,QFRUSRUDXQVLVWHPDGHDPRUWLJXDFLyQ SDUDSUHYHQLUOHVLRQHVHVVLOHQFLRVD\WLHQHXQSRWHQWHYHQWLODGRU LQWHJUDGRSDUDXQHMHUFLFLRPiVDJUDGDEOH,QFRUSRUDXQPRQLWRU /&'FRQSHU¿OHVSUHGHWHUPLQDGRVXQPRWRUGH&9TXHSHUPLWH DOFDQ]DUXQDYHORFLGDGGHKDVWD.PK\VXVLVWHPDGHLQFOLQDFLyQ HOpFWULFDGHKDVWDHOWHD\XGDUiDWUDEDMDUFRQPD\RULQWHQVLGDG ORVP~VFXORVGHODVSLHUQDV\HVSDOGD,QFRUSRUDXQSURJUDPDGH FRQWUROGHULWPRFDUGtDFRWHVWGHFRQWUROGHJUDVD\VLVWHPDGH PHGLFLyQGHOSXOVRSRUFRQWDFWR'LVIUXWDGHOHMHUFLFLRPiVLQWHQVR 0HGLGDV $[+[) [[FP 3HVRNJ 6XSHU¿FLHGHFDUUHUD[FP 'LVHxRGH FRQVRODFRQ YHQWLODGRU LQWHJUDGR

&LQWDGHFRUUHU%+)LWQHVV=; (&20RGH FXRWDV

€0HV

6,1,17(5(6(6

7$(7,1 393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

£'LYLpUWHWHKDFLHQGRHMHUFLFLR 5HDOL]DHOHMHUFLFLRTXHPiVWHJXVWD FRQHVWDELFLFOHWDHOtSWLFD$WKORQ SDUDWRGRWLSRGHXVXDULRVFRQHOTXH FRQVHJXLUiVIRUWDOHFHUWRGRVWXV P~VFXORVDODYH]TXHUHDOL]DVHMHUFLFLR FDUGLRYDVFXODU'LVSRQHGHVLVWHPD GHIUHQRPDJQpWLFRPRQLWRU/&' FRQSHU¿OHVGHHMHUFLFLRGLIHUHQWHV QLYHOHVGHFDUJDUHJXODEOHVPDQXDOPHQWH WHVWGHUHFXSHUDFLyQ\WHVWGHFRQWUROGH JUDVDFRUSRUDO8QDELFLFOHWDTXHWHGDUi XQEXHQUHQGLPLHQWRSDUDORVUHVXOWDGRV PiVSURIHVLRQDOHV %LFLFOHWDHOtSWLFD%+)LWQHVV$WKORQ

'DXQJLURDWXIRUPDGHHVWLUDU /DWDEODGHLQYHUVLyQ*=HURHVXQLQQRYDGRUDSDUDWRTXHWH D\XGDUiDHVWLUDUODFROXPQDYHUWHEUDO\IDYRUHFHUHOHVWLUDPLHQWR GHORVP~VFXORV\DTXHSRGUiVLQFOLQDUVXUHVSDOGRKDVWDž 6XFRUUHDUHJXODEOHEORTXHDODURWDFLyQGHOUHVSDOGR\DMXVWDOD LQFOLQDFLyQGHVHDGD\REWHQGUiVWRWDOFRPRGLGDGFRQVXVFRQIRUWDEOHV DSR\RVGHSLHVFRQDOPRKDGLOODVGHHVSXPD8QDPDQHUDGLIHUHQWHGH PDQWHQHUWXFXHUSRHQIRUPD 0HGLGDVDELHUWD $[+[) [[FP 0HGLGDVSOHJDGD $[+[) [[FP 3HVRNJ3HVRPi[XVXDULRNJ 7DEODGHLQYHUVLyQ %+)LWQHVV*=HUR FXRWDV

€0HV

€0HV

6,1,17(5(6(6 7$(7,1 393727$/€

5I

),1$1&,$&,Ï1(;&/86,9$

FXRWDV

6,1,17(5(6(6

5I

7$(7,1 393727$/€ ),1$1&,$&,Ï1(;&/86,9$

0HGLGDV $[+[) [[FP 3HVRNJ3HVRPi[XVXDULRNJ



Comprar es muy fácil $WXVHUYLFLRKRUDVDOGtDGXUDQWHORVGtDVGHODxR

/7&LQGG




'HSRUWH (MHUFLFLRPRWLYDFLRQDOLQWHUDFWLYR 'HVFXEUHXQDQXHYDIRUPDGHKDFHUHMHUFLFLRFRQODFLQWDGHFRUUHU,63UHPLXPL&RQFHSW$KRUD SRGUiVHQWUHQDUDODYH]TXHGLVIUXWDVGHWXL3KRQHRL3DG3RGUiVQDYHJDUSRULQWHUQHWFRQVXOWDU WXVHPDLOVDFWXDOL]DUWXHVWDGRHQODVUHGHVVRFLDOHVFKDWHDUKDEODUSRUWHOpIRQRYHUYtGHRV« XQDIRUPDPXFKRPiVGLYHUWLGDGHKDFHUHMHUFLFLR6LPSOHPHQWHWLHQHVTXH FRQHFWDUWXL3KRQHRL3DGHQHOVRSRUWHGHOPRQLWRU\VHOHFFLRQDUWX SURJUDPDGHHQWUHQDPLHQWR<VLORSUH¿HUHVSXHGHVYHUODLQIRUPDFLyQ GHOHMHUFLFLRHQVXPRQLWRULQFRUSRUDGR&DOLGDGHLQQRYDFLyQSDUDXQ HMHUFLFLRFRPSOHWR &LQWDGHFRUUHU%+ )LWQHVV,63UHPLXQ FXRWDV

