Page 1

Ingenjörs- och naturvetarprogr am 2017-2018

Utbildningar i teknik och naturvetenskap 2017-2018

Upptech t e k n i k f ö r e n b ät t r e vä r l d


Innehållsförteckning Välkommen till Uppsala universitet

5

Studera med ena foten i forskningen 6-7

8-9

Sveriges bästa studentstad Studera utomlands

10-11

Våra Campus, Danny Nygård

12-13

Att välja utbildning

14

Tekniskt-naturvetenskapligt basår

16

Civilingenjörsprogram Entreprenörskolan Högskoleingenjörsprogram Ämneslärarlärarutbildning

36 37-45 46

Kandidatprogram

47-63

Masterprogram

64-66

Kompletterande lärarutbildning

2

17-36

66

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p


Förändra världen och gör den bättre A

llt vi känner till förändras snabbare och snabbare för varje dag som går. Därför anpassar vi din utbildning efter hur både arbetsmarknaden och världen ser ut när du är färdig. Vi ger dig dessutom möjligheten att skapa framtidens samhälle. Teknik och naturvetenskap är en tredjedel av Uppsala universitet, men utbildningarna är bredare än så. Oavsett vilken inriktning du väljer kommer du att få tillgång till hela universitetet, samverka med andra utbildningar och träffa företag där ditt framtida jobb finns.

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

Foto: Mikael Wallerstedt

Du kan också välja att fortsätta framåt inom forskning hos oss. Vi vill ge dig en kreativ miljö där du får jobba praktiskt med verkliga, aktuella problem. Där du får använda din påhittighet och experimentera dig fram till nya lösningar. För den kunskapen kommer att vara nödvändig i den värld du ska verka i. Och göra dig oumbärlig för de företag som vill lyckas i den.

3


U

pptech (Uppsala University School of Technology) är en satsning på att utveckla och stärka den tekniska utbildningen och forskningen vid Uppsala universitet.

För dig som student innebär det att din utbildning får starkare koppling till arbetslivet, att du får prova på verkliga projekt under din utbildning, inspireras av föreläsare som jobbar på olika företag och mycket mer. Du blir helt enkelt bättre rustad för ditt framtida jobb.

Foto: Mikael Wallerstedt

Där du pluggar bedrivs också världsledande forskning. Områden där universitetet är världsledande är förnybar energi, materialvetenskap, evolutionsbiologi, fysik och livsvetenskaper. Här kan du inspireras av det senaste inom forskningen.

4

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Foto: David naylor

Uppsala universitet är Sveriges första universitet – grundat 1477. Universitetshuset byggdes på 1880-talet.

Välkommen hit, välkommen hem Uppsala är en livfull och charmig stad – bara en kort tågresa från storstadspulsen i Stockholm. Närheten till Arlanda gör det lätt att resa både i Sverige och ut i världen. Uppsala är Sveriges fjärde största stad med drygt 200 000 invånare och 40 000 studenter. Men staden har småstadskänsla och personlighet kvar. Det är exempelvis lagom stort för att ta sig överallt i staden med cykel. Den spännande blandningen mellan universitetets alla ämnen och invånarnas nationaliteter gör att det finns kultur-, musik- och uteliv för varje smak. Uppsala universitet finns också representerat i Visby – Campus Gotland, med det fullskaliga universitetets breda utbud tillsammans med den unika studiemiljön vid ett småskaligt campus. Så vem du än är och var du än kommer ifrån – här finns utrymme för alla att växa och att känna sig som hemma. Välkommen till Sveriges första universitet

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

5


Studera med ena foten i forskningen

På Uppsala universitet får du nära och värdefull kontakt med omfattande och världsledande forskning – samtidigt som du studerar. Det ger dig ett bra försprång – du blir helt enkelt förberedd för det verkliga arbetslivet. På Uppsala universitet forskar vi om allt från materialutveckling och förnybar energi, IT och bioteknik till partikelfysik.

Syre upptäckt på rekordavstånd En internationell forskargrupp inom astronomi och rymdfysik, med deltagare från Uppsala univeristet, har hittat syre längre bort i rymden än någonsin tidigare. Forskarna har med hjälp av jätteteleskopet Alma i Chile upptäckt en emissionslinje från joniserat syre i en extremt avlägsen galax. Fyndet öppnar för nya metoder för att studera galaxer i universums barndom och ger även en viktig pusselbit till den gåtfulla epok i universums historia då gasen mellan galaxerna övergick från att vara neutral till att vara joniserad.

Världens största vågkraftspark Företaget Seabased har tagit ett avgörande steg i utvecklingen mot en fullskalig vågkraftspark. Undervattens­ ställ­verket har kopplats till det ordinarie kraftnätet och anläggningen, som är lokaliserad i Sotenäs på västkusten, kommer att börja generera ström till nätet. Forskning och utveckling bedrivs i nära samarbete med forskare vid Centrum för Förnybar Elenergi­omvandling (CFE) vid Ångströmlaboratoriet, Uppsala universitet.

Genteknik med goda avsikter CRISPR, ett av de senaste årens absolut största genombrott, handlar om att enkelt, billigt och snabbt förändra arvsmassan. Cellerna kan ändras direkt i kroppen eller i ett provrör, och sedan föras tillbaka. Det är nu möjligt att studera sjukdomar bättre, och på sikt även bota ärftliga sjukdomar som cystisk fibros. CRISPR skulle också kunna användas inom jordbruket för att skydda växter och djur mot virus. Det är även möjligt att ändra organismer i forskningssyfte och för industriell produk­tion av exempelvis läkemedel och biobränslen.

6

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Revolutionerande reservdelsrecept En ny typ av implantat för benläkning med fokus på skall­­ kirurgi har utvecklats av en forskargrupp vid Ångström­ laboratoriet. Två salter av kalciumfosfat blandas ihop till en cementpasta som sedan gjuts över ett nät av titan­metall. Materialet liknar ben i sin kemiska sammansättning och har läkande egenskaper som ger bra bentillväxt. Patienternas­ ben växer ihop med materialet och blir alltså en del av implantatet.

Koldioxid i haven Forskning vid Uppsala universitet visar att 90 procent av den koldioxid vi släpper ut hamnar i haven. Jämfört med uppvärmningen i atmosfären så tar det mycket längre tid innan haven svarar på den. Det är viktigt att ha koll på interaktionen mellan haven och atmosfären när man ska göra klimatmodeller. När man började göra klimatmodeller fokuserade man mest på atmosfären, men sedan insåg man havets viktiga roll. Resultaten av forskningen används i stora globala klimatmodeller för att göra klimatscenarier, till exempel: Vad händer om det blir två eller fyra grader varmare?

Svamp i medicinskt syfte? Basidiesvamp, en tidigare okänd svampkomponent i det ytter­sta lagret av varglaven har upptäckts av uppsala­ forskare på Evolutionsbiologiskt Centrum. Lagret pake­ terar in och skyddar hela laven på samma sätt som vår hud gör och kan har potential för användning i medicinskt syfte. Många av svampens metaboliter har såväl anticancer som anti­mikrobiella och antiinflammatoriska egenskaper och har använts i folkmedicin.Varglaven, en illgrön art som inne­håller vulpinsyra, återfinns bara i norra Dalarna och Härjedalen­i Sverige.

Datorerna agerar på egen hand Vid institutionen för informationsteknologi vid Uppsala univer­ sitet tar forskningen om maskininlärning stora kliv framåt. Maskininlärning handlar om att lära datorer resonera och agera utifrån data, utan direkt mänsklig inblandning. Algoritmer kommer att själva kunna bygga modeller utifrån data insamlad från exempelvis kameror och sensorer. Modellerna kan sen användas av maskiner för att fatta beslut. Forskarna bygger nu ett specialskrivet programmeringsspråk där man kommer att kunna skilja på modeller och algoritmer på ett sätt som tidigare inte varit möjligt inom maskininlärning.

Läs mer om vår forskning: www.teknat.uu.se/forskning/

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

7


Uppsalas 13 nationer överträffar det mesta Studentlivet i Uppsala överträffar det mesta. Vill du också uppleva Uppsalas unika studentliv? Kom hit på sista april och få ett smakprov.

Foto: Mikael Wallerstedt

Cyklister i frack och långklänning på väg till bal samsas med männi­ skor på väg till klubbar och pubar. Det finns ungefär 40 000 studenter i Uppsala. Varje höst och vår anländer flera tusen nya studenter och oavsett om du är nykomling eller ej är det lätt att smälta in.

Nationerna erbjuder: • Bibliotek och datorsalar Studera och låna din kurslitteratur på nation. • Bostäder I Uppsala står nationerna för nästan 40% av Uppsalas studentbostäder, ofta centralt belägna. • Stipendier för miljontals kronor delas varje år ut till nationsmedlemmar. • Jobbmöjligheter finns på alla nationer; dryga ut din kassa, ha roligt och lär dig något nytt. • Restaurang och café finns på många nationer till studentpriser. • Nöjen som pub, restaurang och klubbar anordnas av nationerna. Koppla bort studierna emellanåt och umgås ute med dina kompisar. • Hjälp Ibland är inte studietiden bara rolig, nationen kan fungera som ditt stöd. • Nätverk som det ofta talas om, skapas när du träffar studenter med olika bakgrund och studieinriktning. Det är många som fått jobb genom sina gamla nationskontakter. 8

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Här blir studentlivet roligare Väljer du att plugga i Uppsala kommer du att märka att Uppsala är studentstaden framför andra.Var du än går träffar du studenter. Uppsala utsågs 2015 till Årets studentstad – en utmärkelse som vi borde få varje år om man frågar våra studenter. Välkomstveckor När du börjar din utbildning i augusti får du möjlighet att delta på välkomstveckorna. Då lär du känna dina klasskamrater, din nya stad och studentlivet. Aktiviteterna är frivilliga och arrangeras av Uppsala teknolog- och naturvetarkår. Du får också möjlighet att repetera dina mattekunskaper inför studiestarten. Ditt andra vardagsrum Att växa och få insikt om sig själv och andra är till stor del vad student­ livet går ut på. I Uppsala utgör de 13 student­ nationerna självklara mötesplatser kring vilka en stor del av Uppsalas studentliv kretsar. Nationshusen, några med anor från 1600-talet, har olika karaktär, historia, egna traditioner och ligger centralt i Uppsala och har allt från 500 till 8 000 medlemmar. Du väljer fritt vilken eller vilka nationer

du vill tillhöra. Är du medlem i en nation är alla nationer öppna för dig. Nationerna kan sägas vara en sorts tillhörighet baserat på vilken landsdel man kommer från där Smålands nation är den syd­ ligaste och nordligast är Norrlands nation. Alla nationer erbjuder ett brett utbud av aktiviteter som gör din studietid oförglömlig. På nationerna finns pubar, caféer, restauranger, teater, musik och idrottsverksamhet samt mer än 100 olika intresseföreningar. Här arrangeras också mängder av speciella tillställningar som standup­kvällar, baler, damsupéer/herrmiddagar samt nationsspecifika aktiviteter eller temafester. Nationerna är unika mötesplatser där man umgås över program- och ämnes­gränserna, har roligt, engagerar sig, bygger värdefulla kontaktnät och nya vänskaper men också ett ställe att sitta och studera på. På Campus Gotland är studentkåren Rindi centrum för alla aktiviteter och nöjen för alla studenter på Gotland.

Forsränningen. Den sista april varje år försöker studenter med hjälp av egenbyggda, mer eller mindre bräckliga, cellplastflottar ta sig ner för Fyrisån. Drygt 450 rännare brukar delta, och cirka 40 000 åskådare ser på. Universitets rektor delar ut pris till bland annat "Bästa publikfrieri" och "Bästa ingenjörsmässiga flotte".

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

9


Börja i Uppsala – nå hela världen

Om du vill plugga utomlands en del av din utbildning ska du läsa vid Uppsala universitet. Vi har studentutbytesavtal med över 400 universitet i i hela världen och kan erbjuda utbytes­studier på alla kontinenter förutom Antarktis. Du kan till exempel studera i Sydafrika,­Australien, USA, Singapore, Spanien,­Kina, Japan, Brasilien och även Svalbard.

Un der utbytesåret i Taipei passade ITstudenten Marcus bes tiga Qilaishan – Windmarks på att en av Taiwans öve r hun dra bergstopp ar över 30 00 meter .

ja n a, ie n, Ljubl r i Slo ve n bete in om va i it L e on gs ar sätt hon ente n Sam göra et t forsk n in rld en på Kemis tud t täck te vä rutom at p fö up h on h oc nt d är i, reste ru ra . elek trok em e at t hon sk ulle gö d od tr g aldri

”Örtapoteket” på marknaden var nästan som en godis­butik för Anders Rydberg när han var i Marrakech och samlade in material för DNA ”barcoding” av läkemedelsväxter.

Beatrice a Ing rid Sjödell och Geo vetars tud entern djupad e för per ska kun die m stu Jäg erup fick för uto rde sitt gjo de när et kök lien ska kun skaper i det ita utbytesår i Ne apel.

Tillsamman s med nyfunn a vänner och so Team Explor m en del av er s ut forskade Robin Eklin d skogar och ca ögrupper, urféer un der sit t utbytesår til l Portsmouth .

nar en del på Nya Zeelan d läm sig från Bussförbindelserna vanligt sät t att ta ett är a lift Att att önska. mendera s enligt om rek den fär på d A till B. Chokla tima. nten Jen s Roat Kul bioinformatikstude s format sin egen Jen har t site ver Genom Uppsala uni n och USA. a, Skottland, Bra silie profil­utbildning i Kin

10

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Angelica Klaussen gjor de sitt Mas ter of Science projekt i Mombasa, Ken ya. Hen nes arbete han dlade om korall­reven och fråg an om korallätan de fisk ar kan min ska åter väx ten av koraller.

couver, än n a r i Van k tbyteså ssiv fick han u å p e kt ma n sson å untain s berg a . h a o r J a v o Fredrik is tler M sår k an a. I Wh r t et t utbyte K a n ad a b r e d un på hur

Vid sidan av studierna var orientering och vandring ett stående inslag på schemat under Petra Olanders studentutbyte i Kanada.

inte ndell kunde r han ten Jona s Sa l kimon o nä Kemistuden el on iti ad tr a ov pr t at å un dg var i Japan.

Sofie Gunn ar gjorde examensarbetet i Chi le. Hon undersökte förut­sättnin gar för att bygga ett småsk alig t vat ten­kraf tve rk.

Biologistudenten Elham Sadeghayobi var på Galapagos. Hennes studie gick ut på att ta reda på tarmpassage­tiden hos jättesköld­paddorna för att få information om deras roll som fröspridare.

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

Foto: Dreamstime

n om de iväg ho far tvin ga doktorera t n n és svär at Li r n fö vo d l Car Hollan så sn abbt ss tudier i t bli färdig på utlan d såg till at hän ge sig få an H . de n in ic ku n i med . at t han se et så liv t i lig n öj io som m liga pa ss et t – sin verk dock vara g si åt vä xter de sa ån ga telsen vi an kn öt m Utlan d svis rriären . H stark ka en r fö de ft h ha riktig t ly ntak ter oc m ko ko n la el ha n n är intern atio n dlin gen lön eför ha e. position i ig m till Sver tillbak a he

11


Här studerar du Uppsala universitet är stort och utspritt på flera campusområden. Ett campus är ett område med forskning och utbildning inom ett eller flera ämnen. På campus hittar du bland annat studentservice, läsplatser och bibliotek.

UTN

Informationsteknologiskt centrum

Campus Gotland

Informationsteknologiskt centrum

Campus Gotland

På Campus Gotland i Visby finns i dagsläget 18 institutioner och samtliga vetenskaps­ områden är representerade. Här bedrivs högskoleingenjörsutbildningen i Kvalitets­ utveckling & ledarskap, kandidatprogrammen Kvalitet – ledarskap – förbättring och Miljövetenskap samt magisterprogrammet Vindkraftprojektering.

I de gamla regements­byggnaderna samlas datavetare och informations­­teknologer. Forskning och forskarutbildning bedrivs inom allt från mång­dimen­sionella problem till tekniska tillämpningar inom regler- och programvaruteknik. Tillsammans med Ångström­ laboratoriet kallas området för Polacksbacken.

Evolutionsbiologiskt centrum, EBC

Vid EBC finns en stor del av Uppsala universitets forskning och utbildning i biologi. Forskningen är till stor del baserad på genetik och riktar sig mot förståelsen av det evolutionära ursprunget till organismernas egenskaper.

biomedicinskt centrum, BMC

På BMC bedrivs forskning och undervisning inom ibland annat kemi och mole­kylär­biologi. Det är ett av Europas största centra för livs­vetenskaper. Här finns en stark koncentration av forskare inom kemi, struktur­biologi, fysiologi och olika farmaceut­iska discipliner, vilket ger unika förut­sättningar för utveckling av nya läkemedel.

geocentrum

Här läser du till civilingenjör inom miljö- och vattenteknik, geovetare samt meteorolog. På Geocentrum bedrivs forskning och undervisning inom ämnen som natur­resurser, miljörisker, naturkatastrofer, klimat, energisystem, evolution och hållbar utveckling.

12

Ångströmlaboratoriet

Ångströmlaboratoriet, en del av Polacksbacken, är ett av Europas mest avan­cer­ade laboratorier för forskning och utbildning inom energi och material. Här pluggar du som blivande civil- och högskoleingenjör eller fysiker, matematiker och kemist.

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p


Det var examensarbetet som öppnade dörren till drömjobbet på Zetterbergs Industri för Danny Nygård. Anställningen fixade han bokstavligen på en kafferast. – Det blev inget stort kliv ut i arbetslivet, i princip bara några korta steg in till chefens kontor eftersom jag redan satt i huset, skrattar han. Här på verkstadsföretaget Zetterbergs i Östervåla norr om Uppsala hamnade Danny efter att ha sökt exjobb sista terminen på högskoleingenjörsprogrammet i maskinteknik. – Jag blev erbjuden ett uppdrag de själva inte hade tid för: att utveckla en kombidumper för lastbilar, säger Danny. För att ha tillgång till ritningar, produktion och all praktisk kunskap föll det sig naturligt att han satt på Zetterbergs. Han blev en i arbetsgänget och rörde sig på företaget som vilken anställd som helst. Men som

Efter att Danny tagit examen följde några period­ anställningar på Zetterbergs innan han blev tills­ vidareanställd. – Jag fortsatte rätt och slätt mitt exjobb och var med när kombidumpern gick i produktion. Jag hade ju lite hållhake på Zetterbergs eftersom det var jag som kunde den här konstruktionen, så då kunde de ju inte avskeda mig, skrattar Danny. Försäljningen av kombidumpern har tagit fart och säljer bra, framförallt till Norge. Nyligen kom ytterligare ett bevis på hans ingenjörstalanger: Danny till­ delades Sveriges Ingenjörers Wimanska pris.

FAKTA

I sitt examensarbete har Danny Nygård gjort en påbyggnad för lastbilar som gör det möjligt att antingen utrusta lastbilen med en dumperbehållare eller koppla på en trailer. Den här kombidumpern kan användas för flera olika ändamål och spar på så sätt såväl resurser som miljö.

Foto: Mats Kamsten

Examens­ arbetet gav jobb

exjobbare ansvarade han själv för att göra en plan för sitt arbete, något han var tacksam att ha fått lära sig under studierna. – Man kan lugnt säga att själva arbetssättet eller metodiken, den hade man ju inte alls rott iland utan utbildningen. Det handlar ju om att göra upp en plan, hitta förutsättningar och sätta upp mål. En annan betydelsefull erfarenhet var CAD-programmet Solid Works, ett digitalt baserat designprogram som Zetterbergs också använde. Och att omsätta ritningarna i praktiken hade Danny fått pröva på i verkstaden på Ångströmlaboratoriet. – Där svetsade jag och skar i stål och plåt precis som man gör på Zetterbergs. Jag fick respekt för hur yrkesskickligt folk det är som gör det jobbet, och att man som konstruktör måste kunna vända och vrida på utformningen för att hitta den smartaste lösningen.

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp

13


Här hamnar du rätt

Var hittar jag information om kurserna i mitt program? Hur registrerar jag mig för en tenta? Vad kan jag få för jobb efter mina studier? Som ny student har man ofta tusen frågor. Hos Studentservice hittar du svaren.

E

n av dem som lotsar nya och befintliga studenter rätt är studievägledare Sara Rosenquist på Studentservice. Förutom att ansvara för civilingenjörsprogrammet i informationsteknologi och teknisk fysik med materialvetenskap är hon operativ samordnare för studievägledarnätverket inom teknik och naturvetenskap. Vad är Studentservice? – Det är en speciell supportfunktion för studenter vid teknisk-naturvetenskapliga fakulteten, utöver den studentservice som finns för hela universitetet. På Studentservice jobbar ungefär 20 studievägledare med högskole-, civilingenjörs, och kandidatprogrammen inom fakulteten. Dels har vi student­servicediskar på alla campus, dels finns vår studentwebb, www.teknat.uu.se/student. Där hittar du bland annat kontaktuppgifter till alla studievägledare där du kan boka tid hos en studievägledare eller bara komma förbi under en tid då det är drop-in. Kan jag få hjälp innan jag sökt en utbildning? – Många av de studenter som funderar på att läsa en utbildning inom teknik och naturvetenskap tar kontakt med oss studievägledare för att bland annat undersöka karriärmöjligheter efter ett visst program eller hur programmen är utformade och vilka kurser man läser. Dessutom har vi en administrativ service där du kan få hjälp med exempelvis bedömning och tillgodogörande av kurser du läst på annan ort. Då är det bra om du tar kontakt med oss i god tid före sista ansökningsdatum. Här samlar vi in olika slags material och ser till att det kommer till rätt personer på

14

exempelvis kurskanslier, antagnings- eller examensenheten – vi är något av spindlarna i nätet! Vad kan jag få hjälp med när jag blivit antagen och börjat plugga? – I samband med den studentmottagning som Uppsala teknolog- och naturvetarkår, UTN, anordnar, hjälper vi från Studentservice till med schemaläggning, lokalfrågor och ser till att allting flyter på. Från och med den första studieveckan möter du oss också vid de informationsträffar som varje program håller. Då får du som ny student bland annat veta vad du kan förvänta sig av dina studier, vilka undervisningsformer som finns, hur en tenta funkar, vilka finansieringsstöd du kan få från CSN, och vilka skyldigheter och rättigheter du har. De här riktlinjerna är ju viktiga eftersom det handlar om din arbetsmiljö som student. – Bra att känna till är att vi har speciell service för studenter med särskilda behov. En av våra studievägledare hjälper studenter som kanske behöver anteckningsstöd, förlängd skrivtid med mera. Tar man kontakt med studievägledaren tidigt har man bättre chans att klara sina studier bra redan från början. – Något som är viktigt är att redan tidigt börja tänka på det här med karriär och yrkesval. Vi hoppas att studenter tar chansen att få hjälp av vår individuella studie- och karriärvägledning. Hos oss kan man prata om sin utbildning och vilka drömmar och förväntningar man har på framtiden och sitt yrkesliv. Det involverar också en del jobb med självkännedom: vilka kompetenser och kunskaper har jag och i vilken roll skulle jag kunna använda dem i fram­ tiden? Sådant borde alla ta sig tid att reflektera över – det är väldigt nyttigt!

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

Under ditt första studieår finns det tillgång till hjälp med allt från praktiska ärenden till studie­teknik. Skulle du upptäcka att du gjort ett val som inte visar sig passa dig finns det möjlig­ heter till programbyte. Studie­väg­­led­ningen­  på universitetet är till för att ge dig råd och hjälp. Ett tips är att kontakta studievägledarna­ redan idag om du har frågor.­

www.teknat.uu.se/student


Välj din utbildning

Foto: Mikael Wallerstedt

För att underlätta ditt val av utbildning ger vi en överblick över de olika program­ typerna civil­ingenjörs-, högskole­ingenjörs-, kandidatoch master­program inför varje avsnitt.

Civilingenjörsprogram

Högskoleingenjörsprogram

Kandidat- och masterprogram

sid 17-35

sid 37-45

sid 47-66

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

15


Tekni skt nat urvet enska p li g t

B asår /Bastermin

40/20 vecko r

Tekniskt-naturvetenskapligt basår finns för digsom vill studera teknik och naturvetenskap men saknar behörigheten. Efter avklarad basårs‑utbildning har du en reserverad plats för fortsatta studier inom en program­ ‑inriktning vid Uppsala universitet.

