Page 1





Selasa, 18 September 2012

„ Sugiati


Kamsul: Saya Diperintah Sugiati



Edisi 149 „ Tahun X

Pengukuran Lahan Bandar Betsy Ricuh SIMALUNGUN- Sebanyak 135 warga yang hendak mengukur lahan di Bandar Betsy, Kecamatan Bandar Huluan, Simalungun bentrok dengan satpam PTPN III yang berjumlah 400 orang.

Walau tidak ada korban jiwa dalam kericuhan itu, namun kedua belah pihak sempat saling memaki ketika warga yang hendak mengukur lahan, dilarang satpam, Senin (17/9) pukul 11.00 WIB. Amatan METRO, saat ratusan warga tiba di

lokasi, satpam yang berjumlah 400 orang beserta beberapa pimpinan kebun tampak sudah berada di lokasi dan melarang warga yang ingin melakukan pengukuran lahan. „) Baca Pengukuran Lahan ...Hal 6

MEDAN- Sidang kasus perkara dugaan tindak pidana korupsi anggaran di Pemkab Simalungun dengan terdakwa mantan Bendahara Umum Daerah Sugiati kembali di gelar di Pengadilan Negeri (PN) Medan, Senin (17/9). Dalam persidangan tersebut, Jaksa Penuntut Umum (JPU) menghadirkan saksi Kamsul selaku mantan Staf Bendahara Umum Pemkab Simalungun. „) Baca Kamsul: ..Hal 7


RICUH- Warga dan satpam ricuh di lokasi lahan kosong di daerah Bandar Betsy, Senin (17/7).

Demo TPL, Massa Dihadang Kawat Berduri

PNS ‘Siluman’ Belum Diperiksa SIANTAR- Hingga saat ini, kasus PNS ‘siluman’ Pemko Siantar yang kini ditangani Polres Siantar, masih dalam proses penyelidikan. Sementara itu, belum ada yang dijadikan sebagai tersangka dalam kasus ini. Bahkan, dari 12 PNS ‘siluman’ ini belum ada yang diperiksa. Kapolres Siantar AKBP Alberd Sianipar Sik, Minggu (16/9) lewat pesan singkat kepada METRO menerangkan, soal penetapan tersangka PNS ‘siluman’masih menunggu „) Baca PNS ‘Siluman’ ...Hal 7

SIMALUNGUN- Demo ratusan masyarakat Kecamatan Dolok Panribuan, Kabupaten Simalungun, yang tergabung dalam forum masyarakat tolak Toba Pulp Lestari (TPL) FOTO:TONGGO SIBARANI

„ Masyarakat berunjuk rasa ke kantor TPL sektor Aek Nauli meminta TPL ditutup.


„ Polres Siantar melakukan razia rutin gabungan di pintu masuk ke Kota Siantar.

Antisipasi Teroris, Pintu Masuk Siantar Dirazia SIANTAR- Mengantisipasi masuknya teroris, Polresta Siantar melakukan razia gabungan di setiap pintu masuk ke Siantar. Razia dilakukan di Jalan Siantar-Parapat, Siantar Marimbun. Namun hingga Senin (17/9) pukul 15.15 WIB, beluma ditemukan indikasi masuknya teroris ke Siantar. „) Baca Antisipasi Teroris...Hal 6

SIANTAR- Posni Chandra Harianja (22) warga Bukit II Nagori Panombeian Hutaurung, Jorlang Hataran, dipukuli 14 pemuda di Dusun Sibunga-Bunga, Nagori Sibunga-Bunga, Jorlang Hataran, Sabtu (15/9) pukul 23.00 WIB. Mahasiswa Fakultas Pertanian Universitas Simalungun ini pun babak belur dan terpaksa dirawat di RS Horas Insani. Mahasiswa salah satu perguruan tinggi di Siantar ini yang ditemui di salah satu ruangan di RS Horas Insani, Senin (17/9) menyebutkan, Sabtu pukul 22.30 WIB, dia bersama sepupunya Rahadi Damanik (25) berniat hendak pulang ke rumahnya di Nagori Panombeian Hutaurung „) Baca Mahasiswa ...Hal 6

„) Baca Demo TPL...Hal 6

Real Madrid v Man City



di TPL sektor Aek Nauli, Senin (17/9), disambut kawat berduri dan puluhan satpam. Para pendemo yang mendapat pendampingan dari mahasiswa Sahabat Lingkungan (Saling) ini, nyaris terlibat bentrok dengan pihak TPL. Itu terjadi ketika demonstran mencoba merubuhkan blokade TPL yang terbuat dari kayu berlapis pagar berduri yang

The Real Galacticos FOTO:IMELDA PURBA

„ Guru-guru yang tergabung dalam Forum Guru Siantar (FGS) mendatangi kantor Kejaksaan Siantar, Senin (17/9).


FGS Datangi Kejaksaan SIANTAR– Forum Guru Siantar (FGS), mendatangi kantor Kejaksaan Negeri Siantar (Kejari), meminta agar seluruh pengaduan mereka ditanggapi dan segera ditindaklanjuti. Sebab limit waktu sejak mereka melaporkan berapa dugaan penyimpangan di Dinas Pendidikan Siantar (Disdik) tidak kunjung tuntas. Ketua FGS Hendri Tampubolon, Senin (17/ 9) mengatakan, kedatangan mereka ke kantor Kejari untuk mendesak agar kejaksaan segera „) Baca FGS Datangi ...Hal 6

REAL Madrid mempopulerkan istilah Los Galacticos, atau The Galaxy pada 2003 ketika David Beckham pindah ke Bernabeu dari Old Trafford. Lalu 2009 mereka mendesain lagi Los Galacticos edisi dua ketika sukses membayar Cristiano Ronaldo dari Old Trafford pula dengan budget Rp1,2 triliun. So, apa konstelasi istilah Los Galacticos dengan partai penyisihan Grup D Liga Champions kontra Manchester City ini? Los Galacticos arti sederhananya adalah galaksi. Ya, susunan bintang-bintang di angkasa. Diartikan ke sepak bola, Los Galacticos bisa diumpamakan kumpulan bintang-bintang nomor wahid yang didatangkan dalam satu klub. 2003 lalu, Real Madrid mengerikan skuadnya. Mulai David Beckham, Ronaldo, Luis Figo, Zidane, Raul Gonzales dan lainnya. „) Baca The Real ...Hal 7



18 September 2012

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777

3 Bulan TTunjangan unjangan Guru Non Sertifikasi Belum Cair FOTO: EKO HENDRIAWAN

„ Kios liar yang tidak ditertibkan Camat Bandar diduga milik pejabat.

PENERTIBAN KIOS di Perdagangan Tebang Pilih Jalankan Menimbulkan Kecemburuan Sosial Tindakan camat yang melakukan penertiban tidak merata bisa menimbulkan kecemburuan sosial sesama pedagang di kios liar. Tidak tertutup kemungkinan, sesama pedagang akan terjadi bentrok. Sebab mereka yang berjualan di sana kebanyakan menggantungkan hidupnya dengan berjualan. (mua)

Sesuai Aturan

Kalau camat melakukan penertiban seharusnya sesuai aturan yang berlaku. Jangan ada tebang pilih, dan takut menertibkan kios milik keluarga pejabat. Kasihan masyarakat selalu menjadi korban. (mua)

Eliana Septiani, Mahasiswi

Valenskia, Wiraswasta




Menerima Mahasiswa/i Baru T.A. 2012/2013 Program Study:

aw y Dr Luck

tu) 1 (sa


Pendaftaran: 1 Mei 2012 s/d 30 September 2012

ia imed Mult uter Komp Unit

Bagi Mahasiswa/i Baru TA. 2012/2013 Dapat Beasiswa dari Ketua Yayasan 25% uang Kuliah Setiap Tahun

Kami Ada Untuk Anda Senin-Jumat (08.00 s.d 17/00) Sabtu (08.00 s.d 14.00)


Jl. Asahan Komp. Megaland Blok A No.58-60 Telp. 0622 7070215 - 7553367 Pematangsiantar

Mutu dan Pelayanan Yang Utama & Unggul Kwalitas, Unggul Teknologi Ketua Yayasan dto


Direktur dto


SIMALUNGUN-Belasan kios liar di Jalan Rajamin Purba, Kelurahan Perdagangan, Kecamatan Bandar ditertibkan. Anehnya, penertiban yang dilakukan pihak Kecamatan itu tidak merata. Sebab keluarga pejabat yang berjualan di

sana tidak ikut ditertibkaan. Tetapi masyarakat yang tidak punya keluarga pejabat di sapu rata. Pedagang menilai Camat Bandar, Roganda Sihombing, AP, MSi tebang pilih menertibkan kios di sana. (mua/osi)

Kadis Pendidikan Siantar terhormat, kenapa sampai sekarang, 3 bulan tunjangan guru non sertifikasi belum dicairkan? Kalau dalam waktu dekat tidak juga direalisasikan, kami guru akan langsung melaporkannya ke Tipikor dan KPK. 081376297xxx

Jalinsum TTanah anah Jawa TTergenang ergenang Air

Camat Tanah Jawa terhormat, tolong diperbaiki saluran parit yang sumbat bahu jalinsum Tanah Jawa, akibatnya jalan tersebut tergenang air. Sudah 3 hari jalan tersebut tergenang air, tetapi belum juga diperbaiki. 082167562xxx

Lorong Baja Mati Air Kepala PDAM Tirtauli terhormat, air di Lorong Baja, Kecamatan Siantar Martoba setiap hari mati. Padahal kami rutin membayar retribusi pemakaian air. Rasanya sia-sia kami membayar uang air itu. 081264235xxx


18 September 2012

Koordinator Kontras Haris Azhar.

“Terus terang aja, saat ini hingga kedepannya nanti sedang berlangsung penguatan untuk rezim security. Indikasi paling kuatnya dengan terkesan dipaksakannya pengajuan RUU Kamnas ini masuk ke dalam pembahasan undangundang,”

“(Penyidik KPK dari TNI) Itu tidak benar. Kalau mau tentu harus melepaskan dulu militernya, kalau dia melepaskannya, siapa-siapa saja boleh,” Juru Bicara KPK, Johan Budi.