€0HV

6,1,17(5(6(6 7$(7,1

393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

3OLpJDODSDUDTXHRFXSH HOPtQLPRHVSDFLR

&$5$&7(5Ë67,&$67e&1,&$6 ‡0RWRU&9 SLFR

‡9HORFLGDG.PK ‡(OHYDFLyQHOpFWULFDKDVWDHO ‡6XSHU¿FLHGHFDUUHUD[FP ‡$PRUWLJXDFLyQHODVWyPHURV ‡3XOVRHQHOPDQLOODU\WHOHPpWULFR ‡7HFODVGHYHORFLGDGHLQFOLQDFLyQLQVWDQWiQHDV ‡$KRUUDKDVWDXQGHFRQVXPRHOpFWULFR ‡3RWHQWHYHQWLODGRULQWHJUDGR ‡0HGLGDV $[+[) [[FPSOHJDGR[[FP ‡3HVRNJ

'LVSRVLWLYR$SSOH QRLQFOXLGR

(QWUHQDFRQWXL3RG L3KRQHRL3DG

(OHMHUFLFLRPiVVDOXGDEOH\ HQWUHWHQLGR

¢7LHQHVXQL3RGWRXFKL3KRQHRL3DG"(QWRQFHV\DGLVSRQHVGHOD ~OWLPDWHFQRORJtDHQPRQLWRUHVGHDSDUDWRVGH¿WQHVV8QVLVWHPD TXHWHSHUPLWLUiHVWDEOHFHUREMHWLYRVGH HQWUHQDPLHQWRHLQWHUDFWXDUFRPSLWLHQGR FRQWUDODPiTXLQD3RGUiVGHVFDUJDUWH DSOLFDFLRQHVRMXHJRVRXWLOL]DUORSDUD QDYHJDUYHUSHOtFXODVHVFXFKDUP~VLFD OHHUHERRNVKDEODUSRUWHOpIRQR<VLQR GLVSRQHVGHL3RGWRXFKL3KRQHRL3DG SXHGHVYHUODLQIRUPDFLyQGHWXHMHUFLFLR HQVXPRQLWRULQFRUSRUDGR

7HSUHVHQWDPRVXQQXHYRFRQFHSWRGHHQWUHQDPLHQWRLFRQFHSWGH%+ )LWQHVV8QVLVWHPDGLYHUWLGRLQWHUDFWLYR\PRWLYDFLRQDOTXHWHSHUPLWLUi HQWUHQDUDODYH]TXHXWLOL]DVWXL3KRQHR,SDG3RGUiVHVWDEOHFHU REMHWLYRVGHHQWUHQDPLHQWRLQFOXVRFRPSHWLUFRQWUDODPiTXLQD\ DGHPiVGHVFDUJDUWHDSOLFDFLRQHVQDYHJDUSRU ,QWHUQHWFKDWHDUYHUYtGHRV«<VLORSUH¿HUHV SXHGHVXWLOL]DUHOSURSLRPRQLWRUGHODELFLFOHWDSDUD YHUWRGDODLQIRUPDFLyQGHWXHMHUFLFLR8QPpWRGR QXHYR\GLIHUHQWHSDUDHQWUHQDUFRQPXFKDV PiVRSFLRQHV

%LFLFOHWDHOtSWLFDL$WODQWLF

€0HV

%LFLFOHWDHVWiWLFDL3HJDVXV FXRWDV

6,1,17(5(6(6

FXRWDV

€0HV

6,1,17(5(6(6

7$(7,1 393727$/€

5I

7$(7,1 393727$/€

),1$1&,$&,Ï1(;&/86,9$

5I ),1$1&,$&,Ï1(;&/86,9$

0RQLWRU0 VLQL3DG

'LVSRVLWLYR$SSOH QRLQFOXLGR

&$5$&7(5Ë67,&$67e&1,&$6 ‡6LVWHPDGHLQHUFLDGHNJ‡6LVWHPDGHIUHQRPDJQpWLFR‡%UD]RVUHJXODEOHVHQDOWXUD ‡6LVWHPDGHPHGLFLyQGHSXOVRHQHOPDQLOODU‡=DQFDGDFP‡5XHGDVLQFRUSRUDGDV ‡3HVRPi[XVXDULRNJ‡0HGLGDV $[+[) [[FP‡3HVRNJ

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD ,QVWDODFLyQQRLQFOXLGD&RQVXOWDVHUYLFLRGHPRQWDMH

/7&LQGG

'LVSRVLWLYR$SSOH QRLQFOXLGR

&$5$&7(5Ë67,&$67e&1,&$6 ‡6LVWHPDGHIUHQRPDJQpWLFR‡9RODQWHGHLQHUFLDNJ‡3XOVRHQHOPDQLOODU ‡3HVRPi[XVXDULRNJ‡0HGLGDV $[+[) [[FP‡3HVRNJ

902 10 30 10

latiendaencasa.es






'HSRUWH

6LHPSUHKD\XQDVROXFLyQSDUDSRQHUVHHQIRUPD &XtGDWHFRQORVPHMRUHVSURIHVLRQDOHVGHOGHSRUWH &RQFHSW*<0WHSURSRQHODVPiTXLQDVGH¿WQHVVPiVFRPSOHWDV SDUDXQHQWUHQDPLHQWRDWXPHGLGD(OLJHODTXHPiVVHDGDSWHDWL \GLVIUXWDGHXQHMHUFLFLRGHFDOLGDGDOPHMRUSUHFLR\FRQWRGDV ODVFRPRGLGDGHV\DTXHVLTXLHUHVWHGDPRVODRSFLyQGH VHUYLFLRGHPRQWDMHHQFDVD&RQV~OWDQRV

Y

FRQFHSW *<0

%



7

5

)

3RGUiVJXDUGDUODLQFOXVRGHEDMR GHODFDPD &LQWDGHFRUUHU 5XQQHU*\P58 

€

&LQWDGHFRUUHU 5XQQHU*\P58  5(*$/27DSL]SURWHFWRU

5I 6yORKDVWD 393+DELWXDO€

FXRWDV

€0HV

6,1,17(5(6(6 7$(7,1 393727$/€

3DJRDSOD]DGR 6,1(175$'$ &RQV~OWDQRV

5I ),1$1&,$&,Ï1(;&/86,9$

&$5$&7(5Ë67,&$658 ‡0RWRU&9‡9HORFLGDG.PK‡,QFOLQDFLyQKDVWD ‡3DQWDOOD/&'UHWURLOXPLQDGD‡SHU¿OHVSUHGH¿QLGRV‡7HVWGHFRQWURO GHJUDVD‡&RQWUROGHULWPRFDUGtDFR‡6LVWHPDH[FOXVLYRGHDPRUWLJXDFLyQ ³(UJR6RIW´‡6XSHU¿FLHGHFDUUHUD[FP‡3HVRPD[XVXDULRNJ ‡0HGLGDV $[+[) [[FP‡3HVRNJ