N

är du läser vid Uppsala universitets basår får du en kompletterad behörighet och en bra förberedelse inför dina fortsatta universitetsstudier. Du studerar vid Ångströmlaboratoriet och i andra universitetsmiljöer i Uppsala, precis som studenterna på tekniska och naturvetenskapliga utbildningsprogram. På så sätt kan du lätt få den information du behöver för att genomföra din framtida utbildning på bästa sätt. Undervisningen följer skolverkets kursplaner i respektive ämne men ska också visa den bredd av olika undervisningsformer som förekommer vid universitetet. Delar av basårets undervisning är obligatorisk. Samtidigt som du söker till basårsutbildningen väljer du också vilken typ av utbildningsprogram som du tänker fortsätta med efteråt. De inriktningar där du kan få en reserverad plats är: • Civilingenjörsprogram, 300 hp • Högskoleingenjörsprogram, 180 hp • Kandidatprogram i naturvetenskapliga ämnen, 180 hp

Utförlig information för att bli antagen för en reserverad plats för de olika inriktningarna och sista anmälningsdatum kan du läsa om på websidan: www.uu.se/utbildning

16

• Ämneslärarprogrammet med inriktning mot arbete i gymnasieskolan, inriktning matematik eller naturvetenskapliga inriktningar, 330 hp Vilka kurser du läser under utbildningen beror på vilken typ av program du tänker studera vidare på och vilka kurser du har läst tidigare. Om du fullföljer basåret har du en reserverad plats på ett utbildningsprogram inom den inrikt-

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

ning du valt nästföljande hösttermin förutsatt att du söker det i tid. Eftersom basåret är förberedande studier söker du särskilda studiemedel för behörighetsgivande studier under din tid på basåret. Dessa studier räknas alltså inte av från de veckor man kan söka studiemedel för studier på högskolenivå. Av samma anledning ger basårsstudierna inte akademiska högskolepoäng (hp). Som basårsstudent kan du också naturligt ta del av studentlivet med nationer och olika föreningar. Teknisk-naturvetenskaplig basår Basårets kurser följer kurserna i Matematik, Fysik, Biologi och Kemi på gymnasieskolans naturvetenskapliga program. För att erhålla reserverad plats efter basårs­ utbildningen krävs för samtliga inriktningar att du läst delkurserna Matematik 3c, Fysik 1b1, 1b2 och Kemi 1 antingen vid basåret eller under dina tidigare gymnasiestudier. Examination sker i slutet av varje kurs samt i förekommande fall löpande under terminen. Basåret läser vårterminens kurser tillsammans med studenterna som går basterminen. Teknisk-naturvetenskaplig bastermin Om du endast saknar någon eller några av påbyggnadskurserna Matematik 4, Fysik 2, Kemi 2 och Biologi 2 kan du söka till basterminsutbildningen som ges under vårterminen. Basterminen är en behörighetsgivande förutbildning och ger ingen examen. När du läser Uppsala­universitets bastermin får du en kompletterad behörighet och en bra förberedelse inför dina fortsatta universitetsstudier. Basterminen har reserverade platser på civil­ ingenjörsprogram, högskoleingenjörsprogram natur­ vetenskapliga kandidatprogram. För att erhålla din reserverade plats efter basterminen måste du läsa de kurser som krävs för behörighet till det efterföljande programmet.


Civiling enjör s prog r am

M

ed titeln civilingenjör i ditt CV öppnas stora möjligheter för dig att själv välja vad du vill arbeta med, i Sverige eller utomlands. Civilingenjörer kan arbeta i många olika roller som till exempel projektledare, utvecklare eller forskare.

Civilingenjörs­program 300 hp

Kvalificerad teknisk ut­bildning som vilar på en naturvetenskaplig grund. Inriktade mot ett arbetsområde snarare än ett specifikt yrke.

Programmen är inriktade mot ett arbetsområde snarare än ett nischat yrke. Vare sig du vill arbeta med utveckling av nya material, informationsteknologi, miljövänlig energianvändning eller samspelet mellan samhälle och teknik finns det olika inriktningar att välja mellan.

Du följer en bunden studie­plan de 2-3 första åren. Där­efter finns det möjlighet att välja inriktning.

Med en civilingenjörsutbildning från Uppsala universitet får du en kombination av kunskaper med både bredd och djup. Den ger dig också kunskaper med lång hållbarhet inom områden som förändras i snabb

Du läser 2-4 kurser samtidigt. Kurserna­ är av varierande längd. Avslutas med ett examens­arbete om 30 hp.

takt. Du får lära dig att snabbt sätta dig in i nya tankesätt och tekniker. Samtidigt får du smakprov på olika områden för att du ska hitta det du tycker är mest intressant. Mot slutet av utbildningen kan du specialisera dig mot ditt intresse. Under utbildningstiden kan du studera en eller flera terminer utomlands

Ger dig teknisk överblick och kunskap att applicera och utveckla ny teknik inom ditt område. Du kan arbeta självständigt och i grupp med teknisk utveckling och forskning på företag och inom universitets­världen.

på något av de 500 universitet i världen som vi har utbyte med. Det finns också möjlighet att läsa det avslutande året inom Entreprenörskolan (sid 36).

 U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

17


Foto: Fortum

Intelligent energihantering & energibesparande teknik

Marielle Hagström är systemingenjör på ABB i Ludvika – Jag läste elektroteknik med inriktning elkraft och gjorde examensjobbet här vilket sedermera ledde till anställning. Jag arbetar med elektrisk systemdesign och bland uppgifterna så jobbar jag i olika projekt världen över från hopkoppling av nät i Europa, långa transmissioner i Nordamerika till havsbaserad vindkraft i Australien. – Civilingenjörsprogrammet i elektroteknik ger en väldigt bra förberedelse inför arbetslivet med en bra teknisk grund och de engagerade och kunniga lärarna på programmet bidrar till stor del av sitt eget engagemang och vilja. – Mitt engagemang i studentlivet har bidragit stort till min personliga utveckling och jag tror det är väldigt viktigt att ha ett socialt liv vid sidan av studierna. – Med utbildningen ges man en möjlighet att vara med och skapa ett hållbart samhälle med förnyelsebar energi och där alla kan få tillgång till el. Jag ser ljust på framtiden för elektroingenjörer speciellt inom elkraft.

18

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


elektroteknik Att förnya och bygga ut Sveriges­elkraftnät är viktiga ochutvecklande uppgifter, bland annat för att i framtiden kunna ersätta fossila bränslen med förnybara energikällor. Din förmåga som ingenjör att konstruera och utveckla nya tekniska produkter och system har stor inverkan på klimatfrågan och även Sveriges ekonomi. Det gör att det finns ett växande behov av civil­ingenjörer med bred och djup kompetens i elektroteknik både i Sverige och utomlands.

E

ett. Kurserna och delar av kurslitteraturen är på svenska under dessa år men det förekommer föreläsningar, artiklar och ett flertal kursböcker på engelska. Under de avslutande två åren läser du kurser på avancerad nivå och utvecklar då din förmåga att göra självständiga analyser, bedömningar och design­beslut. Då hålls flera kurser på engelska och kurslitteraturen är normalt på engelska. Programmets näringslivsanknytning med till exempel ABB, Vattenfall, Fortum via studiebesök, fältlaborationer och projektuppgifter ger en tydlig koppling till möjliga arbetsgivare. Upplägg Under årskurs ett läser du ett stort kursblock i elektroteknikens grunder samt matematik och beräkningsvetenskap. Under årskurs två och tre bygger du upp en gedigen grund inom elektronik, elkraftteknik samt systemteknik, samtidigt som du läser mera matematik, mekanik, programmering, CAD samt företagsekonomi. Under de två avslutande åren kan du välja mellan att ytterligare bredda din kompetens eller fördjupa dig i ett smalare område inom elektroteknik beroende på intresse­ område. Du har möjlighet att inrikta dig mot antingen förnybar elgenerering eller elektriska styr­system, samtidigt som du fördjupar dina kunskaper i fysik och elektronik. Som avslutning på programmet gör du den sista terminen ett examensarbete på 30 högskolepoäng (hp). Därigenom får du chans att direkt knyta viktig kontakt med en möjlig framtida arbetsgivare.

Programmet har stark anknytning till den världsledande forskningen som bedrivs på Ångströmlaboratoriet.

lnätets betydelse som energieffektiv och miljövänlig energibärare i kombination med det växande behovet av modern infrastruktur för el gör att efterfrågan på kvalificerade elektroingenjörer ökar stort. Dagens komplexa elkraftssystem skapar samberoende och därmed större sårbarhet. Det behövs enorma investeringar i de europeiska eloch kraftnäten för att ta hand om och distribuera energin från vindkraft, solpaneler, vatten och vågkraft. Dagens el- och kraftnät är inte konstruerade för hantera så stora mängder energi från de förnybara kraftkällorna. För att minimera miljöpåverkan från tung processindustri, till exempel pappersbruk, behövs avancerade mät, styr och reglersystem. Det krävs därför moderna styrsystem och energibesparande apparater för att få ett eko­logiskt hållbart samhälle. Behovet av kunskaper inom elektroteknik är brett och introduktionen av elbilar är ett nytt område där behovet av elektroingenjörer ökar. På civilingenjörsprogrammet i elektroteknik i Uppsala får du de färdigheter som krävs för att kunna arbeta som elektroingenjör. Om programmet Utbildningen ger dig breda tekniska kunskaper men hjälper dig också att bli bättre på att kommunicera, sam­arbeta och tänka kreativt. Du får kontakter med näringslivet och får vara med i frontlinjen när du följer Uppsala universitets unika spetsforskning inom den förnybara elenergiproduktionen som bidrar till utvecklingen av ny svensk industri. Om undervisningen Kärnkurserna i elektroteknik under de inledande tre åren ger dig såväl gedigna och breda grundkunskaper som direkt til�lämpbara färdigheter. Projektarbeten knutna till dessa kurser är viktiga moment redan från årskurs

Elektroteknik

Civilingenjörsprogram 300 hp

Årskurs 1 Elektroteknikens grunder Projekt i elektroteknik Matematik Beräkningsvetenskap

 25 hp 15 hp 15 hp 5 hp

Årskurs 2 Elektronik (projekt 5 hp) Matematik Mekanik Elkraftteknik CAD med FEM Programmering

20 hp 5 hp 5 hp 20 hp 5 hp 5 hp

Årskurs 3 Systemteknik Matematik Programmering Företagsekonomi Självständigt arbete Fysik

10 hp 20 hp 5 hp 5 hp 15 hp 5 hp

Årskurs 4-5 Inriktningsspecifika kurser Fysik Kraftelektronik Examensarbete

70 hp 10 hp 10 hp 30 hp

Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen vilket är en yrkesexamen.

Studera utomlands Det finns möjlighet att under de avslutande åren tillbringa en termin eller ett helt läsår utomlands. Karriär Civilingenjörer i elektro­ teknik behövs för arbete med utveckling, konstruktion och verifiering av elektrotekniska system inom olika om­råden. Allt fler produkter och system innehåller idag intelligens i form av elektroniska styr­ system. Vår framtida energiförsörjning är ett viktigt område där elektroingenjörer kan jobba med allt från att producera elkraft till intelligent styrning av såväl energiproduktion som förbrukning. Efter examen är du behörig att söka utbildning på forskarnivå inom alla delområden av elektroteknik, vid Uppsala universitet till exempel inom elektricitetslära, signalbehandling och reglerteknik. Programmet har stark anknytning till den världs­ledande forskningen som bedrivs på Ångströmlaboratoriet inom elektrisk energigenerering och elektriska drivsystem.

Jonathan Toft:

”Vill jobba med styrsystem. Läste först i Lund. Startat upp en studentsektion för programmet.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

19


Foto: Shutterstock

Helhetssyn & framtidsvisioner

Johan Hollsten, produktchef, ABB – Om man känner att energi och fysik är av intresse så är Civilingenjörsprogrammet i energisystem ett bra program. Energisystem är konkret, till skillnad från vissa andra program där det kan vara svårare att ta på vad man blir. – Energifrågan är aktuell och programmet handlar inte bara om teknik utan också om samhället och hur det påverkas av olika energilösningar. Det finns mycket jobb inom sektorn och om vi dessutom ska fasa ut kärnkraften behöver branschen ännu fler ingenjörer. – Om man är intresserad av energibranschen är Civilingenjörsprogrammet i energisystem det bästa programmet oavsett om man vill jobba på ABB, Vattenfall eller mindre företag. Branschen skriker efter ingenjörer med den inriktningen.

20

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


energisystem Energi- och klimatfrågor är idag mycket aktuella och samhället står inför ett stort behov av att förändra energiförsörjningen. Civilingenjörsprogrammet i energisystem, som ges gemensamt av Uppsala universitet och SLU, Sveriges­lantbruks­ universitet, är till för dig som vill vara med och utveckla framtidens energiförsörjning och skapa möjligheter för en hållbar utveckling.

samarbete med kommun eller företag. Examensarbetena i årskurs fem görs ofta i samarbete med näringslivet. Programmet ges i Uppsala. Studera utomlands Du har goda möjligheter att förlägga en del av studierna utomlands. Du kan välja att läsa kurser inom energi­området eller andra ämnen. Du har även möjlighet att genomföra ett projekt utomlands, till exempel som ett minor field study (MFS) i något utvecklingsland.

Upplägg I årskurs ett och två får du goda kunskaper i fysik, kemi, biologi, matematik och data­ Det som gör programmet i energi­ vetenskap som krävs för att ta n av vår tids största ut­­ system unikt är tillgången till SLU:s fram ny energieffektiv och klimaningar är att utveckla och Uppsala universitets forskning matsmart teknik. ett hållbart energisystem med möjlighet till fördjupning inom Du läser energitekniska kurmed hänsyn till hela provind-, våg-, kärn- och vatten­kraft samt bioenergi och solenergi. serna under årskurs två, tre, fyra cessen från utvinning av råvara till och fem. Du får då möjlighet till användningen av energin. Dagens fördjupning inom valfria energitekniker som till energisystem bidrar till miljöförstöring och tär på exempel, vind-, våg-, kärn- och vattenkraft, samt våra naturresurser. Det är därför nödvändigt att bio­ energi, solenergi, elnät och energieffektiviseenergisystemen utvecklas och förändras. ring. I många av dessa kurser studerar du processer Som student på civilingenjörsprogrammet i som behövs för effektivare elproduktion. I kurser energisystem i Uppsala får du kunskap om hållbar om systemanalys och reglerteknik får du redskap användning av energi, både ur tekniskt och samför modellering och optimering av energisystem. hällsinriktat perspektiv. Du läser även kurser i samhällsvetenskap som Det som gör programmet i energisystem unikt till exempel ekonomi, ledarskap och etik. Dessär närheten till SLU:s forskning inom till exemutom, som en röd tråd genom hela utbildningen, pel systemanalys och bioenergi och Uppsala unifördjupar du dina kunskaper och färdigheter att versitets forskning inom områden som vindkraft, anlysera energisystemet. vågkraft, solenergi, elkraft, energieffektivisering, vattenkraft och kärnkraft. På programmet får du Karriär Energifrågorna är idag en av sam­hällets ta del av den samlade kunskap som finns på båda viktigaste frågor och behovet av en hållbar energidessa universitet och du får därför en helhetssyn användning ökar. Efterfrågan på ny­utbildade inom på energi­frågorna. energiområdet väntas öka de närmaste åren. Näringsliv och myndigheter behöver per­soner Om undervisningen Du läser två eller tre kursom kan möta utmaningar inom många olika ser parallellt. Ett betydande inslag i utbildningen om­råden. Det kan gälla förnybara energitekniker är studiebesök på verksamheter runt om i landet. eller hur energi utnyttjas på bästa möjliga sätt i Du har möjlighet att genomföra projektarbete byggnader. Det kan också handla om förnyelse av utomlands. hela energisystem. En stor del av kurslitteraturen är på engelska. I Efter examen kommer du att till exempel flera kurser finns alternativa examinationsformer kunna arbeta som konsult, projektledare, energisom laborationer, projektarbeten och seminarier. ansvarig eller fortsätta med forskarstudier. I slutet av årskurs 3 gör du,tillsammans med en projektgrupp, ett större självständigt arbete i

E

Energisystem

Civilingenjörsprogram 300 hp

Årskurs 1 Introduktion till energisystem gästföreläsningar och studiebesök Matematik och datavetenskap Kemi Fysik/mekanik

10 hp 30 hp 10 hp 10 hp

Årskurs 2 Energisystem gästföreläsningar och studiebesök Matematik och datavetenskap

5 hp 10 hp

Fysik 25 hp mekanik, ellära, termodynamik, strömningslära Biologi och geovetenskap 10 hp Organisk kemi 5 hp Energiteknik 5 hp

Årskurs 3 Energi och miljö 15 hp Matematik och reglerteknik 15 hp Energiteknik/fysik 15 hp förbränning och värmeteknik, elkraft, kvantfysik Självständigt arbete 15 hp

Årskurs 4-5 Obligatoriska valbara kurser: Samhällsvetenskap och humaniora (ekonomi, ledarskap och organisation, socioteknik, miljörätt och etik) Valbara kurser: • Energi - teknik och system (vatten-, vind-, våg- och kärnkraft, sol- och bioenergi, energieffektivisering, elkraft) • Energisystem och miljö (energisystemplanering, energisäkerhet, miljökonsekvensbeskrivning, batterier och lagring, logistik, empirisk modellering, riskanalys) • Samhällsvetenskap och humaniora (energihandel, ledarskap och organisation, socioteknik, miljörätt och etik) • Företagsekonomi • Examensarbete, 30 hp Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civil­ ingenjörsexamen med inriktning energisystem vilket är en yrkesexamen.

Nils Jonsson Forsblad:

”Kul att studera vid två universitet. Intressant med solenergi, det händer så mycket där. Programmet så brett att man kan hamna var som helst.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

21


Foto: Foto: SAAB Group/Peter Karlsson

Spindeln i nätet & problemlösare

Murat Sabotic är systemutvecklare (lead frontend devoloper) på Visual Art – Jobbet fick jag när en headhunter övertalade mig att byta jobb. Som systemutvecklare jobbar jag främst med fokus på det visuella i en applikation samtidigt som jag är ”mentor” för våra nya systemutvecklare. Vi har Sveriges största nätverk av digitala reklamplatser (DOOH – Digital Out Of Home), ett område som växer och som kommer kräva flera duktiga IT-innovatörer och kreatörer framöver. – Civilingenjörsprogrammet i informationsteknologi ger en bra grund för att komma ut till ITmarknaden med en baskunskap som krävs för att bli systemutvecklare, projektledare, testare, testledare, produktägare m fl. Listan kan göras lång. Sen examen för 7 år sen har jag jobbat som projektledare, systemutvecklare, systemarkitekt, utvecklingsansvarig, agile coach mfl. Digitaliseringen växer hela tiden och systemutvecklare är väldigt eftertraktade. Med en utbildning i informationsteknologi är du redo att möta den heta IT-marknaden helt enkelt.

22

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


informationsteknologi IT genomsyrar människors arbete och fritid. Vill du förstå hur informationsteknologi ­fungerar, påverka utvecklingen och skapa morgondagens teknik? Som civilingenjör från IT-programmet i Uppsala kan du jobba med uppgifter som är betydelsefulla för människor i livets alla stadier, för samhällets funktion och för företagens konkurrenskraft.

C

grammet avslutas med större til�lämpade projekt över en hel eller halv termin. Du arbetar självständigt och kreativt i en internationellt präglad miljö. Programmet ges i Uppsala. Kurslitteraturen är mestadels på engelska och i de högre årskurserna är undervisningen ofta på engelska.

Hur bygger man datorsystem med

Studera utomlands Du kan läsa vissa delar av utbildningen utomlands via programmets egna utbyten eller genom universitetets allmänna utbytesprogram. Programmet har till exempel utbyten med universitet i Berlin, Lyon, Madrid, Shanghai, Seoul, Torino och Zürich. Utlandsstudier sker oftast i slutet av utbildningen.

ivilingenjörsprogramhöga krav på tillförlit­lighet i flyg, tåg, bilar, robotar eller medicinsk met i informationstekutrustning? Hur konstrueras dator­ Upplägg De första två åren stunologi ger en hållbar system som löser morgondagens derar du huvud­sakligen programutbildning med kunskaproblem? Hur får man datorer och mering, datorsystemskonstruktion, per som räcker länge. Människor, program att räkna snabbt och rätt? Hur designar­man system som är matematik och elektronik. Därefmatematik och programmering är anpassade­ efter­ användarna? ter följer mer avancerade kurser viktiga ingredienser i utbildningen. inom till exempel datornätverk, Teori och praktik, ofta i projektdistribuerade datorsystem och signalbehandling. form, ger dig helhetsperspektiv och färdigheter du De sista två åren kan du skräddarsy din utbildkan använda både för dagens och morgon­dagens ning genom att kombinera olika profileringsspår. system. Du får lära dig vad som behövs för att Du har också möjlighet att studera företags­ utveckla framtidens motsvarigheter till Google, ekonomi och entreprenörskap. Skype eller iPhone. Eller kanske utveckla proteser med inbyggda datorer eller lättanvända datorer Karriär Efter utbildningen har du mycket goda som aldrig kraschar? möjligheter att få jobb både i Sverige och utomlands. Du kan arbeta inom en mängd områden - IT Om undervisningen Undervisningen har stark behövs och används nästan överallt. Du kan till koppling till universitetets framstående forskning exempel arbeta med avancerad produktutveckinom informationsteknologi. Många av kurserna ling, kravanalys eller systemdesign - ofta i nära präglas av innovativa undervisnings- och examenssamarbete med kunder och användare. former baserade på vetenskaplig förankrad pedaMånga studenter blir konsulter, projektledare gogik. Flera av lärarna har fått pris för sin pedagoeller utvecklare på både stora och små teknikföregiska undervisning. tag. Andra väljer att starta företag, vilket det finns Kurserna genomförs ofta i projektform som möjlighet att lära sig mer om under studierna. en förberedelse för arbetslivet. Flera av projekten sker i samarbete med studenter i andra länder. Pro-

Informationsteknologi

Civilingenjörsprogram 300 hp

Årskurs 1 Datavetenskap Datorsystem Programmering Matematik

 10 hp 10 hp 20 hp 20 hp

Årskurs 2 Datavetenskap Datorsystem Programmering Matematik

10 hp 20 hp 10 hp 20 hp

Årskurs 3 Datorsystem Matematik Ekonomi Självständigt arbete

30 hp 10 hp 5 hp 15 hp

Efter tredje årets självständiga arbete finns det möjlighet att ta ut en kandidatexamen i informationsteknologi.

Årskurs 4 Profileringskurser

60 hp

Årskurs 5 Projekt och valbara kurser 30 hp Examensarbete 30 hp Under årskurs 4-5 kan du skräddarsy din egen utbildning genom att kombinera ett profileringsspår med självvalda kurser: Datorsystemutveckling - arbete med stora, distribuerade datorsystem där kommunikation, arkitektur och säkerhet är viktiga aspekter. Inbyggda system - arbete med småskaliga datorplattformar där det är viktigt med god systemförståelse. Människa, maskin och samhälle - samverkan mellan informationsteknologi, människan som använder den och samhället den används i. Programvaruteknik - inkluderar metoder och tekniker för design och utveckling av mjukvara för olika typer av IT-system och plattformar. Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen vilket är en yrkesexamen.

Mikaela Eriksson:

”Unikt studentliv. Alla väldigt sociala. Fler och fler tjejer på programmet. Arbetsmarknaden ser väldigt bra ut och speciellt tjejer är extra eftertraktade.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

23


Foto: Shutterstock

Spännande forskning & kreativa lösningar

Tobias Collin, Manager Talent Management, Fresenius Kabi – Det finns idag ett tryck på att vi från Fresenius Kabi i Sverige ska förse fabriker i världen med kompetens inom framförallt teknik, kvalitet och produktion. Därför är välutbildad personal en viktig del av vår fortsatta framgång. De personliga egenskaper vi värdesätter är förmåga att kommunicera, ta ansvar, visa engagemang och nyfikenhet, och arbeta i team. – Som ingenjör är det många olika saker man behöver vara duktig på förutom maskiner: jobba med tidsplaner, hålla ihop en budget, jobba med upphandling, kunna samarbeta med andra avdelningar, ha kontakt med underentreprenörer, och så vidare. Man behöver ha flera strängar på sin lyra, och det tror jag kommer att krävas i ännu högre utsträckning i framtiden. Det kan man träna på en massa olika sätt när man pluggar genom att engagera sig i exempelvis nationer och studentföreningar.

24

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


K emiteknik Inriktning mot läkemedel eller material

Idag startas allt fler företag inom bioteknik och behovet av att utveckla material är stort. Därför är civilingenjörer i kemiteknik en eftertraktad yrkesgrupp. Väljer du inriktning mot material får du studera vid ett unikt centrum för materialforskning. Läkemedelsinriktningens kompetens säkras genom Sveriges enda farmaceutiska fakultet. Vad du än väljer väntar en expansiv arbetsmarknad efter dina studier i kemi­ teknik vid Uppsala universitet.

I

kemin styr materialens egenskaper. Dessa kunskaper är mycket eftertraktade av svensk industri. Vissa projekt sker i samarbete, ett sätt för industrin att snabbt få problem belysta.

