Issuu on Google+

JUMAT, 16 MARET 2012

Edisi 331 „ Tahun IX

Tiga Warga Sibatu-batu Dianiaya Oknum Polisi SIANTAR-Kepala pria Marojahan Malau (22) warga Jalan Sibatu-batu, Kecamatan Siantar Sitalasari dipukul pakai batu oleh oknum anggota Polresta Siantar. Peristiwa itu terjadi di Jalan Kartini, Kecamatan Siantar Barat, tepatnya di depan SMP Negeri 4 Siantar, Jumat (16/3) dini hari. Marojahan mengatakan saat itu dirinya mau membeli nasi ke Jalan Merdeka. Di tengah perjalanan tepatnya di depan SMP Negeri 4, oknum polisi

Banyak Kawan nyi Karena Jago nNwaya itar sek rga

n da Rio, begitu teman-tema dia sudah ditinggal il kec ak sej a, ny memanggil ggal dunia. Lalu, nin ibunya yang telah me ayahnya menikah lagi. oleh Mak Tuanya Akhirnya dia ditampung ah hidup tanpa sud a jug g yan (kakak ibu, red) Renville, Kelurahan suami, tinggal di Jalan al 2 „) Baca Banyak...H

yang menumpangi sepedamotor Yamaha Vixion menyerempet korban dari belakang. ”Kepala saya dipukul pakai batu oleh oknum polisi itu. Saya pun terjatuh. Karena ketakutan saya kabur pulang ke kampung dan tidak jadi beli nasinya,” ujarnya. Lanjut Marojahan, saat mau pulang ke kampung, oknum polisi yang sudah bau minuman alkohol mengejar sampai ke kampung.

Foto: Fahmi

„ Satrio Danovan Hutasoit tersanga pemilik ganja.

„) Baca Tiga ...Hal 2



DIDUGA: Marojohan Malau (kiri) dan Kristopel Saragih warga Jalan Sibatu-batu Kelurahan Bukit Sofa yang dianiaya oleh oknum polisi, Jumat (16/3).

Kabag Humas Datangi Mapolres Tengah Malam SIANTAR-Kabag Humas Pemko Siantar Daniel Siregar mendatangi Mapolres Siantar sekitar pukul 23.30 WIB, Kamis (15/3). Daniel berada di Mapolres hampir dua jam dan meninggalkan Mapolres sekira pukul 01.15 WIB Jumat (16/3) dinihari.

Amatan METRO di Mapolresta, setelah turun dari mobil dinasnya Kijang Innova BK 121 T, Daniel langsung menuju ruangan Kaurbin Ops Iptu Asmon Bufitra. Ruangan ini bersebelahan dengan ruangan

„) Baca Kabag...Hal 7

SIANTAR–“Aku terpaksa menjualnya untuk biaya kuliahku dan untuk makan, karena orang tuaku tidak ada lagi,” ucap Satrio Danovan Hutasoit (22) tersanga pemilik ganja saat diperiksa di Unit Narkoba Polres Pematangsiantar.

Foto: Fahmi

GANJA: Tersangka penjual ganja dibawa petugas beserta barang bukti (kiri).

Dia diringkus polisi dari rumahnya di Jalan Renville Kelurahan Merdeka, Siantar Timur, Kamis (15/3) pukul 15.30 WIB karena kepemilikan ganja sebanyak 95 amp. Mahasiswa salah satu Akademi Komputer di Kota

„) Baca Peserta Audisi...Hal 2

Konsumsi Sabu-sabu, Penjual Soto Diciduk (FOTO:FAHMI)

„ Mobil dinas Kabag Humas Pemko Siantar saat berada di Mapolresta Siantar sekitar pukul 00:43:02 WIB, Jumat (16/3).

Paripurna, 27 Anggota DPRD Mangkir Diduga Tarik-menarik Kepentingan

RAYA-Diduga karena tarikmenarik kepentingan antara lima fraksi di DPRD, sebanyak 27 anggota DPRD Simalungun tidak menghadiri atau mangkir dari rapat paripurna di Gedung DPRD, Kamis (15/3) sekira pukul 10.00 WIB. Rapat paripurna membahas rotasi pergantian alat

SIANTAR-Aparat Sat Narkoba Polres Simalungun membekuk pemakai narkoba jenis sabu-sabu, Hendra (23). Dia ditangkap tak jauh dari rumahnya di Dusun Bah Bayu, Nagori

Purba Ganda, Kecamatan Pematang Bandar Simalungun, Rabu (14/3) malam. Dari tangan Hendra, diamankan satu paket besar sabu-sabu. Berdasarkan pengembangan

kelengkapan DPRD ini pun ditunda hingga Senin. Sesuai jadwal, rapat paripurna seharusnya dimulai sekira pukul 10.00 WIB di Ruang Harungguan DPRD. Namun hingga pukul 12.00 WIB, rapat tidak kunjung dimulai dan akhirnya ditunda. Yang terlihat hadir hanya empat unsur pimpinan DPRD, Ketua

„) Baca Paripurna...Hal 7

Foto: Marihot

„ Tersangka pemilik sabu-sabu diamankan di Mapolres Simalungun.

Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun? kirim SMS ke nomor:

082164546471 Siswa SMPN Dolok Panribuan Dipungut Biaya Les Sore Kadis Pendidikan Simalungun terhormat, kami orangtua siswa SMP Negeri Dolok Panribuan, keberatan terhadap kebijakan kepala sekolah yang memberlakukan pengutipan uang les sore Kelas 9. Sementara di sekolah lain, tidak ada pengutipan uang les. Bukankah setelah adanya dana BOS, maka tidak diperkenankan lagi melakukan pengutipan kepada siswa? Lalu ke mana uang BOS itu? Terima kasih. Pengirim: 085371450xxx

dari tersangka, malam itu turut diamankan kurir sabu tempat Hendra membeli barang haram tersebut. Terakhir diketahui kurir tersebut bernama Isdiaman (27) warga Kerasaan. Kurir ini diciduk dari warung soto miliknya di Empalasment Sipef Rabu (14/3) pukul 22.00 WIB saat mengonsumsi sabu. Dari tangannya polisi mengamankan 2 paket kecil sabusabu siap jual. Dihubungi METRO, Kamis (15/3) Kasat Narkoba Polres Simalungun AKP Masku Sembiring mengaku, kedua tersangka sebelumnya telah diintai petugas, karena dicurigai memiliki narkoba jenis sabu– sabu. “Kita sudah mencurigai kedua pelaku sejak awal dan anggota kita telah melakukan pengintaian terhadap kedua

Setubuhi Gadis 14 Tahun

Kerja Cuma Buruh, Keluarga Tak Setuju PERDAGANGAN–Sumiati (37), bibi Mawar (14) (nama samaran) korban yang disetubuhi pacarnya sendiri, Hartono warga Batu Bara, mengaku orangtua korban, sejak awal tak merestui hubungan putrinya karena tersangka adalah seorang pengangguran. Selain itu tersangka kerap mengajak korban pulang hingga larut malam. Sebelumnya, tersangka sudah pernah mengutarakan niatnya untuk menikahi Mawar,

akan tetapi ditolak.kedua orangtuanya. Ditemui METRO, Kamis (15/ 3) pukul 15.00 WIB di kediaman korban Huta I, Kampung Pompa, Nagori Perlanaan, Kecamatan Bandar Simalungun, bibi korban mengaku hubungan korban dengan tersangka Hartono alias Tono (23), warga Dusun III, Nagori Nakaran Batu

„) Baca Konsumsi ...Hal 2

Pengamat Sejarah, Nikolas Simanjuntak

Batak di Mata Dari sejumlah penelitian yang ia lakukan, pengamat sejarah Nikolas Simanjuntak menilai bahwa identitas Batak pada dasarnya bukan diciptakan oleh musafir barat. Namun mereka menuliskan tentang Batak, setelah mendengar dari etnis lain di luar Batak.

Ken Girsang, Jakarta

Penulis Sejarah Asing Itu Seram Hal ini diungkapkan Nikolas kepada METRO, sebab dari sejumlah buku disebutkan bahwa pada zaman masuknya Inggris dan Eropa ke tanah Nusantara, mereka tidak bisa masuk ke dalam wilayah suku Batak. “Jadi ini yang disebut pendapat orientalis. Artinya orang barat melihat timur, selalu melihat yang jeleknya,” ungkapnya. Apalagi orang Batak ketika itu kemudian dikenal sebagai suku yang seakan menganut paham kanibalisme. “Mereka mendengar

kalau kanibalisme itu begitu seram, sehingga mereka tulis dan menganggapnya jelek. Karena di Eropa pada masa itu sudah tidak ada lagi kanibalisme. Batak itu sendiri konotasinya jelek. Artinya suku yang ganas dan suka perang,” jelasnya. Padahal menurut Nikolas, para penulis Eropa ketika itu tidak memahami bahwa kanibalisme merupakan hukum acara untuk menghukum orang dan musuh. “Dahulu

„) Baca Batak ...Hal 7

„) Baca Kerja ...Hal 2




16 Maret 2012



Banyak Kawan Karena Jago Nyanyi

Peserta Audisi Indonesia Idol... Sambungan Halaman 1

Sambungan Halaman 1 Merdeka, Siantar Timur. Sementara, Ma Tuanya memiliki dua anak perempuan, dan merekalah yang menjadi keluarga Rio sejak itu. Selanjutnya dia mulai menjalani kehidupan normal seperti anak-anak biasanya dan dibiayai oleh Ma Tuanya yang bekerja sebagai PNS. Namun, duka menimpanya lagi saat usianya masih muda. Setahun menamatkan SMA, orang yang selama ini menjadi pengaduannya berpulang kepada Ilahi, tepatnya tahun 2010. Dia bersama dua kakaknya pun melanjutkan hidup dengan mengandalkan gaji pensiun mendiang ibunya. Serba kekurangan dan kesepian. Begitulah hari-hari yang dilaluinya. Namun, teman-temannya tak membiarkan dia kesepian. Banyak pemuda sekitar menemaninya. Mengajak main catur, main game, dan bernyanyi sambil menikmati tuak. Orang-orang pun banyak simpatik kepadanya karena dia juga seorang yang santun, hormat, dan yang paling penting pintar menyanyi. Ya, suaranya yang khas membuat pemuda setempat rindu untuk bermain gitar dan bernyanyi bersamanya. Dan itulah modalnya untuk mencoba peruntungan Indonesian Idol pada 2010 lalu. Namun pemuja Judika ini gagal saat audisi di Medan. Pada tahun 2011 lalu, kakaknya menikah di Kabanjahe. Selanjutnya dua orang kakaknya tersebut pindah ke Jambi, ikut dengan laenya (abang ipar, red). Dia pun hidup sendiri Sejak itulah hidupnya mulai tak karuan. Uang pensiun yang selama ini diterima setiap bulan untuk kehidupannya tak lagi diterimanya. Uang tersebut diambil oleh kakaknya. Padahal dia sudah sudah terlanjur mendaftar kuliah di Amik Tunas Bangsa. “Mungkin itu yang membuat dia jual ganja,” ujar salah seorang temannya. Dari hasil menjual ganja tersebutlah dia bisa memenuhi kebutuhan hidup dan kuliah. Untuk mencari tambahan pendapatan, dia juga menerima anak kos di rumahnya. Lalu, saat audisi Indonesian Idol 2012 lalu, dia kembali mencoba peruntungannya. Namun, hasil yang sama dia terima. Gagal lagi. “Bagi juri Indonesian Idol, mungkin suaranya tak bagus. Tapi bagi kami, suaranya sangat menarik dan itu yang membuat kami senang bernyanyi bersamanya,” ujar salah seorang teman lainnya sembari berharap dia diberi keringanan hukuman. (ara)

Siantar ini, awalnya diciduk pihak kepolisian dari salah satu warnet yang berdekatan dengan rumahnya. Saat polisi datang, awalnya dia berontak dan membantah memiliki narkoba jenis ganja. Untukmemperlancarpengeladahan di dalam rumah Satrio, pihak kepolisian memanggil Lurah Merdeka dan RT setempat. Akan tetapi Satrio tetap berteriak dan berupaya berontak saat polisi memegangnya, sehingga mengundangwargaberdatangan untuk melihat apa yang terjadi.

Setelah digeledah seisi rumahnya, akhirnya aparat menemukan daun ganja dari kamar Satrio. Ganja tersebut ditemukan dari lemari kain miliknya dibungkus dalam koran yang berisikan 95 paket kecil (amp) siap jual. Untuk mempertanggungjawabkan perbuatannya, Satrio akhirnya diboyong ke Mapolres Pematangsiantar untuk diproses lebih lanjut. Kepada polisi, Satrio menjelaskan daun ganja tersebut diperoleh dari seorang temannya bernama Gotto sebelumnya sudah ditangkap polisi pada Januari lalu.

Ia menambahkan daun ganja tersebut dibeli sebanyak Rp500 ribu dengan panjar Rp200 ribu. Dengan bentuk daun ganja yang masih utuh dan belum dipaketkan seberat sekitar 0,4 kg. Selanjutnya Satrio kemudian membungkus dengan paketpaket kecil untuk dijual. Ketika diperiksa, ia mengaku terpaksa menjual ganja karena kesulitan mencari uang. Sementara biaya kebutuhan kuliahnya harus dipenuhi. Selain itu untuk memenuhi kebutuhannya sehari-hari ia mengaku dibantu oleh saudaranya. Anak bungsu dari

Kerja Cuma Buruh, Keluarga Tak Setuju Sambungan Halaman 1 Petatal, Kecamatan Talawi, Batu Bara sebelumnya sudah diketahui keluarga korban dan kedua orangtua. ”Hubungan mereka kami semua (keluarga) sudah tahu Bang. Kami mengetahui mereka itu pacaran,” jelas bibi korban. Masih kata Sumiati, sejak awal hubungan, kedua insan berlainan jenis ini tidak mendapatkan restu kedua orangtua korban. Alasannya pelaku tidak memiliki pekerjaan tetap, bahkan pelaku kerap menemui korban di tengah jalan tanpa sepengetahuan orangtua. Sehingga orangtua korban menjadi berang jika melihat pelaku bersama korban. ”Si Tono (tersangka) itu kalau malam minggu sering jemput si Mawar dari tengah jalan dan tidak permisi. Sudah begitu, dia juga pulangnya sampai larut malam, makanya ayah mawar kalau melihat mereka berduaan pasti marah Bang,” akunya. Semasa pacaran, tersangka sempat diperingati pemuda setempat agar tidak pulang terlalu malam. Namun tersangka mengangap peringatan tersebut hanyaisapanjempolsaja.“Sudah pernahsiTonoituhampirdihajar pemuda kampung ini Bang, karena dia sering pulang sampai larut malam jika pacaran,” katanya. Ketika dikunjungi METRO, kediaman korban tampak tertutup. Setelah ditanya pada Sinta (23), salah seorang tetangganya, diketahui bahwa korban dibawa kedua orangtuanya ke Medan. Rencananya korban akan bekerja di sana. ”Mawar pergi ke Medan bersama kedua

orangtuanya. Katanya Mawar mau kerja di sana,” jelas tetangga korban itu. Sejak kejadian tersebut, korban kerap dimarahi kedua orangtuanya, sehingga korban yang merasa malu memutuskan untuk tinggal di Medan. “Mawar sering dimarahi orangtuanya sejak kejadian itu. Sementara semua orang kampung sudah tahu kejadian itu, makanya dia mau tinggal sama abang sepupunya di Medan dan kerja di sana,” katanya. Saya Sangat Mencintainya Sementara, tersangka yang ditemui di Mapolsek Perdagangan, mengaku bahwa dia sangat mencintai korban, bahkan pelaku berniat menikahinya. Hanya saja tersangka mengakui orangtua korban memandangnya miris karena tidak memiliki pekerjaan tetap. ”SayasangatmencintaiMawar Bang, bahkan saya sudah siap menikahinya terlebih lagi dia (korban) sudah tidak lagi sekolah dan sudah kerja. Jadi sudah sepantasnya saya serius dengan dia,” katanya. Namun, tersangka menduga kedua orangtua korban tidak merestui hubungan mereka karena pelaku bekerja sebagai buruh bangunan. “Saya rasa kedua orangtua Mawar tidak suka pada saya, karena saya hanya kerja bangunan,” katanya sembari menjauh dari METRO dantidakinginditanyalebihjauh. Sebelumnya, tersangka berkenalandengankorbanJumat(2/3) di tempat kerja korban di salah satu toko roti di kawasan Perdagangan. Selanjutnya itu kedua nsanberlainanjenisini,memadu cintadenganberpacaran.Hingga pada Sabtu (10/3) pukul 10.00 WIB,tersangkamenemuikorban di Simpang Mayang tepatnya di

Sekolah Satrya Budi Perdagangan. Tidak puas hanya ketemu, pelaku selanjutnya mengajak korban jalan–jalan ke rumahnya di Nagori Bakaran Batu Petata, Kecamatan Talawi Batu Bara. Dengan mengendarai sepedamotor milik tersangka mereka berangkat ke Batu Bara. Namun setelah lama berbincang, korban enggan pulang ke rumahnya, karena sudah larut malam dan dia takut dimarahi orangtuanya. Selanjutnya tersangka menawarkan agar korban menginap di rumahnya. Hingga akhirnya korban bersedia. Setelah menginap di kediaman tersangka, pada Sabtu malam, sesuai cerita korban sebelumnya, tersangka mengajaknya berhubungan badan, namun korban menolak. Tersangka tak mau menyerah, dia terus membujuk korban dan berjanji akan menikahinya, namun korban tetap menolak. Selanjutnya pada Minggu (11/3) pukul 23.00 WIB, tersangka kembali mengajak korban berhubungan dan korban pun bersedia dan merelakan kehormatannya dinodai. Sepulangnya ke rumah, ibu korban Mariani(43)menanyakan kemanakorbanpergiselamadua hari. Korban mengaku ke rumah pacarnyadiBatuBara.Mendegar itu ibu korban berang. Diapun mendesak putrinya untuk mengakui apa yang mereka lakukan selama dua hari. Korban pun akhirnya memngaku telah disetubuhi tersangka. Tak terima dengan keadaan tersebut, orangtua korban Rustam (46) dan istrinya Mariani (43), melaporkan kejadian yang menimpa putrinya ke Polsek Perdagangan. Kemudian pelaku ditangkapdanditahan,Rabu(14/ 3) pukul 12.00 WIB. (mag–02)

tiga bersaudara ini menambahkan, dia hanya memiliki dua anak kos yang tinggal di rumahnya. Sehingga dia mendapat biaya tambahan untuk biaya makannya. “Waktu aku kelas tiga SD ibuku sudah meninggal. Sementara ayahku pada tahun 2008 kemarin menikah lagi dan tidak mempedulikanku lagi,” kata Satrio yang mengaku memiliki dua kakak perempuan. Untuk menunjukkan talenta dalam bernyanyi, mahasiswa semester dua ini menceritakan pernah mengikuti audisi Indonesian Idol di Medan beberapa

waktu lalu. Akan tetapi ia hanya tampil sekali dan selanjutnya ia tidak dipanggil lagi atau dengan kata lain ter-eliminasi. “Kemarin aku menyanyikan lagu Judika dan saat itu juga aku ketemu dengan Judika. Tapi penampilan kedua aku tidak dipanggil panitia lagi,” katanya dengan wajah penuh penyesalan. Kasat Narkoba Polres Siantar AKP Sofyan menerangkan bahwa penangkapan terhadap Satrio berdasarkan informasi yang kerap disampaikan kepada polisi. Polisipun kemudian melakukan

penyelidikan dan akhirnya menangkap tersangka. “Barang bukti yang didapatkan sebanyak 95 paket kecil daun ganja, dan sudah menjualkan 10 paket dengan harga Rp10 ribu satu paket. Kemudian polisi juga mengamankan uang Rp50 ribu sisa hasil penjualan ganjanya,” terang Sofyan. Menurut Sofyan, status Satrio sebagai pengedar dan pengguna narkotika jenis ganja dan dijerat Pasal 114 Ayat 1 Sybs Pasal 111 No 35 tahun 2009 tentang narkotika. (mag-1)

Nilai Rapor Harus Ada Standar Jika Jalur Tes Tulis SNMPTN 2013 Dihapus JAKARTA-Wacana kebijakan pemerintah untuk menghapus jalur ujian tulis pada Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) 2013 mendatang, menuai dukungan. Akan tetapi, dukungan atas kebijakan tersebut harus juga mengedepankan asas keadilan di dalam menentukan penerima jalur undangan. Rektor Universitas Negeri Yogyakarta (UNY) Rochmat Wahab mengatakan, selama ini kriteria dan tingkatan akreditas sekolah juga mempengarungi jumlah siswa yang berhak mengikuti jalur undangan. “Maka itu, kami mendukung jika memang ujian tulis SNMPTN dihapuskan. Asal semuanya harus mengedepannya fairness,” terang Rochmat di Gedung Kemdikbud, Jakarta, Kamis (15/3).

Setidaknya, lanjut Rochmat yang juga Sekretaris Panitia P u s a t SNMPTN itu, penentuan penerimaan jalur undangan ditentukan dengan melalui evaluasi nilai r a p o r berdasarkan kriteria sekolah. Dalam hal ini, tentunya pemerintah harus membuat sistem untuk mendukung langkah tersebut. ”Nilai rapor siswa itu bisa dibedakan berdasarkan kriteria sekolahnya. Nilai 9 di sekolah bagus, tentu berbeda dengan nilai 9 di sekolah standar,” kata Rochmat. Terpisah, Rektor Institut Pertanian Bogor (IPB) Herry Suhardiyanto mengungkapkan, jika sistem jalur ujian tulis dihapuskan maka jalur undangan akan lebih mampu memberikan akses yang luas

bagi semua kalangan untuk masuk ke PTN. “Siswa di daerah akan semakin banyak memiliki kesempatan untuk masuk ke PTN. Bisa dikatakan, ini salah satu bentuk dukungan terhadap perluasan dan pemerataan pendidikan di Indonesia,” tukasnya. Diakui, dengan jalur seleksi nilai rapor dapat dipantau konsistensi kecerdasan siswa sejak semester 1 - 5. “Sehingga, nantinya dapat diketahui apakah kecerdasan siswa ini hanya digenjot bimbingan belajar demi mengejar kelulusan UN dan SNMPTN atau memang kecerdasan sejak awal,” paparnya. Untuk diketahui, IPB menerima mahasiswa sebagian besar lewat jalur undangan hingga 63 persen dan kuota yang diterima dari ujian tertulis SNMPTN hanya 10 persen. Sedangkan melalui jalur mandiri 10 persen, dan sisanya 7 persen melalui beasiswa utusan daerah. (cha/jpnn)

Tiga Warga Sibatu-batu Dianiaya Oknum Polisi Sambungan Halaman 1 ”Saya tidak ada jumpanya di kampung. Tapi di kampung, oknum polisinya memukuli dua orang warga kampung. Udah gitu, distrum-strumnya dua orang kampung yang dipukulinya itu. Kedua orang itu sekarang sedang visum di rumah sakit,” katanya. Masih kata Marojahan, di

kampung mereka oknum polisi ini mengaku sudah minum alkohol. ”Kepada orang kampong, oknum polisi yang memukuli aku itu, berteriak-teriak mengaku-ngaku dari kepolisian,” katanya saat dijumpai di Polresta hendak membuat pengaduan. Di Polresta, Marojahan menunjukkan oknum polisi

yang memukulnya itu dengan rambut cepak dan pakai jaket hitam. Namun, karena polisinya langsung masuk ke ruang Sat Intel, wartawan tidak bisa mengkonfirmasinya. Sampai malam tadi, korban masih menunggu keluarganya mau membuat pengaduan. Sedangkan kepala korban yang bersimbah darah belum juga diobati. (Osi)

Konsumsi Sabu-sabu, Penjual Soto Diciduk Sambungan Halaman 1 tersangka ini,” katanya. Penggerebekan kedua tersangka yang dipimpin Kasat Narkoba AKP Masku. Bahkan Tim dari Mapolres Simalungun ini juga mengendap untuk memantau pelaku. “Kita juga sudah lama mengendap di semak–semak agar kita dapatkan pelaku tersebut,” katanya. Sekitar satu jam memantau, petugas langsung melakukan penangkapan pada kedua tersangka, hingga keduanya diciduk tanpa perlawanan di kawasan Perumahan Karyawan Emplasment Perkebunan Sipef Nagori Kerasaan. Keduanya pun langsung digelandang ke Mapolres Simalungun untuk dilakukan proses penyelidikan selanjutnya. Dari tangan tersangka Hendra petugas berhasil menyita barang bukti sabu– sabu seberat 0,8 gram. Sementara dari tangan Isdiaman diperoleh sabu seberat 0,22 gram yang dikemas dalam dua paket. Saat ini kedua tersangka ditahan di Tahanan Mapolres Simalungun. Kasat Narkoba juga

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pemimpin Umum/Penjab/GM : Wakil Pemimpin Umum : Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Goldian Purba Maranatha Tobing Pandapotan MT Siallagan Alvin Nasution Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: Syafruddin Yusuf, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

mengaku, pihaknya akan melakukan pengembangan terkait kepemilikan narkoba jenis sabu-sabu tersebut. Ditemui di ruangan Satnarkoba, Kamis (15/3) usai menjalani pemeriksaan, Isdiaman kepada METRO mengaku sudah setahun mengonsumsi narkoba yang dibelinya dari rekannya. Menurutnya, saat hendak mengkonsumsi sabu, dia bersama rekannya mengumpulkan uang Rp500 ribu untuk membeli sabu seberat 0,2 gram yang dihisap bergantian. “Sudah satu tahun aku make barang itu Bang. Biasanya kalau gak make karena gak ada duit kepalaku pening dan susah tidur,” katanya pria yang mengaku punya anak satu ini. Isdiaman mengaku membeli sabu dari uang hasil penjualan nasi sotonya. Usaha nasi sotonya sendiri sudah lama dirintisnya di Kerasahan. Sementara Hendra mengaku saat ditangkap belum pernah mengonsumsi sabu. Menurut buruh bangunan ini, dia hanya ingin coba-coba karena dipengaruhi temannya. “Aku belum pernah pake Bang, mau coba-coba aja,” akunya polos.

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kord Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Roy Amarta, Ismail, Efendi Tambunan, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Erik. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Tersangka Arogan Ketika ditemui METRO, Kamis (15/3) pukul 16.00 WIB, Yono (34), salah seorang warga Emplasment Perkebunan Sipef mengaku sudah setahun mengenal kedua tersangka. Di mata warga sekitar, kedua tersangka dikenal arogan. “Mereka itu termasuk suka ugal–ugalan dan arogan Bang. Bahkan mereka juga suka minum–minum di kampung ini,” aku warga tersebut. Bahkan, soal penangkapan keduanya, Yono sempat melihat banyak petugas kepolisian yang melintas dengan sepedamotor, dan satu unit mobil berpenumpang petugas berpakaian preman. “Ketika keduanya digerebek, Saya sempat melihat banyak petugas Sat Narkoba Mapolres Simalungun yang mengenakan pakaian preman hingga diketahui bahwa kedua tersangka telah ditangkap polisi Bang,” katanya. Bahkan, warga sekitar menyambut baik atas tertangkapnya kedua tersangka itu. Sebab warga khawatir kegiatan pelaku akan merusak anak– anak mereka. (mag–02/ hot)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH TarifIklan:Hitam/Putih(B/W)Umum/DisplayRp.7.500/mmkolom,IklanKeluargaUcapanSelamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. HargaEceranRp2.000(dalamkota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733






Maret 2012



Tolong Ditebang Pohon Tua di Simpang Siantar Estate

Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun ? Kirim SMS ke nomor


Camat Siantar terhormat, ada dua batang pohon tua di Simpang Siantar Estate Jalan Asahan sudah cukup tua. Kita takut jika sewaktu-waktu angin kencang, kemudian kayu itu tumbang dan memakan korban jiwa. Jangan sempat terjadi lagi seperti yang di Nagori Lestari itu pak Camat! Pengirim: 081370028xxx

Pembalakan Liar di DAS Sigodang-Raya Huluan

Jalan Pamatangraya-Tigarunggu Seperti Kubangan Kerbau

Kenapa masih marak pembalakan liar di sekitar perengan DAS jalan tembus Sigodang-Raya Huluan. Ini sangat meresahkan dan dapat mengakibatkan longsor di sepanjang perengan DAS jalan tembus Sigodang-Raya Huluan. Pengirim: 085359371xxx

Bupati Simalungun terhormat, tolong diperhatikan infrastruktur jalan Siantar-Saribudolok, mulai dari Pamatangraya-Tigarunggu, kondisinya sangat parah. Padahal sebagian jalan seperti di Desa Rayabayu sudah disertu tapi nggak diaspal. Sekarang kondisi jalan itu sudah seperti kubangan kerbau, saya mohon perhatiannya. Pengirim: 085372262xxx

Walikota, Tolong Tegur Kadisdik! Pak Walikota Hulman Sitorus, mohon ditegur tuh Kadis Dikjar soal kutipan terhadap Guru yang melakukan pengurusan sertifikasi. Nggak mungkin kadisnya nggak tau soal itu..! Pengirim: 082161200xxx


TAK BERIZIN-Seorang warga melintas di lokasi galian C di Tanjung Pinggir, Kamis (15/3). Aktifitas galian C ini sudah berlangsung lama tapi tak berizin.

Eksploitasi Gila-gilaan di Tj Pinggir Hingga kini eksploitasi gila-gilaan terhadap Sungai Bahapal di Tanjung Pinggir Kecamatan Siantar Martoba berlangsung aman tanpa hambatan. Padahal pemerintah setempat tidak pernah mengeluarkan izin eksploitasi.

Untuk mengeruk pasir, mereka pakai mesin penyedot langsung dari dasar sungai. Kemudian untuk tambang galian C lainnya, seperti batu pakai mesin pemecah batu. Tak terasa dasar sungai kandas dikeruk, bukit berbatu rata tanah. Sementara pemko tak menerima PAD, tapi aktivitas tambang jalan terus. Apa komentar Anda? (dro)

Merugikan Negara Pemko Siantar harus tegas mengambil sikap. Tindakan eksploitasi ilegal di Tanjung Pinggir sangat merugikan negara. Sebab pada pasal 33 UUD 1945 ayat 3 disebutkan bumi dan air serta kekayaan alam yang terkandung di dalamnya dikuasai oleh negara dan dipergunakan untuk sebesar-besar kemakmuran rakyat. Ini kan dikuasai oleh siapa dan dipergunakan untuk kemakmuran siapa? (mag–02) Bendri Sihotang Warga Jalan Siatas Barita Siantar

Harus Ditutup Sebelum masyarakat berasumsi bahwa pemko membekingi galian C illegal, sebaiknya segera ditutup. Jangan tebang pilih! EB Manurung Anggota DPRD Siantar

Akibatnya Bisa Abrasi & Longsor Jika aktivitas galian C dilakukan tanpa izin, berarti tidak ada pengawasan. Itu artinya eksploitasi terhadap Sungai Bah Bolon di Tanjung Pinggir itu tidak ramah lingkungan. Akibatnya akan terjadi abrasi, longsor. Maka Pemko Pematangsiantar harus ambil tindakan cepat dan tegas! Fransisko Sitorus Wiraswasta Warga Pagar Jawa, Tanah Jawa

Ada Yang Bekingi Mungkin ada yang bekingi, sehingga tidak ada yang protes dan tetap berlangsung aman tanpa ada hambatan. Donal Sinaga Pegawai Swasta Warga Parapat

PENGUMUMAN NOMOR : PENG- 04/WPJ.26/2012 TENTANG REGISTRASI ULANG PENGUSAHA KENA PAJAK TAHUN 2012 Dalam rangka meningkatkan pelayanan, penertiban administrasi, pengawasan dan untuk menguji pemenuhan kewajiban subjektif dan objektif Pengusaha Kena Pajak (PKP), dengan ini diberitahukan kepada seluruh Pengusaha yang telah terdaftar sebagai Pengusaha Kena Pajak (PKP) bahwa: 1. Kantor Pelayanan Pajak Pratama di Lingkungan Kanwil Direktorat Jenderal Pajak Sumatera Utara II sedang melaksanakan Kegiatan Registrasi Ulang untuk seluruh Pengusaha Kena Pajak Terdaftar. 2. Pengusaha Kena Pajak (PKP) adalah para pengusaha yang bergerak di bidang usaha industri, perdagangan dan jasa yang wajib memungut Pajak Pertambahan Nilai (PPN) atas barang dan/atau jasa yang mereka serahkan/jual dengan omset satu tahun lebih dari Rp. 600 juta. 3. Jangka waktu pelaksanaan Registrasi Ulang Pengusaha Kena Pajak dimulai sejak Pebruari 2012 sampai dengan 31 Agustus 2012. Demikian disampaikan untuk diketahui. Pematang Siantar, 13 Maret 2012 Kepala Kantor, Ttd

Harta Indra Tarigan NIP. 195808251980121001



TENTANG PENGAMBILAN, PENGISIAN DAN PENYAMPAIAN SURAT PEMBERITAHUAN TAHUNAN PAJAK PENGHASILAN (SPT TAHUNAN PPh) Sehubungan dengan kewajiban menyampaikan SPT Tahunan PPh makin dekat, dengan ini diumumkan bahwa : 1. Batas waktu penyampaian SPT Tahunan PPh Tahun Pajak 2011 adalah: • SPT Tahunan PPh Wajib Pajak Orang Pribadi (WP OP) tanggal 31 Maret 2012 dan • SPT Tahunan PPh Wajib Pajak Badan (WP Badan) adalah 30 April 2012. 2. Diingatkan dan dihimbau kepada Wajib Pajak Orang Pribadi agar menyampaikan SPT Tahunan PPh-nya jauh hari sebelum jatuh tempo tersebut diatas untuk menghindari antrian panjang. 3. Wajib Pajak mengambil sendiri formulir SPT Tahunan PPh ke Kantor Pelayanan Pajak (KPP), Kantor Pelayanan Penyuluhan dan Konsultasi Perpajakan (KP2KP), Mobil Pajak Keliling/Pojok Pajak yang sedang beroperasi dan dapat diunduh di website 4. Jenis SPT Tahunan PPh WP OP yang wajib diisi, disesuaikan dengan kriteria sebagai berikut : a. Formulir 1770 SS (SPT Tahunan PPh WP OP 1770 Sangat Sederhana) bagi karyawan yang hanya berpenghasilan dari satu pemberi kerja dengan jumlah penghasilan tidak lebih dari Rp 60 juta setahun; b. Formulir 1770 S (SPT Tahunan PPh WP OP 1770 Sederhana) bagi karyawan berpenghasilan lebih dari Rp 60 juta setahun atau bagi karyawan yang bekerja pada lebih dari satu pemberi kerja, yang tidak mempunyai usaha atau pekerjaan bebas; c. Formulir 1770 (SPT Tahunan PPh WP OP) bagi WP OP yang mempunyai/melakukan kegiatan usaha atau pekerjaan bebas. 5. Jenis SPT Tahunan PPh WP Badan adalah Formulir 1771. 6. Apabila Wajib Pajak mengalami kesulitan dalam pengambilan Formulir SPT Tahunan PPh, misalnya para pekerja pabrik, supermarket, perkebunan dan sebagainya, pengambilan dapat dilakukan secara kolektif oleh salah seorang wakil perusahaan ke kantor pelayanan pajak (KPP) terdekat. 7. Formulir SPT Tahunan Pajak Penghasilan ini dapat difotokopi untuk keperluan sendiri atau pihak lain. 8. SPT Tahunan PPh diisi dengan benar, jelas dan lengkap dan ditanda tangani oleh wajib pajak yang bersangkutan atau oleh pihak yang diberikan kuasa oleh Wajib Pajak dengan surat kuasa bermeterai Rp. 6000,. 9. Apabila terdapat PPh kurang bayar, agar dilakukan pembayarannya melalui Bank Persepsi atau Kantor Pos. 10. SPT Tahunan PPh Formulir 1770 S atau 1770 SS dapat dikumpulkan melalui kantor karyawan masing-masing, yang selanjutnya disampaikan ke KPP atau KP2KP secara kolektif. 11. SPT Tahunan PPh yang telah diisi agar disampaikan (sesuai dengan status SPT) : a. Untuk SPT Nihil / SPT Kurang Bayar (KB) dapat disampaikan melalui : • Secara langsung melalui Tempat Pelayanan Terpadu (TPT) Kantor Pelayanan Pajak (KPP), Pojok Pajak dan Mobil Pajak yang sedang beroperasi; • Drop Box yang terdapat ditempat-tempat strategis seperti plaza, bank, Kantor Pemda Kota/Kabupaten, Kanwil DJP Sumut II, KPP Pratama dan tempat lain yang ditentukan; • Pos/Jasa Ekspedisi yang disertai Bukti Pengiriman Surat ke KPP tempat WP Terdaftar; • E-Filing (khusus untuk Formulir 1770 S dan 1770 SS) yaitu suatu cara penyampaian SPT secara elektronik yang dilakukan secara online dan real time melalui internet pada Website Direktorat Jenderal Pajak ( b. Untuk SPT Lebih Bayar (LB) /Pembetulan SPT/SPT Tahunan yang disampaikan setelah batas waktu penyampaian SPT harus disampaikan melalui : • Tempat Pelayanan Terpadu (TPT) di Kantor Pelayanan Pajak (KPP) tempat WP terdaftar; • Pos/Jasa Ekspedisi yang disertai bukti pengiriman Surat ke KPP tempat WP terdaftar; • E-filing (khusus untuk Formulir 1770 S dan 1770 SS). 12. Untuk informasi lebih lanjut hubungi Kantor Wilayah Direktorat Jenderal Pajak, Kantor Pelayanan Pajak (KPP), Kantor Pelayanan Penyuluhan dan Konsultasi Perpajakan (KP2KP) terdekat atau Kring Pajak 500200. Demikian disampaikan agar masyarakat dapat mengetahui dan melaksanakannya. Perdagangan,13 Maret 2012 Kepala Kantor Ttd SURYA MANURUNG NIP.197712122002121002




Maret 2012





Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter.

Para penyidik KPK adalah perpanjangan tangan banyak pihak yang berkepentingan untuk dilindungi. Semua orang tahu penyidik dari kepolisian dan kejaksaan tidak semuanya bersih.

Sikap Kami Jangan Biarkan Abraham Sendirian EKSISTENSI Komisi Pemberantasan Korupsi (KPK) benar-benar diuji. Hantaman bak gelombang datang dari segala sisi untuk melemahkan institusi pemberantas korupsi yang paling dipercaya rakyat itu. Lepas dari masih adanya kekurangan dan kelemahan, KPK harus diakui merupakan garda terdepan paling menjanjikan untuk memerangi para koruptor di Republik ini. Taring KPK pun semakin tajam setelah berganti pimpinan yang dikomandoi Abraham Samad. Namun, bukan berarti KPK aman dari rongrongan. Semakin garang mereka memberangus koruptor, semakin besar pula perlawanan yang datang. Segala jurus dan segala cara dilancarkan pihak-pihak yang ingin KPK lunglai. Mereka tidak ingin KPK semakin tangguh dan berwibawa. Dari pihak luar, misalnya, kini Komisi III DPR gencar menggodok revisi Undang-Undang Nomor 30 Tahun 2002 tentang KPK. Komisi III sampai studi banding ke luar negeri, padahal mereka hendak memereteli kewenangan KPK. Kelak dengan undang-undang hasil perombakan, KPK lebih banyak berurusan pada pencegahan, bukan penindakan. DPR yang ikut melahirkan KPK pada 2003 kini bernafsu menjadikan anak kandung mereka itu macan ompong. Ironisnya, ketika perlawanan dari luar semakin kencang, KPK justru diguncang perpecahan di dalam. KPK bergolak kala sejumlah penyidik dari kepolisian memprotes Abraham Samad, Selasa (13/3). Mereka berdalih pimpinan KPK memulangkan secara sepihak penyidik ke institusi asal, yakni kepolisian dan kejaksaan. Gejolak yang menghantam KPK itu jelas memprihatinkan. Ketika pimpinan tak lagi akur dengan penyidik, ketika penyidik mulai membangkang kebijakan pimpinan, kiamatlah KPK.Gejolak yang meletup sekaligus membuktikan adanya masalah menyangkut profesionalitas penyidik KPK akibat sistem rekrutmen yang tidak independen. Keberadaan penyidik dari kepolisian dan kejaksaan berpotensi memunculkan dualisme kepatuhan sekaligus menodai integritas. Mereka yang bukan organ resmi KPK juga rawan pengaruh busuk dari luar. Tak mengherankan jika tuduhan miring terlontar bahwa penyidik KPK belum steril dari keberpihakan. Itulah yang antara lain memaksa kepengurusan Abraham Samad memulangkan beberapa penyidik ke institusi masing-masing. Untuk menghadapi koruptor yang punya modal mahabesar, baik uang maupun kekuasaan, KPK mutlak membutuhkan kekompakan, ketegaran, dan independensi. Tanpa ketiga kualitas itu, KPK ibarat David yang tak berkutik melawan Goliath dalam perang besar menghadapi koruptor. Untuk mencapai ketiga kualitas itu, tidak bisa lain KPK harus memiliki penyidik sendiri, yang memang direkrut dan dididik khusus untuk KPK. Bukan penyidik pinjaman, apalagi titipan jaksa dan polisi, yang kemudian protes keras karena dikembalikan KPK ke markas mereka. Kita dukung keberanian Abraham Samad mengembalikan beberapa penyidik ke institusi masing-masing. Lebih dari itu, jangan biarkan pemimpin KPK itu sendirian menghadapi rongrongan dari luar maupun dari dalam. (***)

Hulman vs Pers, Siapa Yang Menang? Indonesia adalah negara yang sebagian besar bertransport dengan sepedamotor. Tapi yang paling unik ada di kota Siantar yang menjadi ibukota motor merek Birmingham Small Army alias BSA, pabrikan Inggris yang sudah tidak diproduksi lagi sekarang.

Oleh: Marim PPurba urba Di acara pembukaan Konperensi Studi Wilayah I GMKI (7/3), Walikota Pematangsiantar Hulman Sitorus konon menyampaikan pernyataannya yang pedas : “Pers dan LSM berbahaya bagi negara dan menjadi penghambat demokrasi di Indonesia!” Besoknya semua koran lokal menjadikannya headline dan juga mengecam dengan demo. MungkinHulmanmaumenyampaikansisilaindari fenomena kehadiran pers, tapi lupa cara menyampaikannya. Dibabak pertama perseteruan ini saya coba melihatnya dengan menulis kembali bagian yangpernahsayapublikasibeberapatahunlalu.Anggap saja bahwa saya menjadi corongnya Hulman dalam melihat pers. Tapi supaya adil, di ‘babak kedua’ nantinya saya akan coba juga menjadi corongnya teman-teman pers dalam memandang Hulman. Dalam suatu peristiwa di era 90-an, saya ingat pernah diajak salah seorang wartawan senior untuk meriset pasar koran di Solo. Mengherankan bahwa begitu banyaknya koran nasional yang menyerbu Solo tapi tak satupun ada Koran Solo. Itulah latar belakangnya ketika ditahun 2000 saya meriset kecilkecilan masyarakat pembaca Siantar, dan memutuskanuntukmendirikanKoranSiantar;sebagai surat kabar pertama yang dilahirkan di Siantar, dikelola oleh orang Siantar, dibaca pembaca Siantar dan memberitakan pernak-pernik tentang Siantar. Pasar surat kabar dan minat pembaca Siantar terbukti masih merupakan ruang yang terbuka. Menyusul kemudian saya revitalisasi Radio Siantar (FM), dan kemudian mendirikan TV Siantar sebagai TV lokal pertama di Indonesia. Sesudahnya atau bersamaan dengan itu kemudian hadir Simalungun Pos, Suara Simalungun, lalu Pos Metro Siantar yang kemudian berubah menjadi Metro Siantar, Pena Rakyat, Sumatera Timur, Trans Media, Sinar Keadilan, Local News, Siantar Pos, Metropolis, Konstruktif, Simantap. Surat kabar di Siantar semakin ramai sebagaimana juga surat kabar di Indonesia, dan pasar yang kompetitif semakin terbuka. Kini suratkabar (media cetak) tidak hanya bersaing dengan suratkabar atau media cetak lainnya, tapi juga dengantelevisi,radiodaninternet.Ketigamediumpublik yangmengandalkanteknologikomunikasiberkecepatan tinggi dalam menyampaikan informasi ini, membuat beritasuratkabaryangbarubisaterbitkeesokanharinya menjadi basi dan tak lagi disentuh pembaca, terutama khalayak generasi digital. Intinya, jika di era digital ini suratkabarhanyamengandalkanberitastraightnews,ia pasti akan habis digilas para pesaingnya. Tren pertumbuhan pelanggan internet di Indonesia semakin signifikanmenggesersuratkabarharian.

BerdasarkanSerikatPenerbitSuratkabar(SPS)Pusat pada tahun 2006, dari sekitar 230 juta penduduk Indonesia, penetrasi TV, Surat Kabar Harian (SKH) dan Internet: 30 juta unit TV dan 6,03 juta Surat Kabar Harian (SKH), dan 6 juta orang pelanggan internet. Itu artinya, daya saing media cetak ke depan sangat tergantung pada kemampuannya menggali cerita di balik berita, mendalami fakta-fakta yang tersembunyi, memahami latar belakang peristiwa, proses dan riwayat sebuah fakta, menganalisis satu fakta dengan fakta lainnya, lalu menenunnya menjadi sebuah bangunan informasi (rekonstruksi) yang mendekati realitas sesungguhnya. Untuk bisa bertahan dan berkompetisi dengan media online dan televisi, suka atau tidak suka media cetakharusmengubahorientasiprodukjurnalismenya. Ketimbang menampilkan straight news seperti yang selama ini dilakukan, saatnya bagi pers di Siantar untuk menyuguhkan features, reportase interpretatif, in-depth news, reportase investigasi dan reportase riset. In-depth news merupakan suatu laporan yang mendalam tentang suatu objek yang biasanya mengenai kepentingan khalayak dan patut diketahui umum. Reportase diawali dari sebuah peristiwa penting sebagai pelatuk (peg news) lalu dilakukan penggalian sebanyak mungkin data agar masyarakat bisa benar-benar memahami persolaan atau peristiwa tersebut secara utuh. Indepth Reporting tidak menyiratkan kegiatan membongkaraib,kesalahan,ataukelemahanpemerintah dengan mencari data dan keterangan belaka. Dalam melakukan indepth reporting, seorang wartawan bisa berangkat praktis dari nol atau dari sekadar membaca kliping-kliping koran. Jurnalisme kontemporer ini bukan sekedar solusi menebus kekalahan koran harian dari media online dan televisi dalam kecepatan menyebarkaninformasi,tapisebuahkeniscayaanuntuk menjawab kebutuhan pembaca intelektual. Yang dibutuhkan pembaca intelektual (masyarakat wellinformed) terhadap media cetak adalah perkembangan terbaru dari peristiwa itu atau berupa pendalaman dan analisis peristiwa disertai kekuatan visualisasi informasi dengan tampilan infografis. Opsi ini tentu saja membawa konsekuensi pembengkakan biaya operasional dan biaya produksi. Tapi liputan isu lokal dengan teknik jurnalisme interpretatif, in-depht news, riset dan investigasi, menjadi potensi kekuatan produk jurnalisme dalam mengisi ceruk pasar yang kosong. Di Sumatera Utara, apalagi di Siantar saat ini relatif belum ada suratkabar harian atau koran berita berkala yang secara serius dan konsisten menyuguhkan informasi dengan ketajaman dan kedalaman menggali informasi, terutama isu-isu lokal. Begitu juga dengan informasi-informasi yang membangkitkan inspirasi, motivasi dan memberikan solusi. Tidak ada pilihan bagi pers di Siantar dan wartawan kecuali segera berubah, sebab jika tidak dilakukan maka rekan-rekan pers akan dilindas oleh perubahan itu sendiri, atau seperti dikatakan Hulman sebagai penghambat demokrasi? Kalau media di Siantar tidak memperbaiki diri, akan sulit menghadapi persaingan ketat diantara 889 penerbitan di Indonesia (251 diantaranya Surat Kabar Harian, sisanya adalah Mingguan, Tabloid, Majalah, Buletin) dengan tiras 17.374.160 eks (6.026.486 diantaranya adalah SKH). Saatnya penyajian berita mengutamakan aspek

keberpengaruhan isu (peristiwa/pernyataan) terhadap kepentingan publik. Isu terpenting dan terhangat di Pematangsiantar sebagai kota dengan suhu politik paling panas. Misalnya menjadi pernyataan Hulman tentang pers sebagai peg news (cantelan/pelatuk berita) untuk dikembangkan, diekplorasi, diteliti, diselidiki, dikorelasikan satu fakta dengan fakta lainnya dan atau diberi interpretasi. Hal lain misalnya bantuan bermilyar rupiah dari Pemko Siantar kepada TNI bisa didalami dengan mencurigai fakta tersembunyi di balik berita (reportase investigasi); atau menyoroti efek domino akibatpemotongananggaran(?)DikjarkeSanggarAnak Balita (in-depth news), dan pemaknaan dari ketidaksediaan Hulman merenovasi Pasar Dwikora yang terbakar (reportase interpretatif). Saat ini muncul tren strategi baru para pemain suratkabar dalam menghadapi persaingan di pasar. KorannasionalterbitanJakarta,kinimenggunakanjurus membuat edisi-edisi lokal. Koran nasional terbitan Jakarta menggunakan edisi lokal skala propinsi. Kompasmisalnya,telahmemulaidenganedisiJawa Barat, Jateng dan Jogjakarta, serta edisi Jawa Timur. Belalainya makin panjang dengan topangan unsur grupnya seperti Tribun, Intisari dan 20-an terbitan lainnya untuk berbagai segmen pembaca. Seluruhnya ada 12 grup besar yang memakai pola yang sama yaitu MNC Media Group, Jawa Pos Group, Kompas Gramedia Group, Mahaka Media Group, Elang Mahkota Teknologi, CT Corp, Visi MediaAsia, Media Group, MRAMedia, Femina Group, Tempo Inti Media dan Beritasatu Media Holding. DiSumateraUtara,beberapaharianlokaljugamencoba menggabungkanberitadaribeberapadaerah(kabupaten/ kota)terdekatatauyangmempunyaikesamaaankultur, dalamsaturubrikasi.Pendekatanpasarsecarageografis ataukedaerahaninimasihrelevan,karenacerukpasarnya yangbelumdigarapsecaraoptimal. Banyakmediayanggagalbukanlantarankelemahan finansial dan penetrasi pasar, melainkan karena permasalahandinewsroom.Kelemahandiruangredaksi yang menurunkan kualitas produk media antara lain karena tim redaksi tidak solid dan kompak (teamwork rapuh), sumber daya wartawan dan editor yang tidak professional, atau etos kerja buruk. KarenaitukoranlokaldiSiantarperluterusmenerus melakukan outbound/ice breaking untuk membangun kekompakan tim. Peningkatan kompetensi calon wartawan dan editor dengan keterampilan jurnalistik untuk berita berkala, khususnya pelatihan jurnalisme presisi (reportase riset), jurnalisme investigasi, dan in-depht reporting. Menyiapkan dokumen prosedur kerja (SOP), dan sanksi (punishment) bagi wartawan yang tidak baik dan penghargaan (reward) untuk prestasi karya jurnalis. Selain tuntutan peningkatan manajemen dan kompetensi,bagaimanapunjugajaminankesejahteraan wartawan Siantar harus tetap diperhatikan, agar rekanrekan pers tak ikut-ikutan tren beberapa wartawan lain yang hidup dari memeras sumber berita. Mungkin sisi ini yang ingin disampaikan oleh Hulman dalam pernyataannya? Jika hal ini benar tentu saja wajar jika wartawanyangmerasaterhinademo.Tapiingat,dalam membangunaliansidiantarawartawanselaluadaancaman daridalam,yaituoknumwartawanyangpagi-pagisudah duluan‘delapan-enam’denganpenguasa.(***) Penulis adalah pengamat media

Pengamat Politik UI Iberamsyah, Kamis (15/3)

Sangat mungkin bagi mafia pajak untuk bermain dalam pengadilan pajak. Posisi pengadilan pajak yang berada di kompleks Kemenkeu membuat kemungkinan mafia pajak tumbuh subur.

