Page 1

Terdepan, Terbesar, danTerbaik di Siantar-Simalungun Baca juga berita-berita Metro Siantar di


GANJA SIAPA INI? Ditemukan di Kebun Sawit 9 Kg



Edisi 316 -th IX Harga Rp2.000

Inggris vs Belanda



Tak Daftarkan Pekerja Peserta Jamsostek


REKONSTRUKSI PENIKAMAN INANG PENDETA HUTABAYURAJA- Penikaman terhadap Inang Pendeta Melati br Butarbutar direkonstruksi, Selasa (28/ 2) siang. Rekonstruksi yang dipimpin Kanit Reskrim AKP Liston Siregar mendapat pengalawan ketat dari puluhan petugas Polsekta Tanah Jawa. Meski ratusan warga hadir menyaksikan jalannya rekonstruksi, namun rekonstruksi berjalan aman dan lancar. Dalam rekonstruksi, tersangka datang ke rumah Inang Pendeta untuk mencari senter. Setelah mengelilingi rumah belakang Inang Pendeta dan memastikan keadaan aman, tersangka mengambil kursi panjang untuk memanjat. „) Baca Erwin ....Hal 2

„ Tersangka masuk dari dinding dapur rumah korban.

„ Tersangka memukul kepala Inang Pendeta dengan batu.

„ Tersangka menikam leher Inang Pendeta.


Ditelanjangi Mulai Simpang Serbelawan SIANTAR–Korban penculikan dan pemerkosaan Fitri Siregar (22) dan kakaknya Juwita Siregar (26) mengaku trauma atas pemerkosaan yang mereka alami. Lima pria yang menculik mereka, sudah menelanjangi keduanya sejak dari simpang Serbelawan, Minggu (26/2) pukul 02.00 WIB.

Ditemui di tempat kontrakan korban Jalan Danau Ranau, Siantar, Fitri mengatakan tidak bisa melupakan peristiwa tersebut, karena tetap terniang dalam pikirannya. Mulai dari para pelaku memaksa mereka masuk ke mobil dengan menodongan senjata, hingga dia diper-

Manufacturing Hope

Terobosan Dua Penyandang Cacat Organ

kosa di depan kakaknya. Dikisahkan, Sabtu (25/2) pukul 22.30 WIB ketika dia dan kakaknya pulang dari kota menuju kosnya, sebuah mobil mencegat mereka dan diancam pistol dengan menuduh

Oleh: Dahlan Iskan Menteri BUMN HARI itu juga kami sepakati pembentukan PT Jasa Marga Lampung, PT Jasa Marga Sumsel, PT Jasa Marga Jambi, PT Jasa Marga Riau, PT Jasa Marga Sumbar, PT Jasa Marga Sumut, dan PT Jasa Marga Bengkulu. Jasa Marga memegang saham mayoritas di setiap perusahaan itu. Sedangkan pemda memegang sejumlah saham

„) Baca Ditelanjangi ....Hal 2

6 Maret Maulid Nabi Dihadiri Plt Gubsu SIANTAR- Seluruh Kepala Sekolah Madrasah bekerja sama PHBI Kota Siantar, 6 Maret di Lapangan HAdam Malik, merayakan Maulid Nabi Muhammad SAW serta Zikir Akbar. Direncanakan, kegaitan diha diri Plt Gubsu Gatot

Pujo Nugroho. Selain dihadiri para pejabat dari Pemprov Sumut, acara Maulid Nabi Muhammad SAW serta Zikir Akbar akan dihadiri kurang lebih 5.000 pelajar serta

„) Baca Terobosan ...Hal 7

Sekda Bisa Diperpanjang Dua Kali

„) Baca 6 Maret ....Hal 2 (f:metro/Gibson)

„ RE Siahaan menjalani sidang pledoi di PN Tipikor Medan, Selasa (28/2).

Sidang Dugaan Korupsi APBD Siantar

RE: Mengapa Saya yang Tanggung Dosa Mereka? (f:metro/ist)

„ Hulman Sitorus SE didampingi Leonardo Simanjuntak, foto bersama panitia Maulid Nabi SAW dan Zikir Akbar yang diketuai Drs H Amar Lubis.

MEDAN- Sidang lanjutan perkara dugaan korupsi di Dinas Pekerjaan Umum dan Bagian Bina Sosial Sekretariat Daerah Kota Siantar tahun anggaran 2007 kembali digelar di pengadilan Tipikor Medan. Kali ini, majelis hakim yang diketuai Jonner Manik dan Jaksa Penuntut Umum mendengarkan nota

pembelaan (pledoi) dari terdakwa mantan Walikota Siantar RE Siahaan. RE Siahaan mempertanyakan mengapa dia yang menjadi terdakwa tunggal pada perkara dugaan korupsi di Dinas Pekerjaan Umum dan Bagian Bina Sosial

„) Baca RE: Mengapa ....Hal 2

MELAPOR- Korban pelecehan seksual ditemani rekannya saat melapor, Selasa (28/2).

JAKARTA- Peluang Ismail Ginting untuk tetap menduduki jabatan sebagai Sekretaris Daerah (Sekda) Kabupaten Simalungun, terbuka lebar. Meski usianya sudah masuk pensiun, tapi Bupati Simalungun JR Saragih diberi kewenangan untuk memperpanjang lagi. Sekretaris Jenderal (Sekjen) Kemendagri, Diah Anggraeni menjelaskan, sesuai ketentuan

„) Baca Sekda ....Hal 7

Kantor Dispenda Dijaga Ketat, Wartawan Jarang Diterima CUCI OTAK “Sepertinya cerah pagi ini bah. Bagus juga ini mencuci biar cepat kering,” kata Nai Ruddut melihat kea rah matahari.

„) Baca CUCI ....Hal 7

SIANTAR- Ada yang lain di Kantor Dinas Pendapatan Pengelolaan Keuangan dan Aset Daerah (PPKAD) Kota Siantar. Setiap hari, kantor berloteng dan bercat warna putih ini dijaga ketat paling sedikit 3 orang anggota Satpol PP. Sementara, di kantor SKPD lainnya tidak ada

penjagaan ketat, seperti di kantor PPKAD yang dipimpin Setiawan Girsang SE, itu. Amatan METRO, Selasa (28/2) di bawah tangga terlihat tiga orang setiap hari anggota Satpol PP berjaga-jaga dilengkapi dengan kursi dan meja. Di atas meja ada tulisan

‘Tamu wajib lapor’. Saat METRO hendak wawancara dengan Kadis PPKAD, terlebih dulu melapor kepada petugas yang berjaga di bawah tangga. Namun, bagi tamu wartawan, petugas jarang mengizinkan bertemu Kadis. Mereka selalu beralasan bahwa Kadis sedang

sibuk. Alasan lain, Kadis lagi ada tamu. “Maaf Pak, Kadis lagi ada tamu. Besok-besok sajalah ya,” ucap salah seorang anggota Satpol PP yang berjaga.

„) Baca Kantor ....Hal 2





29 Februari 2012



Mengapa Saya yang Tanggung Dosa Mereka? Sambungan Halaman 1 Sekretariat Daerah Kota Siantar tahun 2007. Sementara dalam hal peraturannya, setiap keluar dan masuknya uang di suatu SKPD adalah tanggung jawab kepala SKPD-nya. Kata RE, kenapa para SKPD yang bersangkutan dalam kasus ini, seperti Kadis PU, Bonatua Lubis dan pejabat yang punya kewenangan

anggaran di bansos, dalam hal ini Sekda James Lumbangaol dan Christina Risfani Sidauruk tidak dijadikan terdakwa. Bukan itu saja, fakta di persidangan berdasarkan keterangan saksi-saksi, ahli, alat bukti surat dan barang bukti bahwa pejabat yang punya kewenangan mengeluarkan atau mencairkan dana rehabilitas/pemiliharaan Dinas PU berdasarkan hasil perhitungan ahli


„ Ibu pendeta yang berlumuran darah ditarik tersangka menuju ruang dapur.

Erwin Nadapdap Beringas, Setelah Identitasnya Ketahuan Sambungan Halaman 1 Papan dinding atas rumah dibuka pelahan. Selanjutnya tersangka memasukkan kakinya ke dalam dan menuruni dinding dapur. Pintu dapur paling belakang sengaja dibuka dengan tujuan agar gampang lari jika ketahuan. Selanjutnya tersangka menuju ruang tamu. Ada dua kamar yang pintunya terbuka. Namun setelah memasuki kamar pertama, ternyata Inang Pendeta ada di dalam kamar tidurnya. Korban keluar dan masuk ke kamar depan untuk mencari sarung untuk dijadikan topeng penutup muka. Dengan wajah ditutupi sarung, tersangka masuk ke kamar Inang Pendeta untuk mencari senter. Namun tiba-tiba Inang Pendeta terbangun dan berteriak minta tolong. Tersangka bingung dan langsung menyumbat mulut tersangka dengan kain. Namun Inang Pendeta melakukan perlawaanan. Tersangka yang sudah kalap langsung menikam kaki korban sebanyak dua kali. Dalam satu kesempatan, korban berhasil merampas pisau dari tangan tersangka. Akhirnya terjadi perebutan pisau di ruang tidur Inang Pendeta. Tersangka kembali berhasil merampas pisau dari tangan Inang Pendeta. Inang Pendeta memohon agar korban tidak lagi menyakiti tersangka. Korban membuka kalung emas yang dipakainya dan ingin menyerahkan kepada tersangka. Tiba-tiba korban

berteriak keras. Lalu, korban berhasil merampas sarung penutup wajah tersangka . Setelah itu, wajah tersangka terlihat dengan jelas. Merasa takut dikenali, tersangka menikami Inang Pendeta dengan membabi buta. Kemudian tersangka menarik Inang Pendeta ke dapur. Inang Pendeta yang terluka tetap melakukan perlawanan. Hal ini membuat tersangka kalap dan mengambil batu dan botol untuk dipukulkan ke kepala korban. Keadaan terluka ternyata tidak membuat Inang Pendeta menyerah. Diduga jengkel melihat Inang Pendeta yang terus melakukan perlawanan, tersangka kian bringas dan menikam leher korban. Korban kembali ditarik menuju pintu belakang. Akibat mengalami pendarahan yang cukup hebat, akhirnya tersangka jatuh di depan pintu kamar mandi. Sebelum tersangka menghujamkan pisau ke perut korban, tiba–tiba muncul saksi Simon Butarbutar dari pintu dapur dan berteriak jangan ditikam. Tersangka berusaha sembunyi di balik dinding. Massa yang sudah banyak berdatangan langsung mengamankan tersangka. Sementara korban dilarikan ke RS Vita Insani Pematangsiantar. Anggota Polsekta Tanah Jawa yang hadir di TKP langsung mengamankan tersangka dengan memboyongnya ke Mapolsekta Tanah Jawa. (iwa)

BPKP sebesar Rp8.343.003.152.87. “Bukan saya, melainkan Bonatua Lubis bersama bendahara Dinas PU Jhonny Arifin Siahaan dan untuk Dana Bansos James Lumban Gaol dan Christina Sidauruk. Tapi mengapa saya yang menanggung dosa mereka?” jelas RE. Lebih lanjut RE mengatakan, berdasarkan analisa fakta di persidangan dan analisa yuridis

sudah sehat." Terang pria berusia 52 tahun tersebut. Ia menceritakan, sudah 5 bulan ini minum Milkuma. Dengan tubuh yang sehat, ayah 3 orang anak tersebut dapat menjalani aktifitasnya dengan prima. Ia pun mengajak orang lain untuk merasakan manfaat susu etawa ini, "Mari kita sehat bersama Milkuma." Ajak pria yang berprofesi sebagai wiraswasta tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu etawa. Berbeda dengan susu sapi, sesungguhnya susu etawa memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu etawa pun tidak menyebabkan alergi sehingga aman, dan bermanfaat untuk penderita asma. Satu gelas susu etawa memasok 20,0% dari nilai harian Riboflavin. Milkuma adalah minuman serbuk susu etawa yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu

Koran Kebanggaan Orang Siantar-Simalungun Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pemimpin Umum/Penjab/GM : Wakil Pemimpin Umum : Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Marganas Nainggolan Ari Purnama Goldian Purba Affan Bey Hutasuhut Marganas Nainggolan Goldian Purba Maranatha Tobing Pandapotan MT Siallagan Alvin Nasution Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

ini. Seharusnya pelakunya-kan lebih dari satu, itu bila kita mengikuti pasal 55 ini. Tapi mengapa hanya saya,” ujarnya. Sementara itu, Nota pembelaan Tim penasehat hukum RE, yang dibacakan Sarbudin Panjaitan mengatakan, terdakwa RE Siahaan tidak bersalah. “Pasal-pasal yang diberlakukan JPU kepada tertakwa tidak terbukti. Kami meminta agar

RE Siahaan dibebaskan dari segala dakwaan dan tuntutan hukum,” ujar Sarbudin Panjaitan. Mendengar kesaksian dari RE dan pledoi dari penasehat hukumya, JPU hanya diam dan tetap pada tuntutannya. Karena JPU tetap pada tuntutannya, maka hakim pun menunda sidang hingga Selasa(6/3) mendatang dengan agenda putusan. (mag-6)

Ditelanjangi Mulai Simpang Serbelawan Sambungan Halaman 1 kakak beradik ini sebagai pengguna narkoba. Walau sempat menolak, pelaku tetap memaksa agar mereka masuk ke mobil, sedangkan sepeda motornya dibawa oleh salah seorang pelaku. Dengan menggunakan baju warna merah dan mengaku kepalanya masih pening, Fitri melanjutkan, dalam mobil tersebut kakaknya JS duduk di kursi paling belakang yang ditemani satu orang pelaku, sedangkan ia duduk di tengah dan diapit oleh dua orang pelaku dan yang duduk di depan hanyalah sang supir. Dengan laju mobil sekitar 7080 km per jam, kakak beradik ini dibawa oleh pelaku menuju arah Medan. Di mobil tersebut, para pelaku selalu menanyakan tentang kepemilikian narkoba akan tetapi korban tetap berusaha meyakinkan bahwa mereka tidak ada narkoba. “Pas aku duduk di belakang, aku hendak disetrum dengan alat warna hitam dan menakut nakuti aku,” aku Juwita kepada METRO yang juga sedang bersama Fitri. Ia mengatakan, mereka dila-

rang banyak bicara dan meminta tolong supaya tidak disakiti. Sementara itu, adiknya yang berada di depan kakanya diapit dua orang pelaku dengan mengatakan akan membawa mereka ke polisi jika tidak mengaku. “Aku sudah ketakutan dan tetap mengatakan bahwa kami tidak punya narkoba,” kata Fitri lagi. Selanjutnya lewat daerah Serbelawan, pakaian yang dikenakan oleh Fitri satu persatu dibuka oleh pelaku, dengan alasan mencari narkoba, pelaku membuka seluruh pakaian Fitri dan pelaku meraba raba tubuhmya. Sementara itu, kakaknya yang berada di belakang juga dipegangpegang pelaku. “Mereka tidak kasar dan mengatakan supaya mereka diperlakukan seperti layaknya sama pacar,” katanya. Walau salah seorang pelaku satu marga dengan korban, pelaku bermarga Siregar ini mengaku tidak peduli soal marga. Bahkan ia mengatakan agar korban melayani nafsunya sepuas-puasnya. JS berusaha menolak ajakan pelaku, namun karena dengan pistol yang ditodongkan akihirnya mereka pasrah. Bahkan pelaku memaksa untuk

oral seks walaupun di dalam mobil. Sedangkan adiknya, dikerjai oleh pelaku dengan meraba raba tubuhnya yang masih telanjang. Fitri kembali menjelaskan saat tiba di Tebing, mereka berhenti sebentar dan mobil mereka pun berhenti dan menaikkan satu orang teman pelaku. Untuk menjaga rahasia rumah salah seorang pelaku tersebut, kakak beradik tersebut tidak diperbolehkan melihat dari kaca dan kepalanya ditundukkan oleh pelaku. Selanjutnya mereka pun melanjutkan perjalanan menuju Medan, dan saat tiba di Pabatu setir mobilpun dibelokkan ke arah kanan, dan dibawa cukup jauh. “Sepertinya mereka sudah mengenal lokasi itu karena tak satupun terlihat ada pengaman kebun itu,” kata Fitri. Saat tiba di tujuan, mobil dihentikan dan karena suasana gelap, lampu mobil tetap dihidupkan. Selanjutnya, oleh dua orang pelaku, Fitri ditarik keluar dan dibawa sekitar 100 meter dari mobil. Dalam kondisi yang sudah telanjang, Fitri dibaringkan di tanah dan digilir oleh pelaku. “Mereka itu tidak kasar Bang, bahkan mereka memaksa

supaya mereka diperlakukan seperti pacarnya,” kata Fitri. Usai diperkosa bergantian, Fitri mengaku kesakitan dan kepalanya pening-pening. “Aku tak kuasa menolaknya Bang, karena aku juga diancam dengan pistol,” katanya lagi sembari mengatakan dia diperkosa sekitar 30 menit. Sementara itu, Juwita kakaknya hanya disuruh oral seks oleh dua orang pelaku karena saat itu dia sedang datang bulan. “Setelah puas, mereka pun pergi meninggalkan kami dengan hanya mengenakan pakaian seadanya. Sedangkan barang-barang kami semuanya dibawa,” katanya sedih. Sejak itulah, mereka terpaksa berjalan kaki untuk meminta pertolongan kepada warga hingga mereka tiba di Siantar setelah pacaranya menjemput. Ia mengaku seawaktu melewati kebun tersebut, dia sangat ketakutan. Beruntung saat itu sudah mulai pagi, sehingga jalan sudah mulai kelihatan. Sekitar satu jam lebih mereka baru tiba di rumah warga. Setelah di rumah warga, mereka mengetuk pintu salah seorang warga, namun tidak dibuka. Selanjutnya mereka

juga mengetuk pintu rumah lainnya juga tidak dibuka. Hingga ke rumah yang lain pintunya dibuka, akan tetapi dia harus meyakinkan pemilik rumah bahwa mereka tidak berniat jahat, dan merekapun disuruh mengetuk pintu rumah di sebelahnya. “Kakiku sering terantuk batu, bahkan kuburan pun tak sadar kami lewati saat mau mencari rumah warga,” kata Juwita. Juwita mengatakan, rencananya bulan April mendatang dia akan kembali ke Malaysia setelah dia pulang kampung Oktober 2011 lalu. Sedangkan Fitri mengaku sudah setahun tinggal di Siantar dan pekerjaannya sering pindahpindah, bahkan ia mengaku pernah kerja di Ramayana. Sementara untuk mengungkap kejadian tersebut, pihak kepolisian, Senin (27/2) sudah membawa korban ke lokasi kejadian untuk mengecek tempat pelaku melakukan pemer kosaan. Sedangkan, saksi-saksi dan korban masih dilakukan pemeriksaan di Mapolres Siantar. Humas Polres Siantar AKP Altur Pasaribu mengatakan, bahwa pelaku masih dalam lidik. (mag-1)

6 Maret Maulid Nabi Dihadiri Plt Gubsu Sambungan Halaman 1 undangan dari Siantar sekelilingnya. Untuk mensukseskan acara, Ketua Panitia Maulid Nabi Muhammad SAW serta Zikir Akbar, Drs H Amar Lubis bersama Sekretaris, Suhemi dan penanggung jawab acara peringatan Maranaik Hasibuan MA, serta para pengurus, Selasa (28/2) beraudensi dengan Walikota Pematangsiantar,

Hulman Sitorus SE. Walikota Hulman Sitorus SE didampingi Asisten III Leonardo Simanjuntak SH MHum, dan Kabag Humas Drs Daniel Siregar, menerima audiensi di ruang kerja Walikota, di Jalan Merdeka Pematangsiantar. Ketua Panitia Drs H Amar Lubis dan pengurus lainnya melaporkan, pihaknya akan menggelar peringatan Maulid Nabi Muhammad SAW serta

SEJAK LAMA SUSU ETAWA DIPERCAYA MAMPU MENGATASI ASMA Ketika asma menyerang, saluran n a f a s mengalami penyempitan k a r e n a hiperaktifitas terhadap rangsangan tertentu, yang menyebabkan peradangan. Pada penderita asma, penyempitan saluran pernafasan merupakan respon terhadap rangsangan yang pada paru-paru normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Sucipto, warga Dusun Parakan Muncang-Cimanggung, Rancaekek, Muntilan, Jawa Tengah yang telah lama menderita asma kini memilih Milkuma untuk mengatasi keluhannya, "Sudah 12 tahun lamanya aktifitas saya sering terganggu karena menderita asma. Kalau sudah kambuh, nafas sering terasa sesak, badan tidak pernah gemuk. Untunglah kini saya minum Milkuma, Alhamdulillah sekarang saya

sesuai peraturan perundangundangan yang dijadikan sebagai pedoman dalam pengelolaan keuangan daerah, serta dokumendokumen yang ada pada fakta persidangan maka dirinya tidak bersalah. Mengenai penerapan pasal 55 ayat 1 KUHP, hanya dipergunakan bila pelaku tindak pidana lebih dari satu orang. “Sementara saya diberlakukan pasal

etawa segar dan gula aren. Mengkonsumsi Milkuma sebanyak 2 gelas sehari bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu etawa bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Milkuma dikomposisikan dengan gula aren sehingga aman bagi penderita diabetes. Milkuma juga sangat dianjurkan bagi perokok baik perokok aktif maupun pasif. Milkuma sudah tersedia di apotek2 juga toko obat terdekat dikota anda, atau hubungi, Sumut; 085314072195 / 06191128785. Pematang Siantar; Apt Sehat, Apt dear farma. Tebingtinggi; Apt Tanganmas, Apt Bulian, Apt Saudara Baru. Depkes dengan no PIRT. 6.09.3328.01.395.

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: Syafruddin Yusuf, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

Zikir Akbar dilapangan H Adam Malik, pada tanggal 6 Maret 2012. “Direncanakan akan dihadiri Plt Gubsu Gatot Pujo Nugroho, dan Kakanwil Kemenag Sumut, dan lokasi akan dipadati 5.000-an undangan terutama para pelajar di Kota Pematangsiantar. Maranaik Hasibuan MA selaku penanggung jawab acara menambahkan, kegiatan akan dirangkai dengan zikir akbar serta mendoakan agar

para pelajar sukses mengikuti ujian nasional (UN) nantinya. “Kami berharap kiranya Walikota berkenan hadir dalam peringatan Maulid Nabi Muhammad SAW,” tersebut harap Maranaik Hasibuan. Hulman Sitorus SE dalam kesempatan itu mengatakan, dia akan berupaya hadir dan ikut bersama-sama dengan undangan untuk memperingati Maulid Nabi Muhammad SAW serta Zikir Akbar.

“Kalau tidak ada halangan atau tugas yang sangat penting, saya akan hadir,” ujarnya. Walikota menabahkan, kedamaian merupakan kebanggaan dan menjadi kekayaan bagi kita masyarakat Kota Pematangsiantar. Pasalnya kota ini, walaupun beragama agama, etnis, dan budaya, tapi tetap damai. Maka, jadikanlan kedamaian ini menjadi kekuatan untuk pembangunan. (rel/mer)

Kantor Dispenda Dijaga Ketat, Wartawan Jarang Diterima Sambungan Halaman 1 Saat itu METRO hendak meminta konfirmasi tentang setoran parkir ke PPKAD dari UPT Perparkiran. Sedangkan saat dihubungi melalui telepon, Setiawan tidak mengangkat teleponnya namun hapenya berdering. Dikirim pesan singkat konfirmasi, Setiawan tidak membalas. Sementara UPT Perparkiran Siantar, Agustinus Sitorus saat hendak dikonfirmasi tidak berada di kantornya di tanjung Pinggir. Saat ditelepon, dua nomor telepon selulernya tidak aktif dan dialihkan. Yang mengherankan lagi, d kantor-kantor lain tidak ada penjagaan ketat oleh Satpol PP seperti yang terlihat di kantor PPKAD. Misalnya di kantor Kabag Humas Pemko, BKD, Dishub, Tarukim, Bina Marga dan Pengairan, DPRD, seluruh kantor Camat dan kantor lurah, tak satu pun dijaga Satpol PP. Menanggapi hal tersebut, Ketua Aliansi Jurnalist Indonesia (AJI) Kota Siantar, Tigor

Munthe mengatakan, Setiawan Girsang tidak mengerti apa tugasnya sebagai pejabat publik. Kalau Setiawan mengerti tugasnya sebagai pejabat publik, pastinya Setiawan tidak bersikap demikian. “Setiawan bekerja berdasarkan undang-undang. Demikian juga jurnalis (wartawan) bekerja dilindungi dengan undang-undang nomor 40 tahun 1999. Wartawan ditugaskan mencari informasi publik untuk diketaui masyarakat. Wartawan sebagai perpanjangan tangan masyarakat mendapatkan informasi. Kalau memang Setiawan menghalangi wartawan, sama saja menghalangi masyarakat mendapat informasi,” ujar Tigor. Tigor mengatakan, apakah mungkin masyarakat yang langsung mendatangi kantorkantor di SKPD Pemko Siantar. Kalau ada unsur sentimen Kadis kepada wartawan karena memberitakan berita yang negatif, Kadisnya harus berterima. Artinya Kadis tersebut tidak bekerja sesuai amanah.

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kord Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Roy Amarta, Ismail, Efendi Tambunan, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Erik. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak,

“Apa yang dilihat, dirasakan, dan didengar wartawan itulah yang diberitakan. Tetapi terlebih dulu dilakukan kroscek atau cek dan ricek,” papar Tigor. Kadis adalah abdi negara. Sementara wartawan wakil masyarakat meminta informasi dan memberikan informasi lewat berita. Keduaduanya sama-sama dilindungi undang-undang. Maka dari situ, kalau Setiwan tidak mengerti dengan tupoksi jabatannya lebih baik mundur saja,” tegasnya. Lebuh jauh Tigor mengatakan, tugas Satpol PP bukan melarang wartawan melakukan peliputan. Ada indikasinya, kalau takut menghadapi wartawan ada hal yang sendikit yang ditutupi. “Wartawan datang mewawancarai Kadis atau narasumber bukan atas suruhan preman. Tapi ada undangundang pers yang meminta wartawan mencari berita agar masyarakat mengetahui seperti apa negara ini khususnya kondisi di daerahnya,” ungkap Tigor. (Osi)

Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab PematangsiantarAC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733






Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun ? Kirim SMS ke nomor

Februari 2012



Cepatlah Diperbaiki! Agar pembeli nyaman berbelanja, kepada pengelola Pasar Horas agar segera memperbaiki parit yang tumpat. “Kalau hujan air parit meluap, orang pun jadi malas berbelanja,” kata Maruli Saragih. (dro) Maruli Saragih (44) Pedagang Cabai di Gedung 3 Lantai I Pasar Horas Alamat Siantar Estate No 29. Kota Pematangsiantar

Minimnya Kesadaran PERSOALAN parit tumpat sebenarnya terjadi di manamana. Ini persoalan minimnya kesadaran masyarakat membuang sampah pada tempatnya. Pemerintah sebaiknya melakukan gebrakan untuk mengubah perilaku sadar kebersihan, apakah dengan menggalakkan gotong royong dan lain sebagainya. Intinya bagaimana agar lingkungan bersih. “Sama halnya di kampung kita ini (kesadaran buang sampah pada tempatnya masih minim, red),” ujar Malam. (rait) Malam Sidabutar Manager Hotel Warga Jalan Justin Ajibata


„ Parit tumpat yang berada di Pasar Horas gedung III yang sudah lama tidak di perbaiki sangat mengganggu para pedagang dan para pembeli yang akan berbelanja, Selasa (28/2).

Yang namanya tumpat, soal apapun itu pasti tak menyenangkan. Hidung tumpat, misalnya ini akan sangat mengganggu proses sirkulasi masuknya udara ke dalam tubuh manusia. Pernafasan terganggu. Kemudian akan berembes ke organ tubuh yang lain. Sehingga akan mengganggu konsentrasi si penderita hidung tumpat dalam beraktivitas. Nah, dalam topik kali ini, ‘Terang-Terangan’ menyoroti parit kamar mandi Pasar Horas yang tumpat. Meski tidak memiliki keterkaitan langsung, tapi hidung tumpat dan parit tumpat memiliki kemiripan. Itu bisa dilihat pada dampak yang ditimbulkan. Akibat parit tumpat, pedagang yang menjajakan barang dagangannya mengeluh. Air comberan parit akan meluap, bau tak sedap menusuk hidung. Dampaknya, pengunjung tak

nyaman, pelanggan mereka enggan mengunjungi kios-kios pedagang di Gedung 3 lantai I Pasar Horas itu. Jadi wajar saja pedagang mengeluh. Kondisi ini juga tentu sangat memengaruhi omzet mereka. Maka tak berlebihan bila parit tumpat, rejeki pun tumpat. Tapi itulah, berulangkali keluhan itu ‘diteriakkan’ ke pengelola Pasar Horas, tapi belum ada reaksi. Apa komentar Anda? (dro)

Jangan Kutip Retribusinya Saja! Parit tumpat dapat memicu munculnya penyakit. Dinas Pasar harus peduli, jangan tahunya mengutip retribusi. Kenyamanan pada pedagang juga harus diperhatikan. (hot) Jhones Girsang Wiraswasta Warga Pematangraya

Jorok & Bau Suasana di Gedung 3 lantai I Pasar Horas tak lagi nyaman. Apalagi kalau hujan, bau tak sedapnya menyengat di hidung. Bahkan melampui wangi parfum. “Awak saja yang sekilas melintas tak tahan (menahan bau tak sedap). Apalagi pedagang yang duduk 12 jam (di dekat parit WC kamar mandi Gedung 3 lantai I Pasar Horas), setiap hari mereka menahan bau tak sedap. Yang tak terkatakan merekanya,” tukas Rumiska, dengan logat bataknya yang khas. Ia berharap agar Pemko Siantar segera melakukan pembenahan. “Gampangnya itu, liburkan dulu pedagang yang di luar, kemudian perbaiki sanitasinya. Apalah gunanya kota idaman, kalau hari-hari mencium bau. Kadang-kadang kalau hujan, yang kuning-kuning itu (tinja manusia, red) pun lewat,” katanya. (dro) Rumiska Hutagaol (34) Pedagang Hasil Bumi Warga Jalan Simarjarunjung No8 Kampung Karo, Siantar Selatan

Knalpot Blong Bebas Melaju Polisi terhormat, kalau merazia kendaraan tolong ditindak sepedamotor berknalpot blong. Selain berkontribusi besar untuk polusi udara, knalpot blong juga sangat mengganggu lingkungan. Pengirim: 085373693xxx

Putih Mendekat Merah Menjauh Pak polisi terhormat tolong ditindak pengendara sepedamotor yang menggunakan lampu belakang (rem) berwarna putih. Menurut yang saya ketahui bahwa warna putih itu artinya mendekat, merah menjauh, kuning hati-hati. Jadi kalau lampu remnya berwarna putih, awak kira mendekat rupanya menjauh. Ini sangat mengganggu pengendara yang lain. Pengirim: 08126219xxx

Main Judi di Depan Loket Sejahtera

Pak polisi terhormat, tolonglah dirazia orang yang main judi di terminal. Apalagi mereka yang main judi di depan loket Sejahtera, sudah merajalela. Pengirim: 082164589xxx

Naga Hulambu Tanpa Listrik

Kepada Bupati Simalungun DR JR Saragih SH MM terhormat, tolong perhatikan Desa Dolok Parmonangan, tepatnya Naga Hulambu. Sampai saat ini, listrik belum masuk! Ketiadaan listrik membuat desa Naga Hulambu jadi tertinggal, tidak hanya ketinggal informasi karena tidak dapat (puas) menonton televisi, radio, juga berdampak buruk pada anakanak untuk konsentrasi belajar. Dengan segala hormat, mohon agar dibantu supaya listrik ke kampung kami tersambung. Pengirim: 083196532xxx




Februari 2012





Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter.

Maraknya preman, harus segera diberantas. Salah satu cara dengan membuat sekolah preman. Sekolah preman artinya bukan menghasilkan preman. Jadi kita bekerja sama dengan lembaga, kementerian sosial, kementerian Hukum dan HAM dan masyarakat.

Sikap Kami Rekening Buncit Pegawai Pajak DIREKTORAT Jenderal Pajak sungguh menjadi lumbung duit bagi karyawan yang nekat memperkaya diri. Para pegawai di direktorat itu seperti berlomba mengumpulkan harta haram dalam rekening pribadi, simpanan istri, dan anggota keluarga lainnya. Banyak contohnya. Gayus Tambunan, pegawaiDitjenPajakgolonganIIIA,menjadisalah seorang miliarder kesohor. Kini Gayus mendekamdibuikarenadihukumMahkamahAgung 12tahunpenjara.Contohlain,mantanpegawai pajakyangmempunyairekeningbesarialahBahasyim Assifie. Bahasyim memiliki rekening sebesar Rp64 miliar. Mahkamah Agung menghukumnya 12 tahun penjara. Hukuman terhadap Gayus dan Bahasyim tidak membuka mata karyawan Ditjen Pajak lainnya. Buktinya kini muncul lagi nama Dhana Widyatmika. Karyawan Ditjen Pajak itu telahditetapkansebagaitersangkaolehKejaksaan Agung karena rekeningnya mencurigakan. Duit sekitar Rp60 miliar tersimpan di rekeningnya. Awalnya Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK) mencurigai rekening obesitas itu. Sebagai pegawai negeri sipil golongan III C, rekening buncit Dhana sungguh mencengangkan. Rekening itulah yang kemudian dilaporkan ke Kejaksaan Agung. Kasus rekening gendut karyawan Ditjen Pajakitubisamembuatwargayangtaatmembayar pajak kehilangan kepercayaan kepada negara. Untuk apa orang jujur membayar pajak kalau yang tidak jujur justru diuntungkan dan dilindungi? Buktinya, hingga sekarang tidak ada satu punpihakyangmenggendutkanrekeningGayus dan Bahasyim yang masuk penjara. Kepercayaan wajib pajak pun bisa kian tergerus karena sejak meletus kasus Gayus, Ditjen Pajak belum juga menemukan mekanisme pengawasan internal untuk mencegah pengerukanuangrakyatolehkaryawanDitjenPajak. Kasus Dhana menunjukkan karyawan Ditjen Pajak masih leluasa melahap uang pajak untuk memperkaya diri dan kerabat. Kasus dugaan penggelapan pajak oleh Dhana juga dengan jelas menunjukkan program remunerasi tidak berpengaruh bagi integritas, moral, dan produktivitas pegawai negeri sipil. Padahal, program remunerasi justru pertama kali dilakukan di Ditjen Pajak pada 2007. Program remunerasi pertama kali diterapkan di Ditjen Pajak, tentu saja dengan pertimbangan matang. Penerimaan negara terbesar bersumber dari pajak yang dalam APBN 2012 mencapai Rp1.032 triliun. Jumlah itu naik 18,21% jika dibandingkan dengan pada 2011 yang mencapai Rp872,6 triliun. (***)

Mendibud M Nuh, Selasa (28/2)

Korupsi Menggurita vis a vis Penguasa Tunakuasa Dari waktu ke waktu, pementasan “drama” korupsi di negeri ini semakin menjadi-jadi saja. Yang teranyar “dipentaskan” adalah penetapan Angelina Sondakh oleh Komisi Pemberantasan Korpsi (KPK) sebagai tersangka kasus suap Wisma Atlet. Bahkan, Menteri Pemuda dan Olah Raga, Andi A Mallarangeng, pun harus duduk di kursi pengadilan sebagai saksi dalam kasus tersebut. Padahal, memori kolektif publik masih merekam kuat saat mereka berpemeran dalam iklan antikorupsi beberapa tahun silam. Belum lagi tuntas kasus tersebut, kini muncul lagi kasus mafia pajak jilid dua.

Oleh: Ahmad Arif KARENA itu bukan sebuah kesalahan jika upaya pemberantasan praktik KKN (korupsi, kolusi dan nepotisme) di negeri ini bisa diibaratkan bagai pedagang yang berdagang es di daerah kutup atau penjual es yang menjual es saat musim hujan. Hampir bisa dipastikan dengan kondisi seperti itu tidak ada keuntungan yang diperolehnya. Yang ada malah kerugian semata; rugi waktu, rugi tenaga, rugi pikiran. Begitu kuatnya kah gurita korupsi itu di negeri zamrud khatulistiwa ini? Di mana

eksistensi dan supremasi hokum yang pasca runtuhnya orde baru 14 tahun silam digembargemborkan kepada rakyat? Lalu, bagaimana pula fungsi kepemimpinan nasional saat ini? Tidak adakah korelasi positif konstruktif antara kepepimpinan nasional itu dengan kesejahteraan akar rumput yang telah memilihnya? Dunia pun Memerangi Korupsi Korupsi bukan merupakan masalah Negara-negara tertentu saja, tetapi juga merupakan masalah dunia. Ini dapat dilihat dari sejumlah catatan dokumen PBB (Perserikatan Bangsa-Bangsa) yang menunjukkan adanya komitmen tentang pemberantasan korupsi tersebut. Pada periode tahun 1980-an, dunia dikejutkan dengan semakin maraknya kasuskasus korupsi dengan modus operandi yang semakin canggih. Perkembangan fungsi teknologi, tum-buhnya bank-bank yang mempraktikkan mo-ney laundering (pencucian uang), makin menjadikan pelanggaran hokum khususnya korupsi tersebut semakin kompleks. Demikian pula dengan meningkatnya persaingan bisnis antar Negara, terutama bisnis ilegal seperti narkotika, obat-obat terlarang dan sebagainya. Kejadian tersebut menginspirasi dunia internasional untuk menyelenggarakan Konferensi Internasional Anti Korupsi (International Anti Corruption Conference) pertama di Amerika Serikat pada 5-14 Oktober 1983. Sejak itu, konferensi serupa dilaksanakan dua tahun sekali di Negara yang berbeda. Dari konferensi pertama itu dicapai kesimpulan sembilan poin penanggulangan tindak pidana korupsi. Pertama, pemberantasan dan pencegahan korupsi haruslah dilakukan dari atas atau “top political will” secara konsisten dan mengharuskan keteladanan dari penyelenggara Negara. Kedua, badan yang bertugas menanggulangi

korupsi haruslah independen dan mempunyai wewenang yang penuh dalam upaya pen-cegahan dan pemerantasan korupsi. Ketiga, masyarakat, lembaga-lembaga antikorupsi, media massa, harus berperan aktif dalam mengamati dan mencegah terjadinya gejala-gejala praktek korupsi. Keempat, peraturan perundang-undangan pemberantasan korupsi yang jelas dengan sanksi yang dapat me-nimbulkan kejeraan serta proses peradilan yang cepat dan transparan. Kelima, peraturan perundang-undangan yang merupakan jaring-jaring pencegahan dan pemberantasan korupsi haruslah sinkron seperti undang-undang pelaporan kekayaan penyelenggara Negara, pencucian uang dan sebagainya. Keenam, strategi penanggulangan korupsi haruslah secara konsepsional, kom-prehensif dan terintegrasi mengingat sumber korupsi yang multidimensional. Ketujuh, membudayakan gerakan masyarakat anti-korupsi dan menggalakkannya sehingga kebiasaan-kebiasaan yang cenderung mendorong tumbuhnya praktek korupsi dan kolusi akan menghilang. Kedelapan, perlu dilakukan kerjasama global seperti menyelaraskan atau hormonisasi peraturan perundang-undangan pemberantasan korupsi, lalu lintas devisa, rahasia perbankan, pencucian uang, perjanjian ekstradisi dan sebagainya. Kesembilan, perlu digiatkan riset serta publikasi hasil-hasilnya dengan mencermati perkembangan modus operandi yang erat kaitannya dengan white collar crime dan sebagainya. (***) Penulis adalah peminat kajian sosial keagamaan

Setiap tahun pemerintah menambah nilai anggaran pendidikan. Besarnya anggaran yang disediakan itu jangan sampai disalahgunakan oleh pelaksaan dan pemangku kepentingan di bidang pendidikan dan kebudayaan.Artinya, anggaran sudah disisihkan untuk generasi yang akan datang, jangan dikutik-kutik, jangan dibocorkan.

Wapres Boediono, Selasa (28/2)

Ada yang salah dengan sistem di instansi pajak, sebab fenomena pegawai yang terlibat dengan kasus tumbuh subur di korps yang mengurusi uang iuran rakyat itu. Hal itu karena lalainya pengawasan dari Kementrian Keuangan.

Anggota Komisi III Aboe Bakar Al-Habsyi, Selasa (28/2)



Februari 2012

Angie Siap ‘Diadu’ dengan Rosa JAKARTA- Angelina Sondakh dan Mindo Rosalina Manulang akan dikonfrontir dalam persidangan Nazaruddin. Tak mau kalah dengan Rosa, Angelina Sondakh pun siap hadir untuk bersaksi. Mantan putri Indonesia 2001 yang akrab disapa Angie ini akan menenuhi undangan pengadilan. ”Insya Allah Angie akan hadir sesuai jadwal persidangan sebagai saksi,” jelas pengurus Divisi Komunikasi Publik DPP Partai Demokrat (PD) Kahfi Siregar saat dikonfirmasi, Selasa (28/2). Lebih lanjut Kahfi tidak mau berkomentar. Sahabat dekat Angie ini meminta agar melihat saja persidangan yang akan digelar besok.Angie rencananya akan dihadirkan bersama dengan Rosa pada Rabu (29/2) pukul 08.00 WIB. Keterangan keduanya untuk mencocokan sejumlah informasi di persidangan. Misalnya saja soal percakapan BlackBerry Messenger (BBM). Dalam percakapan BBM pada 2010 lalu, seperti yang dokumen di persidangan terungkap kata-kata ‘Bos Besar’, ‘Ketua Besar’, ‘Apel Malang’, dan ‘Apel Washington’. Percakapan BBM terkait Wisma Atlet ini sudah diakui Rosa, namun Angie membantahnya. Angie mengaku baru memiliki BlackBerry pada akhir 2010. KPK Tetap Telaah Laporan Rosa Mindo Rosalina Manulang akhirnya melepaskan jasa pengacara Ahmad Rifai. Namun hal itu tidak akan berpengaruh terhadap laporan Rosa ke KPK soal menteri yang diduga menerima fee. ”Tidak ada pengaruhnya,” kata juru bicara KPK, Johan Budi, di kantornya, Jakarta, Selasa (28/2). KPK tidak akan terpengaruh dengan ketidakhadiran lagi Rifai sebagai kuasa hukum Rosa. Sebab laporan tersebut, atas nama Rosa yang didelegasikan kepada Rifai. Tim pengaduan masyarakat KPK, dipastikan akan tetap menelaah laporan itu. Pada tahap inilah baru bisa diketahui, apakah laporan Rosa bisa diteruskan atau tidak. ”Akan tetap kita tindaklanjuti, tapi apakah benar informasinya, nanti Dumas yang akan memutuskan,” tandasnya.Rifai menjadi pengacara mantan anak buah Nazaruddin di Permai Grup sejak akhir Januari lalu. Rifai langsung tancap gas dengan membuat sejumlah pernyataan yang menohok. Salah satunya adalah mengenai menteri yang minta fee 8 persen ke Rosa terkait pelaksanaan proyek. Nah, pernyataan Rifai yang dianggap mengumbar informasi ke publik itu sempat membuat gerah Lembaga Perlindungan Saksi dan Korban (LPSK). Bahkan LPSK sempat mengancam akan mencabut perlindungan bagi Rosa. Pernyataan Rifai dinilai kontraproduktif. (dtc/int)

Nasional - Sumut




Anas Bakal Dipanggil KPK untuk Kasus Hambalang JAKARTA- KPK menegaskan jika kasus proyek Hambalang masih berada dalam proses penyelidikan. Ketua Umum Partai Demokrat, Anas Urbaningrum, kemungkinan menjadi salah seorang yang akan diminta keterangannya dalam kasus tersebut. ”Kemungkinan Anas juga nanti akan dimintai keterangan dalam proses penyelidikan Hambalang. Tapi tepatnya kapan saya belum dapat info,” kata juru bicara KPK, Johan Budi, di kantornya, Jl HR Rasuna Said, Jaksel, Selasa (28/2). Menurut Johan, pihaknya tidak berhenti dalam mencari adanya dugaan korupsi dalam perkara ini. Contohnya saja, ada dari pihak Kemenpora yang diperiksa Senin (27/2)

kemarin. Johan menegaskan, kasus ini masih dalam tahap penyelidikan. Beberapa pihak sendiri masih terus dikejar keterangannya oleh KPK. Hal ini agak berbeda dengan apa yang disampaikan Ketua KPK, Abraham Samad. Abraham menyebut akan ada tersangka baru kasus Hambalang. Apakah tersangka baru itu adalah ketua partai yang pernah disebutnya? ”Tunggu sajalah. Saya tunggu teman-teman dulu. Saya kan mau menjaga soliditas pimpinan. Kekompakan,” kata Abraham saat ditanya wartawan apakah tersangka kasus Hambalang akan segera diumumkan dan mengarah ke ketua partai. Abraham sendiri memang sangat bersemangat mengungkap kasus ini hingga tuntas. Tapi dia menghormati pimpinan KPK lain yang lebih sabar dalam mengusut kasus hukum. (dtc/int)

„ Anas Urbaningrum memberikan keterangan pers terkait kasus kasus suap wisma atlet yang menyeret namanya.