Uppsalaforskare har upptäckt

Om undervisningen I undervisningen läggs särskild vikt vid förmågan att analysera, formulera och lösa problem. Det gör att du kan utveckla din förmåga och använda dina kunskaper i ditt kommande yrke. Förutom teoretiska kunskaper handlar utbildningen om att träna dig inför rollen som ingenjör. Det sker bland annat genom laborationer, arbete i projektgrupper och kommunikationsträning integrerad i varje kurs.

att grönalgen Cladophora har en Uppsala pluggar du i en kreananostruktur som fungerar som bas i Studera utomlands Du har untiv och forskningsintensiv miljö. miljövänliga batterier. der utbildningen möjlighet att läsa Här finns ett brett kunnande vissa kurser vid andra universitet, både i Sverige och och en mängd företag inom läkemedel, bioutomlands. Sådana kurser kan sedan tillgodoräknas teknik, medicinteknik och materialutveckling. Oavi utbildningen. Du kan också välja att göra ditt exasett vilken inriktning du väljer får du en utbildning mensjobb utomlands, till exempel i Kanada, USA, anpassad efter marknadens behov såväl nationellt Australien, Tyskland eller Frankrike. som internationellt. Ett utvecklat samarbete med näringslivet och Upplägg De två första åren läser alla samma ämeffektiv kommunikationsträning gör dig väl förnen oavsett inriktning. Det är kurser främst i kemi, beredd för yrkeslivet. Dessutom har du möjlighet matematik och beräkningsvetenskap. Från årskurs till kursutbyte med andra universitet i Sverige och tre läser du olika kurser efter vald inriktning, till exutomlands. empel materialkemi eller fysiologi. Under det fjärde året specialiserar du dig ännu Programmets inriktningar: mer beroende på intresseinriktning mot till exemLäkemedel Här har du möjlighet att specialisera  pel analys- eller framställningsmetodiker. Vilken dig på olika delar i utveckling av nya läkemedel. inriktning du än väljer finns ett brett utbud av kurDu kan till exempel lära dig ta fram nya aktiva ser med många möjligheter att profilera dig. substanser både genom design av nya molekyler och eller utveckla nya tillverkningsmetoder. Du Karriär I princip alla som läst civilingenjörsprokan även studera process- och formuleringstekgrammet i kemiteknik, oavsett inriktning, har fått nik, där kurserna handlar om att ta fram nya och jobb inom ett år efter examen. Under de senaste vidareutveckla gamla beredningsformer samt att åren har företag inom läkemedel, bio- och medianalysera och tillverka läkemedel. cinteknik i Sverige ökat kraftigt, speciellt i Uppsala­ Oavsett vilken profil du väljer får du en utbildområdet. Det finns ett stort behov av kompetenta ning som ger dig goda kunskaper för arbete inom civilingenjörer inom läkemedelsbranschen. såväl forskning och utveckling som produktion. Studenter med materialinriktning kan få jobb på företag inom bio- och medicinteknik men efterfrå M aterial Hela utbildningen är förlagd till ett  gas även inom elektronik-, pappers- och verkstadscentrum specialbyggt för materialforskning, industrin. Ångströmlaboratoriet. Utvecklingen av nya Vilken inriktning du än väljer får du också en bra material sker idag i snabb takt vilket skapar möjgrund för en forskarutbildning vid universitetet. Du ligheter till nya uppfinningar inom områden som har möjlighet inom utbildningen att pröva på hur energi, medicin och IT. det är att forska (forskningspraktik). De flesta lärare Från årskurs fyra kan du profilera dig mot områär även aktiva forskare eller har en sådan bakgrund. den som energi, hållbar utveckling och funktionella material. En stark fokusering ligger på hur

Kemiteknik

Civilingenjörsprogram 300 hp

Årskurs 1 Kemi/kemiteknik Matematik Datavetenskap

 35 hp 20 hp 5 hp

Årskurs 2 Kemi/kemiteknik Matematik/statistik Fysik Datavetenskap

35 hp 15 hp 5 hp 5 hp

Årskurs 3 Kemi/kemiteknik 20 hp Grundläggande kurser inom läke­­medelsområdet alternativt material­området 25 hp Självständigt arbete 15 hp

Årskurs 4 Läkemedelskurser 60 hp t ex inom läkemedelssyntes, läkemedelsformulering, farmakokinetik, processteknik galenisk farmaci, läkemedelsteknik, kvalitetssäkring alternativt Materialkurser 60 hp t ex inom materialtillverkning, materialanalys, materialmodellering, mikrostrukturteknik, biomaterial, ytfysik och -kemi

Årskurs 5 Läkemedelskurser 30 hp till exempel inom området produkt- och processanalytisk kemi, toxikologi alternativt Materialkurser 30 hp vidare profilering inom energimaterial, funktionella material, materialanalys, materialsyntes, hållbar utveckling Examensarbete 30 hp Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen vilket är en yrkesexamen.

Olle Gustavsson:

”Närhet till forskning och hög­teknologisk utrustning och funderar på doktorera. Varit aktiv i forsränningen.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

25


Det behövs en helhetssyn för att bedöma konsekvenserna av hushållens och industrins utnyttjande av mark-, luft- och vattenresurser.

Ulrika Bohlin arbetar på Aneheim Consulting – Vi är verksamma inom området ledarskap och management med fokus på projektledning. Med vår tekniska bakgrund och operativa förståelse överbryggar vi gapet mellan management och verksam­ heten. Själv arbetar jag främst mot energibranschen och i huvudsak med projektledning men även med verksamhetsutveckling både internt och externt. Jag är med och får vår egen verksamhet att växa och fungera bättre kombinerat med att jag hjälper andra företag att utvecklas. – Med civilingenjörsprogrammet i miljö- och vattenteknik får man verktyg och kunskaper som rustar dig i en omfattning som jag själv tycker är svårslagen om man vill arbeta inom det miljötekniska området. Jag lärde mig ta in stora mängder komplex information snabbt och sålla ut det som är viktigt. – Studentlivet vid sidan av studierna var en bra skola där jag fick utveckla mina ledarskapsfärdigheter bl a som ordförande för Uppsala teknolog- och naturvetarkår. Nuvarande jobbet fick jag 2016 efter tips från en vän sedan studietiden och på den vägen är det. – Min drivkraft när jag började utbildningen var att jag ville rädda världen och är fortfarande densamma.

26

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp

Foto: Conny Larsson

Miljötänkande & teknikanpassning


M ilj ö - och vattenteknik Vill du arbeta med miljöfrågor och hjälpa till att stoppa miljö­ förstöringen i Sverige och världen? För att klara det krävs nya synsätt och nya tekniska lös­ningar. För att få ett uthålligt samhälle och för att förstå och minska belastningen på miljön måste ny teknik utvecklas. Civilingenjörsprogrammet i miljö- och vattenteknik i Uppsala ger dig de kunskaper som behövs för att utveckla och använda tekniken på rätt sätt.

K

arbeta med utvecklingsprojekt inom miljö- och vattenteknikområdet. Om undervisningen Undervisningen är kopplad till yrkeslivet och består av föreläsningar, lektioner, laborationer, projektarbeten, studiebesök och exkursioner.

Hur blir det med klimatet? Kommer

Studera utomlands Det finns möjligheter för studenterna på programmet att åka utomlands under utbildningen. Bland studenterna är det vanligt att kombinera miljöengagemang med att åka utomlands för att studera eller göra examensarbete. Kina, Indien, Australien, England och Nya Zeeland är exempel på länder som är populära att åka till.

ommer vattnet att vattnet att räcka till alla? För att få ett uthålligt samhälle och räcka till alla, fun­ gerar för att förstå och minska belast­ Upplägg Under årskurs ett och ekosystemen när det ningen på miljön måste ny teknik två bygger du upp en gedigen blir torka? Hur blir det utvecklas. grund genom att läsa kurser inom med klimatet? Vilka åtgärder behömatematik, kemi, biologi, fysik, datavetenskap ver sättas in vid ett giftutsläpp? Det är av största och miljörätt. vikt att vi i klimatförändringarnas tidevarv satsar Under årskurs tre får du praktiskt pröva dina på kunskap, använder nya synsätt och finner alterkunskaper inom meteorologi, hydrologi, reglernativa eller banbrytande tekniska lösningar. teknik och markvetenskap. Det behövs en helhetssyn för att bedöma konI årskurs fyra och fem väljer du att specialisekvenserna av hushållens och industrins utnyttsera dig inom olika terminsblock där vi i projekt jande av mark-, luft- och vattenresurser. För att genomför arbetsuppgifter hämtade ur ingenjöhandskas med miljöfrågor krävs samarbete melrens vardag. Du får här övning i olika arbetssätt lan alla parter i samhället. Som miljö- och vatsom är vanliga för miljö- och vatteningenjörer. teningenjör förstår du hur saker och ting hänger Terminsblocken ges inom uthålliga vatten- och ihop. Du kan tala samma språk som specialister avloppssystem, markmiljö, vattenresurser, luftinom skilda områden, inte bara med andra ingenvård och klimat, miljömanagement och ekosysjörer utan också med ekologer, kemister och miltemmodellering. jöansvariga på företag och myndigheter. Programmet är ett samarbete mellan Uppsala Karriär Civilingenjörer inom miljö- och vattenuniversitet och Sveriges lantbruksuniversitet, området är efterfrågade. Det finns arbetstillfällen SLU. Detta gör civilingenjörsprogrammet i miljöpå större företag, konsultföretag, vattenreningsoch vattenteknik unikt när det gäller kurs­utbud, verk och myndigheter. lärare och forskning. Här finns bland annat bred Som miljö- och vatteningenjör arbetar du kompetens inom hydrologi och meteorologi. inom ett brett teknikområde där det gäller att Basen är ett antal tekniska kurser som krävs för sammanföra kunskap från olika områden. civilingenjörsexamen. Utbildningen blandar traEtt exempel: Ett vattenmiljötekniskt företag ditionell teknik med övriga naturvetenskapliga arbetar med att hindra giftspridning i mark, luft, ämnen för att finna helhetslösningar på miljövatten och berg. De kan tillämpa hydrotekniska och vattentekniska problem. lösningar som erosionsskydd och dimensionerar Du får kunskaper inom såväl matematik, kanaler och avloppssystem på rätt sätt. datavetenskap, fysik, kemi, biologi, geovetenUtbildningen ger dig också en bra grund för skap (mark, luft och vatten) som i de miljötekatt forska vidare inom miljö- och vattenteknik. niska användningsområdena inom produktion och forskning. Du får en inblick i hur det är att

Miljö- och vattenteknik Civilingenjörsprogram 300 hp

Årskurs 1 Miljö- och vattenteknik Matematik/statistik Biologi och ekologi Kemi Datavetenskap

 10 hp 20 hp 10 hp 15 hp 5 hp

Årskurs 2 Miljöanalys Miljörätt Matematik Fysik Kemi Datavetenskap

5 hp 5 hp 10 hp 25 hp 10 hp 5 hp

Årskurs 3 Meteorologi Hydrologi Miljömätteknik Markvetenskap Matematik Systemanalys/reglerteknik Självständigt arbete

5 hp 5 hp 5 hp 15 hp 5 hp 10 hp 15 hp

Årskurs 4-5

Terminsblock som erbjuds (minst två krävs för examen): • Uthålliga vatten och avloppssystem • Markmiljö • Vattenresurser • Luftvård och klimat • Miljömanagement • Ekosystemmodellering Examensarbete, 30 hp Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen vilket är en yrkesexamen.

Jacob Friman: ”Intresserad av miljö som berör många människor. Många praktiska moment i programmet men även fält­arbete där man åker till U-länder och gör ett stort projekt.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

27


Foto: Martin Kelam

Foto: Shutterstock

Forskning, teknikutveckling & livsvetenskap

28

Åsa Hagner McWhirter, Ph D, Senior Scientist, GE Healthcare – Vi har haft en hel del studenter från molekylär bioteknik som gjort praktik och exjobb hos oss. – Några av dem har också fått projektanställning och därefter tillsvidareanställning. Studenterna från programmet har rätt baskunskaper kombinerat med en bredd som behövs på GE. De har också varit drivna och vana att jobba på labb, så vi har varit oerhört nöjda med dem. – På GE behöver vi personer till olika funktioner, allt från produktutveckling och produktion till marknadsföring. Med rätt kompetens, nyfikenhet, intresse och samarbete kan man gå långt hos oss. Branschen i övrigt erbjuder många olika möjligheter både i Sverige och internationellt.

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


M olek y l är bioteknik Vill du utveckla ny teknik som förbättrar människors livsvillkor? Det kan gälla att utveckla enzymer som för att omvandla avfall till användbara material, analysera DNA-sekvenser från patienter för att förstå sjukdomar, modifiera mikroorganismer för att omvandla solenergi till bränsle, utveckla datasystem för att ta hand om biologisk data, eller producera proteiner på ett hållbart sätt. Med en examen i molekylär bioteknik är du rustad för att ta dig an de här utmaningarna och mycket mer.

Ebola

I årskurs fyra väljer du mellan ett stort utbud av kurser inom bioinformatik och molekylär bioteknik. Om du vill kan du läsa kurser inom till exempel ekonomi och entreprenörskap. Kurserna år fyra och fem karaktäriseras av ett arbetssätt som mer liknar yrkes­ livet. De har ett större innehåll av självständiga aktiviteter där det ställs högre krav på din egen initiativ- och organisationsförmåga. Studera utomlands Du har möjlighet att studera som utbytesstudent på många välkända universitet runt om i världen.

Upplägg De inledande kurserna Utbildningen ger dig förutsättningar på programmet ger dig de kunatt självständigt kunna arbeta med skaper inom bioteknik, datavetenavancerade biovetenskapliga skap, fysik, kemi och matematik frågeställningar. som behövs för att du själv ska eknikutvecklingen inom kunna utveckla nya metoder och ny teknik. De biovetenskap är snabb, vilket ställer sista två åren på utbildningen väljer du mellan tre stora krav på dig som biotekniker. Omprofiler. rådet blir alltmer tvärvetenskapligt. För På profilen Molekylär bioteknik för produktion att kunna designa bakterier som ska producera fokuserar du på att designa och utveckla cellubilbränsle behöver du förutom kunskaper i mikrolära produktionssystem för att framställa fysiska biologi även en ingenjörs tankesätt och kunskaper. produkter, på profilen Tillämpad bioinformatik är Utbildningen ger dig den här starka kombinatiofokus att hantera och analysera storskalig biologisk nen av biologi – förståelse för levande system – och biomedicinsk data, och på profilen Tillämoch klassiskt ingenjörskunnande. pad molekylär biofysik är fokus att analysera och Inom bioteknik finns ofta etiska frågeställmodellera biologiska och biomedicinska processer ningar som du behöver kunna förhålla dig till. på molekyl- och cellnivå. Du kan också välja att Som civilingenjör i molekylär bioteknik har du profilera dig mot entreprenörskap. den kompetens du behöver för att utveckla bioUtbildningen avslutas med ett examensarbete tekniken, och tar ansvar för att den används på rätt under hela vårterminen årskurs fem. sätt i samhället. Övning på muntlig och skriftlig kommunikation, att arbeta i olika typer av grupper, och ett Om programmet Uppsala universitet har en professionellt förhållningssätt till bioetiska frågor bred och stark forskning inom biovetenskaper, löper som en röd tråd genom hela utbildningen. såsom bioinformatik, biokemi, biologi och medicin. Vid universitetet finns också Science for Life Karriär Uppsala ligger i hjärtat av Sveriges största Laboratory (SciLifeLab), ett nationellt centrum bioteknikområde. Praktik eller examensarbete för forskning inom biovetenskap. Många biotekinom ett intressant område ger dig ett värdefullt nikföretag är lokaliserade till Uppsala, liksom flera kontaktnät när du ger dig ut på arbetsmarknaden. myndigheter med verksamhet inom bioteknik. Kanske gör du praktik på ett litet biotekniskt föreKursutbudet är stort, lärarna är aktiva forskare tag, eller får en mentor från ett patentföretag. och du har utmärkta möjligheter att göra praktik Som färdig civilingenjör kan du utföra en i forskargrupper vid universitetet, på myndigheter mängd olika arbetsuppgifter. Du kan till exemeller i bioteknikföretag. pel jobba med forskning- och utveckling, storProgrammet har ett utmärkt rykte och med en skalig produktion, eller marknadsföring inom det civilingenjörsexamen i molekylär bioteknik är du område du har profilerat dig. Många jobbar som väl förberedd för en bred arbetsmarknad i Sverige säljare, konsulter, systemutvecklare, bioinformatioch utomlands. ker, validerare, patentingenjörer eller inom management. Efter ett tag hamnar många i chefs- eller Om undervisningen De första åren läser du kurgruppledarpositioner. ser inom bioteknik, datavetenskap, fysik, kemi Uppsala har stark forskning inom biovetenskaoch matematik som ger dig en bred kunskapsbas. per med många världsledande forskningsmiljöer. Undervisningen består vanligtvis av föreläsningar, Kanske hittar du en forskargrupp där du kan fortlektioner, seminarier och övningar. sätta med en forskarutbildning inom ett ämne du År tre avslutas med ett självständigt arbete där brinner för. du i en projektgrupp löser ett biotekniskt problem från ett företag eller myndighet.

T

Miljö- och vattenteknik

Civilingenjörsprogram 300 hp

Årskurs 1 Beräkningsvetenskap/matematik Cellbiologi/molekylär bioteknik Kemi

20 hp 20 hp 20 hp

Årskurs 2 Bioinformatik/biologi Datavetenskap Fysik Kemi Matematik/statistik

10 hp 10 hp 5 hp 10 hp 25 hp

Årskurs 3 Bioinformatik/genomik/mikrobiologi Datavetenskap Fysik Kemi Självständigt arbete

Årskurs 4 Breddning Specialisering

15 hp 15 hp 10 hp 5 hp 15 hp 15-30 hp 30-45 hp

Årskurs 5 Breddning Specialisering Examensarbete

0-15 hp 15 hp 30 hp

Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen i molekylär bioteknik, vilket är en yrkesexamen.

Teresa Reinli: ”Bästa med programmet är att man blandar biologi och teknik. I Uppsala finns en sammanhållning bland alla studenter. Allt är inom cykelavstånd.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

29


Foto: Shutterstock

Tvärvetenskap & systemtänkande

Agnes Kåregård, konsult på ÅF – Jag jobbar med transport- och logistikutredningar på ÅF, ofta med någon form av järnvägskoppling. Mina arbetsuppgifter består både av uppdragsledning och utredningsarbete. Jag arbetar mestadels i flera olika parallella projekt av varierande omfattning. – STS-programmet har gett mig en bra bredd och förmåga att snabbt sätta mig in i nya ämnesområden. Utbildningen gav mig en förståelse för stora komplexa system och hur de påverkar och påverkas av samhället, vilket jag har stor nytta av i mitt arbete med järnvägsfrågor. Inom järnvägs- och infrastrukturbranschen händer det mycket för tillfället och det finns ett stort behov av både underhåll och nyinvesteringar vilket kräver utredningsarbete i olika former. – Om man är intresserad av både teknik och samhällsfrågor är STS-programmet en mycket bra utbildning. Att läsa kurser inom samhällsvetenskap och humaniora utöver traditionella teknikkurser gav intressanta perspektiv på teknik och teknikanvändning.

30

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


system i teknik och samhälle Ett genuint tvärvetenskapligt civilingenjörsprogram

Är du intresserad av att utveckla teknik i ett större perspektiv? Efter civilingenjörsprogrammet i system i teknik och samhälle är du rustad för att ta dig an några av de stora och svåra problem som dagens samhälle möter. Du får en unik tvärvetenskaplig utbildning som ger dig en helhetssyn på tekniken i sitt sammanhang.

Upplägg De två första åren läser du grundkurser inom matematik, teknik och naturvetenskap. Dessutom studerar du teknik utifrån en samhällsvetenskaplig och humanistisk synvinkel. Din tekniska huvudkompetens får du inom området systemteknik, där modellering, simulering, reglerteknik, systemanalys och olika typer av tillämpad statistik är huvudmetoder. Denna systemkompetens kompletterar du under årskurs 3-5, med en valbar teknikprofilering, som till exempel Energisystem eller IT system. Tredje året avslutas med ett projektarbete inom ditt tekniska profilämne. Därefter har du möjnder utbildningen Ska samhället dra nytta av avance­ lighet att ta ut en teknisk kandirad teknik i framkant krävs att den studerar du inte bara datexamen. integreras i samhället på ett bra hur tekniken konstruUnder årskurs fyra gör du en sätt. Det gäller att se sambanden eras och fungerar, utan C-uppsats inom ett av de humamellan teknikutveckling och teknik­ användning. också samspelet mellan teknikutnistiska eller samhällsvetenskapveckling/användning och samhället liga ämnena: Företagsekonomi, i stort och deras påverkan på varandra. Ekonomisk historia, Kulturgeografi, Filosofi eller Teknisk utveckling är en del av samhällets Idé- och lärdomshistoria. Efter det kan du ta ut övriga utveckling. Tekniken påverkas av miljö, filosofi kandidatexamen inom STS-ämnet. ekonomi och kultur, och därför efterfrågas I årskurs fem avslutas programmet med ett ingenjörer med en bred kompetens inom flera examensarbete inom teknikområdet, som oftast om­råden. görs ute på ett företag. Det behövs civilingenjörer som inte bara kan teknik och naturvetenskap, utan också behärskar Efter utbildningen Våra utexaminerade stusystemtänkande som sträcker sig över traditiodenter får kvalificerade och intressanta arbeten. nella ämnesgränser. På civilingenjörsprogramDe vanligaste branscherna är inom IT, energi och met System i teknik och samhälle (STS) får du offentlig sektor, men även samhällsbyggnad & en tvärvetenskaplig utbildning som ger dig en infrastruktur, bank, finans och försäkringar, samt helhets­syn på tekniken i sitt sammanhang. Förfordonsindustri. Du kan till exempel arbeta med utom att läsa kurser i teknik och naturvetenskap teknisk information, riskanalys, systemutveckling, studerar du på programmet teknik utifrån ett produktutveckling, och miljökonsekvensbeskrivsamhällsvetenskapligt och humanistiskt perspekning. De vanligaste rollerna är konsult och protiv – det så kallade STS-perspektivet. jektledare och många har i hård konkurrens fått gå trainee program på flera kända framstående interOm undervisningen Programmet har en mednationella företag, där de får en bred översyn och veten pedagogisk mångfald, där sättet att underförståelse för hela företagets verksamhet. visa och examinera varierar mer än på traditioDe som anställer våra utexaminerade är konnella civilingenjörsutbildningar. En betydande del sultbolag (IBM, Sweco, Accenture, CapGemini, av utbildningen bedrivs i seminarieform där du WSP), Scania, Energimyndigheten, Transport­ tränas i att arbeta i grupp, tänka kritiskt och framstyrelsen, IKEA, Fortum, Svenska Kraftnät, föra dina synpunkter. Google, Microsoft samt stat och kommun. Du kommer att arbeta i olika projekt och göra En del har startar egna företag utifrån examens­ fallstudier ute på företag. På en rad kurser har du arbetet. också traditionella undervisningsformer som föreVissa går vidare inom forskningen efter läsningar, lektioner och laborationer, men även av­klarade studier. Exempel på forskningsområden där är fokus på grupparbete. Varje årskurs inneär Energi infrastruktursystem, Människa – Teknik håller studiebesök och gästföreläsningar. IT system och Teknik och vetenskapsstudier.

U

System i teknik och samhälle Civilingenjörsprogram 300 hp

Årskurs 1 Introduktionskurs Matematik Företagsekonomi Datavetenskap Miljöteknik

 10 hp 25 hp 15 hp 5 hp 5 hp

Årskurs 2 Kulturgeografi & Ekonomisk historia Fysik Matematik Datavetenskap Modellering av dynamiska system

15 hp 5 hp 20 hp 15 hp 5 hp

Årskurs 3 Filosofi och idé- och lärdomshistoria Systemteknik Teknisk profilering Projektarbete

15 hp 10 hp 20 hp 15 hp

Årskurs 4-5 Teknisk profilering (informationsteknologi, energi) 45 hp Humaniora/samhällsvetenskap 15 hp C-uppsats (humaniora/samhällsvetenskap) 15 hp Komplexa system i teknik och samhälle 15 hp Examensarbete 30 hp Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen vilket är en yrkesexamen.

Lovisa Ellegren:

”Programmet­är som en bro mellan teknik och samhälle. Aktiv inom kåren. Vill jobba med något fritt och kreativt. Kanske projektledare?”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

31


Foto: Anders Persson

Forskardrömmar & produktutveckling

Viktor Sehlstedt är utvecklingsingenjör på Erasteel Kloster AB i Söderfors. Jobbet fick jag efter examensarbetet som jag genomförde här och nu jobbar jag inom R&D (Research & Development). Jag är med i utvecklingen av nya produkter och applikationer är dessutom tekniskt marknadsstöd. Just nu är jag också projektledare för att göra vissa förändringar ute i stålverket. – Teknisk fysik med materialvetenskap har gett en oerhört bra och gedigen grund för att förstå och jobba med alla typer av materialfrågor. Utbildningen har en intressant och unik blandning av fysik och kemi där man lär sig om befintliga, nya och framtida material, både hur de funkar på en makroskala men också på atomnivå. Men viktigast av allt är den allmänna erfarenhet man får av att läsa en femårig utbildning som inte går att tillskriva någon speciell kurs. – Materialforskningen sätter ofta gränserna för vad vi kan göra och materialvetare behövs inom många sektorer – från utvecklingen av nästa generations solceller till storskalig stålproduktion. Stålbranschen i sig har lång tradition i Sverige med många stora företag där det finns många intressanta och lockande jobb. Det är ett spännande område med stor utveckling på alla nivåer, från grundforskning till industri.