Menteri Keuangan Agus Martowardojo.

“Banyak pelanggar hukum yang tidak ketahuan. Sekarang kita yakinkan ke pengadilan bahwa mereka harus diproses. Jadi, tidak hanya cukup diproses di pengadilan saja. Harus diyakinkan bahwa pengadilan nanti memberikan hukuman mati kepada koruptor,”

Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter

Sikap Kami Penyidik Independen untuk KPK SINYALEMEN bahwa upaya pemberantasan korupsi di negeri ini penuh tantangan dan bagai jalan mendaki bukanlah isapan jempol. Penegak hukum tidak sekadar menghadapi risiko berat arus balik perlawanan para koruptor, tetapi juga harus menerima gangguan-gangguan sporadis yang datang dari berbagai penjuru. Salah satu gangguan itu ialah ditariknya 20 penyidik Polri dari institusi Komisi Pemberantasan Korupsi (KPK), pekan lalu. Penarikan penyidik Polri sebanyak itu merupakan peristiwa pertama kalinya sejak KPK berdiri. Penarikan sebelumnya memang pernah terjadi, tetapi jumlah yang ditarik paling banyak hanya tiga orang. Polri beralasan penarikan itu dilakukan karena masa kerja mereka sudah habis. Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal Boy Rafli Amar mengatakan kepolisian menyadari penarikan tersebut membuat komisi antikorupsi tersebut kekurangan sumber daya manusia. Terkait dengan hal itu, kepolisian mengaku siap memberikan pengganti. Bagi KPK, penarikan dalam jumlah besar tersebut jelas mengagetkan dan mengganggu. Mengagetkan karena beberapa penyidik yang ditarik itu baru bertugas satu tahun hingga dua tahun di KPK. Padahal, Peraturan Pemerintah Nomor 63 Tahun 2005 tentang Sistem Manajemen Manusia Sumber Daya KPK menyebutkan seorang penyidik Polri bisa bertugas di KPK selama empat tahun dan kontraknya bisa diperpanjang hingga empat tahun lagi. Itu artinya beberapa penyidik yang ditarik tersebut belum habis benar masa kerja mereka di KPK. Penarikan itu juga mengganggu karena dilakukan di tengah upaya gencar KPK menyidik kasus-kasus kakap seperti kasus Bank Century, Hambalang, dan Wisma Atlet. Juru bicara KPK Johan Budi memberikan gambaran bahwa satu penyidik di KPK bisa menangani tiga hingga empat kasus korupsi. Dengan hilangnya 20 penyidik, berarti nasib 80 kasus korupsi terancam terkatung-katung. Karena itulah, kita menyesalkan penarikan penyidik secara besar-besaran dari Polri itu. Penarikan itu menjelaskan kepada publik secara terang-benderang bahwa ada yang tidak mulus dalam koordinasi dua institusi penegak hukum tersebut. Namun, di sisi yang lain, penarikan 20 penyidik Polri dari KPK itu semakin menunjukkan KPK sangat membutuhkan penyidik milik sendiri, yang melekat secara organis di tubuh KPK. KPK tidak boleh bergantung pada penyidik dari kepolisian. Selain itu, KPK pun harus memiliki penyidik yang independen. Dengan memiliki penyidik independen, secara substantif penanganan perkara di KPK tidak bisa diintervensi pihak lain. Perang melawan korupsi memang bukan pekerjaan menyenangkan. Berkali-kali kita ingatkan dalam forum ini bahwa perang melawan korupsi butuh napas panjang, bahkan amat panjang karena ia merupakan perang tiada akhir. Karena itu, gangguan atas perang melawan korupsi itu mesti dipahami sebagai keniscayaan yang sudah diperhitungkan. Jadi, tidak ada alasan bagi KPK untuk menyerah hanya karena kehilangan sejumlah penyidik. (**)

Belajar dari Matsushita Beberapa hari yang lalu, ramai diberitakan oleh banyak media, di Jepang terjadi sebuah cerita yang mengenaskan yakni Menteri Jasa Keuangan, Tadahiro Matsushita, ditemukan tewas di kediamannya, di Tokyo, Jepang. Matsushita tewas diduga karena bunuh diri. Bunuh diri itu dilakukan dikarenakan dua hari sebuah tabloid di negeri Saudara Tua kita itu akan membongkar skandal Matsushita dengan seorang perempuan lain.


Jepang berbeda. Jepang memiliki budaya kesatriaan yang tinggi, tanggung jawab adalah nomer satu. Sedang di Indonesia tradisi seperti itu, yakni tegas dan tanpa toleransi bila melakukan kesalahan tidak terbangun. Perbedaan inilah yang membuat banyak pejabat berlindung di balik budaya Indonesia yang sangat toleransi kepada korupsi, kolusi, nepotisme, dan skandal sex. Hal demikianlah yang membuat banyak pejabat di Indonesia mengatakan bahwa mundur bukan budaya Indonesia. Bahkan ada yang mengatakan mundur sebuah bentuk tindakan yang tidak bertanggungjawab. Meski soal keyakinan kematian antara orang Jepang dan Indonesia ada persamaan, namun dalam penerapannya berbeda. Kalau keyakinan orang Jepang mati dengan bunuh diri untuk kehormatan diri, Kaisar, dan negaranya, itu syah dan wajib. Lain dengan keyakinan yang ada di tengah masyarakat kita. Keyakinan di tengah masyarakat, bunuh diri dilarang keras. Toh kalaupun rela mati untuk kepentingan yang lain, itu masih terjadi perdebatan boleh atau tidaknya. Hal inilah yang membuat mengapa bunuh jarang terjadi di tengah masyarakat. Di Indonesia orang bunuh diri karena mengalami gangguan jiwa. Tak ada budaya mundur inilah yang membuat pemerintahan berjalan tidak efektif. Orang yang sudah benarbenar tak mampu bekerja dan sering gagal masih saja bertahan memimpin sebuah lembaga, institusi, atau pemerintahan. Matsushita yang bunuh diri disebabkan media mau membongkar skandal sex-nya, sedang di Indonesia seorang pejabat yang dari hari ke hari, bahkan dari bulan ke bulan, sudah dikupas oleh koran, majalah, televisi, radio, dan media massa, akan tindak korupsinya, tetap saja bertahan sebagai pimpinan. Akibat dari tak mau mundur akibat kesalahan inilah yang membuat energi menjadi terkuras karena serangan dari kelompok oposisi dan masyarakat, akibatnya pemerintahan berjalan tidak efektif. Lain dengan di Jepang, mundur akibat kesalahan membuat pemerintahan menjadi efektif, sebab batu sandungan yakni pejabat yang melakukan kesalahan itu hilang, sehingga oposisi berhenti menyerang. (**)

Ardi Winangun

KEPERGIAN Matsushita selama-lamanya itu tentu berpengaruh terhadap pemerintahan eksekutif Jepang sebab banyak rekannya menganggap ia adalah politisi berpengalaman dan kualitas kerjanya tinggi. Matsushita melakukan demikian, untuk menebus dosa. Hal demikian untuk menunjukan sebuah kehormatan bagi dirinya. Ia berpikir lebih baik mati berkalang tanah daripada hidup menanggung malu. Langkah yang dilakukan Matsushita di Jepang sendiri bukan suatu hal yang baru dan pertama. Bunuh diri dengan alasan kesalahan yang dilakukan dianggap sebagai sebuah kehormatan. Dengan tindakan yang disebut harakiri, kematian untuk menembus kesalahan, atau kamikaze yang artinya kematian untuk persembahan kepada Kaisar demi kemulyaan negara dan bangsa Jepang, merupakan tradisi turun temurun yang terjadi di Jepang hingga saat ini. Dengan hal-hal demikianlah maka dosa yang dialami bisa ditembus atau kemulyaan roh di Gunung Fujiyama bisa tercapai. Kejadian bunuh diri karena malu atas kesalahan yang dilakukan sepertinya hanya terjadi di Jepang, kalaupun ada di tempat yang lain, seperti menembakan pistol di kepala, itu hanya sesekali terjadi. Dengan sikap demikianlah maka pejabat di Jepang selalu dituntut untuk hidup dan bersikap yang baik, sesuai dengan hukum maupun norma dan etika Shinto atau agama asli Jepang. Dengan tradisi

seperti itu, maka dari Jepang kita nyaris tidak pernah mendengar apa yang namanya korupsi, kolusi, atau nepotisme yang dilakukan pejabat. Bila kita mendengar hal yang demikian, maka tidak lama lagi, pelaku akan melakukan hal bunuh diri. Dengan tindakan satria itulah maka pejabat di negeri matahari terbit itu berlombalomba untuk menunjukan kebaikannya. Sayangnya tradisi yang baik itu, mundur atau bila perlu bunuh diri bila melakukan kesalahan, tidak menular ke banyak negara, apalagi di Indonesia. Sayang selama Jepang menjajah Indonesia, tradisi itu tidak ditularkan. Mungkin kalau menjajah selama 350 tahun, tradisi itu bisa hidup di masyarakat, sayangnya cuma 3,5 tahun. Bagi pejabat di Indonesia apa yang dilalukan Matsushita itu disebut tindakan yang konyol dan bodoh. Pejabat di Indonesia beranggapan mengapa sudah menjabat enak-enak menjadi menteri harus melakukan bunuh diri. Pendapat pejabat di Indonesia demikian, sebab tindakan seperti korupsi, kolusi, nepotisme, bahkan selingkuh merupakan hal yang biasa. Justru ada ada anggapan, kalau tidak melakukan seperti demikian sebuah kebodohan sebab tidak bisa menggunakan jabatan yang ada untuk mengeruk uang negara atau bersenang-senang dengan menggunakan fasilitas negara. Bahkan di Indonesia, seorang pejabat yang sudah nyata-nyata melakukan tindakan korupsi, kolusi, nepotisme, dan selingkuh, masih bisa berkoar-koar di depan orang banyak, bahkan masih sempat-sempatnya ikut pilkada atau pileg. Mereka berdalih tidak merasa bersalah meski pengadilan sudah memutus salah. Pejabat itu selalu berdalih mengatakan, saya menjadi korban politik. Maraknya pejabat yang tidak mundur apalagi bunuh diri di Indonesia bisa jadi karena kultur Indonesia dan

Penulis adalah Pengamat Politik

Selamat & Sukses Atas Terpilihnya

Pdt WTP Simarmata MA Pdt Mori Sihombing MTh Ephorus HKBP

Sekjen HKBP

Pdt Welman Tampubolon STh

Pdt Marolop P Sinaga MTh

Kepala Departemen Koinonia

Kepala Departemen Marturia

Pdt Drs Bihelman DF Sidabutar STh Kepala Departemen Diakonia

Dalam Sinode Godang HKBP di Seminarium HKBP Sipoholon Taput Dari

Pimpinan Pusat GKPS Jl. Pdt. J Wismar Saragih P. Siantar Pdt Jaharianson Saragih STh MSc, PHd

Pdt El Imanson Sumbayak MTh





18 September 2012

Program Loyalti Bagi Pelanggan dan Mitra Outlet di Sumatera

Telkomsel Undi 2 Mobil KIA Sportage M/T MEDAN- Hari ini Telkomsel melakukan penarikan undian pemenang utama program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA. Masing-masing pemenang utama program ini mendapat hadiah berupa 1 Unit Mobil KIA Sportage M/T. Periode program dilakukan mulai tanggal 1 Mei 2012 hingga 31 Juli 2012.