SBY Ingin Jajaran Elite Demokrat Dirombak Total

„ Susilo Bambang Yudhoyono

JAKARTADugaan keterlibatan sejumlah elite Partai Demokrat pada kasus korupsi membuat Ketua Dewan Pembina Partai Demokrat Susilo Bambang Yudhoyono gerah. Yudhoyono yang juga Presiden RI menghendaki reshuffle jajaran elite Fraksi PD, termasuk ketua fraksi yang saat ini dijabat oleh Jafar Hafsah. Perombakan susunan pengurus partai berlambang segitiga biru ini diharapkan

dapat membawa perbaikan internal. Soal informasi para pengganti kader-kader yang terkena reshuffle , saat ini masih menjadi teka-teki. Anggota Fraksi Partai Demokrat di DPR, Soetan Bhatugana, yang mengungkapkan niat SBY terkait perombakan susunan pengurus, enggan berkomentar. “Berbahagialah orang-orang yang dipromosikan, karena mereka itu orang-orang yang

berprestasi dan bersih. Pak SBY menginginkan pembersihan total,” kata Soetan kepada para wartawan sebelum mengikuti Rapat Paripurna DPR di Kompleks Parlemen, Jakarta, Selasa (28/ 2). Ditambahkan, seluruh kader partai pemenang Pemilu 2009 ini juga akan terkena rotasi. Terkait pengganti pucuk pimpinan Fraksi PD yang beranggotakan 149 orang ini, menurut Soetan, calon akan

diajukan oleh Ketua Umum Anas Urbaningrum, dan disetujui oleh SBY. Pada kesempatan itu, Soetan kembali mengimbau para kader yang hendak mengungkapkan adanya pelanggaran kode etik partai segera melapor ke Komisi Pengawas. Para kader jangan membongkar aib ke publik. “Demokrat ingin ke dalam solid, ke luar bangkit. Jangan ke dalam sakit, ke luar sulit,” kekeh Soetan. (kmc/int)

ajang kegiatan dan promosi bisnis anda RABU 29 Februari 2012



Grand Opening Laponta Café

Lokasi Nyaman, Hilangkan Stres SIANTAR-Seiring pertambahan waktu, Kota Pematangsiantar sebagai kota nomor dua terbesar di Sumatera Utara juga ikut mengalami perkembangan zaman, baik dari segi teknologi, pendidikan maupun hiburan. Tentunya, seluruh aktivitas masyarakat dalam menjalani perkembangan zaman ini menjadi semakin kompleks. Waktu terus diburu untuk beraktivitas khususnya dalam mencari kebutuhan hidup. Akhirnya sifat jenuh, stres, capek dan yang lainnya akan terasa. Untung menghilangkan stres, salahseorang warga Kota Pematangsiantar, Viktor Sirait SH SLc membuka usaha hiburan Laponta Cafe di Simpang II Pematangsiantar. Usaha sengaja didirikan untuk memberikan solusi bagi masyarakat Kota Pematangsiantar agar tidak jenuh, stres, capek dan yang lainnya setelah seharian atau seminggu melaksanakan aktivitas. “Kalu tidak percaya, datanglah ke ‘Laponta Cafe’,” ajak Viktor Sirait di sela-sela Grand Opening ‘Laponta Cafe’, Selasa (29/2). Di ‘Laponta Cafe’ tersedia makanan dan minuman nasional secara perorangan, keluarga maupun rombongan. Selain berkaraoke ria sebagai hiburan, juga tersedia kolam ikan yang siap dimasak, seafood, spa, fitness dan massage tradisonal. Setiap hari, tambah Viktor, ‘Laponta Cafe’ akan menyediakan live musik dari pemusikpemusik ternama di Kota Pematangs iantar, baik perorangan, trio, vocal grup. “Anda juga bisa bernyanyi ria secara live musik diiringi pemaian musik yang profesional,” tambahnya. Pantauan METRO, saat Grand Opening ‘Laponta Cafe’ terlihat beberapa undangan dari kalangan pejabat-pejabat, seperti Kadis Perhubungan, Naek Lubis dan rombongan, seniman-seniman, LSM, tokoh pemuda, tokoh masyarakat, tokoh agama, tokoh pers dan udangan lainnya. Dalam acara dirangkai perayaan HUT ke12 putri sulung Viktor Sirait, Angelina Friska Sirait. Lagu panjang umurnya mengiring pemotongan kue HUT. (mer)

Cyrus TV Pad 3G Wifi Dibandrol Rp2,888 juta


GRAND OPENING: Pimpinan Perusahaan Siantar Media Pers (Metro Siantar), Maranata Lumban Tobing disaksikan Viktor Sirait SH SLc dan istri, mengguting pita pertanda resminya ‘Laponta Cafe’ dibuka.

DENPASAR-Telkomsel bersama Mitra Komunikasi Nusantara (MKN) menghadirkan “Cyrus TV Pad 3G WiFi” dalam bentuk komputer tablet berbasis Android yang dilengkapi televisi. Perangkat komputer pertama di Indonesia itu dijual seharga Rp2,888 juta. Pelanggan dapat menikmati TelkomselFlash berkecepatan tinggi yang dipadukan dengan fungsi TV Pad secara gratis selama tiga bulan. Head of Sales & Customer Care Telkomsel Regional Bali-Nusra Syaiful Bachri dalam penjelasan bersama Direktur Pengembangan Bisnis MKN Redi Sopyadi, di Mal Bali Galeria, Kuta, mengatakan, pihaknya menargetkan penjualan satu juta paket tersebut. Paket tersebut dapat diperoleh selama pameran berlangsung pada 27 Februari hingga 4 Maret 2012 di GraPARI Jalan Diponegoro, Denpasar, dan GraPARI Mal Bali Galeria, Kuta. “Di samping gratis layanan TelkomselFLash selama tiga bulan, pelanggan juga berkesempatan mendapatkan uang kembali senilai Rp500.000 dari harga normal dan bonus eksklusif senilai Rp150.000,” ujar Ari, sapaan akrab Syaiful Bachri. Pada pameran penjualan tersebut, Telkomsel dan MKN juga menyediakan paket bundling Cyrus One 3G Wi-Fi yang merupakan ponsel berbasis Android dengan layar selebar 4,3 inci. Paket seharga Rp2.299.000 itu juga terdapat akses gratis internet TelkomselFlash selama tujuh hari dan tiga bulan, apabila konsumen melakukan isi ulang pulsa sebesar Rp50.000 setiap


HADIR: Telkomsel bersama Mitra MKN menghadirkan “Cyrus TV Pad 3G Wi-Fi” dalam bentuk komputer tablet berbasis Android. bulannya. Menurut Redi Sopyadi, pelanggan yang membeli paket Cyrus One 3G Wi-Fi pada pameran penjualan di GraPARI Mal Bali Galeria juga memperoleh potongan harga spesial hingga Rp1,999 juta. Untuk registrasi paket TelkomselFlash, pelanggan cukup mengirimkan SMS dengan cara ketik: ULREG100, lalu kirim ke 3636. Paket itu berlaku untuk satu kali pembelian dan tidak otomatis diperpanjang. Komputer tablet Cyrus TV Pad 3G Wi-Fi yang memiliki layar “capacitive multitouch” 7 inci menggunakan sistem operasi Android 2.3 Gingerbread. (int/nik) .


BELANJA ONLINE: Suasana belanja di Haritsa Kids Store Jalan Sutomo saat grand opening, Sabtu (25/2) lalu. Toko ini juga menyediakan layanan berbelanja online.

Haritsa Kids Store Jalan Sutomo dan Lantai II Siantar Plaza

Sediakan Layanan Belanja Online

SIANTAR-Haritsa Kids Store Jalan Sutomo terus berupaya untuk memanjakan konsumen. Selain menyajikan lokasi belanja yang nyaman dengan desain interior menarik, toko pakaian anakanak yang berada di depan Kantor Pos Pematangsiantar ini, juga menyediakan layanan belanja online. Tertarik? Yuk cari tahu informasinya. “Toko ini merupakan wujud komitmen Haritsa Kids Store untuk menyediakan fashion anak dengan model terbaru, kualitas terbaik, dan harga terjangkau kepada masyarakat Pematangsiantar dan sekitarnya,” terang Owner Haritsa Kids H Muhammad Al Haris SE. Menurut pria yang akrab disapa Haris ini, Haritsa Kids Store juga menjamu konsumen yang ingin berbelanja dengan berbagai fasilitas lain. Misalnya; gratis bungkus kado, bila ada konsumen yang ingin membeli pakaian sebagai hadiah kelahiran anak, ulang tahun, dan lainnya. “Cukup membeli barang yang dinginkan saja. Kertas kado dan jasa bungkusnya tidak dipungut biaya alias gratis,” promosi Haris. Selain itu, sambung Haris,

pihaknya juga menawarkan kemudahan dalam retur barang. Artinya, jika dalam dua hari setelah tanggal pembelian selama barang dan segel belum rusak, pelanggan masih diperbolehkan menggantinya dengan produk lain. Haris menambahkan, fasilitas lain yang ditawarkan adalah memberi ruang bermain bagi anak-anak yang ikut orangtuanya berbelanja. Di sini, buah hati Anda akan dimanjakan dengan kolam mandi bola. “Anak-anak bisa mandi bola sepuasnya. Jadi, para orangtua bisa berbelanja dengan tenang, karena anak-anak Anda bisa bermain dengan aman di toko ini,” jelas Haris. Satu hal, segala jenis fashion anak baik produk lokal hingga impor, mulai dari sepatu, topi, tas sekolah, kaos kaki, baju kemeja, kaos, celana kepper, celana lea, gaun pesta, hingga perlengkapan bayi didiskon 10 %. Haritsa Kids Store juga selalu hadir dengan koleksi fashion anak model terbaru dari Bandung dan Jakarta, serta Korea, Cina, Hongkong, serta Kuala Lumpur. Namun, meski impor, pihaknya tetap memberikan harga yang terjangkau oleh seluruh

lapisan masyarakat. Di samping itu, lanjut Haris lagi, bagi para pelanggan yang tidak sempat berkunjung ke Haritsa Kids untuk update model terbaru, saat ini pihaknya telah membuka toko online melalui facebook. Dalam akun tersebut, pihaknya selalu mengupdate model fashion anak terbaru lengkap dengan foto dan harga serta informasi lainnya. Dan, untuk mendapatkan itu semua, pelanggan cukup berkunjung ke haritsakids klik tombol like. Lalu, cari fashion yang sesuai, transfer dana ke rekening yang ditunjuk, maka barang yang dinginkan siap dikirim ke rumah Anda. “Masyarakat Siantar dan Simalungun tidak perlu repotrepot ke luar kota untuk shopping fashion anak dengan model terbaru. Soalnya di Haritsa Kids juga tersedia. Oia, seperti kata pepatah, sesal dahulu pendapatan sesal kemudian tiada guna, oleh karena itu tunda belanja fashion si buah hati sebelum cek harga dan model terbaru di Haritsa Kids Store Jalan Sutomo (depan kantor pos) dan Lantai II Siantar Plaza,” promosi Haris. (ann/nik)




29 Februari 2012



Istri Doyan Kokain

Simpan 88 Gram Ganja

Bule Jerman Lapor Polisi

8 Baterai Dicuri dari Gardu PLN

Dituntut Enam Tahun Penjara

TEBING TINGGI-Dengan Bahasa Indonesia yang tidak begitu fasih, Hans (90) WNI keturunan Jerman yang sudah 10 tahun menetap di Desa Mangga Dua, Kecamatan Tanjung Beringin, Sergai, mendatangi Polres Tebing Tinggi, Selasa (28/2) sore. Maksudnya adalah mengadukan istrinya Tumiah (40), yang kerap menghabiskan uang kiriman anaknya untuk membeli narkoba. Pantauan di kantor polisi, pengaduan Hans dianggap polisi salah alamat. Pasalnya TKP-nya berada di wilayah hukum Polres Sergai, sehingga korban pun diarahkan untuk membuat laporan pengaduan ke sana. Di Polres Tebing Tinggi, Hans sempat menceritakan secara singkat apa yang ia alami selama ini. Menurutnya, wanita yang telah dinikahinya selama lima tahun dan belum mempunyai keturunan itu kerap mencuri uangnya. Parahnya uang itu selalu habis digunakan untuk membeli kokain. Sementara maksud anak Hans mentransfer uang dari Jerman melalui Bank Mandiri Cabang Tebing Tinggi adalah untuk bekal hidupan hari tuanya. Terakhir ia mengaku mengecek uang sesaat sebelum mendatangi kantor polisi bersama Muri (38), temannya yang menetap di Desa Pekan Tanjung Beringin, Sergai. Saat itu Hans dan Muri datang ke Kantor Bank Mandiri di Jalan Sutomo, Kota Tebing Tinggi untuk mencairkan uang. Namun sepulang dari bank, Ia bersama temannya yang kebetulan adalah seorang sopir Angkutan Kota CV Citra, langsung beranjak ke Polres Tebing Tinggi. Muri sendiri mengaku tidak tahu apa maksud Hans mengajaknya ke Polres tersebut. “Saya tidak tahu apa tujuannya ke Polres. Tadi tanpa banyak cerita, dia (Hans) langsung mengajak ke kantor polisi. Rupanya sampai di sini, Hans hendak mengadukan kebiasaan isterinya yang suka memakai narkoba,” ujar Muri. Pengakuan Muri, ia adalah orang yang sengaja diperintahkan Tumiah (isteri Hans) untuk mengantarkan suaminya ke bank. “Kata istrinya tadi Hans mau mengambil uang Rp2 juta hasil kiriman putranya dari Jerman. Mungkin saja saat bertransaksi di teller bank, Hans melihat slip penarikan lewat ATM yang tidak dilakukannya. Bisa saja yang melakukan penarikan itu adalah isterinya. Trus karena kesal dengan isterinya, Hans marah dan melaporkan ke polisi,” tambah Muri. Saat berada di kantor polisi, Hans baru menceritakan bahwa selama ini istrinya punya kebiasaan memakai narkoba. Dan untuk membeli narkoba itu, istrinya dicurigai selalu mencuri uang di rekening Hans lewat ATM. Kasubbag Humas Polres Tebing Tinggi AKP Ngemat Surbakti membenarkan pihaknya kedatangan seorang warga asal Jerman yang telah lama menjadi WNI dan menetap di Sei Rampah. “Pria berjenggot putih itu hendak melaporkan kebiasaan isterinya yang suka memakai narkoba. Tapi karena tempat tinggal pelapor berada di wilayah hukum Sergai, kita arahkan yang bersangkutan melapor ke sana,” ujar Surbakti. (awi/hez)


JPU M Azril membacakan tuntutan kasus kepemilikan ganja terhadap Wasis Syahputra, di PN Simalungun, Selasa (28/2). SIMALUNGUN-Waris Syahputra (39) warga Dusun III Manik Maraja, Kecamatan Sidamanik, Simalungun dituntutenamtahunpenjaraolehJaksa Penuntut Umum (JPU) M Azril, Selasa (28/2). Terdakwa terbukti memiliki ganja seberat 88 gram dan melanggar pasal114ayatIUURINo35Tahun2009 tentang Narkotika Jo pasal 132 UU RI No 35 Tahun 2009 tentang Narkotika.

Sambungan Halaman 8 karung ditemukan sembilan bungkusan daun ganja yang di pak menggunakan plastik. Antara percaya dengan tidak, Nasir pun panik dan berlari ke Pos Polisi Kerasaan. Di sana iamelaporkantemuannyaitu.Taklama kemudian polisi pun tiba di lokasi. “Sayasempatberhentiketikamelihat dua goni beras itu. Begitu saya buka, isinya ternyata daun ganja kering,” kata

Sidang yang digelar di Pengadilan Negeri Simalungun sekira pukul 15.00 WIB berbeda dari biasanya. Sidang dengan agenda tuntutan ini terpaksa menggunakan ruang sidang anak karenasalahsaturuangsidangdirehab. Selanjutnya usai majelis hakim yang dipimpin Samuel Ginting beranggotakanHeriyantidanSitiHajar membuka persidangan, langsung JPU

membacakan tuntutannya. Menurut JPU M Azril, terdakwa ditangkap, Minggu, (16/10) tahun lalu sekira pukul 13.10 WIB, dari Pekan Selasa Sidamanik. Saat itu terdakwa berniatmenjualganjayangdimilikinya seberat 88 gram. “Terdakwa membeli ganja itu dari Deny Syahputra (berkas berbeda) di kediaman Anton Simangungsong (berkas berbeda), di Afdeling II B Toba Sari, Kecamatan Pematang Sidamanik, dua hari sebelumnya. Informasi ganja itu diketahui terdakwa saat Deny bertemu dengannya di Halte Toba Sari. Di sana Deny mengaku baru saja turun dari Aceh dan membawa ganja,” jelasnya JPU. Lebih lanjut ia menerangkan, Deny langsung mengajak terdakwa ke rumah Anton yang juga berniat membeli ganja. Selanjutnya traksaksi berlangsung dengan lancar dan terdakwa membawa pulang ganja

Ganja Siapa Ini?

Nasir. Namun meski polisi sudah melakukan sweeping di Nagori Kerasaan, pelaku pembawa ganja seberat 9 kilogram itu belum terungkap. Diduga Berasal dari Aceh Dugaan sementara, bungkusan ganja itu berasal dari daerah Aceh. Sebab jika dilihat dari kualitasnya, ganja ini termasuk barang yang berkualitas terbaik. “Kualitas ganja ini terlihat sangat

baik, atau biasa disebut para pemakai ganja dengan daun bakung. Hingga kini kita terus melakukan penyelidikan untuk menemukan pemiliknya,” kata Sirait. Ditambahkannya, saat ini polisi sedang melakukan pengejaran terhadap pemilik ganja. Bahkan, sebelum dibawa ke kantor polisi, pihaknya sudah terlebih dulu melakukan pengintaian. “Pemiliknya sudah kita umpan

yang dibelinya dari Ddeny. “Awalnya hanya Deny dan Anton saja yang berhasil diamankan polisi. Tapi setelah polisi melakukan pengembangan, terdakwa ditangkap di Pekan Selasa Sidamanik beserta barang bukti,” sebut Azril. Sambungnya, hal yang meringankan terdakwa, yakni belum pernah dihukum, masih memiliki tanggungan anak dan istri. Selanjutnya terdakwa mengakui dan merasa bersalah serta berjanji tidak akan mengulanginya kembali. Sedangkan hal yang memberatkan, perbuatan terdakwa tidak mendukung program pemerintah dalam pemberantasan narkotika. “Dengan berbagai pertimbangan, Jaksa menyatakan terdakwa terbukti bersalah dan menuntutnya enam tahun penjara dikurangi masa tahanan, denda Rp800 juta subsider enam bulan penjara,” ungkapnya. (mua/hez)

agar segera mengambil ganja tersebut, tapi belum berhasil,” tambahnya. Sedangkan identitas pelaku masih belum bisa digambarkan. Ia juga tidak menampik bahwa kawasan itu merupakan basis terbesar peredaran ganja di wilayah hukumnya. Hingga kini sembilan kilogram daun ganja sudah diamankan di Mapolsek Perdagangan. (mag-02/ hez)

Bandar Dadu & Leng Diringkus Sambungan Halaman 8 Dolok Marlawan, Siyam Priyadi (60) warga Pematang Asilum, Kecamatan Gunung Malela, Sarto (52) warga Nagori Bangun dan Farida Hairani (48) warga Jalan Pamatang Kecamatan Siantar. Selain ke lima pelaku, pemilik warung juga ikut diamankan dari lokasi. Sementara sebelumnya, sepuluh pelaki judi jenis dadu berhasil ditangkap polisi dari Simpang Hinalang, Kecamatan Purba,

Simalungun. Mereka adalah Tamsar Tambu Saribu (44), Haposan Sipayung (38), Dohot Sinaga (35), Darto Sinaga (35), Darli Simarmata (58), Deymon Purba (36), Jonam Tambun saribu (58), Yondrianto Saragih (31), Edi Makmur Lingga (40) dan Durahman Purba (41). Semuanya adalah warga Simpang Hinalang. Plt Kasat Reskrim Iptu B Manurung kepada wartawan, Selasa (28/2), saat menggelar perkara judi ini di Ruang Sat Reskrim Polres Simalungun

mengatakan, pihaknya akan terus berupaya memberantas berbagai macam tindak pidana perjudian. “Tertangkapanya kesepuluh pelaku ini bermula dari laporan masyarakat yang resah terhadap permainan judi yang kerap dilakukan di warung milik Tamsar Tambun Saribu. Dalam permainan judi tersebut Edi Makmur Lingga berperan sebagai bandar. Lalu mereka kita tangkap,” katanya. Kepada polisi, Edi mengaku memperoleh modal untuk

melakukan judi dadu dari Ammin Tondang yang pada saat dilakukan penggrebekan berhasil melarikan diri. Rencananya, usai menggelar judi dadu itu, ia akan mengembalikan uang yang dipinjamnya beserta Rp300 ribu sebagai uang lampu. “Dari para pelaku disita sembilan buah dadu, satu mangkok, piring alas yang berisi tebakan dadu dan uang sebesar Rp5 juta.semuanya akan dijerat pasal 303 KUHPidana tentang perjudian,” tambah Manurung. (hot/ hez)

Siswi SMP Ngaku Diperkosa Sambungan Halaman 8 menetap di Jalan Kornel Simanjuntak, mengaku sedih atas peristiwa yang dialami putrinya. Sesuai penuturan BS, peristiwa bermula saat korban keluar dari rumah, Minggu (26/2) siang. Tujuannya adalah pergi ke warnet. Kebiasaan korban ini sempat ditegur orangtuanya. Namun ternyata teguran itu semakin membuatnya tak pulang hingga larut malam. Senin (27/2) sekira pukul 01.30 WIB, korban baru selesai

main internet dan tidur di rumah temannya. Namun karena waktu sudah terlalu malam, korban takut mengetuk pintu. Tiba-tiba empat pria mengendarai dua sepedamotor menghampiri korban. Hanya beberapa saat, keempat orang tersebut mengajak korban naik ke sepedamotor. Selanjutnya salah seorang dari empat pria ini membawa korban ke kontrakannya, di Jalan Sisingamangaraja. Sedangkan tiga lainnya pergi meninggalkan BS bersama DP dengan alasan akan

membeli sesuatu. Saat itulah korban mengaku diperkosa. Setelah puas melampiaskan nafsunya, tersangka ketiduran hingga pagi. Sekira pukul 07.00 WIB, korban keluar dari kamar dan berangkat ke rumah temannya di kawasan Kecamatan Siantar Selatan. Sebab untuk pulang ke rumah,BS masih merasa takut akan dimarahi orangtua. Siang harinya, BS pun diantarkan temannya pulang ke kediamannya. Saat itu BS berterus terang menceritakan kejadian yang

sudah dialaminya. Bagai mendengar petir di siang hari, ibu korban langsung menagis histeris. Untuk lebih meyakinkan, ibu korban melihat pakaian dalam anaknya yang terdapat bercak darah. Peristiwa ini langsung dirembukkan di keluarga korban. Selasa (28/2), mereka menempuh jalur hukum. Korban yang didampingi keluarganya langsung membuat pengaduan ke Polres Pematangsiantar. Taka lam setelah pengaduan itu, polisi langsung menjemput dan mengamankan DP. (mag-1)

Sambungan Halaman 8 Minggu (26/2) sekira pukul 10.00 WIB. Hal itu langsung dilaporkan kepada Gomgom Simbolon, selaku petugas di kantor PLN. Kaget dengan kabar tersebut, Gomgom langsung melakukan cek lapangan. Di sana, ia baru yakin bahwa baterai dicuri. Sebab dari sembilan buah baterai yang ada di gardu sebelumnya, kini hanya tinggal satu. Kasubbag Humas Polres Pematangsiantar AKP Altur Pasaribu yang dikonfirmasi membenarkan adanya pengaduan kasus pencurian dengan korban PT PLN Cabang Pematangsiantar. “Seorang supervisor Opdis PT PLN bernama Khairul Syah (54) sudah membuat pengaduan. Kasusnya sedang diselidiki,” katanya. (hez)

Pelaku Sudah 2 Kali Dipenjara Sambungan Halaman 8 Tersangka terpaksa masuk sel untuk yang ketiga kali setelah menjambret tas milik Siti Sipayung (48), pengendara sepedamotor di Jalan Asahan kilometer 4, satu jam sebelum ditangkap. Berhasil merampas tas berisi uang Rp2 juta dan surat-surat berharga, pria ini melarikan diri ke arah Jalan Perdagangan. Namun gerak geriknya sempat tercium polisi. Setelah dilakukan penyelidikan, pelaku didapati sedang bersantai ria di salah satu kafe kawasan Bukit Maraja. Saat itu juga tersangka langsung diciduk tanpa perlawanan. Setelah diinterogasi, ia mengaku sudah menjambret sebanyak empat kali. Dari tangannya, polisi menyita satu unit sepedamotor Yamaha Jupiter Z BK 4915 TAL, dua Hp Nokia dan Blackberry diamankan dari tangan pelaku. Untuk mempertanggung jawabkan perbuatannya, kini tersangka mendekam di sel tahanan Polres Pematangsiantar. Kepada METRO, tersangka mengaku sudah melakuakn aksinya sejak Januari hingga Februari 2012. Beberapa lokasi yang menjadi tempatnya beraksi antara lain, Jalan Diponegoro, depan Kantor Denpom, Jalan Sudirman Depan Pengadian Negeri yang juga tak jauh dari Polres Pematangsiantar, Jalan Tanah Jawa, dan Jalan Asahan Batu IV, Simalungun. Hasil jambret yang diperolehnya berkisar jutaan rupiah. Semua digunakannya untuk berfoya-foya. “Aku sudah pernah masuk penjara dua kali. Yakni tahun 2006 dan tahun 2011. Keduanya dengan kasus yang sama, yaitu jambret. Vonis pertama hanya delapan bulan. Setelah keluar aku kembali masuk penjara dengan kasus sama dan hanya divonis enam bulan,” katanya. Kasat Reskrim Polres Pematangsiantar AKP Azharuddin menjelaskan, tersangka dijerat pasal 365 KUHPidana dengan hukuman maksimal sembilan tahun penjara. Ia juga menambahkan, tim khusus akan berupaya menyapu bersih para pelaku pencurian dengan kekerasan. “Dengan adanya kerjasama baik antara polisi dengan masyarakat, diharapkan keamanan dan ketertiban di Kota Siantar akan tercipta,” katanya. (mag-1/mag-02/ hez)

Sambungan Halaman Satu Terobosan Dua Penyandang Cacat Organ Sambungan Halaman 1 yang besar kecilnya ditentukan oleh kemampuan daerah. Terobosan ini segera saya komunikasikan kepada Menteri PU. Beliau pun segera mengamini. Tinggal urusan administrasi yang harus dipersiapkan. Dalam kesempatan menghadap Presiden SBY Jumat siang lalu, terobosan di Sumatera ini juga saya sampaikan. Tentu presiden sangat menghargai kerja sama antara BUMN dan Kementerian PU seperti ini. Secara bergurau presiden menambahkan: kapan dibangun PT Jasa Marga Pacitan? Di bagian akhir kesepakatan Palembang itu dikonkretkan pula jalan tol mana saja yang akan dibangun. Di Lampung akan dibangun mulai Bakauheni sampai Bandar Lampung ditambah tol di dalam kota. Lalu tol yang menuju Sumsel. Di Sumsel sendiri ditentukan jalur dari Palembang ke Prabumulih, Palembang-Siapi-api, dan Palembang ke perbatasan Jambi. Di Jambi dibangun jalan tol dari perbatasan Sumsel ke Kota

Jambi. Juga dari Kota Jambi ke Tanjung Jabung. Di Riau jalan tol dibangun dari Pekanbaru ke Dumai dan Pekanbaru ke Palalawan. Di Sumbar dibangun jalan tol dari Padang ke Padang Panjang dan langsung ke Bukittinggi terus sambung ke perbatasan Riau. Di Sumut jalan tol dibangun dari Medan ke Tebingtinggi dan terus ke Kuala Tanjung. Juga dari Medan ke Binjai. Jumat sore lalu saya langsung ke Semarang. Di perkebunan kopi Banaran, kami mengumpulkan para manajer dari 10 pabrik gula yang paling sulit di Indonesia. Ini sebagai kelanjutan dari acara bahtsul masail kubro di Surabaya sebulan sebelumnya. Sampai menjelang tengah malam kami bahas bagaimana 10 pabrik tersulit itu bisa keluar dari ‘asfalas safilin’! Problem pokok pabrik gula adalah di pertanyaan yang mendasar ini: di manakah gula itu dibuat? Orang awam tentu menjawab: gula dibuat di pabrik gula! Itu salah! Yang benar, gula itu dibuat di sawah!

Tanaman tebu yang semula kecil tumbuh menjadi besar lalu berisi gula. Ada tebu yang gulanya sedikit, ada tebu yang gulanya banyak. Bergantung pada bibit, cara tanam, pemeliharaan, pemupukan, dan seterusnya. Di sinilah ditentukan banyak sedikitnya gula akan diproduksi. Walhasil, pabrik-pabrik gula harus kembali memperhatikan tata cara penanaman tebu yang benar. Pabrik gula bukanlah pembuat gula. Pabrik gula justru hanya membuang gula. Kadar gula dari sebatang tebu yang, katakanlah 1 kg, setelah digiling hanya keluar gula 0,6 kg. Bukankah ini berarti tugas pabrik gula justru hanya mengurangi gula? Malam itu, di Banaran, para manajer 10 pabrik gula ‘asfalas safilin’ menyepakati untuk back to basic. Tanaman tebu diperhatikan dan efisiensi pabrik ditingkatkan. Paginya, setelah ke Universitas Negeri 11 Maret Solo dan Universitas Muhammadiyah Solo, saya menuju Bantul dan Gunung Kidul. Saya diajak melihat program peningkatan produksi

beras yang dilakukan dengan model korporasi. Pelaksananya PT Sang Hyang Seri, salah satu BUMN pangan kita. Di sawah di Bantul inilah untuk kali pertama saya mengemudikan mesin panen padi. Begitu cepat panen padi dengan menggunakan mesin. Rasanya seperti di Amerika Serikat saja. Sore itu kami berdiskusi dengan para petani. Ternyata sudah begitu berubah cara berpikir petani kita. Mereka serba menginginkan modernisasi. Mereka minta traktor, mesin panen, mesin perontok gabah, mesin blower untuk menghilangkan gabuk, dan mesin pengering gabah. Berbeda sekali dengan ketika saya sering kerja di sawah saat masih remaja dulu. Saya biasa ndaud benih, mencangkul di sawah, nggaruk, dan memegang ani-ani untuk panen. Kembali ke sawah di Bantul kali ini saya melihat kita semua, para pelayan petani, harus berubah pikiran secara total: petani kita sudah menghendaki modernisasi yang paripurna. Kini BUMN memang memiliki

tiga program besar di bidang pangan: Gerakan Peningkatan Produksi Pangan Berbasis Korporasi (GP3K), Proberas, dan Food Estate. GP3K adalah program bantuan untuk petani agar bisa mendapatkan benih unggul, pupuk yang cukup, dan obat hama yang diperlukan. Bantuan itu dikembalikan pada saat panen. Istilahnya yarnen (bayar saat panen). Proberas adalah program untuk menampung sawah-sawah petani yang kurang produktif. Kini banyak petani yang hanya mengusahakan sawahnya dengan hasil 5,1 ton/ha. Daripada seperti itu lebih baik sawahnya diserahkan ke BUMN. Targetnya, BUMN akan mengerjakannya secara intensif dan akan menghasilkan sekitar 6,7 ton/ha. Petaninya untung, negara pun memiliki produksi beras yang cukup. Sedang program Food Estate adalah pembukaan sawah baru 100.000 ha di Kaltim, yang kini dalam tahap persiapan pengadaan lahan. Terobosan memang harus banyak dibuat. Di jalan tol maupun di sawah-sawah. (*)

Sekda Bisa Diperpanjang Dua Kali Sambungan Halaman 1 batas usia pensiun (BUP) adalah 56 tahun. Hanya saja, bisa diperpanjang hingga 58 tahun. ”Jadi bisa diperpanjang dua kali. Batas usia pensiun itu kan 56, bisa diperpanjang ke 57, dan diperpanjang lagi 58 tahun. Jadi tak masalah,” ujar Diah

Anggraeni kepada koran ini di kantornya, kemarin (28/2). Seperti diberitakan, isu pergantian Sekda Simalungun belakangan santer terdengar. Sejumlah nama kandidat disebut-sebut berpeluang menggantikan Ismail Ginting. Antara lain Resman Saragih, Amran Sinaga, Ramadani Purba,

Jhon Sabiden Purba, Topot Saragih, serta info terbaru, Wilson Manihuruk ikut meramaikan bursa calon Sekda Simalungun. Hanya saja, pada saat bersamaan muncul juga kabar bahwa bupati akan tetap mempertahankan Ismail Ginting sebagai Sekda. Dengan demikian bupati akan memperpanjang masa pensiun

yang bersangkutan untuk kedua kali. Tahun lalu, Bupati telah memperpanjang masa pensiun Ismail Ginting. Saat ini usia Ismail Ginting telah memasuki 57 tahun. Sesuai keterangan Sekjen Kemendagri Diah Anggraeni, Ismail bisa diperpanjang sekali lagi. “Itu sepenuhnya

kewenangan bupati,” kata birokrat asal Semarang itu. Namun, kalau toh mau melakukan penggantian, bupati mengusulkan nama-namanya kepada plt Gubernur Sumut Gatot Pujo Nugroho, untuk diteruskan ke Mendagri. “Usulannya bupati ke gubernur,” pungkas Diah. (sam)

CUCI OTAK Sambungan Halaman 1 “Kenapa banyak pakaianmu yang kotor Nai Ruddut,” jawab Ullus yang sudah sejak 20 menit duduk di warung itu. “Sebenarnya bukan kain saja yang mau kucuci, pejabat yang sok hebat dan korup juga mau kucuci, biar bersih otaknya,” Nai Ruddut sedikit bercanda. “Ada-ada saja kau ini Nai Ruddut. Masak pejabat mau kau cuci, payak keringnya,” jawab Ullus juga dengan canda. “Apa yang kalian ributkan, kok masalah cucian pula. Kalau soal cuci pejabat banyak yang mau dicuci, karena kinerjanya sudah banyak yang kotor,” Janggaleman yang baru tiba langsung nimbrung. “Ada juga pejabat lain dari yang lain,” kata Nai Ruddut. “Lain kayak mana maksud kau Nai Ruddut,” tanya Ullus. “Ada itu, pejabat yang selalu dikawal personel Satpol PP. Bukan hanya satu, tiga orang itu yang mengawal,” kata Nai Ruddut. “Ohh yaaa. Kok lain pejabat yang satu itu. Ini agak lain kedengarannya,” kata Janggaleman. “Maksud kau Kadispenda Siantar itu ya Nai Ruddut. Memang kulihat lain dari yang lainnya itu. Perlu juga disoroti itu,” kata Ullus mulai nyambung dan mengetahui pejabatnya. “Luar biasa memang pejabat satu itu. Selain itu, dia juga susah ditemui wartawan untuk wawancara. Bagaimana pula pejabat publik tak mau memberikan informasi yang dikerjakannya kepada publik melalui media,” kata Janggaleman heran. “Berarti yang dikerjakannya tak layak konsumsi publik semua. Atau semua yang dilakukannya kotor,” Nai Ruddut geram. “Ini dia pejabat yang perlu direndam, dicuci otaknya lalu dikeringkan Nai Ruddut. Agar otak dan perbuatannya bisa bersih,” Ullus terbahak-bahak. “Bagus juga itu, perlu juga kita usulkan kepada Walikota bahwa jasa pencuci otak pejabat sudah ada, dengan harapan kinerjanya bisa lebih baik,” Nai Ruddut kian menjadi-jadi dengan angan-angan gilanya. “Betul itu, kita sangat setuju akan hal itu,” Janggaleman mengakhiri. (leo)

Crime Corner




Fakta, Peristiwa dan Hukum

Ganja Siapa Ini?

Ditemukan di Kebun Sawit, Seberat 9 Kg


TAK BERTUAN- Kapolsek Perdangan AKP TP Butar-butar menunjukkan sembilan kilogram daun ganja kering tak bertuan, ditemukan di perladangan sawit Kampung Hulam Kelurahan Kerasaan I, Kecamatan Pematang Bandar, Simalungun, Selasa (28/2).

KERASAAN-Sembilan kilogram daun ganja kering tak bertuan ditemukan di areal perkebunan sawit milik warga di lingkungan VII Nagori Kerasaan, Kecamatan Bandar, Simalungun, Senin (27/2) sekira pukul 13.00 WIB. Kanit Intel Polsek Perdagangan Ipda D Sirait kepada METRO mengatakan, orang yang pertama kali menemukan ganja kering tak bertuan ini adalah Muhammad nasir (50), warga sekitar. Pengakuan Nasir dalam pemeriksaan di kantor polisi, awalnya ia berniat pergi bekerja ke sawahnya, sembari mencari rumput untuk makanan sapi. Ketika melintas di areal perkebunan sawit lingkungan VII Nagori Kerasaan,

Kecamatan Bandar, ia menghentikan laju sepedamotornya. Pasalnya ia menemukan dua karung beras berukuran 15 kilogram yang berisi rerumputan di bagian atasnya.

Karena curiga dan penasaran, Nasir mendekati dan membuka karung. Saat itulah ia terkejut. Sebab dari dalam

„)Baca Ganja ..Hal 7

8 Baterai Dicuri dari Gardu PLN baterai jenis DC 12V SIANTAR-Sebanyak delapan buah Pematangsiantar, ang Cab PLN PT k Merk GS Premium, mili iah itu diembat rup juta dicuri. Baterai seharga delapan berada di Jalan ng, Galu g ban maling dari gardu listrik Tim t, Sabtu (25/2) sekira Raya Kelurahan Simarito, Siantar Bara pukul 09.00 WIB. seorang petugas PLN, Persitiwa pertama kali diketahui

„)Baca 8 Baterai ..Hal 7

1 Penjambret Lagi Ditangkap

Pelaku Sudah 2 Kali Dipenjara


„ Erwin Lubis, residivis yang ditangkap kasus jembret.

S I A N TA R - P o l i s i meringkus seorang pelaku jambret dari salah satu kafe yang berada di lokalisasi Bukit Maraja, Kecamatan Gunung Malela, Simalungun, Senin (27/2) sekira pukul 15.00 WIB. Tersangka adalah Erwin Lubis (31) warga Jalan Emas Kelurahan Baru, Siantar Utara, yang merupakan residivis dan dua kali keluar masuk penjara.

„)Baca Pelaku.Hal 7


„ BS (kanan), siswi SMP yang mengaku diperkosa mahasiswa, Selasa (28/2). Foto Marihot Sinaga

BANDAR JUDI- Para bandar judi dadu dan leng yang ditangkap dan diamankan di Polres Simalungun, Selasa (28/2).

Bandar Dadu & Leng Diringkus RAYA-Lima pelaku judi leng, diringkus polisi saat asik bermain kartu di warung milik Darmawati br Panjaitan (36), di Nagori Bangun,Kecamatan Gunung Malela, Simalungun, Senin (27/2) pukul 17.00 WIB. Dari tangan mereka, berhasil disita barang bukti satu set kartu

Siswi SMP Ngaku Diperkosa

joker dan uang Rp285 ribu. Ke lima tersangka masing-masing Rommel Tambun (50) warga Jalan Danau Ranau Kota Siantar, Perdomuan Hasibuan (52) warga Nagori

SIANTAR-BS (14), seorang siswi kelas dua salah satu SMP Negeri di Pematangsiantar mengaku diperkosa DP, yang berstatus mahasiswa perguruan tinggi kota ini. Pemerkosaan terjadi, Senin (27/2) dinihari, di seputaran Jalan Sisingamangaraja. Kepada METRO, ayah korban B Siregar yang

„)Baca Bandar Dadu .Hal 7

„)Baca Siswi ..Hal 7

RABU 29 Februari 2012 Halaman 9

Siantar Man

Tak Daftarkan Pekerja Jadi Peserta Jamsostek

Perusahaan Harus Diberi Sanksi SIANTAR- Banyak buruh yang belum terlindungi karena belum masuk sebagai peserta Jamsostek. Dinas Tenaga Kerja pun didesak memberlakukan undang-undang Jamsostek dan memberikan sanksi kepada perusahaan yang membandel, yang tidak mendaftarakan buruhnya menjadi peserta Jamsostek.

Koesparmono Irsan

Punya Prinsip Teguh NAMA Koesparmono Irsan SH MM MBA berkibar hingga ke bumi Cendrawasih. Posisinya sebagai Ketua Komisi Penyelidik Nasional (KPN) menuntut mantan polisi reserse ini gigih menyelidiki kasus pembunuhan Ketua Presidium Dewan Papua (PDP) Theys Hiyo Eluay di Irian Jaya. Ia bekerja bersama 10 anggota lainnya dari unsur sipil, Polri dan TNI. Pria berkacamata ini banyak dikenal ceplasceplos. Setiap kali memberi keterangan terkesan berani dan melawan segala macam bentuk

Baca Punya...Hal 10

Demikian disampaikan Adnar Nur dari Serikat Pekerja Seluruh Indonesia (SPSI) Pematangsiantar pada acara diskusi tentang Jamsostek, Selasa (28/ 2) di Aula kantor Jamsostek, Jalan Sakti Lubis Pematangsiantar. Menurutnya, undang-undang Jamsostek hampir 10 tahun berjalan, tetapi belum satu pun perusahaan yang diberikan sanksi. Padahal banyak buruh perusahaan yang belum masuk peserta Jamsostek. “Perusahaan yang tidak menerapkan undang-Jamsostek harus ditindak tegas,” ujarnya. Sementara, Kepala Jamsostek Pematangsiantar Rasidin SH menyampaikan, pihaknya terus mengalakkan perkembangan program Jamsostek. Tujuannya, untuk menarik perhatian buruh menjadi peserta Jamsostek. Karena dengan masuk sebagai peserta Jamsostek, kesejahteraan buruh

Baca Perusahaan...Hal 10


BERBAHAYA: Truk coltdiesel bermuatan barang tetapi tidak memakai tutup pintu. Hal ini sangat membahayakan pengendara di belakangnya.

Mobil Tak Berpintu Membahayakan SIANTAR- Pihak terkait diharap mengevaluasi mobil/truk bermuatan yang tidak memiliki pintu belakang. mobil yang tidak memiliki pintu dianggap sangat berbahaya bagi pengendara di belakangnya. Selain debu yang

dikeluarkan dari dalam mobil, juga besar kemungkinan barang tersebut jatuh melukai pengendara. Budiman (35) warga Sinaksak, Kecamatan Tapian Dolok mengatakan, aparat kepolisian dan dinas per-

hubungan (dishub) harus menindak mobil-mobil yang dianggap membahayakan. Dia mengaku, pernah mengendarai sepedamotor dan berada di

Baca Mobil...Hal 10

Banyak Jajanan Menggunakan Zat Berbahaya SIANTAR- Pelpem GKPS Pematangsiantar mengajak anakanak untuk mengkonsumsi jajanan sehat. Sebab belakangan ini banyak pengusaha ataupun pedagang yang bandel dengan

mencampurkan zat berbahaya ke dalam makanan. Lewat penyuluhan yang disampaikan kepada pelajar-

Baca Banyak...Hal 10


JAJANAN SEHAT- Lesmina br Sitopu saat memberikan penyuluhan jajan sehat terhadap siswa SD GKPS 2.