&$5$&7(5Ë67,&$658 ‡0RWRUGH&9‡9HORFLGDG.PK‡,QFOLQDFLyQKDVWD ‡3DQWDOOD/&'UHWURLOXPLQDGD‡SHU¿OHVSUHGH¿QLGRV‡&RQWUROGHULWPRFDUGtDFR ‡8OWUDSOHJDEOH‡0HGLGDV $[+[) [[FP‡3HVRNJ

1 S H T £

%LFLFOHWD(OtSWLFD&URVVHU&5 FXRWDV

€0HV

%LFLFOHWD(OtSWLFD&URVVHU&5

€0HV FXRWDV

5I

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

),1$1&,$&,Ï1(;&/86,9$

5I

6,1,17(5(6(6 7$(7,1 393727$/€

&$5$&7(5Ë67,&$6&5 ‡9RODQWHGHLQHUFLDNJ‡SURJUDPDV SHUVRQDOL]DEOHV‡5HVLVWHQFLDHOHFWUyQLFD DMXVWDEOHFRQSRVLFLRQHV‡0RQLWRU PXOWLIXQFLyQ‡&RQWUROGHULWPRFDUGtDFR ‡'REOHPDQLOODUHUJRQRPLFRV‡0DQLOODU DMXVWDEOH‡3HVRPD[XVXDULRNJ ‡0HGLGDV $[+[) [[FP ‡3HVRNJ

&$5$&7(5Ë67,&$6&5 ‡9RODQWHGHLQHUFLDNJ‡5HVLVWHQFLDDMXVWDEOH FRQSRVLFLRQHV‡0RQLWRUPXOWLIXQFLyQ ‡&RQWUROGHULWPRFDUGtDFR‡'REOHPDQLOODU HUJRQyPLFR‡3HVRPD[XVXDULRNJ ‡0HGLGDV $[+[) [[FP ‡3HVRNJ

6



5



7RGRVORVSURGXFWRVGHHVWHFDWiORJRHQODWLHQGDHQFDVDHV

/7&LQGG

*D 9HU ,Q


'HSRUWH

£8QDVHVLyQGHFLFOLVPRLQGRRUSURIHVLRQDO 'LVIUXWDGHWXGHSRUWHIDYRULWRHQFDVDFRQHVWDVELFLFOHWDVGHFLFOLVPRLQGRRU)RUWDOHFHUiVWXVSLHUQDV\FXLGDUiVWXFRUD]yQDOD YH]TXHGLVIUXWDVGHXQHMHUFLFLRLQWHQVR3URQWRPHMRUDUiVWXIRUPDItVLFD

FRQFHSW *<0

%LFLFOHWD&LFOLVPR,QGRRU5LGHU5, FXRWDV

€0HV

6,1,17(5(6(6

%LFLFOHWD&LFOLVPR,QGRRU5LGHU5,

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

7$(7,1 393727$/€

5I

5I

),1$1&,$&,Ï1(;&/86,9$

&$5$&7(5Ë67,&$65, ‡9RODQWHGHLQHUFLDNJ‡5HVLVWHQFLDDMXVWDEOH‡0RQLWRUPXOWLIXQFLyQ‡3XOVyPHWUR ‡%RWHOOD\SRUWDERWHOOD‡3HGDOHVDQWLGHVOL]DQWHV‡6LOOtQ\PDQLOODUHUJRQyPLFRV DMXVWDEOHV‡3HVRPD[XVXDULRNJ‡0HGLGDV $[+[) [[FP ‡3HVRNJ

&$5$&7(5Ë67,&$65, ‡9RODQWHGHLQHUFLDNJ‡5HVLVWHQFLDDMXVWDEOH‡0RQLWRUPXOWLIXQFLyQ‡3XOVyPHWUR ‡%RWHOOD\SRUWDERWHOOD‡3HGDOHVDQWLGHVOL]DQWHV‡6LOOtQ\PDQLOODUHUJRQyPLFRVDMXVWDEOHV ‡3HVRPD[XVXDULRNJ‡0HGLGDV $[+[) [[FP‡3HVRNJ

£6XSpUDWHHQFDGDHMHUFLFLR 1RWHSLHUGDVHVWDVHOHFFLyQGHFRPSOHPHQWRVGH¿WQHVVSHUIHFWRV SDUDHQWUHQDUGHXQDPDQHUDPiVLQWHQVD\SURIHVLRQDO3DUDWXV HMHUFLFLRVGHVXHORSDUDFXDQGRWHQJDVTXHUHSRQHUIXHU]DVRVL TXLHUHVGXSOLFDUHOHIHFWRGHWXVHMHUFLFLRVFRQXQDPD\RUUHVLVWHQFLD £7RGRORQHFHVDULRSDUDSRQHUWHHQIRUPDPXFKRPiVUiSLGR 6HW%RWHOODPRGXODEOH 7RDOODPLFUR¿EUD

€

8UEDQOLIHODH[FOXVLYDELFLFOHWD SOHJDEOHGH%RRPHUDQJ 6LWHJXVWDPRYHUWHFRQOLEHUWDG\DKRUUDUWLHPSR\HVSDFLRWXRSFLyQ HVODSUiFWLFDELFLFOHWDSOHJDEOH8UEDQOLIHGH%RRPHUDQJ*UDFLDV DVXH[FOXVLYRVLVWHPDGHSOHJDGRWHODSRGUiVOOHYDUDFXDOTXLHU SDUWH\YROYHUDPRQWDUODHQSRFRVVHJXQGRV/DIRUPDPiVVDQD HFROyJLFD\SUiFWLFDSDUDPRYHUWHSRUODFLXGDG %LFLFOHWDSOHJDEOH %RRPHUDQJ8UEDQOLIH36