32

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Teknisk fysik med

Materialvetenskap är att kombinera fysik och kemi för att förstå materialens uppbyggnad och egenskaper. Som materialvetare kan du utnyttja den förståelsen för att använda materialens egenskaper till ny teknik och för att utveckla nya material med nya möjligheter. Dagens teknik och material ger ofta stora miljöavtryck. Därför behöver både forskning och företag din hjälp för att hitta mer hållbara lösningar.

materialvetenskap

M

Jocke Gustafsson

Upplägg Utbildningen börjar med en introduktionskurs till ämnet materialvetenskap parallellt med den grundläggande matematiken. Under år ett och två läser du många matematik- och fysikkurser, och ett par grundläggande kurser i kemi. Det ger dig en god grund till kurser om kvantmekanik, kemiska bindningar och fasta materials uppbyggnad som börjar i slutet av år två. Den kunskapen, materialvetenskapens grund, byggs på med kurser om de mekanismer som ger materialen deras egenskaper. Tillsammans med kurser om materialens funktioner och tillämpningar får aterialvetenskap bedu de kunskaper som behövs för Forskargruppen för tunnfilmssolceller har gått från forskning till storskalig hövs nästan överallt, utveckling av nya material och ny produktion genom företaget Solibro. eftersom materialen teknik. Kontaktlinser, höftproteser och tand­ är det som sätter den I slutet av årskurs tre ges en kronor är exempel på biomaterial yttersta gränsen för vår teknik. för att laga eller ersätta en trasig kurs som är ett projekt- och kroppsdel. Solceller, smarta fönster, biogrupparbete där du lär dig hur Ångström­laboratoriet spelar en be­ material till implantat, medicinska projekt inom industrin planetydande roll för forskningen om nya verktyg och läkemedel är exempel biomaterial. ras, genomförs och avrapportepå material med specifika egenskaras. Denna kurs värdesätts högt per. av industrin och projekten kommer ifrån företag Du kommer att studera på Ångströmlaboratomed nära anknytning till materialforskning. riet, i samma korridorer som världsledande forsUnder vårterminen år fyra och höstterminen år kare inom materialvetenskapen. Många av dessa fem ges du stora möjligheter att rikta in dig på ett forskare är dina lärare. Detta, samt tillgången särskilt område. Du kan också få en stor bredd och till modern experimentell utrustning, möjliggör lära dig ingenjörsmässighet genom att välja breda undervisning i forskningsfronten. kurser från flera områden. Oavsett vilket du välProgrammet ger dig en god grund i matemajer kommer du att få en fördjupad förståelse för tik, fysik och kemi som du använder för att förmaterialens koppling till sina tillämpningar och stå materialvetenskapens kärna – kunskapen om teoriernas koppling till praktiken. hur materialen är uppbyggda och hur de får sina Utbildningen avslutas med ett examensarbete olika egenskaper. Du lär dig också om materialens hela vårterminen år fem. många tillämpningar och sammanhang. När du I slutet av utbildningen är kopplingen till tar examen från civilingenjörsprogrammet i teknäringslivet och forskarvärlden påtaglig. Ångnisk fysik med materialvetenskap har du därför en strömlaboratoriets framstående position på områbred utbildning med lite av allt. det betyder att det du lär dig är på högsta nivå. Examensarbetet görs i samarbete med näringsOm undervisningen För att lära dig teori komlivet eller forskarvärlden och leder ofta till en förmer du att lyssna på föreläsningar, gå igenom räksta anställning eller en forskarutbildning. neuppgifter på lektioner samt läsa och räkna på egen hand, allt i den mån du känner att du behöKarriär När du har läst civilingenjörsprogramver. För att lära dig mer praktiska saker, till exemmet i teknisk fysik med materialvetenskap har du pel att förstå en analysmetod, är laborationer en en bred grund med kunskaper i både kemi och mycket viktig del av utbildningen. För att lära dig fysik. att jobba i grupp och lösa problem kommer du att Du är en materialvetare med många möjliga få arbeta i flera projekt av varierande storlek. karriärvägar. Du kan bli forskare, specialist eller Kurslitteraturen är till största delen på engelen ingenjör med helhetsgrepp som projektledare ska medan undervisningen till största delen är på eller samordnare. Exempel på stora arbetsgivare i svenska. Sverige: ABB, Combitech, Sandvik, Siemens, SCA, Vattenfall. Studera utomlands Du har möjlighet att förlägga en del av din utbildning vid ca 400 välkända universitet runt om i världen.

Teknisk fysik med materialvetenskap

Civilingenjörsprogram 300 hp

Årskurs 1 Matematik Fysik Kemi Teknik

 25 hp 20 hp 5 hp 10 hp

Årskurs 2 Fysik Teknik Matematik Kemi

15 hp 20 hp 15 hp 10 hp

Årskurs 3 Teknik Teknikprojekt Kemi Fysik

15 hp 15 hp 20 hp 10 hp

Årskurs 4-5 90 poäng profilerande kurser om materialvetenskapens tillämpningar. Du kan välja kurser från många områden: Materialanalys och tillverkning Energisystem och hållbar utveckling Mikro- och nanoteknik (mikroskopiska konstruktioner) Biomaterial (material för användning i kroppen) Polymera och molekylära material (plaster och liknande) Tribologiska material (material för friktion och nötning) Funktionella material (material som kan utföra specifika funktioner: elektriska, elektroniska, optiska, magnetiska och liknande) Examensarbete, 30 hp Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen vilket är en yrkesexamen.

Malin Eriksen:

”På Ångström är man så himla bra på material – nästan Sverigebäst och forskarna som föreläser är väldigt entusiastiska.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

33


Spetskompetens & överblick

YUMI – världens första industrirobot som agerar med dubbla armar. Med YUMI startas en ny era av robot­medarbetare som kan samarbeta med människor och samtidigt garantera deras säkerhet (Foto: ABB)

Erik Zeitler, Klarna Förutom en civilingenjörsutbildning i teknisk fysik har Erik disputerat i databasteknik vid Uppsala universitet. Idag jobbar han på Klarna som toppar listan över de snabbast växande teknikbolagen i Sverige. 2012 började han bygga upp Uppsalakontoret som senior mjukvaruutvecklare och strategisk rådgivare i Klarnas tekniska styrelsenämnd: – I mitt team är vi ett tiotal personer, de flesta utvecklare. Andra är datavetare eller lagringsexperter inom datainfrastruktur. Som teknisk ledare förväntas jag ta initiativ när det ska byggas nya grejer och staka ut vägen, ”så här gör vi”. Det kan vara allt från att ta in en ny datakälla och lista ut hur vi ska bygga in den i den befintliga infrastrukturen. Förutom att ta fram tekniska visioner och strategier är jag även handledare för exjobbare inom databearbetning – sådana studenter efterlyser vi hela tiden!

34

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Civilingenjörsprogrammet i teknisk fysik passar dig som vill ha en bred och genuin ingenjörsutbildning med möjlighet till specialisering. Efter examen har du goda möjligheter att arbeta i många olika branscher, både i Sverige och utomlands. I Uppsala är vi exempelvis med och leder utvecklingen av vågkraft, vindkraft och andra energikällor.

S

Nasa

Teknisk f ysik Du möter en kompetent lärarkår där de flesta är aktiva forskare. Efter examen får du behörighet att forska inom fysik, matematik, data och olika teknikområden. Utbildningen av­slutas med ett examensarbete, där du använder dina kunskaper på en större, självständig arbetsuppgift. Institutioner, näringsliv och forskningsinstitut bidrar med förslag på uppgift, handledning och utrustning. Examensarbetet leder i många fall till en första anställning eller en forskarutbildning. Teknisk fysik har en aktiv student­förening som är med och påverkar och övervakar utbildningens kvalitet.

å länge människan utvecklar ny teknik kommer tekTekniska fysiker kommer alltid att niska fysiker att efterfråefterfrågas för att exempelvis arbeta Studera utomlands Det finns gas. De finns på alla stora med styrsystem för robotar, konstru­ stora möjligheter att studera i teknik- och konsultföretag och kan era instrument för satelliter eller Nordamerika, Europa, Asien eller utveckla strål­behandling för cancer. till exempel arbeta med att proOceanien. grammera styrsystem för robotar, konstruera instrument för satelliter eller utveckla Upplägg Under de första tre åren bygger du en strålbehandling av cancer. stadig grund i matematik, klassisk fysik, elektro­ Civilingenjörsprogrammet i teknisk fysik i teknik och data. Du får prova på en mängd Uppsala ger dig först grunderna inom alla fysiom­råden inom fysiken vilket ger dig bred kompekens grenar, från mekanik och elektromagnetism tens inför valet av inriktning. Denna gedigna komtill kvantmekanik, mätteknik, elektronik och de petens gör att tekniska fysiker är väl förberedda att beräkningsmetoder som du behöver för att förstå använda sina kunskaper i nya situationer. och tillämpa teorierna. I den nya kursen kreativ Ämnen som företagsekonomi och presentaverkstadsteknik har du också tillgång till en större tionsteknik förbereder dig för arbetslivet redan mekanisk verkstad för bland annat elektromagnefrån start och lär dig civilingenjörens roll. Inför tiska rörelsekonstruktioner. fjärde året kan du välja mellan inriktningarna: til�Programmet har tre inriktningar: lämpad fysik, beräkningsteknik, inbyggda system. Tillämpad fysik Tillämpad fysik behandlar  Du börjar nu specialisera dig, men fortsätter energiteknik, kvantfysik (experimentell och samtidigt bredda din kompetens. Varje inriktning teoretisk), medicinsk teknik, tillämpad fysikahar flera undergrenar som ger unika specialistkunlisk modellering med mera. skaper. I praktiken kan du utforma en unik och Beräkningsteknik Beräkningsteknik efterfrågad kompetens i din examen.  behandlar högprestandaberäkningar, simulering, programmering av parallelldatorer, bildKarriär Kombinationen av spetskompetens analys, informationsutvinning med mera. och bred teknisk överblick gör civilingenjörsprogrammet i teknisk fysik till en ytterst eftertraktad Inbyggda system Inbyggda system ger  utbildning på arbetsmarknaden. kompetens inom elektronik, reglerteknik, Som civilingenjör i teknisk fysik kan du arbeta data och intelligent signalbehandling. Utveckför företag med teknisk verksamhet inom exemlingen inom trådlös kommunikation och halvpelvis forskning och utveckling, vid forskningsinledarteknik har revolutionerat området för stitut eller inom industri. "smarta" tekniklösningar, där tekniska fysikers Andra väljer att starta egna företag, eller att kombinationer av kompetenser ger outtömundervisa på universitet och högskolor. liga möjligheter. Utbildningen i Uppsala är internationellt gångOm undervisningen En civilingenjör förvänbar vilket ger dig goda möjligheter till jobb utomtas kunna hålla många bollar i luften och anpassa lands. Så länge människan utvecklar ny teknik sig till nya situationer. Detta krävs också under kommer tekniska fysiker att efterfrågas. utbildningen då du oftast läser tre kurser parallellt. I Uppsalaområdet finns flera verksamheter som Undervisningen består av föreläsningar, lektioner har forskning med koppling till teknisk fysik, till och handledda laborationer. Examination på de exempel protonstråleterapi, robotmekanik, signalolika kurserna sker oftast genom inlämningsuppbehandling och telekom. Här finns även forskning gifter, projektarbete och skriftliga tentamen. om energi från vågor, vind, sol, fission och fusion.

Teknisk fysik

Civilingenjörsprogram 300 hp

Årskurs 1 Teknik och fysik Matematik Datoranvändning Övrigt

 25 hp 25 hp 5 hp 5 hp

Årskurs 2 Teknik och fysik Matematik Datoranvändning Övrigt

30 hp 10 hp 10 hp 10 hp

Årskurs 3-5 Inriktningsspecifika kurser omfattande cirka 105 hp. Tillämpad fysik behandlar energi­teknik, kvantfysik (experimentell och teoretisk), medicinsk teknik, tillämpad fysikalisk modellering med mera. Beräkningsteknik behandlar högprestanda­ beräkningar, simulering, programmering av parallelldatorer, bildanalys, informationsutvinning med mera. Inbyggda system ger kompetens inom elektronik, reglerteknik, data och intelligent signalbehandling. Utvecklingen inom trådlös kommunikation och halv­ ledarteknik har revolutionerat området för "smarta" tekniklösningar, där tekniska fysikers kombinationer av kompetenser ger outtömliga möjligheter. Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Utbildningen leder till en civilingenjörsexamen vilket är en yrkesexamen.

Johanna Blomqvist: ”Ville till en riktig studentstad. Breddat med ekonomi. Vill jobba med produktion. Man skall inte vara rädd för att plugga teknisk fysik.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

35


Foto: Mikael Wallerstedt

Entreprenörskolan Entreprenörskolan i Uppsala är ett avslutande studieprogram för dig som läser ett utbildningsprogram inom naturvetenskap och teknik om minst 240 hp, exempelvis alla civilingenjörs­ programmen eller om du läser masterprogrammet i biomedicin. Entreprenörskolan söks i konkurrens och ersätter det ordinarie avslutande studieåret inom respektive utbildning. Målet med utbildningen är att för­bereda dig för affärsutvecklande uppgifter inom såväl entreprenörsföretag som större företags produkt- och affärsutvecklande enheter. Under ett intensivt utbildningsår får du använda dina specialistkunskaper för att driva

ett affärs­projekt i skarpt läge, från idé till kommersiell verklighet. Samtidigt får du fördjupa dig i ämnen som affärsplanering, marknadsanalys, immaterialrätt och affärs­ juridik. Hur man leder och driver teknikbaserade utvecklingsprojekt och hur man startar företag. Dina lärare är erfarna affärsmän och entreprenörer, forskare och andra specialister inom inno­ vationsområdet. Entreprenörskolan räknas som en del i din examen. Du får alltså en examen från ditt valda utbildningsprogram, till exempel civilingenjörsprogram, med en unik profil mot teknik- och affärs­utveckling.­

Hur kommer det sig att du blev intresserad? Ämnesområdet Life Science har alltid varit spännande men jag ville inte fortsätta med en forskningsrelaterad tjänst. Jag började titta på kompletterande utbildningar och entreprenörsskolan dök upp som en perfekt påbyggnadsutbildning, särskilt då jag var intresserad av affärsrelaterade frågor som marknadsföring och ekonomi. Kontakten med näringslivet lockade mig också till utbildningen. Vad tyckte du om projektet ni jobbade med? Det var jättespännande och roligt att äntligen få komma ut och jobba i ett bolag. Man lärde sig mycket och såg vilka möjligheter som fanns. Jag gjorde mitt projekt på marknadsavdelningen på GE Healthcare i Uppsala. Där blev jag sedan kvar i fyra år. Maria Wrethag, CMO SyntheticMR, tidigare VD på Accelerator Nordic AB och Marketing Manager på GE Healthcare. Nu är hon CMO på SyntheticMR AB, ett företag som har utvecklat en programvara som effektiviserar MR-undersökningar.

36

Vad hade du för mål med entreprenörskolan? Målet var att jobba med affärsrelaterade frågor inom Life Science-området. När jag läste molekylärbiologi insåg jag att jag inte ville jobba på labb men jag hade dålig koll på vilka andra typer av jobb som fanns inom området. Entreprenörskolan visade på andra möjligheter inom Life Scienceområdet. Har du haft användning av entreprenörsskolan i ditt yrkesliv? Ja verkligen. Det har varit min språngbräda in i arbetslivet och även senare har jag haft stor nytta av kunskaperna inom marknadsföring och ekonomi, m.m.

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p


högskoleing enjör s prog r am

H

ögskoleingenjörsprogram är till för dig som vill ha en kortare yrkesinriktad utbildning. Studenter med en högskole­ingen­jörs­ examen är efterfrågade på arbets­marknaden och du har kanske redan under utbildningen hittat din framtida arbetsgivare.

Byggteknikprogrammet ger en kvalitativ och god grundutbildning för byggbranschen. Elektroteknik belyser den högaktuella frågan om användning av energi i vårt samhälle.

Maskinteknik ger goda möjligheter att arbeta med praktisk produkt­ utveckling på internationella svenska företag som Sandvik eller ABB. Kvalitetsutveckling och Ledarskap kombinerar teknikkunskaper med en helhetssyn på kvalitet, ledarskap, ekonomi och hållbar utveckling. Teorin portioneras ut över hela utbildningen för att du ska kunna tillämpa den för att hitta tekniska lösningar. Inom utbildningen jobbar du med verktyg som är praktiskt användbara i arbetslivet. Till exempel får du använda samma datorbaserade hjälpmedel som finns på många företag.

Högskoleingenjörs­ program 180 hp

En kortare och yrkesinriktad utbildning som leder till en gedigen och trygg examen.

Du följer en bunden studie­plan de första två åren. I års­kurs tre väljer du inriktning.

Du läser två till tre kurser sam­tidigt. Kurserna är av varierande längd. Avslutas med ett examens­arbete om 15 hp.

Du kan gå vidare direkt till näringslivet efter tre års studier. Du kan använda den senaste tekniken­i ditt yrke.

Om du vill kan du också bredda din utbildning med valfria kurser från övriga ingenjörsprogram eller vissa icke-tekniska ämnen. Det finns också möjlighet att efter examen fortsätta studera inom något masterprogram.

 U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

37


Foto: Shutterstock

Anläggning, konstruktion & förvaltning

Annika Joneby är arbetsledare på NCC – När jag gjorde ett studieuppehåll under ett år gjorde jag praktik på NCC. Att jag sedan, när jag återgått till studierna, förlade mitt exjobb här blev naturligt. Direkt när jag tagit examen fick jag jobbet. – Jag arbetar ute på ett bostadsbygge i Uppsala och min uppgift är att se till att byggproduktionen flyter på smidigt. Jag planerar arbetet, beställer material och samordnar olika yrkesgrupper. Jag ser även till att vi följer ritningarna, håller tiden och att vi har en säker arbetsmiljö. Uppstår det några problem ser jag till att vi löser dem så fort som möjligt på ett bra sätt. – På utbildningen i byggteknik får man lära sig grunderna inom många olika områden inom bygg, allt från konstruktion till entreprenadjuridik. Det är mycket arbete i projektform vilket jag haft stor nytta av i arbetslivet och man lär sig mycket teori som som man har användning av när man börjar jobba. – Just nu är det en väldigt stark byggkonjunktur och vi har många projekt som ska igång. Befolkningen ökar och det kommer alltid att behövas nya hus, bostäder och vägar. Byggbranschen är väldigt bred och utbildningen öppnar för många roliga yrkesval inom anläggning och husbyggnad.

38

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Byggteknik I takt med städers förtätning och miljonprogrammets behov av upprustning ökar behovet av byggingenjörer med kunskaper i hållbar och energieffektiv byggteknik. Högskoleingenjörsprogrammet i byggteknik i Uppsala ger dig en utbildning baserad på den senaste forskningen och den teknik som efterfrågas av näringsliv och samhälle.

med skriftlig eller muntlig tentamen. Det förekommer också examination enbart med hjälp av projektuppgifter.

Upplägg Under det första året läser du kurser i matematik och byggtekniska ämnen vilket ger dig den bas som krävs för de fortsatta studierna, och du läser en projektkurs med villabygget i fokus. Under det andra året bygger du vidare på din ingenjörskompetens. Du läser kurser inom byggnadsfysik, konstruktion, strömningslära och byggstyrning, och fortsätter arbeta med projektkurser inom villabygget och flerbostadshus. Det tredje året fördjupas kunögskoleingenjörsproMånga av lärarna är yrkes­verk­ skapen inom byggtekniken med grammet i byggteksamma ingenjörer, vilket förstärker utbildningens bransch­anknytning. fokus på energieffektivt och hållnik är upplagt för Antalet tjejer som pluggar till bygg­ bart byggande som tillämpas i en att ge dig en mycket nadsingenjör har ökat på senare år. projektkurs. Du läser även kurser god kompetens inom det bygg­ Behovet av väl­utbildad arbetskraft är stort och det behövs fler kvinnor i inom ledarskap och industriell tekniska området och du har möjbyggbranschen. ekonomi. Sista terminen ges du lighet att välja intresseinriktning möjlighet att välja inriktning mot sista terminen mot konstruktion konstruktion eller byggnadsvård, det sistnämnda eller mot byggnadsvård (en termin på Campus läser du på Campus Gotland. Gotland). Som färdig högskoleingenjör har du Utbildningen avslutas med ett tio veckors många valmöjligheter och kan se fram mot utexamensarbete. manande arbetsuppgifter. Jobben finner du inom Inom programmet finns ett naturligt samprivata företag såväl som inom stat och kommun. arbete med det lokala näringslivet. I samarbete med byggföretag finns möjlighet att få så kallad Om undervisningen Inom programmet anCOOP-praktik. Det innebär att du mellan det passas undervisningen till att efterlikna verkligandra och tredje året kan praktisera två terminer heten på arbetsplatserna. Därför arbetar du ofta i på ett företag. Under praktiken är du avlönad av projektgrupper. I samtliga tekniska ämnen tränar företaget. Vi kan inte lämna någon platsgaranti du även regelbundet på både muntlig och skriftmen för de allra flesta som väljer att göra praktik lig redovisning. Studiemetoderna är medvetet inom utbildningen brukar det lösa sig. valda för att du ska vara väl förberedd när du i din framtida yrkesroll ska presentera dina projekt Karriär Byggandet har under senare år legat på i olika arbetssituationer. en hög nivå men varierar alltid med konjunkUndervisningen består av föreläsningar, räkneturen. Byggprogrammets nära och väletable­ övningar, fältövningar, seminarier, laborationer och rade samarbete med näringslivet bidrar dock till många verklighetsanknutna projektuppgifter. mycket goda utsikter att få arbete som högskoleI utbildningen får du göra många studiebesök ingenjör inom byggteknik. och vi arbetar aktivt med gästföreläsare, så du I Uppsala har programmet en bred inriktning ges bra möjligheter att sammankoppla teori och mot hela byggmarknaden. Det innebär att du som verklighet. färdig högskoleingenjör har många valmöjligheter, Utbildning i användandet av moderna datortill exempel att bli projektingenjör, projekterande hjälpmedel är en viktig del och vi eftersträvar allbyggnadsingenjör, kalkylator, inköpare, arbets­ tid att använda de program som är vanligt föreledare inom produktion eller projektledare. kommande på företag i byggbranschen. Jobben finns i både stora och små privata föreExaminationsformerna varierar, men vanligttag men också inom stat och kommun. vis kombineras en eller flera projektuppgifter

H

Byggteknik

Högskoleingenjörsprogram 180 hp

Årskurs 1 Matematik Byggnadsmaterial och byggteknik Projektkurs villabygge

Årskurs 2 Byggnadsfysik och konstruktion Strömningslära Byggstyrning Projektkurser inom villabygge och flerbostadshus

Årskurs 3 Byggteknik: hållbart byggande och renovering Ledarskap och industriell ekonom Inriktning mot konstruktion eller byggnadsvård Examensarbete Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 3c alternativt Fysik B, Kemi A, Matematik D

Examen Utbildningen leder till en högskoleingenjörsexamen, vilket är en yrkesexamen. Program på avancerad nivå

Efter din högskoleingenjörsexamen kan du välja att fortsätta på bland annat följande master- eller magisterprogram på Uppsala universitet: Industriell ledning och innovation, 120 hp Hållbar utveckling, 120 hp Vindkraftprojektering, 60 hp

Ludvig Rostvik: ”Vi har en

branschnära utbildning med studie­besök på olika arbets­ platser inom byggbranschen.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

39


Europas över 100 år gamla elnät behöver förnyas och i Afrika och Asien saknar två miljarder människor tillgång till elektricitet.

Jonathan Hanning, alumn, ABB Energibranschen är i högsta grad på tapeten, därför ser Jonathan ljust på framtiden för ingenjörer inom energi och elektronik. – Det är här i Ludvika det ”händer” inom elkraft, samtidigt som branschen för förnyelsebar energi växer enormt. Vi har gått från 30 till 150 anställda på kort tid, och till nästa år behöver vi vara närmare trehundra. Det är emellanåt ett problem att rekrytera tillräckligt många färdigutbildade ingenjörer. Jonathan är noga med att betona att inte bara examen är viktig när du söker jobb, utan också engagemang vid sidan om studierna. – Det är vad du gjort utöver utbildningen som gör att du sticker ut bland alla andra ingenjörer som söker anställning. I mitt fall var det att jag jobbat extra som mattelärare, vilket jag fått mycket positiv respons för. Dessutom var jag huvudansvarig för studentmottagningen och hjälpt till med andra arrangemang. Jag skulle rekommendera alla blivande studenter att passa på att engagera sig som tusan. Det är inte bara roligt utan ser dessutom bra ut i ditt CV.

40

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp

Foto: NASA

Elektrotekniska system, utveckling & konstruktion


elektroteknik Att förnya och bygga ut Sveriges­elkraftnät är viktiga och utvecklande uppgifter, bland annat för att i framtiden kunna ersätta fossila bränslen med förnybara energikällor. Din förmåga som ingenjör att konstruera och utveckla nya tekniska produkter och system har stor inverkan på klimatfrågan och även Sveriges ekonomi. Det gör att det finns ett växande behov av hög­skoleingenjörer med bred och djup kompetens i elektroteknik både i Sverige och utomlands.

V

och breda grundkunskaper som direkt tillämpbara färdigheter. Projektarbeten är viktiga moment i kärnkurserna i samtliga årskurser. Kurserna och delar av kurslitteraturen är på svenska men det förekommer föreläsningar, artiklar och kursböcker på engelska. Programmets näringslivsanknytning med till exempel ABB, Vattenfall, Fortum via studiebesök, fältlaborationer och projektuppgifter ger en tydlig koppling till möjliga arbetsgivare.

Elektroingenjörer behövs för arbete med utveckling, konstruktion, test, drift och underhåll av elektrotekniska system inom många områden. Dagens komplexa elkrafts­system skapar samberoende och därmed större sårbarhet.