Jl. Melanthon Siregar No. 41 A P. Siantar. CP 0813 7502 7832 Setiap hari kerja pukul 09.00 - 18.00 WIB Lamaran diterima paling lambat 2 Minggu setelah iklan ini terbit

Intel Susutkan Ukuran Desktop PERANGKAT komputasi berukuran kecil dan mudah dibawa merupakan tren saat ini. Mengingat hal tersebut, Intel ingin menghadirkan komputer desktop berukuran mini tanpa mengurangi tenaga yang dihadirkannya. Dilansir dari PCWorld, pada Mei 2012 lalu, Intel memperkenalkan desain yang disebut Next Unit of Computing (NUC), namun hanya sedikit detil yang dikeluarkan. Kini, mereka telah menyiapkan papan kecil sebagai rumah sebuah prosesor untuk pengapalan Oktober ini. Papan yang jadi rumah prosesor mobile

Core i3 Ivy Bridge itu memiliki ukuran 4x4 inci atau sekira 10x10 centimeter. CPU di dalamnya sudah termasuk prosesor grafis terintegrasi Intel HD 4000. Di balik papan kecil tersebut terdapat total 4 slot, dua di antaranya adalah soket standar SO-DIMM untuk memori, satu slot M-SATA untuk SSD dan terakhir adalah slot mini-PCI untuk berbagai keperluan. Selain itu juga terdapat tiga port USB dan konektor HDMI. NUC merupakan program yang dikembangkan Intel dengan tujuan menyusutkan komputer desktop berkinerja penuh, sehingga memiliki ukuran sekecil mungkin. (int)

Sony dan LG Bakal Garap Smartphone Nexus SEBUAH bocoran dari dokumen yang ditujukan untuk operator telekomunikasi Jepang DoCoMo mengungkap keberadaan smartphone Google Nexus baru. Kali ini, smartphone tersebut akan hadir dari Sony dan LG. Dilansir dari Stuff, Senin (17/9),

LOWONGAN PEKERJAAN Sebuah perusahan yang bergerak dibidang Otomotif membutuhkan segera tenaga kerja dibidang :


Syarat-Syarat : 1. (A) Pria maximal 28 tahun. (B) Wanita, Max 22 Thn Belum Menikah 2. (A) Berpengalaman dibidang sales min,2 tahun 3. (A,B)Pendidikan minimal tamatan SMA. 4. (A,B)Cekatan,Jujur,Dipsiplin dan Bertanggung jawab. 5. (A) Memiliki SIM C. 6. (A) Memiliki kendaraan sendiri. 7. (A) Bersedia ditugaskan keluar kota. Surat lamaran lengkap di alamatkan ke:

PT SUTAN INDO ANEKA MOBIL (Authorized TOYOTA Dealer) Jl. Medan Km 2,8 P.Siantar. Surat lamaran ditunggu paling lambat 22 September 2012 dengan melampirkan: Fotocopy KTP Fotocopy SIM C (A), Fotocopy ijazah, daftar nilai, daftar riwayat hidup dan phasphoto terbaru ukuran 3x4 sebanyak 2 lembar. (TIDAK MELAYANI LEWAT TELEPON)

„ Smartphone Nexus

ini berarti Galaxy Nexus yang dibuat Samsung beserta Galaxy S III yang jadi andalannya bisa saja digantikan sejumlah perangkat Android lain. Bertepatan dengan rumor ini, muncul bocoran mengenai lembaran spesifikasidari SamMobile. Bocoran ini menunjukkanNexusII(berkode nama GT-I9260) akan memiliki layar yang sama seperti Galaxy Nexus saat ini, namun dengan dapur pacu yang berbeda. Nexus II akan menggunakan dapur pacu berupa prosesor dual core A9 berkecepatan 1.5GHz. Kemudian juga ada kamera 8MP yang setara Galaxy S III dan kamera depan setajam 1.9MP.Rumorsebelumnya telah mengindikasikan akan ada lima perangkat yang terungkap bertepatan ulang tahun kelimaAndroidpadatahunini.(int)


“SUMBER JAYA PERMAI” Lokasi: Sumber Jaya Simp. Kerang P. Siantar Segera Hubungi..... Persediaan terbatas

1 Kavling 20 jt-an Rumah yang segera dibangun

Lembaga pendidikan NEC membutuhkan segera Guru Bidang Studi: • Matematika • IPA • Bahasa Inggris Syarat: • Pria / wanita • Single • Tamatan S1 / mahasiswa tingkat akhir • Memiliki pengalaman min. 1 tahun mengajar dibidangnya Antar lamaran anda ke:

„ Head of Sales and Customer Care Regional Sumbagut Division Telkomsel, Filin Yulia disaksikan pihak Dinas Sosial, Notaris dan Kepolisian , melakukan penarikan undian hadiah utama program Rezeki Isi Ulang dan Jutawan Outlet Sumatera berupa 1 Mobil KIA Sportage M/T untuk masing-masing pemenang, Medan, Senin (17/9).




Jl. Pdt. J Wismar Saragih No. 66 Telp. 0622 - 7436254

otomatis berpeluang mendapatkan salahsatu dari seluruh hadiah yang disediakan berupa 30 (tiga puluh) HP Android, 30 (tiga puluh) Tas Trolley, 9 (sembilan) unit Samsung Galaxy Tab 8.9”, 9 (sembilan) unit Sepeda Motor Honda Vario, dan hadiah utama undian berupa 1 (satu) Mobil KIA Sportage M/T. Melengkapi program Rejeki Isi Ulang, Telkomsel juga menyelenggarakan program JUTAWAN OUTLET SUMATERA (JUARA). Program apresiasi ini dikhususkan bagi seluruh mitra outlet yang juga berada diwilayah Sumatera. Programinijugamenyediakanhadiah undian berupa 1 (satu) unit Mobil KIA Sportage M/T, Honda Vario, Tablet Cyrus TV Pad, Blackberry Apollo. Program yang diperuntukkan khusus untuk mitra outlet diseluruh willayah Sumatera ini, dimulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Bagi mitra outlet yang ingin mengikuti program JUARA, akan mendapatkan informasi lengkap tentang mekanisme program melalui petugas Sales Force yang berada dimasing-masing wilayah cluster mitra outlet. Pada kesempatan ini, Gilang Prasetya menghimbau kepada pelanggannya agar tetap berhatihati terhadap penipuan yang mengatasnamakan Telkomsel. Jika pelanggan menerima informasi menjadi pemenang salahsatu program undian Telkomsel, sebaiknya melakukan konfirmasi ke nomor layanan Call Center bebas pulsa Telkomsel yaitu 133 dari kartuHALO dan 155 dari kartu simPATI dan Kartu As. Selain itu pelanggan juga dapat mendatangi kantor layanan GraPARI Telkomsel terdekat. Hal terpenting adalah, Telkomsel tidak pernah mengenakan biaya apapun kepada pelanggan yang menjadi pemenang undian berhadiah dari Telkomsel, baik dalam bentuk uang tunai maupun pulsa. (leo)

Perusahaan kami membutuhkan tenaga kerja sebagai: SUPIR 2 ORANG Dengan syarat: 1. Pria, berpenampilan menarik, jujur dan berdisiplin 2. Mempunyai SIMA 3. Berdomisili di Kota Pematangsiantar lamaran diantar langsung ke

Penarikan undian dilakukan secara transparan di hadapan pihak Dinas Sosial, Notaris dan Kepolisian. Pemenang hadiah utama program Rezeki Isi Ulang adalah Hendriko pelanggan Telkomsel di Palembang dan pemenang utama program Jutawan Outlet Sumatera adalah Mutiara Telkomsel outlet dari Binjai. Para pemenang langsung dihubungi oleh Head of Sales andCustomerCareRegionalSumbagut Division Telkomsel – Filin Yulia, sesaat setelah pengundian berlangsung. Menurut Head Of Telkomsel Sumatera Group – Gilang Prasetya “Program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA merupakan salahsatu program yang diperuntukan bagi pelanggan yang telah setia menggunakan produk Telkomsel serta mitra outlet yang telah setia menjaga loyalitas pelanggan Telkomsel melalui ketersediaan produk di outlet hingga membantu Telkomsel dalam melakukan edukasi keunggulan produk Telkomsel kepada pelanggan di outletnya”. Program Rejeki Isi Ulang adalah program yang dikhususkan untuk pelanggan prabayar Telkomsel di Sumatera (kecuali nomor HLR Aceh), baik pelanggan baru maupun pelanggan yang sudah lama menggunakan kartu simPATI, Kartu AS dan Kartu Facebook. Untuk mengikuti program ini tidak diperlukan registrasi khusus, caranya pelanggan prabayar cukup melakukan isi ulang pulsa pada periode program yang berlaku mulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Jika selama periode program telah mencapai total isi ulang minimal Rp.60ribu, secara otomatis pelanggan tersebut akan berpeluang mendapatkan salahsatu hadiah. Bagi pelanggan yang melakukan isi ulang pulsa selama periode program, mencapai total isi ulang pulsaminimumRp.300.000,secara