Pembangunan Harus Berskala Prioritas SIANTAR- Untuk mensejehaterakan masyarakat, pemerintah dituntut melakukan skala prioritas dalam pembangunan. Jika hal ini dilaksanakan, perekonomian dan kesejahteraan masyarakat akan meningkat. Untuk menetapkan skala prioritas pembangunan yang mengakomodir RPJMD Kota Pematangsiantar tahun 20102015, selama dua hari SelasaRabu (28-29/2) di Ruang Data, Pemko Pematangsiantar melaksanakan konsultasi publik

renwal RKPD Tahun 2013 dan Forum SKPD tahun 2012. Acara dibuka Walikota Pematangsiantar, Hulman Sitorus SE. Hal ini dikatakan Kepala Bappeda Herowhin TF Sinaga AP Msi dalam laporannya kepada Wali Kota, Hulman Sitorus di acara pembukaan. Katanya, tujuan konsultasi publik renwal RKPD tahun 2013 dan Forum SKPD tahun 2012 ini

Baca Pembangunan ...Hal 10


PRIORITAS- Rapat konsultasi public untuk membahas pembangunan berskala prioritas, Selasa (28/2).

Askes Penting Bagi PNS SIANTAR- PT Askes Persero Cabang Pematangsiantar bekerjasama dengan Badan Koordinasi Kehumasan (Bakohumas) SKPD memberikan pemahaman betapa pentingnya pelayanan Asuransi Kesehatan (Askes) bagi PNS di lingkungan Pemko Pematangsiantar. Kegiatan bertajuk ‘Pelayanan Askes Bagi PNS di Pemko Pematangsiantar’ dilaksanakan di Convention Hall Siantar Hotel, Selasa (28/2). Acara diikuti anggota Bakohumas SKPD, Puskesmas, Pensiunan, Ins-

tansi terkait serta PNS di lingkungan Pemko Siantar. Walikota diwakili Asisten Adm Ekonomi dan Pembangunan Drs Samuel Saragih dalam sambutannya menyampaikan, kesehatan bagi PNS sangat menentukan keberhasilan pelaksanaan tugas sehari-hari. Untuk itu keberadaan PT Askes (persero) akan sangat membantu bagi terjaminnya pelayanan kesehatan bagi aparatur pemerintahan.

Baca Askes...Hal 10


ASKES- Diskusi Bakohumas SKPD dengan PT ASKES membahas pentingnya asuransi kesehatan bagi PNS.





Februari 2012



Perusahaan Harus Diberi Sanksi Sambungan Halaman 9 diperhatikan, mulai dari kesehatan, kecelakaan kerja sampai kematian. Rasidin mengutarakan, dalam undang-undang nomor 3 tahun 1992 tentang Jamsostek, dinyatakan bahwa negara menjamin kesejahteraan buruh. Pemerintahan yang sukses adalah pemerintah yang mensejahterahkan masyarakatnya. Sampai saat ini, peserta Jamsostek di Siantar sebanyak 11.314 orang dari 399 perusahaan.

Dan peserta Jamsostek Kabupaten Simalungun, sebanyak 39.460 dari 283 perusahaan. Namun, masih banyak perusahaan yang belum mendaftarkan anggotanya menjadi peserta Jamsostek. Lanjut Rasidin, peserta yang diberikan manfaat tambahan adalah perusahaan dan tenaga kerja yang masih aktif. Pemberian pelatihan kesehatan dan keselamatan kerja (K3) bagi tenaga kerja dan perusahaan, pemberian peralatan K3 kepada perusahaan

Pembangunan Harus Berskala Prioritas Sambungan Halaman 9 adalah untuk menetapkan prioritas program dan kegiatan pembangunan yang mengakomodir RPJMD Kota Pematangsiantartahun2010-2015, dan mensinergikan prioritas dan kegiatan hasil musrenbang kecamatan dengan Renja SKPD, sertamenyusunprioritasrenjaSKPD danalokasianggaranindikatifSKPD. Herowhin mengatakan, peserta acara konsultasi publik renwal RKPD dan Forum SKPD yaitu, pimpinan SKPD sejajaran Pemko Siantar, DPRD, BI, BPS, IuwashUsaid, tokoh masyarakat, LSM, Ormas, dan para delegasi kecamatan se-Kota Siantar. Dalam wejangannya, Walikota Hulman Sitorus SE mengatakan, hingga saat ini situasi perekonomian Indonesia masih mengalami banyak tantangan akibat belum pulihnya dampak kritis perekonomian global. Di sisi lain, dengan bergulirnya pasar bebasbukansajaberdampakpositif terhadap perekonomian bangsa, akan tetapi juga mencemaskan para pelaku ekonomi. “Tentu hal ini tidak tertutup kemungkinan akan berdampak secara langsung maupun tidak langsung kepada kondisi perekonomian dan keuangan daerah ini. Atas dasar itu kita harus membangun kebersamaan, bekerja keras dan bersinergi untuk mendorong terciptanya kehidupan yang harmoni, lingkungan

yang kondusif, serta usaha-usaha produktif yang memiliki keunggulan dan daya saing,” katanya Menurut Walikota, menelah APBD Kota Pematangsiantar TA 2012, dari total belanja, untuk belanja tidak langsung (BLT) sebesar65persendanuntukbelanja langsung (BL) sebesar 35 persen. UntukTA2013diproyeksikanrelatif sama dengan. Maka, untuk mendukung semua program kegiatan yang akan direncanakan, diminta kepada seluruh pimpinan SKPD agar benar-benar memprogramkan kegiatan sesuai dengan skala perioritas, meningkatkan kinerja dengan memanfaatkan sumber daya yang ada secara optimal, efektif, dan efisien, serta tetap memberikan dorongankepadamasyarakatagar lebih giat berusaha, bergotongroyong, juga menciptakan situasi yang kondusif untuk mendorong pembangunan ekonomi di Kota Pematangsiantarini. Kepada peserta, Hulman berharapagarpesertamenghasilkan usulan-usulan program kegiatan yang akan diperhadapkan kepada duahalyangcukupdilematis,seperti dana yang relatif terbatas dan kebutuhan pembangunan semangkin meningkat. Dalam kaitan ini, peserta dituntut untuk mampu berfikir logis dan realistis serta mampuh merumuskan programkegiatanyangsangatprioritas untuk anggaran tahun yang akan dating2013.(mer)

Mobil Tak Berpintu Membahayakan Sambungan Halaman 9 belakang truk colt diesel tanpa pintu. Selama dalam perjalanan, debu dari truk yang bermuatan batu beterbangan ke arah mereka dan mengenai mata anaknya. Bahkan, pandangannya pun terganggu karena debu dari truk tersebut. “Kalau mobil itu menabrak lubang atau tanjakan, bisa-bisa muatannya jatuh. Lantas yang menjadi korbannya pengendara di belakangnya. Sebelum terjadi, perlu diantisipasi,” ujarnya.

Terpisah, Kaur Bin Ops (KBO) Sat Lantas Polresta Siantar, Hilton Marpaung SSos mengimbau kepada pengemudi pengusaha angkutan yang bergerak di bidang bangunan, jika membawa pasir, batu dan kayu diwajibkan memasang pintu belakang. Kalau membawa kayu gelondongan, diikat dua dengan rental tali. “Kalau tidak, bisa dilakukan tilang. Makanya sejak awal kita imbau agar langsung dilengkapi pintu belakangnya,” ujarnya. (osi/ ara)

jasa kontruksi, pemberian bantuan uang pemakaman untuk keluarga uang meninggal dunia dari tenaha kerja yang masih aktif, pemberian bantuan pemeriksaan kesehatan, medical check-up (MCU) bagi tenaga kerja berusia di atas 40 tahun, pemberian bantuan bagi tenaga kerja dan keluarga yang membutuhkan tindakan hemodialisa (cuci darah, red), operasi jantung, pengobatan kanker dan pengobatan HIV/AIDS, dengan pembayaran Rp60 ribu dan Rp30 ribu adalah

keuntungan yang diberikan Jamsostek. “Keuntungan Jamsostek untuk peserta dari jaminan hari tua dan non jaminan hari tua sudah dibagi-bagi. Rp118 triliun uang buruh, Rp2 triliun untuk gaji pegawai Jamsostek sebanyak 3.500 orang,” papar mantan kepala Jamsostek Sibolga ini sembari menyebutkan pada 2014 mendatang Jamsostek akan berubah nama menjadi BPJS2. Selanjutnya, Sukoso yang mewakili FTA SBSI Siantar-Simalungun menyampaikan,

Umat Islam Dituntut Cerdas dan Berakhlak Mulia SIMALUNGUN- Dalam menghadapi beberapa tantangan dan godaan di masa mendatang, seperti dekadensi moral, kebodohan dan kemiskinan, umat Islam dituntut memiliki kemampuan, kecerdasan dan akhlak yang baik, terutama bagi orangtua dalam mendidik anakanaknya agar menjadi generasi muda yang handal, berkualitas sehingga dapat berkompetisi di masa depan. “Tidak terasa tantangan dan godaan itu ada di sekitar kita, misalnya televisi. Kita sangatsulitmemilihdanmemilahtayangan yang ada, mana yang pantas menjadi tontonan dan mana pula tayangan yang pantas menjadi tuntunan. Untuk itu kepada umat Muslim dituntut kemampuan dan kecerdasan untuk menggunakan tekhnologi modern, sehingga tidak merusak akhlak dan aqidah kita,” ungkap Wakil Bupati Simalungun Hj Nuriaty Damanik SH saat menghadiri MaulidAkbarNabiBesarMuhammadSAW 1433 H yang dilaksanakan Sekolah Sepak Bola(SSB)RamerPlusbekerjasamadengan masyarakat dari empat nagori yang berada di Kecamatan Siantar, Sabtu (25/2) di lapangan sepak bola Rambung Merah. Lebih lanjut Nuriaty menyampaikan, kemampuan dan kecerdasan dapat diperoleh manakala kita memahami dan memilikiimanyangkuat,sekaligusmampu menggunakan teknologi secara cerdas sehingga dapat memberikan manfaat bagi masyarakatsecaramaksimal.Persaingandi berbagai lini kehidupan sangan kompetitif, bagi mereka yang tidak memiliki kemampuan ilmu tekhnologi secara plus, suka atau tidak suka akan terpinggirkan. “Persaingan ini dapat kita menangkan manakala anak-anak kita sebagai generasi muda di masa depan dapat kita berikan pendidikan atau ilmu pengetahuan yang

Banyak Jajanan Menggunakan Zat Berbahaya Sambungan Halaman 9


HADIAH-Wakil Bupati Hj Nuriaty Damanik memberikan hadiah kepada salah seorang pemenang sayembara, Sabtu malam (25/2). plus. Oleh karenya peran orangtua sangat menentukan tentang keberhasilan para generasi muda kita,” tandas Nuriaty. Selain itu, Nuriaty yang merupakan Ketua Umum Pengajian Akbar Keluarga Sakinah (PAKS) Kabupaten Simalungun juga menjelaskan, kemiskinan akan muncul dengan sendirinya sebagai dekadensimoraldanketerbelakanganyang akhirnyamenciptakangenerasimudayang lemah. Oleh karena itu, dia mengajak seluruh umat Islam membekali diri dengan akhlak yang mulia, bersungguh-sungguh dalam memotivasi dan membina para generasi muda sehingga memiliki ilmu pengetahuan, teknologi dan ketaqwaan. “Jadilah insan yang bermanfaat bagi masyarakat sebagaimana ajaran Islam, bahwa sebaik-baik manusia adalah manusia yang bermanfaat bagi orang lain,”

sambung Ketua Umum Peringatan Hari BesarIslam(PHBI)KabupatenSimalungun ini. Sebelumnya, Pengulu Pamatang Simalungun AS Siregar dalam sambutannya mewakili masyarakat dari empat nagori mengatakan, peringatan Maulid Nabi Besar Muhammad SAW yang setiap tahunnya dilaksanakan diharapkan tidak hanya sebatas serimonial semata, akantetapimenjadikankegiataninisebagai sarana introspeksi diri, sudah sejauh mana kita mempelajari dan menghayati ajaran Islam yang dibawakan oleh Nabi Muhammad SAW. Dia juga berharap melalui kegiatan ini dapat juga dijadikan sarana dalam rangka memupuk silaturahmi,persatuandankesatuandalam rangka meningkatkan ukhuawah Islamiyah. (rel/ara)

Askes Penting Bagi PNS Sambungan Halaman 9 “Sayaberkeyakinan,PTAskesakandapat melaksanakan tugas dengan semestinya, sebabperusahaaninididukungolehtenaga tenaga yang profesional sesuai dengan motto “melayani pelanggan melampaui harapan”,”ujarnya Ditambahkan Samuel, sosialisasi ini dianggap penting, karena merupakan sarana untuk mengenalkan lebih lanjut informasi tentang pelayanan asuransi kesehatan di lingkungan Kota Pematangsiantar khususnya PNS. Diharapkan agar para pesertayanghadirdapatmemetikinformasi yang akan bermanfaat dalam pelayanan

asuransi kesehatan di lingkungan kerja masing-masing. “Kamimengucapkanterimaaksihkepada PT Askes yang memberikan sosialisasi atas pelayanan Askes bagi PNS di lingkungan Pemko Pematangsiantar,” katanya. Sebelumnya Kabag Humas dan Protokoler selaku Kordinator Bakohumas SKPD, Drs Daniel Saragih melaporkan, Kegiatan adalah bentuk kerjasama Bakohumas dengan PT Askes, yang bertujuan untuk memberi pemahaman tentang pelayanan Askes bagi PNS. Dengan sosialisasi ini nantinya, Bakohumas dapat memberikan informasi Askses melalui SKPD masing masing

sehingga semua PNS dilingkungan Pemko Siantar dapat fasilitas pelayanan Askes. Kepala PT Askes (Persero) Cabang Kota Pematangsiantar dalam makalahnya memamparkanhakdaripesertaAskesyaitu memperoleh Kartu Peserta, memperoleh penjelasan/ Informasi tentang Hak, kewajiban, serta tata cara pelayanan kesehatan lainnya. TampiljugasebagainarasumberDrMaya Damanik MARS dengan Judul makalah “Pelayanan Askes di RSUD dr Djasamen Saragih, serta Peranan Dinas Kesehatan Kota Pematangsiantar, Yuniaryto Pardede SKMKabidJaminandanSaranaKesehatan. (mer)

Punya Prinsip Teguh Sambungan Halaman 9 melawan hukum. Pria kelahiran Pematangsiantar ini memang kuat dalam memegang prinsip. Prestasinya menanjak karena komitmen yang kuat terhadap motto hidupnya sendiri. “I do my best. I’m not the best, I try to do my best.” Di mata polisi berakhir karir di tampuk Deputi Operasi Kapolri ini yang terpenting adalah bukan menjadi polisi terbaik. Namun yang terpenting berbuat kebaikan dalam profesinya sebagai polisi. Baginya, kebaikan itu mahal untuk diakui dan dosa tidak akan terampuni dalam hidupnya. “Artinya punya jasa seperti apapun menjadi polisi, tak akan pernah bisa diterima orang lain. Malahan ketika berbuat kesalahan kecil saja

sebaiknya dibuat peraturan daerah (perda) kewajiban perusahaan memasukkan buruhnya menjadi peserta Jamsostek. “Kami selalu sosialisasikan Jamsostek. Sudah wajar seluruh buruh wajib menjadi peserta Jamsostek, karena gaji sudah diatas Rp1,2 juta, sesuai Upah Minimum Provinsi (UMP),” ujarnya. Turut hadir dalam acara tersebut Kadinsosnaker Simalungun Halomoan Purba, perwakilan SPSI Simalungun dan FTA SBSI Siantar-Simalungun. (osi/ara)

lantas dibesar-besarkan, dituntut dan dituding. Oleh karena itu, harus sadar kalo menjadi polisi,” tutur pria bercucu satu ini. Dalam perjalanan hidupnya, Koesparmono cukup taat nasehat ayahnya Iskandar Irsan asal Madura. Ayahnya yang purnawirawan polisi itu mengatakan kepadanya agar tidak pernah berbuat dosa dan tidak menuntut jasa sekecilpun. Makanya, dia meyakini dalam perjalanan karirnya harus bisa membuktikan itu menjadi polisi baik atau anggota Komnas HAM yang baik. Ayah Koesparmono, tentu cukup beruntung, nasehatnya masih tesimpan di benak putera sulungnya hingga kini. Koesparmono mengingat kembali satu hal yang pernah dituturkan ayahnya kepada dirinya, “Beliau

pernah bilang, eh le, jadilah kamu orang yang terbaik. Jadi maling, maling terbaik, perampok ya perampok terhebat, kalau polisi ya polisi terbaik.” Rasa bangga Koesparmono terhadap ayahnya tak bisa disembunyikan dari nada bicaranya. Cerita-cerita menarik tentang usaha ayahnya menghidupi enam adik kandungnya dan enam anak angkatnya satu cerminnya. “Beliau itu mau juga menjadi montir untuk membiayai kami,” tutur Pak Kus — panggilan akrabnya. Bahkan salah satu adiknya hingga dikenal menjadi dokter pribadi mantan Panglima TNI Jenderal Sudirman. Menulis buku telah dilirik Koesparmono akhirakhir ini untuk mengisi waktu senjanya. Rencananya, buku Marsinah akan diterbitkan bersamaan dengan 13 buku lainnya. (int)

pelajar di SD GKPS 2 Jalan Asahan, Selasa (28/2) Lesmina boru Sitopu didampingi Kordinator Herman Sipayung, sebagai narasumber menyampaikan, banyak jajanan yang dikonsumsi tidak terkontrol lagi. “Berdasarkan survey yang dilakukan Badan Pemeriksa Obat dan Makanan (BPOM) pada 2005 lalu, kasus keracunan makanan sudah semakin marak. Itu disebabkan pengusaha dan pedagang yang membandel dengan mencampurkan zat berbahaya pada makanan,” sebutnya. Lebih lanjut ia menerangkan, pedagang sering membuat jajanan dengan warna mencolok sehingga membuat anak-anak mudah tergoda mengkonsumsinya. Padahal zat pewarna yang digunakan pada makanan itu seharusnya digunakan untuk pewarna pakaian. “Bagaimana tubuh bisa mengkonsumsi zat tersebut, otomatis itu akan berdampak negatif pada kesehatan,” ujarnya. Dia menyampaikan, mereka sengaja memberikan penyuluhan kepada anakanak sejak usia dini, sebab merekalah yang mudah tertarik dengan makanan seperti itu. Mereka diberikan penjelasan apa efek samping makanan yang dikonsumsi itu terhadap kesehatan. “Untuk mengantisipasi makanan yang mengandung zat berbahaya, perlu kerja sama semua pihak. Bukan hanya orangtua dan guru saja yang dituntut untuk mengantisipasi dan mengawasinya. Seharusnya lembaga yang berwenang serta instansi seperti Dinas Perindustrian dan Perdagangan harus ikut turun memantau kondisi jajanan yang dipasarkan di Siantar,” jelasnya. Katanya, penyuluhan yang diberikan secara teori dipadu dengan gambargambar yang menarik dapat menstimulasi minat pelajar untuk melaksanakannya. Pihaknya mengetahui bahwa anak-anak masih kurang paham tentang jajan yang dikonsumsi sehingga semua pihak itu harus berperan dan benar-benar buka mata. “Fakta di lapangan, keracunan makanan banyak dialami masyarakat dari kondisi ekonomi menengah ke bawah. Sebab jajanjajan yang mengandung zat pewarna itu banyak diedarkan secara eceran dengan harga murah. Sementara masyarakat, khususnya siswa yang berasal dari ekonomi menengah ke atas lebih sering membawa bekal dari rumah. Selain itu orangtuanya juga pasti berbelanja di pusat perbelanjaan dan memastikan kehigienisan makanan itu,” ungkapnya. Sambung Herman Sipayung, rencananya usai penyuluhan ini, mereka akan menciptakan kader-kader baru yang akan bertugas menyampaikan agar pelajar tetap mengkonsumsi jajanan yang sehat. Bila anak sehat, itu juga akan berdampak pada semangat dan pencapaian prestasinya. Sementara Kepala SD GKPS 2, J Saragih menyambut baik program dari Pelpem GKPS. “Memang cara untuk mengkonsumsi jajanan sehat ada diajarkan di buku pelajaran oleh guru-guru. Namun sosialisasi ini lebih membantu lagi pemahaman siswa terhadap seluruh dampaknya. Diharapkan agar siswa benar-benar menerapkannya dan mulai mengkonsumsi jajanan yang sehat,” ujarnya. (mua/ara)





Februari 2012


„ Kopral Aisyah al Hamoudi

Dubai Diperkuat Polisi Termungil di Dunia FUJAIRAH - Berukuran tubuh mungil tidak membuat perempuan asal Dubai ini merasa malu atau terus menerus mengurung diri di rumah.

Bahkan seorang perempuan bertubuh mungil di Dubai berhasil membuktikan ukuran tubuhnya yang mini tidak menghalanginya meraih prestasi. Ini lah yang ditunjukkan oleh seorang anggota kepolisian Kopral Aisyah al Hamoudi yang memiliki tinggi badan 88 cm.

Setelah mendaftarkan dirinya di Guinness Book of Records, Kopral Aisyah pun tercatat sebagai anggota polisi terpendek di dunia .”Pusat pelatihan dan perekrutan orang-orang dengan kebutuhan khusus Kementerian Dalam Negeri telah membantu dan mendukung

Saya untuk bergabung dengan Kepolisian Fujairah,” ujar Kopral Aisyah, Selasa (28/2). Aisyah tercatat lulus dari pusat pelatihan Kementerian Dalam Negeri Al Ain pada tahun 2006 lalu. Kini Aisyah aktif bertugas di Kepolisian Fujairah.(oz)

Salah Artikan Kata

Timbulkan Kepanikan di Pesawat


SIRAM : Punggung Kanselir Jerman Angela Merkel yang disiram bir, sehingga menimunan mengalih ke tubuhnya.

Lima Gelas Bir Siram Kanselir Jerman BERLIN-Seorang pramusaji tidak sengaja menumpahkan lima gelas bir ke punggung Kanselir Jerman Angela Merkel. Karena terkejut, pramusaji itu bahkan sempat berteriak kata kotor di belakang Merkel. Merkel terkejut ketika ada minuman dingin yang mengalir di bagian belakang tubuhnya. Pengawal yang berdiri di

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 LOWONGAN KERJA: YAYASAN MAREL MANDIRI menerima tenaga kerja wanita baik gadis/janda, 17 s.d 45 thn, utk dilatih sebagai: baby sister, perawat orang tua sakit/jompo, kakak asuh, syarat: ijazah asli, KTP / Kartu Keluarga, gaji Rp 700.000 s/d 1.500.000/ bulan + uang cuti. hub. Yayasan Marel Mandiri, Jl. Cengkeh Raya No. 18 C Medan, HP 0813 6199 9211; 0878 6968 7879 nb: sampai di medan kami jemput ADA LOWONGAN: Dbthkan Wnt (gadis/ janda) utk dipekerjakan jaga anak & org tua, gaji 900rb s/d 1,5Jt/bln brsh + bonus 50rb. Hub: Yys Sepa Husada, Jl. Psr.III No.45 A Krakatau. Telp. 6643773, 0811 602 145. NB: Sampai di Medan akan dijemput PROMO SUZUKI: Penuh kejutan dan hadiah....!!! • APV Arena angsuran Rp 180 rb-an • Pickup angusuran Rp 85 rb -an, dapatkan info produk terbaru SUZUKI ERTIDA desain keluarga luxurious dan lebih irit bahan bakar. hub. L Tampubolon HP 0853 6260 0182

DAIHATSU P. SIANTAR 100% BARU DP Angsuran • Xenia 12.750.000 3.125.000 • Terios 18.780.000 4.090.000 • Luxio 9.000.0003.961.000 • Pick up 10.000.000 2.432.000 • Sirion 7.000.0004.6 jt hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Beli mobil gratis mobil buruan. Proses cepat data dijemput

TOYOTA BARU SIANTAR • All New Avanza Unit Ready! • All New Avanza Veloz Bonus Lengkap! • New Rush Unit Ready! • Grand New Innova Unit Ready! • Grand New Fortuner Unit Ready! • Vios, Yaris, Altis Bonus Lengkap! • Hilux S-Cab/D-Cab Bensin/Diesel. HUB. SALES EXECUTIVE TOYOTA DEALER: RICKY - HP : 0853 7199 9499 – 0812 6505 3191. Data di JEMPUT, Proses MUDAH, Pasti CEPAT.

DAIHATSU PAKET MURAH 100% DP Angsuran • Xenia 12.750.000 3.125.000 • Terios 15.000.000 4.090.000 • Luxio 19.100.000 3.961.000 • Pick up 9.000.000 2.432.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0878 9228 2993. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio TOYOTA SIANTAR • All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya DIJUAL MOBIL: Kijang Innova G thn 2005, mulus, satu tangan, hitam metalik, harga Rp 165 jt (nego). Hub: 0813.62087021 (TP) “DAIHATSU P. SIANTAR “ 100 % BARU !!! • All new xenia • All new rerios • All new sirion • Grandmax minibus • Luxio Hub: AGUS P. SALES EXECUTIVE HP 0852 7519 4102; 0813 7575 6462 Data dijemput , proses cepat !!! ABADI MOTOR: JUAL SEPEDA MOTOR • Honda Win 2005 • Vega R 2008 • Zealsun mdl Supra 2002 • Vega ZR 2010, 2011 • Mio Soul 2008 • ATM roda 4 • Mio Sporty 2009, 10, 11 • Supra XX gandeng 03 Hub. Asiong. HP 0853 5960 3268 Jl. Ade Irma Suryani 35 (Sp. Singosari) P. Siantar CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Abid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

belakangnya langsung menghalau semua minuman tersebut sambil memegangi kepala pemimpin Jerman tersebut. Sementara Merkel sendiri dengan tenang menangani situasi itu dan kemudian kembali mengangkat gelas di mejanya untuk bersulang, di saat dirinya menghadiri sebuah pertemuan. Pramusaji bernama Martin dan berasal

DIJUAL RUMAH: (Khusus Muslim) Perumahan Karang Bangun Permai, SHM. LT 8 x17 M, LB 8 x 13 M2, KT 3, KM 2, RT, RK, dapur, keramik, PDAM, PLN, berpagar, RP 200 jt / nego. hub. 0821 6888 2933 CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL: Rumah type 70 Luas tanah 20 x 25 M Lokasi Jl. Kertas koran No. 37dekat kompleks Megaland Pematangsiantar. Bagi yang serius / berminat hub. 08122362900 (Tanpa Perantara) CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36, type 42, type 45 (luas tanah 9x11m), atap multiroof, rangka atap baja ringan, dinding batu bata. Ruko type 40 (5x11m), lantai 1, pondasi untuk 2 lantai, atap cor, dinding batu bata. Lokasi: Perumahan Bersatu Maju, Jl. Pdt Wismar Saragih (sedang dibangun Martoba Water Park), hub: Jl. Handayani 4 P. Siantar, HP. 0853.58393525; 0821.64589288; 0852.9602.9651.

dari Yunani tersebut, merasa sangat malu. Tetapi dirinya akan menjadi pahlawan bagi Yunani mengingat masalah terkait kontrol ekonomi Jerman terhadap negara itu. Insiden itu juga tertangkap kamera dan menjadi sensasi di YouTube. Hingga kini masih banyak orang yang menonton kejadian memalukan tersebut. (oz)

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36, type 42, (luas tanah 9x11m), atap multiroof, rangka atap baja ringan, dinding batu bata. Ruko type 40 (5x11m), lantai 1, pondasi untuk 2 lantai, atap cor, dinding batu bata. Lokasi: Perumahan Batu Permata Raya, Jl. Batu Permata Raya Ujung (belakang USI), hub: Jl. Handayani 4 P. Siantar, HP. 0853.58393525; 0821.64589288; 0852.9602.9651.

CASH & CREDIT: Rumah type 42, (luas tanah 9x12m), atap multiroof, rangka atap baja ringan, dinding batu bata, gypsum, relief, lantai keramik. Lokasi: Perumahan Setia Negara Baru, Jl. Pengintai Kompl. Setia Negara IV, (masuk dari Jl. Handayani + dari Jl. SM Raja. Pemasaran: Jl. Handayani 4 P. Siantar, HP. 0853.58393525; 0821.64589288; 0852.9602.9651.

MARYLAND - Seisi pesawat panik setelah seorang pilot memberikan ucapan selamat ulang tahun kepada seorang Ibu. Ternyata, penumpang mengartikan kata ‘mom’ yang berarti Ibu dalam bahasa Indonesia dengan kata ‘bomb’. Pilot dari maskapai Southwest Airlines yang tidak disebutkan namanya, diminta oleh salah satu petugas lalu lintas udara untuk mengucapkan salam kepada ibunya yang terbang dari Baltimore, Maryland, Amerika Serikat (AS) menuju Bandara Mac Arthur New York di Islip, Long Island. Penumpang langsung panik dan meminta kepada kru pesawat untuk mengklarifikasi perkataan pilot dan meyakinkan apakah benar-benar ada bom. Tak lama kemudian, pilot menjelaskan maksudnya. Juru bicara Southwest Airlines, Brandi King mengatakan, “Pilot membuat pengumuman yang disalah pahami. Dia menjelaskan kepada penumpang bahwa ia memberi ucapan selamat ulang tahun kepada ibu yang sedang mengudara bersama mereka.” (oz)

PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430

PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917 PIJAT DAN LULURAN “MBAK SITI”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Pleton Ujung No. 6 (dari Jl. Singa, masuk Jl. Dea) HP 0813 7698 5217 PRAKTEK FISIOTHERAPI DAN AKUPUNTUR: (SPTP No.448.4/7144/SPTP/XI/2011). Mengobati Stroke, Post Stroke, kebas-kebas, gangguan gerakan tubuh, mulut mencong, dll. Datang segera ke: Jl. Dahlia No.4A unit 8, dijamin tubuh anda terasa segar, harga dijamin layak. Hub: IBU TUTI SWARNI SINAGA (A.M.F.D.A.C) 0812.60603349 (Praktek buka: Senin, Selasa, Rabu, Jumat, Sabtu) P. Siantar

CASH & CREDIT: Rumah type 42, type 36, type 40, atap multiroof, rangka atap baja HABONARON DO BONA ringan, dinding batu bata, gypsum, relief, BIRO JASA SIMALUNGUN PUTRA lantai keramik.Lokasi: Perumahan Herawati Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Indah, Jl. Viyata Yudha Ujung, Kel. Bah Kapul Penasehat Hukum-Pengacara. Jl. Merdeka (daerah Tozai Baru) P. Siantar, hub: Jl. No.166 Telp. (0622) 26836 – 27712. P. Siantar Handayani 4 P. Siantar, HP. 0853.58393525; “Atas Kepercayaan Anda Kami Berbuat & Berbakti” 0821.64589288; 0852.9602.9651. CV MITRA JASA KS: Dapat mengurus surat-surat DISEWAKAN RUKO: Luas 8 x 7 M2, 3 1/2 tingkat, tersedia listrik, air, telepon, tangki air, kamar mandi 3, kamar tidur 3, lokasi di Jl. Mariam Tomo No. 28 samping Pajak Hongkong di depan TK Kalam Kudus Pematangsiantar, cocok untuk usaha dan kantor, bagi yang berminat hub. Bapak Ahong HP 0812 6475 899 CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar PERSIL AMELYA: Persil murah langsung sertifikat Hak milik Jl. Medan lorong 7 masuk ¬+ 700m dari samping restoran burung goreng sinaksak beringin Kec. Tapian dolog. Ukuran 10 X 18 = Rp 30 juta ( tinggal 2 persil ) ukuran 9 x 21 M = Rp 33 juta (tinggal 3 persil) Rp 160.000/M hub. R br purba 0852 7539 0076; Naibaho 081 397 818 088

siup, STNK, SIM, property speksi dan lainnya, memberikan NPWP secara gratis dan menyalurkan pinjaman untuk usah mikro. yang beralamat. Jl. Nusa Indah Simp. Dahlia atau Jl. KDS Simp. Bakso Deli HP 0852 7584 8884; 0821 6736 8444 (Kurnia Saragih) “Kepercayaan Anda, Komitmen Kami” ANDA BUTUH DANA CEPAT? Jaminan BPKB sepeda motor Anda, Proses cepat, syarat mudah (minimal tahun 2000 ke atas). Hub. Bpk. GABE HP 0821 6378 8808 BUTUH DANA CEPAT: •Sertipikat •BPKB Hubungi kami: PT BPR EKA PRASETYA, Jl. SM Raja no 202. P Siantar (depan parluasan) Telp. 0622 - 430780 HP 0852 7657 8625 PELUANG PASTI!! HARI INI Joint mulai besok dpt profit/hari 9% selama 200 hari. Tlp. 021-9544 6030 SMS “Berminat” HP. 0877 8847 7900. Info

HOTLINE IKLAN PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800.


0622 - 7553511


RABU 29 Februari 2012




LOWONGAN KERJA Dibutuhkan tenaga wanita tamatan SD, SLTP, SLTA, SPK, AKPER untuk menjadi : • Babby Sitter • Perawat Jompo, • Kakak Asuh Gaji Rp.900.000,- s/d 1.600.000,Hubungi :


Jl. Setia Budi simp. Pemdan Gg. Kasih No. 3 (di depan Kampus UNIV. AMIK UNIVERSAL) 081371677800

LOWONGAN KERJA Dibutuhkan tenaga wanita tamatan SD, SLTP, SLTA, SPK, AKPER untuk menjadi : • Babby Sitter • Perawat Jompo, Kakak Asuh Gaji Rp.900.000,- s/d 1.600.000,Hubungi :

YAYASAN SINAR BUNDA Jl. Ngumban Surbakti No.23 (±300m dari Simpang Pos) Padang Bulan Medan 082160644428

Chik u Enggak Cemburu! Chikaa Jessica: Ak Aku CHIKA Jessica dikabarkan cemburu lantaran kekasihnya, Ade ‘Govinda’ memberikan lagu berjudul Tak Jodoh pada Prastiwi Dwiarti alias Tiwi ‘T2’. Apa kata Chika? “Enggak ada komentar,” jawab Chika dengan wajah datar, Selasa (28/2) siang. Ade ‘Govinda’ dengan Tiwi ‘T2’ memang sempat berpacaran sebelum menjadi kekasih Chika Jessica. Namun Ade memastikan, lagu

tersebut dibuat sebelum dirinya menjalin hubungan dengan Chika. “Itu kan lagu sudah lama direkam. Lagipula pemilihannya ditentukan label,” ujar Ade. “Aku enggak cemburu,” timpal Chika. Seolah tak ingin pilih kasih, Ade juga membuatkan sebuah lagu untuk dinyanyikan Chica. Sayangnya, Chika menolak. “Ini dia orang yang dibikinin lagu tapi menolak,” kata Ade. (nov/int)

Rabu, 29 Februari 2012

Nadia Vega

Selektif Cari Pacar PASCA putus cinta dengan kekasihnya, pria asal Australia, Nadia Vega lebih selektif cari pacar dan menjalin hubungannya. ”Memang pas aku balik ke sini, kami komitmen mau kerja. Aku ingin kerja jadi animator sesuai sama kuliah. Tetapi tahunya akting lagi, di depan layar lagi. Kalau untuk itu (cari pacar), ya lebih selektif aja,” terangnya di Planet Hollywood, Jakarta Selatan, Selasa (28/2). Pemeran film Keumala ini menuturkan sejak putus dari

IU Takut pada Senior

pria asal Austarlia tersbut, artis cantik melankolis ini berusaha tak berkomunikasi lagi. ”Jadi pas putus memang sudah menjalani kehidupan kayak biasa saja. Aku berusaha untuk nggak (komunikasi). Jadinya santai saja,” urainya. Sejauh ini, Nadia mengaku sudah banyak teman pria yang berusaha mendekatinya, namun ia belum membuka hati. “Ada yang dekati, beberapa kali dekat. Tapi belum ada yang ‘klik’,” tuturnya. (idc/int)

HASIL voting terakhir untuk para pemenang Shorty Awards 2012 telah dirilis. Penyanyi asal Indonesia Agnes Monica terpilih sebagai Best Singer di ajang tersebut. Agnes menjadi nomor satu dengan jumlah voting sebanyak 8.414 suara di kategori tersebut. Disusul Justin Bieber dengan 6.640 suara. Penyanyi belia Greyson Chance dan Joe Jonas berada di urutan selanjutnya. Agnes juga ikut mendapat banyak suara dalam kategori Celebrity Shorty Awards. Namun

PENYAN YI Korea IU mengungkapkan perasaannya ketika pertama kali bertemu dengan dua seniornya, Lee Hyori dan Uhm Jung Hwa. Gadis imut ini pun mengungkap bahwa ia sempat takut dengan Lee Hyori. Hal ini terungkap kala IU menjadi bintang tamu dalam acara You & I yang dipandu Lee Hyori dan Jung Jae Hyung, baru-baru ini. Dalam acara tersebut, Lee Hyori mengungkap satu CD yang ia terima dari IU ketika menjalani debut. Di CD tersebut IU menulis, “Lee Hyori sunbaenim (panggilan untuk senior), aku penyanyi baru, IU. Aku gembira karena bisa melihat penampilanmu. Aku akan berusaha lebih baik lagi mulai sekarang.” Ketika mendapatkan CD tersebut, Lee Hyori sedang dalam masa promosi lagu Chitty Chitty Bang Bang. Wanita tersebut lantas bertanya kepada IU tentang bagaimana imej-nya di antara penyanyi junior. “Anda adalah seorang penyanyi yang sangat senior,” ucap IU. “Saya pernah bertemu dengan senior Uhm Jung Hwa beberapa kali, dan setiap kali aku bertemu dengann ya, ia menatap ku sambil tersenyum hangat,” ucap IU. Ketika Lee Hyori setengah bercanda protes tentang dirinya yang terlihat menakutkan jika dibandingkan Uhm Jung Hwa, IU pun buru-buru berkata, “Aku rasa hal ini karena lagu-lagu milik Lee Hyori sunbae sangat karismatik, sementara lagu Uhm Jung Hwa sunbae adalah lagu yang membuat hati bahagia,” tutur IU. (kpl/int)

ternyata Kim Jae Joong personel boyband asal Korea Selatan JYJ lebih berjaya. Dalam kategori tersebut, Agnes hanya berhasil duduk di peringkat ke10. Dalam Music Shorty Awards Agnes juga ikut serta. Ia duduk di peringkat ke-5. Posisi pertama dan kedua ditempati oleh Demi Lovato dan Miley Cyrus. Shorty Awards alias Shorties adalah penghargaan untuk orang atau perusahaan yang eksis di Twitter. Penghargaan ini pertama kali digelar pada 2009. (dtc/int)

KESERIUSAN hubungan asmara antara Olga Syahputra dan Jessica Iskandar semakin kentara, setelah keduanya mengaku bersama-sama bertemu dengan orang tua Jessica. “Kemarin saja bapaknya Jessica waktu di mall mau ketemu sama Olga. Olga serius, kalau dianya serius,” ungkap Olga Syahputra saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Selasa (28/2). Namun Jessica menegaskan kalau hubungan mereka sementara

waktu hanya pacaran. Saling menjajaki dan mencoba mengenal satu sama lain, belum akan memikirkan rencana menikah. Keinginan Olga untuk segera menikah, sementara waktu ditang guhkan terlebih dulu. “Pacaran dulu....Biar Kak Olga saja yang ngomong, kan dia cowoknya. Maunya pacaran dulu, sampai siap,

baru boleh ngelamar,” ungkap Jessica tersenyum. Hal ini sekaligus menjawab hubungan Olga dan Jessica yang konon sekedar gosip belaka. Mereka mengaku serius dan jika berjodoh akan menuju jenjang pernikahan. (kpl/int)





SMA NEGERI 3 PEMATANGSIANTAR Pemimpin Redaksi Sri Wahyuni Pulungan Redaktur Sitta Simanjuntak Junius Sijabat Repoter Tia S Napitupulu Rodo Pandiangan Fahrul Sony Fotografer Jon Bon Jovi Sembiring

“Eh, itu anak baru ya? K ok baru liat?” Kok “Mana? Ahk, iya bener bener.. Siapa dia?” “Wahh, kalian kebangetan, dia itu kan sekelas kita, yang duduknya di pojok sebelah kanan.” “Hee? Masa sih??”

KOMUNITAS FB XPRESI METRO SIANTAR Sampai saat ini, apa sih yang paling ingin kalian inginkan? Boleh tentang apa saja. Ditunggu ya curhatnya :) Dody Sihite Yang aq inginkan adalah membuat ke-2 org tua menangis.. Nangis bahagia.. Aq tdk ingin smwa yg telah dilakukan mereka sia sia di dalam hidup ku,, itulah yg q inginkan Tiara Cheafriecae Octhavianie Rasa na pengen banget bahagia’n ortu. Pengen balas smwa usaha ortu bwt bhagia’n ank2 nya

Baray Hutasoit Pengen nikah itu yg kuinginkan...

Benri Purba Sukses Membuat ke dua orang tua ku bangga, ketemu dan memeluk Agnes Monica dan Britney Spears. Vivie Sidabutar Yang pasti smua org menginginkan mnjadi yg trbaik dlm sgala hal....!!!!

Wyoe Emo-Vandesko Aku pingin harga BBM jangan sampe mahal lahh..Kasian loh masyarakat yang punya penghasilan minim.. :)

POLLING Bagian down to earth? a. Ya (15 %)

Hanyut Dalam Gelas Angelina Sondakh itu bisa jujur .

b. Tidak (50 %) c. Nggak tau (35 %) Arti down to earth?

Novita Manurung Yang paling saya inginkan menadi orng yg lbih baek ge dan bsa membanggakan orng tua

a. Tidak terdeteksi (25%) b. Biasa-biasa aja (25 %) c. Turun ke bumi (50 %)

Teman-teman pernah ngalamin hal itu nggak sih? Berada di posisi orang yang tidak menyadari keberadaan orang lain, atau bahkan di posisi orang yang tidak tersadari keberadaannya? Hemmp.. Kali ini kita bakal ngebahas down to earth, wew…apa itu? Arti harafiahnya sih memang turun ke bumi. Tapi..., kalau ikut bahasa anak gaul sana, artinya tidak terdeteksi atau tidak kelihatan, dari kawan-kawannya. Hal ini memang sering terjadi kan? Kita seringkali tidak sadar kalau si X ada di kelas yang sama dengan kita, dan si Y ternyata ada di sebelah kita. Wow, auranya ngilang gitu. Kok bisa sih jadi orang yang down to earth? Pernah kepikiran ga sih sebenernya kita down to earth ato enggak? Nah, dari hasil polling tim Xpresi, sekitar 15 % mengaku down to earth. Lalu, 50 % dengan tegas bilang tidak. Sisanya, 35 % malah gak tau iya atau tidak. Mereka mengaku bukan orang yang down to earth, dengan alasan orang yang ceria, selalu up to date dan memiliki banyak teman. Ngaku down to earth, karena

pendiam, dan sisanya sangat amat tidak mau tahu. Menurut mereka down to earth ato nggak, samasama nggak penting. So, whateverlah.. ;) Guys, tim Xpresi juga mau ngasih tahu nih. Sekitar 50 persen pada awalnya tidak tahu apa yang dimaksud dengan down to earth. Rata-rata pada ngerti arti harafiahnya aja, turun ke bumi. Hellow, siapa yang turun ke bumi? Bidadari dari kahyangan? Haha, bukan dong. Ada yang lucu nih, seperti yang disampaikan Vivi (16), down to earth, kata-kata yang membuat bulu kudukku naik, iihh ... serem deh, mereka kan mampu berinteraksi sama makhluk yang bisa ilang dan gaib gitu. Huahaha, lucu banget sih kamu, cenayang kali maksud kamu. But, it’s up to you deh. Lalu, 25 % menjawab benar, tidak terdeteksi. Lalu, 25 % lagi gak peduli. So, bagaimana dengan kalian? Ngerasa jadi orang yang down to earth nggak? Atau malah jadi orang tenar yang dikenal semua orang? Hemmp! Guys, kita hidup bertetangga, makhluk sosial, jadi harus pandaipandai bergaul, bersosialisasi dengan lingkungan sekitar kita. Turut berpartisipasi dalam semua kegiatan, bukannya malah ngumpet dan asik dengan duniamu sendiri. Nanti kamu bakalan dicap sombong, ndak punya teman, aneh dan julukan lainnya, dan yang paling parah nggak satupun yang menyadari keberadaanmu, sedih dong saat kamu terlupakan oleh yang lain, memangnya mau? Mempunyai banyak teman juga akan sangat membantu kita saat kita kesusahan, karna mereka tidak akan meninggalkan kita. Masih ngerasa jadi orang yang down to earth? Don’t worry, belum terlambat . Mulai sekarang, tersenyumlah pada semua orang, sapa mereka dengan ceria, buat mereka menyadari keberadaanmu, dan kamu akan segera menjadi orang yang paling ramah seantero sekolah, dan katakan, Bye bye down to earth.