*DVWRVGHHQYtR

€

¼

5I%

5I

3DFNSHVRVSDUDPXxHFDV SHVRVSDUDWRELOORV

€

*DVWRVGHHQYtR

¼

5I%

,1&/8<( ‡/DVWUHVGHPXxHFDV ‡/DVWUHGHFLQWXUD ‡3RGyPHWUR ‡%RWHOOD ‡&LQWXUyQ

6HW5XQQLQJ

€

5I%

7DSL]SURWHFWRUDLVODQWH *DVWRVGHHQYtR

¼

€

5I%

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD ,QVWDODFLyQQRLQFOXLGD&RQVXOWDVHUYLFLRGHPRQWDMH

*DVWRVGHHQYtR

¼

&$5$&7(5Ë67,&$67e&1,&$6 ‡&XDGURGHDOXPLQLRWRWDOPHQWHSOHJDEOH‡YHORFLGDGHV‡&DPELR6KLPDQR‡0DQHWDV GHIUHQR\PDQLOODUHQDOXPLQLR‡(TXLSDGDFRQJXDUGDEDUURVSRUWDEXOWRV\FDEDOOHWH ‡3HGDOHVSOHJDEOHV

902 10 30 10

latiendaencasa.es






'HSRUWH 8QHVSDFLR~QLFRSDUDWUDEDMDU WRGRVWXVP~VFXORV

/DYLEUDFLyQPiVEHQH¿FLRVD

<DSXHGHVPRQWDUWXSURSLRJLPQDVLRHQFDVDFRQHVWDPXOWLHVWDFLyQ +RPHJ\P(QVyORPWHQGUiVOR QHFHVDULRSDUDUHDOL]DUWXVHMHUFLFLRV SROHDDOWDSDUDWUDEDMDU HOWUHQVXSHULRUGHOFXHUSR SROHDEDMDSDUDHOWUHQ VXSHULRUHLQIHULRUGHO FXHUSRSUHVVGHEUD]RV PDULSRVDFXUOGHSLHUQDV \SUHGLFDGRU)DEULFDGD FRQXQFKDVLVGHWXEHUtD GHDOWDUHVLVWHQFLDFRQSHU¿O FXDGUDGRUHFWDQJXODU\ RYDODGRWDPELpQGLVSRQH GHFDEOHDGRGHDFHURTXH RIUHFHXQDUHVLVWHQFLDGH KDVWDNJ %DQFRGHPXVFXODFLyQ 7UHR*

¢4XLHUHVSHUGHUSHVRWRQL¿FDUWX FXHUSR\SRQHUWHHQIRUPDGHPDQHUD IiFLO\GLYHUWLGD"/DSODWDIRUPD9LEUR 0HULWKDUiTXHTXHPHVJUDVD WRQL¿TXHV\IRUWDOH]FDVWXFXHUSR HQXQWLHPSRUpFRUG*UDFLDVDVX SRWHQWHWHFQRORJtDGHYLEUDFLyQ XQDVHVLyQGHPLQXWRVFRQ 9LEUR0HULWHTXLYDOHDKRUDHQ HOJLPQDVLR1RHVSHUHVPiV\ DSURYHFKDHVWDRIHUWDHVSHFLDO SDUDVXELUWHDODSODWDIRUPDPiV LQQRYDGRUDGHOPHUFDGR 3ODWDIRUPDGHYLEUDFLyQ 9LEUR0HULW

€0HV FXRWDV

6,1(175$'$ 393)LQDODSOD]RV€ 7$(7,1 393€

5I

FXRWDV

€0HV

6,1,17(5(6(6 7$(7,1 393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

6Ï/2



81,'$'(6

0HGLGDV $[+[) [[FP 3HVRNJ3HVRPi[LPRXVXDULRNJ 3HVRGHWUDEDMRKDVWDNJ8VR5HJXODUGRPpVWLFR

9(59Ë'(2 ODWLHQGDHQFDVDHV

£(O5HORM9LFHUR\2¿FLDOGHO5HDO0DGULG (VHOPRPHQWRGHO5HORM9LFHUR\2¿FLDOGHO5HDO0DGULG\GHFHOHEUDUORVWULXQIRV GHOFDPSHyQFRQXQDPDUFDOtGHUFRPR9LFHUR\'HSRUWLYR\FRQHVWLORFXHQWDFRQ FURQyJUDIR\FULVWDOPLQHUDOIRQGRGHDFHURFRQWRUQLOORVVXPHUJLEOHPHWURV \SHUVRQDOL]DGRFRQHOQRPEUH\HOHVFXGRGHO5HDO0DGULG(VWiGLVSRQLEOHHOPRGHOR FRQHVIHUDQHJUD\EODQFDHOLJHHOWX\R\OOpYDWHGH5(*$/2XQSLQEDxDGRHQSODWD GHOHVWDGLR6DQWLDJR%HUQDEpXHOHVWDGLRGHWRGRVORVPDGULGLVWDV

3HGDOHDGRU-RFFD

5I

*DVWRVGHHQYtR

¼

0HGLGDV $[+[)  [[FP 3HVRNJ

(VIHUDEODQFD5I% (VIHUDQHJUD5I%



6LTXLHUHVFRPSOHWDUWXHMHUFLFLRWHSURSRQHPRV HOSHGDOHDGRU-RFFDDSURSLDGRSDUDKDFHU UHKDELOLWDFLyQFRQHOTXHSRGUiVUHDOL]DUPRYLPLHQWRV KDFLDGHODQWH\KDFLDDWUiV\VHOHFFLRQDUGLIHUHQWHV QLYHOHVGHLQWHQVLGDG8QDRSFLyQSDUDPDQWHQHUWHHQ IRUPDHQFXDOTXLHUPRPHQWR