Anggota Komisi III DPR RI Nudirman Munir, Kamis (15/3)

Izin kepada PT Merpati Nusantara Airlines untuk membeli pesawat dari China belum diberikan untuk membeli pesawat baru sebab tidak realistis. Saya tekankan realistis saja, memperbaiki perusahaan saja. Pesawat rusak diperbaiki dan dalam waktu merpati sudah dapat 4 pesawat jet miliknya sendiri.

Menteri BUMN Dahlan Iskan, Kamis (15/3)




Maret 2012



Tarif Listrik Batal Naik


AS Pensiunkan 20 Ribu Marinir WASHINGTON- Amerika Serikat (AS) akan mengurangi 20 ribu personel Marinirnya dalam waktu 5 tahun ke depan. Pengurangan ini dalam rangka menghemat anggaran pertahanan seperti yang telah ditetapkan oleh pemerintah AS. Pemangkasan jumlah personel Korps Marinir AS tersebut berasal dari 4 batalion infanteri dan 12 skuadron udara. Pengurangan terbesar berasal dari markas Marinir AS di North Carolina, tepatnya dari Camp Lejeune. Pangkalan udara New River akan kehilangan 5.800 personelnya dan pangkalan udara Cherry Point akan kehilangan 2.100 personelnya. Sementara 3 pangkalan Marinir di California, yakni Camp Pendleton, 29 Palms, dan Miramar akan kehilangan total 6 ribu personel. Pengurangan ini akan dilakukan secara bertahap dalam waktu 5 tahun dan dilakukan sesuai masa tugas masingmasing, sehingga setiap personel bisa menyelesaikan masa tugasnya sebelum akhirnya pensiun. ”Dampaknya akan terasa bagi personel yang akan melalui pendaftaran ulang. Kami jelas-jelas...membutuhkan lebih sedikit marinir, jadi pendaftaran ulang akan diperketat. Marinir akan segera memiliki personel yang profesional, berkualitas dan berkemampuan baik,” ujar Kepala Komando Pengembangan Tempur Korps Marinir AS, Letnan Jenderal Richard Mills seperti dilansir oleh Reuters, Kamis (15/3). Setelah pemangkasan personel ini selesai pada 2016, kekuatan Korps Marinir AS akan menyusut dari 202 ribu orang saat ini menjadi 182 ribu personel. Susunan organisasi tempur pun dirampingkan. Kesatuan infanteri, misalnya, akan berkurang dari 27 batalion menjadi 23 batalion, sementara korps penerbangan menyusut dari 27 skuadron menjadi 58 skuadron. (dtc/int)


„ Ketua Tim Dokter Kepresidenan Brigjen TNI Aris Wibudi memberikan keterangan pers soal perawatan Ibu Negara Ani Yudhoyono di RSPAD Gatot Soebroto, Jakarta, Kamis (15/3).

BATU EMPEDU Ani Yudhoyono Diangkat JAKARTA- Dalam waktu kurang dari tiga bulan, Ibu Negara Ani Yudhoyono kembali menjalani perawatan di Rumah Sakit Pusat Angkatan Darat (RSPAD) Gatot Subroto, Jakarta. Bahkan, kali ini, ibu Agus Harimurti dan Edhie Baskoro itu harus menjalani tindakan medis operasi. Dari hasil pemeriksaan tim dokter kepresidenan, Ani mengidap sakit batu empedu. “Hasil pemeriksaan lanjutan, ditemukan batu kandung empedu disertai radang kandung empedu,” ujar Ketua Tim Dokter Kepresidenan Aris Wibudi di RSPAD, kemarin (15/3). Ani Yudhoyono masuk di RSPAD kemarin sekitar pukul 10.00 untuk persiapan operasi. Rencananya, operasi pengangkatan batu empedu dilaksanakan pagi ini (16/3). “Tindakan yang direncanakan adalah pengangkatan kandung empedu beserta batunya,” kata dokter berpangkat brigjen itu. Aris menjelaskan, penyakit yang diidap Ani diketahui berdasar general checkup rutin. Namun, dia enggan menjelaskan keluhan yang

disampaikan ibu negara. “(Keluhannya) tidak usah ya. Statement ini sudah cukup,” dalihnya. Begitu juga saat diminta menjelaskan penyebab penyakit tersebut. Berdasar situs Wikipedia, batu empedu merupakan suatu bentuk padatan yang terdapat di dalam kantung ataupun saluran empedu sehingga menghalangi perjalanan empedu menuju usus. Kondisi seperti itu akan menimbulkan rasa nyeri dan mual. Menurut Aris, batu empedu dapat dihilangkan dengan beberapa cara. Misalnya, pemberian obat mengandung asam dan garam empedu, ditembak dengan sinar laser, dan diangkat bersama kantong empedunya. “Itu tim bedah yang memutuskan untuk operasi,” kata Aris soal tindakan operasi yang dipilih untuk Ani. Aris tidak menjawab tegas saat ditanya apakah Presiden Susilo Bambang Yudhoyono (SBY) akan menunggu di RSPAD saat operasi berlangsung. Dia justru balik bertanya. “Kalau istri dioperasi, kamu nungguin nggak?,” katanya lantas tersenyum. Penjelasan dokter kepresidinan

tersebut sekaligus menepis kabar yang beredar sehari sebelumnya yang menyebutkan Ani mengalami anfal. Aris menyebut Ani dalam kondisi baik jelang operasi hari ini. ?Kondisinya sangat bagus,” katanya. Kemarin, sejumlah istri menteri yang tergabung dalam Solidaritas Istri Kabinet Indonesia Bersatu (SKIB) tampak menjenguk. Meski menjalani operasi pengangkatan batu empedu, Ani diperkirakan tetap mendampingi SBY yang akan melakukan kunjungan kenegaraan ke Tiongkok, Hongkong, dan Korsel, pekan depan. “Sementara masih sebagaimana yang direncanakan,” kata Juru Bicara Kepresidenan Julian Aldrin Pasha. “Tim dokter mengupayakan kesehatan Ibu Ani seprima mungkin dan (pulih) secepat mungkin,” kata Aris. Sebelumnya, akhir Desember 2011, Ani menjalani perawatan di RSPAD. Kala itu, dokter kepresidenan menyebut Ani menderita demam typhoid (tifus). Karena sakit itu, Ani sempat tidak mendampingi SBY melakukan kunjungan kerja ke Jawa Tengah. (fal/agm/jpnn)

JAKARTA- Kabar gembira bagi masyarakat. Setelah melalui pembahasan alot, pemerintah dan Komisi VII DPR akhirnya sepakat untuk membatalkan rencana kenaikan tarif listrik. Menteri Energi dan Sumber Daya Mineral (ESDM) Jero Wacik mengatakan, setelah mendengar berbagai masukan dari Komisi VII, pemerintah akhirnya sepakat untuk membatalkan rencana kenaikan tarif listrik secara bertahap sebesar 9 persen mulai Mei mendatang. “Suasana kebatinan kami di pemerintah juga merasa, kok sepertinya kurang tepat kalau menaikkan tarif listrik bareng dengan kenaikan (harga) BBM, jadi ditunda dulu,” ujarnya saat rapat dengan Komisi VII DPR kemarin (15/3). Jero mengakui, pemerintah sadar bahwa penolakan dari semua fraksi di Komisi VII DPR terhadap rencana kenaikan tarif listrik membuat hal itu tidak bisa dimasukkan dalam APBN-Perubahan 2012. “Kalaui semua minta kenaikan ditunda, ya saya tidak bisa apa-apa,” katanya. Ketua Komisi VII DPR Teuku Riefky Harsya mengatakan, dengan berbagai pertimbangan, Komisi VII memang tidak bisa menyetujui rencana kenaikan tarif listrik. “Jadi, Komisi VII dan pemerintah sepakat bahwa kenaikan tarif listrik tidak bisa dilakukan,” ujarnya lantas mengetok palu di meja pimpinan rapat. Namun, Jero buru-buru menegaskan, meskipun rencana kenaikan tarif listrik pada Mei nanti dibatalkan, tetapi pemerintah masih membuka opsi kenaikan tarif listrik pada akhir tahun atau tahun

„ Jero Wacik depan. “Jadi, ditunda dulu saja. Tapi nanti kalau masyarakat sudah tenang, sudah tidak demo-demo lagi, nanti kita bicarakan lagi (rencana kenaikan tarif listrik), mungkin akhir tahun ini atau tahun depan,” jelasnya. Meskipun pemabatalan kenaikan tarif sudah disepakati, namun besaran subsidi listrik masih belum diputuskan. Sebelumnya, akibat naiknya harga minyak dunia, pemerintah mengajukan angka subsidi listrik dalam APBN-P 2012 sebesar Rp 89,55 triliun, sehingga setelah ditambah kekurangan pembayaran pada 2010 (carry over) maka totalnya sebesar Rp 93,05 triliun, atau lipat dua dari angka dalam APBN 2012 yang sebesar Rp 44,96 triliun. Namun, angka tersebut ditolak oleh Komisi VII DPR karena dinilai terlalu besar. Untuk itu, pemerintah pun mengajukan dua opsi, yakni subsidi sebesar Rp 83,45 triliun atau Rp 80,45 triliun. Namun, lagi-lagi angka tersebut ditolak oleh Komisi VII DPR. Setelah melalui pembicaraan antara pemerintah dan perwakilan fraksi-fraksi komisi VII, akhirnya memutuskan angka subsidi listrik dalam APBN-P sebesar Rp 64,97 triliun. (owi/sof/jpnn)






Siantar Waterpark Peduli Pendidikan

Besok, Lomba Mewarnai Tingkat TK Digelar SIANTAR-Besok, Sabtu (17/ 3), Siantar Waterpark akan menggelar lomba mewarnai khusus tingkat Taman Kanak-kanak (TK) di Siantar Waterpark Jalan Rakutta Sembiring (Simpang Rami) Pematangsiantar. Kegiatan akan dibuka oleh Ny. Hulman Sitorus Rusmiati Rumanna Pardosi, Ketua Penyelenggara Pendidikan Anak Usia Dini (PAUD) Kota Pematangsiantar. Pimpinan Siantarmas Residence dan Siantar Waterpark Hameng Prayetno didampingi Daulat Sinaga SH, kepada METRO, Kamis (15/3) menjelaskan, penyelenggaraan lomba mewarnai tingkat TK untuk anak-anak Kota Siantar serta sekitarnya merupakan bentuk kepedulian manajeman Siantarmas Residence dan Siantar Waterpark terhadap dunia pendidikan. “Sebagai pelaku usaha sekaligus pengelola taman hibu-

ran air terlengkap di Siantar, kami ingin memberikan kesempatan kepada anak-anak TK untuk menunjukkan bakat yang dimiliki. Dengan melakukan perlombaan, diharapkan rasa percaya diri anak-anak peserta akan bertambah,” kata Daulat Sinaga. Dijelaskan Sinaga, lomba yang mengambil lokasi di taman air Siantar Waterpark sekaligus untuk memberikan kesempatan pengalaman terbaik kepada anak-anak tentang taman hiburan air. Dengan biaya pendaftaran Rp25 ribu, peserta mendapat tiket, satu set crayon serta bingkisan menarik dari panitia. “Diperkirakan pesertanya antara 500 sampai 600 orang, yang merupakan anak-anak PAUD seKota Siantar. Kami berharap orangtua tidak segan-segan untuk mendaftar anak-anaknya karena kegiatan seperti ini jarang digelar,” kata Sinaga. Dijelaskannya, lomba mewar-

nai tingkat TK ini akan memperebutkan hadiah berupa uang tunai, trophy dan tas sekolah. Untuk juara I akan menerima uang tabungan Rp1,5 juta, juara II memperoleh uang tabungan Rp1 juta, juara III menerima uang tabungan Rp750 ribu, juara harapan I menerima tabungan Rp500 ribu, juara harapan II menerima tabungan Rp300 ribu dan juara harapan III menerima tabungan Rp200 ribu. Sementara Pimpinan Siantarmas Residence Hameng Prayetno menjelaskan, selain bergerak dibidang perumahan, pihaknya juga mengembangkan lokasi bisnis strategis yang diberi nama Siantarmas Bisnis Centre. Lokasi bisnis berupa rumah toko terletak menghadap Jalan Medan. Sementara dalam waktu dekat, di komplek Siantarmas Residence juga akan dibangun pusat perbelanjaan terlengkap di Kota Siantar. (esa)

Ultrabook Samsung Fokus di Segmen Premium (FOTO: EDI SARAGIH)

LOKASI: Siantar Waterpark di Jalan Rakutta Sembiring sebagai lokasi lomba mewarnai tingkat TK di gelar, Sabtu (17/3).

Pajak Menyatukan Hati Membangun Negeri Pekan Panutan Penyampaikan SPT Tahunan PPh Tahun Pajak 2011


„ SAMPAIKAN SPT: Walikota Siantar Hulman Sitorus SE beserta Wakil Walikota, Koni Ismail serta mewakili Pemkab Simalungun menyampaikan SPT Tahunan PPh yang disaksikan kepada DJP Kanwil Sumut II Harta Indra Tarigan didampingi KPP Pratama Pardamean Tambunan, Kamis (15/3) SIANTAR- Kepala Kantor DJP Kanwil Sumut II, Harta Indra Tarigan menyatakan, penyampaian pajak ini diharapkan mampu menyatukan hati untuk membangunan negeri demi kelangsungan masa depan. Wajib pajak berkisar 415 ribu. “Tahun lalu, pertumbuhan penyampaian wajib pajak mencapai 14 persen. Sementara tahun ini pencapaian pertumbuhan wajib pajak sudah 28 persen dari target 30 persen,” sebutnya pada Pekan Panutan penyampaian SPT PPh Tahun Pajak 2011 di Kantor Pelayanan Pajak (KPP)

Pratama di Jalan Dahlia Pematangsiantar, Kamis (15/3). Sebelumnya, katanya, instansi ini sudah melakukan sosialiasi kepada wajib pajak yang dilaksanakan secara intensif. Program ini agar wajib pajak dapat mengetahuinya apa menjadi hak dan kewajibannya hingga menggugah kesadaran untuk melaksanan tugasnya. “Untuk tahun ini tugas pencapaian target sekitar Rp 847 triliun. Sehingga diperlukan dukungan oleh seluruh pihak khususnya dari media. Sebab pajak bukanlah tugas dan milik satu institusi

tetapi tugas dan milik seluruh komponen bangsa,” paparnya. Diterangkanya, sebagai penyelenggara pemerintahan dalam tugasnya menggunakan dana pajak, sebaiknya turut mengawasi penggunaan uang pajak dengan benar. Pajak yang sudah dibayar oleh wajib pajak diharapkan dapat digunakan sesuai dengan fungsi pajak itu sendiri. Dengan cara itu masyarakat akan merasa bangga telah membayar pajaknya untuk kepentingan bersama. Sementara itu, Kepala KPP Pratama Pardamean Tambunan

mengaku seluruh karyawan DJP Kanwil Sumut II sudah terlebih dahulu menyampaikan SPT pada 24 Februari 2012. Berdasarkan Surat Edaran Menteri Pendayagunaan Aparatur Negara Republik Indonesia Nomor SE-02/M.PAN/2009 tanggal 31 Maret 2009 tentang Kewajiban Pegawai Negeri Sipil Untuk Mematuhi Ketentuan Peraturan Perundang-undangan Perpajakan. Disebutkan agar Pegawai Negeri Sipil diwajibkan untuk melaksanakan kewajiban perpajakan. “Sarana pelayanan yang saat ini digiatkan untuk lebih mendekatkan DJP kepada wajib pajak dalam penyampaian SPT adalah ‘drop box”. Drop box telah ditempatkan di beberapa pusat keramaian seperti Bank Sumut Jalan Merdeka, Bank BRI Jalan Merdeka, Ramayana dan perusahaan-perusahaan dengan karyawan jumlah banyak,” terangnya. Sedangkankan Wali Kota Siantar, Hulman Sitorus SE menerangkan, pekan panutan ini sebagai langkah awal untuk merangsang kesadaran masyarakat di Siantar. Selain itu masyarakat juga harus patuh memberikan kontribusinya dalam pembangunan dalam bentuk pembayaran pajak serta pelaksanaan kewajiban perpajakan lainnya sesuai dengan ketentuan yang berlaku. (mua)

Samsung tak ingin ketinggalan meramaikan pasar Ultrabook di Indonesia. Seperti vendor lain pada umumnya, Ultrabook dari Samsung juga menyasar segmen premium. Vendor asal Korea Selatan ini baru saja meluncurkan komputer jinjing ultrabook Series 5 Ultra di Jakarta, akhir bulan lalu. Ultrabook ini dibanderol dengan harga Rp8,5 juta. Menurut Sung Khiun, IT Business Director Samsung Electronics Indonesia, Samsung memang punya tradisi untuk menyasar segmen premium terlebih dahulu, setelah itu barulah merambah segmen menengah ke bawah. Untuk saat ini di Indonesia, Ultrabook yang dijual Samsung berkisar pada 900 sampai 1.100 dolar AS. Hal ini juga

„ Ultrabook Samsung dipicu karena masih mahalnya harga komponen dan teknologi yang dibenamkan pada komputer jinjing yang ringan dan tipis itu. Khiun mengakui bahwa pasar di Indonesia cukup unik. Produk yang dijual dengan harga murah agak sulit menuai sukses. “Tapi giliran ada produk mahal, apalagi didesain dengan elegan, bisa saja laku keras,” ujarnya, usai meluncurkan Ultrabook Series 5 Ultra.

Untuk pasar Ultrabook di Indonesia, diprediksi di 2012 ini belum mengalami kenaikan pesat. “Tahun 2012 adalah tahap awal untuk Ultrabook di Indonesia. Tahun 2013 baru akan meningkat pesat,” tegas Khiun. Menurutnya, masyarakat Indonesia masih berorientasi pada harga. Sehingga belum banyak yang memandang Ultrabook dari sisi performa dan sangat mendukung mobilitas seseorang. Lembaga riset International Data Corporation (IDC) memerkirakan bahwa pengiriman perangkat komputer jinjing ke Indonesia akan mencapai 4 juta unit. Dari jumlah itu, Khiun optimis Samsung dapat menjual sekitar 100 ribu unit Ultrabook di Indonesia. (int)

Produsen BlackBerry

Dekati Dunia Pendidikan JAKARTA-Produsen smartphone BlackBerry, Research In Motion (RIM), sejak beberapa tahun terakhir ini telah melakukan pendekatan lokal dengan Indonesia. Tak mengherankan jika RIM melakukan hal demikian, pasalnya, Indonesia menjadi negara dengan jumlah pengguna BlackBerry terbesar di Asia. Salah satu pendekatan yang dilakukan RIM adalah menyasar dunia pendidikan.RIMtelahmenggelarevent untuk pengembang aplikasi dan siap mengucurkan dana untuk pusat inovasi.Pendekatan ini terlepas dari tuntutan pemerintah melalui Kemenkominfoyangtetapmenuntut. Pendekatan edukasi Pada Mei 2011 lalu, perusahaan asal Kanada ini menggelar

BlackBerry Developer Day di Institut Teknologi Bandung (ITB), dengan maksud menarik minat pengembang aplikasi Indonesia untuk menciptakan aplikasi di platform BlackBerry. Dan pada awal Maret 2012 ini, RIM merangkul ITB untuk riset teknologi mobile. Head of Public Relation RIM East Asia, Oliver Pilgerstorfer mengatakan, RIM akan mengucurkan dana 5 juta dollar AS (sekitar Rp 45 miliar) untuk riset selama 5 tahun.Dana tersebut akan digelontorkan secara bertahap setiap tahunnya. ”Investasi ini akan dipergunakan untuk biaya penelitian dalam pengembangan aplikasi dimana ITB memiliki potensi untuk hal tersebut. Dan dana ter-

sebut akan dipergunakan juga untuk membangun RIM Innovation Centre pertama di Indonesia” ujar Andy Cobham, Presiden Direktur RIM Indonesia, seperti dikutip dari situs resmi ITB. Dalam laporan “Dukungan BlackBerry untuk Indonesia Tahun 2011”, pihak BlackBerry mengklaim ada sekitar 120 pengembang aplikasi Indonesia yang ikut andil dalam kesuksesan 700 aplikasi lebih di BlackBerry App World. Sebuah perangkat yang tergolong dalam kategori pintar, memang sangat bergantung pada ketersediaan aplikasi. Oliver mengharapkan, aplikasi asal Indonesia bisa semakin memenuhi kebutuhan aplikasi pada platform BlackBerry. (kps)




16 Maret 2012



Anak SD Dipukuli.. Sambungan Halaman 8 isak Paria menangis di samping ibunya. Di hadapan wartawan, Feronika membuka baju T-shirt hitam yang dikenakan Paria. Pada beberapa bagian tubuhnya terlihat bekas pukulan kayu yang masih memerah pada, terutama pada bahu kiri, lengan kiri dan betis kiri dan kanan. Menurut Feronika, enam bulan belakangan hubungannya dengan suaminya tidak harmonis lagi. Sebagai istri, ia pun sering dipukuli suaminya. Pemukulan dilakukan dengan tangan, bahkan terkadang membenturkan kepala ke mukanya. Terakhir itu terjadi pada Senin (12/3) lalu. “Kalau saya yang dia pukuli, masih bisa bersabar. Tapi kalau anak saya yang dipukuli, saya tidak terima,” jelasnya lagi. Disebutkannya,pemukulanterhadapkorban ini terjadi sekira 11.00 WIB di rumah mereka, tepat saat korban baru pulang sekolah. “Selama ini Paria tidak pernah dipukulinya. Sebabbiasanya,ayahmerekainidatangpagidan mengantarPariakesekolah,”tambahnya. Lebih lanjut diungkapkan wanita yang mengaku berprofesi sebagai penjual kain ini, suaminya memang tidak memiliki pekerjaan tetap. Meski begitu, diduga suaminya punya selingkuhanlain.Terbuktiselamaenambulan, ia mendapat kabar Piatturman Pandiangan memiliki simpanan yang bertempat tinggal di seputaran Jalan Medan. “Enggak usahlah saya sebutkan namanya, saya tahu orangnya,” ungkapnya dengan nada kecewa. DiPolresPematangsiantar,beberapapetugas jaga menganjurkan agar korban dibawa visum ke dokter. Hingga pukul 00.00 WIB tadi malam, Feronika belum datang lagi untuk membuat pengaduan.(ral/hez)

ABG Ditangkap.. Sambungan Halaman 8 diparkirkan di depan rumah, berhubung ia sedang bersiap-siap belanja ke Karang Anam PaneiTongah. Hanyaditinggalmasukrumahsebentarsaja, LA melarikan kreta korban. Aksinya dipermudah, sebab saat kejadian kunci kontak terpasangdisepedamotor.Selanjutnyakorban yang kehilangan sepedamotor, membuat pengaduan ke Polsek Raya. Atas informasi dari warga, LA berhasil diciduk dari Doorsmeer Merek Raya, Kamis (15/3) pukul 10.00 WIB. KepadaMETRO,tersangkamengakunekad mencurikarenabutuhongkosuntukmerantau. Menurutnya, setelah putus sekolah beberapa waktu lalu, ia bekerja di ladang kopi milik orangtua temannya di Sirube-rube, Tiga Ras. “Akunggaktahanlagikerjadisana,maksudku mau merantau bang. Tapi ongkosku gak ada,” katanyatertunduk. Ditambahkannya, usai melarikan Honda Vario itu, korban sudah berungkali berusaha menjualnya, namun tidak ada yang mau membeli. Bahkan ia sempat membawa kreta curianitukeTanahJawauntukdijualRp2,5juta. “Di Tanah Jawa kreta mau kujual Rp2,5 juta, tapitetapgaklaku,”ungkapABGyangmengaku seringmencuriayammilikwargaMerekRayaini. SementarakorbanRosentabrPurbamengaku tidak menyangka pelaku akan mencuri sepedamotornya. “Oppung dia (pelaku) satu kampungku,makanyaakunggakcuriga.Saatitu kuparkir kreta, kunci kontaknya memang gak kucabut,”katanya. Kapolsek Raya AKP Sulaiman Simanjuntak yang dikonfirmasi membenarkan penangkapan pelaku. “Pelaku akan dijerat pasal 363 subsider 362 KUHPidana tentang pencurian. Ancamannya 5 tahun penjara,” tegas Sulaiman. (hot/hez)

Hamil 7 Bulan, Dipaksa Layani Pria Hidung Belang

Terdakwa Mengaku..

Sambungan Halaman 8

Jakarta. Hal itu dikatakan kerabat terdakwa Ira Sipayung, saat dimintai kesaksiannya di Pengadilan Negeri Pematangsiantar, Kamis (15/3). Pada Sidang yang dipimpin majelis hakim Usaha Ginting beranggotakan Ulina Marbun dan Janner Purba ini beragendakan keterangan saksi meringankan (ade charge). Menurut kuasa hukum terdakwa Carles Sijabat, saksi dihadirkan untuk membuktikan barang-barang terdakwa yang ikut dibawa ke persidangan. Kemudian latar belakang terdakwa memilih pergi ke Jakarta. Menurut Ira Sipayung, ia sudah kenal terdakwa sejak lima tahun lalu. “Saya Yuke (Sapaan terdakwa) sejak lima tahun lalu. Kami kenal setelah dikenalkan teman yang sering menjemput anak-anak pulang sekolah dari SD Kalam Kudus,” jelasnya. Menurutnya, saat perkenalan itu terdakwa sudah berumah tangga dan mengelola PT AST bersama Marolop Manurung, suaminya. Selanjutnya persahabatan mereka semakin dekat, apalagi uang arisan mereka bagi dua yakni Rp500 ribu per-orang setiap bulannya. “Yang saya tahu,pengelola PT AST di Jalan Diponegoro Siantar Barat, adalah terdakwa dan suaminya. Sebab saya sering ke sana dan mengajari terdakwa senam yoga. Biasanya kami latihan di kamarnya, lantai dua bangunan,” ungkapnya. Sambung Ira, Selama itu pula terdakwa sering curhat bahwa suaminya menghilang sejak pergi pesta ke Pekanbaru. Oleh karenanya, terdakwa sendirilah yang membiayai kebutuhannya dan kedua anak mereka. “Biasanya setiap Sabtu terdakwa datang ke rumah beserta anak-anaknya. Pernah pagi-pagi sewaktu saya baru mengantar anak sekolah, terdakwa datang dan menangis. Saat itu terdakwa bercerita bahwa ia diusir mertuanya,” paparnya. Diungkapkannya, sejak saat itu ia tidak berani lagi bertanya mengapa terdakwa diusir. Selanjutnya Ira memberikan katakata semangat agar terdakwa bersabar dan memilih jalan terbaik. “Setelah diusir, terdakwa mengaku sudah memutuskan untuk kembali ke Jakarta. Ia berangkat sekitar Juni lalu, sewaktu anakanak libur sekolah. Sebab ia berangkat setelah anaknya menerima rapor, agar lebih mudah masuk ke sekolah baru,” terangnya. Sebelum berangkat ke bandara, malamnya ia beserta teman-teman lain membantu terdakwa untuk packing (berkemas) dari rumah saksi Raya Harahap. Barang yang dipacking itu berupa sepatu, buku dan lainnya. Tidak ada barang bukti seperti yang dihadirkan di persidangan. “Saya merasa itulah perpisahan kecilkecilan yang bisa kami lakukan sebelum terdakwa menetap di sana, makanya kami bantu dia berkemas. Raya yang tinggal di Jalan Penyabungan, juga ikut membantu dan mengetahui terdakwa berangkat ke Jakarta,” sebutnya. Sebelum berangkat, Dona (pelapor) juga curhat kepadanya tentang uang yang ditranfer ke rekening terdakwa sebesar Rp50 juta. Di situ Dona bercerita tidak bisa berbuat apaapa karena mereka bekerja dengan atasannya Maringan Manurung. Bahkan saksi Raya juga bercerita padanya dan menerangkan bagaimana jika Bapak (Maringan, red) tahu kalau ia ikut Bantu-bantu Maria packing. Usai mendengarkan keterangan saksi, hakim kembali menunda persidangan hingga Kamis (22/3). (mua/hez)

akhirnyaDewimenceritakanmengapa dirinya bisa sampai ke Labuhanbatu. Menurut Dewi, 19 Januari 2012 lalu seorangwanita mengaku bernama Lia datang ke rumah orangtuanya di Surabaya. Kepada orangtuanya, Lia berjanji memberikan pekerjaan kepada Dewi, yaknisebagaipembanturumahtangga (PRT) di Pulau Sumatera, tepatnya di Labuhanbatu. Awalnya orangtua dan suami Dewi

Sambungan Halaman 8 tersebut.Takhanyaitu,Linajugaberniat melaporkan Binsar dan Bunga yang dianggap sudah menggoda suaminya. Niatnya itu ditegaskan Lina kepada POSMETRO MEDAN (Grup METRO) saat disambangi di kediamannya, Jalan SukaMuliaKelurahanTongMarimbun, Siantar Simarimbun, Kamis (15/3). Menurutnya,sebelumnyaiamengingatkanBinsardanpelajarkelasISMAswasta Kota Siantar itu untuk tidak macammacam.Namunkeduanyatetapsajatak menggubrisnya. Bahkan di pesan masuk Hp Binsar, selalu saja ada SMS dari nomor Hp Bunga. “Inikan yang namanya selingkuh, yangsatulobangnya,suamikuyabuayanya,” cetus Evalina menanggapi perselingkuhanitu. Bahkan dituturkan pedagang ikan di Pasar Horas ini, setelah beberapa kali mempergoki pesan masuk dari nomor HpBunga,iamemberanikandirimena-

Sambungan Halaman 8 Peristiwaberawalsaatkorbanberadadi tokonya,Rabu(14/3)sekirapukul10.30WIB. Mendadak seorang konsumen yang mengaku bernama M Abdul datang dan menawarsatuunitLaptopmerkAcertype 4752. Setelah terjadi tawar menawar, keduanya sepakat dengan harga Rp4.250.000. Namun begitu diminta pembayaran,priayangmengakutinggaldi

tidak memberikan izin karena ia masih dalam keadaan hamil. Namun Lia terus merayu dan berjanji memberikan uang setelahkorbansampaidiPulauSumatera. Akhirnya suami mengizinkan Dewi berangkat bersama Lia ke Labuhanbatu. Di Labuhanbatu, Lia dibawa ke kafe remang-remang di Adian Batang Labuhanbatu. Lalu Lia menjual Dewi kepada pemilik kafe bernama Jhonson Faber Damanik. Di kafe itu, Dewi setiap harinya disuruh melayani laki-laki hidung

belang.JikaDewitakbisamenghasilkan uang untuk disetor kepada Jhonson, maka Dewi akan dianiaya. Sejak saat itu, Dewi harus melayani setiaplelakihidungbelangyangdatang ke kafe. Rabu (14/3) sekitar pukul 21.00 WIB, Jhonson menyuruh Dewi melayani tamu. Namun saat itu Dewi melihat ada peluang kabur. Beralasan ingin pergi ke belakang, Dewi pamit kepada tamunya. KemudianDewikaburdanmengadukan

peristiwayangdialaminyakepadawarga. Mendengar pengakuan Dewi, warga membawanya ke Polres Labuhanbatu untukmembuatpengaduan. Kasat Reskrim Polres Labuhanbatu AKP Wahyudi membenarkan adanya peristiwa itu. Menurutnya tersangka akan dijerat Pasal 2 ayat( 1) UU RI Nomor 21 Tahun 2007 tentang Perdagangan Orang. Setelah Dewi diperiksa, petugas segera menangkap tersangka. “Nanti pelakunya kita tangkap,” tukas Wahyudi. (cr1)

sehati ABG itu di depan orangtuanya. SaatitujugaorangtuaBungaikutmenegurbahkanmenjambaknya. Itu dianggap Lina agar Bunga jera. Sedangkan untuk suamiya, Evalina sempat memberi ultimatum akan menggugat cerai Binsar jika saja tetap meladeni SMS dari Bunga. Diakui Evalina, pria yang sudah dinikahinyadelapantahunlaluinisudah dua kali melakukan hal yang sama. Sehingga bisa dipastikan, saat ini Binsar sudahberadadiKotaSibolgamembawa trukmajikannya. Pada pertengahan 2010 lalu, Binsar diadukanmecabuligadistetangganyadi Kecamatan Siantar Marimbun. Beruntungupayaperdamaiandengankeluarga sang gadis direspon baik, sehingga Binsarhanyamenginapbeberapaminggu di sel. Namun saat itu Evalina terpaksa mengeluarkan uang Rp10 juta untuk biaya ganti rugi. Belum lagi untuk menyelesaikan segala administrasi di

kepolisian. “Pengalamanitupuntakdijadikannya panutan, sekarang ya terserah dialah. Ceraipunjadilah,masihsanggupnyaaku membiayai sekolah dan kebutuhan anak-anakku,”ujarEvalina. Terpisah, A br Marpaung (39) ibu kandung Bunga, membantah tuduhan EvalinayangmenyebutputrinyamenggodaBinsar.Sebaliknya,Binsarlahyang diyakini sudah memelet putrinya lewat orang pintar, hingga persetubuhan itu lama baru terungkap. Sebab sebelumnya,Bungaterlihatsepertioranglinglung layaknya dihipnotis alias diguna-guna. Pasca terkuaknya aib itu, Senin (12/3) dinihari, br Marpaung langsung membawa putri ke tiganya itu berobat ala kampungatautradisional. Hasilnya, sejak saat itu Bunga bisa bicaradanmenerangkansemuakejadian yang dialaminya bersama Binsar. Malah pertama kali, Binsar mengajaknya bertemu dengan mengirim pesansingkatlewatHp.Entahmengapa

saat itu, Bunga menurut saja diajak dan akhirnya direnggut kehormatannya, tanpa ingat di mana lokasinya. “Inijelassudahadaguna-gunanya,tak mungkin anakku mau sama pria beristri,”ujarnya. Kasat ReskrimPolres Pematangsiantar AKP Azharuddin mengaku masih mengembangkan penyelidikan dan melayangkan surat panggilan kepada dua saksi. Mereka adalah istri terlaporEvalinabrGurning(30)danLilis Nababan(16),kerabatBinsar. “Jikaketerangansaksimengarahpada pembuktian, pasti dilakukan penahanan.Dalamwaktudekatsudahkitaproses terlapor,”ujarAzharuddin. Sebelumnya, Binsar Tampubolon dipergokiistrinyaEvalinabrGurningsaat menyetubuhi siswi SMA yang masih bertetanggadengannya.Penglihatannya ini baru dilaporkan Lina esok harinya kepada orangtua Bunga, yang diteruskan kepada polisi. (Mag-5/hez)

Jalan Viyata Yudha Kelurahan Bahkapul, Siantar Sitalasari ini mengaku ketinggalan uangdirumah.Untukituiamenyarankan agar laptop dibawa pulang, dan pembayarandilakukandirumahnyasaja.Caranya, seorang karyawan toko ikut dengannya menumpang sepedamotor Honda Revo yangplatnyabelumdiketahuiini. Maksud hati hendak mempermudah prosestransaksi,korbansetuju.Untukituia mengutus karyawan bernama Raymond

ikut dengan pelaku. Semula tidak ada kecurigaan korban sama sekali. Saat itu Raymonddudukdiboncenganpelaku.Saat posisi mereka di Jalan Merdeka, tepat di depan sekolah Kalam Kudus, jalanan macet. Berdalih akan melewati sebuah gangyangmerupakanjalanpintasdisana, pelakumenyuruhRaymonduntukturun sementara. Nah, begitu karyawan toko elektronikiniturun,pelakutancapgasdan menghilang tanpa jejak sambil mem-

bawa laptopyangdiboyongdaritoko. Halitulangsungdilaporkannyakepada korban. Oleh Felix, kasusnya dilaporkan kekantorpolisi hariitujuga. Kasubbag Humas Polres Pematangsiantar AKP Altur Pasaribu membenarkan laporan pengaduan korban. “Pelaku masih dalam penyelidikan,diadijeratpasal378dan372 KUHPidana tentang Penipuan dan Penggelapan,”katanya.(mag-1/hez)

mereka terlalu mudah untuk menikahkan anaknya yang notabenenya sudah mempunyaiistri. “Pernikahanitubukanataskemauan saya sendiri, tapi dia yang paling mendesak,”katanya. Tambahnya lagi, seminggu sebelum melangsungkan pernikahan di Gereja, mereka terlebih dulu mengadakan pelatihan atau marguru. Saat hari pernikahan tiba, Endro bersumpah di hadapan Pendeta dan semua orang yang hadir, tidak akan meninggalkan Hartati serta tetap setia. Sementara itu Sarbudin Panjaitan, selaku kuasa Hukum Endro menjelaskan, pernikahan Hartati dan Endro di GerejaGetsemanetertanggal23Juli2011 tidak sah. Sebab saat itu Hartati dan keluarganya,membuatsuratpalsuyang menjelaskan kepada pendeta bahwa orangtua Endro berada di luar kota. Ia jugamengakutelahmelaporkanHartati

dan orangtuanya ke Polsek Siantar MartobapadaFebruari2012. “Itumakanyasayamengatakanpernikahan mereka itu tidak sah,” katanya lewat telepon. Sebelumnya, Hartati mengaku hubungannya sejak pacaran tidak pernah direstui keluarga Endro. Namun karena sudah saling cinta, keduanya sepakat menikah. Meski niat itu ditolak orangtua Endro,pasanganinitetapmelangsungkan pernikahan dengan restu dari orangtua Hartati. Pernikahan dilangsungkan pada 23 Juli 2011 di Gereja Getsemane, yang diberkatiolehPdtJosuaSimatupang. Namun dua minggu kemudian, keluarga Endro menjemput suami HartatiinidarirumahnyadiJalanMedan, SiantarMartoba.Meskiakhirnyaorangtua Endro tahu anaknya sudah menikah, namun itu tidak diakuinya. Sejak saat itu EndrotidaklagitinggalbersamaHartati. Bahkan orangtua Endro pernah

memanggil Hartati ke rumahnya dan memaksa Hartati menandatangani surat yang sudah dikonsep. Parahnya, saat itu Hartati mengaku diancam orangtua Endro menggunakan pistol. Karena terpaksa di bawah ancaman,Hartati pun menandatanganinya. Setelah itu orangtua Endro baru buka bicara,bahwasuratyangditekenadalah surat keterangan bahwa pernihkanan Hartati dan Endro ilegal. Setelah tidak tinggal bersama, Endro dinikahkandenganTitinbrSimanjutak, di Gereja HKBP Pardamean, kamis (8/ 3). Saat itu juga pesta adat dilaksanakan di Sopo Ambia, Jalan Cornel Simanjuntak. Hartati yang mengetahui informasi langsung datang. Di sana ia berteriak histeris dan mengatakan bahwa Endro masih suaminya yang sah. Seluruh undangan yang hadir saat menjadi heran, apalagi saat Hartati memperlihatkansuratnikahnya. (mag-1/hez)

Pelaku Berada di Sibolga

1 Laptop Dibawa Kabur

Pernikahan Hartati Dianggap Sah

Sambungan Halaman 8 Pernikahan keduanya juga sah demi hukum. Hal ini diungkapkan Juhong Siahaan, kuasa hukum Hartati yang mendampinginya melapor ke Polres Pematangsiantar,Kamis(8/3)lalu.MenurutJuhong, iamerasakesaldengankinerjapolisiyang lamamenindaklanjutilaporanHartati. “Pada UU Perkawinan No 1 tahun 1974 diterangkan, perkawinan sah jika dilakukan menurut agama. Makanya saya heran, kenapa orangtua Endro senekaditumengawinkanlagianaknya, padahal ia sudah tahu anaknya sudah melangsungkan pernikahan sebelumnya di Gereja,” katanya saat ditemui di PolresPematangsiantar,Kamis(15/3). Ditambahkannya, Hartati akan tetap berjuang menuntut haknya. Sebab kelurga Endro sudah sepele dan tidak menghargainya. Itu bisa dilihat saat

Sambungan Halaman 8

Sambungan Halaman Satu Batak di Mata Penulis Sejarah Asing Itu Seram Sambungan Halaman 1 salah. Nah karena orang Batak dulu masih menganut paham animisme, maka ketika musuh kalah, maka harus dihabisi bukan hanya fisiknya saja, tapi juga rohnya harus dihabisi,” terangnya. Makanya setelah mati,

ungkap Nikolas, bagianbagian tertentu dari musuh, dimakan. Hal ini sebagaimana keyakinan ketika itu, untuk membinasakan roh dari musuh tersebut. “Nah ini yang tidak dipahami para penulis tersebut,” katanya. Selain itu, hal yang tidak diketahui banyak penulis Eropa

Kabag Humas Datangi Mapolres Tengah Malam Sambungan Halaman 1 Kasat Reskrim AKP Azharuddin. Belakangan diketahui AKP Azharuddin juga berada di ruangan Kaurbin Ops bersama Daniel Siregar. Sekitar pukul 01.15 WIB saat keluar dari ruangan itu, Daniel Siregar enggan memberikan komentar banyak. Disinggung tujuan kedatangannya ke Mapolres, Daniel lebih memilih tertutup. ”Tidak ada apa-apa, memang jalan-jalan tidak boleh,” ujar Daniel singkat sembari masuk ke mobilnya. Sementara Kasat Reskrim AKP Azharuddin menyebutkan, kedatangan Daniel Siregar untuk sharing , dia juga membantah adanya pemeriksaan sebagai saksi

terhadap Daniel Siregar. ”Tidak ada, pemeriksaan apa? Ya kami sharing aja, yang jelas tidak ada yang spesial. Kami kerja berdasarkan tugas yang dibebankan,” jelasnya. Azharuddin kembali menegaskan tidak ada pemeriksaan terhadap Daniel Siregar. Dia juga membantah ada pemutaran rekaman saat acara GMKI di Internasional Restauran Hotel. Namun dia mengakui ada mempertanyakan kepada Daniel tentang bukti rekaman yang mereka miliki dan bukti rekaman itu sendiri pernah diputar di Jalan Proklamasi Kota Siantar. ”Ada kami tanya tadi pemutaran rekaman di Proklamasi yang mereka lakukan bersama PWI itu,” jelasnya lagi. (ral)

ketika itu, dalam hukum Batak sebenarnya tidak seluruhnya pihak yang kalah akan dibunuh. Namun ada juga ketika seseorang minta ampun, maka ia menjadi budak dari yang menang. Atau diusir dari kampung tersebut. “Tapi yang lebih keras, memang dia dihukum mati atau dipancung

seperti di Timur Tengah,” katanya lagi. Nikolas sendiri menemukan fakta sejarah ini, saat ia meneliti yang kemudian melahirkan buku “Acara Pidana Indonesia Dalam Sirkus Hukum” tahun 2009 lalu. Dalam buku tersebut ada bagian tentang sejarah hukum acara di Indonesia. “Jadi saya meneliti

bagaimana hukum acara terjadi di suku-suku primitif. Kebetulan saya mencoba mencari sejarah hukum kita ini, supaya kita jangan impor-impor melulu,” tersangnya. Saat ini sendiri, peninggalan budaya kanibalisme dalam adat Batak menurut Nikolas kemudian, masih dapat dilihat.

Salah satunya dalam adat pangolihon boru (mengawinkan anak perempuan). “Kenapa pinahan (ternak) yang mangolu (hidup) yang dijadikan adat. Inilah tuhor, karena ketika borunya diambil, rohnya ikut hilang dari tengah keluarga tersebut. Makanya kalau diikuti adat-adat, jambar-jambar, itu

Paripurna, 27 Anggota DPRD Mangkir Sambungan Halaman 1 DPRD Binton Tindaon dan tiga wakil ketua, Julius Silalahi, Burhanuddin Sinaga dan Ojak Naibaho. Sementara beberapa anggo ta DPRD lebih memilih duduk di ruang komisi I. Yang duduk di ruangan ini antara lain Luhut Sitinjak, Bernhard Damanik, Evra Sasky Damanik dan beberapa anggota DPRD lain dari lintas fraksi. Sementara ruang Harungguan DPRD yang seyoginya dijadikan ruangan rapat paripurna tetap kosong dengan pintu terbuka. Sesuai agenda yang tertera pada undangan, rapat membahas penetapan perubahan keanggotaan alat kelengkapan DPRD Simalungun. Perubahan keanggotaan pada komisi, Badan Anggaran (Banggar), Badan Musyawarah (Banmus) dan Badan Kehormatan Dewan (BKD). Kemudian rapat juga akan mengumumkan keanggotaan Johalim Purba yang akan

bergabung kembali dengan Fraksi Pembela Amanat Habonaron, di mana sebelumnya yang bersangkutan bergabung dengan Fraksi Partai Demokrat. . Ketua LSM MASA (Masyarakat Adil Sejahtera) Kemas Edi Junaidi ditemui di gedung DPRD menyebutkan, rapat paripurna ini penting untuk membahas, menyusun, melengkapi alat kelengkapan DPRD, seperti Komisi, Badan Anggaran, Badan Musyawarah dan BKD. Dia sangat menyayangkan ketidakhadiran 27 anggota DPRD ini. “Mengurus diri sendiri saja mereka tidak bisa, apalagi mau mengurus kepentingan rakyat,” jelasnya. Dia menduga, ketidakhadiran anggota DPRD yang berasal dari berbagai partai politik ini disebabkan adanya tarikmenarik kepentingan dalam penentuan ketua-ketua pada alat kelengkapan DPRD tersebut. “Coba bayangkan dari 45 anggota DPRD, hanya beberapa orang saja yang hadir,” katanya heran.

Sekretaris Fraksi Pembela Amanat Habonaron Luhut Sitinjak menyebutkan, sembilan anggota fraksinya telah hadir di gedung DPRD untuk melaksanakan rapat paripurna. Dia juga mengakui minimnya kehadiran anggota untuk melaksanakan rapat paripurna. Menurutnya, berdasarkan data, anggota DPRD yang hadir hanya 18 orang. Sementara jumlah anggota DPRD keseluruhan 45 orang. “Tidak kourum, harusnya yang hadir 23 orang, baru bisa dikatakan kourum. Saya tidak tahu alasan ketidakhadiran mereka,” katanya. Disinggung ketidakhadiran 27 anggota DPRD yang lain yang berasal dari lintas fraksi diduga karena tarik-menarik kepentingan politik untuk penempatan pimpinan komisi, Badan Anggaran, Badan Musyawarah dan pimpinan Badan Kehormatan Dewan (BKD), Luhut tidak menampik adanya dugaan seperti itu. “Dari fraksi kami tidak tahu yang seperti itu, makanya

anggota fraksi kami hadir semua, termasuk Ketua Fraksi Evra Sassky Damanik. Kalau ada yang mau bermain seperti itu dari fraksi lain dan berlaku tidak jujur, kami pun bisa bermain,” jelasnya. Saat ini di DPRD Simalungun terdapat lima fraksi, yaitu Fraksi Demokrat Bersatu, Fraksi Golkar Nusantara, Fraksi PDI Perjuangan, Fraksi Pembela Amanat Habonaron dan Fraksi Bersatu. Dengan jumlah anggota DPRD sebanyak 45 orang. Ditemui di ruangannya, Ketua DPRD Binton Tindaon menyebutkan, rapat paripurna tidak sempat dibuka disebabkan tidak kuorum. Pimpinan DPRD sendiri tetap berada di ruangan dan tidak ada yang memasuki Ruang Harungguan. “Rapat paripurna tidak dibuka karena anggota DPRD tidak hadir. Kenapa mereka tidak hadir, saya tidak tahu. Disebabkan banyak anggota DPRD yang tidak hadir, rapat akan digelar besok untuk memanggil pimpinan fraksi,” jelasnya.

berasal dari adat perang semua. Karena dulu mengambil perempuan, harus perang. ”Menariknya di balik penyebutan sejarah bahwa Batak berkonotasi jelek, Nikolas justru bersyukur. Sebab dengan demikian orang Batak menjadi sadar dan introspeksi diri, hingga dapat berubah seperti sekarang ini. Di mana orang Batak dapat berperan begitu luar biasa di seluruh dunia.(**) Disinggung ketidakhadiran 27 anggota DPRD ini karena tarik-menarik kepentingan di antara fraksi pada penentuan pimpinan pada alat kelengkapan DPRD, Binton malah menjawab. “Saya tidak ada menyatakan seperti itu ya. Yang saya tahu, saya tidak mungkin memimpin rapat kalau tidak ada anggota DPRD yang hadir,” jelasnya. Sementara Ketua Fraksi Golkar Timbul Jaya Sibarani yang hadir ke ruangan Ketua DPRD sekira pukul 13.00 WIB atau usai rapat dinyatakan ditunda menyebutkan, ketidakhadiran anggotanya disebabkan ada kegiatan Partai Golkar di Jalan Asahan. Jauhjauh hari dia menyatakan Fraksi Golkar tidak bisa mengukuti paripurna pada Kamis. Ketua Fraksi Demokrat Bersatu Mansur Purba juga tiba di ruangan Ketua DPRD sekira pukul 13.00 WIB. Dia enggan memberikan komentar terkait ketidakhadiran anggota fraksinya pada rapat paripurna tersebut.(ral)

Crime Corner




Fakta, Peristiwa dan Hukum

Wanita asal Surabaya Dijual ke Labuhanbatu

Hamil 7 Bulan, Dipaksa Layani Pria Hidung Belang

Foto Fando

„ Foto pernikahan Binsar Tampubolon dengan Evalina br Gurning.