Fasilitas: 1. PDAM dan PLN 2. Jalan utama L 7 M, jalan lingkungan L 5 M 3. Lokasi strategis dekat Komp. Siantar (Mas/Waterpark + 1 KM)

Contact Person

HP 0823 6712 6137 Zulham Nasution SH Rudi A Nainggolan AMD HP 0821 6615 1867


18 September 2012

Pengukuran Lahan Bandar Betsy Ricuh Sambungan Halaman 1

FGS Datangi Kejaksaan Sambungan Halaman 1 menindaklanjuti seluruh kasus yang terjadi di Disdik Siantar. “Kita pertanyakan sudah sejauh mana laporan-laporan yang kita sampaikan. Sebab limit waktu untuk pihak kejaksaan sudah lewat yakni Agustus lalu,” jelasnya. Menurut dia, pihaknya sudah menanyakan tentang insentif para guru yang dilaporkan. Dari laporan tentang insentif guru itu, ada terjadi penggelembungan data. Sebelumnya dari Dispenda disebutkan jumlah guru yang menerima insentif sebanyak 4.856 orang. Akan tetapi dari Disdik dilaporkan sebanyak 5.516 orang. “Menanggapi laporan kita itu, Kajari mengaku bahwa itu termasuk kerugian negara dan akan ditindaklanjuti melalui audit BPK. Sementara untuk pungli, disebutkan agar kita melaporkan ke polisi. Sebab perkara itu sudah masuk ke pidana umum dan kita diarahkan untuk ke sana,” paparnya. Sambung Tampubolon, didampingi tujuh guru yang ikut hadir, mereka juga mempertanyakan sejauh mana perkembangan dugaan penyimpangan Dana Alokasi Khusus (DAK) 2010. Pihak Kejaksaan lagi-lagi mengaku bahwa masih dilakukan pemeriksaan. Katanya mereka terhalang oleh kepala sekolah yang enggan memberikan keterangan dengan berbagai alasan takut dicopot. “Untuk kasus DAK 2010, saat ini katanya masih diperiksa, kejaksaan katanya terbentur karena beberapa kepala sekolah yang tidak bersedia memberikan keterangan. Saat pemeriksaan hendak dilakukan, kepala sekolah melayangkan berbagai alasan,” paparnya. Dia menerangkan, untuk kasus tersebut, sebaikanya kejaksaan tidak perlu berlama-lama dan bila perlu Kadisdik Setia Siagian segera ditahan. Sebab bila itu dilakukan, berbagai kasus yang terjadi di Disdik akan segera tuntas. “Besok(Selasa)kamiakanberangkatkeKejatisu dan menyampaikan laporan yang sama seperti ke Kejaksaan Siantar. Kedatangan kita sama seperti saat ini untuk menjelaskan seluruh persoalan yang terjadi di Siantar, khususnya dalam bidang pendidikan.PerludiingatbahwaSetiaSiagianyang bertanggungjawab di balik semua ini,” jelasnya. Sementara itu Kajari Siantar Rudi H Pamenan, membenarkan kedatangan guru-guru tersebut. “Kita sudah menjawab seluruh pertanyaan dari guru-guru yang mempertanyakan laporan mereka. Kita tetap mengerjakannya, tapi karena ini masih penyelidikan tidak perlu dibeberkan, karenaakanberdampakdengankesulitanmencari fakta-fakta baru,” ungkapnya. (mua)

Antisipasi Teroris, Pintu Masuk Siantar Dirazia

Sementarawargasudahmempersiapkanalatukur serta bambu sebagai patok batas tanah mereka. Karena pengukuran lahan dilarang, akhirnya warga dan satpam bentrok dan saling ejek. Pengurus FOKRAT Saut Silalahi dan beberapa rekannya tampak berada di tengah kerumunan menyampaikan orasinya. Dia mengatakan, lahan itu adalah milik masyarakat, bukan milik perkebunan PTPN III. “Lahan kami ukur karena kami sudah punya alat bukti dan alat bukti ini kami tempuh melalui jalur hukum, bukan melalui premanisme,” katanya. Sementarawargalainyangkesalterhadappihak kebun juga sahut menyahut meneriaki para satpam. “Pulanghlah kalian, pikirin anak istri. Belum tentu besok kalian masih kerja di kebun itu. Pikirin saja gaji kalian, jangan urusin tanah masyarakat,” kata ibu-ibu yang kesal. Satpam yang merasa dihina mencoba membalasdengannyayianyangmenyindirwarga. “Pinggir Bung, pinggir Bung, pinggir Bung. Pasukan satpam mau lewat. Jangan di tengahtengah, nanti kupijak-pijak. pingir Bung, pinggir

Sambungan Halaman 1 dibentangkan di jalan masuk TPL. Namun, bentrok yang terjadi dengan satpam TPL tidak berlangsung lama, sebab langsung dilerai aparat Polres Simalungun. Selanjutnya, demonstrandiizinkanmasukkedalam.Danenam perwakilanwargadipersilakanbermediasidengan pimpinan TPL. Pertemuantersebuttetaptidakmembuahkanhasil. Pasalnya, tuntutan warga terhadap TPL tidak bisa direalisasikan. Perwakilan TPL, Tagor Manik (pimpinan TPL sektor Aek Nauli) dan didampingi LambertusSiregar(Humas)memberikanjawaban tidak memuaskan. Massa yang berang langsung menyudahipertemuan. “Kamitidakmaumendengarkanretorikabapak. Kami mau mendengar jawaban bapak terkait keluhan warga. Kalau tidak bisa diputuskan hari ini, kami berikan waktu 1x24 jam. Kalau juga tidak bisa diputuskan, aksi ini akan lebih besar,” ujar aktivis lingkungan, Rado Damanik. Adapuntuntutanwargaantaralain;kembalikan lahan pertanian warga yang diserobot seperti di Nagori Naga Hulambu. Jangan lagi terjadi intimidasi dari oknum aparat atas suruhan TPL seperti yang pernah dialami warga. Lalu, hentikan penimbunananak-anaksungaidemikepentingan jalan pengangkut kayu sehingga persawahan warga kering. “KeberadaanTPLdiSimalungunmenyengsarakan masyarakat. Pupuk yang digunakan TPL adalah pupuk bersubsidi dan BBM bersubsidi. Akibatnya masyarakat harus mengalami kelangkaan pupuk dan BBM. Insfratruktur jalan rusak dan penyebab utama banjir,” tegas Rado yang juga pembina Saling.

setelah menghabiskan malam di Siantar Square. Saat itu Rahadi bertindak sebagai joki, sementara Chandra duduk di boncengan. Mereka pun melaju ke kampungnya dengan mengenderai Satria FU BK 6720 TAM. Tiba di lokasi kejadian di Dusun Sibunga-Bunga, tibatiba di depan mereka bergerombol sekitar tujuh sepedamotor berbagai jenis dan melaju di tengah jalan. Diduga gerombolan ini merupakan pemuda setempat. Disebabkan ini, Chandra lalu membunyikan klakson. Setelah beberapa kali diklakson, para pemuda ini lalu menyingkir ke pinggir jalan dan Candra dan sepupunya pun melintas dari gerombolan ini. Hanya saja, baru berjarak sekitar 500 meter melewati gerombolan pemuda ini, tiba-tiba mereka sudah didekati gerombolan pemuda tadi. Gerombolan pemuda ini lalu meminta mereka berhenti. Mereka pun menurut dan menghentikan laju sepedamotornya. Chandra pun turun dari sepedamotor. Sementara Rahadi tetap di atas sepedamotor. Tanpa banyak tanya, salah satu dari gerombolan ini langsung melayangkan pukulan tepat di wajah dan kepalanya. Chandra lalu terjatuh dan menanyakan kenapa dia dipukuli. “Kenapa Bang, apa salah kami. Ini kan bisa dibicarakan,” ujar Chandra saat itu. Namun permohonan Chandra ini tidak digubris oleh gerombolan pemuda ini. Kemudian Chandra mengeluarkan kata-kata kotor akibat kesal dirinya dipukuli terus menerus. Hal ini membuat gerombolan pemuda yang mengeroyoknya itu makin beringas. Dia pun terjatuh lagi karena terus dikeroyok. Chandra lalu lari menjauh. Namun lagi-lagi gerombolan pemuda ini mengejarnya dan kembali memukulinya. Sementara sepupunya

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Koordinator Saling, Johannes Sakti Sembiring menambahkan,berdirinyasuatuperusahaanharus berdampak positif bagi suatu daerah, khususnya masyarakat sekitar. Perekrutan tenaga kerja perusahaan tersebut juga harus melibatkan putra daerah,karenakehadiranperusahaandisanauntuk kesejahteraanmasyarakat. Tetapi tidak dengan TPL yang hanya menjadi momok menakutkan bagi masyarakat Kabupaten Simalungun.Sebab,sejakkeberadaanTPLbanyak hak-hak warga yang dirampas demi kepentingan perusahaan. TutupTPLHargaMati Massa dalam orasinya menegaskan bahwa tutup TPL adalah harga mati, sebagaimana juga terpampang dalam spanduk yang mereka usung. Menurut mereka, masyarakat sudah terlampau lama menderita dengan keberadaan TPL di Simalungun. MenurutKetuaGapoktanPondokBuluDongan Silalahi, pihaknya sangat kecewa ketika PT TPL melarang masyarakat lewat dari jalan umum yang sudahdibuatkanpalang.Palangtersebutsetiaphari dijagaduasampaitigasatpam. “Kami mau masuk kampung sendiri harus melapor kepada satpam TPL. Padahal jalan yang merekapalangadalahjalanumumyangsetiaphari dilewati masyarakat. Tiga kampung yang berada di dalam terpaksa mencari jalan alternatif,” katanya. Ia menambahkan, pada tahun 1999 PT TPL sempat ditutup. Saat itu, masyarakat merasa senang karena bisa mendapatkan hasil panen yang memuaskan. Tetapi beberapa tahun terakhir sejak TPL berdiri kembali, masyarakat petani sawah banyak beralih fungsi menanam jagung karena air dari anak sungai mengering. Menurutnya, itu terjadi karena sejumlah anak sungai di