€

5HORMFURQyJUDIR5HDO0DGULG9LFHUR\ 5(*$/2SLQ(VWDGLR6DQWLDJR%HUQDEpX

€

8QSDVRPiVSDUDSRQHUWHHQIRUPD



9(59Ë'(2 ODWLHQGDHQFDVDHV

3DQWDOOD/&' TXHIDFLOLWDOD YLVXDOL]DFLyQGH ORVGDWRV

5(*$/2 3LQ(VWDGLR 6DQWLDJR %HUQDEpX



Cómodas mensualidades 7~HOLJHVODIRUPDGHSDJR

/7&LQGG




'HSRUWH

(OHQWUHQDPLHQWRPiVFRPSOHWR 7HFQRYLWDE\%+SRQHDWXDOFDQFHHVWRVDSDUDWRVGHHMHUFLFLRVSHUIHFWRV SDUDDTXHOORVTXHTXLHUHQPDQWHQHUVHHQIRUPDHQFDVD\VLQSHUGHUWLHPSR HQGHVSOD]DPLHQWRV8QRVGLVHxRVHVSHFLDOHVTXHQRRFXSDQHVSDFLR\ FRQORVTXHIRUWDOHFHUiVEUD]RV\SLHUQDV\TXHPDUiVFDORUtDV/OpYDWHDO PHMRUSUHFLRHVWRVDSDUDWRVGH7HFQRYLWDE\%+XQDELFLFOHWDHVWiWLFDXQD FLQWDGHDQGDU\HOSHGDOHDGRUHOpFWULFR



&LQWDGHDQGDUPDJQpWLFD 7HFQRYLWDE\%+<)



FXRWDV

€0HV

6,1,17(5(6(6

7$(7,1 393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

&$5$&7(5Ë67,&$67e&1,&$6 ‡)UHQRPDJQpWLFRFRQQLYHOHVGHLQWHQVLGDG‡9RODQWHGHLQHUFLDNJ ‡0RQLWRU/&'‡6XSHU¿FLHGHFDUUHUD[FP ‡0HGLGDV $[+[) [[FPSOHJDGD[[FP ‡3HVRPi[XVXDULRNJ‡3HVRNJ

 %LFLFOHWDHVWiWLFD FRQUHVSDOGR 7HFQRYLWDE\%+<) 

€

0LQLELNH 7HFQRYLWD E\%+<)

3DJRDSOD]DGR 6,1(175$'$ &RQV~OWDQRV

€

5I 0HGLGDV $[+[) [[FP 0HGLGDVSOHJDGD $[+[) [[FP 3HVRNJ

5I $OLPHQWDFLyQ5HG 0HGLGDV $[+[) [[FP 3HVRNJ

&DPELDWXIRUPDGHKDFHUDEGRPLQDOHV 5HDOL]DWXVHMHUFLFLRVGHDEGRPLQDOHVFRQWRWDOVHJXULGDG\FRPRGLGDGFRQHVWHEDQFRGHHMHUFLFLRV8QGLVHxRHVSHFLDOSDUD HMHUFLWDUORVP~VFXORVDEGRPLQDOHVVLQLPSDFWRVJUDFLDVDVXVXSHU¿FLHGHFLOLQGURVDFROFKDGD\DVXVDVDVODWHUDOHV TXHWHVXMHWDUiQPLHQWUDVUHDOL]DVWXVHMHUFLFLRVDODYH]TXHWHD\XGDUiQHQORVPRYLPLHQWRVGHVXELGD\EDMDGD$GHPiV SRGUiVOOHYDUHOFRQWUROGHWXHQWUHQDPLHQWR\DTXHGLVSRQHGHXQFRQWDGRUSDUDYLVXDOL]DUODLQIRUPDFLyQGHFDORUtDV FRQVXPLGDVDEGRPLQDOHVUHDOL]DGRVWLHPSR8QEDQFRSHUIHFWRSDUDXWLOL]DUHQFDVDPX\IiFLOGHPRQWDU\ JXDUGDU\DTXHVHSOLHJDSDUDTXHRFXSHPX\SRFRHVSDFLR£/DIRUPDPiVVHQFLOODGHSRQHUVHHQIRUPD %DQFRGHDEGRPLQDOHV-RFFD

€

5I 0HGLGDVDELHUWRFHUUDGR $[+[)  [[[[FP 3HVRNJ

6HQFLOORVLVWHPDGHSOHJDGR

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD ¼  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD ,QVWDODFLyQQRLQFOXLGD&RQVXOWDVHUYLFLRGHPRQWDMH

/7&LQGG

902 10 30 10

latiendaencasa.es






'HSRUWH

£MXHJRVHQELOODUDLUKRFNH\\SLQJSRQJ <DWLHQHVODVROXFLyQGH¿QLWLYDSDUDWXVMXHJRV(VWDLQFUHtEOHPHVDHVFRQGHORVMXHJRVPiVDSDVLRQDQWHV\GLYHUWLGRVTXHSXHGHVWHQHUHQFDVD 3RUXQODGRHVXQDPHVDGHELOODUDPHULFDQRFRQWRGRVORVDFFHVRULRVTXHQHFHVLWDVSDUDGLVIUXWDUGHODVPHMRUHVSDUWLGDVSRURWURHVXQD IDQWiVWLFDPHVDGHDLUKRFNH\XQMXHJRFOiVLFR\HPRFLRQDQWHFRQHOTXHWHQGUiVTXHPHWHUJROHVDWXDGYHUVDULR<SDUDFRPSOHWDUODV WDUGHVPiVGLYHUWLGDVWDPELpQSXHGHVFRQYHUWLUORHQXQDPHVDGHSLQJSRQJ VLPSOHPHQWHWLHQHVTXHFRORFDUHOWDEOHURODUHG\HPSH]DUDMXJDU £'LVIUXWDGHXQDSDUWLGDGLIHUHQWHFDGDGtD 0HVDELOODUKRFNH\ SLQJSRQJHQ FXRWDV