årt samhälle påverkas starkt av den elektrotekniska utvecklingen. Europas över 100 år gamla elnät behöver förnyas och i Afrika och Asien saknar två miljarder människor tillgång till elektricitet. I takt med det växande behovet av modern infrastruktur för el ökar också efterfrågan på kvalificerade elektroingenjörer. Tillgång till billigt och miljövänligt framställd el är viktig för den ekonomiska utvecklingen, speciellt i utvecklingsländer. Dessa drabbas i högre grad av miljöproblem och klimatrelaterade förändringar på grund av ökade koldioxidutsläpp. Elnätets betydelse som energieffektiv och miljövänlig energibärare blir större och större. Elbilar introduceras i mer omfattande skala. Det krävs därför modernare styrsystem och energibesparande lösningar för att få ett hållbart samhälle. På högskoleingenjörsprogrammet i elektroteknik får du de teoretiska kunskaper och praktiska färdigheter för att kunna arbeta som elektroingenjör inom alla dessa områden, och fler därtill. Utbildningen i Uppsala ger dig breda tekniska kunskaper men hjälper dig också att bli bättre på att kommunicera, samarbeta och tänka kreativt. Du får kontakter med näringslivet och får vara med i frontlinjen när du får följa Uppsala universitets unika spetsforskning inom den förnybara elenergiproduktionen som bidrar till utvecklingen av en ny svensk industri. Ingenjörsinriktade projektkurser utvecklar dina färdigheter och förbättrar dina chanser att få ett attraktivt jobb. Om undervisningen Kärnkurserna som elektroteknikens grunder, elektronik, elkraftteknik samt mät- och styrsystem ger dig såväl gedigna

Studera utomlands Under sista terminen kan du göra examensarbetet och/eller läsa valbara kurser utomlands via Uppsala universitets utbytesavtal.

Upplägg Årskurs ett läser du matematik, grundläggande mekanik samt ett kursblock i elektroteknikens grunder. Under årskurs två och tre läser du kurser i elektronik, elkraftteknik, programmering och beräkningsvetenskap, CAD, mjuk- och hårdvarudesign av mät- och styrsystem, företagsekonomi samt projektledning. Många kurser är projektorienterade och ger dig möjlighet att direkt omsätta teorin i praktiken. I årskurs tre kan du välja mellan att ytterligare bredda din kompetens eller fördjupa dig i ett smalare område inom elektroteknik beroende på ditt intresseområde. Den sista terminen avslutas med ett examensarbete på 15 hp. Därigenom får du chans att visa din förmåga att arbeta som ingenjör och du får också tillfälle att knyta kontakter med framtida arbetsgivare. Alternativt kan du läsa kompletterande kurser för att sedan kunna söka till senare del på civilingenjörsprogrammet i elektroteknik eller till det ettåriga högskoleingenjörsprogrammet i kärnkraftteknik. Karriär Med en examen i elektroteknik från Uppsala universitet får du möjlighet till ett spännande och utvecklande arbete. Elektroingenjörer behövs för arbete med utveckling, konstruktion, test, drift och underhåll av elektrotekniska system inom olika områden. Vår framtida energiförsörjning är ett viktigt område där elektroingenjörer kan jobba med allt från att producera elkraft till intelligent styrning av energiförbrukningen. Programmet har stark anknytning till den världsledande forskningen som bedrivs på Ångströmlaboratoriet inom elektrisk energigenerering och elektriska drivsystem.

Elektroteknik

Högskoleingenjörsprogram 180 hp

Årskurs 1 Introduktion till elektroteknik Elektroteknikens grunder I: Komponenter och kretsar Algebra och vektorgeometri Elektroteknikens grunder II: Kretsteori Envariabelanalys Projektarbete i elektroteknik Elektroteknikens grunder III: Fältteori Mekanik HI

 5 hp 5 hp 5 hp 5 hp 10 hp 15 hp 10 hp 5 hp

Årskurs 2 Elektronik (projekt 5 hp) Transformmetoder EI Beräkningsvetenskap I Elkraftteknik Roterande elektriska maskiner Statistik för ingenjörer Elektriska transmissionssystem CAD med FEM

20 hp 5 hp 5 hp 5 hp 5 hp 5 hp 10 hp 5 hp

Årskurs 3 Mät- och styrsystem 20 hp Programmeringsteknik I 5 hp Företagsekonomi, baskurs A/B (obligatorisk) 5 hp Valbara kurser 15 hp Examensarbete i elektroteknik 15 hp Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 3c alternativt Fysik B, Kemi A, Matematik D

Examen Utbildningen leder till en högskoleingenjörsexamen, vilket är en yrkesexamen. Program på avancerad nivå

Efter din högskoleingenjörsexamen kan du välja att fortsätta på bland annat följande master- eller magisterprogram på Uppsala universitet: Industriell ledning och innovation, 120 hp Hållbar utveckling, 120 hp Vindkraftprojektering, 60 hp

Kristin Hadenius: ”Vi

jobbar­mycket i projektform, där man får testa olika saker inom elektroteknik och det är kul.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

41


Teknikkunskap & helhetssyn

Kristian Hakala, underhållschef, Nordkalk – Utbildningen täcker in många av de behov industrin har idag. Jag är själv ingenjör med inriktning mot produktion och har även läst ekonomi. Den profilen har hjälpt mig mycket i mitt yrkesliv. Kombinationen ingenjör med kompetens inom kvalitet, ekonomi, produktion och miljö ger verktyg och möjlighet att möta de många komplexa utmaningar som ställs inom dagens moderna verksamheter.

42

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Kvalitetsutveckling & ledarskap Högskoleingenjörsprogrammet i kvalitetsutveckling och ledarskap på Gotland ger dig en bred men samtidigt unik kompetens. Du får ingenjörens förmåga att analysera och angripa problem i kombination med kunskaper inom bland annat ledarskap, ekonomi och kvalitets­ utveckling. Dina kunskaper blir branschoberoende vilket gör dig efterfrågad inom såväl traditionell industri som tjänste­ producerande organisationer.

redan under utbildningen. Du får som student jobba aktivt med tillämpning av teoretiska kunskaper och på så sätt blir du väl förbered för din framtida yrkesroll som ingenjör. Under examinationerna är förståelse och tillämpning det viktiga. Därför kommer inte examinationerna bara att bestå av skriftliga sluttentor, utan vi kommer också att använda oss av löpande examination under kursernas gång genom till exempel kontrollskrivningar, skriftliga inlämningsuppgifter, muntliga presentationer, rapporter, laborationer, litteraturstudier, seminarier och projektarbeten. Studiemiljön på Campus Goten värld av global konkurrens Utbildningen är branschoberoende, land är småskalig och främjar god får utvecklings- och förändvilket gör dig efterfrågad både inom traditionell industri och inom tjäns­ kontakt mellan studenter och ringsfrågor en allt större beteproducerande företag. Du blir en lärare, här finns lång erfarenhet av tydelse för företag och organiingenjör med de rätta verktygen för att stödja studenters individuella sationer. För att kunna arbeta med att kunna lösa framtidens problem. lärprocess och att samverka med detta bör du har ett tänkande som det omgivande samhället. kombinerar teknikkunskaper med en helhetssyn på management och förändringsfrågor. Studera utomlands Med universitetets utbytesHögskoleingenjörsprogrammet i kvalitetsavtal får du stora möjligheter att läsa en termin utveckling och ledarskap är utformat för att ge eller ett läsår vid ett utländskt lärosäte. Uppsala dig de kunskaper och ingenjörsmässiga färdigheuniversitet har utbytesavtal till alla kontinenter ter som krävs för en framgångsrik karriär inom utom Antarktis. det industrielltekniska området. Du kommer att utveckla en bred kompetens inom kvalitetstekKarriär Högskoleingenjörsprogrammet i kvalinik, kvalitetsutveckling, ledarskap, projektledtetsutveckling och ledarskap ger dig möjlighening, kommunikation, ekonomi och grundlägter till ett spännande och utvecklande framtida gande kunskaper i matematiska metoder. Du arbetsliv. Din utbildning är branschoberoende, får även fördjupande kunskaper och färdigheter vilket gör dig efterfrågad både inom traditionell inom produktionsledning, processledning, förindustri och inom tjänsteproducerande företag ändringsledning, produktutveckling och industrioch organisationer. Dina framtida arbetsuppgifter ell ekonomi. Med programmet i ryggen blir du kan utgöras av allt från traditionella ingenjörsaren ingenjör med de rätta verktygen för att kunna betsuppgifter till arbetsuppgifter som kvalitetsanlösa dagens och framtidens problem. svarig, projektledare för tekniska utvecklings- och Du som student får tillämpa dina teoreförändringsprojekt, verksamhetsutvecklare eller tiska kunskaper praktiskt med bland annat olika teknisk inköpare. Vidare har du också goda möjinlämnings- och projektuppgifter till externa ligheter till olika ledande befattningar i framtiden. uppdragsgivare. Som avslutning på programmet Efter din examen kan du fortsätta med en tvågör du ett examensarbete om 15 högskolepoäng årig masterutbildning. Uppsala universitet har en (hp) under den sista terminen. Under examenstvåårig masterutbildning i industriell ledning och arbetet får du möjlighet att visa dina kunskaper innovation, som ger ett helhetsperspektiv på tekoch färdigheter som ingenjör samtidigt som du nik, ledarskap och internationell affärsverksamockså får tillfälle att knyta närmare kontakter het. Beroende på dina intressen finns det andra med framtida arbetsgivare. masterutbildningar, dels på Uppsala universitet, men även nationellt och internationellt. Om undervisningen Under programmet komPå Uppsala universitet bedrivs aktiv forskning mer du att möta flera olika typer av undervisinom området. Bland annat sker forskning inom ningsformer som föreläsningar, seminarieövningar, beröringspunkterna mellan kvalitetsutveckling räkneövningar, laborationer, självstudier, inlämoch hållbar utveckling, management med fokus ningsuppgifter och verklighetsanknutna projekt på ledarskap, samt inom organisation och leddär fokus ligger på att i möjligaste mån ha en ning av teknikintensiva verksamheter med särkoppling till näringslivet. skilt fokus på projekt och hållbar organisering. Du får även göra studiebesök på olika företag Resultaten av forskningen möter du som student och organisationer varvat med gäst­föreläsningar genom lärarna som ofta är aktiva forskare. vilket ger dig möjlighet att skapa ett kontaktnät

I

Campus Gotland

Kvalitetsutveckling och ledarskap

Högskoleingenjörsprogram 180 hp

Årskurs 1

Projekt och ledning 10 hp Grundkurs i industriell ekonomi 10 hp Introduktion till kvalitetsteknik för ingenjörer 5 hp Hållbar utveckling, CSR och livscykelanalys 10 hp Kvalitetsutveckling 5 hp Ledarskap och kommunikation 5 hp Projekt i kvalitetsteknik för ingenjörer 5 hp Verksamhetssystem och ledning 10 hp

Årskurs 2 Industriell marknadsföring, inköp och försäljning Algebra och vektorgeometri Funktionslära för ingenjörer Produktions- och produktekonomi Statistik för ingenjörer Lean och Six Sigma inklusive förbättringsprojekt Statistisk kvalitetsstyrning och försöksplanering Ledarskap – att leda andra Energi – System och teknik

10 hp 5 hp 10 hp 5 hp 5 hp 10 hp 5 hp 5 hp 5 hp

Årskurs 3 Design och implementering av logistiska optimeringsmodeller Processledning och logistik Produktionsledning Att leda förändring Produktutveckling och industriellt service management Hållbar industriell verksamhetsutveckling Förstudie för examensarbete i kvalitetsutveckling och ledarskap Examensarbete i kvalitetsutveckling och ledarskap

5 hp 10 hp 5 hp 10 hp 5 hp 5 hp 5 hp 15 hp

Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 3c alternativt Fysik B, Kemi A, Matematik D

Examen Utbildningen leder till en högskoleingenjörsexamen, vilket är en yrkesexamen. Program på avancerad nivå

Efter din högskoleingenjörsexamen kan du välja att fortsätta på bland annat följande master- eller magisterprogram på Uppsala universitet: Industriell ledning och innovation, 120 hp Hållbar utveckling, 120 hp Vindkraftprojektering, 60 hp

Nina Geuken: ”På program­

met får man både matte- och teknikdelen tillsammans med ledarskap och hur människor fungerar. Det passar mig bra.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

43


Foto: Shutterstock

Produktutveckling & produktionsteknik

SIMON SMEDBERG, produktionsteknisk chef på Sandvik Coromant. – Jag ansvarar för en avdelning som jobbar med beredningsautomation för våra tillverkningsflöden. Det är en blandning från att ta hand om det dagliga och till mer långsiktigt strategiskt arbete. – Det började sommaren 2007 innan sista året på utbildningen när jag gick Sandviks sommarteknolog­ program för ingenjörsstudenter. Jag fortsatte med att göra mitt ex-jobb här och sökte under tiden en tjänst som produktionstekniker – som jag fick. Ganska snart fick jag huvudansvaret för stora komplexa investeringsprojekt. Därefter blev jag projektledare med allt från konceptutvärderingar, produktgranskning, maskinberedning och flöden, till en stabil tillverkning och säkra leveranser. – Från utbildningen har nog den största nyttan varit att få lära sig att angripa problem och frågeställningar. En maskinteknisk utbildning ger en väldig bredd – sedan är det upp till en själv hur man vill fördjupa sig. – Jag ser ljust på framtiden och tycker det märks överallt, inom företaget, hos leverantörer och kunder. Det gäller att inte konkurrera med priset utan vara först och bäst med det man erbjuder. Utmaningen blir att hänga med i nya tillverkningstekniker och -metoder.

44

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


M askinteknik Vill du vara med och ta fram morgondagens produkter? Vill du lära dig hela processen i att utveckla ny teknik från idé till färdig produkt? Vill du förverkliga dina idéer genom att arbeta med produktutveckling i samarbete med näringslivet? Det kan bli verklighet om du läser till ingenjör i maskin­teknik vid Uppsala universitet.

Matematiken ger dig den grund du behöver för de båda andra blocken. I det tekniska basblocket läser du maskiningenjörs­ ämnen som datorstödd konstruktion, mekanik, hållfasthetslära, maskin­ element och tillverkningsteknik. Du arbetar med samma CAD/ CAM-system som många ledande industri­företag använder. I blocket ingenjörskompetens får du lära dig kommunikation, kreativitet och kvalitet. Du får perspektiv på ingenjörens roll och ansvar i ett modernt samhälle i kurser som till exempel kvalitetsteknik, miljöteknik och ekonomi samt även i ditt examensarbete. ögskoleingenjörsproProduktutveckling är den proSom maskiningenjör är du med och grammet i maskincess som följer en produkts olika tar fram morgondagens produkter. Du lär dig hela processen i att teknik ger dig goda stadier från idé över konstruktion utveckla ny teknik från idé till färdig kunskaper i traditionell och tillverkning tills att den har produkt. maskinteknik. Du får också en heltjänat ut hos kunden och det är hetsbild av alla led från kundbehov till tillverkning dags för återvinning. En produkts design är ofta av nya produkter. I många av våra kurser används lika viktig som dess funktion. systematiskt datorstöd, främst 3D CAD. Du läI kursen Produktutveckling och design får du ser de avslutande kurserna i produktutveckling i en första inblick i hur formgivning av produkter samarbete med industrin. Allt detta ger dig en bra går till. Du kan också välja att läsa ett antal ickegrund att stå på inför dina framtida utmaningar tekniska kurser som till exempel språk, humanisom yrkesverksam maskiningenjör. ora, ekonomi eller juridik. Det finns även möjligProgrammet ger dig en bred kompetens inom het att bredda dina kunskaper inom ingenjörsomdet maskintekniska området. I de avslutande kurrådet med kurser från övriga ingenjörsprogram. serna finns i första hand möjlighet att profilera utbildningen mot produktutveckling eller produkKarriär Maskiningenjörerna är inte direkt knutna tionsledning. till en bransch utan överallt där fysiska produkter Som färdig högskoleingenjör i maskinteknik konstrueras och tillverkas behövs maskiningen­ har du många valmöjligheter och kan se fram mot jörens kompetens. De tillverkande teknikföreutmanande arbetsuppgifter. tagen står för en stor del av Sveriges export och omfattar en rad olika branscher, till exempel Life Om undervisningen Det första året varvas föreScience, energiteknik, telekommunikation, tekläsningar, ­lektioner och laborationer. Under senare nisk konsult och verkstadsindustrin. Detta gör att delen av utbildningen blir det fler seminarier och arbetsmarknaden för maskiningenjörer är god och projektarbeten. Som student på högskoleingenrelativt stabil över tiden, det vill säga mindre konjörsprogrammet i maskinteknik får du en verkjunkturkänslig än för många andra ingenjörer. lighetsanknuten utbildning. Du får jobba konkret Maskiningenjörsutbildningen vid Uppsala har med projekt utifrån produktspecifikationer, på en profilering mot produktutveckling och det är samma sätt som inom industrin. även den vanligaste yrkesrollen för de studenVi gör ofta studiebesök på olika företag för ter som tagit examen från programmet. Andra att se hur teorin från utbildningen kan användas exempel på arbetsuppgifter för yrkesverksamma i praktiken. Du får också lyssna på gästföreläsare maskiningenjörer är produktionsledning, projektfrån organisationer och företag som berättar om ledning, kvalitetsteknik, försäljning och inköp. sina yrkeserfarenheter. I några av spetskurserna Det finns också möjlighet att fortsätta plugga undervisar också gästlärare från näringslivet. efter examen. Den som har en högskoleingenjörsexamen är behörig att söka till tekniska mastersutUpplägg Utbildningen till ingenjör i maskintekbildningar i och utanför Sverige. Är du intresserad nik kan delas in i tre block: av projektledning och management? Då kan vi varmt rekommendera Masterprogrammet i indumatematik  striell ledning och innovation som ges vid Uppsala tekniskt basblock  universitet. ingenjörskompetens 

H

Maskinteknik

Högskoleingenjörsprogram 180 hp

Årskurs 1 Introduktion till maskinteknik Matematik Mekanik Datorstödd konstruktion Konstruktionsmaterial Hållfasthetslära Maskinelement

 5 hp 15 hp 5 hp 10 hp 5 hp 10 hp 10 hp

Årskurs 2 Företagsekonomi Energiteknik Tillverkningsteknik Elektriska maskiner Statistik Produktutveckling och design I Automatiserings- och robotteknik Ingenjörsmetodik Styr- och reglerteknik Praktisk produktframtagning

5 hp 5 hp 10 hp 5 hp 5 hp 10 hp 5 hp 5 hp 5 hp 5 hp

Årskurs 3 Industriell projektledning Kvalitetsteknik Miljöteknik Ledarskap för ingenjörer Produktionsledning I

5 hp 10 hp 5 hp 5 hp 5 hp

Påbyggnadskurs: Produktutveckling II Produktionsledning II Examensarbete

10 hp 10 hp 15 hp

Allmän behörighet: Grundläggande behörighet samt: Fysik 2, Kemi 1, Matematik 3c alternativt Fysik B, Kemi A, Matematik D

Examen Utbildningen leder till en högskoleingenjörsexamen, vilket är en yrkesexamen. Program på avancerad nivå

Efter din högskoleingenjörsexamen kan du välja att fortsätta på bland annat följande master- eller magisterprogram på Uppsala universitet: Industriell ledning och innovation, 120 hp Hållbar utveckling, 120 hp Vindkraftprojektering, 60 hp

Felix Brunnstedt:

”Jobbat inom stålindustrin innan och blev intresserad av produktionsprocessen. Tänker fortsätta med master.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

45


FOTO: Oscar Edwards

Vill du förena ditt intresse för naturvetenskap och bild­ning och samtidigt jobba med unga människor på väg mot vuxenlivet? Ämneslärarprogrammet ger dig en gedigen natur­ vetenskaplig utbildning där du kommer att få ämneskunskaper på både djupet och bredden. Men det viktigaste av allt är att du lär dig och får verktygen för hur du ska väcka intresse, kunna förklara och lära ut samt att vara en inspiratör.

Behörighet:

Olika behörighetskrav baserat på inriktning.  www.uu.se/utbildning

46

Ämneslärarprogrammet Ä mneslärarprogrammet är en doldis bland de naturvetenskapliga utbildningarna. Du kan bland annat läsa till ämneslärare i fysik­ & matematik, kemi, biologi, naturkunskap eller­matematik. När du är klar med dina studier har du en bra grund att stå på som lärare och ledare­i klassrummet. Läraryrket innebär att du gillar kombinationen kunskap och att lära ut samt vill ha ett socialt yrke där du träffar många människor.

är yrkesverksamma, kommer att handleda och stödja dig. Under VFU:n utvecklar du din yrkes­ identitet. Du får tillfälle att studera och reflektera över läraryrket och dess villkor samt träffa kolleger med olika bakgrund och erfarenheter. Under den tiden bygger du upp din egen didaktiska verktygslåda. Det är ett krav på att nyantagna studenter på lärarprogrammen i Sverige ska visa utdrag ur belastningsregistret för att få genomföra VFU.

Programmet Ämneslärarprogrammet omfattar 300–330 högskolepoäng (hp), beroende på vilka ämnen du vill undervisa i och leder till en ämneslärarexamen med inriktning mot arbete i gymnasieskolan. Du startar med studier i ett av ämnena biologi, kemi, naturkunskap, matematik eller kombinationen fysik & matematik. Först senare väljer du ditt andra ämne, vilket ger dig tid att fundera på hur du vill forma din utbildning. Det kan vara inom ett annat naturvetenskapligt ämne alternativt ett inom matematik, humaniora, samhällsvetenskap eller språk. Kombinationsmöjligheter och intresse styr ditt ämnesval. Centralt i läraryrket är ämnesdidaktik – förutsättningarna för elevers lärande och hur du kan undervisa i dina ämnen. Det handlar inte enbart om vad som sker i klassrummet under en lektion, hur du som lärare väljer vad som ska läras ut eller på vilka grunder detta sker. Det handlar också om skolans plats i samhället, barn och ungas identitetsutveckling, mångfaldsfrågor som etnicitet, kön, klass och funktionshinder samt frågor kring etik och demokrati. Utbildningen lägger stor vikt vid konflikthantering och ledarskap. I den verksamhetsförlagda utbildningen (VFU) testar du dina kunskaper och övar på att undervisa. På en skola tränar och utvecklar du dina färdig­ heter som pedagog. Dina lärarutbildare, som själva

Undervisningen Ämneslärarprogrammet ges på helfart och undervisningsformerna varierar beroende på vilka kurser du läser. Förutom föreläsningar, seminarier och verksamhetsförlagd utbildning förekommer olika former av arbetslagsarbeten. Dina undervisningsämnen läser du på en ämnesansvarig institution och de lärargemensamma kurserna på Campus Blåsenhus.

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

Studera utomlands Internationella ut­byten är en viktig del av lärarutbildningen. Uppsala­universitet samarbetar med en rad framstående universitet som erbjuder lärarutbildning. Du kan även göra en del av din VFU på en skola utomlands. Efter utbildningen En examen från ämnes­ lärarprogrammet ger dig redskap som behövs som ledare och lärare. Som lärare har du ett av världens viktigaste jobb och behovet av välutbildade lärare finns ständigt. Efterfrågan på välutbildade lärare inom naturkunskap och matematik är stor. Din dubbla kompetens i didaktik och ämneskunskap samt dina kunskaper i kommunikation och ledarskap gör det även möjligt att söka arbete inom branscher där det krävs naturvetenskapliga meriter som exempelvis life science, miljö­sektorn, kemiindustrin eller inom matematik/statistik­ området.


k andidat& masterprog r am

E

n naturvetenskaplig utbildning är början på din nationella eller internationella karriär! Vill du ha en utbildning där du kan arbeta inom alla sektorer och alla branscher på arbetsmarknaden? Naturvetare arbetar med bland annat forskning och utveckling, tillsyn, konsultarbete, eget företagande, rådgivning, laboratoriearbete, kommunikation, projektledning och som chefer. De naturvetenskapliga programmen är inriktade mot ett ämnesområde snarare än ett nischat yrke. Inom programmen kan du välja att bredda eller fördjupa dina kunskaper och på så sätt skräddarsy din individuella profil. Redan under första året får du smakprov på olika områden för att du ska hitta det du tycker är mest intressant. Senast efter år två kan du specialisera dig mot ditt intresse. Om du väljer att läsa ett masterprogram kan du specialisera dig ytterligare eller bredda dig. Du som vill arbeta för en hållbar samhällsutveckling, ta fram morgondagens produkter eller flytta fram gränserna inom ditt specialistområde, har efter din utbildning goda karriärmöjligheter. Att dina lärare är aktiva forskare innebär att du får med dig värdefulla specialistkunskaper in i arbetslivet. Som naturvetare blir du bra på problemlösning, får en djup förståelse inom ditt område, utvecklar din analytiska och kommunikativa förmåga, lär dig att arbeta självständigt och i grupp. Genom detta är du väl rustad att tackla framtidens okända utmaningar.

Kandidatprogram 180 hp Kvalificerad naturvetenskaplig utbildning som leder till en bred och specialiserad kompetens, inriktad mot ett ämnesområde snarare än ett specifikt yrke.

Inom naturvetenskaplig utbildning varvas föreläsningar med laborationer/ fältmoment, seminarier och praktik.

Beroende på ämne läser du en kurs i taget eller flera kurser parallellt. Avslutas med ett 15 hp examensarbete.

Du ges möjlighet att studera en eller två terminer utomlands.

Under utbildningstiden kan du studera en eller flera terminer utomlands på något av de 500 universitet i världen som vi har utbyte med. Det finns också möjlighet att läsa det avslutande året inom Entreprenörskolan (sid 36).

masterprogram 120 hp Påbyggnadsutbildning som du kan välja att genomföra i Sverige eller utomlands.

Fokuserar på processer och samspel som ger fördjupad förståelse inom ditt ämne, eller breddar din kompetens. Avslutas med ett 30–45 hp examensarbete.