RANTAU-Dewi Lestari (19) warga Desa Rumput Kecamatan Sumur Bor, Lubang Buaya, Jawa Timur, dijual ke Labuhanbatu. Meski tengah hamil tujuh bulan, ia dipaksa melayani pria hidung belang.

Soal Supir Truk Dipergoki Istri Setubuhi Gadis

Pelaku Berada di Sibolga SIANTAR-Setelah resmi dilaporkan orangtua Bunga (16) terkait perbuatan cabul yang dilakukannya, Binsar Tampubolon (32) kabur ke Kota Sibolga. Sedangkan istrinya Evalina Gurning (Lina) (30) mengaku sanggup menghidupi kedua putranya tanpa mempersoalkan keberadaan supir truk

„)Baca Disuruh ..Hal 7


BERSUMPAH: Dua saksi kasus penggelapan inventaris PT AST, mengambil sumpah di Pengadilan Negeri Siantar, Kamis (15/3).

Sidang Kasus Penggelapan Inventaris PT AST

Saat dimintai keterangannya oleh penyidik Unit Perlindungan Perempuan dan Anak

(UPPA Polres) Labuhanbatu, Kamis (15/ 3) Dewi tampak masih takut bertemu pria. Setelah dibujuk dan ditenangkan,

ABG Ditangkap saat Cuci Kreta Curian RAYA-LA (15) warga Nagori Merek Raya, Kecamatan Raya, Simalungun, ditangkap polisi saat mencuci kreta curian di Doorsmeer Bah Bongir Merek Raya. Penangkapan remaja putus sekolah ini dilakukan berdasarkan pengaduan Rosenta br Purba (26) warga Nagori Raya Bosi, yang kehilangan Honda Vario BK 4133 WV saat diparkir di depan rumah. Kejadian berawal saat pelaku mendatangi rumah korban, Senin (27/ 2) lalu. Waktu itu korban dan tersangka yang sudah saling kenal sempat berbincang-bincang. Sedangkan satu unit Honda Vario BK 4133 WV milik korban

„)Baca Terdakwa ..Hal 7

..Hal 7

„)Baca Pernikahan

Halaman 7

Penipu Menyaru Pembeli Beraksi

1 Laptop Dibawa Kabur SIANTAR-Modus penipuan yang pelakunya menyaru sebagai pembeli di toko kembali terulang. Kalau beberapa waktu lalu terjadi di Toko Sinar Harapan, Jalan Cokroaminoto Kota Siantar,

kali ini dialami Felix Satio, pengusaha Toko Visicom. Akibatnya korban mengalami kerugian materi jutaan rupiah.

„)Baca 1 Laptop Hal 7


Anak SD Dipukuli Bapak

Suami Nikah Lagi, Terdakwa Istri Ngamuk Mengaku Pernikahan Hartati Diusir Mertua Dianggap Sah SIANTAR-Syarat pernikah an antara Hartati br Ginting deng an Endro Panjaitan dinilai sudah terpe nuhi, sehingga pih ak ge rej a me mb erk ati ny a.


DIANIAYA- Paria Pandiangan yang dianiaya orangtuanya, membuat pengaduan di Mapolresta Siantar, Kamis (15/3).

„)Baca ABG ..Hal 7

SIANTAR-Maria Yunita br Sianipar, terdakwa kasus penipuan dan penggelapan uang dan barang inventaris PT AST (Agung Sedayu Travel) mengaku diusir oleh mertuanya M Manurung, sebelum berangkat ke


(Foto Marihot)

CURANMOR- LA, tersangka curanmor yang ditangkap saat mencuci sepedamotor hasil curian, Kamis (15/3).

SIANTAR-Paria Pandiangan (8) siswa kelas II SD RK 7, di Jalan Medan kilometer 6,5 dipukuli ayah kandungnya, Piaturman Pandiangan (38), Kamis (15/3) sekira pukul 11.00 WIB. Akibatnya, punggung dan beberapa bagian tubuh korban mengalami luka memar setelah dihantam kayu. Diduga penganiayaan dipicu pertengkaran kedua orangtuanya.

Tadi malam sekira pukul 23.00 WIB, Ibu korban Feronika br Aritonang (43), warga Jalan Medan kilometer 6,5 Kelurahan Tambun Nabolon, Siantar Martoba, langsung membuat pengaduan ke Polres Pematangsiantar. “Saya dilibas pakai kayu sama bapak, enggak tahu apa sebabnya, tiba-tiba sudah dilibas,”

„)Baca Anak ..Hal 7

JUMAT 16 Maret 2012 Halaman 9

Satpam Kebun Larang Pendirian Tiang PLN Siantar Man

Warga Bintang Mariah Ngadu ke Camat TAPIAN DOLOK- Huta Bintang Mariah, Nagori Dolok Maraja, Kecamatan Tapian Dolok, Simalungun adalah salahsatu huta (dusun,red) yang belum dialiri listrik. Namun permohonan warga agar listrik masuk kewilayah tersebut dihambat perkebunan milik swasta yang beroperasi di sekitar wilayah tersebut. Baca Satpam...Hal 10


SAMPAH- Tumpukan sampah di TPA yang lama tampak sangat semrawut. Saat ini Siantar membutuhkan TPA baru.

Siantar Butuh TPA Baru SIANTAR- Pemko Pematangsiantar sudah sangat mendesak membutuhkan tempat pembuangan akhir (TPA) sampah. Sebab, TPA yang lama, di Jalan Rondahaim, Kelurahan Tanjung Pinggir,

Siantar Martoba, sudah tidak layak pakai. Sampah di sana sudah menggunung. Apalagi, kontrak lahan TPA tersebut berakhir tahun 2012. “Sudah layak Siantar membuat TPA

Nasdem Tuntaskan Pembentukan DPC Delia von Rueti

SEBAGAI perancang perhiasan, karya Delia von Rueti (44) sudah mendunia. Tak tanggung-tanggung, dari Ani Yudhoyono, Marie Elka Pangestu, Michelle Yeoh, Sharon Stone, sampai Muhammad Al-

Baca Karyanya...Hal 10

Lingga Napitupulu

Baca Nasdem...Hal 10

Baca Siantar...Hal 10

Program Makanan Tambahan Anak Sekolah

Siswa Makin Sehat, Semangat dan Cerdas

SIANTAR- Partai Nasdem Kota Pematangsiantar sudah menuntaskan pembentukan-pembentukan Dewan Pimpinan Cabang (DPC) di kecamatan se-Kota Pematangsiantar. Menurut Ketua DPD Nasdem Kota

Karyanya Mendunia

baru,” ujar EB Manurung anggota DPRD Siantar, Kamis (15/3). Lebih lanjut, EB mengatakan ada anggaran yang dianggarkan untuk pembuatan TPA baru. “Adanya anggaran untuk itu. Kalau berapa jumlahnya, saya lihat dulu lah di


MAKANAN- Pembagian makanan tambahan di SDN 122362 Jalan SIsingamangaraja Pematangsiantar.

SIANTAR- Program Pemberian Makanan Tambahan Anak Sekolah (PMTAS) disambut baik oleh guru, siswa, dan orangtua siswa. Harapannya, dengan adanya PMTAS ini, siswa makin sehat, bersemangat, dan cerdas. Demikian harapan yang disampaikan Kepala SDN 122362

Jalan Sisingamangaraja, Kelurahan Sigulang-gulang, Siantar Utara, T boru Samosir, saat pembagian makanan tambahan di sekolah tersebut, Kamis (15/3). Dia menyampaikan, program PMTAS ini adalah salah satu langkah jitu untuk memperbai-

Baca Siswa...Hal 10

Dokter RS Penang Sharing Ilmu ke RSU Djasamen SIANTAR- Menuju Rumah Sakit (RS) Pendidikan April mendatang, Manajamen RS dr Djasamen Saragih Pematangsiantar terus menerus melakukan pembenahan. Selain

perbaikan sarana, peningkatan sumber daya manusia, juga perbaikan perilaku seluruh stakeholder di dalamnya. Yang paling terbaru, manajemen rumah sakit milik

pemerintah ini melakukan sharing ilmu dan pengalaman dengan Mount Miriam Cancer Hospital Penang, Malaysia. Kegiatan dalam bentuk Seminar tentang “Recent Tehno-

logiy Advance in Cancer Management” pada Kamis (15/3) di aula rumah sakit tersebut. Dr Ho Kean Fatt, dari Mount Miriam Cancer Hospital Penang saat seminar mentransfer

sebagian ilmunya kepada dokter-dokter di RS Dr Djasamen Saragih. Nantinya, diharapkan pelayanan dokter-dokter di RS

Baca Dokter...Hal 10


BERFOTO- dr Ria N Telaumbanua, foto bersama dr DR Ho Kean Fatt dan para dokter di RSUD dr Djasamen Saragih.




Maret 2012

Sambungan Halaman 9 dalam APBD,” katanya. Jonliben Saragih, mantan satgas pencari lahan TPA baru mengatakan, sejak 2004 sudah dicanangkan pencarian lahan TPA baru. Namun, baru tahun 2009 yang mulai diperhatikan sampai terjadi pembentukan

panitia 9 untuk mencari lahan TPA baru. “Target lahan TPA baru hanya di dua daerah di Siantar. Yakni wilayah Kecamatan Siantar Martoba dan Kecamatan Siantar Sitalasari,” ujar Jonliben yang saat ini petugas Dishub Provinsi. Menurut Jonliben, dari beberapa daerah yang dicanangkan untuk dibeli menjadi TPA, hanya di Kelurahan Gurilla, Siantar Sitalasari yang pantas dijadikan TPA. Di sana ada lahan dengan luas 2 hektare dengan kedalaman lubang sekitar 100 meter, makanya tempat itu disebut lombang seratus. Dalam menentukan lokasi TPA, ada

ketentuan sesuai perundang-undangan. Misalnya, tempatnya minimal luasnya 2 hektare, kedalaman jurangnya, jaraknya dari pemukiman warga minimal 1 kilometer, jarak ke lapangan udara 1,5 meter dan jarak ke daerah aliran sungai (DAS) minimal 100 meter. “Dari sekian yang ditunjukkan untuk dijadikan TPA baru, hanya lombang 100 yang layak sesuai kriteria perundang-undangan. Kalau masalah harga, sesuai NJOP, sebagaimana ada keterlibatan pihak perpajakan dalam panitia 9,” paparnya. Masih kata Jonliben, pencarian TPA baru sudah lama sejak tahun 2004. Tapi, tahun 2009 baru mulai diseriusi Pemko Siantar.

“Selain anggaran pembelian lahan, Pemko juga sudah mengeraskan jalan masuk menuju TPA baru dengan anggaran Rp350 juta. Namun, sampai saat itu masih jalan saja dilaksanakan, sedangkan pembayaran ganti rugi lokasi TPA tidak ada. Makanya sampai saat ini TPA baru masih mengambang. Saat itu yang masuk dalam tim 9 adalah, Sekda, Asisten I, BPN, Perpajakan, Dinas Pertanian, Camat Siantar Sitalasari, Lurah Gurilla, Badan Lingkungan Hidup dan Dinas Kebersihan. Ia mengaku, setiap harinya sampah masyarakat Siantar sebanyak 28 kubik atau 20

Siswa Makin Sehat, Semangat dan Cerdas kipendidikandiSiantar.“Makanan dan minuman adalah faktor yang sangat penting untuk meningkatkan kecerdasan anak. Semoga denganpemberianmakanantambahan ini mampu meningkatkan kecerdasan siswa di Siantar,” ujarnya. Diamenerangkan,sebanyak154 siswa di sekolah tersebut mendapatkan makanan tambahan. Makanan tersebut juga diolah di sekolah tersebut oleh kepala sekolah dan guru-guru, disaksikan parasiswa.“Kitamausiswamenyaksikan pengolahan makanan tambahan ini. Banyak hal positif yang akanmereka(siswa,red)dapatkan dengan menyaksikan guru-guru mengolah makanan sehat tersebut,” jelas T boru Samosir. Diamenambahkan,programini juga akan berkelanjutan ke depannya. Dalam triwulan, akan dilaksanakan 5 kali pembagian makanan tambahan. “Semoga siswaakanmakinbersemangatdan makin cerdas. Pendidikan yang mapan,pemberiangiziyangcukup, memang harus sudah diberikan sejak dini untuk membentuk anak yang sehat dan cerdas,” ujarnya. Kepala sekolah dan orangtua siswa yang turut hadir pada pembagian makanan tambahan, menyampaikan apresiasinya kepada program Pemko Siantar dalam meningkatkan pendidikan di Siantar ini.

Dalam pembagian makanan tambahan yang dilaksanakan Selasa (13/2)-Sabtu (17/2), siswa diberikan jus wortel, telur, kacang hijau, susu, bolu kukus, dan kue nagasari. PMTASHarusBerkelanjutan Ketua Tim Penggerak PKK Kota Pematangsiantar Rusmiati Hulman Sitorus, Rabu (14/3) saat meninjau pelaksanaan PMTAS tahun 2012 di Sanggar Anak Balita (SAB) Kelurahan Naga Pita, Siantar Martoba menyampaikan, program PMTAS harus terus berlanjut dan ditingkatkan sesuai tujuan meningkatkan asupan gizi peserta didik di Kota Pematangsiantar. PMTAS ini akan meningkatkan ketahanan fisik, minat dan kemampuan belajar dalam rangka menghasilkan insan Indonesia yang cerdas dan kompetitif. Dia juga meminta, agar pengelolaan PMTAS dilakukan dengan benar, baik dan bergizi, jangan asal-asalan saja. Dia menyampaikan, manfaat PMTASsudahbisadilihatdarisikap anak-anak kesehariannya. Yang tadinya malas berangkat ke sekolah kini menjadi giat. “Mungkin karena adanya makanan tambahan bagi mereka,” ujarnya. Program PMTAS juga bermanfaat meningkatkan asupan gizi bagi peserta didik sekaligus menjadi magnetik bagi orangtua yangpunyaanakbalita. (mer/ara)

Nasdem Tuntaskan Pembentukan DPC Sambungan Halaman 9 Pematangsiantar, Lingga Napitupulu BcEng, sudah dilakukan pengoptimalan kantorkantor hingga ke ranting. Di mana ada beberapa kecamatan yang berubah. “Khusus yang tadinya Siantar Marihat dan Siantar Utara sudah diselesikan dengan penyerahan SK (Surat Keterangan) kepada DPP Nasdem, Rabu 14/3) kemarin,” jelas Lingga Napitupulu kepada METRO, Kamis (15/3) kemarin. Saat ini pihaknya tinggal



Siantar Butuh TPA Baru

Sambungan Halaman 9


menunggu pendefenitipan saja. Untuk Siantar Marihat diketuai oleh Rustam Sianipar, Sekretaris WanitaSekretariatdiJalanBahkora II. Untuk Siantar Utara diketuai Pargindot Pangaribuan bersekretariat di depan terminal lama. Sementara Siantar Martoba sekretariat Jalan Tebing-Medan sebelum Waterpark. Perubahan juga dilakukan di beberapa ranting oleh Sugimin. “Demikian juga dengan Kantor Gerakan Pemuda Nasdem, juga telah ditetapkan di Jalan Ahmad Yani Nomor 100,” jelas Lingga. (leo)


MENGADURatusan warga Huta Bintang Mariah, Nagori Dolok Maraja menunggu perwakilannya yang sedang bermusyawarah di dalam Kantor Pangulu Dolok Maraja.

Satpam Kebun Larang Pendirian Tiang PLN Sambungan Halaman 9 Warga pun menyebut pihak perkebunan telah menghambat hak mereka untuk menikmati listrik.. Pasalnya, pihak perusahaantersebutmelarangpendirian tiang PLN di Jalan Kontrol Lahan HGU Blok JJ/67,II 7 Bintang Mariah melalui suratnya tanggal 12 maret 2012 Ref.: HR/ 0344/2012 tertanggal 14 Maret 2012. Keberatan PT Bridgestone membuat warga Bintang Mariah kesal dan marah. Hanya gara-gara 165 batang pohon yang terancam ditebang dan ratusan lainnya terancam dipangkas, perusahaan perkebunan milik asing itu malah tidak mengizinkan tiang PLN didirikan di wilayah operasinya. “Selama Indonesia merdeka, baru kali ini pemerintah membangun PLN di Huta Bintang Mariah. Namun hak warga untuk menikmati layanan listrik PLN dihambat oleh perusahaan perkebunan milikasing,”katawargaJayadiPurba(36), Kristian Sinaga (65), Kartua Sihombing (50), Marulam Sipayung (38) mewakili warga lainnya, Kamis (15/3) ketika mengadu ke Pangulu Dolok Maraja dan Camat Tapian Dolok. Yang mereka sesalkan, kata Jayadi Purba yang merupakan pemrakarsa permohonan pemasukan listrik PLN ke HutaBintangMariahini,hanyagara-gara 165 batang pohon terancam ditebang dan ratusan pohon lainnya terancam

dipangkas, akhirnya perusahaan perkebunan milik asing tidak mengizinkan pendirian tiang PLN di wilayahnya. Padahal awalnya mereka sudah setuju. Merasa diobok-obok oleh pihak perkebunan, Kamis (15/3) sekitar pukul 08.00 WIB ratusan warga Huta Bintang Mariah yang dikoordinir Jayadi Purba mendatangi Kantor Pangulu Nagori Dolok Maraja dan Kantor Camat Tapian Dolok untuk mengadukan perusahaan asing yang menghambat pemasangan tiang PLN. Kata mereka saat itu, bila dibandingkan dengan wilayah lain di lahan HGU perusahaan asing tersebut, seperti Nagori Pusuk Pardamean yang berbatasan langsung dengan Huta Bintang Mariah, Huta Bah Sulung, Huta Bahapal, Huta Dolok Maraja dan daerah lainnya di Simalungun, lebih dari puluhan ribu pohon karet yang ditebang dan tidak ada masalah. Kata mereka, ketika warga memohon pemasangantiangdanpemasukanlistrik PLN ke Wilayah II Medan dan disetujui, pada24Maret2011lalujuga,perusahaan asingtersebuttelahmemberikanizin.Sebagaipersyaratannya,wargamelengkapi adminisitrasi permohonan PLN ke Wilayah II Medan. Di Kantor Pangulu Dolok Maraja ratusan warga Huta Bintang Mariah disambut Pangulu, Rusli. Pangulu berjanji akan membantu menjembatani

antara perusahaan dan masyarakat sesegera mungkin, setelah dirinya selesai menghadiri rapat di kantor Bupati Simalungun di Pamatang Raya. “Hari ini kita tidak bisa bermusyawarah, karena saya akan rapat kekantorbupatidiPamatangRaya.Nanti sepulang dari Raya, kita adakan musyawarah,” janji pangulu di hadapan ratusan warganya. Selasai dari kantor pangulu, warga beranjak ke Kantor Camat Tapian Dolok, Warga disambut disambut dengan baik oleh Camat Tapian Dolok, Williamer Saragih. Melalui sekretarisnya Sakban Saragih,camatmengundangperwakilan warga yaitu Jayadi Purba dkk untuk berdialog di ruangan camat. Dalam pertemuan itu Camat Tapian Dolok, Williamer Saragih mengajak masyarakat untuk tidak resah dan tidak berbuat tindakan yang melanggar hukum. “Secara pribadi saya tersinggung terhadap perusahaan milik asing yang pada awalnya sudah memberi izin, namun akhirnya dilarang. Wajarlah masyarakatresahapalagipembangunan sudah di depan mata. Namun demikian, saya akan memfasilitasi perwakilan masyarakat dengan perusahaan perkebunan itu untuk mencari jalan keluarnya,”kataWilliamerdanmengaku secara teknis dia belum tahu duduk persoalannya. (mer/ara)

ton per hari. Kalau mengharapkan TPA yang lama, tempatnya tidak mencukupi. Sementara Kadis Kebersihan Siantar Ir Kadimin saat hendak dikonfirmasi tidak berhasil ditemui di kantornya. Saat ditelepon, juga tidak dibalas. Beberapa waktu lalu, Kadimin mengatakan, untuk pembuatan TPA baru sudah dianggarkan, dengan biaya sebesar Rp500 juta. “Namun belum ada tempatnya. Petugas masih dalam pencarian TPA yang baru. Karena TPA yang lama sudah habis kontrak pada 2012,” terang Kadimin saat itu. (osi/ara)

Karyanya Mendunia Sambungan Halaman 9 Fayed sudah membeli karyanya. Sejak go public pada 2004, istri Patrick von Rueti ini sudah menciptakan tak kurang dari 175 karya masterpiece. Kecintaan terhadap perhiasan sudah muncul sejak kecil, padahal dia besar di kota terpencil, Pematangsiantar. Dia tumbuh di kampung, di kawasan perkebunan di Pematangsiantar, karena ibunya adalah penanam kelapa sawit dan karet. “Kotanya sangat sederhana tapi sangat kaya. Kami punya tradisi saat Lebaran atau Tahun Baru untuk saling berkunjung. Saat itulah biasanya orang berdandan. Saya hanya ingin tampil berbeda. Kalau ibu saya memberi 5 gram emas, saya minta ke penjualnya apakah bisa dibikin bentuk bunga? Jadi, perhiasan yang saya pakai selalu berbeda dari kebanyakan orang.” “Saat saya kuliah di New York, saya melihat perhiasan tiga dimensi berbentuk bunga dan lebah. Saya penasaran bagaimana membuatnya. Katanya membuatnya dengan teknik wax carving. Jadi, selama liburan musim panas, saya ambil ekstrakurikuler wax carving . Selain itu saya tidak pernah belajar merancang perhiasan.” Katanya, dia mendapat inspirasi karena kebanyakan rumah di sana bergaya kolonial. Furnitur di rumah ibunya juga sangat terbatas. “Enggak kayak di Jakarta, pergi ke mal bisa melihat banyak barang. Saya sering memindah-mindahkan furnitur di rumah. Pokoknya ada saja yang saya lakukan,” ujarnya. Delia sudah membuat sekitar 175 karya. “Kadang saya simpan sendiri karena setelah saya buat, saya tidak ingin berpisah dengannya. Sejak resmi memamerkan karya saya pada 2004, orang-orang bisa melihat saya berevolusi. Dulu karya saya masih malu-malu, sangat sederhana,” jelasnya. Bagaimana kisahnya sampai karyanya dibeli orang-orang terkenal, Delia menjelaskan, biasanya lewat makan malam, pertemuan, atau teman baiknya yang dengan baik hati membuatkan transhow untuk Delia dan teman tersebut punya lingkaran orang-orang ini. “Senang rasanya. Yang biasanya mereka memakai Bvlgari, Cartier, lalu tiba-tiba mereka memakai perhiasan aneh karya perempuan yang tinggal di Bali,” ujarnya. Setelah dibujuk Menteri Perdagangan Marie Elka Pangestu, Delia akhirnya merambah pasar Indonesia hingga alhirnya merambah ke pasar dunia dan karyanya dipakai orang-orang terkenal. (int)

Dokter RS Penang Sharing Ilmu ke RSU Djasamen Sambungan Halaman 9 Djasamen Saragih dapat semakin maksimal, berkualitas dan profesional. Dirut RSU Djasamen Saragih dr Ria N Telaumbanua didamping dr Maya Flora Damanik seusai seminar mengatakan, sejak setahun terakhir, menuju RS Pendidikan, manajemen RS dr Djasamen Saragih telah dan akan terus melakukan pembenahan besar dalam mengoperasikan rumah sakit milik pemerintah ini. Selain perbaikan sarana, juga memperbaiki perilaku seluruh stakeholder di dalamnya. Pembenahan besar-besaran ini tidak terlepas dari rencana manajeman RSU Dr Djasamen Saragih yang akan menjadikan rumah sakit ini

menjadi RS Pendidikan. Artinya, selain sabagai sarana kesehatan juga menjadi sarana pendidikan. “Kita upayakan RS Dr Djasamen Saragih bisa terealisasi menjadi RS Pendidikan pada April 2012 dan selanjutnya RS menuju Badan Layanan Umum (BLU). Sagala upaya perbaikan telah dan akan terus kita lakukan. Yang terakhir adalah, mendatangkan dr DR Ho Kean Fatt, dari Mount Miriam Hospital Penang, sebagai membuka peluang rumah sakit pemerintah berkolaborasi dengan RS Swasta dimanapun juga,” kata dr Ria. dr Ria menjelaskan, Manajeman RSU Dr Djasamen Saragih berupaya mencapi visi Kota Pematangsiantar. “Bidang pendidikan dan kesehatan

adalah dua pilar yang sangat menentukan kemajuan kota, termasuk pembangunan sumber daya manusianya. RSU Djasamen Saragih sebagai RS Tipe B yang dalam proses perkembangan, sedang dan terus berbenah meningkatkan pelayanan kesehatan yang bermutu dan go internasional. Tujuannya, terciptanya rumah sakit yang maju, mantap dan jaya menuju masyarakat yang sehat yang mandiri, dan berkeadilan tahun 2015,” ujarnya. “Jika RSU Djasamen sudah menjadi RS Pendidikan, akan ada anggaran dari APBN melalui Kementerian Kesehatan. Artinya, tidak akan ada biaya tambahan dari APBD dan tidak akan ada perubahan biaya perobatan pasien. Nantinya RS ini juga akan

menjadi wadah aplikatif bagi profesi calon dokter, dokter spesialis, serta tenaga kesehatan lainnya,” tergas dr Ria. Selain itu, RS Dr Djasamen Saragih jika menjadi BLU, nantinya akan ada dokter ahli dari rumah-rumah sakit bergengsi. Apalagi akan adanya pelayanan tambahan pengobatan penyakit Kanker dengan peralatan yang canggih dan dilayani dokterdokter yang ptofesional. Saat acara seminar, dr DR Ho Kean Fatt didampingi ajudannya, Ms Ratna melakukan sharing dan mentransfer ilmuanya kepada peserta seminar. Terlihat hadir, dokter-dokter spesialis yang ada di RS dr Djasamen Saragih, dan elemen pendidikan lainnya. (mer/ara)





Maret 2012


Diolok, Bocah 5 Tahun Potong Rambutnya LONDON - Rean Carter, bocah berusia lima tahun tidak pernah memotong rambutnya sejak dia lahir. Akhirnya, karena kondisi rambutnya yang sudah terlalu panjang, Rean harus memotong rambutnya. Temanteman Rean selalu mengoloknya sebagai anak perempuan. Rambut Rean pun harus dipotong sebab rambutnya itu sangat panjang dan ikal. Anak itu pun meminta untuk menggunting rambutnya, setelah dia merasa tidak nyaman karena selama ini orang-orang selalu menganggap dia sebagai anak perempuan. Ibunya yang bernama Leeanne Smith sempat menangis saat rambut anaknya digunting. “Ketika Rean lahir, dia sudah memiliki rambut yang ikal berwarna keemasan. Saya tidak pernah ingin mengguntingnya, walaupun hanya merapihkan poninya. Sekarang rambut itu tumbuh sampai ke punggungnya dan saya kira itu sangat luar biasa indahnya,” ujar ibunya, Kamis (15/3). Lebih lanjut Leeane menambahkan, ketika mereka berpergian, anaknya selalu dikira sebagai anak perempuan. Orangorang sering mengatakan ‘Wah, dia sangat cantik’. “Saat dia masuk sekolah, rambutnya harus diikat kebelakang agar terlihat lebih rapih. Sayangnya, teman-teman mulai mengolok-oloknya dan mereka tidak ingin bermain bersamamanya,” imbuhnya. (oz)

„ Andreas Panayiotou

Kaya Tapi Tak Bisa Membaca INGGIRISAndreas Panayiotou memiliki kerajaan properti senilai 400 juta poundsterling (Rp 5,5 triliun) dan menduduki peringkat 200 orang terkaya di Inggris. Tapi, dia membuat pengakuan mengejutkan. “Saya tidak bisa membaca,” katanya. Ayah lima anak itu bukannya tidak mau belajar membaca. “Waktu kecil saya berusaha keras agar bisa membaca,” kata lelaki 45 tahun itu. Dia memutuskan berhenti sekolah pada umur 14 tahun. Di luar masalah disleksia, Panayiotou tak membantah bahwa dia benci membaca waktu masih kecil. “Jadi setelah dewasa saya punya cara tertentu untuk menghindarinya. Jadi dia memiliki trik khusus untuk mengakali kelemahannya itu. “Saya memiliki daya ingat yang luar biasa, photographic memory . Saya mengenali bentuk untuk mengenali sebuah kata, tanpa perlu bisa membaca,” ujarnya. Di jalan misalnya, selain menghapalkan tanda lalu lintas, dia menghapalkan bentuk kata nama jalan ataupun nama kota. Sayangnya, trik itu

tidak berlaku pada setiap hal. “Kalau ada nama belakang baru yang saya tidak mengenali, saya tidak mungkin bisa. Begitu juga dengan mengisi formulir seperti paspor. Itu area terlarang saya,” ujar lelaki yang pernah menjadi petinju itu. Meskipun memiliki kekurangan seserius itu, dia berhasil membangun sebuah kerajaan bisnis yang mengagumkan. Di usia muda, anak imigran Yunani itu membeli sebidang tanah kecil di Islington. Pelan-pelan dia membangunnya menjadi gedung apartemen. Dari situlah bisnisnya berkembang. Pada tahun 2007, dia berhasil menjual ribuan rumah. Kini fokusnya beralih ke hotel. Perusahaannya, The Ability Group, kini memiliki tujuh hotel. Yang paling gres adalah Hotel WaldorfAstoria London senilai 70 juta poundsterling (Rp 979 miliar). Dia juga akan menjual “rumah termahal di Inggris”, sebuah properti yang baru direnovasi di Hamstead. Dia berharap rumah itu laku dengan harga 100 juta poundsterling (Rp1,3 triliun). Rumah pribadinya di Epping Forest seluas 8 hektare. Dia juga memiliki tiga pesawat pribadi

dan sebuah kapal pesiar. Dia yakin kesuksesannya adalah gara-gara disleksia karena dengan kekurangannya itu, dia harus melatih diri untuk bekerja lebih keras dibandingkan orang lain. “Semuanya, dorongan kuat untuk membuktikan bahwa saya berarti, kedisplinan yang sangat ketat, dan kebanggaan atas yang sudah saya capai merupakan hasil dari perasaan malu dan kurang yang saya alami karena tertinggal dibanding anak-anak lain yang bisa membaca,” Panayiotou mengaku. Dengan membalik disleksia, Anda berhasil mengembangkan bakat lain. Saya melatih pikiran agar memiliki daya ingat kuat. Kita jadi lebih kreatif dalam menyelesaikan masalah karena pikiran kita dipaksa bekerja untuk memahami yang terjadi di sekitar kita.“Pikiran kita selalu berusaha, berusaha, dan berusaha. Kita jadi lebih kuat karena belajar mengatasi masalah merupakan bagian dari kehidupan,” tuturnya. Panayiotou kini terlibat aktif dalam kampanye untuk mengatasi buta huruf. “Kemampuan membaca merupakan hal pokok seperti makan,” katanya. (int)


JUMAT 16 Februari 2012


LOWONGAN KERJA Dibutuhkan tenaga wanita tamatan SD, SLTP, SLTA, SPK, AKPER untuk menjadi : • Babby Sitter • Perawat Jompo, Kakak Asuh Gaji Rp.900.000,- s/d 1.600.000,Hubungi :

YAYASAN SINAR BUNDA Jl. Ngumban Surbakti No.23 (±300m dari Simpang Pos) Padang Bulan Medan 082160644428

LOWONGAN KERJA Dibutuhkan tenaga wanita tamatan SD, SLTP, SLTA, SPK, AKPER untuk menjadi : • Babby Sitter • Perawat Jompo, • Kakak Asuh Gaji Rp.900.000,- s/d 1.600.000,Hubungi :


Jl. Setia Budi simp. Pemdan Gg. Kasih No. 3 (di depan Kampus UNIV. AMIK UNIVERSAL) 081371677800



Jessica Biel T ak Mau jadi Gadis Baik -Baik Tak Baik-Baik JESSICA Biel ingin mencoba lepas dari kesan gadis baik-baik yang melekat padanya. Kekasih Justin Timberlake ini ingin orang percaya kalau dirinya juga bisa menjadi gadis nakal. ”Aku rasa aku perlu menghancurkan reputasiku seluruhnya. Aku suka keluar rumah, aku sehat dan suaraku sangat nyaring. Saatnya untuk sangat-sangat jahat,” kata Biel, seperti dikutip dari Femalefirst, Kamis (15/3).

Biel menegaskan bisa juga menjadi wanita yang nakal dan berpikir liar. Bahkan, Biel juga bisa berbuat cabul terhadap boneka barbie miliknya. Dia suka membuat boneka barbienya berhubungan seks. ”Itu selalu. Ayo bermain seks dengan Barbie. Barbieku biasanya telanjang. Aku pernah memotong kepalanya, memotong rambutnya sampai pendek. Akhirnya aku menjadikan kepala mereka sebagai lampu Natal,” tandasnya. (oz/int)

Jumat, 16 Maret 2012

Momo ‘Geisha’

Gantikan Luna di Hati Ariel DUGAAN hubungan spesial antara vokalis Geisha Momo dengan Ariel terus bergulir. Momo pun mengaku sering mengunjungi Ariel di Rumah Tahanan Kebon Waru, Bandung. Meski demikian Momo menampik ia sering mengunjungi Ariel karena punya hubungan khusus. Ia mengaku kunjungannya itu berkaitan dengan kolaborasi dengan eks Peterpan. Namun ia masih merahasiakannya. ”Kerja samanya adalah bukan aku dan Ariel tapi aku dan (eks) Peterpan. Yang pasti aku berkolaborasi dengan mereka apa lagunya bla blanya tunggu tanggal mainnya,” ujar Momo saat ditemui di sela-sela syuting video klip ‘Cukup Tak Lagi’ di kawasan Cilandak, Rabu (14/3) tengah malam. Momo pun menyatakan tak tahu sudah berapa kali ia mengunjungi

Ariel di Bandung. Namun yang jelas, ia tak kesana hanya untuk menemui Ariel. ”Seberapa seringnya ke rutan aku nggak ngitung, tapi aku kesana bukan berarti aku nemuin only Ariel nggak. Mereka kan juga akan mengeluarkan album di situ. Aku

menyesuaikan jadwal aku untuk mampir (ke rutan). Itu pun ramerame ada produser aku juga. Tapi kalau nggak ya kadang aku ya aku nggak ikutan,” papar Momo. Narova Morita Sinaga atau yang akrab disapa Momo ‘Geisha’ mengaku dekat dengan Ariel.

Secara pribadi, Ia pun ‘nyamannyaman’ saja dekat dengan eks vokalis Peterpan itu. Namun ia justru khawatir dengan kedekatannya itu akan membuat seseorang terganggu. Lebih tepatnya mengganggu hubungan Ariel dengan seseorang. Luna-kah yang dimaksud? ”Aku nggak merasa terlalu terganggu. Aku malah khawatir dengan aku malah ada orang yang terganggu,” katanya. Lucunya, Momo seperti tak mengetahui hubungan Ariel dan Luna sudah kandas. Entah karena perasaan bahagia, Momo pun terlihat salah tingkah. Dara berdarah Batak itu juga mengaku sering mengunjungi Ariel di Rutan Kebon Waru, Bandung. Lantas seperti apakah kedekatan sebenarnya antara Momo dan Ariel? (dtc/int)

Rachel Maryam Hamil Muda?

Artis dan politisi Rachel Maryam Sayidina telah melangsungkan pernikahan diamdiam dengan kekasihnya, Edwin Aprihandono (Edo). Dia pun digosipkan telah hamil muda. Benarkah?

”Gini aku enggak akan kasih statement hari ini. Karena hal seperti ini statement yang harus diutarakan kami berdua, karena bersangkutan dengan Edo-nya juga. Jadi insya Allah sabar saja, dalam waktu beberapa hari mendatang akan ada statement dari kita berdua,” sanggahnya saat ditemui di Gedung DPR RI, Jakarta, belum lama ini. Berdasarkan kabar yang berhembus, Rachel telah dinikahi Edo secara siri pada 16 Desember 2011. Namun sayang Rachel mendapat kendala restu dari orangtua Edo, lantaran status Rachel sebagai artis yang juga janda beranak satu. Karena keputusan Edo menikah, dia mulai

merintis usaha dari nol, karena bantuan finansial dari sang ayah yang mantan perwira tinggi TNI dihentikan. ”Itu dalam beberapa waktu ke depan kami akan kasih tahu,” paparnya. Rachel resmi bercerai dari Ebes pada 13 Oktober 2010. Dia pun pertama kali bertemu dengan Edo saat tergabung dalam kelompok pengajian Al Maghribi. Kedekatan keduanya terjalin saat mereka melaksanakan ibadah umrah bareng. Dan pada akhir tahun lalu, Rachel melepas masa jandanya dengan Edo. ”Segera aku kasih statement. Memang dari awal kita tahu arahnya ke mana, ini adalah hal serius. Karena buat aku enggak

mau lagi kalau enggak serius. Dari awal memang tujuannya untuk serius,” imbuhnya. Tak hanya pernikahan diam-diam, bintang Arisan! inipun dikabarkan tengah hamil muda. ”Belum hamil saya. Saat ini enggak. Tidak benar,” bantahnya. Meski membantah hamil, namun dari jawabannya sudah tersirat dia sudah menikah. Bahkan, sinyal mereka akan segera meresmikan hubungan sudah tercium saat Rachel menghadiri peluncuran film Arisan!2 di X2, Plaza Senayan, Jakarta, 24 November 2011. ”Soal nikah kalau disuruh besok, saya sih siap karena lebih cepat lebih baik,” ungkapnya kala itu. (oz/int)

DEWI Perssik kecewa pada Ahmad Dhani yang kurang dengan menanggapi kasus yang dialaminya. Untungnya, Dewi mengaku banyak mendapat pelajaran dari kasus ini. Dewi menangis usai divonis hakim dua bulan terkait kasusnya dengan Julia Perez. Dewi merasa tak didukung Ahmad Dhani sebagai bos RCM tempatnya bernaung. “Saya tidak merasa ditinggalkan. Apapun yang dilakukan oleh orang-orang itu, saya akan tetap introspeksi diri, ini pembelajaran diri buat saya,” ucapnya saat ditemui di Pengadilan Negeri Jakarta Timur, Rabu (14/3). Lantas, benarkah Dewi marah hingga berencana keluar dari RCM? “Kita lihat saja nanti,” jawabnya. Dewi diputus hakim dua bulan penjara dengan empat bulan hukuman percobaan. Kasus Dewi ini berawal dari tudingan Jupe atas penganiayaan ringan yang dilakukannya. Saat dibutuhkan menjadi saksi, Dhani tak hadir lantaran sibuk. Lantas apa komentar Dhani? “Sebenarnya enggak lepas tangan. Pengacara Depe itu kan dari pengacara kami. Kita sudah memberikan yang terbaik tapi kan pengadilan yang menentukan,” jawab Dhani saat ditemui di studio Dahsyat, Kebon Jeruk, Jakarta Barat, Kamis (15/3). (nov/int)


16 MARET 2012


KOMUNITAS FB XPRESI METRO SIANTAR Kalau kemarin sudah berpantun, sekarang bikin kata-kata bijak yuk..... hmmm, copas juga boleh asal bisa memotivasi! Irdan Jrocks Tidak semua yang dapat menghitung dapat dihitung, dan tidak semua yang dapat dihitung dapat menghitung.

Yeni MoetzAnaqkolong Learn from yesterday,live for today,hope for tomorrow.the important thing is not to stop questioning. Belajarlah dr hr kmrn,hidup la tuk hr ni,brharaplah tuk hr esok.yg trpenting adalh jgn prnh brhenti brtanya C’alay Yg CuEt Sitorus Obat terbaik jika patah hati adalah jatuh cinta lagi. Don’t be galau. Keep smile:)

Togap Noaiggoelan Ibarat Anjing HItam n Putih Bertarung !! Jika anjing Hitam diberi makan , dan Anjing putih tidak Pasti Yg HITAM MENANG !! Jadi, Pasti Kebaikan Menang Jika Lebih banyak dipupuk Kejahatan.. .Slamat mencoba !! Bekaa SsI’ Ketika galau melanda......bershowerlah

Ardi Ansyah Jgn pernah menyia2kan kepercayaan yg tlah diberikan kepadamu, krn tu bntk penghargaan kpdamu!

Aries Joe Saragih Belajarlah dari tingkah lakumu, karna itu adalah pengalamanmu...dan fahami lah itu..sebaik mungkin...karna di situ akan muncul sudut pandang yang baru..

Wah… wah…. K alau Kalau sudah menjadi jawara kelas mulai dari Sekolah Dasar (SD) hingga SMA SMA,, memang citacita pun cita-cita semakin tinggi. Sama halnya dengan Deariska (17) siswa SMA Negeri 2 yang bercitacita ingin bercita-cita menjadi seorang Dip Dip-lomat.

Kepulauan Riau dan berhasil meraih juara 3. Selanjutnya saat pindah ke Siantar dan sekolah di SMAN 2 ia pernah mengikuti Olimpiade Kimia, tapi nggak berhasil meraih juara. “Teknik belajarku sedikit unik, di dinding kamarku selalu ku pajang jadwal pelajaran yang harus aku kerjakan. Aku pake sistem paket jadwal biar semakin mandiri, disiplin dan waktu pelajaran pun ku tentukan yakni satu setengah jam per mata pelajaran,” ungkap cewek

Deariska, siswa kelas XII IPA 1 ini biasa dipanggil Dea. Ia memiliki segudang prestasi baik di bidang akdemik maupun non akademik. “Hm,,,, sejak SD aku sudah langganan menjadi juara umum hingga SMA. Nggak tau, kenapa bisa juara umum terus, mungkin keturunan ya sama kakak dan orangtua,” sebut cewek berkacamata dan berjilbab ini. Katanya, untuk mata pelajaran yang disukai itu Matematika dan Fisika. Waktu SMP, ia pernah ikut Olimpiade tingkat kota di

Melejitkan Otak Lewat Gaya Menulis Bebas OT AK lebih hebat daripaOTAK da yang dapat kita bayangkan. Jika kamu “memerasnya” dengan cara yang tepat, otak mampu memproduksi ide-ide brilian dalam waktu singkat. Caranya, ambil sehelai kertas dan pena-atau nyalakan program komputer untuk menulis-dan gunakan salah satu metode menulis paling efisien di dunia, yaitu freewriting. Metode ini cukup ampuh untuk melejitkan dua

kemampuan sekaligus, yaitu kemampuan untuk menciptakan ide-ide baru dan membuat tulisan panjang dalam waktu singkat. Dengan begitu, kalau kamu mau belajar menulis dan ingin kreatif dalam waktu bersamaan, buku ini harus kamu pelajari. Kamu akan mempelajari rahasiarahasia freewriting yang dahsyat itu. Setelah membaca buku ini, kamu bakal bisa menulis apapun yang kamu suka-

novel, cerpen, karya ilmiah, non fiksi, biografi, dan banyak lagi-dengan ide-ide kreatif tak terduga yang ada di pikiranmu! Otak Lewat Judul Buku: Melejitkan riting) eew gaya Menulis Bebas (Fr N:: 9786020014937 ISBN se Penulis: Jubilee Enterpri mputindo Penerbit: Elex Media Ko it:Desember 2011 Terbit: Tebal: 184 halaman

yang suka ngemil tersebut. Menurutnya, untuk Senin sudah dijadwalkan pelajaran utama Kimia dan Biologi, Selasa belajar Fisika dan Matematika. Kemudian Rabu belajar Bahasa Indonesia dan Bahasa Inggris, Kamis belajar TPA, Jumat belajar Matematika dan Kimia, Sabtu belajar Fisika dan Biologi. Tiap harinya satu mata pelajaran ku jadwalkan satu setengah jam. “Biasanya malam aku mulai belajar pukul 20.00 WIB hingga

01.00 WIB dini hari, selain pelajaran utama, aku tiap hari bahas-bahas soal try out. Maklum, karena kelas XII harus lebih serius belajar. Aku harus fokus sekarang, bahkan kegiatan ku seperti online dari facebook dan twitter harus ditinggalkan,” sebut Dea yang dulu sempat dipanggil si Ratu Online. Disebutkan anak kedua dari dua bersaudara itu, kalau jenuh belajar sih, ia lebih memilih bermain piano dan ngobrol sama keluarga. Cewek yang satu ini lebih anti dan malas untuk jalan-jalan ke kota. Ia lebih memilih berbincang sama keluarga ketimbang harus jalan-jalan sanasini. Putri pasangan Hendry dan Mustika ini berencana untuk melanjutkan sekolahnya ke UI dan UNDIP. Katanya ia mau mengambil Jurusan Fakultas Kedokteran, atau Teknik Kimia. Tapi kalau selagi mampu, ia pengen mengambil Diplomat. “Optimisku ingin menjadi seorang Diplomat. Aku ingin lebih leluasa mengembangkan ilmuku. Serta sangat tertarik dengan Diplomat karena ilmunya berkembang secara dinamis,” pungkas Dea yang tinggal di Jalan Makasar ini. (mua)

All Sport


16 Maret 2012




Tiger Woods

WOODS TERKAYA, MESSI NOMOR 9 SITUS resmi Forbes mengeluarkan daftar atlet dengan penghasilan terbesar sejagat raya hingga saat ini. Nama-nama seperti Tiger Woods ataupun Kobe Bryant masih mendominasi daftar tersebut. Berikut adalah ulasan dan daftar atlet-atlet tersebut. Dari daftar nama atlet berpenghasilan terbesar versi Forbes tersebut, para pesepakbola sohor ternyata berada di luar lima besar. Pemain terbaik dunia, Lionel Messi berada di urutan 9, masih di bawah pesaing utamanya di Liga Spanyol, Cristiano Ronaldo yang berada di urutan 7. Mereka berdua masih kalah dibandingkan senior mereka, David Beckham. 1. Tiger Woods Pegolf asal negeri Paman Sam tersebut masih berada di puncak daftar atlet berpenghasilan terbesar di dunia versi situs resmi Forbes. Woods sendiri diperkirakan memiliki kekayaan hingga 75 juta dollar AS. 2. Kobe Bryant Diperingkat dua, ada sang bintang Los Angeles Lakers, Kobe Bryant. Seperti daftar yang dirilis oleh situs resmi

Forbes, penghasilan pemain 33 tahun ini ditaksir sekitar 53 juta dollar AS. 3. LeBron James Di bawah Bryant, masih ada bintang NBA lainnya, yaitu LeBron James. Bintang Miami Heat tersebut menurut situs resmi Forbes memiliki penghasilan hingga mencapai 48 juta dollar AS. 4. Phil Mickelson Selain Tiger Woods, pegolf yang masuk dalam daftar 10 atlet terkaya di dunia adalah Phil Mickelson . Pegolf berdarah Amerika Serikat ini ditaksir memiliki kekayaan sebesar 47 juta dollar AS. 5. Roger Federer Nama mantan petenis putra nomor satu dunia tersebut menurut situs resmi Forbes berada d iperingkat lima atlet berpenghasilan terbesar di dunia. Roger Federer yang berkebangsaan Swiss memiliki kekayaan senilai 47 juta dollar AS. 6. David Beckham David Beckham merupakan salah satu dari tiga atlet sepak bola yang dapat menembus sepuluh besar atlet terkaya di dunia. Nilai kekayaan Beckham, yang kini menetap di Los Angeles tersebut sebesar 38 juta dollar AS.