€0HV 6,1,17(5(6(6 7$(7,1

393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

0HGLGDV $[+[)  [[FP 3HVRNJ

-8(*2'(3,1*321* ‡5HG‡SHORWDV‡SDODV -8(*2$,5+2&.(< ‡JROSHDGRUHV‡SDVWLOOD

&DPELDGH MXHJRHQSRFRV VHJXQGRV

-8(*2'(%,//$5 ‡6HWGHERODVGHMXHJR‡WDFRV‡7ULiQJXOR ‡WL]DV‡&HSLOORSDUDHVTXLQDV

¢7HDSHWHFHXQDSDUWLGDGHIXWEROtQ" 2UJDQL]DORVPHMRUHVFDPSHRQDWRVFXDQGRWHDSHWH]FDFRQHVWHPDJQt¿FRIXWEROtQ 5HDOL]DGRFRQ0')ODPLQDGRFRQ39&HVWiHTXLSDGRFRQWRGDVODVFRPRGLGDGHV QLYHODGRUGHSDWDVPDUFDGRUGHPDGHUDERODVVXMHWDYDVRV«6yORWLHQHV TXHHOHJLUFRQTXpHTXLSRTXLHUHVMXJDU«£\FRPHQ]DUODSDUWLGD )XWEROtQ5RERW6W\OH FXRWDV

€0HV

6,1,17(5(6(6

7$(7,1 393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

£7XPHMRUSXQWR HQODSLVWD (TXtSDWHSDUDWXVPHMRUHVSDUWLGDVGH3iGHOFRQ HVWDSDOD/HWKDO&RQWUROGH9DUOLRQ5HDOL]DGD HQPDWHULDOGHDOWDFDOLGDGHVWiGLULJLGDDDTXHOORV MXJDGRUHVTXHEXVFDQFRQWURO6XEDODQFHHV FHQWUDGR\WLHQHXQQ~FOHRGHPP/LJHUD\ FyPRGDWHSHUPLWLUiXQMXHJRSRWHQWH$GHPiV GXUDQWHHOPHVGH6HSWLHPEUHSRUVyOR€ £(PSLH]DODSDUWLGD

3DODGH3iGHO/HWKDO &RQWUROGH9DUOLRQ

6HSWLHPEUH

€

6yORKDVWD 393+DELWXDO€

5I

0HGLGDV $[+[)  [[FP 3HVRNJ



&$5$&7(5Ë67,&$67e&1,&$6 ‡3HVRJ ‡1LYHOGHMXHJR,QWHUPHGLR ‡)RUPDSDOD5HGRQGD ‡3HU¿OPP ‡1~FOHRPP ‡7HFQRORJtD)OH[FRUHFDSDV 8)39DUÀH['LVHxR' ‡*ULS1HJUR

/RV$XWpQWLFRV´$QXQFLDGRHQ79µHQODWLHQGDHQFDVDHV

/7&LQGG




'HSRUWH £0RGDGH2WRxR 7HSUHVHQWDPRVHVWDVSUHQGDVLGyQHDV\UHVLVWHQWHVSDUDWXV DFWLYLGDGHVHQHOFDPSRXQDFKDTXHWDGHVPRQWDEOH\XQFKDOHFR GHDOJRGyQHVSHFLDOPHQWHGLVHxDGDVSDUDLUGHFD]DRKDFHU H[FXUVLRQHVFRQFRPRGLGDG£(OLJHWXPRGHORSUHIHULGR &KDTXHWDGHVPRQWDEOHSDUDKRPEUH

€

5I4,;; 'LVSRQLEOHHQWDOODV

'LYHUVLyQSDUD SRQHUWHHQIRUPD (OQXHYRSDWLQHWHDUWLFXODGR<)OLFNHU)FXHQWDFRQXQ UHYROXFLRQDULRGLVHxRTXHVHPXHYHFRQHOPRYLPLHQWRGHWX FXHUSR6LPSOHPHQWHGHVOL]iQGRWHHVWHSDWLQHWHGHUXHGDVVH PRYHUiDOFRPSiVGHWXFXHUSRJUDFLDVDVXVLVWHPD~QLFRGH SURSXOVLyQ6XVUXHGDVHQSROLXUHWDQRGHDOWDFDOLGDGWHGDUiQ XQDWRWDOVHJXULGDGXQLGRDVXPDQLOODUDFROFKDGR\VXFXHUSR OLJHUR\SOHJDEOHTXHWHSHUPLWLUiWUDQVSRUWDUOR\JXDUGDUORFRQ IDFLOLGDG7XQXHYRFRPSDxHURGHWUDQVSRUWH$KRUDHQ6HSWLHPEUH SRUVyOR€ 3DWLQHWHDUWLFXODGR<)OLFNHU)

€

5I

&KDOHFRFD]DDOJRGyQSDUDKRPEUH

€

5I3$;; 'LVSRQLEOHHQWDOODV

(ONLWGHSHVFDPiVFRPSOHWR ,QtFLDWHHQODSHVFDFRQHVWHFRPSOHWRNLW&RPSXHVWRSRUXQDFDxDGH SHVFDUIiFLOGHPRQWDUUHVLVWHQWH\HUJRQyPLFDFRQVHFFLRQHV GHORQJLWXGGHFP\GLiPHWURGHOtQHDGHPP,QFOX\HORV DFFHVRULRVSDUDWRGRWLSRGHSHVFDFXFKDULOODJLUDWRULDÀRWDGRUHV GHERODSORPRVFDUUHWHDQ]XHORV6DELNLDQ]XHORVVDFDDQ]XHORV VHxXHORVEODQGRV7RGRSUHVHQWDGRHQXQDSUiFWLFDFDMD 6HWGH3HVFD DFFHVRULRV-RFFD 5I%

6HSWLHPEUH

*DVWRVGHHQYtR

¼

€

6yORKDVWD 393+DELWXDO€

¢-XJDPRVDOSLQJSRQJ" %RRPHUDQJWHRIUHFHHVWHQXHYRPRGHORGHPHVDGH 3LQJ3RQJ8QPRGHORGHLQWHULRUGLVHxDGRSDUD HQWUHQDPLHQWRVHQFROHJLRVFOXEHVHVFXHODV GHSRUWLYDV\HQWXSURSLDFDVD6X VLVWHPD&77SHUPLWHODVSRVLFLRQHV GHMXHJRSOHJDGR\IURQWyQSDUD SRGHUMXJDUXQDVRODSHUVRQD3DUDWRWDO FRPRGLGDGLQFOX\HUXHGDVGHWUDQVSRUWH \SHORWHUR£/DGLYHUVLyQHVWiDVHJXUDGD 0HVDGH3LQJ3RQJGHLQWHULRU%RRPHUDQJ1HSDO  FXRWDV