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp

47


Foto: Mahmoud Farag

Livets utveckling & framtidslösningar

Anna-Karin Olofsdotter, personalchef på Länsstyrelsen i Uppsala – Länsstyrelsen sköter många intressanta gröna frågor, alltifrån miljömål till folkhälsofrågor och uppdrag från andra myndigheter. Det är roligt att se och vara del av de stora samhällsprocesserna. – Synen på miljö och hur man hanterar föroreningar har ju förändrats ganska radikalt sedan 60-talet. Miljöfrågorna kommer säkert att fortsätta vara oerhört viktiga, men vi kommer nog att få se förskjutningar inom vilka miljöaspekter man lägger tonvikt på. Jag ser dock ingen risk för att intresset minskar. Myndigheternas roll kan komma att ändras, men att det kommer att fortsätta finnas statstjänstemän med miljöansvar här i Uppsala är jag helt övertygad om.

48

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


B iologi /molek y l ärbiologi Biologi, cellbiologi, ekologi, evolutionsbiologi, molekylärbiologi Biologi omfattar allt från ekologi och miljö till molekylär­ biologi och genetik. Med ett stort utbud av kurser inom biologi och molekylärbiologi väljer du själv inom kandidatprogrammet i Uppsala vilken sorts biolog du vill bli. Den stabila­grunden som också innehåller kemi och mate­ matik gör att du efter avslutad utbildning blir efterfrågad på såväl den nationella som inter­ nationella arbetsmarknaden.

Studera utomlands Du möter studenter från alla världsdelar när du studerar hos oss och du har möjlighet att själv åka utomlands och studera. Vi har studentutbyten med många europeiska och utomeuropeiska länder.

Upplägg De första två åren är gemensamma för alla som läser programmet och ger viktiga grundkunskaper inom alla delar av biologin. Du läser till exempel cellbiologi, organismbiologi, genetik, ekologi och fysiologi. Du läser också kemi samt matematik och statistik som är viktiga verktyg för en biolog. Tredje året inriktar du dig mot något biologiskt område, till exempel naturvård eller molekylärbiologi, genom valfria fördjupningskurser os oss får du en utbildMed en cell- eller mole­kylär­biologisk inriktning kan du till exempel jobba och ett självständigt projektarbete. ning som omfattar på läke­medels- och bioteknikföretag. Du kan göra forskningspraktik djupa faktakunskaper, Väljer du ekologisk eller evolutions­ hos landets främsta forskargrupper förmåga att lösa probiologisk inriktning så kan du arbeta inom många olika biologiska områmed natur- och miljövård. blem, tänka analytiskt och arbeta den, eller yrkespraktik på exempelvis vetenskapligt. Alla våra lärare är något av Uppsalas fler än hundra bioockså aktiva forskare med djupa teknikföretag eller på någon naturvårdsenhet. specialkunskaper som ger dig inblick i den senaste Därefter får du en kandidatexamen och kan forskningen. En enkät till våra alumner visar att antingen söka jobb eller fortsätta med en masterutbiologi­ studenter med grundexamen i biologi från bildning. Uppsala universitet är mycket nöjda med sin utbildning. Karriär Biologer från Uppsala universitet har ett Arbetslösheten bland biologer från Uppsala unibrett arbetsfält beroende på inriktning och intresse. versitet är låg och över sjuttio procent arbetar inom Väljer du ekologisk eller evolutionsbiologisk inriktett område där de har användning av sin biologi­ ning kan du arbeta med natur- och miljövård hos utbildning. Vi har ingångar både för dig som har läst arbetsgivare som till exempel länsstyrelser, Naturoch som inte har läst naturvetenskap på gymnasiet. vårdsverket, miljövårdsorganisationer och konsultföretag. Med en cell- eller molekylärbiologisk inriktOm undervisningen Undervisningen består av ning kan du till exempel jobba med läkemedelsutföreläsningar, laborationer, seminarier, exkursioner veckling eller mikrobiologiska analyser på läkemeoch studiebesök. Vi har väldigt god sammanhållning dels- och bioteknikföretag. Biologer kan också arbeta bland studenterna på programmet och god kontakt som lärare, vetenskapsjournalister eller på museer mellan lärare och studenter. Förutom biologiundervisoch i djurparker. ning av högsta kvalitet profilerar vi också vår utbildMånga studenter fortsätter med en masterexamen ning genom systematisk kommunikationsträning, med och en del även med forskarutbildning, för att speciaövningar i muntlig och skriftlig kommunikation samt lisera sig ytterligare. Med vår kandidatexamen i biogruppinteraktion som en del av undervisningen. logi som grund kan du välja mellan masterprogram Både våra egna kandidatstudenter och våra inom många olika ämnesområden över hela världen. utbytesstudenter och internationella masterstudenNågra exempel inom vårt eget masterprogram i bioter berömmer oss ofta för hur väl fungerande våra logi är miljötoxikologi, evolutionsbiologi, limnologi utbildningar är, även sett ur ett internationellt persamt immunologi och mikrobiologi. spektiv. Vid två tillfällen har Uppsala studentkår utsett programansvarig institution till bästa grundutbildningsmiljö.

H

Biologi/molekylärbiologi

Kandidatprogram 180 hp

Årskurs 1

Organismernas evolution och mångfald 10 hp Biologens kompetenser och det vetenskapliga arbetssättet 5 hp Molekylärbiologi och genetik 10 hp Mikrobiologi med infektionsbiologi 5 hp Kemi (3 kurser) 30 hp

Årskurs 2

Cellbiologi Fysiologi Kvantitativ biologi Matematik och statistik för biologer Ekologi och populationsgenetik

Årskurs 3

Valfria kurser Självständigt arbete

15 hp 15 hp 5 hp 10 hp 15 hp 45 hp 15 hp

Allmän behörighet: Grundläggande behörighet + Biologi 2, Fysik 1a/1b1+1b2, Kemi 2, Matematik 4 alt Biologi B, Fysik A, Kemi B, Matematik D Ingång för samhällsvetare: Grundläggande behörighet + Matematik 3b/3c, Naturkunskap 2 alt Matematik C, Naturkunskap B På ingången för samhällsvetare startar man med kursen Biovetenskap 30 hp och följer därefter kursordningen. Skillnaden mellan ingång för samhällsvetare och programmets "vanliga" ingång är att samhällsvetaringången endast har 15 hp valfri kurs under tredje året, istället för 45 hp.

Examen Programmet leder till en natur­veten­ skaplig kandidatexamen i huvudområdet biologi. Program på avancerad nivå

Årskurs 4-5

Efter din kandidatexamen kan du på Uppsala universitet välja: Masterprogram (120 hp): Biologi med nio olika inriktningar: Cell- och molekylärbiologi Ekologi och naturvård Erasmus Mundus - master i evolutionsbiologi (MEME) Evolutionsbiologi Genetisk och molekylär växtbiologi Immunologi och mikrobiologi Limnologi - inlandsvattnens ekologi och miljö Miljötoxikologi NABiS - samnordisk inriktning mot biodiversitet och systematik

Tillämpad bioteknik Bioinformatik Hållbar utveckling Magisterprogram (60 hp): Vindkraftprojektering

Erik Elgh: ”Många valbara

kurser.­Rekommenderar programmet för alla som gillar allt med naturen, vill bota cancer eller gillar paleontologi.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

49


Foto: Shutterstock

Programmering & produktutveckling

Ramus Haglund är spelutvecklare på Uprise – Uprise är en spelstudio och är en del av Electronic Arts där vi jobbar med spel som Battlefield och Star Wars Battlefront. Först tänkte jag jobba som egen konsult, men kom i kontakt med Uprise som verkade vara ett häftigt företag så jag tog anställning istället. Jag började som frontendutvecklare men har gått över till att jobba mestadels med backend, bland annat med lasttestning. – Det bästa med utbildningen var att den gav mig en väldigt djup förståelse för hur datorer, operativsystem och program fungerar, kunskaper som är en förutsättning för jobbet jag har. Eftersom vi fick lära oss grunderna i programmering och inte hade kurser i specifika programmeringsspråk gör det att jag lätt kan sätta mig in i helt nya språk och koncept. – Enligt mig ska man läsa datavetenskap för att man får lära sig häftiga saker, får kontakter för livet och för att det är så otroligt roligt och framtiden ser ljus ut då exempelvis spelindustrin växer för varje år.

50

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Datavetenskap Datorer används överallt i det moderna samhället – någon måste programmera dem, se till att programvaran blir lätt att använda och gör vad den ska. Kandidatprogrammet i datavetenskap i Uppsala och det efterföljande masterprogrammet ger dig praktiska och teoretiska kunskaper om modern informationsteknologi och programutveckling. Efter avslutad utbildning kan du jobba med att utveckla framtidens IT-lösningar på både små och stora företag.

De praktiska momenten är viktiga och dessa gör du oftast med hjälp av datorer. Inlämningsuppgifterna går oftast ut på att lösa problem som liknar dem du kan ställas inför i arbetslivet.

Kandidatprogram 180 hp

Årskurs 1 Matematik Datavetenskap

20 hp 40 hp

Årskurs 2

Studera utomlands Det finns mycket goda möjligheter att studera utomlands mot slutet av utbildningen, till exempel i Frankrike, Italien, Kina, Nederländerna, Singapore, Spanien, Storbritannien, Turkiet eller Tyskland.

Upplägg De två första åren ägnar du åt grundläggande studier i datavetenskap och matematik. Du lär dig bland annat Datorer används överallt och någon måste program­mera dem, programmera i flera programse till att program­varan blir lätt andidatprogrammet i språk, datorns arkitektur och hur att använda och gör vad den ska. datavetenskap ger dig operativsystem egentligen fungDatavetenskap ger dig rejäla prak­ praktiska och teoretiska tiska och teoretiska kunskaper om erar. informationsteknologin och uppsala kunskaper om informaDet tredje året läser du mer universitet är världsledande inom tionsteknologi, med fokus på hållavancerade datavetenskapliga flera data­vetenskapliga områden. bar programutveckling. Programkurser inom exempelvis datamet innehåller en blandning av kommunikation, kompilatorteknik och programkurser i matematik och datavetenskap, som grovt semantik. Om du väljer att fortsätta läsa år fyra kan delas in i fyra delområden: och fem på masterprogrammet kan du välja fritt i ett mycket stort utbud av spännande kurser. Datorsystem handlar om hur datorer  Undervisningen bygger på aktuell forskning fungerar i samverkan, ofta över stora avstånd. och förbereder dig för en internationell karriär Människa-datorinteraktion handlar också inom näringslivet eller forskarvärlden.  om hur datorer samverkar, men med oss människor. Efter utbildningen Efterfrågan på kompetenta medarbetare inom det datavetenskapliga Programvarusystem tar upp vad som krävs  området är mycket stor och väntas fortsätta växa. för att bygga riktigt stora datorprogram, med Många datavetare arbetar som projektledare eller många människor inblandade i utvecklingen. konsulter inom avancerad produktutveckling. Vanliga arbetsgivare är både mindre företag Formella metoder handlar om hur man kan  och storföretag, exempelvis inom IT-branschen bygga och analysera program och datorsystem men inte bara där. Många stora företag har på ett formellt, matematiskt sätt, för att mycket stora IT-avdelningar och egen programgarantera att de fungerar som de ska. utveckling vilket gör att datavetare kan hamna i nästan vilken bransch som helst. På institutionen för informationsteknologi studeEfter din kandidatexamen kan du bredda och rar du i en internationell miljö med lärare som fördjupa dina kunskaper genom att fortsätta med i många fall är världsledande forskare inom sina en tvåårig påbyggnad i form av en masterutbildområden. Väljer du att fortsätta på Masterproning i dataveten­ skap eller något angränsande grammet i datavetenskap är du väl förberedd område, till exempel människa–datorinteraktion, för en internationell karriär inom näringsliv eller inbyggda system eller tillämpad beräkningsveforskning. tenskap. Uppsala universitet bedriver världs­ ledande Om undervisningen Föreläsningar i helklass forskning inom flera datavetenskapliga områden, och lektioner i mindre grupper blandas med mer till exempel inom människa–datorinteraktion, praktiska inslag som laborationer, inlämningskompilatorteknik, formella metoder och datoraruppgifter och projektarbeten. Kurslitteraturen är kitektur. Forskningen drivs i nära samarbete med till stor del på engelska. Ibland är föreläsningarna industrin och är i särklass störst i Sverige. på engelska, särskilt under det tredje året.

K

Datavetenskap

Matematik Datavetenskap Övrigt

20 hp 35 hp 5 hp

Årskurs 3 Fördjupningsblock Valfria kurser Självständigt arbete

30 hp 15 hp 15 hp

Allmän behörighet: Grundläggande behörighet samt antingen Ma D eller Ma 4

Examen Programmet leder till en natur­veten­ skaplig kandidatexamen med datavetenskap som huvudområde. Program på avancerad nivå

Årskurs 4-5

Efter din kandidatexamen kan du på Uppsala universitet välja: Masterprogram (120 hp): Datavetenskap Hållbar utveckling Inbyggda system Industriell ledning och innovation Människa-datorinteraktion Tillämpad beräkningsvetenskap Magisterprogram (60 hp): Vindkraftprojektering

Geraldine Yactayo:

”Underbar stad med underbara männi­skor. Mest intressant på programmet är grupprojekten där man arbetar på liknande sätt som i yrkeslivet.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

51


Från mikrokosmos till hela universum

Ger dig grunden för att förstå universum från det oerhört stora till det ofattbart lilla

Karin Westermark, Head of Medical Science and Information, Galderma Har läst kandidat- och masterprogrammet i fysik, men också många kurser i kemi och biologi. Efter att ha disputerat i atommolekylfysik jobbade hon i fem år på VG Scienta. Längtade efter att få jobba mer med biologi och sökte sig vidare till Strålskyddsinstitutet. – Främst höll jag på med UV- och laserstrålning. Och där fick jag otippad användning av mina kunskaper i solceller från doktorandtiden. Hur reagerar huden på sol, och vad triggar man i cellerna när man belyser dem med UV-strålning? Så man vet aldrig när ens kunskaper kan komma till nytta. Idag är hon chef för en grupp som samlar fakta och sammanställer material om studier av kosmetiska­behandlingar och produkter. – Här är det viktigt att kunna ta till sig stora mängder fakta, analysera och sammanställa information i en rapport. Och det känner jag igen från grundutbildningen i fysik. Där måste man helt enkelt lära sig att lära sig saker och hitta bra sätt att ta till sig kunskap och sortera fakta. Grunden man får, hänger man upp ny kunskap på.

52

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp

Foto: Shutterstock

Meteorologin studerar jordens klimat och det som sker i atmosfären.


F ysik

Fysik, astronomi, geofysik och meteorologi

Fysiken behandlar stora frågor om framtidens energiförsörjning, ­jordens klimatutveckling, nya material och universums uppkomst. Kandidatprogrammet i fysik i Uppsala ger dig grunden för att förstå universum från det oerhört stora till det ofattbart lilla – från solsystem och galaxer via jorden och dess klimat till atomer och elementarpartiklar.

allt från fysikens grundläggande begrepp och modeller till dagsaktuell forskning. Basblocket innehåller också nyttiga kurser i matematik och datavetenskap och är upplagt för att ge behörighet till tredje årets kurser. Under det tredje året har du stor valfrihet bland många alternativa fördjupningsområden. Inom modern fysik kan du exempelvis fördjupa dig i materialfysik, energiforskning, partikelfysik, teoretisk fysik och andra tillämpningar av kvantmekanik. Inom astronomi kan du studera rymden, stjärnors födelse och död, galaxers utveckling och universums struktur. andidatprogrammet i Meteorologin utforskar jordens fysik ger dig breda och klimat, det som sker i atmosfären gedigna kunskaper i fyFrån oändligt stort till oändligt litet och allt där emellan. Fysiken och hur detta påverkar vårt väder. sik. Du kan också bredbehandlar stora frågor­om fram­ Inom geofysiken studerar du plada och specialisera dig, tack vare tidens energi­f örsörjning, jordens neten Jorden och vad som händer Uppsalas unika miljö med världsklimatutveckling, nya material och i dess inre och till exempel hur det ledande forskning och kompetens universums uppkomst. kan mätas med seismiska metoder. inom de flesta av fysikens områden. Du kan skräddarsy din utbildning mot framNågra spännande exempel är neutrinoforskningen tida jobb eller fortsatta studier med hjälp av olika med teleskopet IceCube på Antarktis, de teorevalfria kurser. Ingen obligatorisk kurs existerar, förtiska fysikernas arbete inom strängteori, astrofyutom det avslutande examensarbetet i årskurs 3. sikforskningen kring exoplaneter, förbättring av solceller genom molekylfysik och geofysikernas Karriär Den breda fysikkompetens du får ger dig strävan att förutsäga jordbävningar. många valmöjligheter efter en kandidatexamen. Oavsett om du väljer att inrikta dig mot astVäljer du att gå direkt ut i arbetslivet kan du ronomi, modern fysik, geofysik eller meteorologi till exempel arbeta med utveckling och användså går kandidatprogrammet djupare in i fysikens ning av olika typer av mätteknik och databehandvärld än de tekniska utbildningsprogrammen. Förling eller med modellering av dynamiska förlopp. utom fysik läser du ganska mycket matematik och Vanliga arbetsgivare är olika industrier, privata lite datavetenskap. företag, statliga verk eller myndigheter. Väljer du att studera vidare efter din kandidatOm undervisningen Undervisningen på kanexamen kan du gå en tvåårig masterutbildning vid didatprogrammet kan ske i stora och små grupUppsala universitet eller annat lärosäte i Sverige per, och du som student får många möjligheter att eller utomlands. Med en masterexamen kan du vara aktiv på föreläsningar och lektioner. De flesta arbeta inom såväl forskning som näringsliv både i fysikkurserna på programmet har praktiska inslag Sverige och utomlands. Inom masterprogrammet som laborationer, grupparbeten, projekt och falli fysik kan du fördjupa dig ytterligare inom det studier. Här tränas du att arbeta i grupp, tänka krifysikområde som intresserar dig. tiskt och att kunna framföra dina synpunkter. Vi Bland tidigare fysikstudenter finns yrkestitlar arbetar med kommunikationsträning genom hela som till exempel meteorolog, informatör, uniprogrammet, både muntligt och skriftligt. Dessversitetslektor, lärare, egen företagare, geofysiutom ingår interaktiva webbövningar och olika ker, utvecklingschef, koncernchef, projektledare, former av digital undervisning som ger stöd och affärsutvecklare, mjukvarudesigner, expert, testökad förståelse. koordinator och forskare. Meteorologer arbetar Lärarna på programmet är aktiva forskare inom med väder i olika sammanhang medan en geo­ fysikens olika områden. Undervisningen utvecklas fysiker lokaliserar naturresurser eller söker lämpockså hela tiden genom nära samarbete med forsliga underjordiska lagringsutrymmen för koldioxid kare specialiserade på lärande inom fysik. Kurslitoch använt kärnbränsle, eller ger råd om markstateratur på engelska är vanligt förekommande. bilitet i stora konstruktionsprojekt. Studera utomlands Vill du läsa en del av din En fysiker med en specialisering kan arbeta i utbildning utomlands kan vi erbjuda dig många många olika sammanhang, men en gemensam utbytesprogram runtom i världen. nämnare är att en färdigutbildad fysiker är en kunnig problemlösare som kan kommunicera sina Upplägg De två första åren läser du ett gemenslutsatser och leverera resultat. samt basblock med fysikkurser som behandlar

K

Fysik

Kandidatprogram 180 hp

Årskurs 1

Introduktionskurs till fysik, astronomi och meteorologi 5 hp Mekanik 15 hp Fysikprojekt 5 hp Termodynamik 5 hp Matematik och datavetenskap (flertal) 30 hp

Årskurs 2 Mekanik 5 hp Elektromagnetism 10 hp Fysikprojekt II 5 hp Optik 5 hp Fysikens matematiska metoder 10 hp Kvantfysik 10 hp Fluidmekanik (krävs för meteorologiinriktn.) 5 hp Matematik och datavetenskap (flertal) 15 hp

Årskurs 3 – fördjupning Fysik och astronomi Kärn- och partikelfysik Fasta tillståndets fysik Valfria kurser

10 hp 5 hp 30 hp

Geofysik – rekommenderat kursspår Datavetenskap Modern fysik Projekt i fysik Global geofysik Tillämpad och miljöinriktad geofysik Kontinuummekanik inom geofysik Jordens potentialfält Miljöekonomisk översiktskurs

5 hp 5 hp 5 hp 10 hp 10 hp 5 hp 5 hp 5 hp

Meteorologi – rekommenderat kursspår Datavetenskap Modern fysik Meteorologi, hydrologi, miljömätteknik Miljöekonomisk överssiktskurs Fjärranalys m meteorologiska tillämpn. Observera, analysera, presentera väder För alla fördjupningar: Examensarbete

5 hp 5 hp 15 hp 5 hp 10 hp 5 hp 15 hp

Allmän behörighet: Grundläggande behörighet + Fysik 2, Kemi 1, Matematik 4 alternativt Fysik B, Kemi A, Matematik E

Examen Programmet leder till en natur­ vetenskaplig kandidatexamen med fysik som huvudområde. Program på avancerad nivå

Årskurs 4-5

Efter din kandidatexamen kan du på Uppsala universitet välja: Masterprogram (120 hp): Fysik (med flera profilområden) Hållbar utveckling Industriell ledning och innovation Tillämpad beräkningsvetenskap Magisterprogram (60 hp): Vindkraftprojektering

Nora Karlsson:

”Min dröm är att stå på TED Talks och föreläsa.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

53


Foto: shutterstock

En planet i förändring – processer & utveckling

Jenny Johansson är hydrogeolog på Bergab – Jag arbetar mycket i projektform där jag bland annat utför hydrogeologiska undersökningar och följer upp tillståndsvillkor gällande vattenverksamhet. Jag kan fördela min arbetstid mellan fält och kontor vilket jag trivs otroligt bra med och jag arbetar med allt från stora infrastrukturprojekt så som Citybanan i Stockholm till hydroundersökningar för gruvindustrin i norra Sverige. – Utbildningen har gett mig en bred och stabil grund att stå på och med vidareutbildningen på mastersnivå lärde jag mig också vikten av att kunna kommunicera min kunskap med andra, vilket är en otroligt viktigt del i min yrkesroll. Geovetare är extra bra på att hantera stora informationsmängder och sedan lyfta fram det som verkligen betyder något. Geovetare behövs till de många infrastrukturprojekt som planeras och efterfrågan ökar i takt med större krav gällande miljö, klimat och hållbarhetstänk. – Geovetenskap är framförallt en rolig och nyttig utbildning som tar upp det viktigaste vi har idag, vår jord. Om vi ska kunna ta hand om den på rätt sätt behövs fler geovetare i byggbranschen eller på en tillsynsmyndighet. En geovetare bidrar alltid till en bättre värld, ett steg i taget!

54

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


geovetenskap Hydrolog-, geolog-, naturgeograf- och paleobiologi

En ökad konkurrens om naturtillgångar, klimatförändringar och allt större påfrestningar på miljön innebär nya utmaningar och möjligheter för dig som geovetare att bidra till en hållbar samhällsutveckling. Med en examen från kandidatprogrammet i geovetenskap kan du göra värdefulla insatser inom områden som rör naturresurser, miljö och samhällsbyggande.

kamrater och lärare och har stora möjligheter att få personligt stöd.

Geovetenskap

Studera utomlands Du har goda möjligheter att läsa delar av geovetarutbildningen utomlands. Utbytesprogram finns både via institutionens och via Uppsala universitets centrala avtal.

Årskurs 1

P

ser som ska ge progression i form av breddning och fördjupning inom huvudområdet geovetenskap. Kursutbudet är avsett att förbereda för både arbetslivet och för en fortsättning på mastersprogrammet. Kurserna inom huvudområdet täcker ett brett kunskapsfält som bygger på institutionens omfattande forsknings- och utbildningsverksamhet. Geovetenskap är gränsöverskridande till sin karaktär och arbetsmöjligheter och programmet ger många möjligheter till ett brett internationellt utbyte för studier, praktik eller arbete. Om undervisningen I utbildningen blandas teori med praktik. Vanliga former av undervisning är föreläsningar, seminarier, laborationer, dataövningar, exkursioner och fältstudier. Exkursioner och fältstudier är viktiga inslag för geovetare som ofta gör provtagningar, mätningar och bedömningar i fält. Geovetarutbildningen bedrivs i relativt små studentgrupper. Du får god kontakt med kurs-

Foto: V Pohjola

Upplägg Första årets kurser introducerar dig till geoveten­ skapen och utöver detta läser du kurser i matematik och statistik. På ingången för samhälls­vetare startar du med en förberedande kurs för fortsatta naturvetenskapliga studier, följt av samma introducerande kurs till geoveten­ å kandidatprogrammet i skapens som ingång för natur­ geovetenskap lär du dig Inom geovetenskap får du kun­ vetare. Skillnaden mellan ingånghur jorden är uppbyggd, ska­per om berggrunden, marken, vattnet, landskapet, livets ut­ arna är att du via ingången för hur den förändras och hur veckling och klimat­f örändringar. natur­vetare under första året läser atmosfär, hydrosfär, litosfär och Perspektivet är jorden i sin helhet kurser i matematik, statistik och biosfär samverkar till att skapa och och de processer som har format och hela tiden förändrar vår planet. landskapsutveckling. upprätthålla jordens klimat. Allt från vulkanism och jordskalv till Andra året får du ytterligare Perspektivet skiftar från det mineral- och gruvdrift. kunskaper på följande geovetenstora till det lilla och med ett tidsskapliga områden: berg, mark, vatten samt miljö perspektiv som sträcker sig från nutid till miljarder och naturresurser. Arbetsmarknaden efterfrågar år tillbaka i tiden. Med denna kunskap kan en geotekniska kunskaper hos geovetare, därför får du vetare även blicka framåt och göra tolkningar och under andra året även läsa kurser i till exempel analyser rörande jordens framtid. geofysik. Det är också under ditt andra år som Geovetenskapens fyra huvudområden är: du läser kemi. Hydrologi – läran om vattenförhållandena på  Tredje året fördjupar du dig inom geovetenjorden skapliga kärnämnen, med kurser till exempel Geologi – läran om berggrunden och dess  inom sedimentologi, livets utveckling, mark­ resurser stabilitet, vattenresursförvaltning, geografiska Naturgeografi – läran om landskapsutveckling  informationssystem (GIS) och geoteknik. Din och jordarter kandidatutbildning avslutas sedan med ett självPaleobiologi – läran om livets utveckling på  ständigt arbete, en fördjupning- eller projekt­ planeten jorden uppgift som som du kan välja att göra på institutionen eller i samarbete med en myndighet eller Programmet som helhet innehåller ett avvägt ett företag. utbud av teoretiskt och praktiskt inriktade kurKarriär Geovetare har ett brett arbetsfält och kan arbeta med aktuella frågor så som kartläggning och planering av hållbar användning av naturresurser, vatten samt miljö- och klimat­frågor. Som geovetare kan du jobba i Sverige och internationellt – dina kunskaper och färdig­ heter är applicerbara över hela världen. Arbets­ uppgifterna kan varierande med alltifrån fält­ arbete till hantering av avancerad analysutrustning och tolkning av resultat. Geovetare kan arbeta hos offentliga arbetsgivare som SGU (Sveriges geologiska undersökning), SMHI (Sveriges meteorologiska och hydrologiska institut), Naturvårds­verket, läns­styrelser eller kommuner men även hos privata arbetsgivare som konsultföretag, gruvföretag eller prospekteringsbolag. Efter examen kan du välja att läsa vidare två år på ett masterprogram vid Uppsala universitet eller något annat lärosäte i Sverige eller utomlands.