7. Cristiano Ronaldo Sesuai dengan nomor punggung Cristiano Ronaldo, ia berada di peringkat tujuh atlet terkaya di dunia. Kekayaan mantan kekasih Paris Hilton ini berkisar 38 juta dollar AS. 8. Alex Rodriguez Di peringkat delapan, ada atlet Baseball kenamaan Amerika Serikat, Alex Rodriguez. Pemain yang berkarir di New York Yankess ini memiliki penghasilan hingga 35 juta dollar AS. 9. Lionel Messi Pesepakbola terbaik dunia tiga kali ini adalah satusatunya putra asal benua Amerika Selatan yang sukses masuk sepuluh besar atlet brepenghasilan terbesardi dunia. Nilai kekayaan pemain yang berjuluk “La Pulga” ini diperkiarakan mencapai 32 juta dollar AS. 10. Rafael Nadal Di peringkat sepuluh, ada nama petenis kenamaan asal Spanyol yaitu Rafael Nadal. Menurut situs resmi Forbes, petenis berusia 25 tahun tersebut memiliki penghasilan sebesar 31 juta dollar AS. (kps/int)

Swiss Open Grand Prix 2012

Harapan Indonesia di Pundak Taufik Petenis nomor dua Indonesia, Taufik Hidayat harus bekerja ekstra keras untuk menembus babak ketiga Swiss Open Grand Prix 2012. Taufik melakoni laga perdananya di babak kedua Swiss Open dengan menghadapi Henri Hurskainen asal Swedia, Kamis (15/3) dini hari WIB. Butuh 59 menit bagi peraih medali emas Olimpiade Athena 2004 ini untuk meraih kemenangan lewat tiga game. Meladeni lawan yang tidak masuk daftar unggulan, Taufik yang menempati unggulan ke-10 sempat dibuat ketar ketir, lantaran Henri mampu merebut game pertama dengan 17-21. Beruntung, Taufik yang unggul pengalaman mampu meredam tekanan yang datang. Dengan penampilan yang tenang, suami dari Ami Gumelar ini mampu membalikkan keadaan dengan meraih dua game berikutnya dengan 21-12 dan 21-16. Taufik pun sukses melaju ke babak ketiga dan akan berhadapan dengan unggulan ke-8 asal China, Du Pengyu.

Taufik menjadi satu-satunya wakil Indonesia di nomor tunggal putra. Pasalnya, dua pebulutangkis lainnya, Tommy Sugiarto dan Andre Kurniawan Tedjono harus lebih dulu angkat koper. Tommy disingkirkan Viktor Axelsen (21-18 21-12), sementara Andre dibekuk unggulan empat asal China, Chen Jin dengan 21-13 21-10. Sementara di nomor ganda putri, Indonesia meloloskan dua wakilnya, Vita Marissa/ Nadya Melati dan unggulan delapan Meiliana Jauhari/ Greysia Polii ke babak kedua. Vita/Nadia menundukkan ganda putri Kanada Alex Bruce/Michelle Li (21-11 21-14), sedangkan Meiliana/Greysia menyingkirkan Mariana Agathangelou/Heather Olver, dua game langsung 21-16 dan 21-16. Di nomor ganda putra, In-

Chisora Kehilangan Surat Izin Bertarung

„ Taufik Hidayat

donesia sukses mengirimkan tiga wakil ke babak kedua. Setelah Angga Pratama/Ryan Agung Saputra, memastikan lolos, Merah Putih menambah dua lagi wakil di babak kedua, yakni pasangan Alvent Yulianto Chandra/Hendra Aprida Gunawan dan Markis Kido/ Hendra Setiawan.

Alvent/Hendra AG yang menempati unggulan ke-5, sukses menundukkan Roger Schmid/ Gilles Tripet asal Swiss dengan 21-11 21-13. Di babak kedua nanti, Alvent/Hendra AG akan berhadapan dengan pasangan India, Rupesh Kumar T/Sanave Thomas. Sementara unggulan empat,

Kido/Hendra juga lolos usai mengandaskan perlawanan ganda putra Malaysia, Gan Teik Chai/Tan Bin Shen. Pasangan unggulan empat ini menang 22-20 21-18. Di babak kedua, Kido/Hendra akan berhadapan dengan ganda putra Taiwan, Chen Hung Ling/Lin Yu Lang. (oz/int)

Audi Siap Caplok Ducati

Moto GP 2012

Hanya Pertarungan Stoner-Lorenzo Managing Director Yamaha Moto Racing, Lin Jarvis menilai musim ini akan menjadi pertarungan head to head antara Casey Stoner dan Jorge Lorenzo. Bahkan Jarvis menilai tidak ada jurang perbedaan antara kedua pembalap itu. Musim lalu Stoner berhasil menjadi juara setelah tampil penuh mendominasi sepanjang musim 2011. Meski begitu, ketika ditanyakan apakah Stoner mampu dikejar oleh Yamaha, Jarvis menjawab dengan penuh keyakinan. “Ya, tanpa keraguan. Saya pikir jelas Jorge (Lorenzo) dan Casey (Stoner) telah menjadi pembalap terdepan selama dua tahun terakhir dan saya pikir itu akan serupa di tahun ini. Perbedaan antara kedua-

nya dapat ditiadakan, karena itu bergantung dari lintasan dan keadaan tertentu,” ujar Jarvis, dilansir dari MotoGP, Kamis (15/3). Jarvis pun memberikan analisis mengenai situasi yang akan dihadapi Stoner, terkait dengan Yamaha. Dirinya yakin pembalap Australia itu akan menghadapi perlawanan ketat dari Lorenzo. “Akhir tahun lalu penampilan Casey mencengangkan, dia tidak membuat kesalahan sama sekali, tetapi Jorge (Lorenzo) menampilkan hal yang sama di tahun sebelumnya. Jadi dalam opini saya, kemungkinan besar musim ini akan menjadi pertarungan head to head antara Jorge dan Casey sejak awal musim ini,” tandasnya. (oz/int)

Audi, yang berada di bawah payung merek top asal Jerman, Volkswagen, dilaporkan sedang melakukan ekspansi untuk mencaplok Ducati. Dikatakan bahwa Audi tengah mengadakan pembicaraan dengan pemilik Ducati, Investindustrial, untuk bisa membelinya. Bulan lalu, Financial Times mengungkapkan hal tersebut, bahwa Investindustrial berencana menjual merek yang menjadi ikon Italia tersebut. Bos Ducati, Andrea Bonomi, mengatakan bahwa pertumbuhan jangka panjang Ducati membutuhkan dukungan dari partner industri kelas dunia. Kini, Financial Times melaporkan bahwa pembicaraan antara Audi dan Ducati telah dikonfirmasi oleh pihak-pihak yang dekat dengan kedua perusahaan tersebut, dan bahwa Audi memang tertarik dengan Ducati. Akan tetapi, detail tentang kemungkinan harga penjualan belum tercapai. Laporan dari Reuters menambahkan, “Kesuksesan kesepakatan (dengan Ducati) akan memperpanjang rivalitas Audi dengan BMW yang sedang merambah ke arena Superbike.” “Saya menyukai semua yang merah,” ujar Chief

„ Rossi

Executive Volkswagen Martin Winterkom dalam konferensi pendapatan tahunan mereka, Senin (12/3). Pernyataan itu merujuk pada warna merah, yang merupakan warna kebesaran Ducati. Ducati merupakan satu dari tiga tim pabrik yang masih berkompetisi di arena MotoGP, dengan mengandalkan juara dunia tujuh kali MotoGP, Valentino Rossi, dan mantan juara dunia 2006, Nicky Hayden, untuk tim pabrik, plus dua pebalap tim satelit. Adapun di arena World Superbike, Ducati baru saja meraih kesuksesan ketika Carlos Checa menjadi juara musim 2011. Grup Volkswagen memiliki anak perusahaan dengan merek mobil ternama, yakni

Lamborghini, Skoda, Seat, Bentley, Audi, dan Bugatti, serta MAN dan Scania untuk kategori truk. Selain Volkswagen, ada beberapa perusahaan lain yang juga tertarik membeli Ducati, antara lain Daimler dan BMW, serta perusahaan asal India, Mahindra & Mahindra dan Hero. Ducati didirikan pada tahun 1926, dan telah memproduksi sepeda motor sport sejak 1946. Saat ini, Ducati sudah menghasilkan beberapa model seperti Diavel, Hypermotard, Monster, Multistrada, Streetfighter, dan Superbike. Jadi, tak mengherankan jika mereka serius tampil di ajang balap Superbike World Championship dan MotoGP. (kps/int)

NASIB petinju kelas berat Inggris, Dereck Chisora bertambah buruk setelah badan tinju pro Inggris mencabut surat izin bertarung karena menganggap dirinya tak Layak memegangnya. Badan tinju pro Inggris melakukan hal ini setelah Chisora terlibat tawuran menghadapi mantan juara dunia tinju kelas berat asal Inggris, David Haye di Muenchen bulan lalu. “Dereck Chisora dianggap tidak layak untuk memegang surat ijin tersebut,” kata sekretaris jenderal dewan, Robert Smith usai pertemuan di Cardiff yang juga dihadiri oleh Chisora. “Kami langsung membatalkan surat ijin tersebut dengan waktu yang tak terbatas.” Sebelumnya, Chisora sudah dijatuhi hukuman larangan bertarung oleh dewan tinju dunia (WBC) yang menyebut tindakan Chisora merupakan tindakan terburuk dari seorang (petinju) Profesional. Chisora kalah angka saat menantang juara dunia tinju kelas berat Vitali Klitschko di Muenchen, jerman, bulan lalu. Sebelum pertarungan, Chisora sudah melakukan ulah dengan menampar pipi Vitali Klitschko dan meludahi adiknya, Wladimir. Puncaknya adalah saat ia terlibat pertengkaran dengan Haye yang saat konferensi pers hadir sebagai wakil televisi Inggris. Saat pertikaian, Chisora juga disebut-sebut mengancam akan membunuh Haye. “Dereck Chisora sudah bersikap tidak sesuai seorang profesional dan juga mengecewakan bukan hanya diri dan keluarga, namun juga para pemegang surat (ijin bertarung) yang selama ini bertingkah laku baik,” kata Smith. Dalam pertemuan dengan badan tinju profesioanl Inggris tersebut, Chisora memang menyampaikan penyesalan dan permintaan maafnya. Sementara manajer Chisora, Frank warren sedang mempertimbangkan apakah pihaknya akan mengajukan banding. (kps/int)

„ Dereck Chisora




Chelsea 22(8) 23 12 2 56% 2 0 4

Napoli Tembakan Pelanggaran Tendangan Sudut Offsides Ball Possession Kartu Kuning Kartu Merah Penyelamatan




23(5) 23 8 4 44% 4 0 4



NGGRIS tercatat sebagai negara dengan jumlah klub terbanyak peraih gelar juara Liga Champion. Total ada empat klub asal Inggris yang mampu meraih juara Liga Champion. BERIKUT DAFTAR PERAIH GELAR LIGA CHAMPION: 1. Inggris

: Liverpool, Manchester United,

2. Italia

: AC Milan, Juventus, Inter Milan

3. Jerman

: Bayern Munich, Borussia Dortmund, Hamburg

4. Belanda

: Ajax, Feyenord, PSV Eindhoven

Notingham Forest, Aston Villa








2 Man City







3 Tottenham H







4 Arsenal







5 Chelsea







6 Newcastle U








25 20

Van Persie Wayne Rooney

Bermain di hadapan pendukungnya sendiri, Chelsea yang tertinggal agregat gol 1-3 dari Napoli langsung berusaha mengendalikan permainan. Hasilnya, menit 28 Didier Drogba berhasil membuka keunggulan tuan rumah. Skor 1-0 untuk Chelsea dan bertahan hingga turun minum. Babak kedua

Arsenal Man United


26 23




2 Barcelona

26 18





3 Valencia

26 12





4 Malaga

26 12





5 Levante

26 11





6 Atl Osasuna









32 30

C Ronaldo Lionel Messi

Real Madrid Barcelona


Milan Juventus Lazio Napoli Udinese Roma Inter Catania Bologna Palermo

27 27 27 27 27 27 27 27 27 27

17 13 14 12 13 12 12 9 9 10

6 4 14 0 6 7 10 5 7 7 5 10 4 11 11 7 8 10 4 13

55-22 39-17 42-33 50-28 37-24 40-33 38-36 35-35 29-31 39-44

Chelsea akhirnya bisa menyelamatkan muka Liga Inggris dengan memastikan satu tempat di perempat final Liga Champions. Dan The Blue menjadi satu-satunya tim yang melaju ke fase tersebut setelah 3 dari 4 perwakilan Liga Inggris lainnya sudah lebih dulu tersingkir.

57 53 48 46 46 41 40 38 35 34

baru berjalan 2 menit saat saat John Terry meggetarkan jala gawang lawan dengan sundulan kepalanya yang menyambut umpan dari tendangan sudut, Skor menjadi 2-0. Secara agregat, skor menjadi 3-3 dan Chelsea bisa langsung lolos karena unggul dalam gol tandang. Namun kegembiraan pendukung Chelsea tidak bertahan lama, 7 menit kemudian, atau menit ke 55, Gokhan Inler berhasil memperkecil ketinggalan, skor pertandingan menjadi 2-1 dan agregat kembali menguntungkan Napoli, yaitu 3-4. Menit 75, Frank Lampard kembali membuat pendukung Chelsea bersorak, Lampard membuat gl lewat titik putih menyusul ada pemain Napoli yang menyentuh bola dalam kotak terlarang. Agregat gol pun menjadi 4-4. Hingga pertandingan 2Ă—90 menit waktu normal skor 3-1 untuk Chelsea tidak

lagi berubah. Maka pertandingan pun berlanjut dengan perpanjangan waktu. Perjuangan pasukan Roberto Di Matteo akhirnya terbayar dengan sebuah gol di menit 105, gol yang dicetak oleh Ivanovic, yang juga menjadi gol terakhir di pertandingan ini membuat papan skor menunjukkan angka 4-1 untuk Chelsea. Agregat gol 5-4, dan Chelsea melaju ke babak Perempat Final Liga Champions musim 2011/2012. Dan Chelsea menjadi tim yang terakhir memastikan tempat di Perempat Final, setelah di pertandingan yang berlangsung bersamaan namun lebih dulu selesai, Real Madrid juga melaju ke fase berikutnya berkat kemenangan 41 atas CSKA Moskow. (int)

5. Spanyol

: Barcelona, Real Madrid

6. Portugal

: Benfica, Porto

7. Perancis

: Marseille

8. Skotlandia

: Celtic

9. Rumania

: Steaua Bucurest

10. Serbia

: Red Star Belgrade

JUMAT, 16 MARET 2012

Edisi 226 Tahun IX

15 Pengamen Terjaring SIBOLGA- Sebanyak 15 pengamen jalanan yang kerap mangkal di Jalan Brigjen Katamso terjaring dalam Operasi Cipta Kondisi yang digelar Polres Sibolga Kota, Selasa (13/ 3) malam. Petugas juga menjaring tiga remaja yang sedang nongkrong hingga larut malam di Jalan Kapt Maruli Sitorus, seputaran Lapangan Simaremare yang merupakan tempat rawan. “Ini operasi rutin yang ditingkatkan. 18 remaja terjaring dan dibawa ke Mapolres untuk diberikan pembinaan moril. 15


15 Pengamen..Hal 2

Kaurbin Ops Reskrim Iptu Erwin Tito memberikan pembinaan kepada para pengamen yang terjaring Operasi Cipta Kondisi, Selasa (13/3) malam.


Harga Sembako Sudah Naik Padahal BBM Belum Naik

SIBOLGA- Diduga akan menimbun, sejumlah becak motor dan mobil pickup mondar-mandir mengangkut jerigen berisi bensin dari sejumlah SPBU di SibolgaTapteng. Sementara di pasar tradisional, harga kebutuhan pokok merangkak naik menjelang akan naiknya harga BBM 1 April mendatang. Baca Harga..Hal 2

Harga Sembako


CUACA EKSTRIM: Sejumlah pria bekerja di perusahaan rokok tengah berteduh di rindangnya pohon kelapa di bibir pantai Wisata Indah Sibolga, baru-baru ini. Iklim Kota Sibolga termasuk cukup panas dengan suhu maksimum mencapai 32° C dan minimum 21.6° C. Sementara curah hujan cenderung tidak teratur di sepanjang tahunnya. Curah hujan tertinggi terjadi pada bulan November, sedang hujan terbanyak terjadi pada Desember yakni 26 hari. Namun saat ini cuaca sulit diprediksi. Bisa sangat panas, namun sebentar kemudian hujan.



Beras BJ Kuku Balam Migor Melinda Tomat Cabai Merah

Rp13.000 Rp16.000 Rp10.500 Rp5.500 Rp17.000

SEKARANG Rp15.000 per solup Rp17.000 per solup. Rp11.000 per kg Rp6.000 per kg Rp24.000 per kg

Catatan: Per solup sama dengan 2,5 kg . Sumber: Pedagang Pasar Sibolga Nauli

Nilai Rapor Harus Ada Standar Jika Jalur Tes Tulis SNMPTN 2013 Dihapus JAKARTA- Wacana kebijakan pemerintah untuk menghapus jalur ujian tulis pada Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) 2013 mendatang menuai dukungan. Akan tetapi, dukungan atas kebijakan tersebut harus juga mengedepankan asas keadilan di dalam menentukan penerima jalur undangan. Rektor Universitas Negeri Yogyakarta (UNY) Rochmat Wahab mengatakan, selama ini kriteria dan tingkatan akreditas sekolah juga memengaruhi jumlah siswa yang berhak

mengikuti jalur undangan. “Maka itu, kami mendukung jika memang ujian tulis SNMPTN dihapuskan. Asal semuanya harus men ged epankan fairness,” terang Rochmat di Gedung Kemdikbud, Jakarta, Kamis (15/ 3). Baca

Rochmat Wahab

Nilai..Hal 2

Pengamat Sejarah, Nikolas Simanjuntak

Batak di Mata Penulis Sejarah Asing Itu Seram Dari sejumlah penelitian yang ia lakukan, pengamat sejarah Nikolas Simanjuntak menilai bahwa identitas Batak pada dasarnya bukan diciptakan oleh musafir barat. Namun mereka menuliskan tentang Batak, setelah mendengar dari etnis lain di luar Batak.

Ken Girsang, JAKARTA Hal ini diungkapkan Nikolas Simanjuntak kepada METRO, sebab dari sejumlah buku disebutkan bahwa pada zaman masuknya Inggris dan Eropa ke tanah Nusantara, mereka tidak bisa masuk ke dalam wilayah suku Batak. “Jadi ini yang disebut pendapat orientalis. Artinya orang Baca

Batak..Hal 7

Julia Perez

Duta Sepak Takraw

MESKI sedang galau karena meratapi kisah cintanya yang jauh dari kata beruntung, Julia Perez tetap profesional menjalankan profesinya sebagai seorang artis. Bahkan di tengah kesibukannya sebagai penyanyi, Jupe diutus oleh Menteri Pendidikan dan Olah Raga dan Palu Community menjadi Duta Sepak Takraw. Penembang Belah Duren ini ingin memasyarakatkan olah raga sepak takraw. Pasalnya, sepak takraw kurang dikenal, bahkan kurang diminati oleh masyarakat Indonesia. Ini adalah kesempatan emas bagi Jupe untuk memperkenalkan olahraga tersebut. “Duta sepak takraw, bagaimana membudayakan Baca

Nikolas Simanjuntak


Salah satu SPBU di Kota Sibolga yang masih melayani pembeli dengan menggunakan jerigen. Foto dijepret, Kamis (15/3).

Demo BBM Dilarang Anarkis MENTERI Koordinator Bidang Politik, Hukum, dan Keamanan (Menkopolhukam) Djoko Suyanto menegaskan, seluruh mahasiswa ataupun masyarakat yang ingin menyampaikan pikiran dan pendapatnya dengan melakukan aksi turun ke jalan (demontrasi) dilarang bertindak anarkis. “Kita tidak akan mungkin

melarang pikiran dan pendapat orang sekelompok mahasiwa karena sekarang sudah mulai turun ke jalan. Ini memang merupakan kehidupan demokrasi. Tapi jangan sampai bertindak anarkis dan merusak sehingga mengganggu kepentingan orang lain yang lebih besar,”

Djoko Suyanto


Demo..Hal 2

Terkait SK Penggantian Ketua Fraksi Demokrat

Pengurus Demisioner Tak Boleh Keluarkan SK JAKARTA- Sekretaris Departemen Perbankan DPP Partai Demokrat Achsanul Qosasi menegaskan, ketua dan sekretaris Partai Demokrat yang sudah demosioner, tidak boleh mengeluarkan surat keputusan (SK). Termasuk SK penggantian

ketua fraksi. “Ketua dan Sekretaris Partai Demokrat yang sudah demosioner tidak dibolehkan mengeluarkan SK penggantian,” kata Achsanul Qosasi kepada koran ini di Jakarta, Kamis (15/3). Seperti diketahui, ketua

DPC Partai Demokrat Tapteng demisoner Tuani Lumbantobing dan sekretaris Partai Demokrat Tapteng juga demisoner Hafrul H Tanjung mengeluarkan SK No 06.I/ DPC-PD/TT/II/2012 Baca

Pengurus..Hal 2

Golkar Janjikan Tercepat Tentukan Calon Gubsu

Duta..Hal 7 Leo Nababan

JAKARTA- DPP Partai Golkar berupaya agar bisa cepat memutuskan siapa calon yang akan diusung dalam Pilgubsu 2013 mendatang. Partai beringin rindang itu saat ini sedang dalam proses melakukan survei untuk mengukur tingkat elektabilitas dan popularitas nama-nama kandidat yang sudah beredar

di masyarakat. “Saat ini kita sedang survei,” ujar Wakil Sekretaris Jenderal DPP Partai Golkar Leo Nababan kepada koran ini di Jakarta, kemarin (15/3). Seperti diketahui, partaipartai besar cenderung lamban memutuskan calon yang Baca

Golkar..Hal 7





16 Maret 2012



Harga Sembako Sudah Naik

15 Pengamen Terjaring Sambungan Halaman 1 diantaranya pengamen. Mereka didata dan membuat surat pernyataan tidak akan mengulangi perbuatannya, lalu diperbolehkan pulang,” terang Kapolres Sibolga Kota melalui Kabag Humas Aiptu R Sormin, Rabu (14/3). Operasi tersebut dipimpin KBO Reskrim Polres Sibolga Kota Ipda Meiyen Priyantono. Sasarannya yakni premanisme, minuman keras, senjata tajam, gelandangan dan pengemis, narkoba, kebut-kebutan di jalan raya, serta gangguan kamtibmas. Sejumlah tempat yang dikenal rawan seperti di sekitar Tangga Seratus, Pelabuhan Lama, pinggir jalan Lapangan Simaremare, dan kawasan lainnya di sekitaran Kota Sibolga. “Malam itu petugas juga mengamankan tiga unit sepedamotor yang tidak dilengkapi surat-surat dan yang knalpotnya blong,” timpal Sormin. Diharapkan, operasi rutin mampu menekan prilaku kenakalan remaja di kota berjuluk Negeri Berbilang Kaum tersebut. “Operasi ini bentuk antisipasi terjadinya tindak kejahatan dan gangguan kambtibmas. Didasari keluhan masyarakat soal ‘ulah’ para remaja dan tempat-tempat mangkal yang rawan yang meresahkan,” pungkas Sormin. (mora)

Sambungan Halaman 1 Pantauan METRO di sejumlah stasiun pengisian bahan bakar umum (SPBU) di Sibolga dan Tapteng, pekerja SPBU masih terus melayani penjualan bahan bakar minyak (BBM) menggunakan jerigen. Pembelian itu pun tidak menyertakan surat dari Dinas Perindustrian dan Perdagangan setempat, selaku instansi yang mengawasi. Salah seorang pembeli bensin menggunakan jerigen yang diwawancarai koran ini mengaku surat izin dari Disperindag tertinggal di rumah. “Suratnya tinggal bang, kalau bensin yang saya beli ini untuk kebutuhan nelayan. Bukan untuk ditimbun,” kata pria yang membawa 4 jerigen berisi bensin

dengan betor. Hampir di seluruh SPBU di Sibolga masih melayani pembeli menggunakan jerigen. Ada yang diangkut dengan betor, becak barang, bahkan mobil pickup. Saat dicoba dikonfirmasi, si pengemudi pickup enggan menjawab hendak dibawa kemana bensin dalam jerigen yang diangkutnya itu. Beberapa pekerja di SPBU di Sibolga saat dikonfirmasi terkait penjualan BBM menggunakan jerigen mengakui sudah diimbau pihak kepolisian untuk tidak menjual BBM lebih dari 10 liter. “Tapi imbauan itu diberikan secara lisan kepada kami,” kata pria yang tidak mau dituliskan namanya ini. Terpisah, Aktivis Lembaga Swadaya Masyarakat (LSM)

Kupas Tumpas Sibolga dan Tapteng, Makmur Pakpahan mengatakan pihak SPBU apakah pengusaha atau petugas SPBU terkesan memelihara pembeli BBM menggunakan jerigen. “Apakah pihak pengusaha memeroleh keuntungan dari kegiatan ilegal itu atau petugasnya yang mendapat komisi dari setiap liter pengisian. Ironisnya, pengendara kendaraan bermotor sering terabaikan. Bahkan jalur pengisiannya pun dibagi dua,” tukas Makmur. Bilapun ada toleransi mengutamakan nelayan membeli BBM, Makmur menyarankan hendaknya petugas mengikuti sampai di titik mana pergerakan BBM tersebut. Begitupun, dari pantuan koran ini sampai Kamis (15/3) kemarin, distribusi BBM kepada

Demo BBM Dilarang Anarkis Koran Kebanggaan Orang Tabagsel Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Tapanuli, Metro Siantar, Metro Asahan, Metro Tabagsel) Chairman : Rida K Liamsi Komisaris Utama : Makmur Kasim Komisaris : Kadafi Direktur Utama : Marganas Nainggolan Direktur : Goldien Purba Pengasuh Pemimpin Umum/Penjab/GM : Marganas Nainggolan Wakil Pemimpin Umum : Goldian Purba Pimpinan Perusahaan : Maranatha Tobing Pimred Metro Tapanuli : Alvin Nasution Wapimred Metro Tapanuli : Daniel Simanjuntak Pimred Metro Siantar : Pandhapotan MT Siallagan Pimred Metro Tabagsel : Muhiddin Hasibuan Pimred Metro Asahan : Eva Wahyuni Tim Ombudsman : Vincent Wijaya DIVISI PRODUKSI Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana Metro Tapanuli: Syafruddin Yusuf, Kordinator Liputan Tapanuli: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO SIANTAR Dewan Redaksi:Marganas Nainggolan (ketua), Goldian Purba, Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana Metro Siantar: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Penanggungjawab Event & Bisnis: Jhon Damanik, Redaktur: Pholmer Saragih, Plidewatna, Nurjannah, Assisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba, Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi:Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Redaktur Pelaksana Metro Tabagsel:.., Kordinator Liputan Tabagsel: Borneo Dongoran, Reporter : Parlindungan Pohan (Padangsidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar , (Palas),Mhd Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana Metro Asahan: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Salomo Seven H Malau, Kabag: Ahmad Yasir, Staf Pracetak:Jamaluddin Sinaga, Amiruddin, Hedry Handoko, Jefree Putra, Andre Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kord Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Roy Amarta, Ismail, Efendi Tambunan, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico, Ardi, Erik Departemen Iklan Manager Iklan: Jamot S, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba PERWAKILAN METRO TAPANULI Ka Perwakilan Tapanuli/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah sari, Staf Pengembangan: Zulfiandi, Perwakilan Tabagsel Ka Perwakilan Tabagsel/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran Pematangsiantar : Jalan Sangnawaluh No.24 Komplek Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Pematangsiantar. e-mail : Perwakilan Jakarta: Jalan Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522 Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733

Sambungan Halaman 1 ungkap Djoko di Gedung Kementerian Pendidikan dan Kebudayaan (Kemdikbud), Jakarta, Kamis (15/3). Menurutnya, tidak seluruh mahasiswa menolak atas kebijakan kenaikan harga bahan bakar minyak (BBM). Maka dari itu, pemerintah berkewajiban untuk memberikan rasionalitas yang tepat agar yang menolak kenaikan harga BBM dapat mengerti. “Bukan kami khawatir dengan gelombang demonstrasi yang akan berdampak ketidaknyamanan

masyarakat. Kita akan tetap berikan waktu dan ruang kebebasan bagi mahasiswa yang demo asal jangan menganggu yang lain,” imbuhnya. Djoko menerangkan, meskipun adanya upaya pemerintah untuk mendewasakan pemikiran masyarakat, tetap banyak kalangan cendekiawan yang paham tentang kondisi makro terhadap perkembangan minyak dunia. “Tapi poin pentingnya saat ini, bagaimana kita bisa memberikan suatu pemahaman yang sama dengan kapasitas layaknya kemampuan ibu dan bapak,” imbuhnya.

Pengurus Demisioner Tak Boleh Keluarkan SK Sambungan Halaman 1 tertanggal 7 Maret tentang penggantian Ketua Fraksi Demokrat DPRD Tapteng. Sementara pada Muscab Demokrat Tapteng yang digelar 18 Februari di Hotel Wisata Indah Sibolga, Sintong Gultom secara aklamasi terpilih sebagai Ketua DPC Partai Demokrat Tapteng. Lebih lanjut diutarakan Qosasi, dirinyajugamengecamlangkahmosi tidak percaya yang dilakukan 23 anggota DPRD Tapteng terhadap Ketua DPRD Tapteng Sintong Gultom. “Mosi tidak percaya dalam parlemen (DPR/DPRD) kita, itu tidak dikenal sama sekali,” ujarnya. Oleh sebab itu, langkah ini menurutnya kemudian, benar-benar menyalahiaturanyangada.Sehingga patut diduga, ada muatan-muatan tertentu di balik hal tersebut. “Karena jabatan Ketua DPRD itu kan ditetapkan oleh partai pemenang pemilu. Jadi kalau pun ada keberatan atau hal lainnya, hal tersebut dapat ditempuh de-

ngan mempertanyakan kepada partai yang bersangkutan,” tambahnya. Melihat kondisi ini, Qosasi semakin curiga, ada apa sebenarnya yang terjadi di Tapteng. Ia khawatir jangan-jangan ini hanya berdasarkan kepentingankepentingan pihak tertentu. “Apalagi kalau memang anggota dewan itu benar-benar selama ini bekerja untuk kepentingan rakyat. Ini tentu sangat aneh. Tapi terus terang saya belum mempelajari benar kasus ini secara mendalam. Cuma pertanyaannya, mosi tidak percaya ini karena kepentingan mereka atau kepentingan rakyat? Sekali lagi saya tegaskan, mosi tidak percaya sama sekali tidak dikenal dalam parlemen kita,” ungkapnya yang menyatakan hal seperti ini memang beberapa kali pernah terjadi di daerah. Namun dapat diatasi hanya di tingkat daerah tersebut. Seperti diberitakan sebelumnya, sembilan Ketua DPAC PD Tapteng juga menyatakan keberatannya terkait surat pengajuan DPC Demokrat Tapteng yang ditandatangani Ketua DPC PD Tapteng

NAFAS BERAT KARENAASMAKINI SEMBUH DENGAN SUSU MILKUMA Hariyem, w a r g a Bakalan, T a m a n Agung, Muntilan, J a w a Tengah kini tak lagi merasakan derita sesak nafas. Ternyata, sudah 4 bulan ini ia minum Milkuma, minuman serbuk susu etawa yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu etawa segar dan gula aren. "Sudah 2 tahun saya menderita asma. Alhamdulillah setelah minum Milkuma, kini saya sudah sehat, nafas berat dan sesak karena asma sudah tidak kambuh lagi." Terang wanita berusia 50 tahun tersebut. Penyakit sesak nafas atau asma telah menjadi salah satu penyakit yang sangat familiar dengan rakyat Indonesia. Ketika asma menyerang, saluran nafas mengalami penyempitan karena hiperaktifitas terhadap rangsangan tertentu, yang menyebabkan peradangan.

Lebih jauh Djoko menambahkan, pemerintah lebih menyarankan agar mahasiswa dan masyarakat lainnya untuk ikut melakukan pengawasan penyaluran BBM di seluruh daerah daripada melakukan aksi turun ke jalan. “Misalnya, mengawasi penyalurannya, apakah tepat sasaran, apakah jumlahnya tidak dipotong oleh lurah dan lainnya? Tindakan ini lebih berguna bagi rakyat miskin dan menyelematkan penderitaannya oleh penyalahgunaan oknum-oknum yang tidak bertanggung jawab,” paparnya. (cha/jpnn)

Penyempitan saluran pernafasan tersebut merupakan respon terhadap rangsangan yang pada paru-paru normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Dengan tubuh yang sehat, kini nenek 1 orang cucu tersebut dapat menjalani aktifitasnya dengan nyaman. Ia pun mengajak orang lain untuk merasakan manfaat susu etawa ini, "Mari kita sehat bersama Milkuma." Ajak ibu rumah tangga tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu etawa. Berbeda dengan susu sapi, sesungguhnya susu etawa memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu etawa pun tidak menyebabkan alergi sehingga aman, dan bermanfaat untuk penderita

asma. Satu gelas susu etawa memasok 20,0% dari nilai harian Riboflavin. Selain itu, mengkonsumsi Milkuma sebanyak 2 gelas sehari bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu etawa bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Milkuma dikomposisikan dengan gula aren sehingga aman bagi penderita diabetes. Milkuma juga sangat dianjurkan bagi perokok baik perokok aktif maupun pasif. Milkuma sudah tersedia di apotek2 juga toko2 obat terdekat dikota anda, atau hubungi, Sumut; 085314072195 / 06191128785. Depkes dengan No. PIRT. 6.09.3328.01.395.

demisioner Tuani Lumbantobing dan sekretarisnya juga demisioner Hafrul H Tanjung perihal penggantian Ketua Fraksi Demokrat DPRD Tapteng. “Surat yang dikeluarkan kedua mantan pengurus partai Demokrat Tapteng itu sama sekali tidak berlaku dan tidak sah,” tegas Ketua DPAC Demokrat Sorkam Barat Parmulaan Saruksuk didampingi Ketua DPAC Demokrat Barus Malau Samosir. Mereka menegaskan, surat dengan No. 06.I/DPC-PD/TT/II/ 2012 tersebut tidak sah. Alasannya, fungsionaris DPC Partai Demokrat Kabupaten Tapteng periode 20062011 sudah demisioner setelah Muscab II berhasil melahirkan ketua terpilih, Sintong Gultom secara aklamasi tepatnya pada 18 Februari 2012 di Hotel Wisata Indah Sibolga. Sekretaris (demisioner) Partai Demokrat Tapteng Hafrul H Tanjung ketika dikonfirmasi METRO melalui ponselnya, Selasa (13/3) malam lalu enggan berkomentar. “No comment ajalah. Nanti jadi malah seperti berbalas pantun pula,” katanya. (gir)

kendaraan roda dua dan empat masih lancar. Namun diperkirakan, seminggu sebelum kenaikan harga BBM, antrean panjang akan terjadi karena stok BBM habis. Sembako Naik Rencana kenaikan harga BBM mulai 1 April mendatang berdampak terhadap harga sejumlah kebutuhan pokok. Seperti di Pasar Sibolga Nauli, Kamis (15/3), harga beras 4 dari Rp235 ribu per kaleng menjadi Rp240 ribu per kaleng. Permaisuri dari Rp12 ribu naik ke Rp13 ribu. Seorang pedagang bermarga Hutagalung di Pasar Sibolga Nauli mengatakan, beras merek BJ naik dari Rp13 ribu menjadi Rp15 ribu per solup (1 solup sama dengan 2,5 kg). Beras kuku balam dari Rp16 ribu menjadi Rp17 ribu per solup. Begitu juga dengan harga minyak goreng merek Melinda dari Rp10.500 menjadi Rp11 ribu per kilogram. Hanya harga gula pasir normal yakni Rp12 ribu per kg. Harga sayuran juga ikut naik. Tomat dari Rp5.500 menjadi

Rp6.000 per kg. Cabai merah dari Rp17.000 menjadi Rp24.000 per kg. “Cuma tomat dan cabai merah yang naik drastis. Bahan pangan lain belum,” tutur R Jotter Simanjorang (31) dan M Betti Situmorang (42), pedagang di Pasar Sibolga). Keduanya mengakui kenaikan harga telah dipengaruhi wacana kenaikan harga BBM. “Pasti itu, sekarang wacana kenaikan BBM oleh pemerintah memicu kenaikan harga,” katanya. Keduanya pun berharap sebelum menaikkan harga BBM, pemerintah terlebih dahulu memikirkan nasip petani dan pedagang. Sebab, kenaikan BBM berpengaruh besar terhadap biaya operasional pedagang, seperti ongkos angkut barang. “Sedangkan terhadap petani, biaya pupuk, bibit, dan racun hama tentu akan ikut naik. Padahal harga jual produk belum tentu naik. Artinya, modal membengkak, sementara hasil penjualan tetap,” kata keduanya. (aris/dungo/tob)

Nilai Rapor Harus Ada Standar Sambungan Halaman 1 Setidaknya, lanjut Rochmat yang juga Sekretaris Panitia Pusat SNMPTN itu, penentuan penerimaan jalur undangan ditentukan dengan melalui evaluasi nilai rapor berdasarkan kriteria sekolah. Dalam hal ini, tentunya pemerintah harus membuat sistem untuk mendukung langkah tersebut. “Nilai rapor siswa itu bisa dibedakan berdasarkan kriteria sekolahnya. Nilai 9 di sekolah bagus, tentu berbeda dengan nilai 9 di sekolah standar,” kata Rochmat. Terpisah, Rektor Institut Pertanian Bogor (IPB) Herry Suhardiyanto mengungkapkan, jika sistem jalur ujian tulis dihapuskan maka jalur undangan akan lebih mampu memberikan akses yang luas bagi semua kalangan untuk masuk ke PTN. “Siswa di daerah akan semakin banyak memiliki kesempatan untuk masuk ke PTN. Bisa dikatakan, ini salah satu bentuk dukungan terhadap perluasan dan pemerataan pendidikan di Indonesia,” tukasnya. Diakui, dengan jalur seleksi nilai rapor dapat dipantau konsistensi kecerdasan siswa sejak semester 1-5. “Sehingga, nantinya dapat diketahui apakah kecerdasan siswa ini hanya digenjot bimbingan belajar demi mengejar kelulusan UN dan SNMPTN atau memang kecerdasan sejak awal,” paparnya. Untuk diketahui, IPB menerima mahasiswa sebagian besar lewat

jalur undangan hingga 63% dan kuota yang diterima dari ujian tertulis SNMPTN hanya 10%. Sedangkan melalui jalur mandiri 10%, dan sisanya 7% melalui beasiswa utusan daerah. Peluang Lebih Besar Rektor Institut Teknologi Bandung (ITB) Akhmaloka meminta kepada pemerintah untuk dapat mengubah aturan mengenai kuota jalur undangan yang berdasarkan tingkat akreditasi sekolah. Ia menyarankan agar sekolah berakreditasi rendah sebaiknya juga diberikan kesempatan lebih besar untuk dapat berpartisipasi dalam seleksi jalur undangan Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) 2013. “Ke depannya sebaiknya PTN juga harus bisa memberikan kesempatan kepada siswa berprestasi di sekolah-sekolah yang non unggulan. Sehingga, kesempatan untuk mengikuti jalur undangan tidak didominasi oleh sekolah unggulan saja,” ungkap Akhmaloka di Gedung Kemdikbud, Jakarta, Kamis (15/3). Jika jalur ujian tulis SNMPTN dihapus, Akhmaloka memastikan peluang bagi sekolah non unggulan akan mendapat kuota jalur undangan menjadi lebih besar. “Misalkan saja, kuota 60 persen dari ujian tulis yang dialihkan ke jalur undangan, maka akan membuka kesempatan yang luas bagi sekolah untuk mendaftarkan siswa-siswa berprestasi di sekolah non unggulan,” terangnya. Untuk diketahui, aturan yang berlaku saat ini, bagi sekolah yang belum terakreditasi hanya diberi jatah lima persen dari jumlah siswa untuk dapat ikut jalur undangan. Lalu sekolah dengan akreditasi C hanya 15 persen, akreditasi B sebanyak 30 persen, sedangkan untuk sekolah akreditasi A paling banyak, yakni 50 persen. “Nah dengan begitu, maka ke depannya sekolah baik unggulan dan non unggulan bisa memiliki kesempatan yang sama. Namun ini belum diputuskan dan masih dalam tahap pembahasan,” jelasnya. (cha/jpnn)





Negeri Wisata Sejuta Pesona

Rusdy Nasution Ambil Formulir ke PKS SIDIMPUAN- Ir H Rusydi Nasution MM melalui kuasanya, Andi Lumalo Harahap mengambil formulir pendaftaran ke penjaringan Balon Walikota dan Wakil Walikota DPD Partai Keadilan Sejahtera (PKS) Kota Psp, Kamis (15/3). Andi Lumalo Harahap datang ditemani Halomoan Harahap, Raul Panggabean, dan Andika Daulay. Mereka tergabung dalam tim kuasa Ir H Rusydi Nasution MM yang saat ini menjabat sebagai Vice President Bank CIMB Niaga Jakarta. Sekretaris Tim Penjaringan dari PKS, Marwan Saleh, mengatakan Rusydi Nasution mengambil formulir pendaftaran melalui kuasanya. Dan diharapkan segera mengembalikan kembali formulir berikut syarat-syarat yang dibutuhkan sesuai dengan apa yang tercantum dalam formulir, secepatnya dalam minggu ini .“Kita masih akan rapat lagi menentukan waktu mulai pendaftaran dan penutupannya, tapi kami harapkan dalam seminggu ini formulirnya segera dikembalikan sekaligus pendaftaran,” ujarnya. Dikatakan Marwan, sudah ada beberapa calon yang datang mengambil formulir ke PKS. Di antaranya Ketua DPRD Tapsel Rahmat Nasution, pasangan Andar Amin Harahap-M Isnandar Nasution, Wakil Ketua DPRDSU Chaidir Ritonga, terakhir Rusydi Nasution. Namun yang sudah mengembalikan formulir sekaligus mendaftar adalah pasangan Andar Amin Harahap-M Isnandar Nasution. Sementara itu Ir Rusydi Nasution MM kepada METRO, Kamis (15/3), melalui telepon selulernya dari Jakarta membenarkan dirinya ikut dalam proses penjaringan di PKS setelah sebelumnya di PD. Ia juga akan melakukan komunikasi dengan partai politik lainnya untuk memantapkan jalan ikut dalam pemilukada Kota Psp ini. (phn)

Anak Rahudman Minta Doa Restu Warga SIDIMPUAN- Pasangan Dedi-Affan meminta doa restu dari warga yang hadir di Tabligh Akbar, mensyukuri 51 tahun ibundanya, Hj Yusra Siregar, di Jalan Bakti PU, Ujung Padang, Kecamatan Padangsidimpuan (Psp) Selatan, Kota Psp, belum lama ini. Acara ini mengundang kaum ibu, tokoh agama, ulama, tokoh adat, dan lainnya. Di sini, merupakan ajang untuk semakin mempererat silaturahmi keluarga besar Dedi Jamisnyah Putra Harahap SSTP MSP dengan masyarakat. Menurut Dedi yang juga anak Wali Kota Medan, Rahudman Harahap, pihaknya sengaja mengundang qori internasional, peraih juara 2 di Teheran tahun 2011, Darwin Hasibuan SPd, untuk memberikan siraman rohani, guna memperkuat iman dan ibadah semuanya melalui, kumandang ayat suci Alquran. Dedi menambahkan, mengambil satu ayat dalam Alquran yang mengandung arti sesungguhnya Allah SWT telah menciptakan manusia dalam bentuk yang sebaik-baiknya. Maksudnya, ucap Dedi, mereka khususnya dirinya sendiri haruslah selalu menghargai dan mengingat jasa seorang ibu yang luar biasa, yang mengubah dirinya dari yang tidak tahu menjadi tahu dan menjadi dewasa. “Mudah-mudahan di ulang tahun ibunda kami Hj Yusra Siregar ke-51 (14 Maret 2012), ibu selalu diberikan kesehatan, kekuatan oleh Allah SWT, dan selalu menjadi ibu yang betul-betul tiada duanya di dunia ini,” ujar putra Rahudman Harahap ini. (neo)

Tapteng Butuh Pustaka Daerah TAPTENG- Kabupaten Tapteng saat ini dinilai sangat membutuhkan Pustaka Daerah. Tujuannya, untuk meningkatkan ilmu pengetahuan dan wawasan masyarakat di setiap kabupaten kota.