€0HV

6,1,17(5(6(6

7$(7,1 393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$

0HGLGDVDELHUWD $[+[) [[FP 3HVRNJ

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD €  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD ,QVWDODFLyQQRLQFOXLGD&RQVXOWDVHUYLFLRGHPRQWDMH

/7&LQGG

902 10 30 10

latiendaencasa.es






'HSRUWH

7RQL¿FDHVFXOSH\ SLHUGHSHVR£DOULWPRGHOD P~VLFD $KRUDSXHGHVFRQVHJXLUXQFXHUSRPiVHVEHOWRGHODIRUPD PiVUiSLGD\VHQFLOODFRQHOSDFNGH'9'¶V=XPED)LWQHVV 8QFRPSOHWRHQWUHQDPLHQWRDHUyELFRTXHFRPELQDULWPRVUiSLGRV \OHQWRVSDUDGLVIUXWDUGHXQHMHUFLFLRDGLFWLYR\GHDOWDHQHUJtD &RQVHJXLUiVWRQL¿FDUHVFXOSLUIRUWDOHFHU\SHUGHUSHVRGH XQDPDQHUDWRWDOPHQWHQDWXUDO\ORPHMRUGHWRGRGLYHUWLGD ,QFOX\HXQSODQDFHOHUDGRSDUDSHUGHUSHVRHQGtDV\GH 5(*$/2HOMXHJRGH7RQLQJ6WLFNVSHVDVFRQVRQLGR EDVDGRHQODVPDUDFDVTXHWHSHUPLWLUiHQWUHQDUDOULWPRGH ODP~VLFD 3DFN'9'¶V=XPED)LWQHVV 5(*$/2SHVDVFRQVRQLGR

€

*DVWRVGHHQYtR

¼

5I%

<325

€ 0É6 //e9$7(2752 -8(*2'( 3(6$6&21 621,'2 5I%

5(*$/2

3$&.'('9'¶V ‡%iVLFR\PLQXWRVH[SUHVV ‡&DUGLR3DUW\ ‡(VFXOSH\WRQL¿FD ‡$EGRPLQDOHV\=XPED/LYH ‡*XtDGHHMHUFLFLRV ‡3ODQGHDOLPHQWDFLyQ *8Ë$727$/%2'<75$16)250$7,21 ‡3ODQDFHOHUDGRSDUDSHUGHUSHVRHQGtDV ‡&RQVHMRVSDUDHOHQWUHQDPLHQWR ‡(VWLUDPLHQWRLQWHJUDOGHOFXHUSR ‡*XtDGHHQWUHQDPLHQWR

-XHJRGHSHVDV FRQVRQLGR

9(59Ë'(2 ODWLHQGDHQFDVDHV

¢7HDSHWHFHXQDVHVLyQGHVSD" (VFiSDWHGHODVWHQVLRQHVItVLFDV\GHOHVWUpVGLDULR\UHVHUYDXQ PRPHQWRSDUDFXLGDUWHGHVSXpVGHXQGXURGtDGHWUDEDMR&RQ HVWDEDxHUDGHKLGURPDVDMHKLQFKDEOH/D\=6SDWHQGUiV HVWHOXMRDWXDOFDQFHWRGRVORVGtDV&RQFDSDFLGDGSDUDFXDWUR SHUVRQDVHVWiUHDOL]DGRHQ39&GHDOWDFDOLGDGFDOLHQWDHO DJXDKDVWDž&\SRGUiVGLVIUXWDUGHOPiVDJUDGDEOHEDxR GHEXUEXMDV&ROyFDORWDQWRHQHOLQWHULRURH[WHULRUJUDFLDVD VXIDFLOLGDGGHPRQWDMH\SDUDVXEXHQPDQWHQLPLHQWRLQFOX\H FREHUWRU\XQDGHSXUDGRUDGH/K£'LVIUXWDGHWXSURSLD VHVLyQGHVSD 0HGLGDV $[+ [FP &DSDFLGDG/ /D\=6SD%HVWZD\ FXRWDV

€0HV

6,1,17(5(6(6 7$(7,1

393727$/€

5I ),1$1&,$&,Ï1(;&/86,9$



Recibe el pedido donde tú quieras 7~HOLJHVHOOXJDUGHHQWUHJD

/7&LQGG




'HSRUWH 4XHPDFDORUtDVDFDGDSDVRFRQ

),71(6667(3



6LQRWLHQHVJDQDVGHLUDOJLPQDVLRVLQRSXHGHVGHMDU GHFRPHUORTXHWHJXVWD\VLQRTXLHUHVFDPELDUWX YLGDGLDULDSDUDKDFHUHMHUFLFLR£QRWHSUHRFXSHV/DV LQFUHtEOHV)LWQHVV6WHSKDFHQWRGRHVHWUDEDMRSRUWL 9tVWHWHDWXPDQHUD\GLVIUXWDGHWRGRVORVEHQH¿FLRVFRQ ODV]DSDWLOODVTXHWHD\XGDUiQDFRUUHJLUODSRVWXUD HVWLOL]DUOD¿JXUDWRQL¿FDUWXFXHUSR\SHUGHUKDVWD NLORVSRUVHPDQD&RQVXHODDQWLGHVOL]DQWHFiPDUDGH DLUH\WHFQRORJtDGHEDODQFHR\HTXLOLEULRSHUIHFWRHQ HOWDOyQ\ODSXQWDWRQL¿FDUiVWXFXHUSR\SHUGHUiVSHVR DFDGDSDVR7HRIUHFHPRVXQPRGHORHQFRORUQHJUR PRGHUQR\HVWLOL]DGRTXHFRPELQDUiFRQWRGDWXURSD <VLSUH¿HUHVWDPELpQSXHGHVHOHJLUODV)LWQHVV6WHS RULJLQDOHVHQFRORUEODQFRODVVDQGDOLDV8UEDQ 7UDLQLQJHVSHFLDOHVSDUDHOEXHQWLHPSRR)LWQHVV6WHS &DVXDO7UDLQHUXQPRGHORH[FOXVLYRSDUDORVKRPEUHV TXHTXLHUHQFXLGDUVH6RQODVDXWpQWLFDV)LWQHVV6WHS DQXQFLDGDVHQ79