Sambungan Halaman 1

Anggota SPS No: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

wargayangmengakubahwalahanmiliknya,mulai mencoba mengurus surat tanah dengan alasan itu adalah lahan peninggalan nenek mereka. Saat itu pihak PTPN III dengan warga sudah pernahricuhsoalperebutanlahantersebut.Untuk mengatasi bentrok warga dengan pihak PTPN III, BupatiSimalungunJRSaragihmemintaagarlahan distanvas atau pemberhentian pengerjaan sementara. Mendapat informasi demikian, PTPN III menyetujui permintaan bupati dengan tidak menanamkembalipohonkaretdilahanyangbaru mereka tebang. Selang waktu, warga yang merasa memliki lahan malah mengurus akta notaris. Sementara Saut Siahaan menuturkan, saat ini sudah135orangyangsudahmengurusaktanotaris di lahan Bandar Betsy dan mereka berhak untuk mengolah lahan karena sudah memiliki alat bukti. “Semua warga yang datang kemari sudah memiliki akta notaris dan berhak untuk mengkelola lahan ini. Sayangnya, ketika mereka ingin mengukur lahan yang didapatnya, pihak perkebunan PTPN III malah mengirim satpam yang tidak dapat menunjukkan alat bukti soal lahan,” kata Saut. (mag-4)


„ Masyarakat bentrok dengan TPL saat berunjuk rasa di jalan masuk kantor TPL sektor Aek Nauli, Senin (17/9). dalam TPL ditutup demi kebutuhan jalan mobil pengangkut kayu. Menyikapi hal tersebut, Rado Damanik dengan tegas mengatakan PT TPL sudah menghina masyarakat Simalungun karena melarang masuk ke kampung halamannya sendiri. Maka kesimpulannya, PT TPL harus angkat kaki dari Kabupaten Simalungun. “Sudah banyak budaya yang dilupakan PT TPL. Selama ini masyarakat diam, sehingga mereka bebas melakukan apa saja. Sekarang kami melakukan perlawanan sampai titik darah penghabisan,” tegas Rado. CamatDolokPanribuanJamesSiahaanSSTPyang hadir dalam kesempata tersebut mengatakan, perwakilanTPLtidakbisamemberikankeputusan

terkaittuntutanmasyarakat.Solusinya,masyarakat menyampaikan tuntutannya, lalu oleh camat diminta tanggapannya dari TPL. “Satu kali 24 jam diberikankesempatanmenjawabtuntutanmasyarakat. Tetapi kalau tuntutan tidak terealisasi, maka aksi besar-besaran akan dilakukan sebagaimana tertuangdalamsuratizinPolres,”katanya. Sementara itu, Pimpinan PT TPL sektor Aek NauliTagorManikmengatakanceritaakhirdariaksi tersebut adalah seluruh tuntutan masyarakat akan dituangkan dalam surat, dan diserahkan kepada camat, dan camat menyerahkannya ke PT TPL. “Itu sudah merupakan bagian keputusan. Tetapi pada prinsipnya, PT TPL bekerja sudah sesuai tupoksi dan peraturan perundangundangan yang berlaku,” katanya. (osi)

Mahasiswa Dipukuli 14 Pemuda

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pemimpin Perusahaan Metro Asahan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

bunan PTPN III dan meminta untuk kembali mundur serta meninggalkan lokasi lahan kosong di daerah Bandar Betsy. Setelah Satpam meinggalkan lokasi, perlahan keramaian mulai terpecah namun warga tetap inginmembahassoallahantersebutdilaintempat. Sebelum bubar, mereka sepakat untuk berkumpul di rumah Saut Siahaan karena hari Selasa (hari ini) atau lusa mereka akan pergi ke Poldasu untuk mengadu soal lahan yang diperebutkan itu. Sesaat setelah bentrok mulai reda, Kepada METRO, Konsultan PTPN III Juliandi Parlindungan Silalahi menerangkan, sejak masa penjajahan Belanda, lahan seluas 146 hektare sudah ditanami pihak perkebunan PTPN III. Setelah reformasi, beberapa oknum tertentu mulai melakukan penggarapan dan mengaku bahwa lahan tersebut adalah milik keturunan dari nenek atau leluhur mereka dan ingin memiliki lahan tersebut. Diamenambahkan,tahun2010silam,tanaman karet di areal Bandar Betsy sudah habis masa panennya,kemudiantanamanditanahseluas146 hektare itu ditebang oleh pihak PTPN III karena ingin ditaman ulang. Ketika penebangan selesai

Demo TPL, Massa Dihadang Kawat Berduri

Sambungan Halaman 1 AmatanMETRO,Senin(17/9)mulaipukul14.30 WIB hingga 15.15 WIB, sebanyak 20 personil dari berbagai satuan di Polres Siantar melakukan razia di pintu masuk Siantar dari arah Parapat. Polisi merazia mobil pribadi, mobil boks, kreta hingga angkutan umum. Petugas memeriksa setiap mobil, baik bagasi, bagian dalam mobil hingga memeriksa identitas pengemudi. Terutama mobil atau angkutan yang memilikinomorpolisidariluar.TerlihathadirKasat Sabhara AKP M Barus, Kasat Narkoba AKP Sofyan dan Kanit Propam Iptu M Panjaitan. Namun lebih setengah jam berada di sana, petugas tidak menemukan apapun dari angkutan yang diperiksa, senjata tajam, senjata api (senpi) dan narkoba. Namun beberapa pengendara yang melintas dan tidak memiliki surat-surat yang lengkap, langsung ditilang petugas. Perwira Penanggungjawab Operasi sekaligus Kasat Sabhara AKP M Barus menyebutkan, razia yang dilakukan ini merupakan razia rutin untuk cipta kondisi. Razia yang dilakukan termasuk razia narkoba, senjata tajam, senpi dan pelaku teroris. Disebutkannya lagi, razia ini juga ada kaitannya untuk persiapan menjelang Pilgubsu 2013. Razia bertujuan menciptakan kondisi yang baik dan kondusif di tengah masyarakat menjelang Pilgubsu 2013 dan mengantisipasi jaringan teroris masuk ke Kota Siantar. “Razia direncanakan setiap hari. Batas waktu tergantung kepada Kapolres Siantar AKBP Alberd Sianipar. Razia ini juga sesuai instruksi Kapoldasu Irjen Wisnu Amat Sastro,” jelasnya. Dikatakannya, razia gabungan ini diiikuti sebanyak20personildariberbagaisatuandiPolres Siantar.RaziasudahdimulaiSeninlalu.Namunhinggahariini,belumditemukansenpiatausajamserta narkoba yang dibawa pengendara mobil maupun kreta. Razia gabungan ini melibatkan satuan narkoba, intelkam, reserse dan lalu-lintas.zia dilakukan di pintu masuk Siantar, seperti di Jalan Parapat,JalanMedan,JalanAsahan,JalanMelanthon Siregar, depan Mapolres dan ditengah kota. (ral)

Bung,pinggirBung,”begitunyanyianparasatpam. Setelah nyayian berhenti, warga mengatakan tingkah laku satpam itu tak ubahnya dengan anak TK yang suka menyindir lawan. Tak berapa lama kemudian, Kapolsek Perdagangan AKP Aron Siahaan beserta beberapa anggotanyatibadilokasimencobamengamankan warga dengan satpam yang terlihat semakin tegang dan saling ejek. Selanjutnya Kapolsek meminta satpam untuk mudur 10 langkah, begitu juga dengan warga. Dua kubu yang sempat sudah merapat akhirnya mundur. Namun warga tetap menyampaikan orasinya. Pada kesempatan itu, Kapolsek memberikan arahan kepada masyarakat untuk tidak bentrok dan meminta agar masyarakat sabar menunggu keputusan Bupati dan Muspida Simalungun soal keberadaan lahan yang diributkan mereka. “Benar surat sudah dilayangkan kepada bupati. Namun belum sempat membahasnya. Putusan kepemilikanlahanseluas146hektareiniakandiberitahukan Selasa (25/9) depan,” kata Kapolsek. Setelah memberikan arahan kepada warga, Kapolsek kembali mendatangi satpam perke-


„ Posni Chandra Harianja. saat itu juga turut dipukuli. Namun sepupunya ini tetap bertahan di atas sepedamotor. Tiba-tiba dari arah Dusun Sibunga-Bunga atau searah dengan mereka, muncul pengendara sepedamotor lain. Gerombolan pemuda ini pun menghentikan aksinya dan bergegas pergi dari lokasi tersebut. “Untunglah Abang itu datang. Dia tinggal di kampung lain, namun searah sama kami. Dialah yang menolong kami. Kami langsung pulang ke rumah dan besoknya membuat pengaduan ke Polsek (Balata). Abang itu yang menjadi saksi, dia ikut ke Polsek,” ujarnya. Disinggung pemicu pemukulan ini disebabkan knalpot racing kenderaannya dan mereka menggeber-geber saat melintasi gerombolan pemuda ini, Chandra membantah.