„ Personel Satpol PP Pemkab Madina saat mengamankan pengunjuk rasa di kantor Dinas PU Madina Kamis (15/3)

Mahasiswa Desak Bupati Copot Plt Kadis PU bupati. Mereka ingin menemui bupati, namun gagal. Selanjutnya, pengunjuk rasa menolak tawaran berdialog antara perwakilan massa dengan pihak pemkab. Dalam tuntutannya, pengunjuk rasa menyampaikan; penempatan Ir Parlaungan Lubis sebagai Plt Kadis PU Madina sudah tidak sesuai dengan visimisi Bupati Madina, yang siap menjalankan pemerintahan bersih dari kolusi korupsi dan nepotisme (KKN). “Sampai saat ini kami melihat visi-misi mulia itu belum terlaksana, bahkan sebaliknya. Kami memang belum mengatakan Hidayat-Dahlan gagal, namun fakta yang ada banyaknya persoalan di pemerintahan dan masyarakat itu tidak terlepas dari penempatan oknum yang

MADINA- BupatiMandailing Natal (Madina) Hidayat Batubara didesak segera mencopot Parlaungan Lubis dari jatabannya sebagai Pelaksana Tugas (Plt)KepalaDinas(Kadis)Pekerjaan Umum (PU) Madina. Sebab, yang bersangkutan dianggap tidak serius menangani sungai Aek Kitang pasca banjir bandang yang melanda Panyabungan. Desakan ini diteriakkan puluhan mahasiswa yang tergabung dalam Majelis Mahasiswa Muslim Mandailing Natal (M-Four), saat berunjuk rasa selama dua jam di depan Kantor Bupati dan Kantor Dinas PU, Kamis (15/3). Aksi unjuk rasa yang dikoordinatori Faisal Ardiansyah ini, dimulai sekitar pukul 10.00 WIB hingga pukul 12.00 WIB. Massa awalnya datang ke kantor

tidak tepat menempati satuan kerja perangkat daerah (SKPD) di Pemkab Madina,” sebut Ardiansyah. Misalnya, sambung Faisal, Ir Parlaungan Lubis, mantan pejabat Dinas PU Kota Medan sudah pernah bermasalah dengan hukum tindak pidana korupsi. Saat ini malah menjadi pejabat di Madina, bahkan jabatan yang dia duduki adalah jabatan strategis. “Bagaimana jadinya Madina bila pejabatnya mantan terpidana kasus korupsi? Seharusnya Bupati tidak menempatkan orang demikian, karena masih banyak pejabat di Madina yang lebih layak dan lebih mampu untuk menduduki jabatan itu,” katanya. Koordinator Lapangan Adra Syukur, menambahkan, yang

lebih menyedihkan lagi, Plt Kadis PU tidak serius menangani korban banjir, contohnya dalam hal pengerukan sungai Aek Kitang. Padahal, masyarakat (saat ini) sedang khawatir terjadi banjir susulan, mengingat pengerukan sungai yang tak maksimal. Usai berorasi di depan kantor Bupati Madina, massa menuju Kantor Dinas PU. Di sini, beberapa kali massa terlibat aksi dorong dengan pihak keamanan, baik dari Satpol PP maupun petugas dari Polres Madina. MassameneriakiagarParlaungan ke luar dari ruangan untuk menemui mereka, sekaligus mendesak Parlaungan mundur dari jabatannya. Namun, sekitar satu jam kemudian salah seorang staf di Dinas PU keluar menemui pengunjuk rasa.(wan)

Tuntutan Pedagang Dikabulkan SIDIMPUAN- Tuntutan puluhan pedagang di lantai 1 plaza Anugerah Tetap Cemerlang (ATC) kepada pihak manajemen, membuahkan hasil. Pihak manajemen mengabulkanperbaikanairconditioner(AC)dantarifservisdiberikan potongan harga untuk bulan ini. Kesepakatan ini diambil kedua belah pihak Kamis (15/3) setelah Rabu (14/3), para pedagang di lantai satu melakukan aksi demo di pintu depan masuk plaza. Manajer Operasional PT ATC Indra Setiawan, kepada METRO, Kamis(15/3)menerangkan,dalam

mediasi yang dilakukan PT ATC dengan pedagang sudah disepakati. Mekanik sudah mulai memperbaiki AC yang mati. Kemudian, septic tank yang menyebabkan bau menyengat sudah disedot. Soal wahana mainan balon loncat dan kolam di depan pintu masuk plaza tetap beroperasi, karena menambah daya tarik pengunjung. “Kesepakatan sudah kita ambil dengan pedagang. Diputuskan untuk bulan Februari ini biaya cas kita berikan potongan 50 persen, karena AC mati sejak tanggal 28

Januari lalu, sehingga pembayarannya berkurang. Eksalator juga diperbaiki, septic tank juga sudah diperbaiki. Sebetulnya apa yangkitabenahiiniadalahhalyang rutin kita lakukan. Soal wahana mainan tetap akan beroperasi seperti biasa karena keberadaan wahanapermainaninimalahmenambah banyak pengunjung yang datang ke plaza,” jelasnya. Dengan dipenuhinya tuntutan pedagang tersebut, ia berharap ke depan tidak akan lagi terjadi hal serupa. Dan setiap permasalahan yang ada dapat langsung disam-

paikan ke pihaknya, agar bisa segera ditangani secepatnya. “Kitaselakupengelolaakantetap berkomitmen untuk berupaya semaksimal mungkin memberikan pelayanan yang baik kepada para pedagang di plaza ATC dan Pasar Sanggumpal Bonang,” tegasnya. Sementaraitupintumasukyang sempat di ‘segel’ oleh pedagang sudah dibuka. Para pedagang sudah kembali membuka dagangannya setelah sehari sebelumnya tutup dan beraktivitas seperti semula. Dan pengunjung juga datang seperti biasa. (phn)

PPP Adakan Safari Jumat di Sibolga-Tapteng TAPTENG- Untuk memperingati hari jadi yang ke 39, Dewan Pimpinan Wilayah (DPW) Partai Persatuan Pembangunan (PPP) bekerjasama Dewan Pimpinan Cabang (DPC) PPP Tapanuli Tengah dan Kota Sibolga, akan menggelar beberapa kegiatan yang berbentuk pengabdian kepada masyarakat, khususnya umat Islam. Hal itu disampaikan oleh Ketua DPC PPP Tapteng, Abdul Basir Situmeang didampingi Sekretarisnya Guspan Siregar. Dikatakannya, kegiatan tersebut merupakan bentuk kepedulian PPP kepada umat sekali-

gus dalam rangka upaya menjunjung tinggi visi misi partai yang memperioritaskan kepedulian terhadap umat dan selalu konsisten dengan prinsip amar maaruf nahi mungkar. “Adapun nantinya kegiatan yang kita laksanakan mulai Jumat (16/3) hingga Minggu (18/3) mendatang adalah, Safari Jumat sekaligus mengadakan bakti sosial gotong royong di seluruh masjid yang ada di Tapteng dan Kota Sibolga,” terangnya kepada METRO di Sekretariatnya di Pandan, Kamis (15/3) kemarin. Dikatakan Abdul Basir kemudian,

„ Sekretaris dan Ketua DPC PPP Tapteng, Guspan Siregar dan Abdul Basir Situmeang

kegiatan ini untuk umat manusia. Karena itu, PPP yang selalu mendambakan kedekatan partai dengan masyarakat, bertekad akan terus berbuat kebaikan dengan mengutamakan kepentingan masyarakat luas, salah satunya dengan melaksanakan kegiatan yang mengabdi pada mayarakat. “Inilah yang akan kita bangun dari saat ini, karena umat begitu sangat memerlukan kegiatan-kegiatan yang menyentuh dan bermanfaat seperti ini. Jangan karena ada kepentingan, baru kita peduli kepada umat. Kita harus sadar bahwa PPP


PENGUMUMAN NOMOR : PENG- 04/WPJ.26/2012 TENTANG REGISTRASI ULANG PENGUSAHA KENA PAJAK TAHUN 2012 Dalam rangka meningkatkan pelayanan, penertiban administrasi, pengawasan dan untuk menguji pemenuhan kewajiban subjektif dan objektif Pengusaha Kena Pajak (PKP), dengan ini diberitahukan kepada seluruh Pengusaha yang telah terdaftar sebagai Pengusaha Kena Pajak (PKP) bahwa: 1. Kantor Pelayanan Pajak Pratama di Lingkungan Kanwil Direktorat Jenderal Pajak Sumatera Utara II sedang melaksanakan Kegiatan Registrasi Ulang untuk seluruh Pengusaha Kena Pajak Terdaftar. 2. Pengusaha Kena Pajak (PKP) adalah para pengusaha yang bergerak di bidang usaha industri, perdagangan dan jasa yang wajib memungut Pajak Pertambahan Nilai (PPN) atas barang dan/atau jasa yang mereka serahkan/ jual dengan omset satu tahun lebih dari Rp. 600 juta. 3. Jangka waktu pelaksanaan Registrasi Ulang Pengusaha Kena Pajak dimulai sejak Pebruari 2012 sampai dengan 31 Agustus 2012. Demikian disampaikan untuk diketahui. Pematang Siantar, 13 Maret 2012 Kepala Kantor, Ttd

Harta Indra Tarigan NIP. 195808251980121001

lahir dari rahim empat partai politik Islam pada tanggal 5 Januari 1973. Jadi PPP memiliki beban moril sebagai penerus estafet empat partai Islam dan wadah penyelamat aspirasi umat Islam,” tambahnya. Abdul Basir Situmeang juga menyampaikan bahwasanya kegiatan Safari Jumat diseluruh masjid di wilayah Tapteng dan Kota Sibolga sekaligus gotong royong missal di masjid-masjid ini akan dihadiri secara langsung oleh Ketua DPW PPP Sumut yang juga merupakan anggota DPRD Sumut, H Fadly Nurzal S Ag.(ahu/nasa)

Yang mana, di Pustaka Daerah tersebut nantinya akan disediakan ratusan hingga ribuan buku dari segala macam bidang ilmu yang bisa dinikmati dan dimanfaatkan oleh masyarakat umum. Menurut beberapa pelajar, Kamis (15/3), mereka sudah sejak lama mendambakan Pustaka Daerah di Tapteng, khususnya di Pandan. Mereka mengaku, selain akan dijadikan sebagai lokasi mencari referensi berbagai macam ilmu pengetahuan, Pustaka Daerah bisa menjadi salah satu lokasi favorit pelajar untuk mengisi waktu luang selepas jam pelajaran. “Kami memang sangat mendambakan adanya Pustaka Daerah di Pandan ini. Apalagi kalau bisa, Pustaka Daerah tersebut dilengkapi dengan banyak judul buku dari segala macam ilmu pengetahuan. Selain nantinya bisa kami manfaatkan untuk mencari referensi tugas sekolah, bisa juga untuk menambah wawasan dengan membaca buku yang kita sukai,” ujar Rudi, Teti, Nur, Susi, Deni dan Andi. Hal senada juga disampaikan salah seorang aktivis, M Ikhsan Siregar yang merupakan Wakil Ketua Forum Sarjana Perintis, Penggerak dan Pemerhati Pembangunan (FORSA P4) Sibolga Tapteng. Menurut M Ikhsan, sebagai sebuah kabupaten kota, sudah selayaknya Tapteng memiliki Pustaka Daerah. Selain bisa dimanfaatkan oleh para pelajar untuk mencari referensi belajar mereka, Pustaka Daerah ini juga bisa dimanfaatkan oleh masyarakat umum. “Di Pandan saat ini terdapat 2 SLTA negeri dan 3 SLTP negeri, serta beberapa SLTA dan SLTP swasta. Jumlah siswanya mencapai ribuan orang. Bila Pustaka Daerah ini ada, para pelajar ini bisa memanfaatkannya untuk lokasi belajar, mencari tugas, menambah wawasan atau sekedar memanfaatkan waktu luang. Dan bagi masyarakat umum, Pustaka Daerah ini juga akan sangat berguna menambah wawasan mereka,” tuturnya Seperti contohnya para petani. Menurut Ikhsan mereka akan bisa mencari dan membaca buku-buku tentang pertanian. Sama halnya juga dengan peternak, nelayan, mahasiswa, pedagang, bahkan tukang becakpun bisa menambah wawasan tentang profesi mereka di Pustaka Daerah ini. “Jadi memang sudah selayaknya, bahkan sudah seharusnya Tapteng memiliki sebuah Pustaka Daerah yang bisa dinikmati masyarakat umum. Kami berharap, adanya Pustaka Daerah ini menjadi salah satu prioritas utama Pemkab Tapteng yang mesti segera disediakan, supaya wawasan masyarakat Tapteng yang selama ini hanya bergantung kepada koran da televisi bisa bertambah,” tukasnya. Terpisah, Plt Kabag Humas Pemkab Tapteng, Iwan RM Sinaga SH saat dikonfirmasi METRO di kantornya mengatakan, Tapteng sebenarnya sudah memiliki Pustaka Daerah, tetapi memang fasilitas dan jumlah buku yang dimiliki masih sangat terbatas serta lokasinya pun kurang strategis, sehingga kurang diketahui, apalagi dimanfaatkan masyarakat. “Sebenarnya Tapteng sudah memiliki Pustaka Daerah, tetapi fasilitas maupun jumlah bukunya sangat terbatas. Pustaka Daerah Tapteng ada di salah satu ruangan di Kantor Bupati Tapteng, yakni di sebelah ruangan Kantor Pertanahan dan Kantor Bagian Ekonomi dan Pembangunan (Ekbang). Memang ruangannya sangat kecil dan agak tertutur, sehingga jarang diketahui, apalagi dimanfaatkan masyarakat. Namun bila ada pelajar, mahasiswa atau masyarakat umum yang ingin mencari maupun membaca buku, silahkan dating ke perpustakaan ini,” pungkasnya.(ahu/nasa)

PNPM-MP di Sipirok Rp3 Miliar SIPIROK-KegiatanProgramNasional Pemberdayaan Masyarakat Mandiri Pedesaan (PNPM-MP) TahunAnggaran(TA)2012diKecamatan Sipirok, akan mengelola dana Rp3 Miliar. Peruntukannya, untukpembangunansarana-prasarana fisik fasilitas umum, dan peningkatan perekonomian masyarakatmelaluisimpanpinjam. Dari 30 desa di kecamatan ini , sebanyak 15 desa ditetapkan sebagai penerima Bantuan Langsung Masyarakat (BLM) PNPMMP TA 2012. Dan dari 10 Kelurahandidaerahyangsama,hanyasatu kelurahan yang memerolehnya. Penetapanitu,melaluiSuratPenetapan Camat (SPC) yang diputuskan atas dasar pelaksanaan Musyawarah Antar Desa PenetapanUsulanatauyangpopulerdisebutMADIIIPNPM-MP2012KecamatanSipirokpadaKamis(15/3). Ke-16 desa penerima BLM ini nantinya ditujukan untuk 11 kegiatan pembangunan sarana pisik dan 11 kegiatan Simpan Pinjam Khusus Perempuan (SPP). Ketua Badan Kerja Sama Antar Desa (BKAD) PNPM-MP Kecamatan Sipirok, Lauddin Siregar SH mengatakan, Kegiatan PNPM-MP TA 2012 Kecamatan Sipirok, akan mengeloladanaRp3Miliar.Perun-


PNPM-Pelaksanaan MAD penetapan usulan PNPM-MP 2012 Kecamatan Sipirok. tukannya, untuk pembangunan sarana-prasarana (fisik) berbagai fasilitas umum, dan peningkatan perekonomian masyarakat melalui simpan pinjam. Fasilitator Tehnik (FT), Rustam HarahapdanKetuaUnitpengelola Kegiatan(UPK),ZainalAbidinSimbolonmengatakan,danatersebut25 persen untuk simpan pinjam, dan selebihnya untuk pembangunan sarana-prasaranafasilitasumum. “Kita harapkan pelaksanaan kegiatanPNPMharuslebihtranparandenganmemungsikanseluruh pelaku-pelaku yang ada dari setiap kegiatan. Hal ini sesuai dengan suratedaranPMDagarhasildansasaran yang akan di capai lebih maksimal dan tepat,” katanya.

Sementara itu Camat Sipirok, Parlindungan Harahap SH dalam arahannya,menghimbauagarpelaku di desa terus memberikan perannyamasing-masing,agarnantinya dana tersebut tidak melenceng dari kegunaan dan tata cara penggunaannya. “Saya lebih menekankan masing-masing pelaku dapat bekerja dengan baik, sesuai fungsinya dan tentunya mengedepankan pengelolaan yang transparan dan baik,” pesan Camat. Hadir dalam acara tersebut Camat, unsur Muspika, FK, FT, BKAD, BPUPK, UPK, PJoK, lurah dan kepala desa, perwakilan pelaku PNPM di desa se-Kecamatan Sipirok. (ran/mer)




Maret 2012





Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter.

Para penyidik KPK adalah perpanjangan tangan banyak pihak yang berkepentingan untuk dilindungi. Semua orang tahu penyidik dari kepolisian dan kejaksaan tidak semuanya bersih.

Sikap Kami Jangan Biarkan Abraham Sendirian EKSISTENSI Komisi Pemberantasan Korupsi (KPK) benar-benar diuji. Hantaman bak gelombang datang dari segala sisi untuk melemahkan institusi pemberantas korupsi yang paling dipercaya rakyat itu. Lepasdarimasihadanyakekurangandankelemahan,KPK harus diakui merupakan garda terdepan paling menjanjikan untuk memerangi para koruptor di Republik ini.Taring KPK punsemakintajamsetelahbergantipimpinanyangdikomandoiAbrahamSamad. Namun, bukan berarti KPK aman dari rongrongan. Semakin garang mereka memberangus koruptor, semakin besar pula perlawanan yang datang. Segala jurus dan segala cara dilancarkan pihak-pihak yang ingin KPK lunglai. Mereka tidak ingin KPK semakin tangguh dan berwibawa. Dari pihak luar, misalnya, kini Komisi III DPR gencar menggodok revisi Undang-Undang Nomor 30 Tahun 2002 tentang KPK. Komisi III sampai studi banding ke luar negeri, padahalmerekahendakmemeretelikewenanganKPK.Kelak dengan undang-undang hasil perombakan, KPK lebih banyak berurusan pada pencegahan, bukan penindakan. DPR yang ikut melahirkan KPK pada 2003 kini bernafsu menjadikan anak kandung mereka itu macan ompong. Ironisnya, ketika perlawanan dari luar semakin kencang, KPK justru diguncang perpecahan di dalam. KPK bergolak kala sejumlah penyidik dari kepolisian memprotesAbraham Samad,Selasa(13/3).MerekaberdalihpimpinanKPKmemulangkan secara sepihak penyidik ke institusi asal, yakni kepolisian dan kejaksaan. GejolakyangmenghantamKPKitujelasmemprihatinkan. Ketika pimpinan tak lagi akur dengan penyidik, ketika penyidik mulai membangkang kebijakan pimpinan, kiamatlah KPK.Gejolakyangmeletupsekaligusmembuktikanadanyamasalah menyangkutprofesionalitaspenyidikKPKakibatsistemrekrutmen yang tidak independen. Keberadaan penyidik dari kepolisian dan kejaksaanberpotensimemunculkandualismekepatuhansekaligus menodaiintegritas. Mereka yang bukan organ resmi KPK juga rawan pengaruh busuk dari luar. Tak mengherankan jika tuduhan miring terlontar bahwa penyidik KPK belum steril dari keberpihakan. Itulah yang antara lain memaksa kepengurusan Abraham Samad memulangkan beberapa penyidik ke institusi masing-masing.Untuk menghadapi koruptor yang punya modal mahabesar, baik uang maupun kekuasaan, KPK mutlak membutuhkan kekompakan, ketegaran, dan independensi. Tanpa ketiga kualitas itu, KPK ibarat David yang tak berkutik melawan Goliath dalam perang besar menghadapi koruptor. Untuk mencapai ketiga kualitas itu, tidak bisa lain KPK harus memiliki penyidik sendiri, yang memang direkrut dan dididik khusus untuk KPK. Bukan penyidik pinjaman, apalagi titipan jaksa dan polisi, yang kemudian protes keras karena dikembalikan KPK ke markas mereka. Kita dukung keberanianAbraham Samad mengembalikan beberapa penyidik ke institusi masing-masing. Lebih dari itu, jangan biarkan pemimpin KPK itu sendirian menghadapi rongrongan dari luar maupun dari dalam.(***)

Pengamat Politik UI Iberamsyah, Kamis (15/3)

Pailit Minyak Negeri Otopilit Peraih nobel ekonomi, Joseph E. Stiglitz di dalam bukunya Making Globalization Work (2006), mengilustrasikan sumber daya alam (SDA) yang berubah menjadi kutukan (resource curse) layaknya seseorang menemukan “berlian� di tengah ruangan.

Oleh: Jusman Dalle Rasa berkelimpahan mengkooptasi imajinasi, kreatifitas dan inovasi sehingga ia tak mampu mengolah apa yang dimilikinya. Tak mampu memberi nilai tambah (add value) menjadi perhiasan yang lebih berharga dan eksklusif. Dan itulah yang dipergunakan terus menerus. Ilustrasi tersebut sangat relevan dengan bangsa kita. Melimpah sumber-sumber energi dengan beragam varian seperti gas alam, panas bumi, batu bara, uranium, dan minyak, namun tak mampu menyelamatkan Indonesia dari krisis energi, utamanya bahan bakar. Bahan baku yang kita miliki telah dieksploitasi, dilelang kepada asing tanpa diberi nilai tambah hingga dihargai murah. Indonesia menjadi negeri yang hampir pailit. Indonesia dan beberapa negara berkembang di Asia serta Afrika, menurut Stiglitz tak menikmati kekayaan alam negaranya. Dalam perspektif berbeda, Ian Bremmer (2011) menuding kapitalisme negara (state capitalism) sebagai biang keroknya. Karena negara dikelola layaknya korporasi (korporatokrasi), semua kebijakan berpatron pada termin bisnis. Logika untung dan rugi yang bermuara pada kepentingan kapital penguasa. Artinya, kekayaan sumber daya alam dilihat sebagai

komoditas. Penulis berkeyakinan, jika rencana menaikkan harga BBM (utamanya premium) sebesar Rp1.500 per liter benar-benar direalisasikan, maka mudharat yang dituai akan lebih besar dari pada manfaatnya yang diraih. Untuk jangka panjang, hanya akan membebani ekonomi masyarakat. Telah menjadi cerita klasik setiap kali kenaikan harga BBM, maka semua harga kebutuhan masyarakat ikut tergerek naik. Baik itu karena memang kebutuhan tersebut berkorelasi dengan kenaikan biaya transportasi, ataupun hanya ulah nakal para spekulan yang memanfaatkan kesempatan meraup untung. Naiknya harga BBM berdampak ganda (multiple effect). Dalam kalkulasi ekonomi, meminjam data Reforminer Institute, kenaikan BBM bisa menyebabkan tambahan inflasi hingga 2,14 persen (menjadi sekitar 7 persen). Inflasi sudah barang tentu menggangu performance ekonomi nasional. Daya beli masyarakat menurun sebagai akibat dari naiknya harga-harga barang. Permintaan (demand) pasti ikut terkoreksi sehingga income industry barang dan jasa terkait, mengalami penurunan. Efeknya, untuk efisiensi dan menghindari over stock, industri terpaksa menurunkan produksi mereka. Hal ini tentu menyebabkan berkurangnya kebutuhan dan permintaan tenaga kerja sehingga bisa berakibat pada pemutusan hubungan kerja (PKH) dan moratorium penerimaan tenaga kerja yang berarti masalah sosial baru, pengangguran. Lebih jauh, menurunnya income perusahaan juga berpengaruh pada penerimaan kas negara dari sektor pajak. Angka kemiskinan juga semakin bertambah seiring limitasi akses masyarakat pada faktorfaktor produksi yang menyebabkan produktifitas mereka menurun. Kelompok penduduk kategori hampir miskin yang berjumlah 27,8 juta jiwa akan terseret ke jurang kemiskinan. Selama ini kelompok penduduk hampir miskin bertahan dari jerat kemiskinan dengan mengandalkan pekerjaan pada sektor non formal. Padahal, kenaikan harga BBM

justru akan memukul sektor non formal ini (selain menyebabkan harga-harga naik). Menurut BPS, pangan dan rokok berperan besar dalam memengaruhi kemiskinan di Indonesia. Kenaikan harga beras menyebabkan penduduk miskin bertambah sebesar 25,45% untuk perkotaan dan 32,81% di pedesaan. Artinya akan ada orang miskin baru di negeri ini yang diakibatkan oleh kebijakan tak pro rakyat, menaikkan harga BBM. Sementara kompensasi dalam skema bantuan langsung tunai, tidak efektif untuk meringankan beban rakyat. Bantuan Langsung Sementara Masyarakat (BLSM) sifatnya jangka pendek, tak mungkin terus menerus diterapkan. Pemberian kompensasi bahkan justru menjadi sketsa paradoks kebijakan kenaikan BBM yang tujuan awalnya untuk menyelamatkan anggaran dari pembengkakan. Berikut penjelasannya. Dari hasil simulasi Society Research and Humanity Development (SERUM) Institute Jika kompensasi kenaikan BBM diberikan kepada 29,89 juta jiwa penduduk miskin dan 27,8 juta jiwa penduduk hampir miskin masingmasing sebesar Rp150.000,00, per bulan sebagaiamana dikatakan Menteri ESDM, maka negara harus merogoh aggaran sebesar Rp8,65 triliun setiap bulan atau sebesar Rp103,8 triliun setiap tahun. Jikapun pemerintah hanya memberikan per kepala keluarga, sangat tidak masuk akal Rp150.000,00 cukup memenuhi kebutuhan 4 orang anggota keluarga dalam sebulan. Salah seorang rekan yang menjadi petugas lapangan di daerah Depok dalam pendataan dan penyaluran BLSM mengatakan bahwa pemerintah menemukan data, jika di daerah Depok untuk kebutuhan non pangan seperti transportasi, listrik dan pemukiman standarnya sekitar Rp56,000 perhari. Sementara untuk kebutuhan makanan pokok sebesar Rp6.000 per hari per orang. Artinya setiap orang membutuhkan Rp62.000 per hari atau Rp1.860.000 perhari. Jikapun pemerintah memberi kompensasi dengan hitungan per kepala sebesar Rp150.000, selain tidak rasional memenuhi kebutuhan hidup masyarakat, juga akan lebih boros ketimbang mempertahakan harga (subsidi) BBM pada harga saat ini. Karena menaikkan harga minyak sebesar Rp. 1.500,00 per liter hanya menghemat Rp57,45 triliun. Tidak efektifnya kebijakan kompensasi juga disebabkan oleh potensi korupsi yang membayangi karena buruknya birokrasi kita. Bahkan, kompensasi tersebut juga hanya menjadi alat pencitraan politik penguasa jelang pemilu 2014. Partai berkuasa memanfaatkan mencitrakan diri sebagai partai pro rakyat. Kebijakan tersebut juga tak menyelesaikan akar persoalan. Ketika kali ini pola serupa masih ditempuh, maka tak menutup kemungkinan di waktuwaktu mendatang kita akan kembali bergelut dengan masalah serupa karena kebijakan yang diambil tidak solutif dan tidak menyentuh akar masalah. Kebijakan menaikkan harga dan kompensasi sifatnya jangka pedek (short term policy). (***) Penulis adalah Pengurus Pusat Kesatuan Aksi Mahasiswa Muslim Indonesia (KAMMI)

Sangat mungkin bagi mafia pajak untuk bermain dalam pengadilan pajak. Posisi pengadilan pajak yang berada di kompleks Kemenkeu membuat kemungkinan mafia pajak tumbuh subur.

Anggota Komisi III DPR RI Nudirman Munir, Kamis (15/3)

Izin kepada PT Merpati Nusantara Airlines untuk membeli pesawat dari China belum diberikan untuk membeli pesawat baru sebab tidak realistis. Saya tekankan realistis saja, memperbaiki perusahaan saja. Pesawat rusak diperbaiki dan dalam waktu merpati sudah dapat 4 pesawat jet miliknya sendiri.

Menteri BUMN Dahlan Iskan, Kamis (15/3)

Pemerintah menunda kenaikan tarif dasar listrik sebesar 9 persen dan akan mengajukan subsidi menjadi Rp43 triliun dan saat ini menunggu keputusan DPR.

Menteri ESDM Jero Wacik, Kamis (15/3)





Maret 2012


Diolok, Bocah 5 Tahun Potong Rambutnya LONDON - Rean Carter, bocah berusia lima tahun tidak pernah memotong rambutnya sejak dia lahir. Akhirnya, karena kondisi rambutnya yang sudah terlalu panjang, Rean harus memotong rambutnya. Teman-teman Rean selalu mengoloknya sebagai anak perempuan. Rambut Rean pun harus dipotong sebab rambutnya itu sangat panjang dan ikal.

„ Rean Carter

Anak itu pun meminta untuk menggunting rambutnya, setelah dia merasa tidak nyaman karena selama ini orang-orang selalu menganggap dia sebagai anak perempuan. Ibunya yang bernama Leeanne Smith sempat menangis saat rambut anaknya digunting. “Ketika Rean lahir, dia sudah memiliki rambut yang ikal berwarna keemasan. Saya tidak pernah ingin mengguntingnya, walaupun hanya merapihkan poninya. Sekarang rambut itu tumbuh sampai ke punggungnya dan saya kira itu sangat luar biasa indahnya,” ujar ibunya, Kamis (15/ 3). Lebih lanjut Leeane menambahkan, ketika mereka berpergian, anaknya selalu dikira sebagai anak perempuan. Orang-orang sering mengatakan ‘Wah, dia sangat cantik’. “Saat dia masuk sekolah, rambutnya harus diikat kebelakang agar terlihat lebih rapih. Sayangnya, temanteman mulai mengolok-oloknya dan mereka tidak ingin bermain bersamamanya,” imbuhnya. (oz)

moyang kita membuat lampu yang bisa terus menyala hinga selama itu? Misteri itu masih tetap merupakan misteri yang pelik akan tetapi sejumlah ahli masih terus berusaha untuk menyelesaikan masalah ini. Beberapa orang diantara mereka seperti Briggen, mengemukakan pendapat bahwa tenaga yang digunakan untuk menyalakan lampu itu adalah sangat mungkin telah hilang dari permukaan bumi ini. Akan tetapi, tidak ada bukti yang menguatkan teori-teorinya itu. Orang pintar seperti apa yang membuat lampu yang tetap terus menyala hingga 1.500 tahun. (int)

INGGIRISAndreas Panayiotou memiliki kerajaan properti senilai 400 juta poundsterling (Rp 5,5 triliun) dan menduduki peringkat 200 orang terkaya di Inggris. Tapi, dia membuat pengakuan mengejutkan. “Saya tidak bisa membaca,” katanya. Ayah lima anak itu bukannya tidak mau belajar membaca. “Waktu kecil saya berusaha keras agar bisa membaca,” kata lelaki 45 tahun itu. Dia memutuskan berhenti sekolah pada umur 14 tahun. Di luar masalah disleksia , Panayiotou tak membantah bahwa dia benci membaca waktu masih kecil. “Jadi setelah dewasa saya punya cara tertentu untuk menghindarinya. Jadi dia memiliki trik khusus untuk mengakali kelemahannya itu. “Saya memiliki daya ingat yang luar biasa, photographic memory. Saya mengenali bentuk untuk mengenali sebuah kata, tanpa perlu bisa membaca,” ujarnya. Di jalan misalnya, selain menghapalkan tanda lalu lintas, dia menghapalkan bentuk kata nama jalan ataupun nama kota. Sayangnya, trik itu tidak berlaku pada setiap hal.

“Kalau ada nama belakang baru yang saya tidak mengenali, saya tidak mungkin bisa. Begitu juga dengan mengisi formulir seperti paspor. Itu area terlarang saya,” ujar lelaki yang pernah menjadi petinju itu. Meskipun memiliki kekurangan seserius itu, dia berhasil membangun sebuah kerajaan bisnis yang mengagumkan. Di usia muda, anak imigran Yunani itu membeli sebidang tanah kecil di Islington. Pelan-pelan dia membangunnya menjadi gedung apartemen. Dari situlah bisnisnya berkembang. Pada tahun 2007, dia berhasil menjual ribuan rumah. Kini fokusnya beralih ke hotel. Perusahaannya, The Ability Group, kini memiliki tujuh hotel. Yang paling gres adalah Hotel Waldorf-Astoria London senilai 70 juta poundsterling (Rp 979 miliar). Dia juga akan menjual “rumah termahal di Inggris”, sebuah properti yang baru direnovasi di Hamstead. Dia berharap rumah itu laku dengan harga 100 juta poundsterling (Rp1,3 triliun). Rumah pribadinya di Epping Forest seluas 8 hektare. Dia juga memiliki tiga pesawat pribadi

dan sebuah kapal pesiar. Dia yakin kesuksesannya adalah gara-gara disleksia karena dengan kekurangannya itu, dia harus melatih diri untuk bekerja lebih keras dibandingkan orang lain. “Semuanya, dorongan kuat untuk membuktikan bahwa saya berarti, kedisplinan yang sangat ketat, dan kebanggaan atas yang sudah saya capai merupakan hasil dari perasaan malu dan kurang yang saya alami karena tertinggal dibanding anak-anak lain yang bisa membaca,” Panayiotou mengaku. Dengan membalik disleksia, Anda berhasil mengembangkan bakat lain. Saya melatih pikiran agar memiliki daya ingat kuat. Kita jadi lebih kreatif dalam menyelesaikan masalah karena pikiran kita dipaksa bekerja untuk memahami yang terjadi di sekitar kita.“Pikiran kita selalu berusaha, berusaha, dan berusaha. Kita jadi lebih kuat karena belajar mengatasi masalah merupakan bagian dari kehidupan,” tuturnya. Panayiotou kini terlibat aktif dalam kampanye untuk mengatasi buta huruf. “Kemampuan membaca merupakan hal pokok seperti makan,” katanya. (int)

Greenberg Rela Habiskan Rp9,1 Juta (int)

MIRIP : Potongan batang pohon tergambar wajah Alien di Swindom.

Wajah Alien Ditemukan di Batang Pohon SWINDOM : Ken Dobson (80) sangat terkejut setelah melihat wajah mirip mahluk luar angkasa alias alien, saat ia sedang memotong kayu di kebun. Mahluk luar angkasa yang akrab dikenal dengan sebutan ET (extra-terrestrial) yang ditemukan Dobson, memiliki mata besar, dan seakan sedang memelototinya. Jika diperhatikan, urat kayu dari batang pohon besar itu menyerupai karakter utama dari film Steven Spielberg, yakni ET, yang dirilis pada 1982 silam.

„ Dave Greenberg


MENYALA: Sebuah lilin yang menyala di Australia

Kaya Tapi Tak Bisa Membaca

Demi Temukan Cinta Sejati

Lilin Menyala 15 ABAD AUSTRALIA: Seorang sarjana Australia Robbert Briggen, berpendapat bahwa manusia jaman prasejarah itu memiliki intelegensi yang lebih maju daripada ilmu pengetahuan yang kita miliki karena mereka memiliki lampu-lampu abadi. ”Pada bulan April 1485 mayat seorang gadis bangsawan dari zaman Yunani Kuno dikeluarkan dari tempat perkuburannya di “Appian Way”. Ketika para penyelidik memasuki tempat pemakamannya, mereka terkejut menemukan sebuah lampu yang menyala sejak 1.500 tahun yang lalu. Pertanyaannya adalah dengan cara apa para nenek

„ Andreas Panayiotou

MASSACHUSSETTS Umumnya banyak orang rela melakukan apa saja demi mendapatkan cinta sejati mereka. Termasuk salah seorang pria pemilik toko bunga di Massachusetts, Amerika Serikat, ini. Pemilik Toko Bunga Main Street Florist di Watertown, Dave Greenberg, mengatakan, dirinya telah mencetak kartu nama dan membuat sebuah situs yang diberi nama untuk mencari belahan hatinya. Greenberg pun menjanjikan akan memberikan imbalan sekira USD1000 atau Rp9,1 juta (Rp9.165). ”Pada akhirnya mereka yang berhasil mempertemukan saya dengan jodoh saya,

akan mendapatkan hadiah berupa uang tunai. Mereka juga akan menjadi tamu kehormatan di pesta pernikahan saya nantinya,” ujar Dave Greenberg, Rabu, (14/3). Ketika disinggung tentang kriteria perempuan idamannya, Greenberg mengatakan dia mencari sosok perempuan yang berusia di atas 50 tahun dan bersedia tinggal dengannya di San Diego. ”Saya hanya ingin bertemu dengan sosok perempuan yang baik. Kami harus memiliki kecocokan dan ketertarikan secara fisik. Saya percaya ini dibutuhkan dalam pernikahan,” ujar Greenberg. (oz)

”Aku memotong kayu ini dengan gergaji mesin. Saat saya dan istri membersihkan kayu itu, kami kaget, karena ada wajah ET di sana. Saya kagum, kemiripan itu benarbenar luar biasa,” ujar Dobson yang tinggal bersama istrinya, Janet di Swindon, Wiltshire, Inggris, Kamis (15/3) Ia mengatakan, pihaknya telah memotong kayu selama bertahun-tahun, dan kami tidak pernah menemukan hal seperti ini sebelumnya. Kayukayu yang dipotong Dobson

rencananya untuk dipakai sebagai kayu bakar. Namun, setelah menemukan ‘wajah’ ajaib itu, Dobson mengurungkan niatnya. “Kami tidak akan membakarnya,” cetus Dobson. Film ET menjadi film paling sukses sepanjang masa. Rekor itu dipegang selama 10 tahun. Ini merupakan peringkat film fiksi ilmiah terbesar yang pernah dibuat. Film ini dirilis ulang pada 1985, dan kemudian dirilis lagi pada 2002, untuk merayakan ulang tahun film ini yang ke-20. (int)

Ensiklopedia Britanica Beralih ke Online JORGE CAUZ : Setelah 244 tahun, perusahaan Encyclopaedia Britannica memutuskan untuk berhenti menerbitkan edisi cetak buku buku referensi ensiklopedia. P e r u sahaan itu akan fokus pada ekspansi digital ditengah meningkatnya kompetisi penyedian dari situs internet penyedia referensi seperti Wikipedia. Perusahaan, yang dulu

menjual buku ensiklopedia dari pintu ke pintu, sekarang lebih banyak memperoleh pendapatan dari penjualan online , hingga 85 persen. Beberapa waktu lalu, versi digital dari ensiklopedia untuk komputer tablet diluncurkan. “Penjualan buku ensiklopedia selama beberapa tahun ini menurun,” kata Presiden Encyclopaedia Britannica Jorge Cauz,” ujarnya. Perusahaan diseluruh dunia telah mencoba untuk meningkatkan kehadiran mereka di dunia internet melalui penjualan online yang memiliki pangsa pasar yang berkembang.

Sejumlah suratkabar, majalah dan penerbit buku telah memiliki produk online untuk meningkatkan jumlah pembaca yang mengakses informasi dengan menggunakan perangkat teknologi seperti komputer tablet dan smartphones. Kecepatan Britannica mengatakan ketika keputusan untuk memfokuskan pada edisi online dipengaruhi oleh masalah paten, kemampuan untuk memperbaharui isi dalam jangka pendek juga merupakan masalah yang besar. “Edisicetakensiklopediaitusudah usang pada menit ketika anda mencetaknya,” kata Cauz. (kps)



16 Maret 2012



Mantan Peserta Audisi Indonesian Idol Jual Ganja SIANTAR-“Aku terpaksa menjual ganja untuk biaya uang kuliah dan makan, kedua orangtuaku tidak ada lagi,” ucap Satrio Danovan Hutasoit (23) saat diperiksa di Satuan Narkoba Polres Pematangsiantar. Ia dibawa polisi dari rumahnya di Jalan Renville Kelurahan Merdeka, Siantar Timur, Kamis (15/3) pukul 15.30 WIB, karena terbukti memiliki 95 amp ganja kering.

Foto Fando

„ Foto pernikahan Binsar dengan Evalibna br Gurning.

Soal Supir Truk Dipergoki Istri Setubuhi Gadis

Pelaku Diperkirakan ke Sibolga

SIANTAR-Setelah resmi dilaporkan orangtua Bunga (16) terkait perbuatan cabul yang dilakukannya, Binsar Tampubolon (32) ddiperkirakan kabur ke Kota Sibolga. Sedangkan istrinya Evalina Gurning (Lina) (30) merasa sanggup menghidupi kedua putranya tanpa mempersoalkan keberadaan supir truk tersebut. Tak hanya itu, Lina juga berniat melaporkan Binsar dan Bunga yang dianggap sudah menggoda suaminya. Niatnya itu ditegaskan Lina kepada POSMETRO MEDAN (Grup METRO) saat disambangi di kediamannya, Jalan Suka Mulia Kelurahan Tong Marimbun, Siantar Simarimbun, Kamis (15/3). Menurutnya, sebelumnya ia mengingatkan Binsar dan pelajar kelas I SMA swasta Kota Siantar itu untuk tidak macam-macam. Namun keduanya tetap saja tak menggubrisnya. Bahkan di pesan masuk Hp Binsar, selalu saja ada SMS dari nomor Hp Bunga. “Inikan yang namanya selingkuh, yang satu lobangnya, suamiku ya buayanya,” cetus Evalina menanggapi perselingkuhan itu. Bahkan dituturkan pedagang ikan di Pasar Horas ini, setelah beberapa kali memergoki pesan masuk dari nomor HpBunga, ia memberanikan diri menasehati ABG itu di depan orangtuanya. Saat itu juga orangtua Bunga ikut menegur bahkan menjambaknya. Itu dianggap Lina agar Bunga jera. Sedangkan untuk suaminya, Evalina sempat memberi ultimatum akan menggugat cerai Binsar jika saja tetap meladeni SMS dari Bunga. Diakui Evalina, pria yang sudah dinikahinya delapan tahun lalu ini sudah dua kali melakukan hal yang sama. Sehingga bisa dipastikan, saat ini Binsar sudah berada di Kota Sibolga membawa truk majikannya. Pada pertengahan 2010 lalu, Binsar diadukan mecabuli gadis tetangganya di Kecamatan Siantar Marimbun. Beruntung upa-

ya perdamaian dengan keluarga sang gadis direspon baik, sehingga Binsar hanya menginap beberapa minggu di sel. Namun saat itu Evalina terpaksa mengeluarkan uang Rp10 juta untuk biaya ganti rugi. Belum lagi untuk menyelesaikan segala administrasi di kepolisian. “Pengalaman itupun tak dijadikannya panutan, sekarang ya terserah dialah. Ceraipun jadilah, masih sanggupnya aku membiayai sekolah dan kebutuhan anak-anakku,” ujar Evalina. Terpisah, A br Marpaung (39) ibu kandung Bunga, membantah tuduhan Evalina yang menyebut putrinya menggoda Binsar. Sebaliknya, Binsarlah yang diyakini sudah memelet putrinya lewat orang pintar, hingga persetubuhan itu lama baru terungkap. Sebab sebelumnya, Bunga terlihat seperti orang linglung layaknya dihipnotis alias diguna-guna. Pasca terkuaknya aib itu, Senin (12/3) dinihari, br Marpaung langsung membawa putri ke tiganya itu berobat ala kampung atau tradisional. Hasilnya, sejak saat itu Bunga bisa bicara dan menerangkan semua kejadian yang dialaminya bersama Binsar. Malah pertama kali, Binsar mengajaknya bertemu dengan mengirim pesan singkat lewat Hp. Entah mengapa saat itu, Bunga menurut saja diajak dan akhirnya direnggut kehormatannya, tanpa ingat di mana lokasinya. Kasat ReskrimPolres Pematangsiantar AKP Azharuddin mengaku masih mengembangkan penyelidikan dan melayangkan surat panggilan kepada dua saksi. Mereka adalah istri terlapor Evalina br Gurning (30) dan Lilis Nababan (16), kerabat Binsar. “Jika keterangan saksi mengarah pada pembuktian, pasti dilakukan penahanan. Dalam waktu dekat sudah kita proses terlapor,” ujar Azharuddin. (Mag-5/hez)

Pengusaha Warnet Ditabrak Lari SIANTAR-Kecelakaan lalulintas terjadi di Jalan Sutomo Kelurahan Pahlawan, Siantar Timur. Satu unit Honda Astrea Grand BK 2037 TJ yang dikendarai Maranson Damanik (32) berboncengan dengan Ari Simanungkalit (16), keduanya warga Perumnas Batu VI, Simalungun, ditabrak lari mobil Kijang Kapsul BK 1759 DZ, Rabu (14/3) pukul 22.15 WIB. Informasi dihimpun di Tempat Kejadian Perkara (TKP) menyebutkan, saat itu sepedamotor yang ditumpangi pengusaha warnet ini melaju dari Jalan Pantoan menuju Jalan Sangnaualuh, Siantar Timur. Setibanya di persimpangan Jalan Pantoan dengan Jalan Sutomo, mobil Kijang melaju dengan kecepatan tinggi dari arah Jalan Sangnaualuh menuju Pasar Horas. Akibatnya sepedamaotor korban yang hendak menyeberang ditabrak. Usai kejadian, mobil yang belum diketahui identitas supirnya itu tancap gas melintasi Jalan Sutomo. Sedangkan kedua korban ter-

kapar di kanan jalan. Namun sebelum kabur, plat mobil bernopol BK 1759 DZ ini tertinggal di lokasi. Selain itu, bumper depan mobil juga tergeletak di aspal. Warga sekitar dan pengendara yang melintas langsung meramaikan tempat kejadian. Sepuluh menit kemudian, personel Satlantas Polres Pematangsiantar tiba dan melakukan olah TKP. Kedua korban yang mengalami luka ringan, dibawa ke RSUD dr Djasamen Saragih. Sedangkan sepedamotornya diamankan ke kantor polisi. Ari Simanungkalik, mengatakan pihaknya baru pulang memperbaiki CPU Komputer dari kampung karo. “Kami baru pulang memperbaiki CPU komputer di Kampung Karo bang. Saat menyebarang jalan ini, kami ditabrak lari mobil Kijang,” ujar Ari di lokasi. Hingga kini pengemudi mobil yang melarikan diri itu masih diselidiki polisi. (Osi/ Mag-1)


DITANGKAP- Satrio Danovan Hutasoit, mantan peserta audisi Indonesian Idol yang ditangkap memiliki 95 paket kecil daun ganja kering, Kamis (15/3).

Awalnya mahasiswa Amik Tunas Bangsa Kota Pematangsiantar ini diamankan polisi dari salah satu warnet di dekat rumahnya. Begitu dipegang, tersangka sempat berontak dan membantah memiliki ganja. Untuk memperlancar penyelidikan, polisi yang didampingi Lurah Kelurahan Merdeka dan RT setempat menggeledah kediaman Satrio. Akan tetapi saat itu tersangka tetap berteriak dan berontak. Aksinya inipun mengundang perhatian warga yang berdatangan ke lokasi. Setelah seisi rumah digeledah, akhirnya polisi menemukan barang bukti dari sebuah kamar yang dihuni Satrio. Ganja itu didapati dari lemari. Saat ditemukan, daun ganja tampak dibungkus kertas koran yang dalamnya berisi 95 paket kecil siap jual. Untuk mempertanggungjawabkan perbuatannya, Satrio langsung diboyong ke Mapolres Pematangsiantar. Kepada polisi ia menjelaskan, daun ganja itu diperoleh dari temannya bernama Gotto yang sudah ditangkap polisi pada Januari lalu. Ia menambahkan, ganja dibeli Rp500 ribu dari Gotto yang sudah dipanjar Rp200 ribu. Saat dibeli, daun ganja seberat 0,4 kilogram itu masih utuh. Begitu barang haram itu berada di tangannya, tersangka membungkusinya menjadi paket kecil yang siap diedarkan. Saat diperiksa, tersangka mengaku terpaksa menjual ganja karena kesulitan mencari uang. Sementara biaya kebutuhan kuliahnya harus dipenuhi. Selain itu, untuk memenuhi kebutuhannya sehari-hari ia mengaku dibantu

saudaranya. Anak ketiga dari tiga bersaudara ini juga memiliki dua anak kos yang tinggal bersamanya. Uang pembayaran kos itu digunakan sebagai tambahan biaya makan. “Waktu kelas tiga SD ibuku meninggal, sementara ayahku menikah lagi dan tidak memperdulikanku lagi sejak 2008 lalu,” kata pemuda yang memiliki dua kakak perempuan ini. Diceritakannya, untuk menunjukkan talentanya dalam bernyanyi, mahasiswa semester dua ini pernah mengikuti Audisi Indonesian Idol di Medan beberapa waktu lalu. Namun ia hanya tampil sekali dan langsung tereleminasi dan tidak dipanggil kembali. “Waktu audisi itu aku menyanyikan lagu Judika. Tapi pada penampilan keduaku, tidak dipanggil panitia lagi” tambahnya. Kasat Narkoba Polres Pematangsiantar AKP Sofyan menerangkan, penangkapan terhadap Satrio dilakukan berdasarkan informasi yang kerap disampaikan warga kepada polisi. Menindaklanjutinya, polisi melakukan penyelidikan dan akhirnya berhasil menangkap tersangka. “Barang bukti yang kita dapatkan berupa 95 paket kecil daun ganja. Pengakuannya, sebelumnya ia sudah menjual 10 paket seharga 10 ribu perpaket. Bersamaan dengan itu, kita juga mengamankan uang Rp50 ribu, sisa hasil penjualan ganjanya” terang Sofyan. Tersangka dijerat Pasal 114 Ayat 1 subs Pasal 111 Undangundang No 35 Tahun 2009 Tentang Narkotika. (mag-1/ hez)

Niat Kawin Semarga, Pemuda Diamuk Massa

„ Andri Tarigan KABANJAHE-Niat Andri Tarigan (22) warga Desa Tanjung Barus, Kecamatan Barus Jahe, untuk membicarakan pernikahannya dengan sang pujaan hati kandas. Bahkansebaliknya,Andrimalahmenjadisasaran kemarahan warga Desa Dokan, Kecamatan Tiga Panah, dan menerima pu-

kulanbertubi-tubi.Persoalandipicukorban berniatmenikahiwanitasemarganya. Kejadiaan naas ini terjadi Rabu (14/3) sekira pukul 05.30 WIB. Dimana kehadiran serta maksud Andri tidak disukai warga sekitar, mengingat sang gadis tambatan hatinya juga bermarga Tarigan. Di ruang tunggu Mapolres Tanah Karo, Kamis (15/3), Andri mengaku bahwa pertemuan pertamanya dengan R br Tarigan terjadi November tahun lalu di SPBUsimpangDokan.Dariperkenalan itu, mereka langsung tukaran nomor Hp yang dilanjutkan dengan komunikasi. Seiring berjalannya waktu, hubungan mereka masih terus berlanjut tanpa memperdulikan status marga. Bahkan kenekadan Andri ini terjadi atas ucapan sang gadis,Selasa(13/3)lalu.Saatitumerekamemadu janji di Puncak Bukit Gundaling, Brastagi. R br Tarigan mengatakan bahwa ia sangat mencintai korban sehingga tidak ingin berpisah. “Saya sayang sekali sama abang, jangan lagi kita berpisah,” ujar br Tarigan, seperti yang dicontohkan Andri.