Jangan Gunakan Sistem Kebut Semalam Lupa adalah sesuatu yang manusiawi dan wajar kita alami. Tetapi, kalau terus menerus lupa mengingat materi pelajaran? Wah, bisa repot juga. Apalagi, jika tengah mempersiapkan diri menghadapi ujian. Daya ingat adalah suatu proses yang sangat penting dalam menjawab soal-soal ujian. Nah, sepuluh tips berikut mungkin bisa membantu dalam meningkatkan daya ingat belajar. Sebagai informasi, beberapa strategi di bawah ini telah diterapkan dalam literatur psikologi kognitif. Strategi ini menawarkan sejumlah cara yang

bagus untuk meningkatkan daya ingat dan retensi informasi. Simak, yuk! 1. Fokuskan perhatian pada materi yang dipelajari Perhatian adalah salah satu komponen utama dari memori. Agar sebuah informasi pada ingatan A berpindah dari memori jangka pendek ke memori jangka panjang, ada cara yang bisa dilakukan. Apa itu? Cobalah untuk belajar di tempat yang bebas dari gangguan,

seperti televisi, musik, atau hiburan lainnya. 2. Hindari belajar dengan sistem ‘kebut semalam’ Belajarlah secara teratur. Penelitian menunjukkan bahwa dengan sistem belajar yang teratur akan membuat seseorang dapat mengingat materi pembelajaran lebih baik dan lebih panjang daripada mereka yang menggunakan sistem ‘kebut semalam’, dengan waktu yang sangat terbatas. 3. Susun dan atur setiap informasi

Para peneliti menemukan bahwa setiap informasi telah diatur dalam memori dan sudah dikelompokkan. Gunakan memori itu untuk menata dan mengorganisasi materi yang dipelajari. Cobalah mengelompokkan bagan-bagan atau istilah-istilah secara bersamaan pada catatan. 4. Memanfaatkan perangkat mnemonik Perangkat mnemonik merupakan alat untuk membantu ingatan/ menghafal informasi. Perangkat ini


Ingin Nampil di Koran? Yuk, Gabun g ke Xpresi Teman-teman yang masih duduk di bangku esempe, esema, esemka, atau yang udah kuliah, ingin dimuat di koran Metro Siantar? Silakan bergabung menjadi bagian keluarga Xpresi Metro Siantar. Di sini, kamu-kamu bisa berkspresi sesuka hati. Mau nulis puisi atau cerpen, boleh. Mau menulis tentang kegiatan ekskul, juga boleh. Trus, kalau ada temanteman atau kamu yang punya prestasi dalam bidang apapun itu, silahkan tulis. Boleh juga loh kegiatan seremoni sekolah, seperti Maulid atau Natal. Hmm, yang sedang galau kalau mau curhat juga boleh. Pokoknya apa saja kegiatan di sekolah kamu (asal positif ya), ungkapkan lewat tulisan. Lalu tunjukkan pada dunia melalui koran terbesar dan terdepan di Siantar Simalungun ini. Ciao…. Ups, hampir lupa. Bagaimana ya cara gabung ke Xpresi? Cukup sederhana, teman-teman silahkan mampir ke kantor redaksi yang berada di Kompleks Megaland atau mau nanya-nanya dulu via udara juga boleh. Hubungi nomor hape 081396292111 atas nama Nurjannah. Oia, kalau bukan kita yang mengharumkan nama sekolah kita, siapa lagi? So, mari berkarya dan go publik. Semangat! (ann)


29 Februari 2012

All Sport




Jerman vs Perancis

„ Samir Nasri

Laga Tim Terbaik

Tak berlebihan apabila mengatakan Jerman kembali jadi powerhouse sepak bola Eropa. Dua kali peringkat tiga Piala Dunia dan sekali runner-up Piala Eropa sejak milenium ketiga ini bergulir adalah bukti sahihnya.

Penampilan Jerman timnas Prancis itu meningkat dan berakan menyaksikan warna setelah pemetim Jerman yang jauh rintah mereka lebih muda di Bremenghapus peratumen pada Rabu (29/ ran ketat tentang ke2) nanti. Pelatih Joawarganegaraan pada chim Loew tak bisa 1999. Tim bangsa Armemanggil Bastian ya murni yang gagal Schweinsteiger, Lumengilap pada Piala kas Podolski, Per Dunia 1994 dan 1998 Mertesacker dan Madan Euro 2000 ber- „ Mueller rio Goetze. transisi dalam satu Sebagai gantinya dekade jadi tim menakutkan beberapa pemain muda tersekarang. baik Bundesliga Holger BadsDengan pemain-pemain setuber, Reus, Sven Bender dan perti Mesut Oezil, Cacau, ThoAndre Schuerle bisa punya mas Mueller, dan pendatang waktu bermain. Loew ingin baru Marco Reus, tim Jerman melindungi pemain-pemain kini lebih baik secara teknik muda tersebut. dari para pendahulunya. “Kami sadar benar ekspetasi Bahkan, presiden UEFA, publik sangat-sangat tinggi,” Michel Platini, meujarnya. “Tapi saya berasumsi ngungkapkan sendiri para pemain muda kami behal tersebut. lum sepenuhnya bisa meme“Mungkin lebih dari nangi setiap laga. Tentu saja sebelum-sebekami ingin menang atas Pranlumnya, Jerman kini cis tapi hasil laga ini tak berpunya tim terbaik di peran besar bagi persiapan tim Eropa. Mereka saya,” sangat muda, sangat Pelatih Prancis, Laurent kreatif. Tak ada poin Blanc, mengaku bahwa timnya yang hilang di kuabelum selevel dengan lawan lifikasi Piala Eropa. mereka nanti. “Hal terpenting Mereka adalah favorit adalah kami jangan terbawa juara Euro bersama permainan mereka, anak-anak dengan Spanyol,” puji harus bisa bermain sesuai Platini di Welt Online. kekuatan kami,” tutur eks bek Mantan playmaker tangguh itu pada L’Equipe. “Anak-anak bisa bermain tanpa beban. Jerman tetap bermain sebagai sebuah mesim yang indah kendati banyak pemain mereka absen. Secara kolektif dan individual, kami harus waspada.” (bg/int)

Saung Alam Raya Cup

Bangkitkan Gairah Sepak Bola


„ Penonton selalu membanjiri stadion Balimbingan untuk menyaksikan turnamen sepak bola Saung Alam Raya Cup U-18 Simalungun. TANAH JAWA- Turnamen sepak bola Saung Alam Raya U-18 yang sedang berlangsung di stadion Balimbingan merupakan tontonan yang menarik bagi warga Tanah Jawa. Bertandingnya tim- tim terbaik kecamatan dan perkebunan se-Simalungun membuat gairah penonton semakin tinggi. Anggota DPRD Simalungun Sugiarto SE dan Manandus Sitangang SSos saat ditemui METRO di sela-sela pertandingan, Senin (28/2) mengatakan, animo masyarakat Tanah Jawa untuk menonton pertandingan sepak bola cukup tinggi. Penonton cukup sportif dan tidak pernah mengucapkan kata-kata yang tidak etis. Setiap tim yang bermain bagus selalu mendapat dukungan penonton. Kesebelasan Star Lake Toba Parapat merupakan salah satu idola penonton Tanah Jawa. Tampil dengan pemain usia muda belia, kesebelasan asal Girsang Sipangan Bolon ini selalu mendapat dukungan penuh setiap turun bertanding. Banyaknya warga Tanah Jawa yang dulunya berasal dari Girsang Sipangan Bolon membuat kesebelasan Parapat bagaikan bermain di kandang sendiri.

Makanan ringan dolung-dolung Parapat selalu dibagikan pemain Parapat kepada penonton. Sepak bola mampu mempererat hubungan antara warga Tanah Jawa dengan warga Girsang Sipangan Bolon Parapat. Sementara Ir Truly Anho Sinaga dan Mukkin Nainngolan, juga anggota DPRD Simalungun menambahkan, kesebelasan Putra Raya yang berasal dari daerah Simalungun Atas juga cukup bersahabat dengan penonton Tanah Jawa. Dengan fisik yang rata-rata bagus, baik stamina, tinggi badan dan kerja sama tim, membuat penonton Tanah Jawa jatuh hati pada tim Raya. Banyak kalangan remaja putri atau cewek ABG Tanah Jawa yang minta foto bersama dengan pemain Putra Raya. Di sinilah mulai terjalin hubungan silaturahmi antar remaja Tanah Jawa dengan anak remaja Kecamatan Raya. Terpisah, Ketua Panitia Robensius Purba SH mengatakan, untuk partai semi final, Kamis (1/3) ada 4 kesebelasan yang akan bertarung, yakni, PSDH Dolok Hataran vs SMA Seminary, dan PS Pasir Mandoge Asahan vs Rambung Merah. (iwa/ara)

Laga Tim Terbaik RABU

Baca Halaman 10

29 FEBRUARI 2012

Prakiraan Formasi:




INGGRIS (4-4-2): Joe Hart, Johnson, John Terry, Rio Ferdinand, Ashley Cole, Theo Walcott, Frank Lampard, Ashley Young, Bent, Crouch. BELANDA (4-3-3): Stekelenburg, Boulahrouz, Heitinga, Mathijsen, van der Weil, Sneijder, Van Bommel, van der Vaart, Kuyt, Van Persie, Robben.

BURSA METRO International F riendlies Friendlies Serbia vs Armenia Bosnia vs Brazil Georgia vs Albania Kazakhstan vs Latvia Moldova vs Belarus Hungary vs Bulgaria Israel vs Ukraine Montenegro vs Iceland Luxembourg vs Macedonia Tunisia vs Peru Greece vs Belgium Malta vs Liechtenstein Romania vs Uruguay Turkey vs Slovakia Afsel vs Senegal Denmark vs Russia Morocco vs Burkina F Austria vs Finland Croatia vs Sweden Swiss vs Argentina Germany vs France Ireland vs Czech Rep Italy vs USA N.Ireland vs Norway Poland vs Portugal Slovenia vs Scotland Wales vs Costa Rica England vs Netherlands Spain vs Venezuela Ecuador vs Honduras Paraguay vs Panama Chile vs Ghana Mexico vs Colombia El Salvador vs Estonia

0 : 3/4 1 1/4 : 0 0 : 3/4 3/4 : 0 1/2 : 0 0 : 3/4 0:0 0:1 3/4 : 0 0 : 1/4 0 : 1/4 0 : 1/2 1/4 : 0 0 : 3/4 0 : 1/2 0 : 1/4 0 : 3/4 0 : 3/4 0 : 1/2 1/2 : 0 0 : 3/4 0 : 1/4 0:1 1/4 : 0 1/2 : 0 0 : 1/2 0 : 3/4 0:0 0 : 2 1/4 0 : 1 1/4 0 : 1 3/4 0 : 3/4 0 : 1/2 0 : 1/4

Serie A Team




K Nilai



































































Laga Inggris versusBelanda yang akan di gelar di stadion wembley (29/2) memang sekadar pertandingan persahabatan tapi atmosfernya dijamin hampir mirip laga di turnamen resmi, di mana pertandingan ini akan mempertaruhkan moral dan mental juara kedua tim. Makin mendekatnya hari H gelaran Piala Eropa 2012, membuat kedua tim dipastikan akan menurunkan komposisi pemain terbaiknya.


aat ini,baik Inggris maupun Belanda tinggal menyisakan tiga p e r t a n d i n g a n persahabatan lagi sebelum di mulainya Piala Eropa. Alhasil, laga kali ini juga bisa menjadi tolak ukur penampilan mereka di gelaran juni-juli mendatang. Belanda sebagi salah satu favorit juara di Piala Eropa 2012 datang dengan pasukan utamanya ke wembley. Bintang-bintang macam Wesley Sneijder, Robin van Persie, hingga Arjen Robben tampak menghiasi skuad besutan Bert van Marwiijk. Praktis, tidak ada pemain bintang De Oranje yang tertinggal. Belanda yang berada di Grup maut, Grup D bersama Denmark, Jerman, dan Portugal merasa perlu untuk melakukan Ujicoba dengan tim

Premier League Team



K Nilai

M. City

M 26





M. United






T. Hotspur


















Newcastle United26 12










Norwich City


















La Liga Real Madrid 24























Ath. Bilbao


















„ Van Persie

„ Stevie G

„ Pertarungan Inggris vs Belanda, beberapa waktu lalu.

Kamis Pukul 03.00 WIB kelas satu sebelum laga sesungguhnya di gelar. Inggris adalah lawan yang tepat untuk mengasah kemampuan Van Pesie dkk. Kemenangan atas Inggris, di mata Van Marwijk, sangat penting untuk meningkatkan moral tim. Bagaimana juga dapat mengalahkan tim sebesar dan sekuat Inggris akan menjadi Modal berharga dlam mengarungi kerasnya persaingan di Piala Eropa Polandia-Ukraina 2012. Sebenarnya Inggris juga memiliki tujuan yang hampir sama, artinya sebagai tolak ukur The Three Lions

Getaran Piala Eropa 2012 sudah semakin mendekat. Kami harus harus bisa mengoptimalkan semua pertandingan persahabatan yang tersisa,”

DA TA DAN FFAKT AKT A DAT AKTA Kedua tim terakhir kali bertemu pada bulan Agustus 2009, pada laga persahabatan. Saat itu kedua tim bermain imbang 2-2 di Amsterdam. Tuan rumah sebenarnya unggul 2-0 lebih dulu melalui Dirk Kuyt dan Rafael van der Vaart. Namun dua gol dari Jermain Defoe menyelamatkan Inggris dari kekalahan. Dari empat pertemuan terakhir kedua tim, selalu berakhir imbang. Terakhir kali Belanda mengalahkan Inggris di kandang sendiri pada bulan Agustus 2001, dengan skor 2-0. Inggris sementara dilatih oleh Stuart Pearce yang ditunjuk menggantikan Fabio Capello yang baru saja mengundurkan diri. Sebelumnya, Pearce adalah pelatih timnas Inggris U-21. Jelang laga melawan Belanda, Inggris malah mendapat kabar buruk dari Wayne Rooney, Tom Cleverley, dan Darren Bent. Ketiganya dipastikan absen karena mengalami cedera. Gareth Barry juga diragukan tampil karena masalah kebugaran.

5 pertandingan terakhir Inggris:

Van Marwijk sebelum bertarung di medan pertempuran yang sebenarnya.Namunsayang tiga pekan sebelum laga dimulai, manajer timnas Inggris Fabio Capello mengundurkan diri. Kedua tim terakhir kali bertemu pada bulan Agustus 2009, pada laga persahabatan. Saat itu kedua tim bermain imbang 2-2 di Amsterdam. Tuan rumah sebenarnya unggul 2-0 lebih dulu melalui Dirk Kuyt dan Rafael van der Vaart. Namun dua gol

16 Nov 2011 13 Nov 2011 8 Okt 2011 7 Sept 2011 3 Sept 2011

: Inggris 1-0 Swedia (persahabatan) : Inggris 1-0 Spanyol (persahabatan) : Montenegro 2-2 Inggris (Kualifikasi Euro 2012) : Inggris 1-0 Wales (Kualifikasi Euro 2012) : Bulgaria 0-3 Inggris (Kualifikasi Euro 2012)

5 pertandingan terakhir Belanda: 16 Nov 2011 12 Nov 2011 12 Okt 2011 8 Okt 2011 7 Sept 2011

: Jerman 3-0 Belanda (persahabatan) : Belanda 0-0 Swiss (persahabatan) : Swedia 3-2 Belanda (Kualifikasi Euro 2012) : Belanda 1-0 Moldova (Kualifikasi Euro 2012) : Finlandia 0-2 Belanda (Kualifikasi Euro 2012)

Head to Head 12 Agus 2009 (persahabatan) 15 Nov 2006 (persahabatan) 09 Feb 2005 (persahabatan) 13 Feb 2002 (persahabatan) 15 Agu 2001 (persahabatan)

dari Jermain Defoe menyelamatkan Inggris dari kekalahan. Dari empat pertemuan terakhir kedua tim, selalu berakhir imbang. Terakhir kali Belanda mengalahkan Inggris di kandang sendiri pada bulan Agustus 2001,

Belanda 2-2 Inggris Belanda 1-1 Inggris Inggris 0-0 Belanda Belanda 1–1 Inggris Inggris 0–2 Belanda

dengan skor 2-0. Inggris sementara dilatih oleh Stuart Pearce yang ditunjuk menggantikan Fabio Capello yang baru saja mengundurkan diri. Sebelumnya, Pearce adalah pelatih timnas Inggris U-21. (ab/int)


Menyuarakan Aspirasi Masyarakat Tapanuli

Jhonny Allen Didemo ke KPK JAKARTA-Sejumlah Waria yang tergabung dalam Komite Waria Antikorupsi (Kowar) menggelar aksi unjuk rasa di depan Kantor Komisi Pemberantasan Korupsi (KPK), Selasa (28/2) siang. Kowar menuntut agar KPK dapat menuntaskan beberapa kasus yang sudah lama mengendap di KPK. Seperti kasus dugaan korupsi dan suap proyek pembangunan pelabuhan dermaga di Indonesia Timur, hingga kasus dugaan mark up tanah makam TPU Pondok Rangon, Jakarta Timur sebesar Rp10

Jhonny Allen

miliar yang dilakukan Wakil Ketua Umum Parta Demokrat (PD) Johnny Allen Marbun. “Susahnya aparat penegak hukum menyentuh Waketum PD ini menimbulkan tanda tanya publik. Ada apa dengan KPK? Apa KPK bermental banci?” teriak Korlap Aksi, Ice dalam orasinya. Seperti diketahui, dalam kasus ini Johnny Allen yang sebelumnya merupakan pegawai di Kebun Raya Binatang, Jakarta Selatan telah dilaporkan secara resmi oleh mantan

ajudannya sendiri ke KPK beberapa waktu lalu. Laporan tersebut yakni terkait dugaan korupsi yang dilakukan Johnny pada proyek dugaan mark up tanah makam TPU Pondok Rangon, Jakarta Timur sebesar Rp10 miliar. “Oleh karena itu, kami mendesak KPK membuktikan lembaganya tidak diintervensi oleh kekuatan partai penguasa dan menuntut KPK segera menangkap Johnny Allen,” teriaknya lagi. (int)

Mata Membelalak, Dicurigai Dibunuh UNTUK memastikan penyebab kematian Nia Daniati Br Situmanggor, pihak kepolisian yang mendapat laporan dari keluarga korban, Selasa (28/2) malam sekira pukul 19.00 WIB menjemput mayat korban dari rumah duka. Dengan menggunakan mobil patroli polisi, jasad Nia dibawa ke RSU Sibolga untuk dilakukan otopsi. Saat di RSU Sibolga, mata korban tidak tertutup, namun seperti membelalak. “Keluarga curiga kalau korban dibunuh, sehingga kita yang mendapat laporan langsung membawa jasadnya untuk diotopsi,” kata pelaksana harian Kasatreskrim Baca

Mata..Hal 2


Jasad Nia Daniati Br Situmanggor di rumah duka, Selasa (28/2) sekira pukul 15.00 WIB. Korban diduga tewas akibat overdosis minuman beralkohol.

TAPTENG- Nia Daniati Br Situmanggor (35) ditemukan sekarat di pinggir Jalinsum Sibolga-Barus, Kecamatan Kolang, Tapteng, Selasa (28/2) siang. Dari mulutnya tercium aroma minuman keras. Saat dilarikan ke rumah sakit, wanita yang bekerja di lapo tuak Valentine di Kolang ini, tewas.


Ibu korban, Pesti br Sihotang (kanan) dan kakaknya, Risma Br Situmanggor, Selasa (28/2).



Melawan Dua Musuh Berat JAKARTA- Harga diri persepakbolaan Indonesia akan dipertaruhkan malam nanti. Ya, timnas Indonesia akan menghadapi Bahrain di laga pemungkas kualifikasi Pra Piala Dunia Grup E zona Asia melawan tuan rumah Bahrain di Stadion Nasional Bahrain. “Skuad Garuda sudah tidak punya kepentingan apapun di kualifikasi ini. Sebab jauh-jauh hari, timnas yang sebelumnya Baca

Melawan..Hal 2

JAKARTA- Pemerintah akhirnya menyampaikan usulan resmi ke DPR terkait rencana kenaikan harga BBM subsidi. Ada dua opsi yang diusulkan. Pertama, menaikkan harga BBM subsidi. Kedua, menetapkan besaran subsidi tetap. Dua opsi inilah yang dimasukkan dalam pembahasan APBNPerubahan 2012 dengan DPR Maret mendatang. Menteri Energi dan Sumber Daya Mineral

(ESDM) Jero Wacik mengatakan, usulan pertama yang disampaikan adalah menaikkan harga BBM subsidi jenis premium/bensin dan solar sebesar Rp1.500 per liter. “Sehingga, harganya akan naik dari Rp4.500 per liter menjadi Rp6.000 per liter,” ujarnya saat rapat kerja di Komisi VII DPR, Selasa (28/ 2). Baca

Usulan..Hal 2

Pelaku Semarga dengan Korban

Kawan Korban Menduga karena Overdosis Alkohol


Usulan Harga Bensin-Solar Rp6 Ribu/Liter

Seputara Kakak-Adik Diculik & Diperkosa

Wanita Pekerja Lapo Tewas Uang dan Perhiasan Hilang

Pra Piala Dunia

Edisi 210 -th VIIII Harga Rp2.000

Dari rumah sakit, jasad ibu satu anak ini diantarkan teman korban, Br Simbolon ke rumah orangtuanya di Jalan Makmur, Lorong VI, Kelurahan Pasir Bidang, Kecamatan Sarudik, Tapteng, hari itu juga sekira pukul

15.00 WIB. “Pas kami lewat mau sarapan ada orang yang bilang, lihat kawan kalian itu, sudah tergeletak di jalan itu. Baca

Wanita..Hal 2

SIANTAR- FS (22) dan kakaknya JS (26) mengaku masih trauma atas penculikan yang mereka alami, Minggu (26/2) dini hari lalu. Mereka dicabuli dan diperkosa kawanan perampok di bawah todongan senjata api. Bahkan, salah seorang dari pelaku merupakan semarga dengan korban. Di tempat kontrakan korban di Jalan Danau Ranau, Pematangsiantar, FS mengatakan dirinya tidak bisa melupakan peristiwa tersebut, bahkan tetap terngiang dalam pikirannya. Mulai dari para pelaku Baca

Pelaku ..Hal 7


FS korban perkosaan

Batang Toru Kaya Tumbuhan dan Hewan Langka

1.000 Orang Utan & Bunga Bangkai TAPTENG- Kabupaten Tapteng ternyata tidak hanya kaya akan objek wisata pantai, air terjun, wisata bahari dan sejarah, tetapi juga kaya akan flora dan fauna. Dari hasil penelitian Yayasan Ekosistem Lestari (YEL), sebuah lembaga LSM yang bergerak di bidang konservasi lingkungan dan

pendidikan yang berpusat di Medan serta bagian dari PanEco yang merupakan salah satu lembaga lingkungan hidup asal Swiss, yayasan ini menemukan 11 jenis tanaman yang merupakan spesies baru didunia ilmiah. Selain itu, lembaga ini juga Baca

1.000..Hal 7

Dua Hari Pasca Banjir Madina, Satu Tewas


Bupati Tapteng Bonaran Situmeang menerima kenang-kenangan berupa foto kawasan Hutan Batang Toru dari Gabriella Fredrikson. (FOTO: NASA).


Masjid Raya Desa Gunung Manaon masih digenangi air.

Warga mencuci kain. Mereka belum bisa membersihkan rumah karena masih digenangi air.

MADINA- Banjir hebat yang menerjang Kabupaten Mandailing Natal, Minggu (26/2) malam lalu, tidak hanya menyisakan lumpur dan tumpukan kayu di mana-mana. Di badan sungai Aek Kitang, Desa Gunungmanaon,

ditemukan sesosok mayat. Selanjutnya, dengan susah payah warga berusaha mengeluarkan jenazah dari timbunan kayu. Adalah Amirhan Nasution (56) korban tewas tersebut. Pria yang sehari-

hari bekerja sebagai parbecak alias tukang becak ini, merupakan warga Mompang Julu, Kecamatan Panyabungan Utara atau sekitar 10 kilometer dari Baca

Korban..Hal 2

Polisi Termungil dan di Dunia Berlangganan pemasangan iklan 5

0631 24676





29 Februari 2012



Wanita Pekerja Lapo Tewas Uang dan Perhiasan Hilang Sambungan Halaman 1 Mabuk mungkin itu. Terus kami lihat, rupanyabetul.Tapiwaktuitu dia (korban) masih hidup, napasnya satu-satu, kondisinya lemas kali.Kuciumaromanyabauminumanberalkohol.Sebelumdibawa ke puskesmas, kami sempat kasih dia minum air putih,” kata teman korban, Br Simbolon, kepada keluarga korban di rumah duka. Br Simbolon mengakui sejak Minggu (26/2), korban terlihat menenggak minuman keras (miras,red). Bahkan, sambung Br Simbolon,dirinyasempatmelihat korban membeli beberapa botol minuman beralkohol. Namun dirinya tidak mengetahui merk

miras yang dibeli korban. “Memang hari Minggu itu dia sudahminumdilapoBrBarasa,itu lapo kawannya. Ada orang yang bilanglagi,diasudahminumsejak sorehariitu,”ujarBrSimbolonyang menduga temannya itu punya masalah yang berat hingga akhirnya berusaha menghilangkan stresnyadenganminummiras. Pemilik lapo tuak tempat korbanbekerja,MansurSimanjuntak (44) mengaku mengetahui kabar soal kondisi korban siang itu dari Br Simbolon. Setelah melihat kondisi pekerjanya yang berprofesi sebagai kasir tersebut, Mansurpunberinsiatifmembawa korban ke puskesmas setempat. “Kami sempat bawa ke

puskesmas, tapi tidak tertolong lagi,”kataMansurserayamengaku mengetahui alamat orangtua korban di Lorong VI, Kelurahan Pasir Bidang karena sebelumnya sudahpernahdatangberkunjung ke rumah tersebut. PerhiasannyaHilang Sementara itu ibu korban, Pesti BrSihotang(60)langsungmenjerit histeris begitu mendengar kabar dan melihat mayat putrinya itu terbujurkakudanditurunkandari ambulans yang membawanya dari Puskesmas Kolang. Jeritan histeris Pesti sontak menyita perhatian dari para tetangga dan warga sekitar. “Inang boruku…, ” tangis histeris ibu korban yang sudah janda tersebut, saat menyambut jasad korban Nia

DaniatibrSitumanggor. Kakak korban, Risma br Situmanggor (40) kepada METRO mengaku pihak keluarga merasakan kejanggalan atas tewasnya Nia.Sebab,selamainikorbandikenal sebagai sosok yang periang, ramahdanbukanpeminum. Apalagi, katanya, sejumlah perhiasan seperti cincin dan kalung emas milik korban hilang. Handphone dan dompet berisi sejumlah uang milik korban juga tidak ditemukan. Selain itu, juga ada luka memar di ujung jari kaki kirikorban.“BaruhariSabtu(25/2) kami ketemu di Sibolga. Dia sempat ajak aku makan dan aku dibelikannya sebungkus rokok. Minggulalupundiamintadibeliin anting-anting, kubelikan. Waktu

ituakutahudialagibanyakuangdi dompetnya,” tutur Risma. Risma sendiri sudah berulangkali meminta adiknya itu untuk berhenti bekerja di lapo, dan menyarankanagarikutberjualanikan keliling di Sibolga, sama seperti dirinya. “Aku enggak tahu apa masalah dia ini. Enggak pernah kelihatan suntuk. Yang kutahu pun dia enggak biasa minum,” tuturnya. Informasi yang dihimpun, korban sudah bekerja di lapo tuak tersebutselamasekitarduabulan. Biasanya, Korban pulang ke rumah orangtuanya di Lorong VI PasirBidang,setidaknyaseminggu sekali. Namun, kata Risma, minggu terakhir ini korban tidak pulang.(cr-05)

Mata Membelalak, Dicurigai Dibunuh Koran Kebanggaan Orang Tabagsel Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Tapanuli, Metro Siantar, Metro Asahan, Metro Tabagsel) Chairman : Rida K Liamsi Komisaris Utama : Marganas Nainggolan Komisaris : Ari Purnama Direktur Utama : Goldian Purba Direktur : Affan Bey Hutasuhut Pengasuh Pemimpin Umum/Penjab/GM : Marganas Nainggolan Wakil Pemimpin Umum : Goldian Purba Pimpinan Perusahaan : Maranatha Tobing Pimred Metro Tapanuli : Alvin Nasution Wapimred Metro Tapanuli : Daniel Simanjuntak Pimred Metro Siantar : Pandhapotan MT Siallagan Pimred Metro Tabagsel : Muhiddin Hasibuan Pimred Metro Asahan : Eva Wahyuni Tim Ombudsman : Vincent Wijaya DIVISI PRODUKSI Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana Metro Tapanuli: Syafruddin Yusuf, Kordinator Liputan Tapanuli: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO SIANTAR Dewan Redaksi:Marganas Nainggolan (ketua), Goldian Purba, Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana Metro Siantar: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Penanggungjawab Event & Bisnis: Jhon Damanik, Redaktur: Pholmer Saragih, Plidewatna, Nurjannah, Assisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba, Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jesron Sihotang (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi:Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Redaktur Pelaksana Metro Tabagsel:.., Kordinator Liputan Tabagsel: Borneo Dongoran, Reporter : Parlindungan Pohan (Padangsidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar , (Palas),Mhd Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana Metro Asahan: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Salomo Seven H Malau, Kabag: Ahmad Yasir, Staf Pracetak:Jamaluddin Sinaga, Amiruddin, Hedry Handoko, Jefree Putra, Andre Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kord Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Roy Amarta, Ismail, Efendi Tambunan, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico, Ardi, Erik Departemen Iklan Manager Iklan: Jamot S, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba PERWAKILAN METRO TAPANULI Ka Perwakilan Tapanuli/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah sari, Staf Pengembangan: Zulfiandi, Perwakilan Tabagsel Ka Perwakilan Tabagsel/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran Pematangsiantar : Jalan Sangnawaluh No.24 Komplek Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Pematangsiantar. e-mail : Perwakilan Jakarta: Jalan Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522 Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733

Sambungan Halaman 1 Polres Tapteng Ipda Sofyan, kemarin (28/2) malam. Diutarakan Sofyan, hasil penyelidikan sementara, belum ditemukan tanda-tanda kekerasan di tubuh korban. “Namun di jari kaki sebelah kiri terdapat luka lecet dan mulutnya berbuih. Untuk memastikan penyebab pasti tewasnya korban, kita masih terus menyelidikinya dengan bekerja sama dengan Polsek Sorkam,” tutur Sofyan, yang juga Kanit Tipikor. Sementara di kamar mayatRSUSibolga,hinggatadimalam

sekira pukul 21.00 WIB, jasad korban masih terbujur kaku dan belum dilakukan otopsi oleh dokter forensik. “Dokternya masih ada kerjaan, mungkin sebentar lagi,” ujar salah seorang petugas medis. DirekturRSUDRFLTobingSibolga, drg Tunggul Sitanggang ketika dikonfirmasi METRO, Selasa (28/2) mengatakan, seseorang dapat meninggal dunia akibat minum minuman beralkohol. “Bisa, walau mungkin berbedabeda daya tahan tiap orang. Misalnya ada orang yang minum segelas sudah kena atau bisa meninggal, ada yang

Usulan Harga Bensin-Solar Rp6 Ribu/Liter Sambungan Halaman 1 Adapun opsi kedua, kata Jero, adalah dengan mematok besaran subsidiBBMsebesarRp2.000perliter. Artinya, harga BBM subsidi jenis premium dan solar akan berfluktuasi mengikuti harga minyak dunia, seperti halnya pertamax dan BBM nonsubsidi lainnya. “Opsi ini muncul karena kita selalu tegang setiap harga minyak naik. Jadi, dengan opsi kedua ini, kita akan terbiasa dengan naik turunnya harga BBM,” katanya. Sebagai gambaran, jika saat ini harga pertamax sekitar Rp9.000 per liter, maka harga keekonomian (tanpa subsidi) premium diperkirakan sekitar Rp8.600 per liter. Jika opsi kedua yang diberlakukan, maka pemerintah akan memberikan subsidi Rp2.000 per liter, sehingga harga premium yang aslinya (tanpa subsidi)sebesarRp8.600perliter,akan menjadi Rp6.600 per liter. Namun, jika harga minyak dunia terus naik dan harga keekonomian premium menjadi misalnya Rp9.000 perliter,makahargapremiumsubsidi juga akan naik menjadi Rp7.000 per liter. Sebaliknya, jika harga minyak duniaturundanharga keekonomian premium

menjadi misalnya Rp7.500 per liter, maka harga premium subsidi yang dijual ke masyarakat pun akan ikut turun menjadi Rp5.500 per liter. Menurut Jero, kenaikan harga tersebut berlaku bagi semua jenis kendaraan, baik sepedamotor, kendaraan umum, maupun mobil pribadi. “Jika kenaikan harga diberlakukan, otomatis pembatasan BBM subsidi tidak akan dilanjutkan. Meski demikian, kami akan tetap mengimbau agar pemilik mobil pribadi membeli BBM nonsubsidi,” terangnya. Pengamat perminyakan yang juga Direktur Eksekutif ReforMiner Institute Pri Agung Rakhmanto mengatakan, jika harga BBM subsidi naikRp1.500perlitermenjadiRp6.000 per liter, maka pemerintah akan mendapat penghematan subsidi BBM sekitar Rp57 triliun. Menurut Pri Agung, kebijakan kenaikan harga ini cukup rasional, implementatif, dan efektif untuk mengatasi permasalahan untuk jangka pendek, tetapi tidak untuk jangka panjang karena kebijakan ini bersifat ad hoc. “Buktinya, setiap kali terjadi lonjakan harga minyak mentah dunia, APBN akan terus tertekan oleh penambahan defisit karena membengkaknyasubsidiBBMdansubsidi energi lainnya (LPG dan listrik),”

SEJAK LAMA SUSU ETAWA DIPERCAYA MAMPU MENGATASI ASMA Ketika asma menyerang, saluran n a f a s mengalami penyempitan k a r e n a hiperaktifitas terhadap rangsangan tertentu, yang menyebabkan peradangan. Pada penderita asma, penyempitan saluran pernafasan merupakan respon terhadap rangsangan yang pada paru-paru normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Sucipto, warga Dusun Parakan Muncang-Cimanggung, Rancaekek, Muntilan, Jawa Tengah yang telah lama menderita asma kini memilih Milkuma untuk mengatasi keluhannya, "Sudah 12 tahun lamanya aktifitas saya sering terganggu karena menderita asma. Kalau sudah kambuh, nafas sering terasa sesak, badan tidak pernah gemuk. Untunglah kini saya minum Milkuma, Alhamdulillah sekarang saya

seember baru kena,” terang Tunggul. Dijelaskannya, zat alkohol dari minumanbercampurkedalamdarah si peminumnya, kemudian mengalir ke saraf otak. “Makanya alkohol bisa membunuh manusia,” jelasnya. Ketika ditanya soal mengapa kelopak mata sesosok jenazah bisa terbuka seperti halnya pada korban, Tunggul mengaku tidak bisa memastikan apa penyebabnya. Sebab harus diperiksa secara medis terlebih dahulu. “Oh itu aku enggak bisa pastikan, harus diperiksa dulu, divisum,” pungkasnya. (mora/nasa)

sudah sehat." Terang pria berusia 52 tahun tersebut. Ia menceritakan, sudah 5 bulan ini minum Milkuma. Dengan tubuh yang sehat, ayah 3 orang anak tersebut dapat menjalani aktifitasnya dengan prima. Ia pun mengajak orang lain untuk merasakan manfaat susu etawa ini, "Mari kita sehat bersama Milkuma." Ajak pria yang berprofesi sebagai wiraswasta tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu etawa. Berbeda dengan susu sapi, sesungguhnya susu etawa memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu etawa pun tidak menyebabkan alergi sehingga aman, dan bermanfaat untuk penderita asma. Satu gelas susu etawa memasok 20,0% dari nilai harian Riboflavin. Milkuma adalah minuman serbuk susu etawa yang diproses secara alami, tanpa pemanis buatan dan bahan

pengawet. Bahan dasarnya adalah susu etawa segar dan gula aren. Mengkonsumsi Milkuma sebanyak 2 gelas sehari bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu etawa bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Milkuma dikomposisikan dengan gula aren sehingga aman bagi penderita diabetes. Milkuma juga sangat dianjurkan bagi perokok baik perokok aktif maupun pasif. Milkuma sudah tersedia di apotek2 juga toko2 obat terdekat dikota anda, atau hubungi, Sumut; 085314072195 / 06191128785. Depkes dengan no PIRT. 6.09.3328.01.395

jelasnya. Karena itulah, lanjut dia, opsi keduayangmematokbesaransubsidi dinilai lebih solutif untuk jangka panjangkarenabisameredamgejolak harga minyak terhadap APBN. Sebagai catatan, Pri Agung sudah melontarkan ide mematok besaran subsidi BBM ini sejak 2010 lalu. Berdasar kajian ReforMiner Institute, pada tingkat harga minyak USD 80 per barel hingga USD 120 per barel, hargaberlakupremiumakanbergerak di kisaran Rp4.500-6.520 per liter dan solar Rp 4.500-6.525 per liter. Jero menambahkan, untuk meringankan beban masyarakat akibat kenaikan harga BBM subsidi, pemerintah siap memberikan kompensasi atau bantuan bagi masyarakat miskin. “Kompensasi ini akan diberikan pada golongan masyarakat terdampak,” katanya. Jero menyebut, beberapa jenis kompensasi diantaranya adalah kompensasi untuk perlindungan kepada masyarakat tidak mampu, Kompensasi transportasi, kompensasi pangan, serta kompensasi bantuan pendidikan. Untuk kompensasi transportasi, lanjut dia, misalnya akan diberikan dalam bentuk kupon angkutan umum atau transportasi khusus bagi anak-anak sekolah. (owi/jpnn)

Korban Dikeluarkan dari Timbunan Kayu Sambungan Halaman 1 tempat lokasi penemuan. Mayat bapak delapan anak ini ditemukan kemarin (28/2) sekira pukul 14.15 WIB oleh puluhan relawan yang juga kader DPC PPP Madina bersama warga Gunungmanaon yang gotong-royong mengangkut tumpukan kayu dari badan sungai agar air tidak mengalir ke pemukiman. Saat itu, warga sibuk memotong kayu besar dengan chainsaw atau mesin pemotong kayu. “Daritadipagi(kemarin)kita(kader PPP, red) bergotong royong dengan sejumlah warga. Lalu sekira jam empat lewat, anggota yang sedang memotong kayu melihat tubuh manusia. Awalnya yang kelihatan adalah tangan. Saat ditemukan, mayat dalam kondisi telentang dan sudah bugil,” terang Ketua DPC PPP Madina HM Dahler Nasution. Sementara itu, informasi yang dihimpun dari keluarga korban, Parhimpunan Nasution, menyebutkan, Minggu (26/2) sore, udaknya (paman) masih bekerja seperti biasa, yakni menarik becak bermoror (betor) mengelilingi Panyabungan. Sekitar pukul 21.00 WIB, korban ingin melihat kondisi jembatan Gunung Tua yang runtuh. Ketika itu, korban memarkirkan betornya tak jauh dari jembatan atau sekitar 20 meter. “Ada yang melihat paman kami memarkirkan betornya di pinggir jalinsum. Ia ingin menyaksikan jembatan yang rubuh. Namun, tidak ada yang melihat udak jatuh karena pada saat itu listrik padam. Kami perkirakan, udak jatuh pada saat itu sehingga tidak diketahui orang lain,” terang Parhimpunan.