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Chandro Purba, Nasa Putramaylanda, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala MD Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva

Menurutnya, saat melintasi gerombolan ini, mereka melaju dengan perlahan. “Knalpot sepedamotor kami memang racing, tapi tidak ada kami geber-geber. Mana berani kami geber, sepedamotor mereka banyak kami lihat. Sepedamotornya ada sekitar tujuh, semua bonceng dua. Lagian mereka itu pemuda Dusun Sibunga-bunga, pemuda setempat, ” jelas anak kedua dari tiga bersaudara ini. Akibat kejadian ini, Chandra mengalami luka lebam di wajah dan kepala. Dia mengaku kepalanya sering pusing pasca kejadian itu. Saat ini Chandra terpaksa menjalani perawatan di RS Horas Insani. Begitu juga dengan sepupunya harus dirawat di rumah sakit tersebut. Dua Pelaku Ditangkap Adi Firmadani (27) warga Nagori Karang Sari Kecamatan Gunung Maligas dan Syaputra (18) warga Nagori Sibunga-bunga, Kecamatan Jorlang Hataran, dua dari 14 pelaku penganiayaan ditangkap petugas Polsek Tiga Balata, Minggu (16/ 9) sekira pukul 10.00 WIB dari Nagori Sibungabunga, Kecamatan Jorlang Hataran, Simalungun. Informasi dihimpun di lokasi kejadian, Candra sempat nyaris dimassakan puluhan pemuda sekitar. Namun gagal setelah seorang warga melerai keributan itu. Selanjutnya pihak Polsek Balata mengamankan tujuh saksi dan dua orang ditetapkan sebagai tersangka, sesuai dengan pengakuan para saksi dan korban saat itu. Sementara lima saksi lainnya tidak terbukti. Namun sejauh ini kelimanya akan tetap diperiksa jika diperlukan. Kapolsek Tiga Balata AKP Surbakti mengatakan, kedua tesangka saat ini sudah ditahan di Rumah Tahanan Sementara (RTP) Polsek Tiga Balata, sementara korban masih dirawat di Rumah Sakit Horas Insani Pematangsiantar. ”Dua tersangka ini sudah kita amankan namun korbannya masih dirawat di Rumah Sakit Horas Insani karena luka berat di

Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Niko, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

kepalanya usai dianiaya,” kata polisi dengan pangkat balok tiga emas di pundaknya ini. Dijelaskannya, berdasarkan hasil pemeriksaan, motif penganiayaan ini disebabkan rasa dendam pada korban yang selalu melintas dengan kecepatan tinggi dan mengeluarkan suara knalpot keras. ”Sejak sebelumnya dua tersangka ini sudah kesal dengan korban karena suara sepedamotornya yang berisik. Sementara setelah saya periksa, suara keretanya biasabiasa saja. Namun ketika ada kesempatan para pelaku langsung menganiaya korban dengan beralasan suara knalpot,” katanya. Bahkan saat kejadian berlangsung, sepedamotor korban nyaris dirusak dua pelaku ini. Sementara warga yang berkerumun langsung meminta dua pelaku menghentikan aksinya. F Sialagan (23) dan Sahat Manalu (25), warga Dusun Sibunga-bunga, Nagori Sibunga-bunga yang ditemui METRO, Senin (17/9) menyebutkan, selama ini korban dikenal sering melintas dari Dusun Sibunga-bunga dengan kecepatan tinggi. ”Memang dia kalau melintas di dusun ini selalu kencang, bahkan suara kretanya juga berisik sekali sampai sakit kuping kalau mendengarnya. Saat itu kretanya saja hampir dirusak namun langsung dihentikan setelah dilarang warga,” kata mereka. Sebelumnya warga juga sempat meminta korban agar berdamai usai dianiaya para pelaku. Namun usaha itu gagal setelah korban pergi meninggalkan dusun itu dan melaporkan kejadian yang dialaminya ke Polsek Tiga Balata. ”Begitu dipukuli, korban sempat diajak berdamai dengan para pelaku. Mereka pun bersedia membayar semua biaya perobatannya. Namun korban tak mau dan langsung melaporkannya hingga kami dengar mereka berdua ditahan. Soalnya Minggu pagi mereka diperiksa lalu sampai saat ini tidak pulang juga dan kami dengar mereka sudah ditahan,” katanya. (ral/mag-02)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



18 September 2012

DEWI: EMANGNYA INI MILIK NEGARA Sambungan Halaman 8 PANCURBATU- EmosiDewi(32),penghunibarakHendridiBandarBarutiba-tiba memuncakkesalahseoranghidungbelang. Pasalnya,usaiindehoidiBungalauGemilang, Alim Kwok (33) Warga Jalan Belawan, Kelurahan Titi Papan, Kecamatan Medan Labuhan,takmaumembayarjasaseksnya. Akibatnya, Alim pun digiring ke Mapolsek Pancurbatu,Senin(17/9),sekirapukul07.00 WIB. InformasidihimpundiMapolsekPancurbatumenyebutkan,malamituAlimdatang ke Bandar Baru dengan mencarter Taxi ExspressBK1547HAyangdikemudikanAmir

HamzahLubis(23),wargaDesaPatumbak, Kecamatan Patumbak. Setibanya di sana, merekapunmemesanBungalawGemilang yangadadikawasanprostitusitersebut. Selanjutnya,Alimpunmemesancewekke salahseorang romboy. Tak berselang lama, Dewi yang merupakan warga Purwokerto JawaTimurdatangkekamaryangditempati keduanya.Begitutibadiruanganyangberisi duatempattidurtersebut,AlimdanDewipun negosiasi harga, dan mereka pun sepakat hingga siang hari Alim membayar sebesar Rp800ribu. Karena telah mencapai kesepakatan, keduainsanberlainanjenisinilangsungnaik bulan.Malamitu,AlimmeniduriDewihingga

Sehari, 2 Jurtul.. Sambungan Halaman 8

Kelurahan Kerasaan I, Kecamatan Pematang Bandar,ditangkapdisalahsatukedaikopidiPekan Kerasaan. KanitReskrimIpdaDSirait,mengatakan,kedua tersangkaSuhermandanPainsudahdiamankan. Rencananya,Selasa(18/9),keduapelakudibawa keLembagaPemasyarakatan(LP).(mag-4/dro)

Pengancam Ibu.. Sambungan Halaman 8

peristiwaituberlangsungpadaSenin(23/4)sekira pukul07.00WIB.“Awalnyaterdakwameminta uangRp6jutakepadaibunya.Akantetapiibunya mengakutidakmemilikiuangkarenakesehariannyahanyaberjualansarapanpagi,”sebutnya. Ia menerangkan, akhirnya ibunya hanya mampu memberikan uang sebesar Rp1,5 juta. Akan tetapi terdakwa merasa tidak senang dan tidakmaumenerimanyauangtersebut.Terdakwa langsungmenendangrumahmerekadanmengambilpipabesidanhendakmemukulibubeserta duaorangadiknya.(mua)

duakali.Setelahbercinta,Dewipunmeminta bayaransesuaidenganyangtelahdisepakati tadi kepada Alim. Namun bukan jawaban yangdidapatDewi,melainkansanghidung belang langsung bolak-balik masuk kamar mandi. Melihatitu,DewipunmengamuksejadinyadanmembuatAmiryangberadapersisdi kamar sebelah keluar, dan menanyakan permasalahannya. Ketika dijelaskan Dewi kalau Alim tak membayar uang jasa ngeseknya, Amir pun terkejut bukan main, karenasesaatsebelumpergiAlimmengaku sebagai pengusaha dan hendak menemui temannyadiBandarBaru. PantauandiMapolsekPancurbatuterlihat

kalauDewiterusmerepetiAlimdengankatakatakasar.“Dasarkaumodalkon***mu aja, udahngotoripunyakukau.Duakali‘nembak’, malah tidak bayar pula. Kau pikir ini milik Negara.Bolak-balikkamarmandikausaatitu, maularinyakauitukan?Alasanmumauke kamar mandi, padahal kau mau lari, yang benarajalahkau.Yangbayarkamarmuajajuga sopirtaksimuitu.Manusiaapakauini,”omel Dewipenuhemosi. AmirHamzahsaatdiwawancaraimengatakan, saat itu Alim meminta dirinya untuk mengantarkankeBandarBaru.“Diaminta antarkankeBandarBarudenganjanjiakan membayar Rp500 ribu pulang-pergi (PP). Karena yakin, aku pun mengantarkannya

Parkaranjang Tewas Diseruduk Innova

Sambungan Halaman 8 tiba Kijang Innova hitam BK1968T yang dikemudikan toke kentang Maringan Butarbutar(49)langsungmenabrakkorbandaribelakang.Akibatnyakorbanterpental,kepalanyamembenturaspaljalan. Sesudahmenabrak,Maringantancap gas. Untuk menghindari amuk massa, Maringanlangsungmenyerahkandirike MapolsekPaneiTongah.MaringansendirimerupakanwargaJalanKabanjahe,

SaribuDolok,KecamatanSilimakuta. MenurutpenuturanLae(adikipar)korban diRSUDjasamenSaragih,BManurung(43), korbantinggaldiSirpangSigodang.Selama 20tahunperkawinanmereka,hinggakorban meninggalbelumdikaruniaanak.Keduanya juga tidak ada mengangkat anak sebagai penerusketurunankorban. Masih kata Manurung, keluarga korbanyangtinggaldikampunghanyasatu orang, yaitu adik perempuan korban. Sedangkansaudaralaki-lakikorbanyang

lainmerantaukeKalimantandanPekanbaru. “Mau sarapan laeku ini tadi ke bawah,diEmbongituadatempatsarapan.Barudarirumahdia,itulahditabrakdari belakang. Besok mau dikebumikan. Cuma masih kami tunggu saudaranya yanglain,”jelaslaekorbanini. Amatan METRO di Ruang Instalasi JenazahRSUDjasamenSaragih,korban mengalamilukadanpatahrusukkanan. Laluadalukagugusdikakikananbawah korban. (ral/hot/dro)

ketiganya sedang ngelem . Lalu petugas kepolisian langsung memboyong ketiganya ke Mapolsek Perdagangan. Paginya, orangtua Dede yang mengetahui anaknya di kantor polisi langsung menjenguknya. Sementara orangtua Putra dan Yuda sampai siang hari, tak juga kunjung datang melihat.