Dalampembicaraanserius,merekaberniat melanjutkanhubungankejenjangyanglebih tinggiyaknimahligairumahtangga. Keyakinan akan cinta ini langsung ditindaklanjuti br Tarigan dengan memberitahukan keluarganya. Namun niat mereka ternyata mendapat larangan keras berhubung keduanya masih satu marga. Meski demikian, br Tarigan tetap pada pendiriannyadanberinisiatifmencarijalan keluar dan menemui Rindy, teman dekatnya di Tiga Panah. “Begitu kami bertemu, aku tanya Rindy tentangkeselamatankudilokasi.Tapiwaktu ituRindymengakubertanggungjawabdan akan menjagaku,” tambahnya. Mendengar ucapan Rindy, mereka bertiga berangkat ke Desa Dokan, tepatnya ke kediaman paman br Tarigan. Begitu sampai, mereka langsung mengutarakan niatnyayanginginmenikah.Namun halitu langsung ditolak keluarga sang kekasih. “Karenapembicaraanbuntu,pamannya menyuruh agar kami menghubungi keluargaku di Tanjung Barus agar datang ke Desa Dokan. Tapi sebelum mereka tiba,

massa dan anggota sebuah organisansi pemuda berkumpul dan mengepung rumah itu. Terus mereka mulai berteriak danmeyuruhsayakeluar.Bahkanjikatidak saya lakukan, mereka mengancam akan mematikan saya,” ungkap Andri. Melihatbanyaknya wargayang berkumpul,makaAndrydisembunyikandirumah. Tak berselang lama polisi tiba di TKP. Hadirnya petugas penegak hukum ini membuat warga sepakat untuk tidak menghakimi Andry. Nah mendengar janji warga itu, Andry pun dikeluarkan. Selanjutnya warga mengaku akan membawanya ke kantor kepala desa. Tetapi janji itu tidak ditepati warga. Begitu keluar rumah, pemuda naas inipun dipukuli. Bahkan larangan polis kini tak diperdulikan warga. Selang beberapa menit, polisi akhirnya berhasilmenyelamatkanAndrydanmemboyongnya ke Polres Tanah Karo. “Mungkin kejadian ini akibat hasutan pihak ketiga yang tidak senang,” ujar Andri sambil mengusap wajahnya yang memar. (amr/hez)

Anak Angkat ‘Diangkat‘ Juga SEBAGAI orangtua asuh, kelakuan Faridi (65) sunggguh kebablasan. Mentang-mentang gedenya cantik, Asri (18) si anak angkat pun “diangkat” ke ranjang hotel dan disetubuhi bak istri sendiri. Warga pun terhenyak, karena Faridi ini adalah orang terpandang di daerahnya. Gelarnya itu berbeda dengan gelar ningrat seperti RM alias Raden Mas atau RR = Raden Rara. Sebab pada gelarnya, ada label agama di situ, sehingga siapa yang menyandang gelar, harus punya konsekuensi moral. Perilakunya harus terukur, menjadi panutan dan percontohan lingkungan sekitarnya. Faridi yang tinggal di Banjarharjo Kabupaten Brebes (Jateng), di lingkungannya juga sangat dihormati. Orangnya juga cukup sosial, sehingga sekian puluh tahun lalu, dia sudah memungut anak miskin dan dijadikan anak angkat. Asri, yang jika dalam asuh-

an orangtua kandungnya takkan jadi apa-apa, bersama Faridi semuanya bisa. Paling tidak sekolahnya pun lancar, dan kini sudah duduk di SMA kelas III. Namun ternyata, godaan memang lebih besar. Setan-setan penggodanya dipilih yang kelas berat. Bila orang biasa cukup digoda setan lulusan SD Inpres kelas jauh lagi, penggoda Faridi harus bergelar S2 lulusan Amerika. Maka sejak sianak angkat berangkat remaja dan nampak cantik, setan bergelar master itu mulai mengompori Faridi. “Lihat tuh Bleh, bodinya Asri semakin indah menawan. Kalau aku bukan setan, sudah kupakai sendiri tuh” bujuk si setan. Kala itu yang menggoda Faridi baru setan sarjana lokal, yang skripsinya saja pesan di Prapatan Pramuka, Jakarta. Makanya Faridi tak terpengaruh. Buru-buru kordinator Satgas Penggoda Iman mengirim S2 dari Universitas Berke-

lai. Wih, cara-cara mencuci otak Faridi demikian rapi, sehingga akhirnya ia terpesona pada anak angkat sendiri. Terbukti belakangan Faridi suka mencuri-curi pandang bodi mulus Asrisambil jakun turun naik macam bandul timba konvensional. Awalnya Asri diajak bepergian ke suatu tempat, lalu menginap dalam hotel. Di situlah Farid mulai merayu-rayu si anak angkat. Awalnya Asri menolak, tapi karena diancam takkan dibiayai sekolah, akhirnya dia mau juga “diangkat” ke atas ranjang. Sementara Faridi sibuk menikmati tubuh anak angkatnya, piranti video pun merekam adegan mesum tersebut. InilahkalipertamaAsrimerasakan keganasan lelaki penjahat kelamin atau Sastro Pandelepan kata orang Solo. Lain waktu, Faridi minta lagi. Lagi-lagi Asri berusaha menolak. Tapi begitu diancam dengan video mesum yang pernah direkamnya,

akhirnya si anak angkat bertekuk lutut dan berbuka pada juga. “Ya sudahlah, daripada ketelanjangannya jadi konsumsi publik, mending terus telanjang bersama ayah angkat,” begitu keputusan Asri. Maka sejak saat itu Asri secara rutin menjadi menu kedua bagi Faridi. Lokasinya bisa di rumah sendiri, bisa di dalam hotel. Endog kamal (telur rebus) Brebes bisa tahan sampai enam minggu. Tapi rahasia “endog Asri” bisa lebih lama lagi, sehingga baru

setahun kemudian skandal ayah angkat itu terkuak. Pasalnya lamalama Asri tak tahan juga jadi ajang birahi ayah angkatnya. Kepada ibu kandungnya di Jakarta, dia bercerita bla bla bla.. Nah, orangtua mana yang rela putri kandungnya dirusak masa depannya. Maka Faridi pun dilaporkan ke Polres Brebes dan ditangkap. Saat dicegat pers, ia memilih tutup mulut dengan alasan stress menunggu pemeriksaan. Dulu waktu “angkat” si anak angkat, stres nggak? (pk/int)





Maret 2012



Jelang UN, Kurangi Main Facebook Sambungan Halaman 8 net, agar para siswa dapat lebih tenang dan konsentrasi dalam belajar serta mempersiapkan dirinya. Namun kalau untuk mengetahui informasi yang berhubungan dengan ilmu pengetahuan boleh-boleh saja, namun itupun sebisa mungkin dikurangilah selama menghadapi pelaksanaan UN,” imbuh Syarfi sembari menyarankan agar para siswa membentuk kelompok belajar untuk membahas soal-soal yang berpeluang keluar di UN. Syarfi juga mengatakan pelaksanaan try out ujian nasional ini dimaksudkan untuk mengukur sejauh mana kemampuan para siswa dalam mengerjakan soal-soal UN yang bakal dihadapi para siswa nantinya. “Dengan brgitu, seluruh siswa yang akan mengikuti UN bisa mengetahui sejauh mana kemampuan mereka dalam menghadapi UN yang akan datang. Sehingga mereka (siswa,red) dapat belajar serta mempersiapkan dirinya untuk lebih baik lagi dalam menghadapi UN,” ujar Syarfi seraya mengatakan try out juga membentuk karakter dan mental siswa untuk menghadapi ujian akhir. Syarfi juga berpesan, saat menghadapi UN nantinya agar para peserta tidak terlalu tegang dan usahakan serileks mungkin, namun tetap serius dalam menjawab seluruh soal yang ada. “Jangan terlalu tegang, santai namun serius. Sebab dalam menghadapi ujian tidak boleh terlalu tegang, bila perlu, mana soal yang lebih muda itu dijawab terlebih dahulu, sebab waktu yang diberikan kepada peserta ujian terbatas,” saran Syarfi lantas berharap, dengan dilaksanakannya try out ini dapat meluluskan seluruh siswa SMA sederajat di Kota Sibolga. Sementara itu, Kepala Dinas Pendidikan Kota Sibolga Drs Alpian Hutauruk MPd didamping Kabid Dikdas, Drs Supriono menyampaikan, pelaksanaan try out ini adalah salah satu program Dinas Pendidikan Kota Sibolga dalam rangka mempersiapkan siswa/i kelas terakhir untuk mengikuti Ujian Nasional (UN) dan Ujian Akhir Sekolah Berstandar Nasional (UASBN) tahun pelajaran 2010/2011. “Tujuannya untuk mengukur kemampuan siswa dan juga mensosialisasikan cara pengisian lembar jawaban computer (LJK). Hasil dari try out ini nantinya adalah sebagai bahan masukan kepada pihak sekolah untuk mengambil suatu langkah atau upaya perbaikan,” katanya. Ia mengatakan, sesuai dengan agenda pendidikan nasional, pelaksanaan UN 2012-2013 jenjang Sekolah Menengah Atas, Madrasah Aliyah dan Sekolah Menengah Kejuruan (SMA, MA, SMK) digelar pada 16 hingga 19 April 2012. Sedangkan, UN Sekolah Menengah Pertama, Madrasah Tsanawiyah (SMP dan MTs) digelar pada 23 hingga 25 April 2012 dan untuk tingkat SD digelar 7 hingga 9 Mei 2012 mendatang. “Untuk itulah kita melaksanakan try out di sekolah-sekolah, dan pelaksanaannya kita buat seolah-olah sedang menghadapi Ujian Nasional. Jadi harapan kita saat ini anak-anak sudah dalam persiapan yang penuh dalam menghadapi UN,” ujar Alpian seraya menambahkan jumlah peserta yang mengikuti UN nantinya sebanyak 6733 orang, yang terdiri dari, SD/MI dan Swasta sebanyak 2.479 Orang, SMP/MTs sebanyak 2.222 orang, SMAN/MA dan Swasta sebanyak 1.352 orang, dan SMKN dan Swasta sebanyak 1.499 orang. (tob/nasa)

Warga Miskin Rebutan Beras Sambungan Halaman 8 cewa tidak mendapat jatah, beberapa warga kemudian merampas paksa dua karung beras raskin jatah warga lainnya. Meski akhirnya dibayar seharga Rp87 ribu per karungnya (isi 50 kg,red). Tapi, kedua karung beras itu sebelumnya sudah dibayar oleh warga pemiliknya, namun karena tidak sanggup mengangkutnya, maka dititipkan sementara di salahsatu ruangan di kantor lurah tersebut. Sebenarnya kericuhan pembagian raskin itu sudah terjadi sejak kemarin, Rabu (14/3). Dimana sejak pagi seratusan warga sudah mendatangi kantor lurah setempat untuk menuntut jatah raskin mereka. Kericuhan terjadi karena menurut warga, pembagian raskin tidak merata dan pilih bulu. Sementara itu, Lurah Aek Parombunan Abdul Karim Sihite didampingi beberapa kepala lingkungan, babinsa kelurahan, TP PKK kelurahan, staf dan pegawai kelurahan menjelaskan duduk persoalan pembagian raskin tersebut. “Saya terangkan dari awal. Bahwa sesuai data statistik terakhir pada tahun 2009 lalu, war-

ga penerima raskin di Kelurahan Aek Parombunan sebanyak 358 KK. Kemudian kartu kendali penerima raskin dikembalikan ke Kantor PMK k arena akan diperbaharui. Karena itu pada tahun 2010 lalu saya meminta para kepling mendata warganya yang tidak mampu, menunggu keluarnya data terbaru dari BPS pada Juni 2012 mend atang. Maka dari 8 lingkungan yang ada, didapatlah data warga tak mampu sebanyak 779 KK. Inilah yan g kemudian diasums ikan yang layak mendapatkan raskin,” terang Lurah. Kemudian, sambung Lurah, sebelum pembagian raskin terakhir ini, pihaknya menggelar musyawarah yang mengundang seluruh elemen pemerintah kelurahan dan unsur masyarakat setempat. Dalam musyawarah itu diputuskan dan disepakati, agar seluruh warga tak mampu mendapat jatah raskin, maka 1 karung raskin isi 50 kg seharga Rp87 ribu akan dibagikan kepada 3 KK. Dengan syarat dapat menunjukkan kartu keluarga asli. Pengambilannya di kantor lurah, jadi tidak melalui para kepala lingkungan lagi.

“Jadi setiap jatah raskin datang, kami musyawarah bersama dulu, biar semua terbuka dan transparan. Dalam musyawarah itu diputuskan bagaimana cara pembagian, porsi per KK, harganya dan teknis pembagiannya. Biar berkurang yang penting terbagi merata. Soal harga memang dinaikkan sedikit, bukan untuk apa-apa, melainkan sekedar untuk biaya akomodasi, biaya bongkar, dan makan minum petugas pembagi. Itu pun sudah disepakati bersama, dan kenaikan harga itu dihitung sepantasnya. Kalau harga dari Bulog Rp1.650 per kg,” tutur Lurah. Hanya saja, Lurah tidak menyangka kalau warga yang datang menuntut jatah raskin mereka sejak kemarin membludak. Kata Lurah, kemarin saja (Rabu, 14/3) sudah ada sekitar 900 KK lebih yang dibagikan raskin. Padahal jatah raskin untuk triwulan Maret, April dan Mei 2012 ini hanya 322 karung. Dimana seharusnya per bulan warga penerima berhak menerima 15 kg raskin. “Tujuan kami itu baik. Tidak ada niat mau menggelapkan, atau pun memanipulasi data. Cuma yang in-

Taat Pajak, PNS Harus Jadi Contoh Warga Sambungan Halaman 8 mentara apabila belum memiliki NPWP harus membayar yang nilainya mencapai jutaan rupiah. “Termasuk dalam hal pembiayaan negara sedikitnya 80% dana APBN bersumber dana dari pajak ditambah sumber-sumber dana lainnya seperti Migas, BUMN dan utangan dari luar negeri,” katanya. Wali kota juga mengatakan, kalau semua WP patuh membayar pajak,

petugas pajak jujur melaksanakan tugasnya, serta tidak ada dana yang diselewengkan, maka tidak tertutup kemungkinan, seluruh dana APBN kita dapat dibiayai penerimaan pajak. “Dengan demikian, pada gilirannya nanti, Indonesia tak lagi tergantung dari pinjaman luar negeri,” tandasnya seraya mengajak kembali seluruh wajib pajak segera menyampaikan SPT tahunan tersebut hingga batas waktu yang ditentukan.

Kepala KPP Pratama Sibolga, Marthin Hutabarat SE MM menjelaskan, saat ini masih banyak WP non filler (memiliki NPWP tapi tidak menyampaikan SPT) ditambah masih adanya masyarakat yang menjadi free rider (penumpang gelap yang menikmati fasilitas publik tapi tidak membayar pajak, red). Kondisi seperti ini dikatakannya menjadi contoh ketidakadilan bagi masyarakat yang telah membayar pajak. (tob/nasa)

tisasi dalam aksi ‘kudeta’ terhadap Ketua KNTM Sibolga Nirwan Kamal Chaniago oleh sekelompok anggota melalui sebuah pertemuan yang digelar belum lama ini. Dedi Sutomo menduga, aksi ‘kudeta’ tersebut turut didalangi oleh oknum Kepala Dinas Kelautan Perikanan dan Peternakan Kota Sibolga, Hendra Darmalius. Pasalnya, belakangan ini Nirwan Kamal Chaniago membuat statemen di sejumlah media massa tentang dugaan pekerjaan asal jadi terhadap bangunan TPI Sibustakbustak berbiaya Rp2,2 miliar yang dikerjakan rekanan kontraktor di daerah setempat. “Menurut saya, kritikan yang sampaikan Nirwan tersebut merupakan hal yang wajar, lantaran mereka tidak ingin kecewa akibat proses pembangunan TPI dikerjakan asal jadi,” bilang Dedi kepada METRO, Kamis

(15/3) di Sibolga. Ditambahkan Dedi, proses pemberhentian seorang ketua kelompok tidak semestinya dilakukan melalui sebuah pertemuan dadakan, selanjutnya menyampaikan mosi tak percaya dan langsung main hunjuk pelaksana ketua. “Seyogianya, proses tersebut dilakukan sesuai mekanisme yang berlaku atas dasar musyawarah dan mufakat, setelah masa periodesasi kepengurusan organisasi tersebut berakhir. Menurut saya, semua organisasi akan melakukan hal yang sama sebagaimana diamanatkan dalam anggaran dasar dan anggaran rumah tangga (AD/ART) serta peraturan organisasi (PO) masing-masing organisasi,” ungkap Dedi. Lalu, kata Dedi, kenapa secara tibatiba KNTM Sibolga dilanda kemelut tanpa didasari alasan yang jelas disertai adanya tudingan miring terhadap kepemimpinan Nirwan Ka-

mal Chaniago. “Saya menduga, telah terjadi sebuah konspirasi politik dalam aksi kudeta ini. Karena, tidak mungkin ada asap kalau tidak ada api,” jelasnya. Sebagai mantan pengurus, kata Dedi, dirinyaterusmemantauperkembangan organisasi KNTM Sibolga dibawah pimpinan Nirwan Kamal Chaniago yang menunjukkan grafik pertumbuhan secara positif. Hal itu ditandai dengan dibangunnya Tempat Pelelangan Ikan (TPI) oleh Pemko Sibolga di lahan milik KNTM Sibolga. “Saya juga menduga, Nirwan Kamal Chaniago telah terjebak dalam politisasi birokrasi. Artinya, pada saat TPI Sibustakbustak itu rampung dibangun, maka pada saat itu pula Nirwan sengaja ‘dibuang’ karena sesuatu hal atau kepentingan tertentu,” tegas pria berkacamata yang juga Dewan Presidium Komite Masyarakat Nauli untuk Demokrasi (Komando) SibolgaTapteng itu. (fred/tob/nasa)

pentingnya akurasi data oleh BPS (Badan Pusat Statistik), sebagai acuan pasti. Sebab, sesuai data tahun 2011, jumlah pendduk di Kelurahan Aek Parombunan kini sekitar 10 ribu jiwa dengan 2.415 KK. “Kita tunggu saja Juni nanti kartu kendali penerima raskin keluar. Maka yang berhak mendapat raskin itu hanya warga yang memiliki kartu pengendali sah, kalau tidak punya maka tidak akan dilayani,” tandas Lurah. (mor/nasa)

Ngadu ke Anggota Dewan Sambungan Halaman 8 tah Camat Sibolga Selatan. “Biar didata supaya periode nanti diprioritaskan mendapat jatah raskin berikutnya,” celutuk Irsan Sitompul. Menyikapi keluhan tersebut, Jamil Zeb Tumori menyatakan kondisi ini menunjukkan kalau sistim atau cara pembagian raskinnya kurang tepat. Sekaligus menandakan bahwa tingkat kemiskinan semakin tinggi. Sebagai wakil rakyat, Jamil sendiri merasa ikut bertang-

gungjawab atas persoalan tersebut, dan berjanji akan memperjuangkan hak-hak masyarakat tidak mampu. “Menurut saya pembagian kartu kendali penerima raskin harus segera dikeluarkan. Supaya ada acuan dan sistim atau cara pembagian raskin yang tepat sasaran. Menurut data statistik, warga miskin Sibolga sekitar 6 ribuan KK. Jadi memang dibutuhkan keseriusan pemerintah dalam menanggulangi permasalahan ini,” tutur Jamil. (mor/nasa)

Korban Badai Dapat Bantuan Beras, Mie Instan, dan Telur Sambungan Halaman 8 Sitompul SH yang saat itu didampingi Lurah Sibolga Ilir, Juprayer Sitinjak SE menyebutkan, jumlah bantuan yang diberikan kepada warga yang terkenan

musibah badai yakni 3 karung beras dengan berat 30 kg per karungnya, tiga kardus mie instan dan tiga papan telor. “Kita berharap bantuan ini bermanfaat bagi warga yang terkena musibah,” tukas Sanggaraja. (dungo/nasa)

Minta Tenaga Kerja Asal Sibolga Diprioritaskan Sambungan Halaman 8

Kadis Kelautan Dituding Berperan Gulingkan Nirwan Sambungan Halaman 8

gin saya sampaikan, warga juga hendaknya bisa memahami kondisi keterbatasan ini. Kalaupun ada warga yang kecewa karena tidak mendapat raskin, kami minta supaya berbesar hati. Kami sudah melakukan upaya semaksimal mungkin,” tuturnya. Lurah sendiri mengaku telah menyampaikan sejumlah persoalan raskin tersebut dalam musrenbang kelurahan, kecamatan dan tingkat kotamadya, seperti soal

Mudah-mudahan upaya ini membuahkan hasil. Pada prinsipnya kita ingin menekan pengangguran,” tutur Ketua Komisi III DPRD Sibolga Jamil Zeb Tumori bersama anggota komisi Kamil Gulo SPdI, Hj Nur Arifah, Henri Tamba SE, Manunggang Panggabean, sepulangnya mereka dari Medan, Selasa (13/3) di Sibolga. Jamil menambahkan, banyak persoalan muncul tatkala agen penyalur tenaga kerja bermasalah, dan akhirnya calon tenaga kerja gagal berangkat ke negara yang dituju. Maka itu, jalinan komunikasi dengan pihak PT AMS perlu dibangun. “Kita juga pernah pengalaman begitu, tenaga kerja gagal dikirim ke Malaysia karena agen penyalurnya yang bermasalah. Kali ini kita bangun komunikasi dan kita lakukan monitoring,” terangnya. Sebelumnya, sesuai dengan keputusan rapat koordinasi dengan Dinas Sosial dan Tenaga Kerja Sibolga, Komisi III bersama Kepala Perwakilan

PT AMS Cabang Sibolga-Tapteng, Mulyadi berangkat ke Medan pada hari Sabtu (10/3) kemarin. Rombongan diterima oleh Pimpinan PT AMS Medan, Hj Zubaidar dan wakilnya, Abdul Gani. Dikatakan Jamil, Hj Zubaidar saat itu menjelaskan, PT AMS adalah perusahan resmi penyalur tenaga kerja yang sudah berdiri sejak tahun 1992, dengan tujuan kerja ke Malaysia. Sudah ada puluhan tenaga kerja asal Sibolga yang disalurkan oleh perusahaan tersebut. Dan semua diberangkatkan dan ditanggani dengan baik “Pihak PT AMS merespon positif kedatangan kami. Pihak perusahaan sepakat soal membangun jalinan komunikasi dengan kita. Bahkan pihak perusahaan memberi masukan agar calon tenaga kerja diberi subsidi pinjaman oleh pemerintah daerah. Pinjaman itu dapat dikembalikan atau dicicil dengan potongan gaji. Pada kesempatan itu, Komisi III juga meminta kiranya pihak PT AMS mau melakukan sosialisi di Sibolga,” tutur Jamil. (mor/nasa)

Sambungan Halaman Satu Batak di Mata Penulis Sejarah Asing Itu Seram Sambungan Halaman 1 barat melihat timur, selalu melihat yang jeleknya,” ungkapnya. Apalagi orang Batak ketika itu menurutnya kemudian, dikenal sebagaisukuyangseakankanibalisme. “Mereka mendengar kalau kanibalisme itu begitu seram, sehingga mereka tulis dan menganggapnya jelek. Karena di Eropa pada masa itu sudah tidak ada lagi kanibalisme. Batak itu sendiri konotasinya jelek. Artinya suku yang ganas dan suka perang,” jelasnya. Padahal menurut Nikolas, para penulis Eropa ketika itu, tidak memahami bahwa kanibalisme merupakan hukum acara untuk menghukum orang dan musuh. “Dahulu kalau terjadi sebuah sengketa, maka diselesaikan dengan pertarungan. Lalu hukumnya siapa yangkalah,diasalah.Nahkarenaorang Batak dulu masih menganut paham animisme, maka ketika musuh kalah, maka harus dihabisi bukan hanya fisiknya saja, tapi juga rohnya harus dihabisi,” terangnya. Makanya setelah mati, ungkap Nikolas, bagian-bagian tertentu dari musuh,dimakan.Halinisebagaimana keyakinan ketika itu, untuk membinasakan roh dari musuh tersebut. “Nah ini yang tidak dipahami para penulis tersebut,” katanya. Selain itu hal yang tidak diketahui banyak penulis Eropa ketika itu, dalam hukum Batak juga menurut Nikolas, sebenarnya tidak seluruhnya pihak yang kalah akan dibunuh. Namun ada juga ketika seseorang minta ampun, maka ia menjadi budak dari yang

menang. Atau diusir dari kampung tersebut. “Tapi yang lebih keras, memang dia dihukum mati atau dipancung seperti di Timur Tengah,” katanya lagi. Nikolas sendiri menemukan fakta sejarah ini, saat ia meneliti yang kemudian melahirkan buku “Acara Pidana Indonesia Dalam Sirkus Hukum” tahun 2009 lalu. Dalam buku tersebut ada bagian tentang sejarah hukum acara di Indonesia. “Jadi saya meneliti bagaimana hukum acara terjadi di suku-suku primitif. Kebetulan saya mencoba mencarisejarahhukumkitaini,supaya kita jangan impor-impor melulu,” tersangnya. Saat ini sendiri, peninggalan budaya kanibalisme dalam adat Batak menurut Nikolas kemudian, masih dapat dilihat. Salah satunya dalam adat pangolihon boru (mengawinkan anak perempuan). “Kenapa pinahan (ternak) yang mangolu (hidup) yang dijadikan adat. Inilah tuhor, karena ketika borunya diambil, rohnya ikut hilang dari tengah keluarga tersebut. Makanya kalau diikuti adat-adat, jambar-jambar, itu berasal dari adat perang semua. Karena dulu mengambil perempuan, harus perang. “Menariknya di balik penyebutan sejarah bahwa Batak berkonotasi jelek, Nikolas justru bersyukur. Sebab dengan demikian orang Batak menjadi sadar dan introspeksi diri, hingga dapat berubah seperti sekarang ini. Di mana orang Batak dapat berperan begitu luar biasa di seluruh dunia. (***)

Golkar Janjikan Tercepat Tentukan Calon Gubsu Sambungan Halaman 1 bakal diusung di setiap pemilukada untuk memilih gubernur. Sebut saja Pilgub DKI Jakarta, meski telah memasuki pendaftaran pasangan calon ke KPUD, hingga kemarin sejumlah partai besar belum menetapkan calonnya, termasuk dengan partai mana akan berkoalisi. Di Partai Demokrat, PDIP, PKS, PPP, masih terjadi tarik-menarik di internal partai. Bisa dibilang, Partai Golkar lah yang paling cepat memastikan calonnya, yakni Alex Noerdin, sebagai cagub DKI Jakarta. Apakah untuk Pilgub Sumut nanti Golkar juga akan paling cepat menentukan calonnya? “So pasti,” tegas Leo Nababan. Sebelumnya, pemerhati politik lokal, DR Umar Syadat Hasibuan kepada koran ini pernah menganalisis, Golkar bakal mengusung Gus Irawan. Ini lantaran Gus sudah punya kedekatan dengan Golkar, antara lain karena abangnya, Bomer Pasaribu, merupakan politisi senior Golkar. “Posisi Gus Irawan juga diuntungkan dengan kondisi saat ini dimana tokoh Golkar Sumut tidak ada yang menonjol,” ujar Umar Hasibuan. Apakah lantaran sudah

mengantongi nama sehingga Golkar menjanjikan paling cepat mengumumkan calonnya? Leo belum memberi kepastian karena saat ini masih sedang survei. Yang pasti, namanama yang beredar semua disurvei, termasuk Gus Irawan. Hanya saja Leo mengatakan, ketika sudah ada nama yang mantap, maka proses penggodokan tidak perlu waktu lama. “Kalau sudah mantap, ngapain lama-lama,” tegasnya, lagi-lagi belum mau menyinggung nama. Leo menyebut partainya merupakan partai yang sudah cukup matang dalam pergulatan politik. Golkar, katanya, selalu menghitung aspek waktu, kapan saatnya menetapkan calon. “Politik itu momentum,” ujarnya. Maksudnya, penentuan calon juga harus berdasarkan taktik dan strategi. “Kalau sudah ada yang mantap, harus cepat. Kalau tidak cepat, bisa ketinggalan kereta. Calon itu bisa diambil partai lain. Golkar tak mau ketinggalan kereta,” imbuhnya lagi. Berdasarkan pengalaman Pilgubsu 2008, PDIP merupakan partai yang baru menetapkan dan mendaftarkan calonnya, yakni Tri Tamtomo-Benny Pasaribu, di menit-menit terakhir.

Rapat penentuan nama di DPP PDIP, saat itu, bahkan digelar beberapa jam sebelum penutupan pendaftaran calon di KPU Provinsi Sumut. Chairuman Harahap, yang saat itu mendaftar sebagai calon PDIP, harus gigit jari dan gagal ikut bertarung di Pilgubsu. Penetapan calon oleh PDIP yang di menit-menit akhir itu membuat posisi Chairuman ‘terkunci’, tidak punya waktu lagi mencari partai lain sebagai perahu untuk maju. Model PDIP yang seperti itu, ada tanda-tanda bakal terulang lagi di Pilgubsu 2013. Politisi PDIP, Ganjar Pranowo kepada koran ini beberapa waktu lalu menyebutkan, partainya masih dalam taraf membaca dinamika yang berkembang. Sama sekali belum melakukan apa-apa, termasuk survei. Hal ini diperkuat pernyataan politisi senior PDIP, Sabam Sirait, yang mengatakan, pihaknya akan mencari informasi sebanyak-banyaknya mengenai siapa calon yang kiranya layak diusung. Meski mengarah ke RE Nainggolan, namun itu baru pendapat pribadi Sabam. “Di Taput itu, sewaktu Nainggolan itu jadi bupati, pertama kalinya saya makan kuda,” ujar Sabam Sirait, kepada koran ini beberapa waktu lalu. Jadi, PDIP akan mengusung RE

Duta Sepak Takraw Sambungan Halaman 1 dan menghormati kebudayaan milik bangsa Indonesia. Banyak negaranegara lain, mengakui milik mereka. Saya prihatin dan harus bersuara untuk menggenggam milik bangsa ini,” ungkapnya ketika ditemui di Gedung Menpora Senayan, Jakarta

Selatan, beberapa waktu lalu. Sebagai duta dan mencintai dunia olahraga, Jupe juga berencana akan memperkenalkan olah raga yang berasal dari Sulawesi Tengah ini hingga mancanegara. “Saya mencintai olahraga, ketika tugas sampai keluar kota, saya ajak bermain bersama, buat pertandingan.

Enggak hanya di Indonesia tapi dunia juga mancanegara,” jelasnya. Dalam kesempatan ini, Jupe juga memberi informasi kepada mantan kekasihnya, Gaston Castano seputar cara bermain sepak takraw dengan baik dan benar. Terlebih Gaston juga berkarir di dunia sepakbola. Bahkan Jupe akan mengenalkan sepak takraw

Nainggolan? Sabam tidak memberikan jawaban tegas. Secara diplomatis, dia mengatakan, “Kalau dari keluarganya, dari keluarga baik, jujur. Buat saya harus dicari yang jujur. Jujur yang pertama, yang kedua pintar.” Untuk masalah kecepatan pencalonan ini, Golkar kemungkinan hanya tersaingi oleh PKS. Dewan Pimpinan Pusat Partai Keadilan Sejahtera (DPP PKS) menyediakan waktu yang cukup panjang untuk ancang-ancang menghadapi ‘pertempuran’ di Pilgub Sumut 7 Maret 2013. Partai berbasis ideologi Islam itu tak mau lagi mengulangi kejadian Pilgub Sumut 2008, dimana hanya punya waktu yang mepet untuk menetapkan calon dan partner koalisi. Tidak ingin tergagap-gagap lagi jelang Pilgub Sumut 2013, saat ini DPP PKS sudah mulai menginventarisir nama-nama calon yang akan diajukan di pesta demokrasi lima tahunan tingkat lokal di Sumut itu. DPP PKS telah membentuk tim khusus untuk proses penggodokan nama kandidat. “Saat ini nama-nama sedang kita godok. Ada tim khusus yang menangani hal ini,” ujar Ketua DPP PKS, Refrizal. Sumut sendiri, bagi PKS, merupakan salah satu daerah yang dijadikan barometer. Karenanya, Mukernas PKS tahun ini akan digelar di Medan, yakni pada 26 Maret 2012 mendatang. (sam) ke sekolah sepak bola miliknya. “Saya tunjukin bolanya, saya ceritain asal sepak takraw, dan juga saya akan mengenalkannya di sekolah bola saya,” tutupnya. Selain Jupe, artis lainnya seperti Pasha ‘Ungu’ Abdee ‘Slank’ dan Corry Pamela, turut diutus sebagai Duta Sepak Takraw. (int)


Harga Rp2.000



Perekat Masyarakat Kota Berbilang Kaum


SAMPAIKAN SPT, Wali Kota Sibolga Drs HM Syarfi Hutauruk saat memasukkan berkas SPT Tahunan ke dalam Drop Box SPT, disaksikan Kepala KPPP Sibolga Marthin Hutabarat SE MM dan pimpinan SKPD kota Sibolga, Kamis (15/3) kemarin.

Taat Pajak, PNS Harus Jadi Contoh Warga SIBOLGA-PNS selaku abdi negara dan pelayan di tengah masyarakat, harus menjadi contoh kepada masyarakat luas soal ketaatan membayar pajak. Salah satu caranya, dengan menyampaikan SPT PPh (Surat Pemberitahuan Tahunan Pajak Penghasilan) tepat waktu, yakni hingga batas akhir 31 Maret 2012. Demikian dikatakan Wali Kota Sibolga, Drs HM Syarfi Hutauruk saat menyampaikan SPT Tahunan PPH, Kamis (15/ 3). Wali kota juga mengimbau, seluruh wajib pajak (WP) yakni, orang pribadi baik yang berprofesi sebagai Pegawai Negeri Sipil (PNS), TNI/Polri, Bankir, pengusaha dan masyarakat yang berpenghasilan

Pembagian Raskin di Aek Parombunan Ricuh AEK PAROMBUNAN- Kebijakan Lurah Aek Parombunan, Kecamatan Sibolga Selatan untuk pemerataan pembagian beras miskin (raskin) bagi warga menimbulkan kericuhan. Umakumak protes lantaran jatah raskinnya berkurang dan bahkan hilang. Tak pelak, adu mulut, desakdesakan, dan bahkan tarik-tarikan goni berisi raskin pun terjadi. Mana jatah berasku (raskin). Dari semalam pagi, sudah dua hari aku menunggu, janji-janji saja. Mana berasku, kubayar, ini uangnya, kubayar!,” teriak Seniman br Halawa (34), sambil memegangi kartu keluarganya sebagai syarat mendapatkan raskin, di kantor lurah setempat, Kamis (15/3) siang. Ibu 3 anak itu mengaku bekerja sebagai buruh bangunan, sementara suaminya

... Hal 7


MENGADU- Beberapa warga Aek Parombunan mendatangi rumah Jamil Zeb Tumori, kerena mereka kecewa tidak mendapat jatah raskin, Kamis (15/4).

Ngadu ke Anggota Dewan


RICUH- Pembagian raskin di kantor Kelurahan Aek Parombunan, Sibolga Selatan, yang diwarnai kericuhan, Kamis (15/3).

‹ Baca Taat ‹

... Hal 7

Korban Badai Dapat Bantuan Beras, Mie Instan, dan Telur

seorang penarik becak dayung. Di periode pembagian raskin sebelumnya, ibu ini selalu mendapat jatah beras yang dibagi 2 bulan sekali itu. Ada puluhan warga yang mayoritas kaum ibu yang mendatangi kantor lurah siang itu. Kericuhan antara warga dengan staf kelurahan pembagi raskin pun tidak terelakkan. Bahkan, karena ke-

‹ Baca Warga ‹

di atas Rp60 juta pertahun untuk taat pajak. Menurut wali kota, kewajiban membayar pajak bagi setiap warga negara (wajib pajak) sudah diatur dalam UU. Seperti halnya gaji PNS, di dalamnya sudah ada hak negara untuk diberikan kepada negara dalam rangka mensejahterakan rakyat. Pada kesempatan itu, Wali Kota Sibolga menggambarkan, kemudahan-kemudahan yang didapat warga negara taat pajak khususnya yang sudah memiliki NPWP. Salah satunya keperluan fiskal untuk berpergian ke luar negeri bisa diperoleh dengan gratis. Se-

BEBERAPA warga Kelurahan Aek Parombunan, Kecamatan Sibolga Selatan, yang kecewa karena tidak mendapat jatah raskin (beras miskin) mengadu ke rumah anggota DPRD Sibolga, Jamil Zeb Tumori di Jalan Sisingamangaraja No. 317, Kelurahan Aek Manis, Kecamatan Sibolga Selatan, Kamis (15/4) sekira pukul 11.00 WIB. Warga yang mengadu diantaranya, Mei Hati Harefa (31), Melisa Laia (33), Nasiba Gulo

(34), Warni Hati Harefa (29), Apriana Lahagu (25), dan Satimina Gulo (46). Mereka mengaku tinggal di Jalan Jenderal Sudirman, Lingkungan III, Kelurahan Aek Parombunan. “Kami tidak dapat raskin. Sudah dari semalam kami menunggu di kantor lurah. Padahal sebelumnya kami semua dapat,” keluh mereka kepada Jamil Zeb Tumori, yang juga Ketua Komisi III itu. Sebelumnya, para ibu rumahtangga itu sudah dari kantor

Lurah Aek Parombunan di Jalan Jend Sudirman dengan membawa goni plastik kosong dan kartu keluarga masing-masing. Tak berapa lama kemudian, Kepala Lingkungan I Kelurahan Aek Parombunan, Irsan Sitompul datang ke rumah tersebut dan mendata para ibu-ibu itu. Kepala Lingkungan mengaku kehadirannya atas perin-

‹ Baca Ngadu ‹

KETAPANG-Prihatin dengan korban bencana badai yang menerpa warga Jalan Mawar, Ketapang, Kelurahan Sibolga Ilir, Kota Sibolga. Wali Kota Sibolga, Drs HM Syarfi Hutauruk bersama Dinas Sosial Kota Sibolga memberikan bantuan beras, mie instant, dan telur, Kamis (15/3) sore kemarin. Wali Kota dalam sambutannya mengatakan, bantuan yang diberikan pemerintah kota (Pemko) Sibolga bertujuan untuk meringankan sedikit beban warga yang terkena musibah. “Saya berharap, bantuan yang diberikan ini setidaknya bisa meringankan penderitaan

yang dialami oleh warga yang rumahnya rusak akibat cuaca buruk yang melanda Sibolga beberapa waktu lalu,” kata Syarfi. Soal kerusakan rumah, sambungnya, langkah selanjutnya Pemko Sibolga akan berupaya memberikan bantuan, misalnya bantuan untuk atap rumah milik warga yang diterbangkan angin, sehingga tidak bisa digunakan lagi. “Kita akan mengupayakan hal itu, dan kami berharap agar warga yang terkena musibah bisa bersabar,” ujar Syarfi. Kadis Sosial, Sanggaraja

‹ Baca Korban ‹

... Hal 7

... Hal 7


Jelang UN, Kurangi Main Facebook

SIBOLGA- Mantan Sekretaris Kelompok Nelayan Tolong Menolong (KNTM) Sibolga, Dedi Sutomo Simanjuntak menduga, ada unsur poli-

SIBOLGA-Guna memastikan persiapan siswa menghadapi ujian nasional (UN) untuk tingkat SMA/MA/ SMK yang akan digelar tanggal 16 April mendatang, Wali Kota Sibolga Drs HM Syarfi Hutauruk meninjau pelaksanaan Try Out (uji coba) ujian nasional, Kamis (15/3) sore kemarin. Pada kesempatan itu, Syarfi mengingatkan agar seluruh siswa yang akan mengikuti Ujian Nasional untuk mengurangi intensitasnya dalam menggunakan internet seperti bermain facebook, yahoo mesenger, twitter, atau lainnya yang tidak berhubungan dengan ilmu-ilmu pengetahuan di sekolah. “Menjelang pelaksanaan UN ini sebaiknya para siswa menahan diri dululah untuk tidak chating-chatingan atau bermain game yang ada di inter-

‹ Baca Kadis ‹

‹ Baca Jelang ‹

„ Dedi Sutomo

Kisruh di Kepengurusan KNTM Sibolga

Kadis Kelautan Dituding Berperan Gulingkan Nirwan ... Hal 7

... Hal 7


PERTEMUAN antara Komisi III DPRD Sibolga dan pihak PT AMS Medan guna menjalin komunikasi positif terkait penyaluran tenaga kerja asal Sibolga ke luar negeri, Sabtu (103).

Komisi III Temui PT AMS Medan

Minta Tenaga Kerja Asal Sibolga Diprioritaskan (FOTO:RIDWAN),

TINJAU TRY OUT, Wali Kota Sibolga, Drs HM Syarfi Hutauruk didampingi Kadis Diknas Sibolga dan anggota Komisi I DPRD saat meninjau pelaksanaan try out.

SIBOLGA-Komisi III DPRD Sibolga ‘mendekati’ agen resmi penyalur tenaga kerja ke luar negeri, PT Andalan Mitra Sejati (PT AMS), yang beralamat di Jalan Halat, Medan. Tujuannya, agar tenaga kerja asal Sibolga dapat menjadi proritas untuk dipekerjakan.

“Ke depan lapangan kerja semakin minim, seiring dengan tuntutan kualitas SDM yang profesional. Sebalumnya kami sudah menjalin komunikasi dengan PT Mujur Timber dan PT AR Martabe.

‹ Baca Minta ‹

... Hal 7


Teraktual dari Tarutung, Balige, Humbahas, dan Samosir





Di Daerah Terpencil

Tunjangan Guru Rp170 Ribu, Kasek Rp210 Ribu BALIGE- Akhir tahun ini, sebanyak 633 guru yang bertugas di daerah terpencil di Kabupaten Toba Samosir bakal menerima tunjangan yang berasal dari APBD. Adapun tunjangan yang mereka terima yakni, untuk Kepala Sekolah (Kasek) sebesar Rp210 ribu per bulan, dan guru Rp170 ribu per bulan. “Mereka yang berhak menerima tunjangan itu adalah para guru yang mengajar di daerah terpencil. Besaran tunjangan yang diterima tergan-

tung jabatan. Yakni, Kasek Rp210 ribu per bulan, guru kelas Rp170 ribu per bulan,” kata Sekretaris Dinas Pendidikan Tobasa, Marangkup Sinurat kepada METRO, Kamis (15/3) di ruang kerjanya. Marangkup menegaskan, tunjangan yang diterima para guru tersebut tidak berasal dari Anggaran Pendapatan Dan Belanja Negara (APBN), melainkan Anggaran Pendapatan dan

Foto:Metro/Horden Silalahi

JAGA SPBU: Kabag Ops Polres Humbahas, AKP Herwansyah Putra saat memantau penjagaan di SPBU 44, Doloksanggul, Kamis (15/3).

„) Baca Tunjangan .Hal 10

SPBU Dijaga 10 Polisi DOLOKSANGGUL- Menjelang kenaikan Bahan Bakar Minyak (BBM), Polres Humbahas menempatkan 10 polisi di Stasiun Pengisian Bahan Bakar Umum (SPBU) Doloksanggul, Kabupaten Humbahas. Hal itu dilakukan untuk mengantisipasi kemungkinan terjadinya penimbunan BBM dan keributan di SPBU. Demikian diungkapkan Kapolres Humbahas, AKBP Verdy Kalele SH SiK MH melalui Kabag Ops, AKP Herwansyah Putra SH kepada METRO, Kamis (15/3) di SPBU 44, Doloksanggul.

AMBRUK: Kondisi bronjong Aek Simare Desa Lumban Binanga Kecamatan Laguboti, ambruk dua bulan lalu. Namun, hingga sekarang, pihak kontraktor belum ada tandatanda untuk memperbaikinya.

Dua Bulan Selesai Dikerjakan

“Untuk mengantisipasi kemungkinan terjadinya penimbunan BBM dan pengamanan SPBU 44 ini, kita telah membentuk tim dari tiap-tiap fungsi yakni reskrim, intel, samapta, dan di-

ngankan diperbaiki, ditinjau saja belum ada,” ketus marga Hutajulu (40) warga Desa Lumban Binanga, Kamis (15/3). Kepala Desa Lumban Binanga, Sihar Hutajulu ketika dikonfirmasi METRO membenarkan ambruknya beronjong Aek Simare, Desa Lumban Binanga, Kecamatan Laguboti itu. Katanya, kondisi itu sudah ia laporkan ke Dinas PU Tobasa.

„) Baca Bronjong ..Hal 10

Kabid Diklat Tak Gubris Kepala BKD DOLOKSANGGUL- Kepala Bidang Diklat dan Pembinaan pada Badan Kepegawaian Daerah (BKD) Humbang Hasundutan, Arwan Silaban menolak memaparkan jumlah PNS yang dijatuhi hukuman disiplin sesuai PP 53 Tahun 2010 di daerah itu. Bahkan, Arwan tak mengindahkan perintah Laurencius Sibarani, selaku pimpinannya (Kepala BKD) yang sebelumnya menyarankan agar dia memberi keterangan pers soal jumlah PNS yang dijatuhi hukuman disiplin tersebut. “Saya tidak mau memberikan

data itu. Itu berkas yang sudah dijatuhi hukuman disiplin, tapi saya tidak mau memberikan datanya,” cetus Arwan sambil menghunjuk tumpukan berkas di samping meja kerjanya. Walaupun wartawan telah memberitahukan berulangulang soal penjelasan jumlah PNS yang dijatuhi hukuman disiplin itu adalah perintah pimpinannya, tetapi Arwan ngotot tidak mau memberi keterangan. ”Saya tidak mungkin memberitahukan itu, kalau pimpinan boleh. Ayo kita tanya dulu-

„) Baca Kabid ..Hal 10


„) Baca SPBU ....Hal 10

Akhirnya Sampah di Pasar Tarutung Diangkut

Beronjong Lumban Binanga Ambruk LAGUBOTI- Bangunan beronjong berbiaya Rp1 miliar di Aek Simare Desa Lumban Binanga Kecamatan Laguboti kembali ambruk kedua kalinya. Padahal, bangunan yang dikerjakan PT Putri Lan TA 2011 ini baru dua bulan lalu selesai dikerjakan. “Bangunan beronjong itu sudah dua kali ambruk. Pertama langsung diperbaiki kontraktor yang mengerjakan. Tetapi, kali ini dibiarkan begitu saja. Ja-

gabung dengan polsek-polsek yang ada di Humbahas,” kata Hermansyah. Ia menjelaskan, untuk mengantisipasi kemungkinan adanya aksi masyarakat akibat naiknya harga BBM, Polres telah menyiapkan atau mengerahkan satu regu yang berjumlah 10 orang untuk berjaga di SPBU 44 Doloksanggul. “Di SPBU 44 Doloksanggul kita

FOTO Bernad L Gaol

SAMPAH: Petugas kebersihan mengangkut sampah di kawasan Pasar Tarutung dengan menggunakan alat berat jenis Bhacoe Loader, Kamis (15/3).

TARUTUNG- Tumpukan sampah di kawasan pemukiman warga Jalan HKI Tarutung tepatnya di belakang Pasar Tarutung akhirnya diangkut Dinas Kebersihan dan Pertamanan Taput bekerja sama dengan Dinas Pekerjaan Umum. Petugas mulai membersihkan sampah yang sempat menggunung hingga dua meter dengan panjang sekitar 20 meter. Pembersihan tumpukan sampah itu sendiri diakui Kepala UPT Pasar Tarutung, PPP Lumbantobing setelah adanya pemberitaan dari surat kabar Harian METRO TAPANULI. “Pengangkutan sampah ini dilakukan setelah membaca berita Metro Tapanuli, selanjutnya Plt Kepala Dinas Pasar Kebersihan dan Pertamanan Taput merespon dan menindaklanjutinya,” sebutnya. Katanya, tumpukan sampah di

„ Agustina Dwiana

Jumlah Keluarga Miskin di Taput Besar TARUTUNG- Jumlah rumah tangga miskin (RTS) di Tapanuli Utara meningkat dibanding tahun sebelumnya. Jika tahun 2008 berada di angka 24.731 Kartu Keluarga, tahun 2011 meningkat jadi 26.144 atau kenaikan mencapai 1.913 KK.

„) Baca Akhirnya..Hal 10

„) Baca Jumlah ..Hal 10


Masyarakat Ngadu ke Camat SIMALUNGUN- Huta Bintang Mariah, Nagori Dolok Maraja, Kecamatan Tapian Dolok, Simalungun adalah salahsatu huta (dusun,red) yang sampai saat ini belum dialiri listrik dari PT PLN. Karenanya, warga tahun lalu bermohon ke PLN dan disetujui. Sayangnya, kabar baik ini sepertinya dihambat salahsatu perkebunan milik asing yang beroperasi di sekitar wilayah mereka. Karenanya, perusahaan raksasa ini dituding warga telah melanggar HAM (Hak Azasi Manusia-red) Bintang Mariah.

Pasalnya, pihak perusahaan perkebunan milik asing tersebut melarang pendirian tiang PLN di jalan control Lahan HGU Blok JJ/67,II 7 Bintang Mariah melalui suratnya tanggal 12 maret 2012 Ref.: HR/0344/ 2012 tertanggal 14 Maret 2012. Keberatan PT Bridgestone membuat warga Bintang Mariah kesal dan marah. Hanya gara-gara 165 batang pohon yang terancam ditebang dan ratusan lainnya terancam di toping, perusahaan perkebunan milik asing itu malah tidak mengizinkan tiang PLN didiri-

kan di wilayah operasinya. “Selama Indonesia Merdeka, baru kali ini pemerintah membangun PLN di Huta Bintang Mariah. Namun hak warga untuk menikmati layanan listrik PLN dihambat oleh perusahaan perkebunan milik asing,” kata warga Jayadi Purba (36), Kristian Sinaga (65), Kartua Sihombing (50), Marulam Sipayung (38) mewakili warga lainnya, , Kamis (15/3) ketika mengadu ke Pangulu (kepala desa) Dolok Maraja dan Camat

„) Baca Masyarakat Hal 10


MENGADU-Ratusan warga Huta Bintang Mariah, Nagori Dolok Maraja terlihat menunggu perwakilannya yang sedang bermusyawarah di dalam Kantor Pangulu Dolok Maraja.





16 Maret 2012



Telkomsel Siap Implementasikan Jaringan 4G MEDAN- Telkomsel menegaskan pihaknya siap mengimplementasikan jaringan 4G dengan teknologi Long Term Evolution (LTE) menyusul transformasi teknologi telekomunikasi tahun ini yang lebih mengarah kepada bisnis berbasis layanan data sesuai dengan gaya hidup digital. Head of Corporate Communications Division Telkomsel, Ricardo Indra, di Medan, Kamis, mengatakan, kebutuhan masyarakat akan kecepatan akses terhadap beragam layanan komunikasi data terus meningkat sejalan dengan gaya hidup digital atau “mobile style”. Menyikapi kebutuhan itu, manajemen sudah memiliki

pondasi kuat dan siap mengimplementasikan jaringan 4G dengan LTE didukung oleh ketersediaan ekosistem device dan layanan data. katanya. Keunggulan teknologi LTE dibandingkan teknologi sebelumnya adalah kecepatan transfer data dan mampu memberikan “coverage” serta kapasitas layanan yang lebih besar. LTE juga berperan dalam mengurangi biaya operasional, mendukung penggunaan multiple-antena, fleksibel dalam penggunaan “ bandwidth ” operasi serta dapat terhubung atau terintegrasi dengan teknologi yang sudah ada. Transformasi jaringan dan teknologi pada TI support, bill-

ing, storage dan CRM akan terus dikembangkan Telkomsel dari waktu ke waktu. Sebagai pemain utama layanan seluler, infrastruktur jaringan, “coverage” terluas dengan layanan terlengkap, Telkomsel telah menjangkau seluruh kecamatan hingga pedesaan, bahkan di atas 15 kapal PELNI dengan BTS Pico via satelit VSAT IP yang menjadi terobosan pertama di Indonesia bahkan Asia. Dewasa ini Telkomsel memiliki lebih dari 44.000 jumlah Base Transceiver Station (BTS) termasuk 9.500 Node B (BTS 3G) yang tersebar dari Sumatera hingga wilayah Timur Indonesia dengan bandwidth 20 Giga bit per second (Gbps))

untuk memenuhi kebutuhan pelanggan akan kualitas layanan data kapan kapan dan dimana saja. Untuk menunjang penggunaan jaringan data packet switch, tahun 2011 Telkomsel telah menyiapkan 27 Serving GPRS Support Node (SGSN) dan 10 Gateway GPRS Support Node (GGSN) karena makin besar kapasitas SGSN dan GGSN, semakin besar pula jumlah pelanggan data yang dapat diakomodir oleh jaringan Telkomsel. Indra menambahkan, industri telekomunikasi di Indonesia telah memasuki fase baru, yakni fase pasca terpenuhinya layanan telekomunikasi dasar, dimana

broadband menjadi kebutuhan pelanggan selular saat ini. Karena itu, katanya, tersedianya pita frekuensi yang sesuai, kesiapan regulator, operator, jaringan dan perangkat bagi pengguna merupakan faktor penting dalam rangka mengadopsi teknologi masa depan komunikasi di tanah air. Sebagai operator selular yang melayani lebih dari 107 juta pelanggan, Telkomsel membutuhkan frekuensi ideal yang mampu mendukung teknologi LTE yang pada akhirnya memberikan kenyamanan bagi masyarakat untuk berselancar, mengunduh maupun mengunggah data dengan kualitas optimal. (ant/ int)

Kabid Diklat Tak Gubris Kepala BKD Sambungan Halaman 9 lah beliau ke ruang kerjanya,” ketusnya. Sebelumnya, Kepala BKD Laurencius Sibarani ketika dikonfirmasi wartawan, Kamis (15/3) di kantornya, terkait jumlah PNS di pemkab itu yang dijatuhi hukuman disiplin sesuai PP 53 Tahun 2010, langsung mendelegasikan sejumlah wartawan untuk wawancara kepada Arwan Silaban. ”Oh kalau itu besok bisa tidak? Karena saya kebetulan dipanggil bupati ke kantornya. Kalau ga bisa, ke Arwan Silaban saja lah langsung,” ujar Lau-

rencius. Untuk diketahui, BKD melalui Bidang Diklat dan Pembinaan dituding melakukan tebang pilih terhadap PNS yang melanggar disiplin kerja. Di antaranya, penanganan hukuman disiplin kerja terhadap sejumlah PNS yang jarang masuk kantor seperti, Ir JHS yang mejabat sebagai salah satu Kepala Bidang di Dinas Kehutanan, yang sudah hampir 6 bulan jarang masuk kantor. Tak hanya itu, BKD juga diduga sering menerima suap dari PNS yang bermasalah disiplin kerja agar tidak dikenakan hukuman. (hsl)

SPBU Dijaga 10 Polisi Sambungan Halaman 9 telah siapkan satu regu berjumlah 10 orang dan satu pleton di setiap polsek,” ungkapnya. Namun, sejauah ini, katanya, pengamanan saat pengisian BBM di SPBU 44 Doloksanggul masih berjalan lancar kerena dari pihak SPBU tidak melayani warga yang membawa jerigen. “Pengisian BBM masih lancar. Karena pihak SPBU sengaja

tidak melayani jerigen dan belum ada kita temukan oknum yang sengaja menimbun BBM,” katanya. Sementara itu, pengawas SPBU 44 Doloksanggul, Samuel Sibarani mengatakan, stok BBM di SPBU 44 masih mencukupi jika dilihat dari kebutuhan per hari yakni, 16 ribu sampai 18 ribu liter untuk solar dan 25 ribu hingga 29 ribu liter untuk premium.