Selanjutnya, Senin (27/2) siang setelah memastikan korban tidak pulang ke rumah sedangkan betornya masih parkir di pinggir jalinsum,pihakkeluargamelaporkan kehilangankorbankePolresMadina. Dan kemarin siang, keluarga korban menerima kabar Amirhan Nasution telah meninggal tertimpa tumpukankayudisungaiAekKitang, sekitar 1,5 kilometer dari jembatan rubuh. Kasatreskrim Polres Madina AKP SMSiregarSHmembenarkanlaporan pengaduan orang hilang. “Benar ada laporan pengaduan orang hilang yang identitasnya sama dengan mayat yang ditemukan. Untuk sementarakitaperkirakandiahanyut saat melihat jembatan runtuh. Memangdilokasikitalihataboutmen (penyangga) jembatan di pinggir sungairetak.Mungkinkorban(ketika itu) terlalu dekat berdiri di pinggir sungai, tetapi kita masih lihat dulu kepastiannya,” tukas Kasat. DidugakarenaPembalakanLiar SementarasungaiAekKitangyang berada sekitar 100 meter dari pemukiman warga di Desa Gunungmanaon dipenuhi kayukayubesardenganpanjanglebihsatu kilometer. Dari potongannya, kayukayu tersebut diperkirakan berasal dari sisa penebangan yang belum bisa dipastikan darimana asalnya. Menyikapi hal ini, Kepala Dinas Kehutanan (Dishut) Madina Drs Maraondak Harahap mengaku, pihaknya masih melakukan penyidikan penyebab terjadinya banjir. “Kita belum bisa banyak berkomentar. Tim dari Polhut dan instansi terkait lainnya berada di lapangan untuk menyidiki penyebab banjir,” tandas Harahap. (wan)

Melawan Dua Musuh Berat Sambungan Halaman 1 diarsiteki Wim Rijsbergen babak belur dihajar lawan-lawannya dan pasti gagal melaju ke putaran ke IV. Tapi Bagi tuan rumah Bahrain, laga yang akan dimulai pukul 20.00 ini masih bisa menjadi jalan untuk lolos ke babak berikutnya. Syaratnya Bahrain harus bisa menang telak 9-0 atas Indonesia dan di waktu bersamaan Qatar kalah dari tuan rumah Iran (lihat grafis). Kondisi ini tentu sangat tidak menguntungkan bagi timnas Merah Putih yang kini ditangani Aji Santoso. Sebab Irfan Bachdim cs pasti akan menghadapi tim yang sangat bersemangat untuk mencetak banyak gol. Sementara publik tanah air tahu jika timnas yang sekarang terbangkeBahrainhampirsemuanya wajah-wajah baru yang minim pengalaman laga internasional. Saat berujicoba melawan tim IPL (Indonesia Premier League) Persebaya 1927, Jumat (24/2) lalu di Surabaya timnas tampil buruk dan kalah 1-0. Timnas saat ini yang diberangkatkan hanya diperkuat oleh para

pemain yang berkompetisi di IPL. TidakadasatupunpemainISL(Indonesia Seper League) yang dipanggil. Itu karena menurut PSSI, kompetisi ISL adalah ilegal. Padahal sebelumnya mayoritas skuad timnas adalah para pemain ISL. Pada pertemuan pertama di Stadion Utama Gelora Bung Karno (SUGBK) pada 6 September tahun lalu, Bambang Pamungkas dkk menyerah 2-0. Setelah pertandingan kemudiansempatterjadiketegangan antara pemain dengan pelatih Wim Rijsbergen yang dalam press conference menyalahkan timnya yang tampil buruk. Lalu bagaimana timnas Indonesia yang sudah berubah ‘wajah’ di laga malam nanti? Sekecil apapun palung meraih poin pasti masih ada. Tapi itu butuh perjuangan ekstra keras. Sebab selain akan menghadap para pemain Bahrain yang pasti akan tampil ‘edan edanan’ untuk mencetak banyak gol, para pemain timnas Merah Putih juga akan menghadapi dengan cuaca dingin yang cukup ekstrem. Ya, saat ini cuaca di Bahrain berkisar antara 10-15 derajat Celsius. “Hahaha sebagian besar semua pemain nyaris ‘mati’. Kita harus latihansekarangdandiluarsanasuhu udara 10 derajat,” demikian ditulis pemain naturalisasi Diego Michiels dalam akun twitternya tiga hari lalu. Keitka dihubungi wartawan kemarin, bek Abdul Rahman menyatakan hal serupa. “Di Bahrain dingin, suhunya 16 derajat celcius. Dingin sekali. Latihan saja pakai jaket tebal, seperti pemain Eropa. Tapi, itu bukankendala,”kataAbdulRahman. (ali/jpnn)




Negeri Wisata Sejuta Pesona Razia Rutin di Perbatasan Sibolga-Tapteng


20 Pengendara Ditilang Selama Sejam „ Truk yang terbalik di Jalinsum Anturmangan, Kecamatan Sipirok

TRUK TERBALIK, MACET 4 JAM SIPIROK- Ratusan kendaraan bermotor terjebak macet selama empat jam di Jalinsum Anturmangan, Kecamatan Sipirok, Kabupaten Tapanuli Selatan, Selasa (28/2) siang. Antrean kendaraan ini disebabkan truk bermuatan ampas terbalik, setelah sebelumnya menyenggol truk pengangkut kayu yang terperosok di pinggir jalan. Kemarin sekitar pukul 09.00 WIB, truk pengangkut kayu dengan nomor polisi BK 9621 BI yang datang dari arah Sipirok terperosok di pinggir jalan. Antrean kecil pun terjadi. Lalu sekira pukul 13.00 WIB, dari arah yang sama melintas truk pengangkut ampas nomor polisi BK 8424 MU menyenggol truk yang terperosok itu. Sejurus kemudian, truk pengangkut ampas tadi terbalik hingga menyebabkan macet selama empat jam. Lalu-lintas kembali normal pukul 17.00 WIB setelah kedua truk itu dievakuasi. Sejumlah warga yang ditemui METRO di lokasi, antara lain; Siregar (45), Ritonga (50) dan Harahap (34), menyebutkan, kerusakan jalinsum di wilayah Sipirok memangsudahsangatmengkhawatirkan.Sebab,mulai titik Sipirok hingga perbatasan Kabupaten Tapanuli Utara (Taput), tercatat ada tiga lokasi rawan macet. Yakni, Aek Latong di sekitar Km 10, Batu Jomba Km 13, dan jembatan Aek Sihoru-horu Km 15. Salahsatu penyebab macet dalah ribuan lubang berbagai ukuran yang membentang di sepanjang jalan. Menurutmereka, meskiupayamengantisipasimacet ditigatitikterusditingkatkanolehinstansiterkait,namun pemeliharaan jalur lainnnya terkesan berkurang. Tak heranbilalokasirawanmacetbertambahyaknidiDusun Anturmangan tepatnya di Km 4. “Sudahseringterjadiantreandisini.Tapiyangterpanjang baru hari ini (kemarin). Kita heran, mengapa kondisi ini dibiarkan?Seandainyaditimbunkerikilsaja,jalurinisudah amandanlancar,”terangmereka,Selasa(28/2). “Kami berharap pemerintah juga memperhatikan kondisi jalan ini. Kerusakannya sudah parah. Tak hujan sekalipun masih berpeluang macet, apalagilah ketika hujan,” tambah salah seorang pengguna jalan, Sihombing (40). (ran)

Tindak Tegas Oknum yang Suka Jual Beli Jabatan SIDIMPUAN- DPRD Kota Padangsidimpuan (Psp) segera melaksanakan Rapat Gelar Pendapat (RDP) dengan pihak-pihak terkait tentang pengaduan pencopotan Ayub Hasibuan sebagai Kepala SMP Negeri 10 Psp. Selain itu, DPRD juga meminta pihak terkait menindak tegas oknum yang suka jual beli jabatan. Menurut Ketua DPRD Psp Aswar Syamsi Lubis SE, setelah membaca pengaduan Ayub Hasibuan, ia kemudian mendisposisikan persoalan itu ke Komisi I yang membidangi pemerintahan dan Komisi III membidangi pendidikan. “Kedua komisi ini segera melakukan RDP dengan pihak-pihak terkait, seperti Dinas Pendidikan (Disdik), KepalaSMPNegeri10,dansiapa-siapasajayangdisebut Ayub Hasibuan dalam pengaduannya,” sebut Aswar, Selasa 28/2). Aswar menambahkan, pihaknya berharap kepada WalikotaPspZulkarnaenNasutiondijelangakhirmasa jabatannya agar lebih selektif melakukan mutasi untuk menghindari hal-hal yang tidak diinginkan. Karena dari hasil laporan Kepala SMPN 10 tersebut, diketahui Ayub Hasibuan cukup berprestasi dan mampumengangkatsekolahmenjadiSekolahStandar Nasional(SSN)danbekerjasamadenganDisdikProvsu selama tiga tahun. Ketua Komisi III DPRD Psp H Khoiruddin Nasution menambahkan, pihaknya memang sudah merencanakan menggelar RDP bersama dengan Komisi I dan pihak terkait soal pengaduan pencopotan Kepala SMPN 10. (phn)

SARUDIK- Kesadaran masyarakat dalam berlalu lintas dinilai masih rendah. Hal itu dilihat dari hasil tilang yang dilakukan Satlantas Polres Tapteng, Selasa (28/2) di perbatasan Sibolga-Tapteng tepatnya di Kecamatan Sarudik. Setiap hari personel ini menilang sedikitnya 20 pengendara selama satu jam. Bahkan, puluhan pengendara memilih stop di pinggir jalan tak jauh dari lokasi hingga razia selesai digelar. Razia yang dipimpin langsung oleh Kasat Lantas AKP Eddy Sudrajad dan Kaurbin Ops Satlantas IPDA Rosmeri ini, sebagai upaya meminimalisasi tingkat kecelakaan lalu lintas dan menekan angka kriminalitas di jalan wilayah hukumnya. Eddy mengatakan, kegiatan tersebut rutin dilaksanakan Polres Tapteng. Tujuannya, untuk menurunkan angka kriminal di jalan raya serta meningkatkan kesadaran masyarakat agar lebih mematahui peraturan lalu lintas. Seperti, melengkapi surat-surat kendaraan. ”Hal ini kita laksanakan untuk menekan tingginya angka kriminalitas di jalan. Seperti curanmor (pencurian kendaraan bermotor) dan curas (pencurian dengan kekerasan) dan tindakan-tindakan kriminalitas lainnya,” jelasnya. Ia mengakui, kesadaran masyarakat di daerah itu masih rendah. Hal itu dibuktikan dengan

sedikitnya 20 surat tilang dikeluarkan setiap paginya. “Kita tidak akan memberi toleransi bagi pengendara yang melakukan pelanggaran. Artinya, langsung ditilang dan harus mengikuti sidang dengan jadwal yang tertera disurat tilang,” tegasnya. Dalam razia itu, katanya, petugas Polantas turut sibuk mengatur lalu lintas. Pasalnya, banyak kendaraan baik roda dua maupun empat diberhentikan dan wajib menunjukan surat-surat kendaraan. ”Gerakgerik kendaraan yang bermasalah beda. Hal seperti itu langsung kami razia,” tandasnya. Razia yang dimulai sejak pukul 07.40 WIB hingga 08.15 WIB mengambil start dari Jalan SM Raja, Kecamatan Sarudik, tak jauh dari perbatasan Kota Sibolga. Pihaknya mengimbau kepada pengendara untuk selalu mematuhi peraturan berlalu lintas. Seperti, memakai helm dan sabuk pengaman.


BERHENTI: Beberapa pengendara sepedamotor berhenti dan memilih parkir di pinggir jalan menunggu razia selesai, Selasa (28/2). Pantauan METRO banyak pengendara khususnya sepedamotor memilih memarkirkan kendaraannya tak jauh dari lokasi razia. Mereka menunggu razia selesai. Alasannya hanya satu, takut ditilang.

“Takut ditilang bang. SIM ku tak ada,” ketus salah seorang pengendara saat diwawancarai METRO. Pria ini mengaku pihak Satlantas Polres Tapteng sangat tegas terhadap pengendara yang melang-

90 Persen Jalan Kabupaten Rusak Parah PANDAN- Sekitar 90 persen jalan di Kabupaten Tapteng rusak parah. Kerusakan ini diimbau segera diperbaiki guna meningkatkan pertumbuhan ekonomi masyarakat. “Dari zaman ke zaman, dari sudah berapa banyak pemimpin, jalan kabupaten di daerah ini tidak pernah mampu memberikan kebahagian kepada warga. Akibatnya, pertumbuhan ekonomi warga terhambat, sehingga tak salah daerah ini di cap ketiga termiskin di Sumatera Utara (Sumut),” kata aktivis LSM Kupas Tumpas Sibolga-Tapteng, Makmur Pakpahan, Selasa (28/2). Makmur membeberkan, beberapa jalan kabupaten yang kondisinya rusak parah di antaranya, jalan Kabupaten Sipakpahi-Hudopa Nauli, Kecamatan Kolang, Jalan Aloban-Bair, Kecamatan Tapian Nauli, Jalan Masundung dan Parjalihotan, Simanosor, Kecamatan Pinangsori, Jalan Sidomulyo, Kecamatan Lumut. Kemudian jalan menuju Desa Simargarap, Kecamatan Pasaribu Tobing (Pastob), Jalan Sigiringgiring, Kecamatan Tukka serta sejumlah jalan kabupaten lainnya yang terdapat di 20 kecamatan di Tapteng. Makmur mengakui, setiap tahunnya, pemkab mengalokasikan sekian miliar anggaran untuk perbaikan dan pembangunan jalan jalan kabupaten tersebut. Namun setiap tahunnya juga, Pemk-


JALAN RUSAK- Pengendara kesulitan melintasi jalan menuju Desa Sipakpahi-Hudopa Nauli, Kolang, Tapteng, yang rusak parah. ab harus memikirkan dana untuk jalan yang sudah diperbaiki atau dibangun tersebut. Pasalnya, dalam hitungan bulan, jalan yang sudah diperbaiki rusak kembali. “Dimana letak kesalahan ini semua? Pemerintah kah atau kontraktor yang hanya memikirkan untung besar dan tentunya kita miris akan hal ini.,” ungkap Makmur. Di kesempatan ini, Makmur mengilustrasikan dampak kerusakan jalan ter-

hadap tingkat pendapatan masyarakat. Bila jalan baik, biaya yang dikeluarkan masyarakat untuk mengangkut hasil produksi pertanian cukup relevalan. Namun tidak demikian bila jalan rusak, pengusaha pengangkutan barang tentunya akan menaikkan tarif ongkos angkut, demi menutupi pengeluaran atas biaya kerusakan kenderaan. “Soalnya, akibat kerusakan jalan tersebut, biaya

pengeluaran untuk perawatan atau perbaikan yang harus dikeluarkan sudah diluar batas normal. Misalnya, perawatan atau perbaikan kenderaan dapat dilakukan 3 kali sebulan, menjadi sekali sebulan,” bebernya. Makmur memuji terobosan Pemkab yang dilakukan oleh Bupati Tapteng Raja Bonaran Situmeang dengan turun ke lapangan melihat sejumlah proyek pembangunan jalan yang ditenderkan di Dinas Pekerjaan Umum (PU). Bonaran bahkan menegaskan kepada para kontraktor untuk memperhatikan mutu (kualitas) bangunan bila masih ingin mendapatkan proyek pemerintah di Tapteng. Sebelumnya, salah seorang warga, D br Sianturi (39) mengeluhkan kerusakan jalan kabupaten menuju Desa Sidomulyo, Kecamatan Lumut. Menurutnya, kerusakan jalan menuju desa tersebut benar benar memprihatinkan bahkan akibat kondisi itu dirinya sempat mengumpat kepada penyedia jasa (becak bermotor) yang telah mengambil peluang keuntungan dari situasi itu. “Masa jarak tempuh hanya sekitar 1 km dari simpang Jalan PadangsidimpuanDesa Sidomulyo, tarif ongkos Rp30 ribu. Sementara tarif angkutan dari Sibolga ke Kecamatan Lumut dengan jarak tempuh kurang lebih sekitar 40 km sendiri hanya Rp7 ribu,” tandasnya. (mora/nasa)

gar aturan. “Tak bisa kompromi bang. Sebelumnya aku sudah pernah ditilang gara-gara tak punya SIM. Ujung-ujungnya nebusnya di Pengadilan. Trauma aku,” tandasnya. (nasa/des)

PPL Honorer Diusul jadi PNS PANDAN- Jumlah Petugas Penyuluh Lapangan (PPL) yang ada di Tapteng hingga saat ini masih jauh dari prasyarat yang disampaikan dalam UU Nomor 16 Tahun 2006 tentang Sistem Penyuluhan Pertanian, Perikanan dan Kehutanan. Dalam undang-undang tersebut disebutkan, setiap desa atau kelurahan, minimal memiliki 1 petugas PPL. Sementara di Tapteng, jumlah PPL hanya 97 orang dari 177 desa/kelurahan. Artinya, Tapteng masih kurang minimal 80 orang PPL supaya sesuai dengan standar yang diatur undang-undang. Itu pun, dari jumlah PPL Tapteng yang bertugas saat ini, hanya 33 orang yang sudah menjadi PNS, sementara sisanya 64 orang lagi merupakan PPL Tenaga Harian Lepas (THL). “Tapteng saat ini hanya memiliki delapan Balai Penyuluh Pertanian (BPP) untuk membina 638 kelompok tani yang ada di 20 kecamatan atau 177 desa dan kelurahan. Pada 8 BPP tersebut, kita hanya memiliki 97 orang PPL, atau kurang sekitar 80 orang lagi untuk memenuhi persyaratan sesuai yang diamanatkan UU nomor 16 tahun 2006. Untuk itu, kami sangat mengharapkan adanya penambahan personil PPL di Tapteng guna meningkatkan kinerja dari PPL itu sendiri,” kata Kepala Kantor Penyuluhan Pertanian, Perikanan dan Kahutanan Tapteng, M Siregar. Selain mengharapkan adanya penambahan jumlah PPL, ia ingin Bupati Raja Bonaran Situmeang mau mengangkat PPL honorer jadi PNS karena sudah sekian tahun mengabdi membantu pembinaan masyarakat, khususnya di bidang pertanian dan perikanan. “Kasihan mereka yang selama ini telah bekerja keras membantu meningkatkan produksi pertanian dan perikanan di Tapteng. Apalagi, mulai tahun 2008 hingga 2010, honor PPL yang ditampung di APBN hanya 10 orang saja. Padahal mereka bekerja selama 12 bulan penuh setahun. Bahkan, sejak tahun 2011, honor PPL yang ditampung di APBN delapan bulan saja. Beruntung, Badan Koordinasi Penyuluh (Bakorluh) Provinsi Sumut mau menampung anggaran honor PPL selama 2 bulan. Kami berharap bupati mau mengangkat para PPL honorer ini menjadi PNS. Atau setidaknya mau membantu membayar honor mereka selama 2 bulan lagi, supaya genap setahun,” harapnya. (ahu/ nasa)

Sampuran Golkar, Objek Wisata Terabaikan Nama air terjun ini Sampuran Golkar. Letaknya di Desa Mela I, Kecamatan Tapian Nauli, Kabupaten Tapteng. Airnya jernih dan lokasinya sangat asri. Namun sayang, objek wisata ini tak setenar Pantai Kutai di Desa Mela II, di kecamatan yang sama. ARIS HOTNAULI BARASA-TAPTENG JARAK menuju air terjun Sampuran Golkar ini sekitar 3,5 km dari pusat Kota sibolga. Objek wisata yang turut dikembangkan oleh Partai Golkar (dengan membangun jembatan menuju air terjun) ini sangat cocok untuk keluarga dan kaula muda untuk menghabiskan waktu liburan akhir pekan, sembari menghilangkan kepenatan aktifitas di kantor dan di sekolah. Namun sayang, jalan menuju air terjun ini masih tanah dan bebatuan. Kondisi jalan seperti inilah yang menjadi alasan mengapa air terjun ini tidak diramaikan pengunjung. Sejak dibuka tahun 1980 sampai sekarang, jalan menuju objek wisata tersebut belum pernah diaspal. Jika musim hujan, jalan tersebut licin dan

belumpur. Sedangkan musim kemarau, debu berterbangan dan mengganggu pernafasan warga sekitar. Masyarakat yang berada di sekitar objek wisata tersebut berharap agar pemerintah daerah memperhatikan akses jalan menuju Sappuran Golkar, demi mengembangkan objek wisata tersebut sekaligus memperbaiki perekonomian masyarakat. Johannes Silaban (40), pedagang makanan yang berjualan di sekitar air terjun Sappuran Golkar, mengharapkan adanya perhatian pemerintah untuk menata Sappuran Golkar, sehingga menarik minta wisatawan untuk berkunjung ke daerah tersebut. “Jika air terjun ini ramai, perekomonian warga akan sekitar akan semakin membaik,” bi-

„ air terjun golkar langnya. Hal yang sama juga diharapkan Marjani Simatupang dan Tangget Simbolon, tokoh masyarakat sekitar yang telah lama berdomisili di daerah

tersebut. “Kita harapkan pemerintah juga lebih memperkenalkan air terjun ini ke masyarakat luas,” tambah mereka.(**)




Februari 2012





Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter.

Maraknya preman, harus segera diberantas. Salah satu cara dengan membuat sekolah preman. Sekolah preman artinya bukan menghasilkan preman. Jadi kita bekerja sama dengan lembaga, kementerian sosial, kementerian Hukum dan HAM dan masyarakat.

Sikap Kami Rekening Buncit Pegawai Pajak DIREKTORAT Jenderal Pajak sungguh menjadi lumbung duit bagi karyawan yang nekat memperkaya diri. Para pegawai di direktorat itu seperti berlomba mengumpulkan harta haram dalam rekening pribadi, simpanan istri, dan anggota keluarga lainnya. Banyak contohnya. Gayus Tambunan, pegawaiDitjenPajakgolonganIIIA,menjadisalah seorang miliarder kesohor. Kini Gayus mendekamdibuikarenadihukumMahkamahAgung 12tahunpenjara.Contohlain,mantanpegawai pajak yang mempunyai rekening besar ialah Bahasyim Assifie. Bahasyim memiliki rekening sebesar Rp64 miliar. Mahkamah Agung menghukumnya 12 tahun penjara. Hukuman terhadap Gayus dan Bahasyim tidak membuka mata karyawan Ditjen Pajak lainnya. Buktinya kini muncul lagi nama Dhana Widyatmika. Karyawan Ditjen Pajak itu telahditetapkansebagaitersangkaolehKejaksaan Agung karena rekeningnya mencurigakan. Duit sekitar Rp60 miliar tersimpan di rekeningnya. Awalnya Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK) mencurigai rekening obesitas itu. Sebagaipegawai negeri sipil golongan III C, rekening buncit Dhana sungguh mencengangkan. Rekening itulah yang kemudian dilaporkan ke Kejaksaan Agung. Kasus rekening gendut karyawan Ditjen Pajakitubisamembuatwargayangtaatmembayar pajak kehilangan kepercayaan kepada negara. Untuk apa orang jujur membayar pajak kalau yang tidak jujur justru diuntungkan dan dilindungi? Buktinya, hingga sekarang tidak ada satu punpihakyangmenggendutkanrekeningGayus dan Bahasyim yang masuk penjara. Kepercayaan wajib pajak pun bisa kian tergerus karena sejak meletus kasus Gayus, Ditjen Pajak belum juga menemukan mekanisme pengawasan internal untuk mencegah pengerukan uang rakyat oleh karyawan Ditjen Pajak. Kasus Dhana menunjukkan karyawan Ditjen Pajak masih leluasa melahap uang pajak untuk memperkaya diri dan kerabat. Kasus dugaan penggelapan pajak oleh Dhana juga dengan jelas menunjukkan program remunerasi tidak berpengaruh bagi integritas, moral, dan produktivitas pegawai negeri sipil. Padahal, program remunerasi justru pertama kali dilakukan di Ditjen Pajak pada 2007. Program remunerasi pertama kali diterapkan di Ditjen Pajak, tentu saja dengan pertimbangan matang. Penerimaan negara terbesar bersumber dari pajak yang dalam APBN 2012 mencapai Rp1.032 triliun. Jumlah itu naik 18,21% jika dibandingkan dengan pada 2011 yang mencapai Rp872,6 triliun. Karena itu, aparat pajak haruslah benarbenar orang jujur. Kita tidak ingin berprasangka buruk bahwa banyak karyawan Ditjen Pajak terlibat mafia. Namun, kita juga perlu mengingatkan bahwa mafia tidak bekerja sendirian. Dia seperti gurita. Kasus Dhana jelas dan tegas menunjukkan mafia pajak belum sepenuhnya diungkap dan diberantas. Karena itu, jangan salahkan publik jika beranggapan masih banyak sindikat pajak gentayangan di Ditjen Pajak. (***)

Mendibud M Nuh, Selasa (28/2)

Korupsi Menggurita vis a vis Penguasa Tunakuasa Dari waktu ke waktu, pementasan “drama” korupsi di negeri ini semakin menjadi-jadi saja. Yang teranyar “dipentaskan” adalah penetapan Angelina Sondakh oleh Komisi Pemberantasan Korpsi (KPK) sebagai tersangka kasus suap Wisma Atlet. Bahkan, Menteri Pemuda dan Olah Raga, Andi A Mallarangeng, pun harus duduk di kursi pengadilan sebagai saksi dalam kasus tersebut. Padahal, memori kolektif publik masih merekam kuat saat mereka berpemeran dalam iklan antikorupsi beberapa tahun silam. Belum lagi tuntas kasus tersebut, kini muncul lagi kasus mafia pajak jilid dua.

Oleh: Ahmad Arif KARENA itu bukan sebuah kesalahan jika upaya pemberantasan praktik KKN (korupsi, kolusi dan nepotisme) di negeri ini bisa diibaratkan bagai pedagang yang berdagang es di daerah kutup atau penjual es yang menjual es saat musim hujan. Hampir bisa dipastikan dengan kondisi seperti itu tidak ada keuntungan yang diperolehnya. Yang ada malah kerugian semata; rugi waktu, rugi tenaga, rugi pikiran. Begitu kuatnya kah gurita korupsi itu di negeri zamrud khatulistiwa ini? Di mana eksistensi dan supremasi hokum yang pasca runtuhnya orde baru 14 tahun silam digembargemborkan kepada rakyat? Lalu, bagaimana pula fungsi kepemimpinan nasional saat ini? Tidak adakah korelasi positif konstruktif antara kepepimpinan nasional itu dengan kesejahteraan akar rumput yang telah memilihnya? Dunia pun Memerangi Korupsi Korupsi bukan merupakan masalah Negara-negara tertentu saja, tetapi juga merupakan masalah dunia. Ini dapat dilihat dari sejumlah catatan dokumen PBB (Perserikatan BangsaBangsa) yang menunjukkan adanya komitmen tentang pemberantasan korupsi tersebut. Pada periode tahun 1980-an, dunia dikejutkan dengan semakin maraknya kasus-kasus korupsi dengan modus operandi yang semakin canggih. Perkembangan fungsi teknologi, tumbuhnya bank-bank yang mempraktikkan money laundering (pencucian uang), makin menjadikan pelanggaran hokum khususnya korupsi tersebut semakin kompleks. Demikian

pula dengan meningkatnya persaingan bisnis antar Negara, terutama bisnis ilegal seperti narkotika, obat-obat terlarang dan sebagainya. Kejadian tersebut menginspirasi dunia internasional untuk menyelenggarakan Konferensi Internasional Anti Korupsi (International Anti Corruption Conference) pertama di Amerika Serikat pada 5-14 Oktober 1983. Sejak itu, konferensi serupa dilaksanakan dua tahun sekali di Negara yang berbeda. Dari konferensi pertama itu dicapai kesimpulan sembilan poin penanggulangan tindak pidana korupsi. Pertama, pemberantasan dan pencegahan korupsi haruslah dilakukan dari atas atau “top political will” secara konsisten dan mengharuskan keteladanan dari penyelenggara Negara. Kedua, badan yang bertugas menanggulangi korupsi haruslah independen dan mempunyai wewenang yang penuh dalam upaya pencegahan dan pemerantasan korupsi. Ketiga, masyarakat, lembaga-lembaga antikorupsi, media massa, harus berperan aktif dalam mengamati dan mencegah terjadinya gejalagejala praktek korupsi. Keempat, peraturan perundang-undangan pemberantasan korupsi yang jelas dengan sanksi yang dapat menimbulkan kejeraan serta proses peradilan yang cepat dan transparan. Kelima, peraturan perundang-undangan yang merupakan jaring-jaring pencegahan dan pemberantasan korupsi haruslah sinkron seperti undang-undang pelaporan kekayaan penyelenggara Negara, pencucian uang dan sebagainya. Keenam, strategi penanggulangan korupsi haruslah secara konsepsional, komprehensif dan terintegrasi mengingat sumber korupsi yang multidimensional. Ketujuh, membudayakan gerakan masyarakat antikorupsi dan menggalakkannya sehingga kebiasaan-kebiasaan yang cenderung mendorong tumbuhnya praktek korupsi dan kolusi akan menghilang. Kedelapan, perlu dilakukan kerjasama global seperti menyelaraskan atau hormonisasi peraturan perundang-undangan pemberantasan korupsi, lalu lintas devisa, rahasia perbankan, pencucian uang, perjanjian ekstradisi dan sebagainya. Kesembilan, perlu digiatkan riset serta publikasi hasil-hasilnya dengan mencermati perkembangan modus operandi yang erat kaitannya dengan white collar crime dan sebagainya. Tunakuasa Uraian di atas sengaja saya nukilkan dari karya mantan Jaksa Agung RI berjudul “Dunia pun Memerangi Dunia” (2002; iii, 4-5) untuk mengingatkan memori kita bahwa dunia pun secara global telah berpadu memerangi korupsi sejak beberapa dekade lalu. Banyak cerita sukses yang sesungguhnya bisa dijadikan pelajaran buat kesuksesan Indonesia dalam upaya pemberantasan dan pencegahan KKN. Namun, sepertinya asa itu belum tergapai juga. Apa hal yang membuat penguasa Indonesia seolah powerlessness (tak kuasa) menghadapinya? M. Amien Rais, dalam pidato pengukuhan dirinya sebagai guru besar di UGM tahun 2001 silam menguraikan, “Baik kekuasaan maupun ketiadaan kekuasaan dapat menjadi sumber masalah dalam kehidupan bersama. Seorang bangsawan Inggris bernama Lord Acton mengatakan, power tends to corrupt and absolute power corruptsabsolutely. Kekuasan itu cenderung korup, dan kekuasan yang absolut akan korup secara absolut pula.

Contoh paling tepat dan dekat adalah pengalaman bangsa kita di masa Orde Baru. Pada masa itu, korupsi kekuasan telah kita saksikan dalam berbagai bentuknya dan berlangsung selama jangka waktu yang lama. Sampai-sampai, kekuasaan yang korup itu terjelma dalam diri seorang patron. Dalam peristilahan ilmu politik, bentuk korupsi kekuasaan ini dikenal dengan nama “neopatrimonialisme” (Bratton & van de Walle, 1994). Dapat dikatakan bahwa negara Orde Baru adalah negara yang cukup ideal dilihat dari sudut korupsi kekuasaan ini”. Selanjutnya Amien Rais menegaskan, “Kita sering lupa bahwa bahaya yang dapat timbul dari penyalahgunaan kekuasaan tidak berbeda jauh dari bahaya yang dapat timbul dari dampak negatif tuna kuasa (powerlessness). Keadaan tuna kusa dapat merugikan kerjasama sosial dan kehidupan bersama. Dengan memodifikasi ungkapan Lord Acton yang telah disebutkan, dapat dikatakan bahwa, powerlessness tends to corrupt and absolute powerlessnes corrupts absolutly. Tuna kuasa cenderung kearah korupsi, dan tuna kuasa yang absolut akan menjurus kepada korupsi absolut pula”. Penguasa Pemberani Perang melawan korupsi merupakan perang melawan hawa nafsu karena pada hakikatnya tindakan kejahatan itu berakar pada moralitas manusia. Prof. Taverne, pakar hokum berkebangsaan Belanda, mengatakan bahwa kesemuanya itu pada akhirnya tergantung pada manusianya sendiri. Dus, manusia seperti apakah yang seharusnya menjadi penguasa Indonesia saat ini? Penguasa pemberani, itulah jawabnya. Ada tiga keberanian yang harus dimiliki seorang penguasa agar kekuasaannya berdaya guna untuk rakyatnya sebagaimana telah ditorehkan dengan tinta emas dalam sejarah kemanusiaan oleh duo Umar; Umar bin Khattab dan Umar bin Abdul Aziz, sebagaimana pernah dituliskan oleh mantan Ketua MPR RI periode 2004-2009, Dr. Hidayat Nurwahid (2006: ix – xiv). Pertama, kesederhanaan. Di tengah meningkatnya jumlah rakyat miskin seperti sekarang, kesederhanaan merupaka hal yang sangat penting. Hal yang justru paling susah dilakukan oleh para penguasa. Gelimang harta dan bujuk rayu jabatan menjadi penggoda yang teramat sulit dihindari. Kedua, keteladanan. Keteladanan menjadi hal utama yang disorot rakyat. Kepatuhan terhadap penguasa sangat berbanding lurus dengan kemampuan mereka memberikan keteladanan. Semakin jauh para penguasa dari keteladanan, makin jauh pula rakyat dari kepatuhan. Ketiga, al itsar (mendahulukan orang lain daripada diri sendiri). Umar bin Khattab pernah berkata, “kalau rakyat mengalami kekenyangan, saya orang terakhir yang menikmatinya. Tapi jika mereka mengalami kelaparan, saya yang pertama merasakannya.” Indonesia membutuhkan penguasa yang pemberaniuntukmembebaskannegeriinidari gurita korupsi. Tanpa penguasa yang berani, adil, mandiri dan peduli, kita tak bisa berharap Indonesia akan terbebas dari lingkaran setan KKN(korupsi,kolusi,nepotisme)danatauNKK (nolongin kawan-kawan). Semoga!! (***) Penulis adalah peminat kajian sosial keagamaan

Setiap tahun pemerintah menambah nilai anggaran pendidikan. Besarnya anggaran yang disediakan itu jangan sampai disalahgunakan oleh pelaksaan dan pemangku kepentingan di bidang pendidikan dan kebudayaan.Artinya, anggaran sudah disisihkan untuk generasi yang akan datang, jangan dikutik-kutik, jangan dibocorkan.

Wapres Boediono, Selasa (28/2)

Ada yang salah dengan sistem di instansi pajak, sebab fenomena pegawai yang terlibat dengan kasus tumbuh subur di korps yang mengurusi uang iuran rakyat itu. Hal itu karena lalainya pengawasan dari Kementrian Keuangan.

Anggota Komisi III Aboe Bakar AlHabsyi, Selasa (28/2)

Moratorium pendaftaran haji masih belum perlu dilakukan. Sebab keputusan tersebut dapat memicu naiknya ongkos haji. Sehingga, moratorium yang diusulkan belum langkah tepat.

Mantan Ketua Umum PBNU KH Hasyim Muzadi. Selasa (28/2)




Februari 2012



Dubai Diperkuat Polisi Termungil di Dunia

„ Kopral Aisyah al Hamoudi

FUJAIRAH - Berukuran tubuh mungil tidak membuat perempuan asal Dubai ini merasa malu atau terus menerus mengurung diri di rumah.

Bahkan seorang perempuan bertubuh mungil di Dubai berhasil membuktikan ukuran tubuhnya yang mini tidak menghalanginya meraih prestasi. Ini lah yang ditunjukkan oleh seorang anggota kepolisian Kopral Aisyah al Hamoudi yang memiliki tinggi badan 88 cm.

Setelah mendaftarkan dirinya di Guinness Book of Records, Kopral Aisyah pun tercatat sebagai anggota polisi terpendek di dunia .”Pusat pelatihan dan perekrutan orang-orang dengan kebutuhan khusus Kementerian Dalam Negeri telah membantu dan mendukung

Saya untuk bergabung dengan Kepolisian Fujairah,” ujar Kopral Aisyah, Selasa (28/2). Aisyah tercatat lulus dari pusat pelatihan Kementerian Dalam Negeri Al Ain pada tahun 2006 lalu. Kini Aisyah aktif bertugas di Kepolisian Fujairah.(oz)

Salah Artikan Kata

Timbulkan Kepanikan di Pesawat


SIRAM : Punggung Kanselir Jerman Angela Merkel yang disiram bir, sehingga menimunan mengalih ke tubuhnya.

Lima Gelas Bir Siram Kanselir Jerman

Iklan Putin BICARA Keperawanan MOSKWA-Pekan depan, rakyat Rusia akan mengikuti pemilihan presiden. Iklan kampanye pun mulai bertebaran, khususnya di televisi. Tak terkecuali iklan kampanye untuk Perdana Menteri Vladimir Putin yang berupaya menjadi presiden Rusia untuk kali ketiga. Namun, iklan kampanye yang satu ini memantik kontroversi.

Iklan televisi itu menggambarkan seorang gadis yang ingin melepas keperawanan, tetapi dia bingung memilih kepada siapa dia akan menyerahkan kegadisannya. Karena itu, dia mendatangi seorang peramal untuk mengetahui sosok lelaki pertamanya. ”Mari kita cari, siapa lelaki yang ditakdirkan untukmu,” kata sang peramal dalam iklan tersebut. ”Saya berharap saya melakukannya (berhubungan seks) karena cinta. Ini yang pertama bagi saya,” ujar si gadis. Ternyata, ketika sang peramal membalik selembar kartu, yang tampak adalah wajah sang perdana menteri.AFP melaporkan, iklan itu merupakan bagian dari seri iklan yang dibuat biro iklan Aldus ADV. Biro itu mengaku membuat iklan tersebut berdasarkan

BERLIN-Seorang pramusaji tidak sengaja menumpahkan lima gelas bir ke punggung Kanselir Jerman Angela Merkel. Karena terkejut, pramusaji itu bahkan sempat berteriak kata kotor di belakang Merkel. Merkel terkejut ketika ada minuman dingin yang mengalir di bagian belakang tubuhnya. Pengawal yang berdiri di belakangnya langsung menghalau semua minuman tersebut sambil memegangi kepala pemimpin Jerman tersebut. Sementara Merkel sendiri dengan tenang menangani situasi

itu dan kemudian kembali mengangkat gelas di mejanya untuk bersulang, di saat dirinya menghadiri sebuah pertemuan. Pramusaji bernama Martin dan berasal dari Yunani tersebut, merasa sangat malu. Tetapi dirinya akan menjadi pahlawan bagi Yunani mengingat masalah terkait kontrol ekonomi Jerman terhadap negara itu. ”Seorang kolega seharusnya membawakan bir untuk Angela Merkel. Tapi ia sangat gugup, dia meminta saya untuk melakukan itu. Tanpa disadari ada yang mendorong dari belakang dan saya

konsep “untuk menarik kaum muda agar berpartisipasi” dalam pemilihan presiden yang akan datang. Namun, perusahaan itu tidak mengungkap siapa pemesan klip iklan tersebut. Iklan itu mendapat berbagai komentar miring, terutama dari kelompok oposisi dan para blogger, ungkap BBC. Salah seorang blogger yang menggunakan nama @step_42 menyindir iklan itu dengan mengatakan Putin. Hanya karena cinta untuk kali pertama Yang ketiga jelas-jelas pemaksaan. Seperti diketahui, Putin menjadi presiden Rusia untuk dua kali masa jabatan, mulai dari tahun 2000 hingga 2008. Namun, berdasarkan konstitusi, dia tidak bisa menduduki posisi itu untuk tiga masa jabatan berturut-turut.

Langkah yang diambil Putin pada pemilihan presiden 2008 adalah memberi kesempatan Dmitry Medvedev (ketika itu perdana menteri) untuk mengikuti pemilihan presiden dan memenanginya, sementara dia menduduki kursi perdana menteri. Jika memenangi pemilihan presiden pada pekan depan, Putin akan menjadi presiden untuk kali ketiga. Kampanye pencitraan Putin selama ini selalu menunjukkan sisi macho mantan agen dinas rahasia yang pernah dua kali menjadi presiden itu. Pada November 2011, Putin tampil mengenakan baju selam. Sebelumnya, dia ditampilkan sedang berburu paus, memancing, menunggang kuda dengan bertelanjang dada, dan berbagai aktivitas maskulin lainnya. (kps)

Perempuan Tak Bersuami Lahirkan Anak 14 AMERIKA SERIKAT-Nadya Suleman, seorang perempuan yang tinggal di Los Angeles, Amerika Serikat, adalah seorang ibu yang luar biasa. Meski tak bersuami, dari rahim Nadya telah lahir 14 anak yang kesemuanya hasil teknik implantasi embrio dari sperma para pendonor. Uniknya lagi, delapan anak yang terakhir adalah anak kembar yang lahir pada 26 Januari 2009 di Rumah Sakit Kaiser Permanente Bellflower, California, Amerika Serikat. (int)

mencoba untuk menangkap gelasgelas tersebut, tapi sudah terlambat,” ucap Martin, Selasa (27/2). ”Saya berteriak benar-benar keras. Hebatnya, Merkel berbalik badan dan tersenyum padaku. Walapun dalam keadaan basah dia tetap naik panggung dan memberikan pidato singkat” ujar pria berusia 21 tahun itu. Insiden itu juga tertangkap kamera dan menjadi sensasi di YouTube. Hingga kini masih banyak orang yang menonton kejadian memalukan tersebut. (oz)

„ Vladimir Putin

MARYLAND - Seisi pesawat panik setelah seorang pilot memberikan ucapan selamat ulang tahun kepada seorang Ibu. Ternyata, penumpang mengartikan kata ‘mom’ yang berarti Ibu dalam bahasa Indonesia dengan kata ‘bomb’. Pilot dari maskapai Southwest Airlines yang tidak disebutkan namanya, diminta oleh salah satu petugas lalu lintas udara untuk mengucapkan salam kepada ibunya yang terbang dari Baltimore, Maryland, Amerika Serikat (AS) menuju Bandara Mac Arthur New York di Islip, Long Island. “Pilot mengatakan bahwa ‘ada seorang ibu yang mengudara bersama kita’. Tapi para penumpang malah mengira pilot tersebut mengatakan ‘ada bom yang mengudara bersama kita’,” keterangan pihak berwenang, Selasa (28/2). Penumpang langsung panik dan meminta kepada kru pesawat untuk mengklarifikasi perkataan pilot dan meyakinkan apakah benar-benar ada bom. Tak lama kemudian, pilot menjelaskan maksudnya. Setelah kejadian itu, beberapa penumpang mengeluh kepada pihak terkait tentang pengumuman tersebut.Juru bicara Southwest Airlines, Brandi King mengatakan, “Pilot membuat pengumuman yang disalah pahami. Dia menjelaskan kepada penumpang bahwa ia memberi ucapan selamat ulang tahun kepada ibu yang sedang mengudara bersama mereka.” Juru bicara itu juga mengakui pilot tersebut memang diminta oleh salah satu petugas lalu lintas. Persatuan Maskapai Penerbangan atau Federal Aviation Administration (FAA) memang mengakui adanya pengumuman singkat yang dilakukan pilot atau kru pesawat lainnya. Tapi jika itu diluar batas yang tidak wajar, maka tidak perlu diumumkan. FAA sedang menyelidiki kasus tersebut dan meminta penjelasan dari petugas lalu lintas udara tersebut, sedangkan sang pilot dibebaskan dari tuduhan melakukan ancaman bom.(oz)

Rompi Canggih Ketahui Serangan Jantung

„ Berikut ini foto keseharian N a d y a S u l e m a n bersama anak anaknya.

INGGIRIS-Seorang pasien jantung di Inggris akan menjadi orang pertama di dunia yang mengenakan rompi yang dapat memberitahukan kapan terjadinya serangan jantung. Rompi ini dapat mendeteksi serangan jantung 12 jam lebih awal sebelum terjadinya serangan. Perangkat yang disebut Heartscape ini berisi 80 sensor yang ditempelkan pada dada dan punggung pasien. Selain itu, alat ini akan menayangkan gambaran organ secara tiga dimensi. Gambar tiga dimensi tersebut memberikan informasi rinci kepada dokter tentang letak serangan jantung hanya dalam beberapa menit. Alat ini d i k l a i m menyediakan gambaran yang lebih a k u r a t dibandingkan alat apapun. Teknologi elektrokardiograf (EKG) konvensional telah dipakai selama 60 tahun. Sayangnya, keterbatasannya

„ Ilustrasi dapat membuat pasien mengalami keterlambatan penanganan sampai 12 jam hanya untuk mendapatkan hasil tes darah. Selama waktu itu, kerusakan jantung akan terus terjadi. “Jika Heartscape terbukti berhasil, maka alat ini dapat memiliki dampak positif yang besar bagi pasien, terutama untuk mendiagnosa atau mendeteksi penyakit jantung koroner dengan cepat,” kata Paul Knee, direktur

manajer produsen rompi Heartscape, Verathon Medical UK Ltd, Selasa (28/2). Rumah Sakit Bradford Royal Infirmary akan menjadi rumah sakit pertama yang memperkenalkan rompi serangan jantung ini. Dalam setahun, Rumah Sakit Bradford merawat 300 orang pasien yang menderita serangan jantung parah dan 1.200 orang pasien serangan jantung ringan. (kps)



29 Februari 2012



Dua Sepupu Tewas Tenggak Miras (Foto: Tamba Tinendung/ Sumut Pos)

Foto Darwis

Nanto br Tumangger, korban terbakar akibat lampu teplok meledak, Senin (27/2).

„ Lesmari, terlihat menjalani perawatan di RSU Tanjungpura. Korban mengalami kritis setelah mengkonsumsi miras oplosan, Selasa (28/2).