Kanit Reskrim Polsek Perdagangan Ipda D Sirait, mengatakan ketiga anak itu hanya diberi pengarahan. Selanjutnya akan dikembalikan kepada orangtua mereka masingmasing. “Kita tidak dapat menahan anak itu, karena ini hanya bentuk kenakalan remaja dan mereka sudah diberi arahan,” ujarnya. (mag-4/dro)

Residivis Curanmor Tepergok Ngelem

Sambungan Halaman 8 Swanda warga yang sama Senin (17/ 9), dini hari sekira pukul 02.00 WIB. Dini hari itu, polisi sedang melakukan patroli di sepanjang Jalan Rajamin Purba dan sekitarnya. Melihat tingkah laku Putra, Yuda dan Dede yang mencurigakan, lantas polisi menghampiri mereka. Ternyata

sampaitujuandanakupunmenunggunya hinggapulang,”ujarAmir. Dikatakannyalagi,katanyajam05.00WIB, merekaharuspulangkeMedan,karenadia maukeBandara.Sebabpukul07.00WIB,dia sudahharusberangkatuntukurusanbisnis keJakarta.“Karenapengakuanyaitu,akupun jadiyakindanakutunggulahdia.Terus,pagi ituakutiba-tibadibangunkannya.Diaminta uangkuRp165ribu,katanyamaudibayardi Bandara,karenadiBandarBarutidakadaATM. Akukasilah,ehmalahtaklama,akudengar suara gaduh dan ternyata dia gaduh sama cewek yang ada di kamarnya itu,” ungkap Amir, yang mengaku kalau istrinya lagi mengandunganakpertamamereka.

DiceritakanAmirlagi,sekarangiatidakbisa bilangapa-apalagi,sebabdiasudahmembayarkanuangkamarkepadapihakpenginapandariuangnyasendiriitu.Malamitu,iasama sekali tidak ada membooking cewek. “Aku hanyatiduraja,itupunkarenadikamarituada duaruangannya,kalautidakakumautidurdi taksikusaja,”ujarHamzahsambilmembuat pengaduandiMapolsekPancurbatu. Dewi sendiri mengaku tidak senang denganulahAlimtersebut.“Diaitutidakpunya otak,udahditidurinyaakuduakali,ehmalah maularidantakmaubayar.Kurasadiamaulari darijendelakamarmandi,tapikarenatakada jendeladikamarmandiitu,diapuntakjadilari,” ujarDewi.(roy/pmg/dro)

Sambungan Halaman 8

Barisman,Pasumemilikisakitketerbelakangan mentalsejakusiamuda.AkantetapiPasusempat menikahdansudahmemilikiduaanak.Namun karenahubungankeluargamerekatidakharmonis, Pasu dengan istrinya Paina Sinaga berpisahdankeduaanakmerekapundibawa PainakedaerahBaganBatu. KapolsekSiantarSelatanAKPGDamanik menerangkan bahwa pihak keluarga tidak menuntut dan pihak keluarga Pasu telah membuatsuratpernyataan. MenurutBarisman,rencananyaPasuakan dikebumikanhariiniSelasa(18/9)diDusun Limak,NagoriMerekRaya.(pra/dro)

Rupanya, Warga Merekraya

Sumbayak (52), warga Huta Limak, Nagori Merekraya,KecamatanRaya. Terungkapnyaidentitaskorbanitusetelah pihak keluarga Pasu di Kecamatan Raya membacadimediacetaktentangpenemuan sesosok pria yang tidak bernyawa. Dengan memerhatikan fotonya, pihak keluarganya pun datang ke Ruang Forensik RS Umum DjasamenSaragihuntukmemastikannya. Setelahmemerhatikan,BarismanSaragih(57) memastikanbahwapriatersebutmerupakan adik kandungnya. Menurut keterangan

Agus-Suheri Jadi Curanmor

Sambungan Halaman 8 sepedamotor Honda Mega Pro BK 6683 TWyangdikendarainyaselaludiparkirkan diSimpangSinumpol.Duajambekerjadi ladangnya Kanariman hendak maragat (menyadappohonaren). Saat tiba di lokasi tempat kretanya

diparkirkan,Kanarimanmendapatiduaorang yang tidak dikenalnya sedang mengutak-atikkuncikontaksepedamotornya. Dua pelaku yakni Agus Pitoyo dan Suheri, keduanya warga Pangkalan Budiman Sei Rampahkagetdanlangsungkaburdengan menggunakansepedamotorjenisbebekBK 5047NZkearahSindarraya.(hot)

Sambungan Halaman Satu Korupsi Anggaran Pemkab Kamsul: Saya Diperintah Sugiati Sambungan Halaman 1 Agenda sidang untuk mengkonfrontir keterangan Kamsul dengan saksi dari pihak Bawasda Simalungun, perihal ketegasan laporan keuangan pada tahun 2005, sekaitan dengan adanya penandatangan cek yang seharusnya dicairkan pada 2005 namun dicairkan pada 2006. Dalam persidangan tersebut, Majelis Hakim P.Simarmata kembali mempertegas kepada JPU agar Kamsul dihadirkan pada persidangan berikutnya. Hal ini diperlukan dalam pelaporan keuangan anggaran daerah karena Kamsul bersikukuh bahwa dia hanya menulis laporan yang diperintahkan oleh atasannya saat itu yakni terdakwa Sugiati. Namun dalam laporan keuangan itu, Kamsul tidak menulis semuanya. Akan tetapi ada juga tulisan dari pihak Inspektorat dalam hal ini Bawasda. Sehingga penasehat hukum terdakwa merasa aneh kenapa pihak inspektorat bisa membuat laporan keuangan. Namun Kamsul berkilah bisa saja mereka membuatnya, karena ada temuan penyimpangan dalam laporan keuangan tersebut. “Saya hanya diperintah atasan untuk menulis keuangan, kalau masalah ada kerugian atau penyelewengan, saya tidak tahu. Karena tugas saya hanya menulis laporan keuangan sesuai dengan perintah pimpinan yang saat itu Bendahara Pengeluaran Simalungun yaitu ibu Sugiati,” ucap saksi. Pernyataan Kamsul, mendapatkan reaksi dari penasehat hukum terdakwa, Dewi SH dkk yang meminta kejujuran saksi mengenai laporan keuangan, sebab sebagai staf seharusnya memberikan masukan kepada pimpinan dan bukan membiarkannya. Bahkan ketika ditanyakan berbagai pengeluaran yang menggunakan anggaran daerah, Kamsul terlihat beberapa kali gugup,

terutama dalam pencairan cek. Akibat pernyataan Kamsul yang berbelitbelit dan terkesan menghindar dengan mengatakan lupa, penasehat hukum meminta agar saksi Kamsul pada sidang berikutnya juga kembali dihadirkan dengan maksud untuk mencocokkan (konfrontir) dengan keterangan tiga saksi dari Bawasda. “Sebab ganjil seorang staf kerjanya hanya menulis dan tidak melakukan koreksi, kalau begini terus bisa hancurlah keuangan kas daerah,” ujar pengacara saksi. Sementara saksi Asmarita Purba Mantan Bendahara Dinas Perhubungan Pemkab Simalungun, membenarkan kalau mereka ada menerima uang dari Bendahara Umum Daerah Sugiati. Namun uang itu kata saksi untuk pengurusan dan pengiriman mobil bantuan dari Dirjen Perhubungan Darat dan biaya perjalanan dinas ke Jakarta. “Uang itu hanya untuk mengurus mobil dan biaya perjalanan dinas,” sebutnya. Saksi mengatakan, semuanya sudah sesuai dengan ketentuan. Di mana yang membuat konsep pada waktu Kadis Perhubungan Simalungun Janursing Saragih. Pembayaran item tersebut, pihak Dishub Simalungun meminta uang panjar sebesar Rp29. 900.000 dari total uang yang dicairkan Rp69 juta. Sementara saksi Dinar Saragih dalam kesaksiannya mengatakan, setelah serah terima sebagai Bendahara Umum Daerah dari Sugiati, ada menandatangani berita acara serah terima bersama Sugiati. Sedangkan buku control bank, buku cek, buku bank, buku pembantu dan buku pajak daerah katanya diterimanya dari staf-stafnya. Retno selaku penasihat hukum Sugiati menanyakan, siapa staf nya itu? Dijawab Dinar, stafnya itu adalah Kamsul. Sedangkan Sugiati hanya menyerahkan kunci kas kepada Dinas Saragih selaku penggantinya sebagai Bendahara Umum Daerah. (Far)

PNS ‘Siluman’ Belum Diperiksa Sambungan Halaman 1 perkembangan penyidikan. Sementara, sebelumnya beberapa pejabat sudah dimintai keterangan oleh polisi termasuk juga Sekda Pemko Siantar Donver Panggabean. Namun ke-12 orang yang menggunakan SK PNS palsu tersebut belum ada diperiksa, termasuk juga Asni br Manurung yang disebut sebagai pelaku pembuat SK palsu. Rocky Marbun, yang melaporkan kasus ini ke Mapolres Siantar menyebutkan bahwa kasus PNS ‘siluman’ tersebut sudah masuk ranah persoalan pemerintah. “Bukan dari nilai uang yang telah dikeluarkan oleh pemko untuk gaji kepada PNS ‘siluman tersebut. Akan tetapi, subtansialnya adalah bahwa SK palsu bisa lolos,” katanya. Menurutnya, masyarakat luas tetap menunggu

proses peyelilidikan. Kepolisian Siantar diharapkan dapat mengungkap kasus tersebut hingga tuntas tanpa harus membutuhkan waktu yang sangat lama. Diterangkan, kasus tersebut dibaiknya cepat diselesaikan karena uang daerah sempat dinikmati oleh 12 orang PNS ‘siluman’ untuk gaji mereka pada Agustus kemarin. Sehingga harus ada kesimpulan bagaimana pertanggungjawaban pemko terhadap uang tersebut. “Dalam kasus ini kepolisian diminta supaya bertindak profesional, sebab kemungkinan dalam kasus ini para pejabat ikut terlibat,” kata Rocky. Sebelumnya diberitakan, ada 12 orang PNS ‘siluman’ dengan menggunakan SK palsu lolos terdaftar sebagai PNS di Kota Siantar. SK ke-12 orang tersebut diserahkan oleh Asni br Manurung kepada salah seorang staf di Dispenda bernama Robert Lumban Gaol. Dalam SK tersebut

menyebutkan bahwa 12 orang tersebut adalah PNS dari Pemkab Simalungun yang mutasi ke Pemko Siantar. Lampiran SK tersebut ada tertulis SK dari Sekda, Waikota, BKD, Provsu dan walaupun itu fotocopy tapi Robert tersebut memasukkan nama tersebut kedalam database sebagai PNS di Kota Siantar dan berhak mendapatkan gaji. Selanjutnya 12 orang tersebut bertugas di sejumlah dinas dan kecamatan, juga di kantor lurah dan Satpol PP. Anehnya para kepala SKPD tersebut tidak mengetahui bahwa pegawai di lingkungannya adalah PNS ‘siluman’. Pada Juli akhir, bagian pembendaharaan Dispenda Siantar mengeluarkan uang sebanyak Rp27.566.427 untuk gaji Agustus ke-12 PNS ‘siluman tersebut. Uang itu diserahkan kepada bendahara di instansi masing-masing. (pra)