Kandidatprogram 180 hp

Biovetenskap (förber kurs för samhällsvet) Geovetenskap, planeten jorden Matematik Statistik för geovetare Landskapsutveckling

30 hp 30 hp 15 hp 5 hp 10 hp

Årskurs 2 Bergarter- och jordarter Geofysik Naturresurser och miljö Kemi Geokemi

15 hp 5 hp 10 hp 25 hp 5 hp

Årskurs 3

Kärnkurser och tillämpade kurser till exempel sedimentologi, stratigrafi och paleobiologi, hydrologi och vattenresursförvaltning, GIS och fjärranalys, geoteknik och byggnadsgeologi, strukturgeologi och markstabilitet, fältkurs 45 hp Självständigt arbete i geovetenskap, i enlighet med valt profilområde 15 hp Ingång för samhällsvetare

På ingången för samhällsvetare startar man med kursen Biovetenskap 30 hp (förberedande kurs för fortsatta naturvetenskapliga studier) och följer därefter kursordningen. Skillnaden mellan samhällsvetaringången och naturvetaringången är att kurserna i matematik, statistik och landskapsutveckling inte ingår i samhällsvetaringången. Allmän behörighet: Grundläggande behörighet + Biologi 2, Fysik 1a/1b1+1b2, Kemi 2, Matematik 4 alt Biologi B, Fysik A, Kemi B, Matematik D Ingång för samhällsvetare: Grundläggande behörighet + Matematik 3b/3c, Naturkunskap 2 alt Matematik C, Naturkunskap B

Examen Programmet leder till en naturvetenskaplig kandidatexamen med geovetenskap som huvudområde. Program på avancerad nivå

Årskurs 4-5

Efter din kandidatexamen kan du på Uppsala universitet välja: Masterprogram (120 hp): Masterprogram i geovetenskap – hydrologi/hydrogeologi, geologi, naturgeografi, paleobiologi och europeisk paleobiologiinriktning Masterprogram i hållbar utveckling Magisterprogram (60 hp): Vindkraftprojektering

Fredrik Österman:

”Programmet innehåller mycket fältstudier och jag gillar att vara ute i naturen.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

55


Foto: Alexander Giacomini

Experimentera, laborera & utveckla

Karin Stenberg, HR-direktör GE Healthcare Sverige – För oss är det viktigt att rekrytera medarbetare med rätt kompetens för att säkerställa företagets ställning i framkanten globalt av såväl forskning som tillverkning. Behovet av utbildad personal är idag större än antalet som examineras inom naturvetenskaper som biologi och kemi. Utöver formell kompetens vill vi ha nyfikna lagspelare, för vi är beroende av att alla kan jobba tillsammans. Det är viktigt att medarbetarna är fokuserade på kundens behov samt klartänkta, kreativa och modiga. En bra blandning av kunnande och nyfikenhet är en bra grund. GE Healthcare är ett globalt företag med drygt 50 000 anställda i mer än 100 länder. GE Healthcare har sitt huvudkontor i London och ingår i General Electrics.

56

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


K emi För dig som har fantasi, nyfikenhet och kreativitet har kemiämnet många spännande områden att erbjuda. Nya ämnen skapas varje dag i hopp om att hitta smartare material, nya mediciner och att få nya insikter om hur naturen fungerar. Från det senaste cancerläkemedlet till innovativ datorteknologi – från utveckling av alternativa energikällor till studier av avlägsna galaxer – kemi är en central och spännande vetenskap.

V

och studiebesök. Teori och experiment går hand i hand genom hela utbildningen och stor vikt läggs vid att lära dig arbeta på ett vetenskapligt sätt. Som en del i din utbildning ger vi dig också kommunikationsträning där övningar i både tal och skrift ingår i kurserna. All undervisning sker i moderna och välutrustade lokaler i Uppsala. Studera utomlands Vill du läsa en del av din utbildning utomlands kan vi erbjuda dig många utbytesprogram runtom i världen. Karriär Kemister behövs inom all industri, från läkemedel till metall, inom sjukvård och miljöskydd, inom forskning vid universitet och inom näringslivet, som lärare, vid patentbyråer samt inom vetenskaplig journalistik och brottsutredningar. Det är vanligt att man arbetar i grupp, särskilt på större företag. Många kemister har också arbetsledande ställning. Kemister har ett mycket brett arbetsfält med många tänkbara arbetsuppgifter beroende på profilering och intresse. Kemi är i grunden en laborativ vetenskap och för alla de kemister som arbetar i laboratorier är yrket lite att likna vid ett hantverk där kreativitet och skickligt handlag har lika stor betydelse som de teoretiska kunskaperna. Vissa discipliner laborerar mest framför datorn. Oavsett vilken kemispecialisering man har finns det också en mängd arbeten där kunskaper i kemi och inom något annat område som till exempel ekonomi, språk, kommunikation, projektledning, entreprenörskap, juridik eller hållbar utveckling kombineras. Dessa områden är exempel på möjliga biämnen. Efter din kandidatexamen kan du fortsätta med en tvåårig påbyggnad i form av en masterutbildning i kemi eller något annat ämnesområde. Behovet av kemister kommer att öka. Genomsnittsåldern för nu arbetande kemister i Sverige är hög och många kommer att gå i pension inom en snar framtid. Det gör att du efter utbildningen kommer att ha goda möjligheter på arbetsmarknaden.

Kemister behövs inom många indu­ strier, från läkemedel till metall, inom sjukvård och miljöskydd, inom forsk­ ning vid universitet och inom närings­ livet. Du kan arbeta som lärare, vid patentbyråer samt inom vetenskaplig journalistik och brottsutredningar.

id Uppsala universitet hittar du de flesta inriktningar inom kemi­ ämnet. Här bedrivs forskning inom kemins alla grenar tillämpat på en rad olika områden som till exempel material, energi, biosensorer, läkemedel, miljökemi och nanoteknologi. Denna mångfald avspeglas också i det stora kursutbud som väntar dig. Lärarna på programmet är själva aktiva forskare med djupa specialkunskaper inom sina områden. Kemiutbildningen vid Uppsala universitet fick hösten 2010 det näst högsta betyget från internationella studenter i CHE:s Europarankning. Detta var mycket tack vare det stora kursutbudet, den starka forskningsanknytningen samt den goda laborationspedagogiken. Vid Universitetskanslersämbetets utvärdering 2013 fick utbildningen betyget ”hög kvalitet”.

Om programmet Programmets styrka ligger i möjligheten att få djup kemikunskap samtidigt som du får bredda dig inom andra relevanta områden. De tre första terminerna på programmet består av gemensamma kurser för alla inriktningar. Sen för­djupar du dig inom valda kemiområden. Du kan också bredda dina kunskaper med ämnen som till exempel matematik, biologi, fysik, språk, ekonomi, juridik eller något helt annat som ger dig en unik profil.

Kemi

Kandidatprogram 180 hp

Årskurs 1 Grundkurser, kemi, organisk kemi, oorganisk kemi och biokemi

40 hp

Grundkurser i matematik

20 hp

Årskurs 2

Under tredje terminen resterande kemigrundkurser: analytisk kemi, fysik för kemister och fysikalisk kemi 30 hp Under fjärde terminen börjar du forma din egen profil. Programmet erbjuder påbyggnadkurser i kemi samt grundkurser inom andra ämnesområden. För examen krävs minst 30 hp inom ett annat ämnesområde än kemi.

Årskurs 3 Valfria kurser

45 hp

Examensarbete

15 hp

Allmän behörighet: Grundläggande behörighet + Biologi 2, Fysik 1a/1b1+1b2, Kemi 2, Matematik 4 (områdesbehörighet A11) alternativt Biologi B, Fysik A, Kemi B, Matematik­D (områdes­behörighet 14)

Examen Programmet leder till en natur­ vetenskaplig kandidatexamen med kemi som huvudområde. Program på avancerad nivå

Årskurs 4-5

Efter din kandidatexamen kan du på Uppsala universitet välja: Masterprogram (120 hp): Kemi – Inriktningar: analytisk kemi, biokemi, bio- och nanomaterial, EACH Excellence in Analytic Chemistry, fysikalisk kemi, kemi för förnybar energi, kemisk biologi, organisk kemi, teoretisk kemi. Hållbar utveckling Industriell ledning och innovation Tillämpad beräkningsvetenskap Tillämpad bioteknik Magisterprogram (60 hp): Vindkraftprojektering

Om undervisningen Undervisningen består av föreläsningar, lektioner, laborationer, seminarier Johan Pettersson:

”Ville bli marinbiolog men kemi är mycket roligare. Mycket tid och hjälp från föreläsarna. Tänker gå vidare med master och få mer spetskompetens.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

57


Företags- & organisationsutveckling

Foto: Mikael Wallerstedt

Jonas Eriksson pluggar Ledarskap-Kvalitet-Förbättring i Visby – Det är ett unikt program med fokus på ledarskap i kvalitet och utvecklingsfrågor. Programmet var som skräddarsytt för mig då jag ville utveckla mitt ledarskap och jag gillar att arbeta i projekt. Projektmetodiken erbjuder möjlighet att verkligen veta om man gör ett bra jobb i och med de tydliga målsättningar som sätts samtidigt som det även ger mig valmöjlighet att variera mitt arbete över tid. Stämningen blir lätt väldigt familjär då Campus Gotland är mindre där kontakten studenter emellan är bra, både i klassen men även mellan programmen, och vi får en nära lärarkontakt där vi kan diskutera ledarskapsfrågor i detalj. På fritiden är jag engagerad i Rindi studentkår som fungerar både som kår och nation här på Gotland. Det blir mycket fika och middagar samt utflykter i den otroligt vackra Gotländska naturen. Ledarskap-Kvalitet-Förbättring ger en bred kunskap inom flera områden med betoning på att utveckla dig som person inom lednings-, kvalitets- och utvecklingsfrågor.

58

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


Ledarskap Kvalitet Förbättring Vill du leda och utveckla fram­ tidens företag och organisationer? Då är kandidatprogrammet i ledarskap – kvalitet – förbättring rätt utbildning för dig. Du får en branschoberoende utbildning som ger dig en bred kunskap om verksamhetsutveckling. Du får lära dig strukturerade arbetssätt, metoder och får en ökad förståelse för hur organisationer och företag fungerar.

Om undervisningen Programmet innehåller olika typer av undervisningsformer; föreläsningar, seminarieövningar, självstudier, inlämningsuppgifter, laborationer och verklighetsanknutna projekt som genomförs hos företag och organisationer. Du kommer att få jobba enskilt, i par och i grupp i olika konstellationer under programmets gång. Gästföreläsare används under hela utbildningen för att förmedla hur verksamheter och metoder fungerar i praktiken. Du kommer också att få jobba med projektarbeten som sker i samarbete med värdföretag, där du tillämpar dina teoretiska kunskaper praktiskt. Du kommer att studera grupp­ Ett viktigt inslag är att du rogrammet vänder sig till dynamik och ledarskap med bland reflekterar över det du har lärt dig som i första hand vill annat kommunikation och mångfald dig genom teori och tillämpning, arbeta med utvecklingsså att du får ökad förståelse för antingen själv eller tillsammans och förbättringsarbeten hur du själv, individer och grupper fungerar och hur ledarskapsproblem med dina kurskamrater. Om du är inom företag och organisationer. i samband med förbättrings- och yrkesverksam kommer du att ha Kunskaperna du får resulterar i utvecklingsarbeten kan lösas. möjlighet att göra stora delar av att du blir effektivare i ditt arbete, tillämpningen i din egen organisabättre i ditt ledarskap samt att du tion vilket ger en konkret nytta tillbaka till orgaska kunna öka effektiviteten och kundtillfredsnisationen. ställelsen inom företag och organisationer på ett På Uppsala universitet bedrivs en aktiv forskhållbart sätt. ning inom området. Resultaten av forskningen möter du som student genom lärarna. Om programmet Basen i programmet är kurser Examinationen sker genom tentor, skriftliga inom kvalitetsutveckling där du studerar arbetsprov, inlämningsuppgifter, muntliga presentatiosätt, metoder och verktyg för verksamhetsutveckner, laborationer, seminarier och projektarbeten. ling. På så sätt kommer du att systematiskt kunna Studiemiljön på Campus Gotland i Visby är identifiera problem, analysera och förbättra prosmåskalig vilket främjar god kontakt mellan stucesser och arbetssätt samt upprätthålla nivån på denter och lärare. de förbättrade processerna och arbetssätten. Dina kunskaper att förbättra verksamheter Studera utomlands Genom universitetets byggs på med bland annat företagsekonomi och utbytesavtal får du stora möjligheter att läsa en juridik. Genom företagsekonomin kommer du termin eller ett läsår vid ett utländskt lärosäte. att lära dig att planera, kalkylera, redovisa och utvärdera det ekonomiska utfallet av en verkKarriär Efter programmet är du redo att jobba samhet, samt att skapa goda relationer med kuninom såväl varu- som tjänsteproducerande verkder. De juridiska kunskaperna ger dig kunskaper samheter. Du kan söka jobb inom privata företag, i civilrättens centrala delar, samt översiktlig kunoffentliga eller kommunala verksamheter. Dina skap i straffrätt, processrätt, förvaltningsrätt och kommande arbetsuppgifter kan bli att leda eller EG-rätt. delta i förbättrings- och utvecklingsprojekt, arbeta Eftersom stora delar av verksamhetsutvecksom projektledare för förändrings- och förbättlingen i näringslivet sker i projektform läggs även ringsprojekt, ansvara och arbeta med kvalitetsfråstor vikt vid projektmetodik och projektledning. gor, arbeta som verksamhetsutvecklare, eller arbeta Att arbeta med förbättrings- och utvecklingsarmed andra planerings- och ledningsuppgifter. beten innebär även att arbeta med eller leda en Efter din kandidatexamen kan du fortsätta grupp av människor. Därför kommer du även att med en tvåårig påbyggnad i form av en masterutstudera gruppdynamik och ledarskap med bland bildning nationellt och internationellt. annat konflikthantering och förändring.

P

Campus Gotland

Ledarskap-kvalitetförbättring

Kandidatprogram 180 hp

Årskurs 1 Projekt och ledning Grundkurs i industriell ekonomi Introduktion till kvalitetsteknik Kvalitetsutveckling Hållbar utveckling, CSR och livscykelanalys Ledarskap och kommunikation Projekt i kvalitetsteknik Verksamhetssystem och ledning

10 hp 10 hp 5 hp 5 hp 10 hp 5 hp 5 hp 10 hp

Årskurs 2 Ledarskap och coachning Tillämpad variation och statistik inom kvalitetsutveckling Ledarskap och konflikthantering Lean management Ledarskap och kultur Biområde företagsekonomi: Grundkurs marknadsföring Ekonomisk kalkylering Organisation I - Individen och gruppen i organisationen Affärsredovisning med tillämpad företagsekonomisk analys

5 hp 5 hp 5 hp 5 hp 10 hp 7,5 hp 7,5 hp 7,5 hp 7,5 hp

Årskurs 3 Juridisk översiktskurs 15 hp Six sigma 5 hp Att leda förändring 10 hp Produktutveckling och service management 5 hp Hållbar verksamhetsutveckling 5 hp Förstudie examensarbete 5 hp Examensarbete 15 hp Allmän behörighet: Grundläggande behörighet + Matematik 3b/3c alternativt Matematik C

Examen Programmet leder till en teknologie kandidatexamen med industriell teknik som huvudområde. Program på avancerad nivå

Årskurs 4-5

Beroende på dina kursval inom kandidat­ programmet kan du på Uppsala universitet efter kandidatexamen välja: Masterprogram (120 hp): Hållbar utveckling Industriell ledning och innovation Magisterprogram (60 hp): Vindkraftprojektering

Johanna Persson: ”Det bästa med utbildningen är att man utvecklas mycket som person. Och Visby är väldigt fint och mysigt.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

59


Matematiken finns i naturen. Tal som ingår i en serie där varje tal är lika med summan av de föregående två talen kallas fibonaccital och går ofta att hitta i spiralformade strukturer i naturen. Antalet spiraler som fröna i en solros bildar motsols respektive medsols utgör två grannar i fibonaccitalföljden.

Anette Norberg, produkt­ansvarig chef, Folksam Liv De flesta känner Anette Norberg som Sveriges mest framgångsrika curlingspelare genom tiderna. Vid sidan av de sportsliga framgångarna har Anette hunnit med såväl matematikstudier som en lång yrkeskarriär inom försäkringsbranschen. – Jag vet vad mina drivkrafter är och det är att lösa problem, vilket matematik i grunden handlar om. Just den kunskapen har jag haft ohyggligt mycket nytta av på vägen, oavsett vad jag har gjort. Det är ett visst sätt att tänka, ett visst sätt att se på en utmaning man ställs inför. – Försäkringsbranschen rekryterar väldigt många matematiker. Vi försöker hålla kontakt med universiteten, för det är en väldigt efterfrågad arbetskraft, så vi vill gärna fånga upp de duktiga direkt från utbildningarna.

60

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp

Foto: shutterstock

Matematik, beräkningar & problemlösning


M atematik Kandidatprogrammet i matematik i Uppsala passar dig som har ett starkt intresse för matematik. Du får en djupare förståelse för matematiken och lär dig inte bara hur man räknar utan också vad som finns bakom formlerna. Om du till exempel alltid har undrat varför det är farligt att dela med nollan kommer du här att få reda på svaret.

M

att få mycket goda möjligheter att arbeta inom många olika branscher. Prognoser talar för att matematisk kompetens kommer att bli ännu mer eftertraktad i framtiden. Några av de områden där matematik spelar en central roll är försäkringsmatematik, bildanalys, medicinsk forskning, finans, signalbehandling, sökoptimering, kryptering och datavetenskap. Ett annat växande fält är datorstödd bevisföring, där forskare använder programmeringskod för att konstruera matematiska bevis.

Om undervisningen Undervisningen sker dels i stora föreläsatematik har fascineningar där läraren går igenom och rat människor i alla tiförklarar teori, dels i lektioner där der och kan liknas vid I och med att den matematiska forskningen växer för varje år du löser övningsuppgifter och får ett språk som hjälper arbetar många matematiker som tillfälle till diskussion och frågor. oss att förstå vår komplexa värld. forskare. De flesta forskar i ren Det är vanligt med inlämningsMatematiken spelar en central roll mate­matik men det finns även uppgifter, oftast frivilliga som ger inom allt från datavetenskap, momatematikforskare som utvecklar metoder inom olika tillämpningar bonus till tentamen. På datakurdern teknik och naturvetenskap till som t ex biologi, ekonomi och serna förekommer obligatoriska nyare områden som finansiell matemedicin. programmeringsuppgifter. Under matik och biostatistik. tredje året gör du ett självständigt examensarbete. Matematik är inte bara vetenskapens språk utan också ett fristående forskningsämne som Studera utomlands Som student vid Uppsala ständigt expanderar. universitet kan du åka på utbytesstudier till ett stort antal universitet över hela världen. MatemaOm programmet Under de första två åren får tiska institutionen har dessutom utbytesavtal med du en god matematisk grund. Du lär dig bland universitet som är särskilt bra på matematik, i länannat om oändligheten och hur du kan räkna med der som Frankrike, Tyskland och Irland. tal i flera dimensioner. Du får även baskunskaper i programmering och beräkningsvetenskap och lär Karriär Om du inte vet vad matematiker jobbar dig att lösa svåra matematiska problem med dator. med beror det förmodligen på att de flesta mateDet tredje året har ett friare upplägg där du väljer matiker i arbetslivet har andra titlar, till exempel fördjupningskurser efter intresse. aktuarie, analytiker, data scientist, chef, IT-specialist. Du kan välja att fördjupa dig i olika typer av De flesta studenter som tar kandidatexamen i matematisk teori eller att använda matematik för matematik i Uppsala läser vidare på något masteratt lösa konkreta problem. Ett exempel på mateprogram. Majoriteten av dem som tar en mastermatisk teori som också har konkreta tillämpningar examen i matematik väljer att jobba utanför akaär dynamiska system. De är mycket intressanta demin, medan en mindre andel fortsätter till doksom forskningsämne, samtidigt som de är användtorandstudier och satsar på en forskarkarriär. bara inom allt från väderprognoser till sociologisk Bland dem som väljer arbetsmarknaden utanforskning. för universitetet är det vanligaste yrket aktuarie. Utbildningens bredd och matematiska substans Vidare arbetar många som olika typer av analykommer att ge dig värdefulla kunskaper i modern tiker, till exempel finansanalytiker, riskanalytiker, matematik och en hög konkurrenskraft på arbetskvantitativ riskanalytiker, business analyst, technimarknaden. Du kommer dessutom att få behörigcal business analyst. En annan titel som förekomhet till flera masterprogram, i bland annat matemer bland våra alumner är technical support engimatik, finansiell matematik, bioinformatik, tillämneer. Ett relativt nytt yrke som börjar bli vanligare pad beräkningsvetenskap och matematisk statistik. är data scientist. Det finns även många som arbetar Tack vare matematikens allmängiltighet är den med signalbehandling, systemutveckling, statistik användbar inom såväl teknik och naturvetenskap och biostatistik. som det samhällsvetenskapliga området. Eftersom Våra alumner finns inom organisationer som datorer blir allt bättre på att hantera stora mängSpp, Swedbank, Scandia liv, Statistiska centralbyder information behöver de som ska tolka inforrån, Elekta, Uppsala Clinical Research, Regionalt mationen besitta stor matematisk kompetens. Med cancercentrum, Max Matthiessen, Prover, Försvatanke på att det fortfarande är relativt ovanligt ret, First Derivatives, Accenture, Qliro, ÅF, Götemed djupa matematikkunskaper i samhället komborg Energi och många fler. mer du som läser matematik på universitetsnivå

Matematik

Kandidatprogram 180 hp

Årskurs 1 Matematik (varav 5 hp i beräkningsvetenskap) Extra fördjupningskurs i matematik

60 hp 5 hp

Årskurs 2 Matematik (varav 15 hp matematisk statistik) Data- och beräkningsvetenskap

45 hp 15 hp

Årskurs 3 Valfria kurser i matematik och andra ämnen (till exempel algebraiska strukturer, logik, differentialgeometri, regressionsanalys, tillämpad matematik, beräkningsvetenskap, databasteknik, matematikens historia, finansiell matematik) 45 hp Examensarbete i matematik

15 hp

Allmän behörighet: Grundläggande behörighet + Fysik 2, Matematik 4 alternativt Fysik B, Mate­matik E

Examen Programmet leder till en teknologie kandidatexamen med matematik som huvudområde. Program på avancerad nivå

Årskurs 4-5

Beroende på dina kursval inom kandidat­ programmet kan du på Uppsala universitet efter kandidatexamen välja: Masterprogram (120 hp): Matematik och finansiell matematik Datavetenskap Hållbar utveckling Industriell ledning och innovation Tillämpad beräkningsvetenskap Magisterprogram (60 hp): Vindkraftprojektering

Joel Dahne:

”Mycket valfrihet i programmet. Jag har inriktat mig på data­ kurser. Tänker ta master och vill undervisa så småningom.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

61


Foto: shutterstock

Tvärvetenskaplig problemlösning

Jimmy Holpers, regionekolog på Region Gotland: ”För att hitta ekologiskt hållbara lösningar och använda de ekosystemtjänster närmiljön erbjuder när samhället utvecklas krävs medvetenhet och dialog. I mitt arbete hjälper jag plan- och bygglovshandläggare såväl som exploatörer att värna befintliga värden, och i vissa fall till och med gynna naturmiljöer vid nya exploateringar.”