Â&#x2021;3pUGLGDGHSHVR Â&#x2021;$SRUWD¿UPH]DDORVJO~WHRV Â&#x2021;7HQVLyQGLQiPLFDHQOD]RQDGHODV SDQWRUULOODVPXVORV\SLHUQDV Â&#x2021;&RUULJHODSRVWXUD\DXPHQWDOD HVWDWXUD Â&#x2021;0HMRUDODFLUFXODFLyQ Â&#x2021;3UHYLHQHODVYDULFHV Â&#x2021;&RPEDWHODFHOXOLWLV Â&#x2021;7RQL¿FDHOFXHUSR\PROGHDOD ¿JXUDFRQVRORFDPLQDU Â&#x2021;7RGRVORVEHQH¿FLRVGHOHMHUFLFLR FDUGLRYDVFXODU Â&#x2021;7ULSOLFDORVUHVXOWDGRVGHXQD FDPLQDWD Â&#x2021;4XHPDFDORUtDVVLQHVIXHU]RV





*DVWRVGHHQYtR

¼

),71(6667(3 6DQGDOLDVPXMHU

â&#x201A;¬

5I%&$8;; 'LVSRQLEOHHQWDOODV =DSDWLOODVKRPEUH

â&#x201A;¬



5I%:=;; 'LVSRQLEOHHQWDOODV =DSDWLOODV%ODQFDVPXMHU

â&#x201A;¬

5I%90;; 'LVSRQLEOHHQWDOODV =DSDWLOODV1HJUDVPXMHU

â&#x201A;¬

5I%=';; 'LVSRQLEOHHQWDOODV 9(59Ã&#x2039;'(2 ODWLHQGDHQFDVDHV

*DVWRVGHHQYtRLQFOXLGRVHQODFXRWD â&#x201A;¬  9HUFRQGLFLRQHVGH¿QDQFLDFLyQHQODFRQWUDSRUWDGD

/7&LQGG

902 10 30 10

latiendaencasa.es






5RWRUD]HU

/DVLHUUDGHORVSURIHVLRQDOHV GHOEULFRODMH

+D]WXVWDUHDVGHEULFRODMH LJXDOTXHXQSURIHVLRQDO FRQHVWDIDQWiVWLFD VLHUUDFLUFXODUGHPDQR 5RWRUD]HU8QDVLHUUD YHUViWLOGXUDGHUDSRUWiWLO \OLJHUDTXHWHSHUPLWLUi UHDOL]DUWRGRWLSRGHFRUWHVGH PDQHUDSUHFLVD\PX\VHQFLOOD 5RWRUD]HUHVXQDVLHUUDGH YDLYpQFLUFXODUGHEDQGDGH FRUWHK~PHGR\GHDUFR£WRGRHQ XQR7LHQHXQDSRWHQFLDGH: \USPHLQFOX\HWUHVGLVFRVGH FRUWHGLIHUHQWHVSDUDWUDEDMDUFRQWRGR WLSRGHPDWHULDOHV&RUWDHQKRUL]RQWDO YHUWLFDOHQOtQHDUHFWDHQIRUPDFXUYDH LQFOXVRKDFLDDUULED3RGUiVUHDOL]DUFRUWHV VXSHU¿FLDOHVPHGLDQRV\SURIXQGRVVLQGDxDU ODVXSHU¿FLHGHDSR\R<SDUDQROOHQDUWRGR HOVXHOR\ODURSDGHSROYRLQFRUSRUDXQ PDQJXLWRGHDVSLUDFLyQSDUDDVSLUDUDOD PLVPDYH]TXHVHFRUWD$GHPiVLQFOX\HGH 5(*$/2XQVHWDGLFLRQDOGHGLVFRVGH FRUWH\XQPDOHWtQSDUDWUDQVSRUWDUOR¢3RU TXpJDVWDUGLQHURHQKHUUDPLHQWDVGLIHUHQWHV \FDUDVFXDQGRWRGRORTXHQHFHVLWDVHV 5RWRUD]HU"

/RVGLVFRVGHFRUWHGH5RWRUD]HUWHSHUPLWHQFRUWDUFXDOTXLHUWLSRGHPDWHULDO

(OVHFUHWRGH5RWRUD]HU GLVFRVSDUDWRGRWLSRGHFRUWHV

5(*$/2 0DOHWtQ\GLVFRVGHFRUWHDGLFLRQDOHV

Â&#x2021;GLVFRGHVLHUUDGHDFHURHVSHFLDOSDUDFRUWDUDOXPLQLR Â&#x2021;GLVFRGHVLHUUDFRQFDUEXURGHWXQJVWHQRHVSHFLDOSDUD PDGHUD Â&#x2021;GLVFRGHFRUWHGHGLDPDQWHHVSHFLDOSDUDEDOGRVDV\JUHV $GHPiV5RWRUD]HUFRUWDPHWDOD]XOHMRVPRTXHWD SODFDVGH\HVRSOiVWLFRPiUPROSLHGUD«

6LHUUD5RWRUD]HU 6HWGLVFRVGHFRUWH 5(*$/26HWGLVFRV DGLFLRQDOHV0DOHWtQ

â&#x201A;¬

5I 3HVRVLHUUDNJ

/7&LQGG

9(59Ã&#x2039;'(2 ODWLHQGDHQFDVDHV



catalogo la tienda en casa otoño 2012  

catalogo la tienda en casa otoño 2012

Read more
Read more
Similar to
Popular now
Just for you