Lampu Teplok Meledak, Ibu Hamil Terbakar

LANGKAT-Dua sepupu tewas usai mengkonsumsi miras (minuman keras) jenis Mansion yang dicampur dengan Pepsi Blue, Selasa (28/2) dinihari. Kedua korban adalah Deni Kazana alias Dedi (19) dan sepupunya Irma Huda (28), keduanya warga Dusun VIII Desa Mekar sawit, Kecamatan Sawit Seberang, Langkat. Informasi dihimpun menyebutkan, peristiwa yang berujung kematian ini berawal dari digelarnya hiburan kibot (keyboard) di salah satu desa Kecamatan sawit Seberang. Seolah sudah menjadi tradisi, tanpa kehadiran miras rasanya acara pesta tidaklah lengkap. Oleh sebab itulah kedua korban langsung mencari miras untuk dinikmati sambil menonton organ tunggal. Saat itu minuman yang dipilih adalah kedua korban adalah Mansion. Minuman itu lalu dicampur Pepsi Blue. Merasa racikannya sudah sempurna, minuman itupun ditenggak sedikit demi sedikit hingga keduanya jadi teller. Selain mereka, beberapa rekan lainnya juga ikut ambil bagian. Mereka adalah Anggi (17), Andi (17), Prima (21) dan Yogi (20). Menjelang tengah malam, suasana dingin bagi sebagian warga, tetapi hanggat bagi para pemuda ini karena sudah meminum minuman keras tadi Menjelang dini hari, kibot berakhir dan mereka bergerak pulang ke rumah masing-masing. Namun tak lama setelah itu, kedua korban mengalami rasa sakit yang luar biasa di bagian dada dan perut. Mereka langsung muntah-muntah, hingga tak sadarkan diri. Selanjutnya keduanya dibawa ke Klinik Keluarga untuk diobati secara medis. Naas, belum lama ditangani tim medis, keduanya menghembuskan nafas terakhir. “Mereka keracunan minuman keras.Tadi kami sudah mencoba melakukan pertolongan, tapi takdir berkata lain,” kata Dr Dahlia, pemilik Klinik Keluarga. Keesokan paginya, ternyata keempat remaja lainnya juga ikut keracunan akibat meminum miras oplosan tersebut. Lalu, keempatnya dibawa ke Klinik Keluarga untuk diberikan perawatan secara serius. Nasib baik, kondisi keempatnya sudah berangsur pulih dan dalam tahap penyembuhan. “Begitu bangun tidur pagi, dadaku terasa sesak bang. Terus aku merasa pusing dan mual-mual, padahal semalam itu aku minum cuma sedikit. Sedangkan dua temanku yang tewas itu memang paling banyak minum,” kata Anggi, salah seorang korban yang dirawat. Sementara, Kanit Reskrim Polsek Padang Tualang Iptu Firman PA saat dikonfirmasi membenarkan kejadian tersebut. Kata Firman pihaknya masih melakukan penyelidikan terkait tewasnya kedua remaja tersebut yang diduga akibat miras oplosan tersebut. “Kita masih selidiki dan kami akan segera memanggil pemilik warung yang menjual miras itu, “ katanya seraya mengaku korban

yang tewas telahpun dikebumikan keluarganya. PSK Kritis Minum Topi Miring Sementara seorang PSK bernama Lesmari (19), warga Dusun Bukit Harapan, Desa Bukit Selamat, Besitang, terpaksa dilarikan ke RSU Tanjungpura, Selasa (28/ 2).korban dirawat di rumah sakit akibat kritis usai meminum minuman keras. Keterangan yang dirangkum menyebutkan, korban yang sudah dalam kondisi kritis diantar seorang warga ke rumah sakit. Menurut cerita warga, korban diketahui minum miras diduga oplosan tersebut karena merasa suntuk sejak handphone gengamnya hilang. Kesal atas kehilangan tersebut, korban memilih melampiaskanya dengan alkohol. Waktu itu, bilang warga yang tak mau namanya disebutkan ini, kala itu wanita bertubuh tomboy ini terlihat dudukduduk di salah satu Kafe di Desa Bukit Selamat, Senin (27/2) malam. Tiba-tiba saja korban mengaku sakit di kepala dan perutnya. Kondisi korban yang terlihat mengkhawatirkan tersebut membuat warga melarikannya ke puskesmas terdekat. Namun tim medis puskesmas tidak bisa berbuat banyak karena minimnya peralatan serta kurangnya obatobatan yang dibutuhkan. Keadaan korban makin parah kala itu, bahkan ia terlihat sudah tak sadarkan diri. Karena kondisinya kian memburuk, korban pun dilarikan ke RS Tanjung Pura. Setibanya di RS tersebut, korban ditangani secara intensif. Untuk menyelamatkan nyawanya, dokter memasang Monitor Kordiokram untuk mengetahui kestabilan denyut jantung dan napas korban. Meski begitu kondisi korban tetap memburuk. Selanjutnya dokter menyarankan agar korban dirujuk ke Medan, tapi karena tak ada keluarga yang mau bertangung jawab, korban hanya dirawat di RS ini. ”Katanya dia minum Topi Miring campur minuman enerji ditambah soda,” ujar seorang teman korban yang mengatakan korban sering mangkal di salah satu kafe di Bukit Selamat sebagai pelayan. “Kami nggak tahu di mana keluarganya tinggal, jadi mau bagaimana memberitahukan sama keluarganya. Bahkan identintas seperti KTP juga tak ada,” lirih teman korban ini. Terpisah Wakapolres langkat Kompol Safwan Khayat ketika dikonfirmasi terkait maraknya miras oplosan mengaku sedang menyiapkan operasi untuk memberantasnya. (wis/hez)

Foto Darwis

MIRAS OPLOSAN- Dua dari lima korban miras oplosan yang menjalani perawatan di rumah sakit.

Istri Doyan Kokain Bule Jerman Lapor Polisi TEBING TINGGI-Dengan Bahasa Indonesia yang tidak begitu fasih, Hans (90) WNI keturunan Jerman yang sudah 10 tahun menetap di Desa Mangga Dua, Kecamatan Tanjung Beringin, Sergai, mendatangi Polres Tebing Tinggi, Selasa (28/2) sore. Maksudnya adalah mengadukan istrinya Tumiah (40), yang kerap menghabiskan uang kiriman anaknya untuk membeli narkoba. Pantauan di kantor polisi, pengaduan Hans dianggap polisi salah alamat. Pasalnya TKP-nya berada di wilayah hukum Polres Sergai, sehingga korban pun diarahkan untuk membuat laporan pengaduan ke sana. Di Polres Tebing Tinggi, Hans sempat menceritakan secara singkat apa yang ia alami selama ini. Menurutnya, wanita yang telah dinikahinya selama lima tahun dan belum mempunyai keturunan itu kerap mencuri uangnya. Parahnya uang itu selalu habis digunakan untuk membeli kokain. Sementara maksud anak Hans mentransfer uang dari Jerman melalui Bank Mandiri Cabang

Tebing Tinggi adalah untuk bekal hidupan hari tuanya. Terakhir ia mengaku mengecek uang sesaat sebelum mendatangi kantor polisi bersama Muri (38), temannya yang menetap di Desa Pekan Tanjung Beringin, Sergai. Saat itu Hans dan Muri datang ke Kantor Bank Mandiri di Jalan Sutomo, Kota Tebing Tinggi untuk mencairkan uang. Namun sepulang dari bank, Ia bersama temannya yang kebetulan adalah seorang sopir Angkutan Kota CV Citra, langsung beranjak ke Polres Tebing Tinggi. Muri sendiri mengaku tidak tahu apa maksud Hans mengajaknya ke Polres tersebut. “Saya tidak tahu apa tujuannya ke Polres. Tadi tanpa banyak cerita, dia (Hans) langsung mengajak ke kantor polisi. Rupanya sampai di sini, Hans hendak mengadukan kebiasaan isterinya yang suka memakai narkoba,” ujar Muri. Pengakuan Muri, ia adalah orang yang sengaja diperintahkan Tumiah (isteri Hans) untuk mengantarkan suaminya ke bank. “Kata istrinya tadi Hans mau

mengambil uang Rp2 juta hasil kiriman putranya dari Jerman. Mungkin saja saat bertransaksi di teller bank, Hans melihat slip penarikan lewat ATM yang tidak dilakukannya. Bisa saja yang melakukan penarikan itu adalah isterinya. Trus karena kesal dengan isterinya, Hans marah dan melaporkan ke polisi,” tambah Muri. Saat berada di kantor polisi, Hans baru menceritakan bahwa selama ini istrinya punya kebiasaan memakai narkoba. Dan untuk membeli narkoba itu, istrinya dicurigai selalu mencuri uang di rekening Hans lewat ATM. Kasubbag Humas Polres Tebing Tinggi AKP Ngemat Surbakti membenarkan pihaknya kedatangan seorang warga asal Jerman yang telah lama menjadi WNI dan menetap di Sei Rampah. “Pria berjenggot putih itu hendak melaporkan kebiasaan isterinya yang suka memakai narkoba. Tapi karena tempat tinggal pelapor berada di wilayah hukum Sergai, kita arahkan yang bersangkutan melapor ke sana,” ujar Surbakti. (awi/hez)

Simpan 88 Gram Ganja

Dituntut 6Tahun Penjara Foto Asnawi

Hans (kanan), pria asal Jerman yang mengadukan istrinya karena kerap mengkonsumsi kokain, Selasa (28/2).

ABG Terjebak Asmara Duda

Jadi duda terlalu lama memang bisa bikin lelaki ganas. Macam Ganda (42) (bukan nama sebenarnya) ini contohnya. Meski dirinya sudah bangkotan, gadis ABG Harni (16) (bukan nama sebenarnya), “ditelateni” juga setelah kenal lewat jejaring Facebook dan Hp. Karuan

saja orangtuanya kalang-kabut, karena murid SMA kelas II itu sudah disetubuhinya 10 kali. Teknologi informasi yang demikian canggih, sering disalahgunakan orang. Pernah ada keluarga menuntut ke pengadilan, karena ditagih utang lewat facebook.

PAKPAK BHARAT-Nanto br Tumangger (21), ibu rumah tangga yang sedang hamil tua, warga Dusun Rube Haji Desa Siempat Rube IV, Kecamatan Siempat Rube, kritis, Senin (27/2). Hal itu setelah hampir sekujur tubuhnya mengalami gosong akibat terbakar. Kini korban menjalani perawatan di RSUD Salak. Kejadian bermula saat Nanto hendak menyalakan lampu lentera di kamar tidur mereka sebagai penerangan malam hari, Sabtu (25/2) sekira pukul 20.00 WIB. Diduga lampu tersebut diisi minah diduga oplosan mengandung premium, sehingga saat dinyalakan, lampu langsung meledak. Naas bagi korban, saat itu api hampir menyembur sekujur tubuhnya. Akibatnya, tubuh korban hangus terbakar. Selain korban, kamar tidur beserta isinya seperti pakaian dan peralatan tidur, juga habis dilalap sijago merah. Suami korban Gunneng Manik (27) menuturkan, kejadian berlangsung amat singkat, berkisar 10 menit lamanya. Beruntung Nanto dapat segera dievakuasi dari lokasi dengan bantuan warga. “Sudah lama kami menggunakan minyak tanah sebagai bahan bakar keperluan sehari-hari, tapi tidak pernah meledak. Saya tidak habis pikir kok bisa jadi begini, saya curiga minyak tanah ini mengandung bensin karena ada bau yang menyengat menyerupai bensin,” ungkap Gunneng manahan isak tangis menyaksikan keadaan istrinya yang rencananya akan dirujuk ke RSUD Sidikalang akibat kondisinya yang kian kritis. Selain Nanto, dalam sepekan ini telah terjadi dua musibah yang hampir serupa melanda di Kecamatan tersebut, yakni warga Desa Namuseng. Mereka berharap pihak berwajib dapat mengungkap kebenaran dugaan minah oplosan yang beredar di Kabupaten Pakpak Bharat agar tidak menelan korban lain. (mag-14/hez)

Itu kan sama saja mempermalukan orang hingga seluruh dunia. Lalu banyak juga FB dijadikan sarana pacaran. Awalnya hanya cating lewat dunia maya, akhirnya berlanjut ke dunia nyata. Banyak yang puas, tapi banyak juga yang kecewa karena lawan cating ternyata tak seindah warna aslinya. Harni, seorang pelajar SMA di Tenggarong (Kaltim), termasuk salah satu di antaranya. Dia sangat bahagia ketika berhasil kenalan dengan lelaki mengaku Ganda. Tutur katanya dalam FB dan cating sangat santun dan mendayu-dayu, sehingga dia jadi terpikat pada kesempatan pertama. Setelah akrab sekian lama di jejaring sosial, Harni-Ganda sepakat untuk tatap muka di Simpang Tiga, Loa Janan, Kutai Kartanegara (Kukar). Dengan dada berdebar-debar gadis ABG itu menuju TKP dengan sepedamotor pinjaman. Begitu ketemu, sebetulnya Harni

kecewa berat. Soalnya, Ganda tidak sesuai dengan bayangannya. Dikiranya masih remaja sepantaran, nggak tahunya sudah bapakbapak. Tapi Ganda memang perayu ulung. Dengan cepat dia bisa menghilangkan keragu-raguan dan kekecewaan si gadis. “Tampang memang Pepabri, tapi semangat masih Akabri, Dik” kata batin Ganda. Buktinya ketika Harni diajak jalan-jalan ke Balikpapan tidak menolak. Bahkan di rumah koskosan Jalan Ahmad Yani, ABG itu mau saja dijadikan “simaskot” non BRI sebulan lamanya. Namanya simpanan, gadis pelajar SMA itu diperlakukan bak istri sendiri. Tak kurang dari 10 kali Ganda berhasil menyetubuhi. Maklum, sebagai duda dia kan sudah lama nganggur. Mumpung ada tuh barang, langsung saja dirapel. Enak bagi Harni-Ganda, kalang kabut buat orangtua sigadis yang

sudah 10 bulan ditinggalkan anak tanpa berita. Tahu-tahu Harni pulang sambil mengajak cowoknya, dalam rangka mengembalikan motor pinjaman itu. Dengan wajah tanpa dosa, Ganda malah meminta Harni mau dijadikan istri. Tentu saja keluarga si gadis terkaget-kaget. Kenal saja belum kok langsung mendaftar jadi calon mantu. Lagi pula umur Ganda kan lebih cocok jadi ayah putrinya. Karuan saja lamaran itu ditolak, bahkan Ganda dilaporkan ke polisi dengan tuduhan melarikan gadis di bawah umur. Polisi pun dengan mudah menangkap duda itu dengan tuduhan pelanggaran pasal 332 KUHP. Dalam pemeriksaan, Ganda mengakui selama ini hidup sendirian, tanpa istri dan tanpa pekerjaan. Maka begitu kenal dengan Harni langsung digarapnya sebanyak 10 kali. Tanpa kerjaan, tapi pintar mengerjai kan? (pk/int)

SIMALUNGUN-Waris Syahputra (39) warga Dusun III Manik Maraja, Kecamatan Sidamanik, Simalungun dituntut enam tahun penjara oleh Jaksa Penuntut Umum (JPU) M Azril, Selasa (28/2). Terdakwa terbukti memiliki ganja seberat 88 gram dan melanggar pasal 114 ayat I UU RI No 35 Tahun 2009 tentang Narkotika Jo pasal 132 UU RI No 35 Tahun 2009 tentang Narkotika. Sidang yang digelar di Pengadilan Negeri Simalungun sekira pukul 15.00 WIB berbeda dari biasanya. Sidang dengan agenda tuntutan ini terpaksa menggunakan ruang sidang anak karena salah satu ruang sidang direhab. Selanjutnya usai majelis hakim yang dipimpin Samuel Ginting beranggotakan Heriyanti dan Siti Hajar membuka persidangan, langsung JPU membacakan tuntutannya. Menurut JPU M Azril, terdakwa ditangkap, Minggu, (16/10) tahun lalu sekira pukul 13.10 WIB, dari Pekan Selasa Sidamanik. Saat itu terdakwa berniat menjual ganja yang dimilikinya seberat 88 gram. “Terdakwa membeli ganja itu dari Deny Syahputra (berkas berbeda) di kediaman Anton Simangungsong (berkas berbeda), di AfdelingIIBTobaSari,KecamatanPematang Sidamanik, dua hari sebelumnya. Informasi ganja itu diketahui terdakwa saat Deny bertemu dengannya di Halte Toba Sari. Di sana DenymengakubarusajaturundariAcehdan membawa ganja,” jelasnya JPU. Lebih lanjut ia menerangkan, Deny langsung mengajak terdakwa ke rumah Anton yang juga berniat membeli ganja. Selanjutnya traksaksi berlangsung dengan lancar dan terdakwa membawa pulang ganja yang dibelinya dari Ddeny. “Awalnya hanya Deny dan Anton saja yang berhasil diamankan polisi. Tapi setelah polisi melakukan pengembangan, terdakwa ditangkap di Pekan Selasa Sidamanik beserta barang bukti,” sebut Azril. (mua/hez)




29 Februari 2012



Lawak Batak Sitimba Laut Hadir di Barus Sambungan Halaman 8 memelihara hubungan kekerabatan di antaranya, yang satu keturunan (satu darah), juga untuk melestarikan dan mengetahui budaya dan adat Batak (adat leluhur bangso Batak),” kata Erwin kepada METRO, Selasa (28/2) di Sibolga. Ketua panitia pesta syukuran, Sahat Simatupang memaparkan sejumlah kegiatan yang akan dilaksanakan dalam acara itu. Di antaranya, ziarah napak tilas ke pulo pane (jalan yang pernah ditempuh Oppui Raja Simatupang) yang diikuti oleh keturunan Raja Toga Simatupang boru/ bere dan ibebere dan Margordang Bolon di Bukit Hasang, Barus. Acara ini nantinya akan dihibur artis keturunan Raja Toga Simatupang. Juga diundang pada kesempatan itu artis Pop Batak Ibukota Simatupang Sisters dan Lawak Batak Sitimba Laut. Untuk memeriahkan kegiatan, pihaknya juga mengundang Ketua Toga Simatupang se-Dunia Oppui M Togatorop beserta segenap pengurus yang bermukim di Bonapasogit (kampung halaman) Muara, Kepala Daerah, yakni Bupati Tapteng Raja Bonaran Situmeang. “Kita juga tengah melobi dan mengharapkan kehadiran Bupati Asahan, Taufan Gama Simatupang serta sejumlah keturunan Raja Toga Simatupang lainnya. Seperti, Syamsul Sianturi (pengusaha) dan tokoh-tokoh Simatupang lainnya,” tandasnya. (tob)

Stop Bongkar Muat di Jalan Yos Sudarso Sambungan Halaman 8 I Hutapea, T Situmeang, Robbi Harahap, Hendra, Dedi dan sejumlah tokoh pemuda setempat, Selasa (28/2). Menurutnya, selama ini mereka kerap menyaksikan Jalan Yos Sudarso itu dijadikan sebagai tempat mobil bongkar muat truk ekspedisi yang membawa sembako, semen, besi dan lainnya. Sehingga jalan tertutup sama sekali dan tidak bisa dilalui masyarakat. “Setiap hari Minggu, daerah ini selalu ramai mobil dan truk jenis fuso, colt diesel dari Kota Medan dan melakukan bongkar muat di tengan jalan. Sebab dilokasi ini ada beberapa gudang. Di antaranya, gudang berbunga, gudang matahari dan gudang Sibolga-Nias,” bebernya. Mereka berharap, Pemko Sibolga dapat melakukan tindakan tegas dengan menertibkan turk-truk ekspedisi yang jelas sudah mengganggu kenyamanan warga. Khususnya warga setempat yang terpaksa harus melewati jalan lain untuk keluar dari lokasi pemukiman warga. “Tak hanya itu, akibatnya jalan di lokasi ini juga menjadi rusak karena truk yang kami lihat membawa muatan melebihi kapasitas. Kami berharap, agar hal ini menjadi perhatian serius dari Pemko,” tegas mereka lantas menyarankan agar Pemko juga mendirikan secepatnya tempat bongkar muat seperti yang direncanakan di daerah Sibolga Julu. (cr-04/tob)

5 Bagan Pancang Ditertibkan Sambungan Halaman 8


SIMATUPANG: Keturunan Raja Toga Simatupang foto bersama usai memberi keterangan terkait pesta bona taon, Selasa (28/2) di Sibolga.

194 Mahasiswa STIKes Nauli Husada Capping Day Sambungan Halaman 8 siswa dan menjadi tanggung jawab moral. Setelah menempuh pendidikan teori, para mahasiswa dituntut pula untuk menempuh pendidikan secara praktek lapangan. Capping day ini bertujuan untuk mengaplikasikan ilmu pelajaran secara teori selama enam bulan, yakni masa percobaan sebagai calon mahasiswa,” terang Mei Yati. Ia meminta, agar mahasiswi peserta capping day setia terhadap nilai sumpah sebagai seorang tenaga medis dan tidak merasa rendah dipandangan orang lain sebagai tenaga persalinan untuk seorang ibu yang melahirkan dan dan tenaga keperawatan yang melayani masyarakat. “Kita harus menghormati profesi kita yang sangat manusiawi. Jangan merasa rendah diri di hadapan orang lain. Perawat diminta setia melayani masyarakat,” paparnya seraya mengatakan jumlah mahasiswa/i yang mengikuti Capping Day sebanyak 194 terdiri dari mahasiswa D III Keperawatan sebanyak 125 orang dan D III Kebidanan sebanyak 69 orang. Asisten II Pemko Sibolga, Drs Juneidi Tanjung MPd dalam sambutannya mengatakan, nama STIKes Nauli Husada Sibolga sudah populer den-

gan menghasilkan tenaga kesehatan yang berperan membangun kesehatan, termasuk di Kota Sibolga. “Untuk itu, kita meminta mahasiswa STIKes Nauli Husada Sibolga harus siap melahirkan tenaga medis yang profesional guna menghadapi era globalisasi yang penuh dengan persaingan dan kesiapan itu tercermin dari kelancaran proses belajar mengajar,” tukas Juneidi. Ia mengatakan, kesehatan merupakan aspek yang sangat penting dalam kehidupan manusia. Sebab, dengan kondisi sehat seorang manusia dapat melakukan aktifitas sehari-hari dengan baik. “Bidang kesehatan sendiri merupakan prioritas utama dalam pelayanan yang dilakukan oleh pemerintah pusat. Begitu juga oleh Pemko, di samping pendidikan dan peningkatan perekonomian masyarakat,” pungkasnya. Peningkatan pemberian pelayanan kesehatan kepada masyarakat, sambung dia, dilakukan melalui pembangunan sarana dan pra sarana kesehatan. Peningkatan ketersediaan alat-alat medis dan obat-obatan terutama peningkatan kapasitas dan kualitas sumber daya manusia para tenaga medis melalui pendidikan formal maupun non formal.

“Pemko telah menjalin hubungan kemitraan dengan semua Yayasan Pendidikan di Sibolga termasuk Yayasan STIKes Nauli Husada yang kami akui telah banyak berperan dalam meningkatkan kualitas SDM di bidang kesehatan di kota ini,” pungkasnya. STIKes Nauli Husada sebagai salah satu lembaga pendidikan profesi di Kota Sibolga, katanya diharapkan mampu menciptakan tenaga-tenaga professional yang muda, terampil dalam bidangnya, serta dapat mengisi kekurangan tenaga kesehatan yang dibutuhkan Sibolga maupun secara nasional. “Bahkan menjadi tantangan bagi kita untuk menjawab kebutuhan tenaga kesehatan di tingkat internasional. Kami yakin, STIKes Nauli Husada senantiasa berupaya untuk melengkapi seluruh sarana yang dibutuhkan, termasuk tenaga pengajar (dosen) yang professional,” tandasnya. Hadir dalam capping day dan pengukuhan tersebut, mewakili Kapolres Sibolga Kota, AKP S Simangunsong, Pimpinan BANK BNI Sibolga, mewakili Kadis Kesehatan Kota Sibolga dan Tapteng, mewakili Direktur RSU SIbolga dan RSU Pandan, ratusan orang tua para mahasiswa serta sejumlah undangan lainnya. (tob)

Penertiban dilakukan Adpel Sibolga bersama Pimpinan dan Komisi II DPRD, Pertamina, DKP Sibolga-Tapteng dibantu personel kapal patroli KPLP Sibolga. Dari kelima bagan pancang yang ditertibkan, dua di antaranya terpaksa dirubuhkan dengan cara ditarik oleh kapal patroli KPLP pakai tali tambang. Sedangkan satu lagi sudah rusak karena telah ditinggal pemiliknya. Sementara dua lagi dijanjikan akan dibongkar sendiri oleh pemiliknya. Sebab mereka meminta kelonggaran satu hari unutk membuka jaring, kayu dan tali bagan. Sebanyak empat kapal patroli KPLP diterjunkan untuk menarik tiangtiang bagan, yang dipimpin oleh PH KPLP Sibolga, Pangihutan Harahap. Kelima bagan pancang yang rata-rata berdiri di kedalaman 13-15 meter tersebut di antaranya milik Marulitua Banjarnahor, Hatoguan Rajagukguk, Dinson Sihombing, B Togatorop dan M Rajagukguk. Mereka semua adalah warga Ketapang, Sibolga. “Sesuai kesepakatan di surat pernyataan yang ditandatangani oleh kelima pemilik bagan, Selasa (28/2) batas waktu pembokoran. Kalau tidak maka kami terpaksa melakukan pembokaran seperti sekarang,” tutur Kepala Adpel Sibolga, M Ilyas melalui Petugas Lala dan Kepelabuhanan, Augustia Waruwu, Selasa (28/2). Turut dalam penertiban tersebut Wakil Ketua DPRD Sibolga, Imran S Simorangkir, Ketua Komisi II DPRD Sibolga, Jimmi R Hutajulu, Wakil Ketua Komisi II DPRD Sibolga, Heri Yon Marbun, dan anggota Komisi II, Jansul P Pasaribu. Kemudian, Kabid Perikanan Tangkap DKP Sibolga, RA Marbun, Kabid Penangkapan Perizinan DKP Tapteng, Torang M Tamba dan GP Hutagalung. Disaksikan oleh Administrasi Marine Pertamina Masayu Niken KS. Sebelumnya, DPRD Sibolga, Adpel Sibolga, DKP Sibolga-Tapteng, pihak HNSI Sibolga, serta perwakilan pemiliknya melakukan survei lokasi bersama tanggal 26 Januari lalu. Survei itu dilakukan menyusul adanya keluhan dari Pertamina bahwa kapal tanker pemasok BBM kesulitan bermanuver akibat keberadaan kelima bagan pancang tersebut. Buntutnya, para pemilik bagan meminta perhatian DPRD. Pihak Adpel sendiri menyatakan sudah beberapakali memberi toleransi batas waktu pembokaran kepada pemilik bagan. “Sebenarnya kita sudah memberi peringatan dan toleransi waktu kepada pemilik untuk segera membongkar sendiri bagannya. Karena itu saya harap komitmen kali ini dapat dilaksanakan dengan bijaksana. Adpel sendiri sebelumnya sudah siap memberi bantuan armada kapal bilamana bagan pancang yang mengganggu jalur pelayaran itu akan dibongkar,” timpal Augustia Waruwu. Pemilik Sempat Protes Upaya penertiban itu tidak berjalan mulus. Sebab, dua dari pemilik bagan protes dan meminta toleransi waktu lagi. Salah satunya Marulitua Banjarnahor. Saat bagan miliknya hendak dirubuhkan, lelaki itu berteriakteriak dari atas bagan. “Ini soal perut pak. Robohkan lah, biarlah aku mati bersama baganku,” teriak Marulitua Banjarnahor dari atas bagan. Setelah dilakukan dialog, Marulitua akhirnya berhasil dibujuk. Kemudian, diberi penjelasan oleh Kabid Penangkapan Perizinan DKP Tapteng, Torang M Tamba. Marulitua pun berjanji akan membongkar sendiri bagannya, hari ini, Rabu (29/2). Aksi protes juga dilakukan pemilik bagan lainnya, B Togatorop. Yang akhirnya petugas memberi toleransi sehari untuk Togatorop membongkar sendiri bagan miliknya. “Tolonglah pak, saya akui memang sudah lewat batas waktunya, tapi saya minta satu hari saja. Biar saya saja yang membongkar jaring dan tali bagan itu,” pintanya. Menurut pria paruh baya berkulit hitam ini, dirinya telah mengeluarkan modal sebesar Rp25 juta untuk mendirikan bagan pancang tersebut. Lokasi berdirinya bagan tersebut diakui cukup strategis. Sebab, selain aman dari terjangan ombak, di lokasi itu juga lebih banyak ikannya. Wakil Ketua DPRD Sibolga, Imran S Simorangkir mengatakan, pihaknya telah melakukan berbagai upaya dialog dan mediasi dengan pihak-pihak terkait. Hasilnya, para pemilik bagan akan diusulkan mendapat bantuan alat tangkap ikan dari pemerintah, jika bersedia. “Memang tidak ada kompensasi berupa ganti rugi materi. Tapi kita upayakan agar mereka memperoleh bantuan alat tangkap,” tutur Imran diamini Ketua Komisi II, Jimmi R Hutajulu. (mora/tob)

Sambungan Halaman Satu Pelaku Semarga dengan Korban Sambungan Halaman 1 memaksa mereka masuk ke mobil dengan menodongkan senpi, hingga dia diperkosa di depan kakaknya. Diceritakannya, Sabtu (25/2) sekira pukul 22.30 WIB, ketika dia dan kakaknya pulang dari kota menuju kosnya, sebuah mobil mencegat mereka dan diancam pistol oleh pelaku dengan menuduhkakakberadikinisebagai pengguna narkoba. Walau sempat menolak, pelaku tetapmemaksaagarmerekamasuk ke mobil. Sedangkan

sepedamotornya dibawa oleh salah seorang pelaku. FS yang mengenakan baju warna merah melanjutkan, dalam mobil tersebut kakaknya JS duduk di kursi paling belakang yang ditemani satu orang pelaku. Sedangkan ia duduk di tengah dan diapit oleh dua orang pelaku, sedangkan yang duduk di depan hanyalah sang sopir. Dengan laju mobil sekitar 70-80 km per jam, kakak beradik ini dibawa para pelaku menuju arah Medan. Di mobil tersebut, para pelaku selalu menanyakan tentang kepemilikian narkoba, tapi korban

tetapberusahameyakinkanbahwa mereka tidak ada memiliki narkoba. “Pas aku duduk di belakang, aku hendak disetrum dengan alat warna hitam dan menakut-nakuti aku,” aku JS kepada METRO yang juga sedang bersama FS. Iamengatakan,merekadilarang banyakbicaradanmemintatolong supaya tidak disakiti. Sementara itu, adiknya yang berada di depan kakaknya diapit dua orang pelaku dengan mengatakan akan membawa mereka ke polisi jika tidak mengaku.

“Aku sudah ketakutan dan tetap mengatakan kami tak punya narkoba,” kata FS lagi. Selanjutnya lewat daerah Serbelawan, Kabupaten Simalungun, pakaian yang dikenakan oleh FS satu persatu dibuka oleh pelaku, dengan alasan mencari narkoba. Pelaku juga meraba-rabatubuhnya.Sementara itu, JS yang berada di belakang juga dipegang-pegangi oleh pelaku. “Mereka tidak kasar dan mengatakan supaya mereka diperlakukansepertilayaknyasama pacar,”katanya. Walau salah seorang pelaku satu

marga dengan korban, pelaku bermarga Si ini mengaku tidak peduli soal marga. Bahkan ia meminta agar korban melayani nafsunyasepuas-puasnya. JS berusaha menolak ajakan pelaku, namun karena dengan pistol yang ditodongkan akhirnya merekatetappasrah.Bahkanpelaku memaksauntukoralsekswalaupun didalammobil.Sedangkanadiknya, ‘dikerjai’ oleh pelaku dengan meraba-rabatubuhnyayangmasih telanjang. FSkembalimenjelaskansaattiba di Tebingtinggi, mereka berhenti sebentar. Pelaku menaikkan satu

1.000 Orang Utan & Bunga Bangkai Sambungan Halaman 1 menemukanbungabangkaiatau Rafflesia Gadutensis dan beragam jenis anggrek di hutan yang masuk dalamwilayahTapteng. HalinidisampaikanKoordinator YEL, Gabriella Fredrikson didampingi koordinator lainnya, Grahan Usher kepada Bupati Tapteng Raja Bonaran Situmeang beserta seluruh jajaran pimpinan SKPDdancamatse-TaptengdiAula Bina Graha kantor Bupati Tapteng, Selasa(28/2). “Dari hasil penelitian kami di Hutan Batang Toru yang beberapa bagiannya masih masuk dalam wilayah Kecamatan Tukka, Pinangsori, Badiri, Lumut dan Sibabangun, kami menemukan banyak sekali tumbuhantumbuhan langka di dunia, termasukbungabangkaiatauRafflesia Gadutensis dan puluhan jenis anggrekyangsangatcantik.Bahkan,

kami juga menemukan 11 jenis tumbuhanyangmerupakanspesies barudiduniailmiahyangnamanya sampai saat ini masih belum kami tentukan,” ujar wanita cantik berkewarganegaraanSwissini. Di samping memiliki puluhan tanamanatau floralangka,hutandi Tapteng, khususnya yang masih termasuk kawasan Hutan Batang Toru,jugamenyimpanratusanjenis hewan atau fauna langka dan dilindungi oleh negara, mulai dari orangutan,tapir,harimausumatera, kucing batu, beruang madu, dan kambinghutan. “Kamijugamenemukan265jenis burung di hutan ini dan dari jumlah tersebut terdapat 59 jenis burung khas Sumatera yang termasuk langka,salahsatunyaadalahburung enggang kepala putih dan 16 jenis burung pelatuk. Semuanya itu merupakan harta karun dan aset berharga bagi Tapteng, Sumut bahkan Indonesia. Oleh karena itu,

kami sangat mengarapkan dukungan dari Pemkab Tapteng untuk turut berpartisipasi menjaga kelestarian hutan ini, terutama kawasan hutan Batang Toru,” harapnya. Dijelaskannya,khususkeberadaan orang utan, salah satu hewan paling langka yang dianggap paling mirip dengan manusia, kawasan Hutan Batang Toru saat ini menjadi habitat terakhirorangutan,selaindikawasan hutan Sembahe dan Aceh. Di mana diHutanBatangToruini,diperkirakan masih terdapat sekitar 900 sampai 1.000ekorOrangutanatau10hingga 15persendaritotalpopulasiyangada. “Kamiperkirakansekitar600ekororang utan berada di Blok Batang Toru Baratdan300-400ekordiblokBatang Toru Timur. Jumlah ini termasuk bagian paling banyak terdapat populasiorangutanyangdiperkirakan diduniahanyatinggal6.600ekorlagi. Kami sangat mengharapkan peran serta Pemkab Tapteng bersama

Pemkab Tapsel dan Taput sebagai kawasanpemilikHutanBatangToru untukturutsertamenjagakelestarian hewan langka ini,” ujarnya.m Bupati Tapteng Raja Bonaran Situmeang padakesempatanitumenyampaikan bahwa dirinya merasa terkejut dan takjub atas informasi yang baru saja disampaikanolehYEL. Dirinya selama ini tidak pernah menyangka bahwa ternyata hutan Tapteng sangat kaya akan flora dan faunalangka.Olehkarenaitu,dirinya mengaku akan siap bekerja sama dengan YEL untuk melestarikan hutan-hutan di seluruh Tapteng beserta seluruh isinya. “Jujursaja,informasiinibarusaya perolehdariYEL.Selamainisayatak menyangka bahwa hutan Tapteng sedemikian kayanya. Kami akan berusaha sekuat tenaga untuk menjagadanmelestarikanhutanini beserta seluruh habitat flora dan fauna di dalamnya. Kami juga mengharapkan bantuan dari YEL

untuk memberikan daftar namanama tumbuhan atau hewan di hutan ini sebagai tambahan data bagi kami, supaya kami bisa menjadikanhutaninisebagaisalah satu daya tarik wisata yang saat ini tengahkamigalakkan,”tuturnya. Bupati juga berharap YEL tidak hanya bergerak dan berusaha melestarikan kawasan Hutan Batang Toru saja, tapi juga ikut membantu melestarikan hutan di kawasan Pulau Mursala yang saat ini tengah mengalami krisis akibat ulah pembalakan liar yang dilakukan sejumlah oknum yang tak bertanggung jawab. “Hutan di Pulau Mursala yang tengah kritis seharusnya juga menjadi salah satu perhatian YEL. Jika tidak dilestarikan segera, maka air terjun terunik dan terindah di dunia yang ada di pulau itu akan musnah dalam waktu dekat,” pungkasnya.(ahu)

orang teman mereka. Untuk menjaga rahasia rumah salah seorang pelaku tersebut, kakak beradik ini tidak diperbolehkan melihat dari kaca dan kepalanya ditundukkan oleh pelaku. Selanjutnya mereka pun melanjutkan perjalanan menuju arah Medan. Saat tiba di Pabatu, Serdang Bedagai, setir mobilpun dibelokkan ke arah kanan, dan dibawa cukup jauh. “Sepertinya mereka sudah mengenal lokasi itu sebelumnya, karena tak satupun terlihat ada pengaman kebun itu,” kata FS. Saat tiba di tujuan, mobilpun dihentikan, dan karena suasana gelap, lampu mobil tetap dihidupkan. Selanjutnya, oleh dua orang pelaku, FS ditarik keluar dan dibawasekitar100meterdarimobil. Dalam kondisi yang sudah telanjang, FS dibaringkan di tanah dan digilir oleh pelaku. “Mereka itu tidak kasar Bang, bahkan mereka memaksa supaya mereka diperlakukan seperti pacarnya,” beberFS. Usai diperkosa bergantian, FS mengaku kesakitan dan kepalanya pening-pening. “AkutakkuasamenolaknyaBang, karena aku juga diancam dengan pistol,” katanya lagi sembari mengatakandiadiperkosasekitar30 menit. Sementaraitu,JSkakaknyahanya disuruh oral seks oleh dua orang pelaku karena saat itu dia sedang datangbulan. “Setelah puas, mereka pun pergi meninggalkan kami dengan hanya mengenakan pakaian seadanya. Sedangkan barang-barang kami semuanyadibawa,”katanyasedih. Sejak itulah, mereka terpaksa

berjalan kaki untuk meminta pertolongan kepada warga hingga mereka tiba di Siantar setelah pacaranyamenjemput. Ia mengaku sewaktu melewati kebun tersebut, dirinya sangat ketakutan. Beruntung saat itu sudah mulai pagi, sehingga jalan sudah mulai kelihatan. Sekitar satu jam lebih mereka baru tiba di rumah warga. Setelah di rumah warga, mereka mengetuk pintu salah seorang rumah warga, namun tidak dibuka. Selanjutnya mereka juga mengetuk pintu rumah lainnya juga tidak dibuka. Hingga ke rumah yang lain pintunya dibuka, akan tetapi dia harus meyakinkan pemilik rumah bahwa mereka tidak berniat jahat, danmerekapundisuruhmengetuk pintu rumah di sebelahnya. “Kakiku sering terantuk batu, bahkankuburanpuntaksadarkami lewati saat mau mencari rumah warga,”kataJS. JSmengatakan,rencanayabulan April mendatang dia akan kembali ke Malaysia setelah dia pulang kampung Oktober 2011 lalu. Sedangkan FS mengaku sudah setahun tinggal di Siantar dan pekerjaannya sering pindahpindah,bahkaniamengakupernah kerjadiRamayana. Sementara untuk mengungkap kejadian tersebut, pihak kepolisian, Senin (27/2) sudah membawa korban ke lokasi kejadian untuk mengecek tempat pelaku melakukan pemerkosaan. Sedangkan, saksi-saksi dan korban masih dilakukan pemeriksaan di Mapolres Siantar. Humas Polres Siantar AKP Altur Pasaribu mengatakan, pelaku masih dalam lidik.(mag-1)

RABU Harga Rp2.000



Perekat Masyarakat Kota Berbilang Kaum

Lawak Batak Sitimba Laut Hadir di Barus Meriahkan Pesta Bona Taon II Raja Toga Simatupang SIBOLGA- Sabtu (3/3) mendatang, keturunan Raja Toga Simatupang (Toga Togatorop, Toga Sianturi, Toga Siburian) Sibolga-Tapteng menggelar Pesta Syukuran Bona Taon. Acara ini akan dimeriahkan Pop Batak Ibukota Simatupang Sisters dan artis Lawak Batak Sitimba Laut. Ketua Generasi Muda

(Gema) Keluarga Besar Simatupang (KBS) Boru/Bere/Ibebere Sibolga, Erwin S Simatupang didampingi Ichwan Simatupang (Kepala Dinas Perindustrian, Perdagangan, Koperasi dan UKM kota Sibolga) dan M Soaloon Simatupang (Kontraktor), mengajak seluruh pemuda keturunan Toga Simatupang untuk

berkenan hadir ke kota Barus tepatnya di Bukit Hasang. “Kita ingin seluruh pemuda keturunan Toga Simatupang hadir. Karena kegiatan pesta Bona Taon Raja Toga Simatupang II yang dilaksanakan di Bukit Hasang, Barus ini sangat positif. Selain dalam rangka

‹ Baca Lawak ‹

5 Bagan Pancang Ditertibkan Pemilik Sempat Protes

SIBOLGA- Sesuai tenggat waktu yang telah disepakati bersama, lima bagan pancang jaring penangkap ikan yang sebelumnya dikeluhkan mengganggu jalur pelayaran di perairan Teluk Nauli Sibolga sekitar Pulau Sarudik ditertibkan, Selasa (28/2).

...Hal 7

‹ Baca 5 ‹

Bagan ...Hal 7


PROTES: Marulitua Banjarnahor protes dengan berteriak-teriak dari atas bagan miliknya meminta tolerensi waktu pembongkaran, Selasa (28/2).

Stop Bongkar Muat di Jalan Yos Sudarso KOTA BERINGIN- Warga Jalan Yos Sudarso, Kelurahan Kota Beringin, Kecamatan Sibolga Kota, resah dengan aktivitas bongkar muat sejumlah truk di daerah itu. Mereka juga mengaku terganggu karena sopir truk parkir sembarangan. “Kami meminta agar truk-

truk yang melakukan bongkar muat di Jalan Yos Sudarso menghentikan aktivitasnya. Sebab jalan ini merupakan fasilitas umum dan jangan dijadikan sebagai tempat bongkar muat barang,” kata

‹ Baca Stop ‹

...Hal 7


HAMBAT JALAN: Sejumlah truk yang melakukan aktivitas bongkar muat di jalan Yosudarso. Akibatnya jalan menjadi terhambat dan mengganggu kenyamanan warga, apalgi warga setempat.

194 Mahasiswa STIKes Nauli Husada Capping Day SIBOLGA- Sebanyak 197 mahasiswa/i Sekolah Tinggi Ilmu Kesehatan (STIKes) Nauli Husada yang terdiri dari Prodi D III Kebidanan dan Prodi D III Keperawatan mengikuti capping day sekaligus pengukuhan mahasiswa di Gedung Nasional, Kota Sibolga, Selasa (28/2). Prosesi acara diawali dengan jalan beriring di belakang tokoh menyerupai Florence Night Angel yang menjadi tokoh dan pelopor dalam keperawatan yang lahir di Florence (Italia) pada 12 Juli 1820 dan wafat pada 13 Agustus 1910 lalu. Menurut sejarah, ia merupakan tokoh yang berperilaku baik, rajin beribadah, suka

mengunjungi dan menolong orang sakit dimana oleh Raja Edward VIII dianugerahi sebagai perintis gerakan palang merah. Mahasiswa semester pertama ini selanjutnya dipasang cup (topi) oleh para dosen dan memasang lilin dari tokoh Florence Night Angel serta mengucapkan janji. Direktur STIKes Nauli Husada, Dra Mei Yati Simatupang SST MKes dalam sambutannya menyampaikan capping day adalah suatu kewajiban sesuai dengan kurikulum keperawatan nasional. “Selain itu juga menjadi kebanggaan bagi para maha-

‹ Baca 194 ‹

Mahasiswa ...Hal 7


Teraktual dari Tarutung, Balige, Humbahas, dan Samosir




Selangkah Lagi Kasus Korupsi Martuaman Tuntas

„ Martuaman Silalahi

TARUTUNG- Korupsi dana kas Sekretariat Pemkab Humbahas tahun 2005 senilai Rp1,3 miliar yang diduga dilakukan Sekda, Martuaman Sudiaman Silalahi, tinggal menunggu penyidikan terakhir. ”Soal penyidikan kasus Sekda Humbahas sebenarnya tinggal selangkah lagi. Kita sedang mengupayakan satu item penyidikan lagi. Mudahmudahan dapat segera kita selesaikan,” ungkap Kajari Tarutung S Simanjuntak SH saat ditemui di ruang kerjanya, Selasa (28/2). Namun saat dicecar apa item yang satu itu? Kajari me-

ngelak menguraikan. ”Itu teknis penyidikan. Tidak mungkin kita beberkan. Tunggu sajalah,” jawabnya. Dituding penyidikan lambat, Kajari menegaskan pihaknya tidak pernah mengendapkan kasus tersebut. ”Selama ini mungkin anggapan banyak pihak kasus itu sudah mengendap. Itu anggapan yang salah. Sekarang kita butuh ketelitian untuk melengkapi berkas. Apalagi berkas ini dugaan korupsi,” paparnya. Kajari pun berjanji akan menuntaskan kasus tersebut. ”Yang jelas, kasus ini akan saya upayakan untuk segera tun-

tas. Tidak ada toleransi bagi para pelaku korupsi,” tandasnya. Sebelumnya Kajati Sumut AK Basuni Masyarif SH Senin (20/2), saat melakukan kunjungan kerja di Kantor kejaksaan Negeri Tarutung memastikan kasus penyidikan atas tersangka Sekda Humbahas masih terus berlanjut. “Kendalanya adalah masalah perizinan pemeriksaan rekening bank milik tersangka,” kata AK Basuni Masyarif. Sementara Ketua LSM Pijar Keadilan Humbahas, Lambok



Bendahara Ngaku Dihipnotis Uang Rp86,5 Juta Gagal Disetor ke Bank DOLOKSANGGUL- Bendahara UPT Pendidikan Wilayah I Humbang Hasundutan, Goktua Purba, mengaku dirampok dua pria pengendara mobil Daihatsu Terios warna silver di depan RSU Doloksanggul, Senin (27/2) sekira pukul 8.30 WIB. Uang Ro86,5 juta lenyap. Benarkah?