“Sampai saat ini, stok BBM di Kabupaten Humbahas masih mencukupi, kecuali hari Jumat karena di Pasar Doloksanggul, stok kita tambah,” sebut Samuel. Untuk penyaluran BBM, tambahnya, pihaknya hanya melayani pengecer resmi yang dihunjuk Pemkab saja. “Kita hanya melayani pengisian BBM dengan jerigen jika sudah memiliki surat izin dari Dinas

Perindakop. Sampai saat ini masih 3 orang yang sudah memiliki izin itu. Yakni di Kecamatan Lintongnihuta atas nama Marga Silaban, di Kecamatan Pakkat atas marga Nainggolan, dan satu lagi di Kecamatan Sijama Polang atas nama marga Aritonang,” pungkasnya. Sementara Kasubang Humas Polres Taput, Aipda W Barimbing ketika dikonfirmasi METRO tadi malam me-

ngatakan, SPBU di Tapanuli Utara diawasi 3 personel polisi. Namun tidak tertutup kemungkinan, jumlah itu bisa bertambah. “Untuk saat ini Polres mensiagakan 3 personel setiap SPBU. Meliputi empat SPBU di Taput. Namun tidak tertutup kemungkinan adanya penambahan personel bila situasinya dianggap rawan,” singkatnya. (hsl/cr-01)

Akhirnya Sampah di Pasar Tarutung Diangkut Sambungan Halaman 9

FOTO Bernad L Gaol

SAMPAH: Petugas kebersihan mengangkut sampah di kawasan Pasar Tarutung, Kamis (15/3).

daerahPasarTarutungsudahmulai dibersihkandenganmenggunakan bantuan alat berat karena banyaknya sampah. Kondisi itu membuat wargamenjadilegalantaransampah yangselamainisudahmengganggu pernapasan dan juga pemandangan. “Terimakasihataspemberitaannya, sehingga kami selaku petugas pasar bekerja sama dengan Dinas PUK Taput dan Dinas Pasar Kebersihan dan Pertamanan bersama sama membersihkan tumpukan sampah ini,” ucap Lumbantobing kepadaMETRO,Kamis(15/3). Pihaknyasendiri,mengakusangat terganggudengankeberadaansampah-sampah itu. Kepada warga diharapkan membuang sampah pada tempat yang telah disediaka. Sehingga petugas kebersihan tidak kewalahanmengangkutnya. SenadadikatakanKepalaBidang

KebersihanRobetSitumorang.Menurutnya, setiap hari petugas selalu mengangkut sampah. Namun, wargadansejumlahpedagangtetap saja ada yang membandal dengan membuangsaampahditempatitu. “Setiap hari sampah diangkut angkut,namunsetelahituadabeberapa warga kembali membuang sampah di lokasi tersebut sehingga kawasan itu selalu penuh sampah. Saya berharap kepada masyarakat, sebelum sampah diangkut sebaiknyamembuangnya,jangansetelah diangkutbarudibuang,yangnantinyabisamenumpuklagi,”imbaunya. Pantauan METRO pengorekan tumpukansampahmenggunakan satu unit alat berat jenis Bhacoe Loader milik Pemkab Taput dan sejumlaharmadasampah.Petugas berjibaku mengangkat sampah ke truk yang telah disediakan. Hingga siang hari, petugas terus bekerja hinggakawasanitubersihkembali. (cr-01)

Tunjangan Guru Rp170 Ribu, Kasek Rp210 Ribu Sambungan Halaman 9 Belanja Daerah (APBD) Tobasa. “Tujuan diberikannya tunjangan ini untuk mendukung operasional dan kesejahteraan guru di daerah terpencil. Agar mereka betah mengajar di sana,” tandas

Marangkup. Namun, sambungnya, tunjangan dimaksud berlaku hanya bagi guru atau Kasek mulai dari tingkat SD hingga SMP. Sementara pencairan dana, lanjutnya, diberikan sekali setahun dan biasanya dicairkan pada akhir tahun.

“Dananya diberikan melalui kepala sekolah masing-masing. Kepala sekolah itu sendirilah yang mendistribusikan kepada guru,” ungkapnya. Adapun sekolah yang berhak menerima tunjangan guru di Tobasa yakni di Kecamatan Nassau (SD, SMP seluruhnya),

SD di Kecamatan Uluan (sebagian), SD di Kecamatan Borbor (sebagian), SD di Kecamatan Pintupohan Meranti (sebagian), SD di Kecamatan Porsea (sebagian) dan SD di Kecamatan Silaen (sebagian). Terpisah, Ketua DPRD

Tobasa, Sahat Panjaitan membenarkan adanya tunjangan guru yang mengajar di daerah terpencil. “Tunjangan itu bersumber dari APBD. Dari APBN saya kurang tahu. Apakah ada atau tidak. Nanti akan saya tanyakan ke Diknas,” singkatnya. (cr-3)

Masyarakat Ngadu ke Camat Sambungan Halaman 9 Tapian Dolok. Yang mereka sesalkan, kata Jayadi Purba yang memprakarsai permohonan pemasukan listrik PLN ke Huta Bintang Mariah ini, hanya gara-gara 165 batang pohon terancam ditebang dan ratusan pohon lainnya terancam di toping, akhirnya perusahaan perkebunan milik asing tidak mengizinkan pendirian tiang PLN di wilayahnya. Padahal awalnya mereka sudah setuju. Merasa diobok-obok oleh pihak perkebunan, Kamis (15/3) sekitar pukul 08.00 WIB ratusan warga Huta Bintang Mariah yang dikoordinir Jayadi Purba

mendatangi Kantor Pangulu Nagori Dolok Maraja dan Kantor Camat Tapian Dolok untuk mengadukan perusahaan asing yang menghambat pemasangan tiang PLN. Kata mereka saat itu, padahal bila dibandingkan dengan wilayah lain di lahan HGU perusahaan asing tersebut, seperti Nagori Pusuk Pardamean yang berbatasan langsung dengan Huta Bintang Mariah, Huta Bah Sulung, Huta Bahapal, Huta Dolok Maraja dan daerah lainnya di Simalungun, lebih dari puluhan ribu pohon karet yang ditebang dan tidak ada masalah. Kata mereka, ketika warga memohon pemasangan tiang

dan pemasukan listrik PLN ke Wilayah II Medan dan disetujui, pada tanggal 24 Maret 2011 lalu juga, perusahaan asing tersebut telah memberikan izin. Sebagai persyaratannya, warga melengkapi adminisitrasi permohonan PLN ke Wilayah II Medan. Di Kantor Pangulu Dolok Maraja seluruh ratusan warga Huta Bintang Mariah disambut Pangulu, Rusli. Pangulu berjanji akan membantu menjembatani antara perusahaan dan masyarakat sesegera mungkin, setelah diriya selesai menghadiri rapat di Kantor Bupati Simalungun di Pamatang Raya. “Hari ini kita tidak bisa bermusyawarah, karena saya akan rapat ke Kantor Bupati di Pama-

tang Raya. Nanti sepulang dari Raya, kita adakan musyawarah,” jani pangulu di hadapan ratusan warganya. Selasai dari kantor pangulu, warga beranjak ke Kantor Camat Tapian Dolok, Warga disambut disambut dengan baik oleh Camat Tapian Dolok, Williamer Saragih. Melalui sekretarisnya Sakban Saragih, Camat mengundang perwakilan warga yaitu Jayadi Purba dkk untuk berdialog di ruangan camat. Dalam pertemuan itu Camat Tapian Dolok, Williamer Saragih mengajak masyarakat untuk tidak resah dan tidak berbuat tindakan yang melanggar hukum. “Secara pribadi saya tersing-

gung terhadap perusahaan milik asing yang pada awalnya sudah memberi izin, namun akhirnya dilarang. Wajarlah masyarakat resah apalagi pembangunan sudah di depan mata. Namun demikian, saya akan memfasilitasi perwakilan masyarakat dengan perusahaan perkebunan itu untuk mencari jalan keluarnya,” kata Williamer dan mengaku secara teknis dia belum tahu duduk persoalannya. Pantauan di lapangan sesaat sesudah warga dan camat mengadakan musyawarah, puluhan aparat kepolisian turun. Namun pihak kepolisian tidak direpotkan warga, karena tujuan mereka adalah mengadu bukan untuk domonstrasi. (mer)

AMBRUK: Kondisi bronjong Aek Simare Desa Lumban Binanga Kecamatan Laguboti, ambruk dua bulan lalu.

Bronjong Lumban Binanga Ambruk Sambungan Halaman 9 “Desember lalu sudah kita laporkan ke Dinas PU. Tapi sampai sekarang belum diperbaiki,” tandasnya. Belum diperbaikinya beronjong itu, kata Sihar, karena anggaran proyek tersebut bukan wewenang PU kabupaten melainkan Provinsi. “Ketika hal itu saya laporkan, pihak PU kabupaten saat itu mengatakan beronjong Aek Simare merupakan wewenang provinsi,” tandasnya. Ambruknya beronjong itu, kata Sihar bakal jalan daerah beronjong putus total. Karena kerusakannya jauh lebih parah disbanding kerusakan pertama. “Lihat saja ke hulu sungai itu, tanggulnya sudah banyak yang longsor. Sebentar lagi jalan itu akan putus,” tandasnya. Direktur PT Putri Lan bermarga Sinambela ketika dikonfirmasi METRO melalui telepon selularnya, tidak mau mengangkat. Meski nada dering aktif, anmun yang bersangkutan tak kunjung mengangkat. Demikian dikonfirmasi melalui SMS, Sinambela juga tidak mau men-

jawab. Sementara, seorang pelaksana proyek bermarga Tampubolon ketika dikonfirmasi mengaku, bangunan beronjong itu sampai saat ini masih tahap pemeliharaan. “Kami akan koordinasi dulu dengan PU Tobasa, kami lihat dulu kondisinya,” singkatnya. Kasi Intel Kejaksaan Negeri Balige, Andi Salim ketika dikonfirmasi di ruang kerjanya mengaku pihaknya sudah mengetahui ambruknya beronjong itu. Bahkan, pihaknya sudah meninjau langsung ke lokasi. “Kita sudah tinjau ke lokasi, dan sudah diambil fotonya,” ujarnya. Karena proyek itu masih dalam tahap pemeliharaan, kata Andi, dalam waktu dekat, pihaknya akan memanggil pihak-pihak terkait di dalamnya. “Kita akan memanggil pihak-pihak terkait. Kalau memang kondisi beronjong sudah dua bulan ambruk, dan belum diperbaiki, kita akan mempertanyakan hal ini ke pihak kontraktor. Artinya, niat baik dari pihak kontraktor ataupun pejabat terkait sepertinya belum ada,” tandasnya. (cr-03)

Jumlah Keluarga Miskin di Taput Besar Sambungan Halaman 9 Hal ini berdasarkan Pendataan Program Perlindungan Sosial (PPLS) 2011 Badan Pusat Statistik (BPS) Taput. Kepala Seksi Statistik Sosial, Agustina Dwiana membenarkan. Namun, kriteria pendataan rumah tangga miskin yang mereka lakukan kali ini sedikit berbeda dengan tahun sebelumnya. “Tahun 2008, BPS berpedoman kepada 14 kriteria untuk mengkategorikan seseorang itu miskin. Tetapi tahun 2011 tidak.

BPS langsung melakukan pendekatan ke Kepala Desa dan bidan setempat,” kata Agustina kepada METRO, Rabu (14/3) di Tarutung. Pendataan dengan melibatkan Kades menurut Agustina dinilai lebih efektif. Karena seorang Kades lebih tahu bagaimana kondisi warganya. Soalnya, berdasarkan pengalaman tahun tahun sebelumnya, informasi yang diberikan masyarakat kepada petugas pendata tidak sepenuhnya benar. Kadang, masyarakat memberikan data yang salah agar mereka dianggap miskin agar memeroleh bantuan dari pemerintah. Sehingga menjadi pro dan kontra di kalangan masyarakat itu sendiri. “Selain Kades, kita juga minta keterangan dari tetangga yang dikatakan keluarga miskin. Jadi tidak semata mata hanya pengakuan maupun data fisik rumah saja yang menjadi pertimbangan,” tegas Agustina. Ditanya soal jumlah penerima Bantuan Langsung Tunai (BLT) tahun ini, Agustina mengaku belum tahu. Yang jelas, sambungnya, jumlah RTM tidak menjadi penentu sebagai penerima BLT. “BPS hanya melakukan pendataan. Soal berapa penerima BLT, kita belum tahu. Tetapi, biasanya data RTM bisa dipakai untuk menetapkan siapa-siapa saja penerima BLT. Namun, peraturan bisa saja berubah. Makanya, kita belum tahu berapa penerima BLT di daerah ini,” pungkasnya. (cr-01)




Maret 2012

AS Pensiunkan 20 Ribu Marinir WASHINGTON- Amerika Serikat (AS) akan mengurangi 20 ribu personel Marinirnya dalam waktu 5 tahun ke depan. Pengurangan ini dalam rangka menghemat anggaran pertahanan seperti yang telah ditetapkan oleh pemerintah AS. Pemangkasan jumlah personel Korps Marinir AS tersebut berasal dari 4 batalion infanteri dan 12 skuadron udara. Pengurangan terbesar berasal dari markas Marinir AS di North Carolina, tepatnya dari Camp Lejeune. Pangkalan udara New River akan kehilangan 5.800 personelnya dan pangkalan udara Cherry Point akan kehilangan 2.100 personelnya. Sementara 3 pangkalan Marinir di California, yakni Camp Pendleton, 29 Palms, dan Miramar akan kehilangan total 6 ribu personel. Pengurangan ini akan dilakukan secara bertahap dalam waktu 5 tahun dan dilakukan sesuai masa tugas masing-masing, sehingga setiap personel bisa menyelesaikan masa tugasnya sebelum akhirnya pensiun. ”Dampaknya akan terasa bagi personel yang akan melalui pendaftaran ulang. Kami jelasjelas...membutuhkan lebih sedikit marinir, jadi pendaftaran ulang akan diperketat. Marinir akan segera memiliki personel yang profesional, berkualitas dan berkemampuan baik,” ujar Kepala Komando Pengembangan Tempur Korps Marinir AS, Letnan Jenderal Richard Mills seperti dilansir oleh Reuters, Kamis (15/3). Setelah pemangkasan personel ini selesai pada 2016, kekuatan Korps Marinir AS akan menyusut dari 202 ribu orang saat ini menjadi 182 ribu personel. Susunan organisasi tempur pun dirampingkan. Kesatuan infanteri, misalnya, akan berkurang dari 27 batalion menjadi 23 batalion, sementara korps penerbangan menyusut dari 27 skuadron menjadi 58 skuadron. (dtc/int)

„ Win Htein

Diberitakan Korupsi, Menteri Tuntut Media MYANMAR- Sebuah jurnal mingguan di Myanmar akan menghadapi tuntutan hukum dari Kementerian Pertambangan Myanmar. Kementrian itu tidak terima dengan pemberitaan dugaan korupsi di instansi pemerintah itu. Rencana pengajuan gugatan hukum atas jurnal mingguan The Voice tersebut disampaikan Direktur Jenderal Kementerian Pertambangan Win Htein, Rabu (14/3). “Sesungguhnya tidak ada yang salah (di kementerian itu). Akibat kesalahan pemberitaan mereka, martabat kami rusak. Kami juga menyesalkan kesalahpahaman yang kemudian muncul antara masyarakat dengan kementerian akibat pemberitaan itu,” ujar Htein. Perubahan saat ini memang terjadi sangat pesat di Myanmar. Perubahan itu termasuk pemberitaan di media. Pemerintahan saat ini semakin memperhalus sensor mereka terhadap media massa. Artikel yang diterbitkan The Voice dan digugat Kementrian Pertambangan diketahui memang tidak melalui badan sensor negeri itu. Menyikapi kejadian ini, sejumlah pengamat menilai adanya pergulatan pengaruh dan kekuasaan dalam pemerintahan sendiri. Pergulatan itu terjadi antara kubu reformis dari Presiden Thein Sein dan tokoh-tokoh yang masih menganut paham garis keras sisa peninggalan pemerintahan otoriter masa lalu. (kmc/int)



Tarif Listrik Batal Naik

Internasional Gempa 6,4 SR Guncang Papua Nugini NEW BRITAIN-Gempa bumi berkekuatan 6,4 Skala Richter (SR) melanda wilayah Papua Nugini. Gempa ini dinyatakan tidak berpotensi tsunami.Dilaporkan gempa ini terjadi di wilayah New Britain pada Kamis (15/3), sekitar pukul 07.13 waktu setempat. Pusat gempa terletak di sekitar 204 km sebelah barat daya Rabaul atau sekitar 598 km dari Port Moresby, ibukota Papua Nugini. Gempa ini tercatat berpusat pada kedalaman 48 km dari permukaan laut. Meskipun getaran akibat gempa dirasakan cukup luas, namun belum ada korban jiwa maupun kerusakan yang terjadi. ”Ini nampaknya terjadi pada wilayah yang dipenuhi desa-desa kecil yang cenderung terisolasi di bagian selatan. Mungkin getarannya terasa, tapi gempa seperti ini cukup sering melanda wilayah tersebut dan orang-orang yang tinggal di sana telah terbiasa dengan kondisi ini,” ujar ahli gempa dari Geoscience Australia, Emma Mathews kepada AFP, Kamis (15/3). Wilayah Papua Nugini, termasuk New Britain, tergolong sering dilanda gempa seperti ini. Sebabnya, negara ini terletak pada wilayh ‘Pacific Ring of Fire’, yang menjadi pusat wilayah seismik akibat gesekan antar lempengan tektonik. (dtc/int)


JAKARTA- Kabar gembira bagi masyarakat. Setelah melalui pembahasan alot, pemerintah dan Komisi VII DPR akhirnya sepakat untuk membatalkan rencana kenaikan tarif listrik.

„ Ketua Tim Dokter Kepresidenan Brigjen TNI Aris Wibudi memberikan keterangan pers soal perawatan Ibu Negara Ani Yudhoyono di RSPAD Gatot Soebroto, Jakarta, Kamis (15/3).

BATU EMPEDU Ani Yudhoyono Diangkat JAKARTA- Dalam waktu kurang dari tiga bulan, Ibu Negara Ani Yudhoyono kembali menjalani perawatan di Rumah Sakit Pusat Angkatan Darat (RSPAD) Gatot Subroto, Jakarta. Bahkan, kali ini, ibu Agus Harimurti dan Edhie Baskoro itu harus menjalani tindakan medis operasi. Dari hasil pemeriksaan tim dokter kepresidenan, Ani mengidap sakit batu empedu. “Hasil pemeriksaan lanjutan, ditemukan batu kandung empedu disertai radang kandung empedu,” ujar Ketua Tim Dokter Kepresidenan Aris Wibudi di RSPAD, kemarin (15/3). Ani Yudhoyono masuk di RSPAD kemarin sekitar pukul 10.00 untuk persiapan operasi. Rencananya, operasi pengangkatan batu empedu dilaksanakan pagi ini (16/3). “Tindakan yang direncanakan adalah pengangkatan kandung empedu beserta batunya,” kata dokter berpangkat brigjen itu. Aris menjelaskan, penyakit yang diidap Ani diketahui berdasar general checkup rutin. Namun, dia enggan menjelaskan keluhan yang

disampaikan ibu negara. “(Keluhannya) tidak usah ya. Statement ini sudah cukup,” dalihnya. Begitu juga saat diminta menjelaskan penyebab penyakit tersebut. Berdasar situs Wikipedia, batu empedu merupakan suatu bentuk padatan yang terdapat di dalam kantung ataupun saluran empedu sehingga menghalangi perjalanan empedu menuju usus. Kondisi seperti itu akan menimbulkan rasa nyeri dan mual. Menurut Aris, batu empedu dapat dihilangkan dengan beberapa cara. Misalnya, pemberian obat mengandung asam dan garam empedu, ditembak dengan sinar laser, dan diangkat bersama kantong empedunya. “Itu tim bedah yang memutuskan untuk operasi,” kata Aris soal tindakan operasi yang dipilih untuk Ani. Aris tidak menjawab tegas saat ditanya apakah Presiden Susilo Bambang Yudhoyono (SBY) akan menunggu di RSPAD saat operasi berlangsung. Dia justru balik bertanya. “Kalau istri dioperasi, kamu nungguin nggak?,” katanya lantas tersenyum. Penjelasan dokter kepresidinan

tersebut sekaligus menepis kabar yang beredar sehari sebelumnya yang menyebutkan Ani mengalami anfal. Aris menyebut Ani dalam kondisi baik jelang operasi hari ini. ?Kondisinya sangat bagus,” katanya. Kemarin, sejumlah istri menteri yang tergabung dalam Solidaritas Istri Kabinet Indonesia Bersatu (SKIB) tampak menjenguk. Meski menjalani operasi pengangkatan batu empedu, Ani diperkirakan tetap mendampingi SBY yang akan melakukan kunjungan kenegaraan ke Tiongkok, Hongkong, dan Korsel, pekan depan. “Sementara masih sebagaimana yang direncanakan,” kata Juru Bicara Kepresidenan Julian Aldrin Pasha. “Tim dokter mengupayakan kesehatan Ibu Ani seprima mungkin dan (pulih) secepat mungkin,” kata Aris. Sebelumnya, akhir Desember 2011, Ani menjalani perawatan di RSPAD. Kala itu, dokter kepresidenan menyebut Ani menderita demam typhoid (tifus). Karena sakit itu, Ani sempat tidak mendampingi SBY melakukan kunjungan kerja ke Jawa Tengah. (fal/agm/jpnn)

Menteri Energi dan Sumber Daya Mineral (ESDM) Jero Wacik mengatakan, setelah mendengar berbagai masukan dari Komisi VII, pemerintah akhirnya sepakat untuk membatalkan rencana kenaikan tarif listrik secara bertahap sebesar 9 persen mulai Mei mendatang. “Suasana kebatinan kami di pemerintah juga merasa, kok sepertinya kurang tepat kalau menaikkan tarif listrik bareng dengan kenaikan (harga) BBM, jadi ditunda dulu,” ujarnya saat rapat dengan Komisi VII DPR kemarin (15/3). Jero mengakui, pemerintah sadar bahwa penolakan dari semua fraksi di Komisi VII DPR terhadap rencana kenaikan tarif listrik membuat hal itu tidak bisa dimasukkan dalam APBN-Perubahan 2012. “Kalaui semua minta kenaikan ditunda, ya saya tidak bisa apa-apa,” katanya. Ketua Komisi VII DPR Teuku Riefky Harsya mengatakan, dengan berbagai pertimbangan, Komisi VII memang tidak bisa menyetujui rencana kenaikan tarif listrik. “Jadi, Komisi VII dan pemerintah sepakat bahwa kenaikan tarif listrik tidak bisa dilakukan,” ujarnya lantas mengetok palu di meja pimpinan rapat. Namun, Jero buru-buru menegaskan, meskipun rencana kenaikan tarif listrik pada Mei nanti dibatalkan, tetapi pemerintah masih membuka opsi kenaikan tarif listrik pada akhir tahun atau tahun

„ Jero Wacik depan. “Jadi, ditunda dulu saja. Tapi nanti kalau masyarakat sudah tenang, sudah tidak demo-demo lagi, nanti kita bicarakan lagi (rencana kenaikan tarif listrik), mungkin akhir tahun ini atau tahun depan,” jelasnya. Meskipun pemabatalan kenaikan tarif sudah disepakati, namun besaran subsidi listrik masih belum diputuskan. Sebelumnya, akibat naiknya harga minyak dunia, pemerintah mengajukan angka subsidi listrik dalam APBN-P 2012 sebesar Rp 89,55 triliun, sehingga setelah ditambah kekurangan pembayaran pada 2010 (carry over) maka totalnya sebesar Rp 93,05 triliun, atau lipat dua dari angka dalam APBN 2012 yang sebesar Rp 44,96 triliun. Namun, angka tersebut ditolak oleh Komisi VII DPR karena dinilai terlalu besar. Untuk itu, pemerintah pun mengajukan dua opsi, yakni subsidi sebesar Rp 83,45 triliun atau Rp 80,45 triliun. Namun, lagi-lagi angka tersebut ditolak oleh Komisi VII DPR. Setelah melalui pembicaraan antara pemerintah dan perwakilan fraksi-fraksi komisi VII, akhirnya memutuskan angka subsidi listrik dalam APBN-P sebesar Rp 64,97 triliun. (owi/sof/jpnn)

TKI Harus Dilatih 200 Jam JAKARTA- Kementerian Tenaga Kerja dan Transmigrasi (Kemenakertrans) mengumumkan, penempatan Tenaga Kerja Indonesia (TKI) domestic worker ke Malaysia ditunda hingga bulan April 2012 mendatang. Penundaan ini disebabkan adanya kesepakatan Pemerintah Indonesia dengan Pemerintah Malaysia bahwa untuk Calon TKI yang akan bekerja pada sektor domestik ke Malaysia harus mengikuti pelatihan minimal 200 jam pelajaran. Menteri Tenaga Kerja dan Transmigrasi (Menakertrans) Muhaimin Iskandar menyebutkan, pelatihan 200 jam yang berbasis pada jabatan kerja meliputi house keeper (pengurus rumah tangga), cooker (tukang masak), baby sitter (pengasuh bayi/ anak), dan caretaker (perawat jompo). Kesepakatan penundaan ini sudah dibahas di dalam pertemuan Joint Task Force (JTF) atau Satuan Tugas Gabungan dari dua negara ini. Pertemuan ini juga berhasil merampungkan kesepakatan akhir antara JTF Indonesia dan JTF

Malaysia. “Selain itu, ini sebagai evaluasi untuk memastikan proses persiapan pemberangkatan TKI domestic worker telah dilakukan dengan baik dan melalui prosedur yang benar,” ungkap Muhaimin di Gedung Kemenakertrans, Jakarta, Kamis (15/3). Di tempat yang sama, Dirjen Binapenta Kemnakertrans, Reyna Usman menambahkan, selain kesepakatan pelatihan TKI 200 jam yang berbasis pada jabatan kerja tersebut, pertemuan JTF ini pun sepakat mengenai range gaji TKI. “Kisaran (range) gaji yang telah ditetapkan oleh JTF antara kedua negara adalah 600 sampai 800 RM. Namun JFT Indonesia tetap berjuang menetapkan upah sebesar minimum 700 RM. Kini adalah sebuah peningkatan dibandingkan sebelumnya yang kisaran gajinya hanya antara 350 s/d 400 RM,” kata Reyna. Selain itu, tambah Reyna ada kewajiban penambahan 27 RM untuk penggunaan one day off (hari libur). Sehingga kalau dalam sebulan liburnya 4 hari itu tidak digunakan

maka pengguna harus membayar 108 RM sehingga total gajinya menjadi 808 RM (700+ 108 RM) “Konsekuensinya pihak Indonesia kita harus betul-betul mengawal pelatihan 200 jam yang berbasis pada jabatan kerja tadi. Sedangkan Malaysia berjanji untuk mencegah adanya Journey visa (visa wisata) dan hanya memberikan visa kerja kepada tenaga kerja Indonesia yang sudah memiliki sertifikat keterampilan atau sertifikat kompetensi berdasarkan 4 jabatan tadi, paparnya. Diketahui, jumlah PPTKIS yang menandatangani kontrak kinerja penempatan TKI domestik worker ke Malaysia sebanyak 176 perusahaan dan jumlah PPTKIS yang sudah mendapatkan rekomendasi pengurusan demand letter adalah 70 perusahaan. Sedangkan informasi dari Malaysia, dari sebanyak 273 Agency yang telah melakukan perjanjian kontrak kerja (aku janji) hanya 5 buah Agency yang diijinkan menerima TKI dari Indonesia pada awal April nanti. (cha/jpnn)

„ Terdakwa kasus suap wisma atlet SEA Games Muhammad Nazaruddin tiba di RS Abdi Waluyo, Jakarta Pusat, Kamis (15/3).

Idap 3 Penyakit

Nazaruddin Dirawat di RS Abdi Waluyo JAKARTA- Terdakwa kasus suap wisma atlet M Nazaruddin didiagnosa dokter mengidap 3 penyakit. Nazar pun harus diopname sampai Jumat (16/3) besok. Apa saja sakit Nazar ”Penyakit Nazar ada 3. Sewaktu di Singapura dia pernah sakit jantung. Jantungnya kumat. Kedua sakit maag. Ketiga tekanan darah drop 90/60,” jelas pengacara Nazar, Hotman Paris Hutapea. Hal itu disampaikan Hotman Paris usai menjenguk Nazar di RS Abdi Waluyo, Jl HOS Cokroaminoto Kav 31-33, Menteng, Jakarta Pusat, Kamis (15/3). Sesuai surat dokter atas ketiga

penyakitnya itu, imbuh Hotman, Nazar akan diopname sampai Jumat besok. ”Dia akan opname sampai besok Jumat, apakah dilanjut atau tidak opnamenya maka keputusannya Jumat sore. Apakah opname diperpanjang atau tidak itu urusan tim dokter. Besok ada pemeriksaan lagi, saat ini kondisi Nazar sangatsangat lemas,” jelas Hotman. Saat ini, yang diizinkan menjenguk adalah pihak keluarga, kepolisian dan penyidik Komisi Pemberantasan Korupsi (KPK). “Tadi ada Nasir,” kata Hotman. Siapa yang membayar tim dokter? “Terdakwa,” jawab Hotman. (dtc/int)

Ketua KPK Tepis Kabar Miring soal Angie dan Miranda JAKARTA- Ketua Komisi Pemberantasan Korupsi (KPK), Abraham Samad memastikan, tidak ada masalah terkait penetapan Miranda Goeltom dan Angelina Sondakh sebagai tersangka kasus korupsi. Abraham mengatakan, penetapan tersangka keduanya melalui mekanisme yang semestinya. KPK menetapkan Miranda sebagai tersangka kasus dugaan suap cek perjalanan sementara Angelina menjadi tersangka kasus dugaan korupsi wisma atlet SEA Games. “Apa yang ditetapkan pimpinan sifatnya kolektif kolegial,” kata Abraham dalam temu media di Jakarta, Kamis (15/3) didampingi jajaran pimpinan KPK lainnya. Abraham menepis kabar yang menyebutkan kalau penetapan tersangka kedua wanita itu hanyalah ambisi pribadi Abraham, tanpa melalui kesepakatan pimpinan yang lain. Kabar itu menyebutkan, belum ada cukup bukti

„ Pimpinan Komisi Pemberantasan Korupsi (KPK), (kiri ke kanan), Bambang Widjojanto, Abraham Samad, dan Busyro Muqoddas menjawab pertanyaan wartawan saat temu media di Gedung KPK, Jakarta, Kamis (15/3). untuk menetapkan keduanya sebagai tersangka. Menurut Abraham, dapat dipastikan, ada dua alat bukti yang cukup untuk meningkatkan status Miranda dan Angelina dari saksi menjadi tersangka. Apalagi, dalam kasus suap cek perjalanan, katanya, nama Miranda sudah bertahun-tahun disebut terlibat.

KPK, katanya, sudah mendalami berkali-kali keterlibatan dua wanita itu dalam kasus masing-masing. “Insya Allah ini bukan terburuburu, ini sudah dihitung matangmatang, didalami berkali-kali. MSG (Miranda) sudah bertahun-tahun, bagaimana tidak bisa ditemukan buktinya?” ungkap Abraham.

Terkait Miranda dan Angelina yang belum diperiksa maupun ditahan KPK, Abraham mengatakan kalau hal itu merupakan bagian strategi mengingat adanya keterbatasan jumlah penyidik KPK jika dibanding jumlah kasus yang ditangani lembaga ad hoc itu. Abraham juga menepis informasi yang beredar di media sosial

terkait gaya kepemimpinannya. Terkait kasus Miranda, tersiar kabar melalui media sosial Twitter kalau Abraham sengaja mengembalikan seorang penyidik ke institusi Polri karena penyidik tersebut memiliki bukti untuk menyeret pihak Bank Artha Graha yang diduga sebagai penyandang dana di balik pembelian cek perjalanan senilai Rp 24 miliar tersebut. Menurutnya, isu itu tidak benar. Dia mengaku justru mendorong Miranda ditetapkan sebagai tersangka kemudian mengungkap auktor intelektualis di balik kasus cek perjalanan. Lagipula, kata Abraham, dirinya tidak mampu mengintervensi kebijakan institusi Polri terkait penyidik-penyidik Polisi itu. “Masing-masing institusi adalah yang punya kewenangan, independensi, sehingga tidak bisa diintervensi. Apa hebat Abraham menelepon Kapolri, Kejaksaan Agung, minta orang-orang itu ditarik?” ucapnya. (kmc/int)



16 MARET 2012


New Yaris Rp190 - Rp227,9 Juta per Unit Penjualan Online Smartphone dan Tablet Meningkat Toyota baru saja merilis wajah baru New Yaris. Kini, New Yaris tampak makin agresif dan gaya dengan desain eksterior dan interior baru. New Yaris ini dipasarkan antara Rp190 juta Rp227,9 juta per Unit. Toyota Yaris memimpin pasar di kelas compact 4x2 medium dengan pangsa pasar 44% dengan penjualan pada Februari sebanyak 2.575 unit. Hal ini juga menjadi rekor penjualan tertinggi Toyota Yaris sejak pertama diluncurkan di 2006. “Kami berupaya terus

berinovasi di produk atau layanan. Kedepannya, kami berharap penyegaran ini sesuai yang diinginkan pelanggan,” kata Direktur Marketing PT Toyota Astra Motor (TAM) Joko Trisanyoto di Jakarta kemarin. New Yaris kini menggunakan teknologi smart system. Untuk menghidupkan dan mematikan mobil ini cukup menekan tombol tanpa menggunakan kunci. Sistem semacam ini diketahui belum ada di produk lain di segmen sama. Tak hanya itu, ada sensor parkir untuk memberi kenyamanan pengendara

saat akan memarkir mobil. Desain eksterior front dan rear bumper New Yaris juga tampak makin segar. Khusus tipe E dan S, ada aeromudguard berdesain baru untuk memperkuat kesan sporty. Rear Combination Lamp juga tampil lebih atraktif dengan menggunakan New LED Lamp. Roda kemudi juga mengalami perubahan dengan desain flat di bagian bawah. Selain itu, bahan yang digunakan adalah bahan kulit yang dipadukan jahitan merah. Kombinasi jahitan merah ini juga terdapat pada shift knob dan bahan fabric di kursi kendaraan. (int/mer)

Rakuten, operator ritel online terbesar di Jepang dan ketiga di dunia, mengungkapkan tingginya penetrasi ponsel pintar dan komputer tablet dapat mendorong peningkatan trafik penjualan online sebanyak sembilan kali lipat pada tahun-tahun mendatang. “Konsumen lebih cenderung membeli perangkat bergerak dibandingkan PC,” kata Chief Mobile Officer Rakuten Kenichiro Nakajima dalam siaran persnya kemarin..

Transaksi online pengguna PC yang menggunakan ponsel biasa (feature phone) meningkat 1,5 lipat sedangkan transaksi mereka akan meningkat dua kali lipat ketika pindah ke ponsel pintar. Menurut ABI Research, belanja melalui perangkat mobile akan mencapai lebih dari US$163 miliar di seluruh dunia pada 2015 atau 12 persen dari omset e-commerce global. Dengan pencapaian itu, Forrester memprediksi m-commerce akan mencapai 31 miliar dolar AS pada tahun 2016.

Penjualan tablet akan meningkat pesat sebanyak 70 juta unit pada 2014. Kenichiro mengatakan para peritel harus menghadirkan sebuah layanan yang memungkinkan konsumen berbelanja sesuai dengan keinginan mereka dengan cara membangun sarana media penjualan baikfisik, mobile dan sosial. “M-commerce adalah saluran ritel yang menarik dan sedang berkembang pesat, peritel harus memanfaatkan peluang ini,” (int/mer)

Ultrabook Samsung

KIA Ceed Tiga Pintu Dijual Tahun Depan Baru saja KIA menghadirkan hatchback Ceed 5-pintu paling anyar dalam pameran Geneva beberapa hari lalu, kini produsen mobil Korea itu kembali memunculkan sketsa versi 3-pintu dengan nama Pro Ceed. Hatchback ini akan tampil paling cepat di Paris Motor Show pada akhir September 2012 dan akan dipasarkan pada 2013. Secara desain, Pro Cee’d sama persis dengan Ceed, hanya dibedakan lewat pintu, sama seperti Rio hatchback. Model lampu depan yang memanjang mendekati pilar A, lengkap dengan aksesori LED di bagian bawah, air dam menyatu dengan rumah lampu kabut, gril khas KIA modern, dan pelek ukuran 18 inci dengan model unik, masih sama dengan versi 5-

Ultrabook Samsung Fokus di Segmen Premium pintu. Begitu juga interior, mulai dari pengaturan setir yang bisa disetel naik-turun dan majumundur, pengatur jok pengemudi secara elektrik, AC dual-zone climate control, layar informasi, hingga sunroof. Dari sektor hiburan tersedia juga koneksi iPod, Aux, dan USB serta kualitas suara yang keluar dari 6 speaker. Fitur

tambahan yang unik juga tersedia, yaitu Parallel Park Assist System (sistem bantuan saat parkir paralel) yang ditunjang oleh keberadaan sensor parkir di depan, samping, dan belakang, serta tersambung dengan komputer untuk membantu setir bergerak otomatis. Jadi, pengemudi hanya tinggal mengatur rem dan gas saja. (int/mer)

Sony Xperia Sola, Bisa “Browsing” Tanpa Sentuh Layar Sony Mobile Communication telah meluncurkan perangkat Android terbaru, Xperia Sola. Perangkat ini memiliki teknologi unik yaitu bisa browsing tanpa menyentuh layar. Sony Mobile menyebut teknologi tersebut dengan “Floating Touch”. Teknologi ini memungkinkan pengguna menelusuri halaman situs dengan melayangkan jemari di atas layar. Cara ini tak berbeda dengan ketika pengguna mengarahkan sebuah kursor, tanpa harus benar-benar menyentuh layar. Ketika tautan yang diinginkan telah ditemukan, tautan tersebut dapat di-highlight dan dengan sentuhan sederhana, halaman tersebut dapat terbuka. Namun, sayangnya fitur Floating Touch ini hanya dapat diterapkan saat berselancar di internet menggunakan browser; tidak bisa digunakan di tempat lain. Xperia Sola memiliki layar 3,7 inci (854 x 480 LCD),

Sony Xperia Sola Reality Display dari Mobile Bravia Engine, prosesor dual core 1 GHz , kamera 5 MP, dan Android 2.3 (Gingerbread) yang dapat ditingkatkan menjadi Android 4.0 (Ice Cream Sandwich). Ponsel ini juga dilengkapi Digital Living Network Alliance (DLNA), xLOUD, 3D surround sound, dan Near Field Communication (NFC). Khusus fitur NFC, perangkat ini memiliki perangkat bernama SmartTags. Ada dua SmartTags yang terdapat

dalam paket pembelian Xperia Sola, dan dapat dipersonalisasi hingga 10 perintah. Di sisi kamera, ponsel ini dilengkapi fitur fast capture yang memungkinkan kamera untuk mengambil gambar ketika berada dalam mode standby dalam waktu maksimal 1,5 detik, cukup dengan menekan satu tombol kamera saja. Ponsel ini akan dipasarkan mulai kuartal II-2012. Namun, harganya belum bisa diumumkan. (int/mer)

Ponsel Smartfren Andro Masuk ke Indonesia SETELAH Smartfren meluncurkan dan membuka masa pre-order ponsel pintar Smartfren Andro pada perhelatan Mega Bazaar Computer 2012 di Jakarta, Februari lalu, kini Andro resmi dipasarkan untuk seluruh wilayah di Indonesia. Produk ini dibanderol dengan harga Rp1.483.900. Menurut Djoko Tata Ibrahim, Deputy CEO Commercial Smartfren, Andro yang berjalan dengan sistem operasi (operating system-OS) Android 2.3 (Gingerbread) ini menjadi produk primadona Smartfren di tahun ini. “Android menjadi OS yang canggih denganketersediaanaplikasiyangbanyak.Dan untuk memenuhi koneksi internet yang cepat, Smartfren memberikan solusi,” ungkap Djoko. Iamenjanjikan,Smartfrenakanmenyediakan update OS Android 4.0 (Ice Cream Sandwich) pada bulan April mendatang. Andro merupakan smartphone yang diproduksi oleh vendor asal China, Hisense. Nama asli tipe Andro adalah Hisense HS-E910. Andro memiliki bentang layar 4 inci dengan resolusi layar 480x800 piksel. Dimensi panjang dan lebarnya 125,5x64mm, dengan ketebalan 10,8mm. Untuk urusan dapur pacu, Andro dibekali prosesor Qualcomm MSM7627A 1GHz, RAM 512MB, baterai Li-ion 1630mAH, dan kamera 3,2MP tanpa LED flash. Sedangkan konektivitasnya, Andro menyediakan slot MicrosSD hingga 32GB, MicroUSB, jack audio 3,5mm, bluetooth, serta CDMA dan Wi-Fi untuk koneksi internet. Djoko mengatakan, jika ada keluhan atau kerusakan pada produk Andro, maka pengguna bisa melakukan perbaikan di galeri-galeri Smartfren di seluruh Indonesia. (int/mer)

Samsung tak ingin ketinggalan meramaikan pasar Ultrabook di Indonesia. Seperti vendor lain pada umumnya, Ultrabook dari Samsung juga menyasar segmen premium. Vendor asal Korea Selatan ini baru saja meluncurkan komputer jinjing ultrabook Series 5 Ultra di Jakarta, akhir bulan lalu. Ultrabook ini dibanderol dengan harga Rp8,5 juta. Menurut Sung Khiun, IT Business Director Samsung Electronics Indonesia, Samsung memang punya tradisi untuk menyasar segmen premium terlebih dahulu, setelah itu barulah merambah segmen menengah ke bawah. Untuk saat ini di Indonesia, Ultrabook yang dijual Samsung berkisar pada 900 sampai 1.100 dolar AS. Hal ini juga dipicu karena masih mahalnya harga komponen dan teknologi yang dibenamkan pada komputer jinjing yang ringan dan tipis itu. Khiun mengakui bahwa pasar di Indonesia cukup unik. Produk yang

dijual dengan harga murah agak sulit menuai sukses. “Tapi giliran ada produk mahal, apalagi didesain dengan elegan, bisa saja laku keras,” ujarnya, usai meluncurkan Ultrabook Series 5 Ultra. Untuk pasar Ultrabook di Indonesia, diprediksi di 2012 ini belum mengalami kenaikan pesat. “Tahun 2012 adalah tahap awal untuk Ultrabook di Indonesia. Tahun 2013 baru akan meningkat pesat,” tegas Khiun. Menurutnya, masyarakat Indonesia masih berorientasi pada harga. Sehingga belum banyak yang memandang Ultrabook dari sisi performa dan sangat mendukung mobilitas seseorang. Lembaga riset International Data Corporation (IDC) memerkirakan bahwa pengiriman perangkat komputer jinjing ke Indonesia akan mencapai 4 juta unit. Dari jumlah itu, Khiun optimis Samsung dapat menjual sekitar 100 ribu unit Ultrabook di Indonesia. (int/mer)

RIM Buat Keyboard Seharga Rp1,8 untuk Playbook Research in Motion (RIM) tak hanya memperkenalkan tablet BlackBerry Playbook, tetapi juga melengkapinya dengan papan ketik (keyborad, red). RIM menyediakan BlackBerry Mini Keyboard melalui pemesanan di dengan harga US$ 199,99 (sekitar Rp1,8 juta). Bagi mereka yang tak terbiasa memakai keyboard virtual, kehadiran papan ketik fisik ini tentu sangat membantu. “Keyboard QWERTY ini menjadi aksesoris yang ideal untuk mengetik e-mail, membuat dokumen, berselancar di web, atau menggunakan aplikasi lain,” kata James Poulton, Direktur Advanced Accessories RIM, dalam keterangan tertulis, Kamis, (15/3). BlackBerry Mini Keyboard merupakan perangkat portabel yang dilengkapi ruang untuk menempatkan telepak tangan di

antara touchpad. Ketika papan ketik fisik ini digunakan, maka tampilan keyboard virtual otomatis tersembunyi dan pengguna bisa menikmati tampilan di layar Playbook secara penuh. Fungsi touchpad mendukung gerakan tambahan seperti kontrol pada tetikus dan touchpad standar di laptop. Misalnya, termasuk ketukan sekali untuk mensimulasikan klik mouse, ketukan dua jari untuk klik kanan, dan menggesek dua jari ke atas atau bawah untuk menggulir secara vertikal. BlackBerry Mini Keyboard memiliki desain yang mungil. Ketebalan tak sampai 6 milimeter. Keyboard ini dapat terhubung ke BlackBerry PlayBook melalui bluetooth dengan fitur enkripsi 128-bit untuk menyimpan data yang melewati antara keyboard dan tablet dengan aman. (int/ mer)

Jessica Biel T ak Mau jadi Gadis Baik -Baik Tak Baik-Baik JESSICA Biel ingin mencoba lepas dari kesan gadis baik-baik yang melekat padanya. Kekasih Justin Timberlake ini ingin orang percaya kalau dirinya juga bisa menjadi gadis nakal. ”Aku rasa aku perlu menghancurkan reputasiku seluruhnya. Aku suka keluar rumah, aku sehat dan suaraku sangat nyaring. Saatnya untuk sangat-sangat jahat,” kata Biel, seperti dikutip dari Femalefirst, Kamis (15/3).

Biel menegaskan bisa juga menjadi wanita yang nakal dan berpikir liar. Bahkan, Biel juga bisa berbuat cabul terhadap boneka barbie miliknya. Dia suka membuat boneka barbienya berhubungan seks. ”Itu selalu. Ayo bermain seks dengan Barbie. Barbieku biasanya telanjang. Aku pernah memotong kepalanya, memotong rambutnya sampai pendek. Akhirnya aku menjadikan kepala mereka sebagai lampu Natal,” tandasnya. (oz/int)

Jumat, 16 Maret 2012

Momo ‘Geisha’

Gantikan Luna di Hati Ariel DUGAAN hubungan spesial antara vokalis Geisha Momo dengan Ariel terus bergulir. Momo pun mengaku sering mengunjungi Ariel di Rumah Tahanan Kebon Waru, Bandung. Meski demikian Momo menampik ia sering mengunjungi Ariel karena punya hubungan khusus. Ia mengaku kunjungannya itu berkaitan dengan kolaborasi dengan eks Peterpan. Namun ia masih merahasiakannya. ”Kerja samanya adalah bukan aku dan Ariel

tapi aku dan (eks) Peterpan. Yang pasti aku berkolaborasi dengan mereka apa lagunya bla blanya tunggu tanggal mainnya,” ujar Momo saat ditemui di sela-sela syuting video klip ‘Cukup Tak Lagi’ di kawasan Cilandak, Rabu (14/3) tengah malam. Momo pun menyatakan tak tahu sudah berapa kali ia mengunjungi Ariel di Bandung. Namun yang jelas, ia tak kesana hanya untuk menemui Ariel.