62

UUppppssaallaa uunni v i veerrssi t i teett –– uuttbbi li lddnni n i nggaarr i i tteekknni k i k oocchh nnaattuurrvveetteennsskkaapp


M ilj övetenskap Campus Gotland

Du som vill arbeta med dagens och framtidens miljö­frågor behöver både goda ämneskunskaper och kompetens för att samarbeta med andra experter. Kandidat­programmet i miljövetenskap på Gotland riktar sig till både naturvetare och samhälls­vetare som vill bli specialister inom miljöområdet samt har ett stort intresse för problemlösning med tvärvetenskapligt angreppssätt.

under en termin eller mer. Uppsala universitet har utbytes­ program med ett stort antal läro­ säten i olika länder i hela världen och du kan få hjälp med att hitta de kurser, praktikplatser med mera som passar dig och som också kan tillgodoräknas i examen.

Upplägg Under första året läser du grundläggande kurser inom programmets fokus­­­om­råden. På ett tidigt stadium förs samhällsvetenskapliga moment och diskussioner om miljö och utveckling in. Termin 3 och 4 vidare­ utvecklar du dina färdigheter i att förstå, analysera och hantera Miljövetare arbetar ofta med rogrammet fokuserar på strategiska miljöfrågor både inom miljövetenskapliga problemställcentrala miljöfrågor, så näringslivet och i offentlig verksamhet. ningar ur olika samhälleliga persom hållbar förvaltning Man ser ett framtida större behov av spektiv såsom geografiskt, juriav ekosystemtjänster, generalister med holistiskt angrepps­ sätt och intresse för systemlösningar. diskt, politiskt och ekonomiskt. biologisk mångfald och naturVidare ingår kurser i naturvård, resurser. Studieorten Gotland miljöövervakning och GIS för att du ska kunna innebär utmärkta möjligheter till exkursioner, arbeta praktiskt med miljöfrågor. Du har också praktiska övningar och fallstudier med lokal anmöjlighet att göra en praktikperiod under somknytning på centrala teman inom programmet. maren. Utbildningen behandlar miljöfrågors komplexiUnder tredje året får du en ökad fördjuptet ur ett systemperspektiv och inkluderar både ning och tillämpning inom programmets fokus­ naturvetenskapliga- och samhällsvetenskapliga områden, med exempel från kustzon och landangreppssätt. Din kompetens blir bred och tvärskap kring Östersjön som återkommande inslag. vetenskaplig, vilket ger dig förmåga till helhetsUnder termin 5 ges kurserna på engelska. Sista bedömningar och åtgärdsrekommendationer. terminen kan du kombinera det självständiga Det teoretiska innehållet kopplas genomgående examensarbetet med kurser i statistik, projekttill aktuella frågor på miljöområdet och metoder ledning eller praktik. för att lösa problem och främja en hållbar samhällsutveckling. Karriär Miljövetare arbetar ofta med strategiska miljöfrågor både inom näringslivet och i Om undervisningen Under utbildningen offentlig verksamhet. Man ser ett framtida större kommer du att vara delaktig i olika undervisbehov av generalister med holistiskt angreppsningsformer såsom seminarier, workshops, föresätt och intresse för systemlösningar. Utöver djup läsningar, fältövningar och praktikmoment. Du inom visst område behövs breda kunskaper och får regelbundet möta representanter från forskförmåga att arbeta med komplexa frågor, som ning och arbetsliv för att koppla det teoretiska exempelvis i samhällsplanering. Du kan exeminnehållet till aktuella miljöfrågor och praktiska pelvis arbeta som rådgivare, miljöstrateg, miljö­ tillämpningar. samordnare eller konsult i organisationer och Studiemiljön på Campus Gotland är småskapå myndigheter. Det finns också arbeten inom lig vilket främjar god kontakt mellan studenter naturvårdsbranschen och utbildningssektorn. och lärare, här finns lång erfarenhet av att stödja Efter examen kan man också studera vidare studenters individuella lärprocess och att sampå ett masterprogram för fördjupning inom verka med omgivande samhälle i utbildningarna. något område eller för att ytterligare öka sin tvärvetenskapliga kompetens. En masterexamen kan Studera utomlands Du har möjlighet att förleda till en yrkesbana som forskare. lägga dina studier till ett universitet utomlands

P

Miljövetenskap

Kandidatprogram 180 hp

Årskurs 1

Introduktion till miljövetenskap Naturresurser och ekosystemtjänster Miljö och klimat i förändring Natur- och kulturlandskapets biologiska mångfald

Årskurs 2 Samhällsplanering och miljörättvisa Naturvård för miljövetare Miljöekonomi och ekologisk ekonomi Miljö- och förvaltningsrätt Projekt i miljörätt Statistik för miljövetare Miljöövervakning och GIS

Årskurs 3 Integrerad kustzonsplanering Förvaltning av ekosystemtjänster­ Miljödata och tillämpad miljöstatistik Miljöledningssystem och projektledning Praktik Självständigt arbete (examensarbete) Allmän behörighet: Grundläggande behörighet + Matematik 3b/3c, Naturkunskap 2, Samhällskunskap 1b/1a1+1a2 alternativt Matematik C, Naturkunskap B, Samhällskunskap A

Examen Utbildningen leder till en kandidat­ examen med miljövetenskap som huvud­ område. I programmet ingår kurser som kan ge biområdena­biologi och geovetenskap. Program på avancerad nivå

Årskurs 4-5

Efter din kandidatexamen kan du på Uppsala universitet välja mellan följande program: Masterprogram (120 hp): Hållbar utveckling Global miljöhistoria Geografi Magisterprogram (60 hp): Vindkraftprojektering

Robin Andersson: ”Jag ville

kombinera min naturvetenskapliga bakgrund på gymnasiet med samhällsfrågor, och det får jag möjlighet till på programmet.”

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

63


På kandidatutbildningen lär man sig grunderna och på master­ utbildningen blir studierna mer forskar­förberedande och klassen blandad på ett helt annat sätt

Cecilia Bayard valde att fördjupa sina kunskaper med en masterutbildning efter kandidatexamen och är nu anställd på Sweco Environment AB. Vad har du läst innan din master? – Jag har läst geovetenskap som är ett intressant ämne som man kan koppla till mycket och det täcker så många områden, särskilt utbildningen i Uppsala. Det finns goda arbetsmöjligheter efter utbildningen och geovetenskap är också ett väldigt roligt ämne. Vad är det för skillnad? På masterutbildningen ställs det naturligtvis högre krav. Jag och mina andra klasskompisar på mastern var verkligen motiverade till att fortsätta studera och det tror jag man måste vara. En mas­ terutbildning glider man inte igenom. Jag lärde mig otroligt mycket på masterutbildningen och jag växte mycket som person under de två åren. På både kandidatprogrammet i geovetenskap och master­ programmet i geovetenskap hade vi fältkurser och man kan själv styra vilken typ av examensarabete man vill göra. Vill man jobba mer i fält så finns det möjlighet till det. På båda utbildningarna finns också möjlighet till att göra praktik. På kandidatutbildningen lär man sig grunderna och på master­ utbildningen blir studierna mer forskarförberedande.Vi läste artik­ lar och lärde oss hur man skriver och publicerar dessa på master­ utbildningen. Man har mycket med sig från kandidaten in i master­ utbildnigen men studierna blir på en högre nivå. På masterutbildningen var dessutom klassen blandad på ett helt annat sätt än kandidatutbildningen. På masterutbildningen i geo­vetenskap studerar folk från bland annat USA, Neder­länderna, Tyskland, England, Grekland, Chile, Malaysia och Frankrike. Varför valde du att göra en master? Jag kände mig inte riktigt klar efter kandidaten, jag ville veta mer. Det kändes dessutom lättare att få jobb efter studierna om jag hade en master. Du jobbar på Sweco. Hur fick du jobbet? Jag har en kontakt på företaget och den personen rekommen­ derade mig och skickade in mitt cv. Det tog två veckor och sedan hade jag jobb. Jag fick besked på fredag och började på onsdagen följande vecka. Det gick fort. Vilka arbetsuppgifter har du? Jag är handläggare och fälttekniker så arbetsuppgifterna är väldigt varierade. Jag är både ute i fält och tar prover, exempelvis vatten­ prover, och skriver rapporter och provtagningsplaner på kontoret. Jag jobbar med förorenad mark och provtagningarna behövs för att veta om sanering eller schaktning behöver göras. Jag är ofta ute på industrier eller bensinmackar i samband med att man ska riva gammalt eller bygga nytt. Jag får resa en del i jobbet och har bland annat varit på olika platser i Eskilstuna, Katrineholm, Stockholm och Västerås. Vad har du haft mest nytta av från din utbildning? Fälterfarenheten är värdefull och också vanan av att skriva rappor­ ter. Utbildningen är så bred, särskilt kandidaten, och det ökar för­ ståelsen för de delar av jobbet man inte är direkt in­kopplad i. På så vis är det lätt att förstå vad andra gör. Hur ser framtiden ut inom den bransch du arbetar i? Det ser ljust ut. Konsultbranschen expanderar för tillfället och de behöver folk. Miljöfrågor blir viktigare och en större del i alla steg när man bygger, så folk med den kompetensen behövs. Mina tidi­ gare kursare jobbar bland annat på kommuner och konsult­företag. En annan klasskompis jobbar på NASA. Har du några tips till den som börja läsa en masterutbildning?­ Ta hjälp av dina kurskamrater, allt blir mycket lättare när man kän­ ner att man gör det tillsammans. Man kan få mycket hjälpa bara av att diskutera saker och det är bra att göra något roligt i mellan åt när det blir tungt. Håll motivationen uppe och kom ihåg att du stu­ derar på programmet för att du är intresserad av ämnet.

64

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p


ma sterprogr am Masterprogram är tvååriga utbildningar för dig som har en treårig kandidatexamen eller motsvarande. En master­examen från Uppsala universitet är en internationellt gångbar examen som ger dig en bra grund för såväl akademisk forskning som en karriär i näringslivet eller offentlig sektor, i Sverige eller utomlands. De kursansvariga lärarna är aktiva forskare vilket ger under­visningen en stark koppling till aktuell forskning. Flera är dessutom världsledande inom sina forskningsfält. Det gör

att kurserna ligger i framkanten av utvecklingen inom respek­ tive om­råde. Du kan specialisera dig inom ett område som intresserar dig allra mest eller välja att skapa en individuell profil på din examen genom att läsa kurser från flera olika områden. Vi lägger stor vikt vid att utveckla studenternas analytiska förmåga och att ge kunskaper med lång hållbarhet. Huvuddelen av eller hela utbildningen ges på engelska och du läser tillsammans med studenter­från hela världen.

BIOLOGI

FÖRNYBAR ELGENERERING

På masterprogrammet i biologi får du en förstklassig utbildning med stor valfrihet att skapa din egen profil. Genom det stora kursutbudet inom biologi och molekylärbiologi får du det ämnesdjup som behövs och ökar din konkurrenskraft på arbetsmarknaden. Hos oss får du också systematisk kommunikationsträning med övningar i både muntlig och skriftlig framställning. Vi strävar efter att alla sorters biologi ska finnas på universitetet. Varje student på masterprogrammet i biologi har sin egen personliga studieplan och det finns genomtänkta vägar att gå. Du kan välja fritt bland ett stort antal kurser efter eget intresse. Examensarbetet under andra året sker i nära kontakt med näringsliv eller universitet. Masterprogrammet i biologi förbereder dig för framtida forskning eller arbete inom näringslivet.

Sveriges och Europas elnät står inför en gigantisk omställning. Inom en snar framtid ska energiförsörjningen anpassas till förnybara energikällor. Efterfrågan på kvalificerad personal inom det energitekniska området är därför mycket stor. Masterprogrammet i förnybar elgenerering är ett unikt program som ligger nära både forskning och näringsliv – det gör att du får kunskaper inom energiområdets absoluta framkant och även möjligheter till kontakter med branschen redan under utbildningen. Masterprogrammet i förnybar elgenerering erbjuder dig en högaktuell och intressant utbildning inom elkraftsystem och förnybar elgenerering. Uppsala universitets energiforskning är världsledande inom flera om­råden och det finns ett nära samarbete mellan forskning och näringsliv. Det innebär att du kan följa forskning på nära håll samtidigt som du får möjlighet att knyta kontakter med industrin för framtida karriärval.

BIOINFORMATIK Masterprogrammet i bioinformatik vänder sig till dig som vill inrikta dig mot det spännande tvärvetenskapliga området bioinformatik, som kombinerar datavetenskap, matematik och biologi. Uppsala universitet har en mycket stark kompetens inom bioinformatik och datavetenskap. Verk­tygen som används och utvecklas är centrala inom flera olika forskningsområden, till exempel när du vill förstå funktionen hos människans arvsanlag eller utveckla nya typer av läkemedel. Inom en rad områden, exempelvis biomedicin, läkemedelsutveckling och evolutionsbiologi, används moderna metoder som genererar stora mängder data: DNA/RNA/proteinsekvenser, molekylstrukturer, gen­uttryck och mätdata. För att göra dessa data tillgängliga som användbar information och kunna dra relevanta slutsatser behövs verktyg för hantering och analys. En bioinformatiker har kompetens att både utveckla och använda sådana verktyg.

GEOVETENSKAP Hur kan vi hitta och använda viktiga naturresurser på jorden och samtidigt skydda miljön? På masterprogrammet i geovetenskap vid Uppsala universitet lär du dig om samspelet mellan jordens system samtidigt som du får avancerad och specifik kunskap inom geovetenskaper. Du utforskar klimatförändringar ur perspektivet av jordens processer i atmosfären, hydro­sfären, kryosfären, litosfären och biosfären. Uppsala universitet har en av Europas mest heltäckande forskningsinstitutioner inom geovetenskaper. Forskning inom geovetenskaper foku­serar på ämnen som spänner från jordens kärna till atmosfären, från mikro­skopiska mineral och fossil till hur berg och hav bildas och de proces­ser som formar planeten, från tiden för jordens födelse fram till idag.

DATAVETENSKAP

HÅLLBAR UTVECKLING

Masterprogrammet i datavetenskap ger dig en bred utbildning med möjlighet till fördjupade kunskaper inom de områden du är intresserad av. Du får färdigheter och kunskaper som håller länge, till exempel problemlösningsmetoder snarare än detaljer om specifika verktyg eller programmeringsspråk. Din undervisning baseras på aktuell forskning och ges av internationellt kända forskare. På så sätt blir du förberedd för en internationell karriär inom industri eller forskning. Institutionen för informationsteknologi vid Uppsala universitet, där du läser masterprogrammet i datavetenskap, är världsledande i forskning inom dataområdet. Det innebär att undervisningen på kurserna ges av ledande experter som alltid är uppdaterade med de senaste rönen.

Masterprogrammet i hållbar utveckling är ett internationellt och tvärvetenskapligt program med studenter och lärare från många olika ämnen. Alla har dock ett gemensamt intresse – en hållbar utveckling. Programmets mål är att du i din framtida yrkesutövning ska vara väl förtrogen med frågor som rör hållbar utveckling ur flera perspektiv – alltifrån de grundläggande ekonomiska till de väldigt konkreta som hur dricksvattnet ska räcka till alla på vår jord. Målet med programmet i hållbar utveckling är att du i din framtida yrkes­ut­ övning ska kunna använda aspekter på hållbar utveckling oavsett vad du ar­betar med. Det kan gälla samhällsplanering, utbildning, forskning, kommu­nikation, förvaltning av naturresurser, beslutsfattande och mycket annat.

INBYGGDA SYSTEM FYSIK Fysiken vid Uppsala universitet spänner från det minsta till det största, med högklassig forskning inom alla fysikens fält – från utforskandet av elementarpartiklar och materiens struktur, jordens inre och dess atmosfär, till rymden och universums egenskaper. Vid Ångströmlaboratoriet vid Uppsala universitet samarbetar fysiker kring frågor som bland annat rör energi, partiklar, material, rymdfysik och astronomi. Vid Geocentrum utnyttjar forskarna fysikaliska principer för att studera och förstå jorden och dess väder och klimat. På Geocentrum i Uppsala ligger även Svenska nationella seismiska nätet som övervakar jordbävningar i Sverige och globalt. Dessa och andra samarbeten skapar en kreativ miljö för både utbildning och forskning.

Masterprogrammet i inbyggda system erbjuder en utbildning av världsklass i data- och systemvetenskap med fokus på design, implementering och analys av inbyggda system. Programmet har nära samband med ledande­forskning inom inbyggda system på Uppsala universitet, och förbereder dig för en karriär inom såväl näringsliv som forskning. Många av de produkter som vi använder varje dag till exempel mobil­ telefoner, tvättmaskiner, bilar och även flygplan, är styrda av datorer. Dessa kan innehålla hundratals små datorer som knappt syns och miljontals rader­ programkod. System och produkter som styrs av inbyggda datorer är av avgörande betydelse för industri och samhälle. Utveckling av inbyggda system kräver avancerade tekniska kunskaper och gränsar mot flertalet ämnen inom såväl datorteknik som elektronik och matematik.

Forts 

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p

65


INDUSTRIELL LEDNING & INNOVATION Vill du ha en karriär som kretsar kring ledarskap och innovation? Uppsala universitet erbjuder dig en bra bas för en karriär inom teknikintensiva innovativa företag inom olika branscher. Oavsett om du startar ett eget företag eller arbetar för ett etablerat företag, ger masterprogrammet i industriell ledning och innovation en djup förståelse samt en rad olika verktyg för att hantera komplexa innovationsprocesser. Innovation är viktigare nu än någonsin tidigare. Det industriella landskapet i dag bjuder på ökad konkurrens, snabba förändringar i konsumentmarknader, politisk och legal instabilitet, samt växande miljö- och samhällsutmaningar. För att företag ska förbli konkurrenskraftiga och även utmärka sig i denna nya komplexa miljö är det viktigt att ligga i framkant av innovation och affärsutveckling samt att ha ett helhetsperspektiv på teknik, ledarskap och internationella affärer.

KEMI Uppsala universitet erbjuder en högklassig utbildning i kemi på avancerad nivå, nära kopplad till världsledande forskning. Tack vare denna forskningsanknytning har du möjlighet att fördjupa dig inom det område av kemin som intresserar dig mest, till exempel den för Uppsala universitet unika inriktningen mot kemi för förnybar energi eller bio- och nanomaterial eller­någon av våra övriga kemi­ inriktningar på avancerad nivå. En kemiexamen från Uppsala universitet ger dig konkurrensfördelar både i Sverige och internationellt. Enligt den senaste nationella ut­värderingen håller masterprogrammet i Uppsala en hög kvalitet, inte minst tack vare kopplingen till världsledande forskning inom till exempel arti­ficiell fotosyntes, solceller, effektiva batterier, materialvetenskap, läkemedelsutveckling, regenerativ medicin och biomarkörer för medicinsk diagnos.

MATEMATIK Tycker du om matematik och vill ta dina kunskaper till en ny nivå? På masterprogrammet i matematik kommer du att få fördjupade insikter inom några av matematikens mest moderna och centrala forskningsområden. Du kan välja att ägna dig åt matematisk teori eller satsa på modellering och tillämpningar.

Kompletterande lärarutbildning

Att jobba som lärare är ett av världens viktigaste arbeten – och roligaste. Förutom kunskaper i konsten att undervisa jobbar du med ämnen som du själv är intresserad av. Läraryrket är dynamiskt. Samspelet med eleverna är viktigt och utmanar dig som problemlösare. Samtidigt som du ska inspirera blir du inspirerad. Det är ett fritt yrke där du själv planerar och utformar din undervisning. Läroplanen styr innehållet men hur du ska förmedla kunskaper är upp till dig och din kreativitet. Du lär dig mycket av dina elever, om livet och vad som rör sig i huvudet på dagens unga som i framtiden ska styra samhället. Kompletterande lärarutbildning är ett program för dig som vill arbeta som ämneslärare och som redan har akademiska poäng i de ämnen som finns i skolans årskurs 7–9 eller gymnasiet. Under tre terminer varvar du teori och praktik. Den utbildnings­ vetenskapliga kärnan tar upp kunskaper som är viktiga för lärarprofessionen.

66

Masterprogrammet i matematik vid Uppsala universitet består av tre inriktningar som fokuserar på olika matematiska områden – matematik, finansiell matematik samt tillämpad matematik och statistik. Oavsett vilken inriktning du väljer har du stor möjlighet att välja kurser efter intresse och på det sättet utforma en unik utbildningsprofil.

Tillämpad beräkningsvetenskap Datorsimuleringar av komplexa problem spelar idag en nyckelroll i vetenskapliga undersökningar och ingenjörsarbete. Masterprogrammet i tillämpad beräkningsvetenskap breddar och fördjupar dina kunskaper inom naturvetenskap eller teknik med inriktning mot datorer, datorsimuleringar och matematiska modeller. Du lär dig tillämpa beräknings­metoder, program­och programvara, samt matematiska och statistiska modeller inom ditt speciella intresseområde. Stort eller litet, på makro- eller mikronivå – idag studeras olika feno­men på datorskärmen. För att kunna använda, utveckla och tillämpa dator­simuleringar inom ett visst ämnesområde krävs en god bakgrund inte bara i själva ämnesområdet som till exempel kemi eller fysik, utan också i beräkningsmetoder, avancerade datorer, programvara, programmering och statistiska och matematiska modeller. Masterprogrammet i tillämpad beräkningsvetenskap ger dig dessa kunskaper.

TILLÄMPAD BIOTEKNIK Masterprogrammet i tillämpad bioteknik vänder sig till dig som vill inrikta dig mot tillämpad bioteknik och samtidigt få kunskap om projektstyrning och entreprenörskap. Det är ett program som ger en dig en unik profil och där du möter både svenska och internationella studenter och lärare, vilket ger dig möjlighet att skapa ett nätverk som du kommer att ha nytta av i framtiden. Uppsala universitet är det rätta valet för dig om du är intresserad av bioteknikstudier. Uppsala ligger mitt i det starkaste bioteknikklustret i Sverige och har under många decennier varit ett centrum för nyskapande och hög­kvalitativ bioteknisk forskning och utveckling. Här finns ett stort antal bioteknikföretag, både stora och små. Samarbete mellan Uppsala universitet, bioteknikföretag, universitetssjukhuset och myndigheter genererar en stimulerande utbildningsmiljö.

Centralt för läraryrket är ämnesdidaktik – förutsättningar för elevers lärande och hur du kan undervisa i dina ämnen. Programmet lägger stor vikt vid konflikthantering och ledarskap. Under den verksamhetsförlagda utbildningen (VFU) som du genomför på en skola, tränar och utvecklar du dina färdigheter som pedagog. Kompletterande lärarutbildning kan du läsa antingen på plats i Uppsala eller på distans. Både distans- och campusutbildningen är på heltid och undervisningen ges under dagtid. Att arbeta som lärare är att ha ett av världens viktigaste jobb. Behovet av välutbildade lärare finns ständigt. I grund­skolan och gymnasieskolan är det till exempel stor efter­frågan inom teknik, naturvetenskap och i vissa språk. En lärarexamen ger dig möjlighet att söka dig till andra områden inom utbildning och lärande. Med en lärarexamen kan du även arbeta på andra arbetsplatser än i skolan. Utbildningen kan ge behörighet att söka forskarutbildning.

Magisterprogram i vindkraftprojektering Den globala vindkraftsindustrin fortsätter att breda ut sig geografiskt och öka i såväl projektstorlek som komplexitet. Därmed ökar efterfrågan på professionella chefer som kan leda och genomföra dessa tvärvetenskapliga projekt på ett framgångsrikt sätt. Magisterprogrammet i vindprojek­ tering på Campus Gotland förbereder dig för olika karriärvägar inom vindkraft som kombinerar teknik, projektledning och samhällsvetenskap. Läs detta magisterprogram och bidra med ett positivt fotavtryck till en global och hållbar värld. Programmet ges på Campus Gotland i världsarvs­staden Visby. Vindenergi på Campus Gotland är ledande på utbildning i vindkraftprojektering.

U p p s a l a u n i v e r s i t e t – u t b i l d n i n g a r i t e k n i k o c h n at u r v e t e n s k a p


Anmälan görs på nätet:

www.antagning.se För att bli antagen till Uppsala universitets tekniska eller naturvetenskapligprogram måste du uppfylla vissa krav. Dels grundläggande behörighetskrav för högskolestudier och dels särskilda behörighetskrav för respektive program.

Webbanmälan öppnar den 15 mars

Din anmälan ska ha kommit in senast den 18 april

Kontrolluppgifter – april-juni

Kompletteringar – mitten av juni

Antagningsbesked med svarskrav – mitten av juli

Glöm inte att svara på antagningsbesked – slutet av juli

Andra antagningsbeskedet – början av augusti

mer I nformation: För ytterligare information om programmen – kontakta studievägledare för respektive program. Svaren på de vanligaste frågorna får du här: www.uu.se/utbildning

Produktion: © Uppsala universitet 2017, Teknisk-naturvetenskapliga fakulteten Text: Anders Sahlin, Anneli Björkman Layout: Mats Kamsten Fotografer/bilder: Mikael Wallerstedt, Carlis Fridlund, Mats Kamsten, Dreamstime, Shutterstock, Morguefile

Repro/tryck: Danagårds


B

www.uu.se/utbildning

sveriges fĂśrsta universitet

Uppsala Porto betalt Port PayĂŠ Kundnummer 20299724

Teknatbroschyren 2017-18  

Utbildningar i teknik och naturvetenskap vid Uppsala universitet

Read more
Read more
Similar to
Popular now
Just for you