Bank BRI Doloksanggul. Lalu dua pria menghipnotisnya dan membawanya ke dalam mobil. Kemudian pelaku membawa Goktua ke Jurang Sipittu-pittu, Kecamatan Tampahan, Toba Samosir.

Goktua kepada koran ini, Selasa (28/2) mengaku dirampok

„) Baca Bendahara .Hal 10

saat akan menyetorkan uang cicilan kredit pinjaman guru ke

„) Baca SelangkahHal 10


ONAN TOMBIS: Seorang ibu dan suaminya berdagang martabak di terminal Onan Tombis Porsea, pada pekan hari Rabu, baru baru ini. Onan Tombis adalah sebuah pasar tradisional yang cukup ramai didatangi para pedagang dari berbagai daerah di Tapanuli dan wilayah Siantar.

Keluarga Pengusaha Tambang Menyerah

Bermohon Kapolres Ampuni Pekerja yang Ditangkap BALIGE- Robert Pardede alias Kempes Pardede, keluarga Alis Cooper Pasaribu, pengusaha tambang batu yang me-

„) Baca Keluarga ..Hal 10

DITANGKAP: Sejumlah polisi ketika menangkap para pekerja tambang di areal hutan Aek Ihan Natumingka, Kecamatan Borbor. Enam orang pekerja tambang ditangkap dari kawasan terlarang ini.




Tangis Tumpah, Ratusan Pelayat Antarkan ke Pemakaman (FOTO: Bernad L Gaol)

DISEMAYAMKAN: Para pelayat berdatangan ke rumah duka sebelum pemakaman Nai Dewi yang tewas jatuh dari irigasi.


Ratusan pelayat membanjiri rumah duka almarhum Tumiar Purba alias Nai Dewi (48) di Dusun Pasar-pasar Desa Dolok Saribu, Kecamatan Pagaran, Taput, Selasa (28/2). Hingga di pemakaman, suami dan anakanak Timiar terus meratapi kepergian wanita yang tewas setelah terjatuh dari irigasi. Banyak kenangan semasa korban hidup. Seperti kata warga, korban adalah wanita

„) Baca Tangis ..Hal 10





29 Februari 2012



Dihapus, Triliunan Dana Penyesuaian ke Daerah JAKARTA- Undang-undang (UU) Nomor 33 Tahun 2004 tentang hubungan keuangan pemerintahpusatdanpemerintah daerah akan segera direvisi. Langkah revisi ini mengikuti revisi UU Nomor 32 Tahun 2004 tentang pemerintahan daerah, yang salah satu babnya mengatur hubungan keuangan pusat-daerah. MendagriGamawanFauzitelah mengirim surat ke Menkumham AmirSyamsuddinagardalamrevisi UU Nomor 33 nantinya merujuk pada ketentuan RUU tentang pemda, sebagai revisi UU 32. ”Mendagri berharap materi dan substansi yang akan diatur di RUU hubungan keuangan pemerintah pusat dan pemerintah daerah harus sejalan dengan konstruksi

MACET- Truk bermuatan ampas terbalik di Jalinsum Anturmangan, Kecamatan Sipirok, Kabupaten Tapanuli Selatan, Selasa (28/2) siang. Macet pun terjadi selama 4 jam.

Truk Terbalik, Macet 4 Jam SIPIROK- Ratusan kendaraan bermotor terjebak macet selama empat jam di Jalinsum Anturmangan, Kecamatan Sipirok, Kabupaten Tapanuli Selatan, Selasa (28/2) siang. Antrean kendaraan ini disebabkan truk bermuatan ampas terbalik, setelah sebelumnya menyenggol truk pengangkut kayu yang terperosok di pinggir jalan. Kemarin sekitar pukul 09.00 WIB, truk pengangkut kayu dengan nomor polisi BK 9621 BI yang datang dari arah Sipirok terperosok di pinggir jalan. Antrean kecil pun terjadi. Lalu sekira pukul 13.00 WIB, dari arah yang sama melintas truk pengangkut ampas nomor polisi BK 8424 MU menyenggol truk yang terperosok itu. Sejurus kemudian, truk pengangkut

ampas tadi terbalik hingga menyebabkan macet selama empat jam. Lalu-lintas kembali normal pukul 17.00 WIB setelah kedua truk itu dievakuasi. Sejumlah warga yang ditemui METRO di lokasi, antara lain; Siregar (45), Ritonga (50) dan Harahap (34), menyebutkan, kerusakan jalinsum di wilayah Sipirok memang sudah sangat mengkhawatirkan. Sebab, mulai titik Sipirok hingga perbatasan Kabupaten Tapanuli Utara (Taput), tercatat ada tiga lokasi rawan macet. Yakni, Aek Latong di sekitar Km 10, Batu Jomba Km 13, dan jembatan Aek Sihoruhoru Km 15. Salahsatu penyebab macet dalah ribuan lubang berbagai ukuran yang membentang di sepanjang jalan. Menurut mereka, meski upaya

mengantisipasi macet di tiga titik terus ditingkatkan oleh instansi terkait, namun pemeliharaan jalur lainnnya terkesan berkurang. Tak heran bila lokasi rawan macet bertambah yakni di Dusun Anturmangan tepatnya di Km 4. “Sudah sering terjadi antrean di sini. Tapi yang terpanjang baru hari ini (kemarin). Kita heran, mengapa kondisi ini dibiarkan? Seandainya ditimbun kerikil saja, jalur ini sudah aman dan lancar,” terang mereka, Selasa (28/2). “Kami berharap pemerintah juga memperhatikan kondisi jalan ini. Kerusakannya sudah parah. Tak hujan sekalipun masih berpeluang macet, apalagilah ketika hujan,” tambah salah seorang pengguna jalan, Sihombing (40). (ran)

Warga Ajibata Urus KK ke Simalungun AJIBATA- Sejumlah warga Ajibata, Tobasa kesal karena kembali tanpa hasil saat mengurus surat Keterangan Keluarga (KK) ke Dinas Kependudukan dan Catatan Sipil Toba Samosir. Padahal ongkos mereka ke sana sudah cukup besar. M Pakpahan warga Lumban Poki, Ajibata mengatakan, pengurusan KK di Tobasa sungguh berbelit-belit. “Padahal berkas saya lengkap yang ditanda tangani kepala desa, sekdes dan Camat Ajibata,” ujarnya sambil menunjukkan berkas-berkasnya. Hal yang sama juga dialami Rohani br Siburian warga di Pelabuhan KMP Tao Toba Fery Ajibata. Pedagang makanan ini merasa sengaja dipersulit untuk melengkapi berkas. “Kemarin saya kembali dari

kantor kelurahan Parsaoran Ajibata dan dianjurkan ke Balige. Saya diharuskan melengkapi banyak surat. Antara lain surat kartu keluarga dari kedua orang tua, foto, akte nikah yang dikeluarkan pengadilan tidak boleh oleh gereja, dan yang paling sulit harus mengikutsertakan surat akte nikah dari orang tua dan mertua. Ini tidak masuk akal,” pungkasnya. Sementara P M Nainggolan yang terpaksa mengurus KK ke Kecamatan Girsang Sipangan Bolon Simalungun karena sudah 3 kali pulang dari Balige tanpa hasil. “Terpakasa saya urus KK ke Simalungun. Semuanya selesai, walaupun tempat tinggal sesuai alamat orang tua di Parapat. Saya rela tak dapat KTP dari Tobasa,” katanya. Menindak lanjuti hal

tersebut, Sekcam Ajibata, Lurah Monang Manihuruk SE, mengatakan mengenai penerbitan KK bukan menjadi wewenang pemerintah kecamatan tapi melalui Dinas Kependudukan dan Catatan Sipil Tobasa di Balige. “Kami hanya memfasilitasi dari Kecamatan Ajibata ” kata Sekcam. Sementara Kepala Dinas Kependudukan dan Catatan Sipil Tobasa Dra Rosita Siagian MSi yang dihubungi melalai telephone selularnya menjelaskan, mengenai penerbitan KK di Tobasa mempedomani Peraturan Presiden (Perpres) tentang persyaratan, tata cara pendaftaran pendududuk dan pencatatan sipil yang tertuang dalam pasal 11-14. “Memang seperti itulah prosedurnya,” katanya. (Rait)

April, Perekaman e-KTP TAPUT- Masyarakat di Taput diminta datang menghadiri proses perekaman untuk penerbitan kartu tanda penduduk elektronik atau yang biasa disebut e-KTP. Proses perekaman dimulai sejak bulan April, antara lain pas photo, tanda tangan, dan sidik jari yang dilakukan di setiap kantor camat di seluruh wilayah Taput. Kepala Dinas Kependudukan dan Catatan Sipil Pembab Taput M Siregar, Selasa ( 28/2) mengatakan, sejauh ini peralatan untuk perekaman belum sampai

di setiap kecamatan. Namun, katanya, peralatan yang langsung dikirim dari pusat tersebut akan tiba pada waktunya dan proses perekaman akan berjalan mulai April bulan depan. Proses perekaman, tambah Siregar, akan dimulai sejak April dan ditarget selesai bulan September. “Jadi kita meminta masyarakat memenuhi proses perekaman yang akan dilakukan di kantor camat,” katanya. Sementara itu Camat Siatas Barita Dra Betty Sitorus yang dihubungi melalui selulernya,

Selasa( 28/2) mengaku sudah mengetahui program tersebut. Begitupun mereka masih menunggu kedatangan perlatan perekaman penerbitan e-KTP. “Sambil menunggu perlatan datang kita memaksimalkan data kependudukan dulu. Semua kepala desa serta sekretaris desa bekerja dari pintu ke pintu untuk melakukan pendataan. Nah setelah peralatan itu nantinya datang, barulah ada undangan bagi masyarakat melakukan perekaman identitas di kantor camat,” katanya. ( ht)

RUUpemdasebagaipenggantiUU 32,” ujar Juru Bicara Kemendagri, Reydonnyzar Moenek. Dipasal161ayat(2)RUUpemda, disebutkan bahwa hubungan keuangan dalam penyelenggaraan urusan pemerintahan yang diserahkan kepada pemda meliputi empat poin, yakni, pertama, pemberian sumber pendapatan asli daerah berasal dari pemungutan pajak daerah, retribusi daerah, hasil pengelolaan kekayaan daerah yang dipisahkan dan lain-lain pendapatan asli daerah yang sah. Kedua, pemberian dana bersumber dari perimbangan keuangan antara pemerintah pusat dan pemerintah daerah. Ketiga, pemberian dana

penyelenggaraan otonomi khusus untuk pemda tertentu yang ditetapkan dalam undangundang. Keempat, pemberian pinjaman dan/atau hibah, dana darurat, insentif (fiskal). Dari ketentuan pasal 161 itu terlihat jelas bahwa jika materi di RUU itu nantinya disetujui DPR dan diakomodir di dalam UU perimbangan keuangan yang baru (pengganti UU 33/2004), maka tidak ada lagi yang namanya “Dana Penyesuaian”. Seperti diketahui, selama ini dana transfer ke daerah terdiri dari Dana Bagi Hasil (DBH), Dana Alokasi Umum (DAU), Dana Alokasi Khusus (DAK), dana otsus, dan dana penyesuaian.

Dana Penyesuaian inilah yang selama ini sistem distribusinya ditentukan dengan kriteriakriteria yang tidak jelas dan berbau politik. Seknas Forum Indonesia untuk Transparansi Anggaran (Fitra), Yuna Farhan pernah menyebut, dana penyesuaian untuk pembangunan infrastruktur daerah, membuka peluang bagi mafia anggaran di DPR. Salah seorang anggota DPR Wa Ode Nurhayati jadi tersangka perkara penyaluran dana penyesuaian ini oleh KPK. Data yang didapat koran ini, dana penyesuaian untuk 2011 sebesar Rp48,235 triliun. Sedang untuk 2012 jumlahnya mencapai Rp57 triliun. (sam)

Bendahara Ngaku Dihipnotis Sambungan Halaman 9 Ceritanya begini. Pagi sekira pukul 8.00 WIB Goktua mengendarai sepedamotornya menuju bank. Namun dia singgah di sebuah bengkel di Pasar Doloksanggul untuk menservice sepedamotornya. Dari bengkel itu Goktua berjalan kaki menuju Bank BRI Doloksanggul yang memang jaraknya tidak terlalu jauh, di komplek Pasar Doloksanggul. Saat itu, kata Goktua, mobil Terios warna silver memepetnya, lalu seorang penumpang menyapa. ”Lae. Nggak kenal lagi lae samaku,” ujar seorang pria sambil menepuk pundak

Goktua yang kemudian mengaku tidak sadar, dan mengikut saja ketika dimasukkan ke dalam mobil. Dan anehnya, sambung korban, dia tidak sadar sudah dibawa ke arah Kota Siborongborong, Tapanuli Utara. “Tangan saya tidak diikat, mulut saya juga tidak dibekap. Saya ditidurkan di belakang mobil itu. Kebetulan mobilnya tidak punya kursi bekalang. Saya juga tidak diancam dengan senjata tajam atau senjata api” katanya. Lebih anehnya lagi, saat berada di mobil, Goktua mengaku mendengar dua pelaku berkata; “Nanti kita buang saja dia ke

Sipittu-pittu.” Dan Goktua mengaku sudah dibuang ke jurang Sipittu-pittu sekira pukul 9.30 WIB. ”Saya baru sadar setengah jam kemudian. Saya mengambil handphone dan mencoba menghubungi keluarga. Karena signal hp susah, telepon tidak bisa masuk. Kemudian saya mengirimkan SMS ke salahsatu keluarga untuk minta tolong,” katanya lewat sambungan HP. Namun pertolongan terhadap Goktua baru terjadi pukul 16.00 WIB. Di mana sejumlah keluarganya didampingi polisi mendatangi lokasi. Kemudian dia diangkat dari tepi jurang. Namun ketika ditanya ke-

napa korban tidak berusaha keluar dari tepi jurang? Goktua terdiam beberapa saat, lalu cepat-cepat memmutus pembicaraan dengan alasan ada tamu yang datang. ”Nantilah kita ngomong lagi pak, saya ada tamu,” katanya buru buru menutup sambungan telepon. Kasubbag Humas Polres Humbahas Iptu Suharmono SH saat dihubungi wartawan mengaku mengetahui cerita korban. Tapi korban belum mem buat laporan resmi. ”Memang benar Goktua dijemput dari jurang Sipittupittu. Tapi dia belum membuat pengaduan,” katanya.(hsl)

Selangkah Lagi Kasus Korupsi Martuaman Tuntas Sambungan Halaman 9 Situmeang pernah menyarankan bupati mencobot jabatan

tersangka dari bangku sekda. Untukdiketahui,dugaankorupsi yang dilakukan Sekda Humbahas atas kas Sekretariat Kantor Bupati

Humbahas Tahun Anggaran 2005 meliputi,panjarpenerimaanCPNS, panjar biaya PRSU, biaya ulang tahun Pemkab Humbahas, biaya

paket Natal, biaya open house Bupati Humbahas dan biaya pembinaanpers,dengantotaldana Rp1,3 miliar.(hsl)

Keluarga Pengusaha Tambang Menyerah Sambungan Halaman 9 ngekploitasi seputaran Aek Ihan Natumingka, Kecamatan Borbor, Tobasa, mendatangi Kapolres Toba Samosir, Selasa (28/2). Robert meminta kasus 6 pekerja tambang yang ditangkap, bisa dihentikan. “Tujuan kedatangan saya terkait ditangkapnya beberapa orang pekerja tambang itu. Tolonglah kasus ini jangan diproses lagi, cukuplah hanya pekerjanya saja yang diproses,” ujar Robert Pardede kepada Kapolres Toba Samosir AKBP Budi Suherman. Robert Pardede mengakui izin tambang batu itu tidak ada, karena instansi yang mengeluarkan izin tambang di Tobasa tidak ada. “Hal inilah menjadi dilema bagi daerah kita ini. Jika semua galian C dihentikan, dari mana lagi batu kita peroleh. Padahal pembangunan terus berjalan,” tutur Robert Pardede memberi alasan. Dipaparkan Robert Pardede, ada baiknya pemerintah maupun DPRD mencari solusi terbaik dalam mengatasi persoalan galian C ini. Di satu sisi, Perda galian C untuk daerah Tobasa telah dicabut, sementara hasil

yang diperoleh dari setiap kegiatan galian C ini sangat dibutuhkan untuk pembangunan. Robert Pardede juga tidak memungkirinya, retribusi atau PAD dari kegiatan galian C ini selama ini kontribusinya tak ada bagi pemerintah setempat. Jadi, sambung Robert Pardede, dia bermohon dan berharap dapat petunjuk dari Kapolres Tobasa, bagaimana solusi terbaik untuk menyikapi masalah tersebut. “Mohon petunjuk pak Kapolres, karena pelaku penambangan itu adalah keluarga kita,” ujar Robert Pardede. Menanggapi hal itu, Kapolres Tobasa Budi Suherman juga tidak memungkiri, batu yang dihasilkan dari lokasi galian C sangat dibutuhkan demi kelancaran pembangunan di Tobasa. Jadi dalam hal ini, pemerintah dan DPRD Tobasa kiranya dapat mencari solusi yang menyangkut Galian C ini. Di satu sisi, lanjut Budi Duherman, polisi sebagai penegak hukum wajib memproses setiap tindakan pelanggaran hukum, karena itu adalah tupoksi kepolisian. “Sebenarnya kami tidak pilih kasih atau tebang pilih dalam menindak seseorang yang me-

langgar hukum, sepanjang proses mekanismenya kami jalankan,” tandas Budi Suherman. Soal lokasi tambang batu yang berlokasi di wilayah Aek Ihan Natumingka itu ilegal atau tidak, dan lokasi itu berada dalam kawasan SK Menhut No 44, adalah bukan ranah kami, melainkan ada instansi yang berwenang yaitu Dinas Kehutanan dan Dinas Lingkungan Hidup,” terang kapolres. Pada pertemuan itu Kapolres meyanggupi menghentikan penyelidikan asalkan pihak pengusaha para pekerja tambang itu membuat surat pernyataan tidak mengulangi kegiatan penambangan, dan mau menghentikan kegiatan penambangan. Tapi, imbuh kapolres, surat pernyataan ini harus melalui Dinas Kehutanan. Artinya, pelaku itu sendirilah yang bermohon dan membuat surat pernyataan kepada Dinas Kehutanan. “Jika surat pernyataan itu sudah dikeluarkan dinas kehutanan, maka polisi akan menghentikan proses penyidikan,” sebut Budi Suherman. Sayangnya Kadis Kehutanan dan Perkebunan Toba Samosir Alden Napitupulu tidak ber-

hasil dikonfirmasi. “Bapak kadis tidak berada di sini, bapak pergi melayat orang tua bupati di Simanobak,” ujar salah seorang stafnya. Dicoba HP Alden dihubungi, sedang tidak aktif. Terpisah, Alis Cooper Pasaribu ketika dikonfirmasi METRO terkait ditangkapnya enam orang pekerjanya dari lokasi penambangan batu di wilayah Aek Ihan Natumingka Kecamatan Borbor, mengatakan, soal izin tambang memang tidak ada. “Sepengetahuan saya semua tambang batu di Tobasa tidak ada. Karena yang mengeluarkan izin tambang batu itu tidak kami ketahui siapa, “ ujarnya via HP, seraya mengatakan, lokasi tambangnya itu tidak dia ketahui berada di lokasi kawasan hutan. Soal tertangkapnya enam orang pekerjanya di lokasi kemarin, dan sudah dimintai keterangan oleh Satreskrim Tobasa, Alis Cooper sudah mengetahuinya. “Saya sudah tahu semalam pekerja saya itu ditangkap dan dibawa ke Polres Tobasa. Soal apa tindakan dan tanggapanku, no comment lah dulu,” singkat Alis Cooper Pasaribu. (cr-03)

Tangis Tumpah, Ratusan Pelayat Antarkan ke Pemakaman Sambungan Halaman 9 pekerja keras yang pantingtulang untuk menghidupi anakanaknya yang masih remaja. Namun sebelum meninggal dunia, keluarga korban sudah merasakan firasat lain karena korban sering meminta sesuatu. “Sejak bulan lalu sudah 7 kali dia kudengar meminta sesuatu dari orang-orang dekatnya,” terang adik kandung almarhum Rudi Purba (45) kepada METRO Selasa (28/2) di Pagaran. “Atik beha onma hita pajumpang, lean jo diau sada kenang kenangan.Unangholithamutuau. (Mana tau ini pertemuan terakhir kita,kasilahakukenang-kenangan. Jangan pelit kalian samaku,” kata Rudi Purba menirukan permintaan almarhum. Hal serupa juga disebutkan N boru Simajuntak (39) kerabat dekat almarhum yang datang

melayat dari Padang Sidempuan. “Saat itu almarhum meminta saya datang mengunjunginya. Romajohamu eda tuhuta kon, atik beha dang pajumpang behita muse. (Datang lah dulu kalian ke kampung kami mana tau kita tidak berjumpa lagi,” kenang boru Simajuntak. Histeris Isakan tangis suami almarhum Martua Asi Simajuntak dan anak anaknya tumpah ketika acara kebaktian dipimpin guru jemaat GKPI Hutabulu St B Purba. Acara itu ibadah terakhir sebelum almarhum dimakamkan di tanah milik keluarga almarhum. “Ngarobe pangula nihuria Mak Dewi, bereng jo satokkin, unang sai sip sip ho inang. (Sudah datang pengurus gereja kita Mak Dewi, lihat dulu sebentar, jangan diam saja kau sayang,” ratap suami almarhum

seraya merangkul anakanaknya. Ratapan itu sontak membuat anak anaknya ikut menangis. “Boasa mate ho oma, ise be paresohon baju bajunami molo sikkola, gelleng geleng dope adek adekkon. (Kenapa meninggal bu, siapalah yang menyiapkan baju kami ke sekolah, kecil kecil lagi adekku ini,” ratap anak nomor dua almarhum, Jansen Simajuntak. Jenajah Tumiur Purba dimakamkan di atas tanah miliknya sendiri di Desa Dolok Saribu, Pagaran Taput. Saat jenazah dibawa, ratusan kerabat dan tetanga khusuk mengikuti acara pemakaman. Prosesi pemakaman berlangsung sekitar 30 menit, selanjutnya dilaksanakan adat batak mangido tangiang/ sappu bona (memohon doa) agar keluarga yang ditinggal tetap tabah, dan ke depan

persitiwa seperti itu jauh dari kehidupan keluarga yang ditinggal. Acara adat itu berlangsung sederhana dihadiri pihak hula hula marga Purba, dongan tubu marga Simajuntak dan kerabat. Sebelumnya acara diawali kebaktian singkat secara Kristen protestan. Seperti diberitakan kemarin, korban hanyut Minggu (26/2) malam sekira pukul 19.30 WIB. Kala itu korban bersama tiga anaknya hendak menghadiri pesta tulangnya di Dusun Lumban Hariara desa Pancur Napitu. Nah, saat melintasi irigasi bondar gadu-gadu, korban mengeluh pusing lalu duduk di tebing irigasi. Malang, korban terjatuh. Begitupun anaknya Juliana Simajuntak sempat berusaha menolong dengan menangkap rambut ibunya. Namun usaha itu gagal. (***)




Februari 2012




Internasional Jutaan Pekerja Siap Gelar Aksi Mogok INDIA- Pekerja India tuntut perbaikan kondisi serta upaya penurunan angka inflasi. Jutaan pekerja India bersiap menggelar aksi mogok menentang tingginya angka inflasi serta menuntut kondisi kerja lebih layak dan penghentian penjualan perusahaan negara pada pihak swasta. Aksi mogok ini didukung oleh sebagian besar serikat kerja utama di India juga ribuan serikat kerja kecil yang terdapat di seantero negeri itu. Perbankan, transportasi, kantor pos dan pelabuhan adalah sektor-sektor yang diperkirakan akan paling parah terkena dampak akibat aksi ini. Namun layanan di jalur kereta api India diperkirakan tetap berjalan. Meski angka inflasi di India turun dari 9,1% pada bulan Desember, inflasi tetap tinggi di kisaran 7,5%. Pertumbuhan bidang keuangan setahun ini akan berakhir pada bulan Maret dan diperkirakan akan bertengger pada titik 7%, lebih rendah dari ramalan sebelumnya di titik 9%. Pemeintahan Perdana Menteri Manmohan Singh mencoba mengurangi defisit anggaran dengan menjual saham pada sejumlah perusahaan milik negara, hal yang sangat ditentang kalangan serikat kerja. Tuntutan aksi yang lain adalah ditempuhnya upaya-upaya untuk memotong inflasi, jaminan sosial untuk kalangan pekerja yang tidak tergabung dalam serikat serta ditegakkannya aturan UU tenaga kerja. Negara bagian seperti Bengal Barat, Tripura dan Kerala, dimana partai komunis punya pengaruh lebih kuat, diperkirakan juga akan menjadi sasaran parah dari aksi ini. (dtc/int)

20 WNI Dievakuasi dari Suriah DAMASKUS — Kedutaan Besar RI di Damaskus, Suriah, kembali mengevakuasi 20 warga negara Indonesia yang bekerja sebagai pekerja rumah tangga di negara tersebut, Selasa (28/2). Mereka dijadwalkan tiba di Jakarta dengan pesawat Etihad nomor penerbangan EY 472 pada pukul 14.15, Rabu (29/2/2012). Direktur Informasi dan Media Kementerian Luar Negeri PLE Priatna mengatakan, dari 20 WNI tersebut, sembilan di antaranya dievakuasi dari berbagai wilayah konflik di Suriah, yakni kota Homas (6 orang), Hama (1 orang), dan kawasan pinggiran Damaskus (2 orang). ”Selanjutnya direncanakan 20 WNI tersebut akan diserahterimakan dari Kementerian Luar Negeri kepada pihak BNP2TKI di TKI Lounge Bandara Soekarno-Hatta untuk kemudian difasilitasi kepulangannya ke daerah asal masing-masing oleh BNP2TKI,” imbuh Tatang Razak, Direktur Perlindungan WNI Kemlu dalam siaran pers yang diedarkan hari Selasa.(kmc/int) Berikut nama-nama WNI yang dievakuasi dari Damaskus: Aryati bt Sana (asal Banten), Ani Laisah Amin (Lampung Selatan), Rustiah Ropadi (Indramayu), Atikah Anwar (Cianjur), Mariah bt Mardiyah Sumarudin (Lombok Barat), Nunung Idik (Sukabumi), Tinem bt Ruscaman Salep (Indramayu), Riyanti bt Dartum Samad (Tangerang), Etikartini bt Karya Mocin (Indramayu), Wasni bt Raski (Indramayu), Basriyah Romadin (Pamekasan), Mariyati bt Kamdi Kenik (Cirebon), Kuniah bt Rokani (Indramayu), Eneng Rohati bt Uding Bisri (Sukabumi), Atiyah bt Ata (Tangerang), Aspiyah Bani (Serang), Lina Wati (Bogor), Dewi bt Wawan (Cirebon), Tati Sabtibi (Purwakarta), dan Kureni bt Kasmita Caska (Indramayu). (dtc/int)

Malaysia Sediakan SMS untuk Pesan PRT KUALA LUMPUR- Kementerian Tenaga Kerja mengatakan sekitar 7.000 calon siap diberangkatkan ke Malaysia. Persatuan Agen Pembantu Rumah Tangga Asing (PAPA) Malaysia membentuk nomor telepon khusus dan SMS untuk memesan pembantu rumah tangga asal Indonesia. Penjabat Presiden PAPA Jeffrey Foo mengatakan layanan khusus yang dibuka Selasa (28/ 2) ini sudah menjaring 600 telepon dan SMS dalam waktu tiga jam. ”SMS ditujukan untuk mendaftar majikan yang ingin mengambil pekerja domestik dari Indonesia. Setelah itu kita akan beritahu ke pemerintah Malaysia yang selanjutnya memberitahu pemerintah Indonesia,” kata Jeffrey kepada BBC Indonesia. ”Responnya bagus sekali, dalam tiga jam sudah ada 600 orang mendaftar, dalam satu minggu, kemungkinan ada 10.000,” tambah Jeffrey. Indonesia dan Malaysia tahun lalu menyepakati pencabutan moratorium pengerahan pembantu rumah tangga asal Indonesia. Moratorium diterapkan tahun 2009 menyusul sejumlah kasus penyiksaan terhadap pembantu rumah tangga asal Indonesia. Kelompok pertama tenaga kerja yang akan dikerahkan ke Malaysia akan diberangkatkan bulan Maret, menurut humas Kementerian Tenaga Kerja dan Transmigrasi, Suhartono. (dtc/int)

„ Anas Urbaningrum memberikan keterangan pers terkait kasus kasus suap wisma atlet yang menyeret namanya.

Anas Bakal Dipanggil KPK untuk Kasus Hambalang JAKARTA- KPK menegaskan jika kasus proyek Hambalang masih berada dalam proses penyelidikan. Ketua Umum Partai Demokrat, Anas Urbaningrum, kemungkinan menjadi salah seorang yang akan diminta keterangannya dalam kasus tersebut. ”Kemungkinan Anas juga nanti akan dimintai keterangan dalam proses penyelidikan Hambalang. Tapi tepatnya

kapan saya belum dapat info,” kata juru bicara KPK, Johan Budi, di kantornya, Jl HR Rasuna Said, Jaksel, Selasa (28/2). Menurut Johan, pihaknya tidak berhenti dalam mencari adanya dugaan korupsi dalam perkara ini. Contohnya saja, ada dari pihak Kemenpora yang diperiksa Senin (27/ 2) kemarin. Johan menegaskan, kasus ini masih dalam tahap penyelidikan. Beberapa pihak sendiri masih terus dikejar keterangannya oleh KPK. Hal ini agak berbeda dengan apa yang disampaikan Ketua KPK, Abraham Samad. Abraham menyebut akan ada tersangka

baru kasus Hambalang. Apakah tersangka baru itu adalah ketua partai yang pernah disebutnya? ”Tunggu sajalah. Saya tunggu temanteman dulu. Saya kan mau menjaga soliditas pimpinan. Kekompakan,” kata Abraham saat ditanya wartawan apakah tersangka kasus Hambalang akan segera diumumkan dan mengarah ke ketua partai. Abraham sendiri memang sangat bersemangat mengungkap kasus ini hingga tuntas. Tapi dia menghormati pimpinan KPK lain yang lebih sabar dalam mengusut kasus hukum. (dtc/int)

Triliunan Dana Penyesuaian ke Daerah Dihapus JAKARTA - Undang-undang (UU) Nomor 33 Tahun 2004 tentang hubungan keuangan pemerintah pusat dan pemerintah daerah akan segera direvisi. Langkah revisi ini mengikuti revisi UU Nomor 32 Tahun 2004 tentang pemerintahan daerah, yang salah satu babnya mengatur hubungan keuangan pusat-daerah. Mendagri Gamawan Fauzi telah mengirim surat ke Menkumham Amir Syamsuddin agar dalam revisi UU Nomor 33 nantinya merujuk pada ketentuan RUU tentang pemda, sebagai revisi UU 32. “Mendagri berharap materi dan substansi yang akan diatur di RUU hubungan keuangan pemerintah pusat dan pemerintah daerah harus sejalan dengan konstruksi RUU pemda sebagai pengganti UU 32,” ujar Juru Bicara Kemendagri, Reydonnyzar Moenek. Di pasal 161 ayat (2) RUU pemda, disebutkan bahwa hubungan keuangan dalam

penyelenggaraan urusan pemerintahan yang diserahkan kepada pemda meliputi empat poin, yakni, pertama, pemberian sumber pendapatan asli daerah berasal dari pemungutan pajak daerah, retribusi daerah, hasil pengelolaan kekayaan daerah yang dipisahkan dan lain-lain pendapatan asli daerah yang sah. Kedua, pemberian dana bersumber dari perimbangan keuangan antara pemerintah pusat dan pemerintah daerah. Ketiga, pemberian dana penyelenggaraan otonomi khusus untuk pemda tertentu yang ditetapkan dalam undang-undang. Keempat, pemberian pinjaman dan/atau hibah, dana darurat, insentif (fiskal). Dari ketentuan pasal 161 itu terlihat jelas bahwa jika materi di RUU itu nantinya disetujui DPR dan diakomodir di dalam UU perimbangan keuangan yang baru (pengganti UU 33/2004), maka tidak ada lagi yang

namanya “Dana Penyesuaian”. Seperti diketahui, selama ini dana transfer ke daerah terdiri dari Dana Bagi Hasil (DBH), Dana Alokasi Umum (DAU), Dana Alokasi Khusus (DAK), dana otsus, dan dana penyesuaian. Dana Penyesuaian inilah yang selama ini sistem distribusinya ditentukan dengan kriteria-kriteria yang tidak jelas dan berbau politik. Seknas Forum Indonesia untuk Transparansi Anggaran (Fitra), Yuna Farhan pernah menyebut, dana penyesuaian untuk pembangunan infrastruktur daerah, membuka peluang bagi mafia anggaran di DPR. Salah seorang anggota DPR Wa Ode Nurhayati jadi tersangka perkara penyaluran dana penyesuaian ini oleh KPK. Data yang didapat koran ini, dana penyesuaian untuk 2011 sebesar Rp48,235 triliun. Sedang untuk 2012 jumlahnya mencapai Rp57 triliun. (sam/jpnn)

Jumat, Nunun Jalani Sidang Perdana JAKARTA- Dalam hitungan hari, Nunun Nurbaeti, bakal duduk sebagai pesakitan di kursi terdakwa. Jumat (2/3) pekan ini, Nunun bakal menjalani sidang perdananya. ”Jadwalnya hari Jumat,” kata hakim Sujatmiko di Pengadilan Tipikor, Jakarta Selatan, Senin (27/2) malam. Jubir PN Jakpus ini bakal menjadi ketua majelis perkara Nunun. Hakim anggotanya adalah Eka Budi Prijanta, Sofialdi, Anwar dan Ugo. Jaksa yang akan mendakwakan Nunun akan diketuai oleh M Rum. Sidang sendiri direncanakan dimulai pukul 09.00 WIB. Pengacara Nunun, Ina Rachman, mengatakan, Nunun mengidap kelainan jantung bawaan lahir. Selain itu, saluran untuk bernafas juga mengalami hambatan. ”Hasil pemeriksaan tadi, ibu memiliki kelainan jantung bawaan lahir dan dorongan untuk nafas terhambat,” kata Ina.. Karena kondisinya tidak stabil, Nunun tidak bisa memberikan pernyataan saat pemeriksaan siang tadi. “Mohon maaf tidak dapat memberikan statement karena kondisi ibu sangat tidak stabil,” imbuhnya.

„ Nunun Nurbaeti Nunun pada pukul 11.00 WIB tadi mendatangi RS Harapan Kita Jakarta. Istri dari politisi PKS, Adang Dorodjatun, itu bera-

da di rumah sakit selama satu jam. Namun Nunun tidak bisa menemui wartawan dan memilih lewat pintu samping. (kmc/int)

Angie Siap ‘Diadu’ dengan Rosa JAKARTA- Angelina Sondakh dan Mindo Rosalina Manulang akan dikonfrontir dalam persidangan Nazaruddin. Tak mau kalah dengan Rosa, Angelina Sondakh pun siap hadir untuk bersaksi. Mantan putri Indonesia 2001 yang akrab disapa Angie ini akan menenuhi undangan pengadilan. ”Insya Allah Angie akan hadir sesuai jadwal persidangan sebagai saksi,” jelas pengurus Divisi Komunikasi Publik DPP Partai Demokrat (PD) Kahfi Siregar saat dikonfirmasi, Selasa (28/2). Lebih lanjut Kahfi tidak mau berkomentar. Sahabat dekat Angie ini meminta agar melihat saja persidangan yang akan digelar besok. Angie rencananya akan dihadirkan bersama dengan Rosa pada Rabu (29/2) pukul 08.00 WIB. Keterangan keduanya untuk mencocokan sejumlah informasi di persidangan. Misalnya saja soal percakapan BlackBerry Messenger (BBM). Dalam percakapan BBM pada 2010 lalu, seperti yang dokumen di persidangan terungkap kata-kata ‘Bos Besar’, ‘Ketua Besar’, ‘Apel Malang’, dan ‘Apel Washington’. Percakapan BBM terkait Wisma Atlet ini sudah diakui Rosa, namun Angie membantahnya. Angie mengaku baru memiliki BlackBerry pada akhir 2010. (dtc/int)

SBY Ingin Jajaran Elite Demokrat Dirombak Total

„ Susilo Bambang Yudhoyono

JAKARTA- Dugaan keterlibatan sejumlah elite Partai Demokrat pada kasus korupsi membuat Ketua Dewan Pembina Partai Demokrat Susilo Bambang Yudhoyono gerah. Yudhoyono yang juga Presiden RI menghendaki reshuffle jajaran elite Fraksi PD, termasuk ketua fraksi yang saat ini dijabat oleh Jafar Hafsah. Perombakan susunan pengurus partai berlambang segitiga biru ini

diharapkan dapat membawa perbaikan internal. Soal informasi para pengganti kader-kader yang terkena reshuffle, saat ini masih menjadi teka-teki. Anggota Fraksi Partai Demokrat di DPR, Soetan Bhatugana, yang mengungkapkan niat SBY terkait perombakan susunan pengurus, enggan berkomentar. “Berbahagialah orang-orang yang dipromosikan, karena mereka itu orang-orang yang

berprestasi dan bersih. Pak SBY menginginkan pembersihan total,” kata Soetan kepada para wartawan sebelum mengikuti Rapat Paripurna DPR di Kompleks Parlemen, Jakarta, Selasa (28/2). Ditambahkan, seluruh kader partai pemenang Pemilu 2009 ini juga akan terkena rotasi. Terkait pengganti pucuk pimpinan Fraksi PD yang beranggotakan 149 orang ini, menurut Soetan, calon akan diajukan oleh Ketua Umum Anas

Urbaningrum, dan disetujui oleh SBY. Pada kesempatan itu, Soetan kembali mengimbau para kader yang hendak mengungkapkan adanya pelanggaran kode etik partai segera melapor ke Komisi Pengawas. Para kader jangan membongkar aib ke publik. “Demokrat ingin ke dalam solid, ke luar bangkit. Jangan ke dalam sakit, ke luar sulit,” kekeh Soetan. (kmc/int)



29 FEBRUARI 2012


Cyrus TV Pad 3G Wifi Dibandrol Rp2,888 juta MKN Perluas Pasar di Indonesia (FOTO IST)

BlackBerry-BlackBerry terbaru dengan tablet PlayBook yang diharapkan bersaing dengan Apple iPad dan Samsung Galaxy Tab.

Blackberry Siap Perang di Pasar Eropa JAKARTA-Blackberry siap bertarung di pasar Eropa. Vendor smartphone dan tablet asal Kanada ini mengaku telah menyiapkan sistem operasi baru. “Sistem operasi terbaru untuk BlackBerry sudah siap bersaing di pasar Eropa,” kata Kepala Eksekutif Thorsten Heins kepada 2.000 pengembang. Perusahaan yang bermarkas di Kanada itu telah kehilangan pangsa pasar dan nilai pasar setelah kalah bersaing dengan Apple, Google dan Samsung. RIM belum meluncurkan perangkat berbasis sistem operasi terbaru QNX untuk memperbaiki citranya setelah keterlambatan peluncuran tahun lalu, kegagalan tablet PlayBook dan kegelisahan pemegang saham. “Pasar ponsel pintar masih baru yang memiliki peluang besar bagi kita, konsumen dan pebisnis,” kata Heins. Heins yang menjabat CEO pada 23 Januari pasca-pengunduran diri duo pendiri dan mantan CEO RIM, menjanjikan penjualan yang siginikan pada akhir tahun ini dan menjadi paradigma baru pengguna ketika menggunakannya di rumah, mobil, tablet dan pon’sel pintar.RIM menggelar pertemuan pertama pengembang di Eropa dengan

2.000 peserta yang fokus membuat aplikasi untuk BlackBerry terbaru dan tablet PlayBook. RIM berharap perangkat terbarunya itu dapat bersaing dengan Apple iPad dan Samsung Galaxy Tab. “RIM membutuhkan waktu untuk pindah sepenuhnya ke sistem operasi QNX. Jika perangkat RIM itu sudah siap, perangkat itu akan memberikan pengalaman menarik, platform teknis yang kuat dan lebih baik kepada konsumen selama dekade ke depan, “kata Kevin Michaluk, Pendiri laman dan peserta konferensi. “Apple iOS berkembang dengan baik, tetapi sebenarnya iOS adalah sistem operasi mobile yang paling tua, lebih tua dari Android, WebOS, Windows Phone sedangkan BlackBerry OS.10 adalah platform mobile terbaru,” katanya. Heins mengutip laporan pasar GfK yang menyebutkan BlackBerry masih nomor wahid di Inggris, Spanyol, Arab Saudi, Uni Emirat Arab, Kuwait, dan Belanda. Ada dua miliar aplikasi BlackBerry yang diunduh di App World dan Enam juta aplikasi BlackBerry yang diunduh RIM setiap harinya. (int/mer)

Mudahnya Berita Palsu Beredar Lewat Twitter Ungkapan “Think Before You Tweet” tampaknya memang harus diterapkan oleh pengguna Twitter. Tweet yang berisi gurauan sekalipun, jika ditanggapi serius oleh pengguna Twitter lainnya, akan berakibat fatal, terutama jika menyangkut berita kematian seseorang.Seorang pengguna Twitter bernama Michael Robert Meras dengan akun Twitter @PwedeMerasMuna menuliskan “berita palsu” soal kematian Rowan

Sebastian Atkinson (yang biasa dikenal sebagai Mister Bean) kemrin. Hanya selang beberapa jam setelah tweet tersebut di-posting, pengguna Twitter yang lain pun melakukan re-tweet dan membuat hashtag #RIP Rowan Atkinson yang kemudian menjadi trending topic dunia. Parahnya lagi, halaman Wikipedia Rowan Atkinson juga langsung di-update dengan tanggal kematiannya, yakni 26 Februari 2012. (int/mer)

LG Usung Baru untuk Optimus JAKARTA-LG Electronics (LG) mengubah logo untuk Optimus. Optimus adalah nama ponsel yang LG menggunakan sistem operasi Android. Logo optimus terdiri dari dua elemen utama, yakni LG dan Optimus. Menggunakan warna abu-abu, warna resmi logo korporat LG. Sedangkan optimus menggunakan warna merah yang juga menjadi warga korporat LG. Logo ini telah dirilis dua tahun lalu. Tahun ini dengan lebih mengedepankan aspek modern dan seamless simplicity, LG melakukan perubahan pada elemen optimus. Warna merah pada Optimus diganti dengan

warna abu-abu. Melalui logo itu LG berharap mampu menghadirkan produk berkualitas tinggi, memiliki desain yang prestisius, serta mampu merefleksikan teknologi yang mengedepankan esetika dan keindahan. Logi baru akan diperkenalkan di ajang Wobile World Congres 2012. (int/ mer)

DENPASAR-Telkomsel bersama Mitra Komunikasi Nusantara (MKN) menghadirkan “Cyrus TV Pad 3G Wi-Fi” dalam bentuk komputer tablet berbasis Android yang dilengkapi televisi. Perangkat komputer pertama di Indonesia itu dijual seharga Rp2,888 juta. Pelanggan dapat menikmati TelkomselFlash berkecepatan tinggi yang dipadukan dengan fungsi TV Pad secara gratis selama tiga bulan. Head of Sales & Customer Care Telkomsel Regional BaliNusra Syaiful Bachri dalam penjelasan bersama Direktur Pengembangan Bisnis MKN Redi Sopyadi, di Mal Bali Galeria, Kuta, mengatakan, pihaknya menargetkan penjualan satu juta paket tersebut. Paket tersebut dapat diperoleh selama pameran berlangsung pada 27 Februari hingga 4 Maret 2012 di GraPARI Jalan Diponegoro, Denpasar, dan GraPARI Mal Bali Galeria, Kuta. “Di samping gratis layanan TelkomselFLash selama tiga bulan, pelanggan juga

berkesempatan mendapatkan uang kembali senilai Rp500.000 dari harga normal dan bonus eksklusif senilai Rp150.000,” ujar Ari, sapaan akrab Syaiful Bachri. Pada pameran penjualan tersebut, Telkomsel dan MKN juga menyediakan paket bundling Cyrus One 3G Wi-Fi yang merupakan ponsel berbasis Android dengan layar selebar 4,3 inci. Paket seharga Rp2.299.000 itu juga terdapat akses gratis internet TelkomselFlash selama tujuh hari dan tiga bulan, apabila konsumen melakukan isi ulang pulsa sebesar Rp50.000 setiap bulannya. Menurut Redi Sopyadi, pelanggan yang membeli paket Cyrus One 3G Wi-Fi pada pameran penjualan di GraPARI Mal Bali Galeria juga memperoleh potongan harga spesial hingga Rp1,999 juta.