”Seberapa seringnya ke rutan aku nggak ngitung, tapi aku kesana bukan berarti aku nemuin only Ariel nggak. Mereka kan juga akan mengeluarkan album di situ. Aku menyesuaikan jadwal aku untuk mampir (ke rutan). Itu pun rame-rame ada produser aku juga. Tapi kalau nggak ya kadang aku ya aku nggak ikutan,” papar Momo. Narova Morita Sinaga atau yang akrab disapa Momo ‘Geisha’ mengaku dekat dengan

Ariel. Secara pribadi, Ia pun ‘nyaman-nyaman’ saja dekat dengan eks vokalis Peterpan itu. Namun ia justru khawatir dengan kedekatannya itu akan membuat seseorang terganggu. Lebih tepatnya mengganggu hubungan Ariel dengan seseorang. Luna-kah yang dimaksud? ”Aku nggak merasa terlalu terganggu. Aku malah khawatir dengan aku malah ada orang yang terganggu,” katanya. Lucunya, Momo seperti tak mengetahui hubungan Ariel dan Luna sudah kandas. Entah karena perasaan bahagia, Momo pun terlihat salah tingkah. Dara berdarah Batak itu juga mengaku sering mengunjungi Ariel di Rutan Kebon Waru, Bandung. Lantas seperti apakah kedekatan sebenarnya antara Momo dan Ariel? (dtc/int)


19 Februari - 20 Maret

Rachel Maryam Hamil Muda? Artis dan politisi Rachel Maryam Sayidina telah melangsungkan pernikahan diam-diam dengan kekasihnya, Edwin Aprihandono (Edo). Dia pun digosipkan telah hamil muda. Benarkah? ”Gini aku enggak akan kasih statement hari ini. Karena hal seperti ini statement yang harus diutarakan kami berdua, karena bersangkutan dengan Edo-nya juga. Jadi insya Allah sabar saja, dalam waktu beberapa hari mendatang akan ada statement dari kita berdua,” sanggahnya saat ditemui di Gedung DPR RI, Jakarta, belum lama ini. Berdasarkan kabar yang berhembus, Rachel telah dinikahi Edo secara siri pada 16 Desember 2011. Namun sayang Rachel mendapat kendala restu dari orangtua Edo, lantaran status Rachel sebagai artis yang juga janda beranak satu. Karena keputusan Edo menikah, dia mulai merintis usaha dari nol, karena bantuan finansial dari sang ayah yang mantan perwira tinggi TNI dihentikan. ”Itu dalam beberapa waktu ke depan kami akan kasih tahu,” paparnya. Rachel resmi bercerai dari Ebes pada 13 Oktober 2010. Dia pun pertama kali bertemu dengan Edo saat tergabung dalam kelompok pengajian Al Maghribi. Kedekatan keduanya terjalin saat mereka melaksanakan ibadah umrah bareng. Dan pada akhir tahun lalu, Rachel melepas masa jandanya dengan Edo. ”Segera aku kasih statement. Memang dari awal kita tahu arahnya ke mana, ini adalah hal serius. Karena buat aku enggak mau lagi kalau enggak serius. Dari awal memang tujuannya untuk serius,” imbuhnya. Tak hanya pernikahan diam-diam, bintang Arisan! inipun dikabarkan tengah hamil muda. ”Belum hamil saya. Saat ini enggak. Tidak benar,” bantahnya. Meski membantah hamil, namun dari jawabannya sudah tersirat dia sudah menikah. Bahkan, sinyal mereka akan segera meresmikan hubungan sudah tercium saat Rachel menghadiri peluncuran film Arisan!2 di X2, Plaza Senayan, Jakarta, 24 November 2011. ”Soal nikah kalau disuruh besok, saya sih siap karena lebih cepat lebih baik,” ungkapnya kala itu. (oz/int)

Tidak ada salahnya Anda menerima saran dari siapa pun selama itu membangun semangat hidup Anda. Ikuti saja walaupun ada kritikan. Buktikan bahwa Anda jauh lebih baik daripada apa yang mereka katakan. Tetaplah fokus pada apa yang Anda kerjakan.


DEWI Perssik kecewa pada Ahmad Dhani yang kurang dengan menanggapi kasus yang dialaminya. Untungnya, Dewi mengaku banyak mendapat pelajaran dari kasus ini. Dewi menangis usai divonis hakim dua bulan terkait kasusnya dengan Julia Perez. Dewi merasa tak didukung Ahmad Dhani sebagai bos RCM tempatnya bernaung. “Saya tidak merasa ditinggalkan. Apapun yang dilakukan oleh orang-orang itu, saya akan tetap introspeksi diri, ini pembelajaran diri buat saya,” ucapnya saat ditemui di Pengadilan Negeri Jakarta Timur, Rabu (14/ 3). Lantas, benarkah Dewi marah hingga berencana keluar dari RCM? “Kita lihat saja nanti,” jawabnya. Dewi diputus hakim dua bulan penjara dengan empat bulan hukuman percobaan. Kasus Dewi ini berawal dari tudingan Jupe atas penganiayaan ringan yang dilakukannya. Saat dibutuhkan menjadi saksi, Dhani tak hadir lantaran sibuk. Lantas apa komentar Dhani? “Sebenarnya enggak lepas tangan. Pengacara Depe itu kan dari pengacara kami. Kita sudah memberikan yang terbaik tapi kan pengadilan yang menentukan,” jawab Dhani saat ditemui di studio Dahsyat, Kebon Jeruk, Jakarta Barat, Kamis (15/3). Lantas, bagaimana tanggapan Dhani jika Dewi memutuskan untuk keluar dari RCM lantaran kecewa? “Ya, enggak apa-apa, enggak ada masalah,” kata Dhani santai. Dhani sendiri mengaku sudah berkomunikasi dengan manajer Dewi. Sebagai bos, Dhani menyarankan untuk tidak memperkarakan atau memperpanjang masalah ini dengan mengajukan banding. “Kemarin manajer Depe telepon. Saya bilang enggak perlu banding, terima saja,” ujarnya. (nov/int)

(20 Januari - 18 Februari)

Berikan perhatian kepada orang yang memang Anda sayangi. Jangan sampai Anda menyesal nantinya. Beranikan diri Anda untuk mengambil keputusan dan mencari mana yang menjadi prioritas dalam hidup Anda.


(23 September - 22 Oktober)

Carilah rezeki dari segala. Kalau ada celah lain yang sudah tertutup, carilah pada celah yang lain. Hal ini membuat Anda dan teman Anda merasa nyaman menjalani hidup.


(23 Oktober - 22 November)

Berikan perhatian kepada orang yang memang Anda sayangi. Jangan sampai Anda menyesal nantinya. Beranikan diri Anda untuk mengambil keputusan dan mencari mana yang menjadi prioritas dalam hidup Anda.


(23 Agustus-22 September)

Jangan bosan mencari hal baru yang bisa membuat diri Anda bisa lebih berkembang. Agar rezeki Anda semakin bertambah, Anda harus bekerja keras dan mengembangkan kreativitas Anda lebih tinggi lagi.


(21 Desember -19 Januari)

Perhitungkan kembali semua bisnis Anda. Apabila Anda salah, tidak hanya kerugian saja yang akan Anda alami, tetapi juga semua jaringan Anda akan tertutup. Ini akan menghambat perjalanan Anda.


( 23 November - 20 Desember)

Perhatikan apa yang Anda kerjakan dan lakukan. Jangan mencampuradukan urusan pribadi dengan urusan pekerjaan. Anda juga harus memperhatikan tim Anda. Jangan sampai tim yang sudah Anda bangun itu menjadi kurang solid.


(21 Maret - 20 April)

Buka wawasan yang lebih luas untuk bisa membangun diri. Anda merasa nyaman di mana pun Anda berada dan dalam kondisi apa pun karena Anda sudah siap dengan segudang jalan keluar. Belajarlah dan teruslah belajar untuk bisa mengimbangi alur yang sudah ada dalam hidup Anda.


(21 April - 20 Mei)

Harus lebih sabar dan jangan mudah putus asa menghadapi segala kesulitan yang ada. Manfaatkan jaringan Anda dengan orang lain untuk membuka peluang baik bisnis dan untuk memperkuat lingkungan, sehingga Anda semakin kuat membangun diri Anda dan lebih sukses.


(21 Mei - 20 Juni)

Harus ada target dalam hidup. Apabila ada target, perjalanan Anda akan jauh lebih terarah. Kalau masalah muncul, Anda juga bisa dengan cepat mengatasinya. Fokuskan diri pada apa yang menjadi kebutuhan atau kemauan Anda.


(21 Juni- 20 Juli)

Jangan selalu menyalahkan orang lain tanpa mencari tahu mana yang benar dan mana yang salah. Buatlah orang lain merasa nyaman berkomunikasi dengan Anda. Dengan begitu, semua kesulitan yang muncul bisa diatasi. Peluang Anda pun terbuka lebar.


Yakinlah bahwa kesuksesan akan datang menghampiri Anda dan membuat Anda bisa menjalani hidup lebih baik. Anda juga bisa mengatasi segala masalah yang ada baik, dalam diri Anda maupun keluarga Anda.

Katrina Kaif Sheza-Shezy Idris

Umroh Bareng

MELEP AS keberangkatan dua anaknya ke MELEPAS tanah suci, ayah dan ibu dari Sheza dan Shezy Idris memang telah menanamkan pada anak-anak mereka agar selalu menyucikan diri dengan berangkat umroh setiap tahunnya. Pada kesempatan kali ini, ayah dan ibu dua selebriti tersebut memang tidak ikut berangkat umroh bersama mereka. “Tadinya mau sekeluarga. Karena yang kecil lagi ujian, jadi gak bisa. Kita itu, rencana kita tiap tahun harus menyucikan diri,” ungkap sang mama. Melihat anak-anaknya sudah bisa menghasilkan uang sendiri dengan profesi masing-masing, ayah dan ibu Shezy dan Sheza selalu mengingatkan mereka untuk tak lupa beribadah. “Saya selalu ingatkan istri dan keluarga untuk selalu umroh. Nanti mereka pulang saya baru berangkat bareng yang kecil,” ujar ayahnya. Sedangkan sang ibu pun punya harapan dengan berangkatnya anak-anaknya umroh ini. “Anak-anak sukses dalam karir. Untuk Sheza, kelar skripsi setelah itu semoga ada yang assalamualaikum (melamar),” pungkas mamanya sambil tertawa saat dijumpai di Bandara Soekarno hatta, Tangerang, Banten, Rabu (14/3). (kpl/int)

Tolak Rp1 M Demi Shahrukh Khan AP A yang dilakukan APA Katrrina Kaif ini memang luar biasa. Demi komitmennya pada Shahrukh Khan, bintang Bollywood ini rela melepas uang £127,000 (lebih dari Rp1 miliar) yang seharusnya mengalir ke kantongnya. Seperti dilansir dari Digital Spy, Katrina diminta untuk tampil selama 10 menit di fashion show yang berlokasi di Kochi. Namun karena tidak mau menunda syuting film LONDON ISHQ, dia memilih untuk melepas kesempatan emas itu. Fashion show itu sendiri dijadwalkan pada 25 Maret mendatang. Jika dihitung-hitung, penghasilan yang akan diterima lebih dari £12.000 per menit. Namun sayang saat itu

(21 Juli-21 Agustus)

Katrina harus berada di Inggris untuk keperluan syuting film Shahrukh Khan tersebut. LONDON ISHQ sendiri direncanakan akan rilis tanggal 16 November mendatang. Waktu yang mepet itulah yang kemungkinan membuat Katrina lebih memilih komitmennya di film tersebut. Selain itu, Katrina juga sedang disibukkan dengan syuting film lain, yaitu EK THA TIGER bersama Salman Khan. Katrina sendiri memang dikenal sebagai bintang yang sangat profesional. Walaupun dia pernah terlibat perpisahan yang menyakitkan dengan Salman, namun dia masih mampu bekerja sama dengan baik dengan aktor kawakan tersebut. (kl/int)

Ayumi Hamasaki

Jadi Liar

PERUBAHAN radikal ditunjukkan oleh penyanyi Jepang Ayumi Hamasaki di album barunya. Bertitle PARTY QUEEN, bintang cantik yang biasanya identik dengan imej anggun tersebut kini berubah jadi ratu pesta yang liar. Album PARTY QUEEN tersebut bakal dirilis pada tanggal 21 Maret mendatang. Namun sebelumnya, detail lagu dan cover album telah diungkap ke publik. Album ke-13 Ayumi tersebut terdiri dari 14 track, termasuk lagu How Beautiful You Are yang merupakan soundtrack dari TV seri populer Jepang, berjudul Saigo Kara Nibanme no Koi. PARTY QUEEN terdiri dari tiga edisi, yaitu: CD limited dengan bonus DVD yang berisi 4 music video dari lagu terbaru Ayumi, limited CD dengan bonus 3 DVD (music video dan 2 DVD berisi footage dari konser Countdown Live 2011-2012 ~ Hotel Love Songs), dan yang terakhir edisi CD reguler. (kl/int)

14 JUMAT, 16 MARET 2012

Haus Membuat Kita Lebih Sering Marah Tubuh kita selalu meminta jatah air setiap hari. Kita tentu sudah akrab dengan slogan bahwa tubuh lebih dari 70% tubuh kita berupa cairan, maka seharusnya kita akrab dengan air dan menjaga agar tubuh terhindar dari dari dehidrasi. Sayangnya.. masih banyak dari kita yang selalu mengalami dehidrasi. Tak hanya membuat bibir kering dan pecah-pecah, dehidrasi bisa membuat kita bad mood. Sebuah penelitian pada 25 orang wanita yang dipublikasikan dalam The Journal of Nutrition menemukan bahwa dehidrasi tak hanya menyebabkan sakit kepala, kehilangan fokus, dan rasa nyeri pada sendi, tetapi juga perubahan mood. Efek ini akan langsung terasa walaupun tubuh hanya kekurangan 1% cairan. Bagaimana mengetahui apakah kita mengalami dehidrasi atau tidak selain dari rasa haus? Cek warna urin Anda, jika warnanya kuning gelap, bisa dipastikan Anda mengalami dehidrasi. Warna urin yang baik adalah kuning jernih. Pilih minuman yang mudah diserap tubuh, misalnya air putih, minuman bebas alkohol dan bebas kafein. Maka.. jangan heran jika tanggal PMS masih lama dan tidak ada masalah, tetapi ada dorongan untuk marah-marah tanpa sebab. Bisa jadi Anda sedang mengalami dehidrasi. Jadi, ambil segelas air dan minum pelan-pelan! Lihatlah, Anda akan lebih tenang dan santai beberapa saat kemudian. (kl/int)

Bicara fakta, sampai sekarang pun masih banyak wanita yang kerap punya pikiran salah tentang lawan jenisnya. “Well, maybe. Tapi itu bukan saya pastinya,” begitu mungkin sanggah Anda dalam hati. Hmm, jangan terlalu yakin dulu, honey. Betapa pun banyaknya pria yang telah Anda buat terpesona, bukan berarti Anda telah “lulus” dalam hal memahami isi kepala mereka. Lebih baik baca artikel berikut sampai selesai, then see how surprised you’ll be! 1. Pria bisa menebak SENDIRI apa yang Anda ingin ia mengerti. THE TRUTH: Mereka tak bisa, dan tak akan pernah bisa! Ini adalah kesalahan terbesar yang masih saja wanita pikirkan sampai saat ini. Ya, mungkin si dia bisa dengan mudahnya sadar kalau ada sesuatu yang mendadak bikin Anda murung. Tapi bicara soal penyebabnya, percayalah, pria tak akan pernah bisa menebaknya sampai bibir Anda sendiri yang berkata-kata. Maka, kali lain sikapnya membuat Anda naik pitam, atau ada masalah yang Anda ingin ia pahami, utarakan langsung padanya. Jangan membuang waktu dengan bermimpi bahwa akhirnya pria akan mengerti dengan sendirinya. It won’t happen. 2. Pria bisa berubah. THE TRUTH: Secara fisik memang bisa, tapi sisanya, lebih baik Anda berhenti berharap terlalubanyak.Memangadabeberapapriayang bisa mengubah sifat, atau mengontrol kebiasaan buruknya ketika dia benar-benar punya niat yang besar. Tapi yang harus Anda pahami, sifat tersebut akan tetap ada pada diri mereka. Jadi bisa dipastikan, sikap itu bisa “kambuh” kapan pun. That’s why, saat mencintai seorang pria, Anda harus bisa menerima dia apa adanya, baik dan buruknya. Jika memang tak bisa, lebih baik akhiri, dan berhenti menipu diri dengan harapan bahwa suatu saat dia akan berubah. Ini bisa bikin Anda menyesal nantinya. 3. Pria suka wanita yang dress up setiap saat THE TRUTH: Well, pria nor-

mal mana yang tak suka melihat wanita yang nampak stunning dengan riasan sempurna, berbalut bodycon dress seksi, berdiri anggun beralaskan stiletto tajam menantang... Superhot. And it’s true, pemandangan ini akan memanjakan mereka untuk sesaat. Tapi dear, itu bukan berarti mereka menuntut Anda untuk tampil sempurna 24/7, kok. When it comes to the one they love, pria justru lebih cinta terhadap kecantikan yang datang dari kesederhanaan. Itulah mengapa si dia kerap mengeluh ketika Anda terlalu pusing soal berat badan yang sedikit bertambah, atau menghabiskan waktu berjam-jam hanya untuk dandan. Karena bagi pria, saat terlihat percaya diri dan merasa nyaman dengan apa adanya Anda, itulah saat di mana Anda terlihat paling cantik, bahkan saat Anda mengenakan jeans, T-shirt, dan dengan rambut terikat sekalipun! 4. Pria juga multitasker seperti Anda. THE TRUTH: “Keajaiban” multitasking hanya dimiliki oleh wanita. Pria boleh saja lebih fokus saat mengejar impian mereka. Tapi saat dihadapkan pada berbagai masalah di waktu yang sama, Anda mutlak pemenangnya. Ini juga berlaku dalam soal cinta, lho. Anda mungkin bisa mengatur romantic suprprise untuknya di tengah deadline yang mengejar. Tapi dia? Belum tentu. Jadi, tak perlu terlalu dramatis jika si dia lupa menghubungi Anda saat boy’s night out bersama para sahabatnya, atau tidak mengacuhkan Anda ketika sedang asik mengutaka t i k

mobilnya. Itu bukan berarti dia melupakan Anda. He’s just not born that way. 5. Pria tak suka hal-hal yang romantis. THE TRUTH: They love it the same way as you do! The Notebook mungkin terlalu drama bagi mereka, tapi 50 First Date? Tak ada pria yang tak menyukai masterpiece romantis Adam Sandler itu. Romantic getaway? Mungkin mereka tak pernah terpikir untuk mengaturnya, tapi saat Anda yang memberikan kejutan itu untuknya, he’s definitely gonna love it. See, bukannya mereka tak menyukai halhal romantis. Masalahnya, definisi romantis menurut Anda dan pria memang kerap berbeda. Atau kadang, mereka hanya kurang berinisiatif untuk melakukannya. Bahkan, menurut survei di, 80% pria berharap bisa menjadi lebih romantis, lho. How surprising! 6. Pria mulai jarang berkata I love you = They don’t love you anymore. THE TRUTH: Buang jauh segala pikiran negatif ketika si dia tak lagi mengumbar kata cinta sesering dulu. Selama tak ada bukti nyata akan adanya wanita lain, dan selama dia masih terus berada di samping Anda, berarti semua kecemasan itu sama sekali tak beralasan. Sebaliknya, si dia justru telah benar-benar nyaman dengan hubungannya bersama Anda, sampai merasa tak perlu meyakinkan Anda akan cintanya. Ingat darling, komitmen dari seorang pria merupakan bukti yang jauh

lebih nyata dibanding sekadar kata cinta di awal hubungan. 7. Men are always craving for threesome. THE TRUTH: 100% true–jika Anda berbicara tentang para wanita yang mereka temui saat clubbing, atau dalam kisah one night standmereka. Tapi, jika berbicara tentang wanita yang benar-benar mereka cintai, Anda salah besar! Percaya Cosmo, semua pria, termasuk pasangan Anda, tak akan pernah rela membagi miliknya dengan siapapun. 8. Pria tersinggung jika Anda berusaha meraih orgasme sendiri kala sesi panas bersamanya. THE TRUTH: Oh honey, itu justru merupakan impian mereka! Sama seperti Anda yang kerap merasa kesal ketika pasangan kurang lama melakukan foreplay, si dia pun bisa kesal saat Anda terlalu lama meraih the big O. Jadi, bertanggung jawab atas kepuasan masing-masing adalah win win solutionyang sangat pria dambakan. Saat Anda percaya diri untuk menyentuh berbagai titik “panas” di tubuh Anda, itu justru bisa bikin dia makin “menggila”! 9. Saat patah hati, pria tak pernah “menderita”. THE TRUTH: Mungkin mereka kerap terlihat menikmati party meriah di berbagai club, plus borganta-ganti wanita. Think they are having so much fun? Maybe. Tapi itulah cara mereka untuk melupakan “penderitaannya”. Ingat, berbeda dengan Anda, pria tak punya kebebasan untuk menangis atau berkeluh kesah setiap saat. Jadi, cara terbaik mereka untuk dealing dengan kegagalan cinta adalah... going wild! Psst... Semakin mereka berusaha untuk terlihat senang, biasanya justru semakin dalam luka yang ingin ditutupi, lho. YOU CAN HANDLE THEM! Poin-poin berikut bikin Anda lebih pakar soal “menangani” pria! Stop being such a drama queen! Sikap terlalu dramatis tak hanya membuat pria jengah, tapi juga akan menyiksa diri Anda sendiri. Hasilnya? Pertengkaran besar yang sebenarnya tak perlu ada! Have your own life! Saat Anda mencintai seorang pria, jangan sampai melupakan diri Anda sendiri. Dengan tetap memiliki passionpribadi dan tak terlalu bergantung pada si dia, Anda akan selalu terlihat menarik di matanya. Skip the hesitation! Utarakan maksud Anda dengan jelas, mulai soal perbedaan pendapat, perasaan yang mengganjal, sampai urusan manuver seksi di ranjang. Ini akan jauh mempermudah hubungan Anda dengan pria manapun! (kl/int)


Karamel Bahan: 125 gram mentega, dipotong-potong 100 gram gula 1 sdt ekstrak vanila 2 butir telur 100 gram tepung 1/4 sdt baking powder 1/2 sdt soda kue 35 gram bubuk kokoa 120 ml susu cair 50 gram choco chips 12 buah permen karamel, dipotong persegi Icing Karamel: 100 gram gula palmsuiker 60 gram mentega 2 sdm susu cair 100 gram gula icing, diayak Cara Membuat: 1. Panaskan oven di suhu 180oC. Siapkan loyang cupcake. 2. Di mangkok besar, kocok mentega, gula dan ekstrak vanila hingga berwarna pucat dan creamy. Tambahkan telur satu per satu sambil terus dikocok. 3. Ayak tepung dan bubuk kokoa bersamaan di wadah lain. Masukkan ke dalam adonan secara bergantian dengan susu dan choco chips. Diawali dan diakhiri dengan tepung. 4. Masukkan adonan ke dalam cup hingga setinggi 2/3 cup. Panggang hingga matang. Biarkan dingin sebelum dihias. 5. Untuk icing karamel, gabungkan gula, mentega dan susu di panci. Masak dengan api kecil sambil diaduk terus hingga gula larut. Kemudian panaskan hingga mendidih. 6. Biarkan dingin, kemudian masukkan gula icing. Aduk rata. 7. Masukkan dalam pipping bag, hias bagian atas cupcake. Kemudian tambahkan potongan permen karamel di atasnya. (kl/int)

Arti Mimpi Berhubungan Intim Mimpi sedang berhubungan intim ternyata menyimpan arti atau pesan yang ingin disampaikan hati kecil kepada Anda. Mimpi berhubungan intim, bukan berarti selalu berhubungan dengan kehidupan seksual semata. Bisa jadi, itu adalah ungkapan dari hati terdalam yang ingin menyampaikan perasaannya kepada diri Anda. Dr. Pulkit Sharma, seorang Clinical Psychologist dan Psychoanalytical Therapist mengadakan penelitian akan hal ini, dan hasilnya, ia menemukan 5 makna sesuai mimpi berhubungan intim pada umumnya, sebagai berikut: Mimpi: Pasangan berhubungan intim dengan orang lain ARTINYA: Anda sedang menyimpan kemarahan, pikiran, pesan, atau kekecewaan yang malah Anda pendam sendiri. Anda juga sedang merasakan kesepian dan membutuhkan perhatian dari pasangan, sayangnya Anda malah mendapati pasangan sedang cuek dan tak memberikan perhatian pada Anda. Mimpi: Anda sedang berhubungan intim dengan seorang sahabat dekat ARTINYA: Sejak kapan Anda bermimpi berhubungan intim dengan sahabat Anda? dan seberapa sering mimpi ini muncul? Bila jawabannya cukup sering, maka Anda harus menyadari bahwa ia termasuk orang yang sangat penting dan cukup dekat dengan Anda. Namun, mimpi ini juga bisa berarti perasaan terpendam Anda kepada dirinya, yang mungkin memang terlalu dekat dan berlebihan bila dianggap sebagai teman biasa saja.

perhatian yang mendalam. Mimpi: Mimpi mengalami sexual abuse ARTINYA: Sebenarnya ini termasuk mimpi buruk, karena di sana perasaan Anda sedang campur aduk, antara rasa takut, kecewa serta trauma. Anda mungkin perlu berbicara intim dengan seseorang mengenai masalah yang sedang Anda alami. Terutama bila memang Anda baru saja mengalami pelecehan seksual, trauma ini akan terbawa hingga Anda bisa sembuh dan bangkit lagi. Namun tentu saja hal itu tidaklah mudah. Mimpi: Berhubungan intim dengan mantan kekasih ARTINYA: Banyak di antara Anda yang mungkin memimpikan hal ini. Apabila Anda sudah memiliki pasangan, bukan berarti Anda sedang ingin selingkuh lho. Mimpi ini merupakan bagian dari masa lalu yang muncul sebagai kenangan indah. Pada umumnya mimpi ini ada ketika

Mimpi: Melihat diri sendiri sedang berhubungan intim dengan seseorang ARTINYA: Mimpi ini berarti sebuah cermin hati Anda, di mana Anda sangat merindukan hubungan yang melindungi dan mengerti Anda sepenuhnya. Hati Anda sedang merindukan seseorang saat ini, merindukan kasih sayang dan

perasaan Anda sedang bahagia. Jadi jangan merasa bersalah terhadap pasangan Anda. (kl/int)

All Sport


16 Maret 2012




Tiger Woods

WOODS TERKAYA, MESSI NOMOR 9 SITUS resmi Forbes mengeluarkan daftar atlet dengan penghasilan terbesar sejagat raya hingga saat ini. Nama-nama seperti Tiger Woods ataupun Kobe Bryant masih mendominasi daftar tersebut. Berikut adalah ulasan dan daftar atlet-atlet tersebut. Dari daftar nama atlet berpenghasilan terbesar versi Forbes tersebut, para pesepakbola sohor ternyata berada di luar lima besar. Pemain terbaik dunia, Lionel Messi berada di urutan 9, masih di bawah pesaing utamanya di Liga Spanyol, Cristiano Ronaldo yang berada di urutan 7. Mereka berdua masih kalah dibandingkan senior mereka, David Beckham. 1. Tiger Woods Pegolf asal negeri Paman Sam tersebut masih berada di puncak daftar atlet berpenghasilan terbesar di dunia versi situs resmi Forbes. Woods sendiri diperkirakan memiliki kekayaan hingga 75 juta dollar AS. 2. Kobe Bryant Diperingkat dua, ada sang bintang Los Angeles Lakers, Kobe Bryant. Seperti daftar yang dirilis oleh situs resmi

Forbes, penghasilan pemain 33 tahun ini ditaksir sekitar 53 juta dollar AS. 3. LeBron James Di bawah Bryant, masih ada bintang NBA lainnya, yaitu LeBron James. Bintang Miami Heat tersebut menurut situs resmi Forbes memiliki penghasilan hingga mencapai 48 juta dollar AS. 4. Phil Mickelson Selain Tiger Woods, pegolf yang masuk dalam daftar 10 atlet terkaya di dunia adalah Phil Mickelson . Pegolf berdarah Amerika Serikat ini ditaksir memiliki kekayaan sebesar 47 juta dollar AS. 5. Roger Federer Nama mantan petenis putra nomor satu dunia tersebut menurut situs resmi Forbes berada d iperingkat lima atlet berpenghasilan terbesar di dunia. Roger Federer yang berkebangsaan Swiss memiliki kekayaan senilai 47 juta dollar AS. 6. David Beckham David Beckham merupakan salah satu dari tiga atlet sepak bola yang dapat menembus sepuluh besar atlet terkaya di dunia. Nilai kekayaan Beckham, yang kini menetap di Los Angeles tersebut sebesar 38 juta dollar AS.

7. Cristiano Ronaldo Sesuai dengan nomor punggung Cristiano Ronaldo, ia berada di peringkat tujuh atlet terkaya di dunia. Kekayaan mantan kekasih Paris Hilton ini berkisar 38 juta dollar AS. 8. Alex Rodriguez Di peringkat delapan, ada atlet Baseball kenamaan Amerika Serikat, Alex Rodriguez. Pemain yang berkarir di New York Yankess ini memiliki penghasilan hingga 35 juta dollar AS. 9. Lionel Messi Pesepakbola terbaik dunia tiga kali ini adalah satusatunya putra asal benua Amerika Selatan yang sukses masuk sepuluh besar atlet brepenghasilan terbesardi dunia. Nilai kekayaan pemain yang berjuluk “La Pulga” ini diperkiarakan mencapai 32 juta dollar AS. 10. Rafael Nadal Di peringkat sepuluh, ada nama petenis kenamaan asal Spanyol yaitu Rafael Nadal. Menurut situs resmi Forbes, petenis berusia 25 tahun tersebut memiliki penghasilan sebesar 31 juta dollar AS. (kps/int)

Swiss Open Grand Prix 2012

Harapan Indonesia di Pundak Taufik Petenis nomor dua Indonesia, Taufik Hidayat harus bekerja ekstra keras untuk menembus babak ketiga Swiss Open Grand Prix 2012. Taufik melakoni laga perdananya di babak kedua Swiss Open dengan menghadapi Henri Hurskainen asal Swedia, Kamis (15/3) dini hari WIB. Butuh 59 menit bagi peraih medali emas Olimpiade Athena 2004 ini untuk meraih kemenangan lewat tiga game. Meladeni lawan yang tidak masuk daftar unggulan, Taufik yang menempati unggulan ke-10 sempat dibuat ketar ketir, lantaran Henri mampu merebut game pertama dengan 17-21. Beruntung, Taufik yang unggul pengalaman mampu meredam tekanan yang datang. Dengan penampilan yang tenang, suami dari Ami Gumelar ini mampu membalikkan keadaan dengan meraih dua game berikutnya dengan 21-12 dan 21-16. Taufik pun sukses melaju ke babak ketiga dan akan berhadapan dengan unggulan ke-8 asal China, Du Pengyu.

Taufik menjadi satu-satunya wakil Indonesia di nomor tunggal putra. Pasalnya, dua pebulutangkis lainnya, Tommy Sugiarto dan Andre Kurniawan Tedjono harus lebih dulu angkat koper. Tommy disingkirkan Viktor Axelsen (21-18 21-12), sementara Andre dibekuk unggulan empat asal China, Chen Jin dengan 21-13 21-10. Sementara di nomor ganda putri, Indonesia meloloskan dua wakilnya, Vita Marissa/ Nadya Melati dan unggulan delapan Meiliana Jauhari/ Greysia Polii ke babak kedua. Vita/Nadia menundukkan ganda putri Kanada Alex Bruce/Michelle Li (21-11 21-14), sedangkan Meiliana/Greysia menyingkirkan Mariana Agathangelou/Heather Olver, dua game langsung 21-16 dan 21-16. Di nomor ganda putra, In-

Chisora Kehilangan Surat Izin Bertarung

„ Taufik Hidayat

donesia sukses mengirimkan tiga wakil ke babak kedua. Setelah Angga Pratama/Ryan Agung Saputra, memastikan lolos, Merah Putih menambah dua lagi wakil di babak kedua, yakni pasangan Alvent Yulianto Chandra/Hendra Aprida Gunawan dan Markis Kido/ Hendra Setiawan.

Alvent/Hendra AG yang menempati unggulan ke-5, sukses menundukkan Roger Schmid/ Gilles Tripet asal Swiss dengan 21-11 21-13. Di babak kedua nanti, Alvent/Hendra AG akan berhadapan dengan pasangan India, Rupesh Kumar T/Sanave Thomas. Sementara unggulan empat,

Kido/Hendra juga lolos usai mengandaskan perlawanan ganda putra Malaysia, Gan Teik Chai/Tan Bin Shen. Pasangan unggulan empat ini menang 22-20 21-18. Di babak kedua, Kido/Hendra akan berhadapan dengan ganda putra Taiwan, Chen Hung Ling/Lin Yu Lang. (oz/int)

Audi Siap Caplok Ducati

Moto GP 2012

Hanya Pertarungan Stoner-Lorenzo Managing Director Yamaha Moto Racing, Lin Jarvis menilai musim ini akan menjadi pertarungan head to head antara Casey Stoner dan Jorge Lorenzo. Bahkan Jarvis menilai tidak ada jurang perbedaan antara kedua pembalap itu. Musim lalu Stoner berhasil menjadi juara setelah tampil penuh mendominasi sepanjang musim 2011. Meski begitu, ketika ditanyakan apakah Stoner mampu dikejar oleh Yamaha, Jarvis menjawab dengan penuh keyakinan. “Ya, tanpa keraguan. Saya pikir jelas Jorge (Lorenzo) dan Casey (Stoner) telah menjadi pembalap terdepan selama dua tahun terakhir dan saya pikir itu akan serupa di tahun ini. Perbedaan antara kedua-

nya dapat ditiadakan, karena itu bergantung dari lintasan dan keadaan tertentu,” ujar Jarvis, dilansir dari MotoGP, Kamis (15/3). Jarvis pun memberikan analisis mengenai situasi yang akan dihadapi Stoner, terkait dengan Yamaha. Dirinya yakin pembalap Australia itu akan menghadapi perlawanan ketat dari Lorenzo. “Akhir tahun lalu penampilan Casey mencengangkan, dia tidak membuat kesalahan sama sekali, tetapi Jorge (Lorenzo) menampilkan hal yang sama di tahun sebelumnya. Jadi dalam opini saya, kemungkinan besar musim ini akan menjadi pertarungan head to head antara Jorge dan Casey sejak awal musim ini,” tandasnya. (oz/int)

Audi, yang berada di bawah payung merek top asal Jerman, Volkswagen, dilaporkan sedang melakukan ekspansi untuk mencaplok Ducati. Dikatakan bahwa Audi tengah mengadakan pembicaraan dengan pemilik Ducati, Investindustrial, untuk bisa membelinya. Bulan lalu, Financial Times mengungkapkan hal tersebut, bahwa Investindustrial berencana menjual merek yang menjadi ikon Italia tersebut. Bos Ducati, Andrea Bonomi, mengatakan bahwa pertumbuhan jangka panjang Ducati membutuhkan dukungan dari partner industri kelas dunia. Kini, Financial Times melaporkan bahwa pembicaraan antara Audi dan Ducati telah dikonfirmasi oleh pihak-pihak yang dekat dengan kedua perusahaan tersebut, dan bahwa Audi memang tertarik dengan Ducati. Akan tetapi, detail tentang kemungkinan harga penjualan belum tercapai. Laporan dari Reuters menambahkan, “Kesuksesan kesepakatan (dengan Ducati) akan memperpanjang rivalitas Audi dengan BMW yang sedang merambah ke arena Superbike.” “Saya menyukai semua yang merah,” ujar Chief

„ Rossi

Executive Volkswagen Martin Winterkom dalam konferensi pendapatan tahunan mereka, Senin (12/3). Pernyataan itu merujuk pada warna merah, yang merupakan warna kebesaran Ducati. Ducati merupakan satu dari tiga tim pabrik yang masih berkompetisi di arena MotoGP, dengan mengandalkan juara dunia tujuh kali MotoGP, Valentino Rossi, dan mantan juara dunia 2006, Nicky Hayden, untuk tim pabrik, plus dua pebalap tim satelit. Adapun di arena World Superbike, Ducati baru saja meraih kesuksesan ketika Carlos Checa menjadi juara musim 2011. Grup Volkswagen memiliki anak perusahaan dengan merek mobil ternama, yakni

Lamborghini, Skoda, Seat, Bentley, Audi, dan Bugatti, serta MAN dan Scania untuk kategori truk. Selain Volkswagen, ada beberapa perusahaan lain yang juga tertarik membeli Ducati, antara lain Daimler dan BMW, serta perusahaan asal India, Mahindra & Mahindra dan Hero. Ducati didirikan pada tahun 1926, dan telah memproduksi sepeda motor sport sejak 1946. Saat ini, Ducati sudah menghasilkan beberapa model seperti Diavel, Hypermotard, Monster, Multistrada, Streetfighter, dan Superbike. Jadi, tak mengherankan jika mereka serius tampil di ajang balap Superbike World Championship dan MotoGP. (kps/int)

NASIB petinju kelas berat Inggris, Dereck Chisora bertambah buruk setelah badan tinju pro Inggris mencabut surat izin bertarung karena menganggap dirinya tak Layak memegangnya. Badan tinju pro Inggris melakukan hal ini setelah Chisora terlibat tawuran menghadapi mantan juara dunia tinju kelas berat asal Inggris, David Haye di Muenchen bulan lalu. “Dereck Chisora dianggap tidak layak untuk memegang surat ijin tersebut,” kata sekretaris jenderal dewan, Robert Smith usai pertemuan di Cardiff yang juga dihadiri oleh Chisora. “Kami langsung membatalkan surat ijin tersebut dengan waktu yang tak terbatas.” Sebelumnya, Chisora sudah dijatuhi hukuman larangan bertarung oleh dewan tinju dunia (WBC) yang menyebut tindakan Chisora merupakan tindakan terburuk dari seorang (petinju) Profesional. Chisora kalah angka saat menantang juara dunia tinju kelas berat Vitali Klitschko di Muenchen, jerman, bulan lalu. Sebelum pertarungan, Chisora sudah melakukan ulah dengan menampar pipi Vitali Klitschko dan meludahi adiknya, Wladimir. Puncaknya adalah saat ia terlibat pertengkaran dengan Haye yang saat konferensi pers hadir sebagai wakil televisi Inggris. Saat pertikaian, Chisora juga disebut-sebut mengancam akan membunuh Haye. “Dereck Chisora sudah bersikap tidak sesuai seorang profesional dan juga mengecewakan bukan hanya diri dan keluarga, namun juga para pemegang surat (ijin bertarung) yang selama ini bertingkah laku baik,” kata Smith. Dalam pertemuan dengan badan tinju profesioanl Inggris tersebut, Chisora memang menyampaikan penyesalan dan permintaan maafnya. Sementara manajer Chisora, Frank warren sedang mempertimbangkan apakah pihaknya akan mengajukan banding. (kps/int)

„ Dereck Chisora




Chelsea 22(8) 23 12 2 56% 2 0 4

Napoli Tembakan Pelanggaran Tendangan Sudut Offsides Ball Possession Kartu Kuning Kartu Merah Penyelamatan




23(5) 23 8 4 44% 4 0 4



NGGRIS tercatat sebagai negara dengan jumlah klub terbanyak peraih gelar juara Liga Champion. Total ada empat klub asal Inggris yang mampu meraih juara Liga Champion. BERIKUT DAFTAR PERAIH GELAR LIGA CHAMPION: 1. Inggris

: Liverpool, Manchester United,

2. Italia

: AC Milan, Juventus, Inter Milan

3. Jerman

: Bayern Munich, Borussia Dortmund, Hamburg

4. Belanda

: Ajax, Feyenord, PSV Eindhoven

Notingham Forest, Aston Villa








2 Man City







3 Tottenham H







4 Arsenal







5 Chelsea







6 Newcastle U







7 Liverpool







8 Sunderland







9 Everton







10 Fulham







11 Swansea City







12 Norwich City







13 Stoke City







14 WBA







15 Aston Villa







16 Blackburn R







17 Bolton W







18 QPR







19 Wolves







20 Wigan Athletic








25 20 16

Van Persie Wayne Rooney Demba Ba

Chelsea akhirnya bisa menyelamatkan muka Liga Inggris dengan memastikan satu tempat di perempat final Liga Champions. Dan The Blue menjadi satu-satunya tim yang melaju ke fase tersebut setelah 3 dari 4 perwakilan Liga Inggris lainnya sudah lebih dulu tersingkir. Bermain di hadapan pendukungnya sendiri, Chelsea yang tertinggal agregat gol 1-3 dari Napoli langsung berusaha mengendalikan permainan. Hasilnya, menit 28 Didier Drogba berhasil membuka keunggulan tuan rumah. Skor 1-0 untuk Chelsea dan bertahan hingga turun minum. Babak kedua

baru berjalan 2 menit saat saat John Terry meggetarkan jala gawang lawan dengan sundulan kepalanya yang menyambut umpan dari tendangan sudut, Skor menjadi 2-0. Secara agregat, skor menjadi 3-3 dan Chelsea bisa langsung lolos karena unggul dalam gol tandang. Namun kegembiraan pendukung Chelsea tidak bertahan lama, 7 menit kemudian, atau menit ke 55, Gokhan Inler berhasil memperkecil ketinggalan, skor pertandingan menjadi 2-1 dan agregat kembali menguntungkan Napoli, yaitu 3-4. Menit 75, Frank Lampard kembali membuat pendukung Chelsea bersorak, Lampard membuat gl lewat titik putih menyusul ada pemain Napoli yang menyentuh bola dalam kotak terlarang. Agregat gol pun menjadi 4-4. Hingga pertandingan 2Ă—90 menit waktu normal skor 3-1 untuk Chelsea tidak

lagi berubah. Maka pertandingan pun berlanjut dengan perpanjangan waktu. Perjuangan pasukan Roberto Di Matteo akhirnya terbayar dengan sebuah gol di menit 105, gol yang dicetak oleh Ivanovic, yang juga menjadi gol terakhir di pertandingan ini membuat papan skor menunjukkan angka 4-1 untuk Chelsea. Agregat gol 5-4, dan Chelsea melaju ke babak Perempat Final Liga Champions musim 2011/2012. Dan Chelsea menjadi tim yang terakhir memastikan tempat di Perempat Final, setelah di pertandingan yang berlangsung bersamaan namun lebih dulu selesai, Real Madrid juga melaju ke fase berikutnya berkat kemenangan 41 atas CSKA Moskow. (int)

5. Spanyol

: Barcelona, Real Madrid

6. Portugal

: Benfica, Porto

7. Perancis

: Marseille

8. Skotlandia

: Celtic

9. Rumania

: Steaua Bucurest

10. Serbia

: Red Star Belgrade

Arsenal Man United Newcastle U


26 23




2 Barcelona

26 18




70 60

3 Valencia

26 12





4 Malaga

26 12





5 Levante

26 11





6 Atl Osasuna







7 Ath Bilbao







8 Atl Madrid







9 Espanyol

26 10





10 R Vallecano

26 10





11 Sevilla







12 Real Sociedad







13 Getafe







14 Mallorca







15 Real Betis







16 Granada







17 Villarreal







18 Racing S







19 Sporting Gijon







20 Real Zaragoza








32 30 17

C Ronaldo Lionel Messi G HiguaĂ­n

Real Madrid Barcelona Real Madrid

SERIA A ITALIA KLASEMEN SEMENTARA 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

19 18 16

Milan Juventus Lazio Napoli Udinese Roma Inter Catania Bologna Palermo Chievo Atalanta Genoa Siena Fiorentina Parma Cagliari Lecce Novara Cesena

27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27

17 13 14 12 13 12 12 9 9 10 9 9 9 8 8 7 7 6 4 4

Ibrahimovic Di Natale Edinson Cavani

6 14 6 10 7 5 4 11 8 4 7 12 6 8 8 10 10 7 8 5

4 0 7 5 7 10 11 7 10 13 11 6 12 11 11 10 10 14 15 18

Milan Udinese Napoli

55-22 39-17 42-33 50-28 37-24 40-33 38-36 35-35 29-31 39-44 22-33 31-29 35-48 32-28 27-28 33-42 26-35 30-44 22-46 16-42

57 53 48 46 46 41 40 38 35 34 34 33 33 32 32 31 31 25 20 17

LIGA CHAMPION, INGGRIS & TRADISI SEPAKBOLA Mundurnya prestasi klub-klub sebuah negara dalam kancah Eropa tentu bukan kisah baru. Negara-negara besar memang punya fase kejayaan masing-masing. Apakah kasus kemunduran Inggris ini pun cuma soal siklus? Ketika Italia mendominasi Liga Champion pada akhir 1990-an sampai awal 2000-an, Real Madrid dan Barcelona bergantian menyelamatkan muka Spanyol. Sementara Inggris bergembira atas keajaiban yang dibawa Alex Ferguson di Manchester United. Saat Inggris menguasai, klub-klub seperti Madrid, Barca, Milan, Juventus dan Internazionale memberikan perlawanan berarti. Namun tidak demikian dengan tim-tim Inggris musim ini, saat Spanyol mendominasi. MusimlaluManchesterUnitedmenjadifinalisLiga Champion. Dikandaskan Barca secara total, Alex FergusonmengakuilevelBarcadiatastimnya.Tapi

REAL Madrid memastikan satu tiket di babak perempat final Liga Champion setelah menaklukkan tim Rusia, CSKA Moskow dengan sekor telak 4:1 di Santiago Barnebeu, Kamis (15/3) dinihari atau Rabu malam waktu setempat Dalam pertandingan ini Real Madrid sebenarnya hanya membutuhkan hasil seri 0:0 setelah pada leg sebelumnya menahan CSKA dengan skor 1:1. Saat wasit S. Lannoy? meniup peluit, anak asuh Jose Mornho ini memperlihatkan dominasinya atas tim tamu. Kombinasi Higuain, Ronaldo, Kaka dan Oziel di barisan depan Los Blancos beberapa kali mengancam gawang CSKA yang dikawal Chepchugov. Gol semata wayang pada paruh pertama akhirnya tiba dari kaki Higuain pada menit 26. Berawal dari umpan lambung Mesut Oezil, Sami Khaidira yang tak terkawal bergerak ke kiri lapangan sebelum melepaskan umpan kepada Kaka yang telah menunggu di kiri kotak pinalti. Bola datar yang dilesakkan Kaka, kemudian dibelokkan dengan sempurna

saat itu memang tak ada tim yang selevel Barca. KekalahanMUbukanhalyangterlampaubikinmalu. Namun musim ini mereka tak mampu bersaing dengantim-timnonunggulan.DemikianjugaCity. Sementara nafas Arsenal dan Chelsea yang lebih panjangbisakitakira-kirakapanberakhirnya. Tragedi Heysel tahun 1985 yang menyebabkan kematian 39 orang membuat klub-klub Inggristakbolehmengikutikompetisiluarnegeri. Sebelum hukuman ini, tim-tim Inggris punya prestasi hebat di Champion. Klub antah-berantah seperti Nottingham Forest saja sanggup juara Champion dua kali berturut-turut. Sementara Aston Villa kebagian sekali. Ini belum dihitung dengan masa jaya Liverpool. Tapi selepas hukuman itu, wakil mereka selalu terseok-seok. Setelah penantian panjang, barulah MU memecahkan telur pada tahun 1999, dan disusul masa ke-

oleh Higuain ke gawang Chepchugov. Memasuki babak kedua Madrid tak mengendorkan serangan. Unggul dalam ball possession membuat Tim Ibukota Spanyol ini semakin mendominasi. Ini semakin terlihat dengan sebuah gol indah yang dilesakkan Ronaldo dari luar kotak pinalti pada menit ke 55. Bernabeu kembali bersorak 2:0 untuk Madrid. Dominasi tuan rumah semakin terlihat setelah Karim Benzema yang baru masuk 30 detik sebagai pemain pengganti mencatatkan namanya di papan skor. Striker Prancis ini berhasil memaksimalkan umpan Ozil pada meni 70. Kiper CSKA sebenarnya mampu menahan tendangan Benzema, namun

bangkitan klub Inggris. Dalam hal ini Inggris berutang pada para pelatih seperti Alex Ferguson, Arsene Wenger, dan Jose Mourinho. Mereka membawa perubahan penting bagi Liga Inggris. Dalam buku Soccernomic, Simon Kuper dan StefanSzymanskimenceritakanbetapadiInggris yang demikian antusias dengan sepakbola, profesi pelatih sepakbola tak terlalu dianggap terhormat. Sepakbola adalah olahraga yang tumbuh di kalangan kelas pekerja. Ketika Inggris kian makmur tumbuhlah kelas menengah yang lebih sejahtera, sementara pekerjaan di sepakbola tetap dianggap bagiannya kelas pekerja yang jumlahnya terus mengecil. Tentu tak ada yang salah jika sepak-bola dimainkan kelas pekerja. Persoa-lanya, dengan kian menciutnya

populasi mereka, berarti kian kecil pula kemungkinan bakat-bakat bagus masuk. Sementara kelas-kelas menengah baru kian terekslusi dari sepakbola. Padahal mereka punya keunggulan pendidikan yang boleh jadi berpengaruh baik terhadap perkembangan sepakbola. Kondisi ini terjadi sejak pertumbuhan pesat ekonomi Inggris pasca Perang Dunia II. Di sekitar periode yang sama pula Inggris tak lagi menjadi referensi bagi negara-negara besar sepakbola. Klub-klub Inggris baru bisa berbicara banyak di Eropa pada tahun 1970an sampai awal 1980-an, ketika tiga klub mereka mendominasi Liga Champion. Tapi sepakbola terus berkembang, dan Inggris kembali gagal beradaptasi dengan kerumitan taktik. (int)

bola yang tak tertahan kembali disambar Benzema yang membuat para pendukung Madrit kembali bersorak. 3:0 untuk Madrid. Tim tamu berusaha membalas dengan meningkatkan serangan. Hasilnya di menit ke 77 Zoran Tosic memperkecil kekalahan CSKA setelah memanfaatkan umpan Alan Dzagoev. Unggul jumlah gol Madrid mulai memperkuat pertahanan, serangkaian peluang untuk tim tamu tercipta namun belum ada yang berbuah gol. Justru Madrid yang menambah pundi-pundi gol lewat serangan balik cepat. Benzema yang menerima umpan jauh dari baris pertahanan tak mampu ditahan pemain belakang CSKA. Benzema yang berdiri bebas memilih untuk menyerahkan bola kepada Ronaldo. Dengan tenang CR7 menyarangkan bola yang diikuti gemuruh pendukung tuan rumah pada menit ke 94. Skor 4:1 bertahan hingga pluit babak terakhir. (jpnn)

Metrosiantar, 16 Maret 2012