TELKOMSEL-Telkomsel bersama Mitra MKN menghadirkan “Cyrus TV Pad 3G Wi-Fi” dalam bentuk komputer tablet berbasis Android yang dilengkapi televisi dengan harga Rp2,888 juta. Untuk registrasi paket TelkomselFlash, pelanggan cukup mengirimkan SMS dengan cara ketik: ULREG100, lalu kirim ke 3636. Paket itu berlaku untuk satu kali pembelian dan tidak otomatis diperpanjang. Komputer tablet Cyrus TV Pad 3G Wi-Fi yang memiliki

layar “capacitive multitouch” 7 inci menggunakan sistem operasi Android 2.3 Gingerbread. Di dalamnya dilengkapi fitur televisi analog-digital yang dapat menangkap tayangan saluran televisi lokal maupun global, menikmati musik, dan memaksimalkan fungsi kamera beresolusi 5

megapiksel. Komputer tablet itu juga dapat digunakan untuk telepon, mengirim SMS, “portable hotspot” hingga lima pengguna, dan internet, selain fitur GPS (Global Positioning System) yang terhubung dengan navigasi berbasis satelit. (int/mer)

Bahan Keramik untuk “Casing” Samsung Galaxy S III

Hyundai Indonesia Siapkan New Santa Fe Sukses meraih angka penjualan sebesar 4.786 unit di tahun 2011, PT Hyundai Mobil Indonesia (HMI) kini tengah mempersiapkan produk terbarunya, New Santa Fe untuk mengisi segmen Sport Utility Vehicle (SUV) premium di tanah air. Sebelumnya desas-desus mengenai kehadiran Hyundai New Santa Fe memang santer dihembuskan. Kini, setelah dikonfirmasi kabar tersebut ternyata bukan isapan jempol semata. New Santa Fe khusus disiapkan untuk bertarung di Indonesia. Varian anyar ini bahkan belum dirilis secara resmi di pasar global maupun di

negara asalnya, Korea Selatan. Sedangkan untuk waktu peluncuran New Santa Fe di Indonesia sendiri masih belum bisa diprediksikan. Vice President Director HMI, Mukiat Sutikno menjelaskan, bahwa dari gambar spy shot yang ditampilkan, terlihat jelas perbedaan desain antara generasi saat ini dan versi 2013 nya. Dari luar kesan tajam dengan pakem ‘fluidic sculpture’ khas Hyudai terasa kental. Tampilan ini menggusur kesan membulat yang lebih menonjol di varian saat ini. “Sementara baru foto spy shot nya dulu yang kami tampilkan, karena mobil ini

belum resmi meluncur. Detail spesifikasi yang terdapat pada prinsipalnya di Korea Selatan sendiri masih bersifat confidential atau rahasia,” ujarnya. New Santa Fe akan dibekali mesin berkapasitas 2.4 liter DOHC Theta II. Mesin empat silinder ini sanggup menghasilkan tenaga sebesar 175 hp yang dikawinkan dengan sistem transmisi 6speed manual. Selain itu terdapat pula Santa Fe SE yang hadir lewat pilihan engine 3.5 liter DOHC Lambda II V6 yang sanggup menyalurkan daya sebesar 276 tenaga kuda melalui transmisi 6-speed Shiftronic. (int/mer)

Setelah batal bakal Galaxy S III ini tidak akan diluncurkan pada lebih besar dari Galaxy Mobile World Nexus dengan rentang Congress (MWC) di 4,65 inci. Karena Galaxy S pekan ini, Samsung III dirumorkan tidak akan Electronics memakai bezel di sisi dikabarkan bakal depan ponselnya. Selain menyiapkan itu, Samsung juga peluncuraan Samsung memberi kemajuan bagi Galaxy S III di 50 negara ponsel pintar termutaksecara bersamaan. hirnya dengan mengguKendati demikian, nakan keramik di Samsung belum keseluruhan belakang mengumumkan waktu ponsel, bukan plastik peluncuran secara glossy seperti biasanya. bersamaan tersebut. Tentunya yang dimaksud Kabar sebelumnya keramik di sini bukan menyebutkan Galaxy S III seperti keramik lantai yang bakal diumumkan pada mudah pecah. Mei 2012. Waktu tersebut Samsung akan menggudipilih karena memberi nakan jenis keramik kesempatan bagi khusus dengan Samsung Galaxy S II agar bisa terjual lebih banyak. Itu soal waktu peluncuran. Sekarang rumor mengenai desain ponselnya sendiri. Galaxy S III bakal (FOTO IST) memiliki bodi CASING-Bahan Keramik untuk “Caslebih tipis, ing” Samsung Galaxy S III. bahkan dibanding iPhone 4S, dan bakal karakteristik nyaman memiliki layar super besar dipegang, tahan lama, dan yaitu 4,8 inci. Namun, pihak ramah lingkungan. Samsung belum Penggunaan keramik, membocorkan tipe layar bukan aluminium, tersebut, meski ada rumor sepertinya dilakukan bakal memakai jenis layar Samsung demi menghinSuper AMOLED Plus HD. dari gugatan dari Apple Meski bakal memiliki soal bahan casing ponsel. layar besar, dimensi (int/mer)

Yamaha Indonesia Siapkan Model Sport 250cc? Yamaha Motor Company berhasrat meramaikan persaingan antara Honda CBR250R dengan Bajaj Pulsar 200 NS di segmen sport di India. Amunisi sudah dipersiapkan merek garputala dan rencananya diluncurkan tahun depan (2013), meski belum dibocorkan sosoknya. Roy Kurian, Kepala Bisnis Nasional Yamaha India mengatakan, observasi pasar sepeda motor segmen 250 cc terus dilakukan Yamaha. Produsen Jepang ini juga memutuskan untuk merakit model baru secara lokal di India. Alasannya, agar lebih kompetitif karena tak perlu membayar pajak bea masuk. “Pasar sepeda motor 250 cc memang terus tumbuh. Ada sepasang produk yang mengisi segmen ini dan banyak

konsumen yang meningkatkan tunggangannya ke sepeda motor 250 cc. Kami akan menggunakan 100 persen komponen lokal untuk memproduksi produk itu, di sini (India),” komentar Kurian kemarin Dari survei yang dilakukan Yamaha, lanjut Kurian, ternyata tak semua konsumen puas dengan sepeda motor 250 cc yang ada di pasar sekarang ini. Jadi, masih ada ceruk pasar yang kosong dan Yamaha membidik segmen itu. Indonesia Berita dari India ini seperti sebuah indikasi positif bagi perkembangan produk sport Yamaha di Indonesia. Mungkin tak ada hubungan langsung dengan India, tapi Eko Prabowo, General Manager Promotion and Communica-

tions PT Yamaha Indonesia Motor Manufacturing (YIMM) membocorkan rencana Yamaha Indonesia ke depan. “Saya tidak bohong. Yamaha Indonesia tak punya rencana memproduksi atau memasarkan R15 (Ver 2.0) ke Indonesia. Kami punya rencana lain, sesuatu yang lebih besar,” tegas Eko di Bandung, akhir pekan lalu. Dikatakannya, dari segi bentuk dan desain R15 Ver 2.0 memang banyak digemari oleh calon konsumen di Indonesia. “Tapi, buat apa kita memasarkan produk yang pasarnya kecil, mending kami cari produk lain yang bisa melampaui penjualan produk itu (R 15 Ver 2.0),” lanjut Eko. Dari ucapan Eko, jelas tersirat bahwa Yamaha Indonesia menyiapkan produk sport lain di Indonesia. (int/mer)

Chik u Enggak Cemburu! Chikaa Jessica: Ak Aku CHIKA Jessica dikabarkan cemburu lantaran kekasihnya, Ade ‘Govinda’ memberikan lagu berjudul Tak Jodoh pada Prastiwi Dwiarti alias Tiwi ‘T2’. Apa kata Chika? “Enggak ada komentar,” jawab Chika dengan wajah datar, Selasa (28/2) siang. Ade ‘Govinda’ dengan Tiwi ‘T2’ memang sempat berpacaran sebelum menjadi kekasih Chika Jessica. Namun Ade memastikan, lagu

tersebut dibuat sebelum dirinya menjalin hubungan dengan Chika. “Itu kan lagu sudah lama direkam. Lagipula pemilihannya ditentukan label,” ujar Ade. “Aku enggak cemburu,” timpal Chika. Seolah tak ingin pilih kasih, Ade juga membuatkan sebuah lagu untuk dinyanyikan Chica. Sayangnya, Chika menolak. “Ini dia orang yang dibikinin lagu tapi menolak,” kata Ade. (nov/int)

Rabu, 29 Februari 2012

Nadia Vega IU Takut pada Senior

PENYAN YI Korea IU mengungkapkan perasaannya ketika pertama kali bertemu dengan dua seniornya, Lee Hyori dan Uhm Jung Hwa. Gadis imut ini pun mengungkap bahwa ia sempat takut dengan Lee Hyori. Hal ini terungkap kala IU menjadi bintang tamu dalam acara You & I yang dipandu Lee Hyori dan Jung Jae Hyung, baru-baru ini. Dalam acara tersebut, Lee Hyori mengungkap satu CD yang ia terima dari IU ketika menjalani debut. Di CD tersebut IU menulis, “Lee Hyori sunbaen im (panggilan untuk senior), aku penyany i baru, IU. Aku gembira karena bisa melihat penampilanmu. Aku akan berusaha lebih baik lagi mulai sekarang.” Ketika mendapatkan CD tersebut, Lee Hyori sedang dalam masa

promosi lagu Chitty Chitty Bang Bang. Wanita tersebut lantas bertanya kepada IU tentang bagaimana imej-nya di antara penyanyi junior. Ketika Lee Hyori setengah bercanda protes tentang dirinya yang terlihat menakutkan jika dibandingkan Uhm Jung Hwa, IU pun buru-buru berkata, “Aku rasa hal ini karena lagu-lagu milik Lee Hyori sunbae sangat karismatik, sementara lagu Uhm Jung Hwa sunbae adalah lagu yang membua t hati bahagia,” tutur IU. Mendengarnya Lee Hyori pun lantas berkomentar, “Yah aku tidak bisa berkata apa-apa karena IU terlalu cute. Aku akan berusaha menjadi senior yang lebih mudah didekati mulai saat ini.” (kpl/ int)

Selektif Cari Pacar PASCA putus cinta dengan kekasihnya, pria asal Australia, Nadia Vega lebih selektif cari pacar dan menjalin hubungannya. ”Memang pas aku balik ke sini, kami komitmen mau kerja. Aku ingin kerja jadi animator sesuai sama kuliah. Tetapi tahunya akting lagi, di depan layar lagi. Kalau untuk itu (cari pacar), ya lebih selektif aja,” terangnya di Planet Hollywood, Jakarta Selatan, Selasa (28/2). Pemeran film Keumala ini menuturkan sejak putus dari pria asal Austarlia tersbut,

artis cantik melankolis ini berusaha tak berkomunikasi lagi. ”Jadi pas putus memang sudah menjalani kehidupan kayak biasa saja. Aku berusaha untuk nggak (komunikasi). Jadinya santai saja,” urainya. Sejauh ini, Nadia mengaku sudah banyak teman pria yang berusaha mendekatinya, namun ia belum membuka hati. “Ada yang dekati, beberapa kali dekat. Tapi belum ada yang ‘klik’,” tuturnya. (idc/int)


19 Februari - 20 Maret Tidak ada salahnya Anda menerima saran dari siapa pun selama itu membangun semangat hidup Anda. Ikuti saja walaupun ada kritikan. Buktikan bahwa Anda jauh lebih baik daripada apa yang mereka katakan. Tetaplah fokus pada apa yang Anda kerjakan.

HASIL voting terakhir untuk para pemenang Shorty Awards 2012 telah dirilis. Penyanyi asal Indonesia Agnes Monica terpilih sebagai Best Singer di ajang tersebut. Agnes menjadi nomor satu dengan jumlah voting sebanyak 8.414 suara di kategori tersebut. Disusul Justin Bieber dengan 6.640 suara. Penyanyi belia Greyson Chance dan Joe Jonas berada di urutan selanjutnya. Agnes juga ikut mendapat banyak suara dalam kategori Celebrity Shorty Awards. Namun ternyata Kim Jae Joong personel boyband asal Korea Selatan JYJ lebih berjaya. Dalam kategori tersebut, Agnes hanya berhasil duduk di peringkat ke-10. Dalam Music Shorty Awards Agnes juga ikut serta. Ia duduk di peringkat ke-5. Posisi pertama dan kedua ditempati oleh Demi Lovato dan Miley Cyrus. Shorty Awards alias Shorties adalah penghargaan untuk orang atau perusahaan yang eksis di Twitter. Penghargaan ini pertama kali digelar pada 2009. (dtc/int)


(20 Januari - 18 Februari)

Berikan perhatian kepada orang yang memang Anda sayangi. Jangan sampai Anda menyesal nantinya. Beranikan diri Anda untuk mengambil keputusan dan mencari mana yang menjadi prioritas dalam hidup Anda.

KESERIUSAN hubungan asmara antara Olga Syahputra dan Jessica Iskandar semakin kentara, setelah keduanya mengaku bersama-sama bertemu dengan orang tua Jessica. “Kemarin saja bapaknya Jessica waktu di mall mau ketemu sama Olga. Olga serius, kalau dianya serius,” ungkap Olga Syahputra saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Selasa (28/2). Namun Jessica menegaskan kalau hubungan mereka sementara waktu hanya pacaran. Saling menjajaki dan mencoba mengenal satu sama lain, belum akan memikirkan rencana menikah. Keinginan Olga untuk segera menikah, sementara waktu ditang guhkan terlebih dulu.

“Pacaran dulu....Biar Kak Olga saja yang ngomong, kan dia cowoknya. Maunya pacaran dulu, sampai siap, baru boleh ngelamar,” ungkap Jessica tersenyum. Hal ini sekaligus menjawab hubungan Olga dan

(23 September - 22 Oktober)

Carilah rezeki dari segala. Kalau ada celah lain yang sudah tertutup, carilah pada celah yang lain. Hal ini membuat Anda dan teman Anda merasa nyaman menjalani hidup.

Scorpio Jessica yang konon sekedar gosip belaka. Mereka mengaku serius dan jika berjodoh akan menuju jenjang pernikahan. (kpl/int)

(23 Oktober - 22 November)

Berikan perhatian kepada orang yang memang Anda sayangi. Jangan sampai Anda menyesal nantinya. Beranikan diri Anda untuk mengambil keputusan dan mencari mana yang menjadi prioritas dalam hidup Anda.


(23 Agustus-22 September)

Jangan bosan mencari hal baru yang bisa membuat diri Anda bisa lebih berkembang. Agar rezeki Anda semakin bertambah, Anda harus bekerja keras dan mengembangkan kreativitas Anda lebih tinggi lagi.


(21 Desember -19 Januari)

Perhitungkan kembali semua bisnis Anda. Apabila Anda salah, tidak hanya kerugian saja yang akan Anda alami, tetapi juga semua jaringan Anda akan tertutup. Ini akan menghambat perjalanan Anda.


( 23 November - 20 Desember)

Perhatikan apa yang Anda kerjakan dan lakukan. Jangan mencampuradukan urusan pribadi dengan urusan pekerjaan. Anda juga harus memperhatikan tim Anda. Jangan sampai tim yang sudah Anda bangun itu menjadi kurang solid.

Tya Ariesta


Tak Laku Akting SETELAH namanya cukup dikenal di dunia akting, kini Tya Ariestya mulai merambah ke dunia tarik suara. Dengan singlenya yang berjudul Lagi-Lagi Kamu, Tya dan pasangan duetnya, Abdul & Coffee Theory berusaha menciptakan warna baru dalam dunia musik. Terkait keputusannya untuk merambah dunia musik, Tya pun menyangkal kabar yang menyebutkan bahwa usaha itu dilakukan karena dia mulai tidak laku di dunia akting. Sebaliknya, dia menjajal musik karena dia ingin mencoba hal baru yang belum pernah dia lakoni sebelumnya. “Ada yang bilang aji


mumpung dan enggak laku, memang banyak yang ngomong, tapi aku mau belajar sesuatu yang baru,” ungkapnya beberapa waktu lalu. Pada akhirnya semua proses yang dijalaninya di dunia musik membuat Tya merasa enjoy. Dia bahkan mengakui bahwa dia mulai ketagihan main musik. Dia pun telah membuat perjanjian dengan Abdul untuk membuatkan single duet lain yang memungkinkan Tya mengekplorasi kemampuan bernyanyi. “Ketagihan aku duet, aku bikin duet tapi gue yang nyanyi agak banyakan. Insya Allah, Abdul sudah janji,” lanjutnya. (kpl/int)

(21 Maret - 20 April)

Buka wawasan yang lebih luas untuk bisa membangun diri. Anda merasa nyaman di mana pun Anda berada dan dalam kondisi apa pun karena Anda sudah siap dengan segudang jalan keluar. Belajarlah dan teruslah belajar untuk bisa mengimbangi alur yang sudah ada dalam hidup Anda.


(21 April - 20 Mei)

Harus lebih sabar dan jangan mudah putus asa menghadapi segala kesulitan yang ada. Manfaatkan jaringan Anda dengan orang lain untuk membuka peluang baik bisnis dan untuk memperkuat lingkungan, sehingga Anda semakin kuat membangun diri Anda dan lebih sukses.


(21 Mei - 20 Juni)

Harus ada target dalam hidup. Apabila ada target, perjalanan Anda akan jauh lebih terarah. Kalau masalah muncul, Anda juga bisa dengan cepat mengatasinya. Fokuskan diri pada apa yang menjadi kebutuhan atau kemauan Anda.


(21 Juni- 20 Juli)

Jangan selalu menyalahkan orang lain tanpa mencari tahu mana yang benar dan mana yang salah. Buatlah orang lain merasa nyaman berkomunikasi dengan Anda. Dengan begitu, semua kesulitan yang muncul bisa diatasi. Peluang Anda pun terbuka lebar.


(21 Juli-21 Agustus)

Yakinlah bahwa kesuksesan akan datang menghampiri Anda dan membuat Anda bisa menjalani hidup lebih baik. Anda juga bisa mengatasi segala masalah yang ada baik, dalam diri Anda maupun keluarga Anda.

29 FEBRUARI 2012



“Eh, itu anak baru ya? K ok baru liat?” Kok “Mana? Ahk, iya bener bener.. Siapa dia?” “Wahh, kalian kebangetan, dia itu kan sekelas kita, yang duduknya di pojok sebelah kanan.” “Hee? Masa sih??”

SURVEI Teman-teman pernah ngalamin hal itu nggak sih? Berada di posisi orang yang tidak menyadari keberadaan orang lain, atau bahkan di posisi orang yang tidak tersadari keberadaannya? Hemmp.. Kali ini kita bakal ngebahas down to earth, wew…apa itu? Arti harafiahnya sih memang turun ke bumi. Tapi..., kalau ikut bahasa anak gaul sana, artinya tidak terdeteksi atau tidak kelihatan, dari kawan-kawannya. Hal ini memang sering terjadi kan? Kita seringkali tidak sadar kalau si X ada di kelas yang sama dengan kita, dan si Y ternyata ada di sebelah kita. Wow, auranya ngilang gitu. Kok bisa sih jadi orang yang down to earth? Pernah kepikiran ga sih sebenernya kita down to earth ato enggak? Nah, dari hasil polling tim Xpresi, sekitar 15 % mengaku down to earth. Lalu, 50 % dengan tegas bilang tidak. Sisanya, 35 % malah gak tau iya atau tidak. Mereka mengaku bukan orang yang down to earth, dengan alasan orang yang ceria, selalu up to date dan memiliki banyak teman. Ngaku down to earth, karena

Remaja Kesepian Tanpa Internet HAMPIR setengah dari keseluruhan anak usia 12 tahun mengaku sedih hidup tanpa internet. Tak hanya itu, saking bergantungnya, mereka mengaku menjadi kesepian tanpa internet. Hampir setengah dari semua anak di bawah usia 12 tahun mengaku akan menjadi sedih tanpa akses internet. Tak hanya itu, satu dari lima anak mengaku akan menjadi kesepian jika tak bisa mengakses internet. Fakta tersebut ditemukan setelah dilakukan jajak pendapat pada seribu anak di Inggris dengan usia antara delapan hingga 16 tahun. Dalam jajak pendapat itu, para anakanak ini ditanya mengenai dampak internet pada kehidupan mereka. Hasil dari jajak pendapat ini sendiri menunjukkan, anak-anak kini memiliki keterikatan emosional yang sangat kuat pada internet. Secara tak mengejutkan, keterikatan emosional ini menjadi makin kuat saat anak-anak ini menjadi remaja. Menurut data yang diperoleh, sebanyak 60% remaja di usia 12-16 tahun mengaku mereka akan merasa sedih tanpa sambungan web dan 48 % di antanya mengakui akan merasa kesepian. Remaja merupakan pengguna berat dari perangkat mobile dan anehnya, hasil jajak pendapat menemukan, anak usia dua tahun bahkan telah mendominasi iPad yang diperuntukkan keluarga.

Jajak pendapat yang disebut dengan proyek ‘Digital Futures’ ini dilakukan oleh Intersperience, sebuah perusahaan riset di Inggris. CEO Intersperience Paul Hudson mengatakan, “Fakta bahwa anak memiliki keterikatan emosional yang kuat pada internet sering dianggap sebagai hal yang negatif namun sebenarnya ini adalah hal wajar untuk generasi yang kehidupan sosialnya sebagian besar adalah online.” Ini sama seperti menjauhkan telepon dari orang tua yang akan merasa sedih dan kesepian. Hasil jajak pendapat ini juga menemukan, 74 % anak di bawah usia 12 tahun bermain game online. Tak hanya itu, terungkap 65% anak di usia tersebut diketahui menggunakan internet untuk mengerjakan pekerjaan rumah mereka. Lebih dari sepertiga anak online untuk mencari barang-barang yang akan dibeli atau dijual. Sementara anak-anak muda juga menggunakan web untuk melihat harga dari barang-barang fesyen. Hudson mengatakan, “Orang dewasa mungkin khawatir pada hubungan emosional yang kuat antara internet dan anak-anak ini namun hasil penelitian menunjukkan sebaliknya.” Anak-anak tak kehilangan seni percakapan dan mereka masih lebih suka untuk mengobrol dengan teman-teman mereka secara pribadi, tutupnya. (int)

POLLING Bagian down to earth? a. Ya (15 %) b. Tidak (50 %) c. Nggak tau (35 %) Arti down to earth? a. Tidak terdeteksi (25%) b. Biasa-biasa aja (25 %) c. Turun ke bumi (50 %)



Jangan Gunakan Sistem Kebut Semalam Lupa adalah sesuatu yang manusiawi dan wajar kita alami. Tetapi, kalau terus menerus lupa mengingat materi pelajaran? Wah, bisa repot juga. Ada banyak strategi yang bisa diterapkan. Yang jelas, jangan menggunakan strategi yang umumnya digunakan para pelajar: sistem kebut semalam! Nah, sepuluh tips berikut mungkin bisa membantu dalam meningkatkan daya ingat belajar. Sebagai informasi, beberapa strategi di bawah ini t e l a h diterapkan dalam

pendiam, dan sisanya sangat amat tidak mau tahu. Menurut mereka down to earth ato nggak, samasama nggak penting. So, whateverlah.. ;) Guys, tim Xpresi juga mau ngasih tahu nih. Sekitar 50 persen pada awalnya tidak tahu apa yang dimaksud dengan down to earth. Rata-rata pada ngerti arti harafiahnya aja, turun ke bumi. Hellow, siapa yang turun ke bumi? Bidadari dari kahyangan? Haha, bukan dong. Ada yang lucu nih, seperti yang disampaikan Vivi (16), down to earth, kata-kata yang membuat bulu kudukku naik, iihh ... serem deh, mereka kan mampu berinteraksi sama makhluk yang bisa ilang dan gaib gitu. Huahaha, lucu banget sih kamu, cenayang kali maksud kamu. But, it’s up to you deh. Lalu, 25 % menjawab benar, tidak terdeteksi. Lalu, 25 % lagi gak peduli. So, bagaimana dengan kalian? Ngerasa jadi orang yang down to earth nggak? Atau malah jadi orang tenar yang dikenal semua orang? Hemmp! Guys, kita hidup bertetangga, makhluk sosial, jadi harus pandaipandai bergaul, bersosialisasi dengan lingkungan sekitar kita. Turut berpartisipasi dalam semua kegiatan, bukannya malah ngumpet dan asik dengan duniamu sendiri. Nanti kamu bakalan dicap sombong, ndak punya teman, aneh dan julukan lainnya, dan yang paling parah nggak satupun yang menyadari keberadaanmu, sedih dong saat kamu terlupakan oleh yang lain, memangnya mau? Mempunyai banyak teman juga akan sangat membantu kita saat kita kesusahan, karna mereka tidak akan meninggalkan kita. Masih ngerasa jadi orang yang down to earth? Don’t worry, belum terlambat . Mulai sekarang, tersenyumlah pada semua orang, sapa mereka dengan ceria, buat mereka menyadari keberadaanmu, dan kamu akan segera menjadi orang yang paling ramah seantero sekolah, dan katakan, Bye bye down to earth.

literatur psikologi kognitif. Strategi ini menawarkan sejumlah cara yang bagus untuk meningkatkan daya ingat dan retensi informasi. Simak, yuk! 1. Fokuskan perhatian pada materi yang dipelajari Perhatian adalah salah satu komponen utama dari memori. Agar sebuah informasi pada ingatan A berpindah dari memori jangka pendek ke memori jangka panjang, ada cara yang bisa dilakukan. Apa itu? Cobalah untuk belajar di tempat yang bebas dari gangg u a n , seperti televisi, musik, atau hiburan lainnya. 2. Hindari belajar dengan sistem ‘kebut semalam’ Belajarlah secara t e r a t u r. Penelitian

menunjukkan bahwa dengan sistem belajar yang teratur akan membuat seseorang dapat mengingat materi pembelajaran lebih baik dan lebih panjang daripada mereka yang menggunakan sistem ‘kebut semalam’, dengan waktu yang sangat terbatas. 3. Susun dan atur setiap informasi Para peneliti menemukan bahwa setiap informasi telah diatur dalam memori dan sudah dikelompokkan. Gunakan memori itu untuk menata dan mengorganisasi materi yang dipelajari. Cobalah mengelompokkan bagan-bagan atau istilah-istilah secara bersamaan pada catatan. 4. Memanfaatkan perangkat mnemonik Perangkat mnemonik merupakan alat untuk membantu ingatan/ menghafal informasi. Perangkat ini juga menjadi teknik yang sering digunakan oleh siswa untuk membantu mengingat. Sebagai contoh, kamu mungkin mengasosiasikan istilah yang perlu diingat dengan benda yang akrab dengan kamu. Misalnya, dengan syair, lagu, atau lelucon tertentu. (int)

Mobil Wisata Jip Mini Bermesin Sepedamotor

Berbekal pengalaman praktik kerja para siswa SMKN 1 Kota Cirebon di Viar Motor Indonesia, muncul keinginan untuk merakit mobil. Bukan mobil biasa, melainkan mobil wisata berbentuk jip mini, tetapi bermesin sepeda motor. Menurut Koordinator Pengembangan Program Keahlian Kendaraan Ringan Otomotif SMKN 1 Kota Cirebon Edi Susianto, ide merakit mobil sebetulnya sudah ada empat tahun lalu. Namun, ide itu terkendala pertimbangan target pasar yang akan disasar. Akhirnya ide itu baru terwujud tahun ini setelah SMKN 1 Kota Cirebon membulatkan tekad menyasar tempat wisata. Alasannya sederhana, karena hanya akan digunakan di lokasi wisata, jip mini ini tidak membutuhkan surat izin seperti kendaraan lain yang beroperasi di jalan umum. Bekerja sama dengan perusahaan Viar Motor Indonesia, Edi yakin siswa mampu memproduksi mobil wisata secara massal. Saat membangun prototipe mobil wisata, bagian rangka dibuat siswa. Adapun bagian bodi, mesin, dan gardan dipasok

rekan industri. ”Membuat rangka lebih mudah karena memakai las biasa. Tinggal disambungsambung. Diharapkan lamalama kami bisa membuat sendiri semua bagian,” kata Edi. Meski bermesin motor, mobil wisata ini memakai konstruksi gardan mobil dengan seal di as roda sehingga lebih aman dan stabil. Dengan kapasitas silinder 150 cc dan kapasitas tangki bahan bakar 12,5 liter, penggunaan bahan bakarnya irit, yakni 1:20. Spesifikasi yang digunakan adalah tipe mesin 4 langkah OHC, water cooler (radiator) single cylinder vertical, gigi transmisi 5

kecepatan, dan aki berkekuatan 12 volt 9 Ah. Meski kecil, mobil ini kuat dan bisa melaju dengan kecepatan 60 kilometer per jam. Sebelum dipasarkan, kata Vinsentius Bambang Widjaja dari Viar Motor Indonesia, setiap unit harus menjalani uji kualitas dari industri. Untuk saat ini, prototipe mobil wisata masih menjalani proses penyempurnaan di bagian steering wheel dan suspensi agar lebih nyaman. ”Kita tak mau asal lepas karena membawa nama Viar,” katanya. Untuk membuat rangka dan merakit, hanya siswa kelas XI program keahlian otomotif yang (int) dilibatkan.(int)

Laga Tim Terbaik RABU

Baca Halaman 10

29 FEBRUARI 2012

Prakiraan Formasi:




Inggris (4-4-2): Joe Hart, Johnson, John Terry, Rio Ferdinand, Ashley Cole, Theo Walcott, Frank Lampard, Ashley Young, Bent, Crouch. Belanda (4-3-3): Stekelenburg, Boulahrouz, Heitinga, Mathijsen, van der Weil, Sneijder, Van Bommel, van der Vaart, Kuyt, Van Persie, Robben.

BURSA METRO International F riendlies Friendlies Serbia vs Armenia Bosnia vs Brazil Georgia vs Albania Kazakhstan vs Latvia Moldova vs Belarus Hungary vs Bulgaria Israel vs Ukraine Montenegro vs Iceland Luxembourg vs Macedonia Tunisia vs Peru Greece vs Belgium Malta vs Liechtenstein Romania vs Uruguay Turkey vs Slovakia Afsel vs Senegal Denmark vs Russia Morocco vs Burkina F Austria vs Finland Croatia vs Sweden Swiss vs Argentina Germany vs France Ireland vs Czech Rep Italy vs USA N.Ireland vs Norway Poland vs Portugal Slovenia vs Scotland Wales vs Costa Rica Spain vs Venezuela Ecuador vs Honduras Paraguay vs Panama Chile vs Ghana Mexico vs Colombia El Salvador vs Estonia England vs Netherlands

0 : 3/4 1 1/4 : 0 0 : 3/4 3/4 : 0 1/2 : 0 0 : 3/4 0:0 0:1 3/4 : 0 0 : 1/4 0 : 1/4 0 : 1/2 1/4 : 0 0 : 3/4 0 : 1/2 0 : 1/4 0 : 3/4 0 : 3/4 0 : 1/2 1/2 : 0 0 : 3/4 0 : 1/4 0:1 1/4 : 0 1/2 : 0 0 : 1/2 0 : 3/4 0 : 2 1/4 0 : 1 1/4 0 : 1 3/4 0 : 3/4 0 : 1/2 0 : 1/4 0:0

Serie A Team




K Nilai



































































Laga Inggris versusBelanda yang akan di gelar di stadion wembley (29/2) memang sekadar pertandingan persahabatan tapi atmosfernya dijamin hampir mirip laga di turnamen resmi, di mana pertandingan ini akan mempertaruhkan moral dan mental juara kedua tim. Makin mendekatnya hari H gelaran Piala Eropa 2012, membuat kedua tim dipastikan akan menurunkan komposisi pemain terbaiknya.


aat ini,baik Inggris maupun Belanda tinggal menyisakan tiga p e r t a n d i n g a n persahabatan lagi sebelum di mulainya Piala Eropa. Alhasil, laga kali ini juga bisa menjadi tolak ukur penampilan mereka di gelaran juni-juli mendatang. Belanda sebagi salah satu favorit juara di Piala Eropa 2012 datang dengan pasukan utamanya ke wembley. Bintang-bintang macam Wesley Sneijder, Robin van Persie, hingga Arjen Robben tampak menghiasi skuad besutan Bert van Marwiijk. Praktis, tidak ada pemain bintang De Oranje yang tertinggal. Belanda yang berada di Grup maut, Grup D bersama Denmark, Jerman, dan Portugal merasa perlu untuk melakukan Ujicoba dengan tim kelas satu sebelum laga sesungguhnya di gelar. Inggris adalah lawan yang tepat untuk mengasah kemampuan Van Pesie dkk. Kemenangan atas Inggris, di mata Van Marwijk, sangat penting untuk meningkatkan moral tim. Bagai-

Top Scorer Gol Nama 18 15 15


Antonio Di Natale German Denis Zlatan Ibrahimovic




K Nilai

M. City






M. United






T. Hotspur


















Newcastle United26 12










Norwich City


















Gol Nama


Robin Van Persie Wayne Rooney Demba Ba

Arsenal M. United Newcastle

La Liga Real Madrid 24






















Ath. Bilbao
























Atl. Madrid













Top Scorer Gol Nama 29 28 14

Cristiano Ronaldo Lionel Messi Gonzalo Higuaín

mana juga dapat mengalahkan tim sebesar dan sekuat Inggris akan menjadi Modal berharga dlam mengarungi kerasnya persaingan di Piala Eropa Polandia-Ukraina 2012. Sebenarnya Inggris juga memiliki tujuan yang hampir sama, artinya sebagai tolak ukur The Three Lions sebelum bertarung di medan pertempuran yang sebenarnya. Namun sayang tiga pekan sebelum laga dimulai, manajer timnas Inggris Fabio Capello mengundurkan diri. Kedua tim terakhir kali bertemu pada bulan Agustus 2009, pada laga persahabatan. Saat itu kedua tim bermain imbang 2-2 di Amsterdam. Tuan rumah sebenarnya unggul 2-0 lebih dulu melalui Dirk Kuyt dan Rafael van der Vaart. Namun dua gol dari Jermain Defoe menyelamatkan Inggris dari kekalahan. Dari empat pertemuan terakhir kedua tim, selalu berakhir imbang. Terakhir kali Belanda mengalahkan Inggris di kandang sendiri pada bulan Agustus 2001, dengan skor 20.

DA TA DAN FFAKT AKT A DAT AKTA Kedua tim terakhir kali bertemu pada bulan Agustus 2009, pada laga persahabatan. Saat itu kedua tim bermain imbang 2-2 di Amsterdam. Tuan rumah sebenarnya unggul 2-0 lebih dulu melalui Dirk Kuyt dan Rafael van der Vaart. Namun dua gol dari Jermain Defoe menyelamatkan Inggris dari kekalahan. Dari empat pertemuan terakhir kedua tim, selalu berakhir imbang. Terakhir kali Belanda mengalahkan Inggris di kandang sendiri pada bulan Agustus 2001, dengan skor 2-0. Inggris sementara dilatih oleh Stuart Pearce yang ditunjuk menggantikan Fabio Capello yang baru saja mengundurkan diri. Sebelumnya, Pearce adalah pelatih timnas Inggris U-21. Jelang laga melawan Belanda, Inggris malah mendapat kabar buruk dari Wayne Rooney, Tom Cleverley, dan Darren Bent. Ketiganya dipastikan absen karena mengalami cedera. Gareth Barry juga diragukan tampil karena masalah kebugaran.

5 pertandingan terakhir Inggris:

Van Marwijk Inggris sementara dilatih oleh Stuart Pearce yang ditunjuk menggantikan Fabio Capello yang baru saja mengundurkan diri. Sebelumnya, Pearce adalah pelatih timnas Inggris U-21. (ab/int)

16 Nov 2011 13 Nov 2011 8 Okt 2011 7 Sept 2011 3 Sept 2011

: Inggris 1-0 Swedia (persahabatan) : Inggris 1-0 Spanyol (persahabatan) : Montenegro 2-2 Inggris (Kualifikasi Euro 2012) : Inggris 1-0 Wales (Kualifikasi Euro 2012) : Bulgaria 0-3 Inggris (Kualifikasi Euro 2012)

5 pertandingan terakhir Belanda: 16 Nov 2011 12 Nov 2011 12 Okt 2011 8 Okt 2011 7 Sept 2011

: Jerman 3-0 Belanda (persahabatan) : Belanda 0-0 Swiss (persahabatan) : Swedia 3-2 Belanda (Kualifikasi Euro 2012) : Belanda 1-0 Moldova (Kualifikasi Euro 2012) : Finlandia 0-2 Belanda (Kualifikasi Euro 2012)

Head to Head 12 Agus 2009 (persahabatan) 15 Nov 2006 (persahabatan) 09 Feb 2005 (persahabatan) 13 Feb 2002 (persahabatan) 15 Agu 2001 (persahabatan)

Belanda 2-2 Inggris Belanda 1-1 Inggris Inggris 0-0 Belanda Belanda 1–1 Inggris Inggris 0–2 Belanda

Inggris Minus Pemain

Top Scorer 23 17 16

Kamis Pukul 03.00 WIB

Getaran Piala Eropa 2012 sudah semakin mendekat. Kami harus harus bisa mengoptimalkan semua pertandingan persahabatan yang tersisa,”

Udinese Atalanta Milan

Premier League Team

„ Van Persie

„ Stevie G

Klub Real Madrid Barcelona Real Madrid

„ Pertarungan Inggris vs Belanda, beberapa waktu lalu.

Ditinggal sejumlah pilarnya, timnas Inggris harus menjamu Belanda dalam kondisi timpang setelah beberapa pilarnya cedera dan dipastikan tidak bisa dimainkan. Kabar terakhir adalah striker Wayne Rooney, Tom Cleverley, dan Darren Bent absen karena cedera, selain Garreth Barry yang juga masih diragukan kondisinya. Empat langganan timnas sebelumnya, Rio Ferdinand, Frank Lampard, Joleon Lescott, dan Andy Carroll kali ini tidak dipanggil Pelatih Stuart Pearce ke timnas. Pemain lainnya yang tidak dipanggil karena masih cedera adalah Michael Carrick, Jermain Defoe, Peter Crouch, Aaron Lennon, dan John Terry. Pasca pencopotan ban kapten dari John Terry, Inggris hingga saat ini belum menunjuk kapten baru. Posisi kapten Inggris pada laga ini kemungkinan akan diisi antara Steven Gerrard, Gareth Barry, dan Scott Parker. Pearce memanggil dua pemain muda pada laga uji coba ini, yaitu Fraizer Campbell dan Tom Cleverley. Sementara bintang muda Arsenal Alex Oxlade Chamberlain sempat dipertimbangkan Pearce meski akhirnya tidak dipanggil. Adapun Pelatih Belanda Bert van Marwijk memanggil 3 pemain muda ke timnas, yaitu Ola John, Luciano Narsingh, d a n Adam Maher. L a g a melawan Inggris akan menjadi laga pertama me r e k a berkostum timnas senior. Tidak banyak kejutan dalam skuad Belanda saat ini. Bintangbintang seperti Arjen Robben, Wesley Sneijder, Dirk Kuyt, Rafael van der Vaart, Mark van Bommel, semuanya dipanggil. Hanya Ryan Babbel dan IBrahim Afellay yang tidak dipanggil karena masih cedera. (bc/int)

RABU 29 Februari 2012

„ Ketua STIKes Nauli Husada, Dra Mei Yati Simatupang.

Metro Tapanuli Society

„ Asisten II, Drs Juneidi Tanjung MPd.

„ Tokoh menyerupai Florence Night Angel memimpin barisan prosesi mahasiswa STIKes Nauli Husada Sibolga pada acara.



„ Direktur Sekolah Tinggi Ilmu Kesehatan (STIKes) Winda Nauli Husada Dra Mei Yati Simatupang SST MKes, staf pengajar foto bersama mahasiswa STIKes Prodi D III Kebidanan.

„ Direktur STIKes Winda Nauli Husada Dra Mei Yati Simatupang SST MKes, staf pengajar foto bersama mahasiswa STIKes Prodi D III Keperawatan.

Capping Day, Pintu Gerbang Mahasiswa Mengabdi ke Masyarakat

„ Direktur STIKes Winda Nauli Husada Dra Mei Yati Simatupang SST MKes dan undangan menyaksikan barisan prosesi.

„ Mahasiswa STIKes Nauli Husada menunggu penyematan Cup dan upacara angkat janji.

„ Mewakili Direktur RSU Sibolga, Mewakili Kadis Kesehatan Sibolga mengikuti acara Capping Day STIKes Nauli Husada Sibolga.

„ Mahasiswa STIKes NAuli Husada Prodi D III Keperawatan menunggu pengukuhan dan angkat janji.

„ Undangan dan orang tua para mahasiswa/i STIKes Nauli Husada mengikuti acara Capping Day.

„ Para mahasiswa STIKes Nauli Husada Prodi D III Kebidanan dan D III Keperawatan saat mengikuti acara Capping Day.

„ Undangan dari Dinas Kesehatan dan RSU Kota Sibolga mengikuti acara Capping Day STIKes Nauli Husada Sibolga.

„ Undangan dari DInas Kesehatan Tapteng dan RSU Pandan mengikuti acara Capping Day STIKes Nauli Husada Sibolga.

„ Paduan suara STIKes Nauli Husada menampilkan sejumlah lagu dalam acara Capping Day.

„ Salah seorang mahasiswi STIKes Nauli Husada disematkan cup dalam acara Capping Day.

„ Para mahasiswi STIKes menyalakan lilin melambangkan mahasiswa siap mengabdikan diri kepada maayarakat.

„ Barisan dosen saat bersiap meninggalkan lokasi penyematan cup dalam acara Capping Day STIKes Nauli Husada Sibolga.

„ Asisten II Pemko Sibolga, Drs Juneidi Tanjung MPd memberikan selamat kepada mahasiswa/i berprestasi.

„ Asisten II Pemko Sibolga, Drs Juneidi Tanjung MPd, Direktur STIKes Winda Nauli Husada Dra Mei Yati Simatupang SST MKes foto bersama.

„ Tokoh menyerupai Florence Night Angel memimpin barisan prosesi mahasiswa STIKes Nauli Husada Sibolga.

Teks dan Foto: Ridwan T Butarbutar STh. Lokasi dan Waktu: Gedung Nasional Kota Sibolga, Selasa 28 Februari 2012

Metrosiantar, 29 Februari 2012  

Koran Kebanggaan Orang Siantar Simalungun

Metrosiantar, 29 Februari 2012  

Koran Kebanggaan Orang Siantar Simalungun