The Real Galacticos Sambungan Halaman 1 Dengan kekuatan maksimal itu, plus uang yang dikeluarkan untuk gaji dan sebagainya, Real Madrid memang berbicara di kancah Eropa. Apalagi di kompetisi domestik. Hanya saja, Trofi LigaChampionsmasihgagalmasuklemarikoleksi sudahsatudekadelamanya.Terakhirmusim20012002 mereka angkat trofi antar klub benua biru itu. Lalu edisi 2009 hingga kini, Real Madrid masih hobimengoleksipemainkelassatudunia.Dimulai dari era perekrutan Cristiano Ronaldo hingga zamanKarimBenzemadkk.Bedanyausiabintang yang dihadirkan relatif lebih muda dibanding Los Galacticos edisi perdana. Di bawah kendali pelatih nyentrik bermental juara, Jose Mourinho, Florentino Perez sang presiden klub ingin Madrid kembali jawara di Eropa. Dan musim inilah ambisinya. Konstelasinya dong? Oke. Lihat Manchester City masa kini. Disupport syeikh kaya raya, Mansour bin Zayed Al Nahyan, City menjelma jadi klub bertabur bintang. Mereka acap kali disebut mediasebagaipeniruulahRealMadriddenganLos

Galacticos-nya. Dengan asupan dana tak berseri, ManchesterCitymudahsajamemboyongpemain yang diinginkan. Lihatlah sederet pemain ini: Mario Balotelli, Carlos Tevez, David Silva, Edin Dzeko, Sergio Aguero, Yaya Toure. Dan Siapa pun yang diiginkan sang syeikh sesuai kebutuhan Mancini, bisa dilobi lalu dibeli. Bahkan anekdot di kalangan pundit menyebutkan jika saja Lionel Messi dijual Barcelona bertriliun harganya, maka sang syeikh siap membayar. Begitulah konstelasinya. Sama-sama berstatus klub bertabur bintang. Hanya itu. Jika menilik prestasi, sudah jelasjawabnya.Madridsudahpunyasembilantrofi LigaChampionsdilemarinya,sedangkanTheCitizen nihil adanya. Apa kata para juru racik strategi untuk laga ini? Kita mulai dari cuap-cuap Mancini. Di Soccernet diberitakan jika Mancini berencana membangun sejarahlayaknyaRealMadrid.Bukansekarang,tapi 10 tahun lagi. Wartawan usil bertanya yang lebih kepada menyindir soal uang yang dimiliki City. Menurut analisa awak media, uang tak akan mampumembelisejarah.TapiManciniyangdoyan senyum menjawab santai.

“Sudah jelas, kami memang tidak memiliki sejarah seperti Real Madrid. Tapi kami sudah memenangkan beberapa piala kok,” bebernya. “Kamiinginmenangsekarang.Dandalam10tahun ke depan kami akan menjadi tim top seperti Real,” lanjut pelatih yang menggantikan Mourinho di Inter Milan 2010 silam. IsuRonaldoyangsedanggalaudiBernabeujuga diamati pelatih asli Italia itu. Bahkan dia berharap Ronaldo tak dimainkan. “Lebih baik jika mereka meninggalkan Ronaldo di rumah. Ronaldo adalah pemain terbaik dunia,” sebutnya. Kalau Mou yang minta dipanggil The Only One tampak lebih santai menatap laga ini. Baginya yang utama adalah menang dan lolos dari grup maut ini. Grup D memang neraka. Dihuni empat klub jawara empat liga berbeda. Madrid wakili Spanyol, City wakili Inggris serta Ajax sang juara Belanda plus Dortmund yang angkat trofi di Jerman. “Kita berbicara tentang sebuah kelompok dengan empat juara liga dari empat negara besar. Terutama City dan Borussia Dortmund,” kata Mourinho di (*)




Residivis Curanmor Tepergok Ngelem BANDAR- Eka Shaputra alias Putra (16), warga Jalan Bahagia, Kelurahan Perdagangan III, Kecamatan Bandar, yang diketahui residivis pelaku curanmor (pencurian sepedamotor) kembali diringkus polisi. Ia tepergok ngelem bersama temannya Tri Yuda dan Dede

„) Baca Residivis ..Hal 7


„ Sesosok mayat lakilaki itu rupanya Pasu Saragih.


Rupanya, Warga Merekraya SIANTAR– Identitas pria yang ditemukan meregang nyawa di patung rumah adat Jalan Pematang, Kelurahan Pematang, Siantar Selatan, itu akhirnya terungkap, Minggu (16/9) pukul 17.00 WIB. Adalah Pasu Saragih „) Baca Rupanya..Hal 7



„ Alim Kwok



Parkaranjang Tewas Diseruduk Innova SIANTAR- Edi Simarmata (48), warga Sirpang Sigodang, Kecamatan Panei, tewas ditabrak Kijang Innova BK 1968 T di jalan umum Siantar-Saribudolok, Nagori Marjandi Embong, Panombeian Panei, Senin (17/9), sekira pukul 09.30 WIB. Setelah menikah 20 tahun silam, pria yang sehari-hari menganyam keranjang (pengrajin keranjang dan biasa disebut parkaranjang, red) ini tinggal sendiri. Istrinya pergi tak tahu

ke mana rimbanya. Informasi dihimpun, korban melaju ke arah Siantar mengendarai Honda GLPro BK6083TR. Korban berangkat dari rumahnya di Sirpang Sigodang dan berniat sarapan pagi di salahsatu warung di Nagori Marjandi Embong. Tiba di lokasi kejadian, korban hendak belok ke kanan, namun tiba-

„) Baca Parkaranjang ..Hal 7


„ Edi Simarmata terbujur kaku di kamar jenajah akibat kecelakaan lalu lintas. Salahseorang saudarinya terlihat menangisi jasadnya, Senin (17/9).


Agus-Suheri Jadi Curanmor RAYA- Agus Pitoyo (26) dan Suheri (23), keduanya berprofesi sebagai kuli bangunan nekad mencuri sepedamotor (runmor) petani yang sedang diparkir di simpang perladangannya. Kedua pria tersebut berhasil ditangkap warga. Keduanya kemudian diserahkan ke polisi setelah sebelumnya babak belur dihajar massa. Kejadiannya bermula saat korban Kanariman Sinaga (37), warga Bah Pasussang, Nagori Siporkas, Kecamatan Raya, Simalungun hendak menuju ladangnya di Sinumpol Minggu (16/9). Seperti biasanya,

„) Baca Agus..Hal 7

Foto Marihot Sinaga

„ Agus-Suheri, dua tersangka curanmor diamankan di Mapolsek Raya, Senin (17/9).

Pengancam Ibu Kandung Dituntut Setahun Penjara SILOU KAHEAN– Terdakwa Aliando Purba (33) warga Jalan Sarang Panei, Nagori Tani, Kecamatan Silou Kahean tertunduk lesu setelah dituntut setahun penjara. Terdakwa melakukan pengancaman terhadap ibu kandungnya Nurmilah Saragih dan melanggar pasal 335 ayat 1 KUHPidana. Hal itu disampaikan Jaksa Penuntut Umum (JPU) Bilin Sinaga di hadapan majelis hakim Ramses Pasaribu beranggotakan Monalisa dan Adria Dwi Afanti, Senin (17/9). Menurutnya, berdasarkan keterangan di persidangan

„) Baca Pengancam ..Hal 7


„ Dua tersangka judi togel yang diamankan petugas Unit Reskrim Polsek Perdagangan, Senin (17/9).

Sehari, 2 Jurtul Togel Gol BANDAR- Suherman (43) warga Jalan Simponi, Kelurahan Perdagangan I, Kecamatan Bandar, dibekuk polisi di depan rumahnya Minggu (16/9), sekira pukul 14.30 WIB. Dari Suherman, polisi menyita barang

bukti satu buah HP berisi nomor pesanan nomor togel. Malam harinya sekira pukul 21.00 WIB, Pain Bangun Simamora (57), warga Pekan Kerasaan, „) Baca Mau ..Hal 7 „) Baca Sehari..Hal 7


18 September 2012

Pengutipan Retribusi Menyalahi Aturan Kadis Pasar Belum Masuk Kantor

SIANTAR- Aparat penegak hukum diharapkan segera melakukan pemeriksaan terhadap pejabat di Dinas Pasar Kota Siantar, terkait adanya

dugaan manipulasi data jumlah pedagang dan pengutipan retribusi yang dilakukan.

„ Baca Pengutipan Hal 10

Pajak Penginapan Diduga Menguap Dipungut Melebihi Tarif


JALAN RUSAK- Kondisi Jalan H Ulakma Sinaga Nagori Rambung Merah butuh perbaikan serius. Akibat banyaknya lubang di sepanjang jalan ini, banyak pengendara yang mengalami kecelakaan.

Jalan H Ulakma Sinaga Ancam Pengendara SIANTAR- Sejumlah pengendara yang melintas di Jalan H Ulakma Sinaga Nagori Rambung Merah, mengeluh karena badan jalan yang rusak parah.

Banyaknya lubang di jalan tersebut mengancam keselamatan pengendara, terutama

„ Baca Jalan ...Hal 10

BANDAR- Tarif pajak penginapan di Kecamatan Bandar dan sekitarnya diduga menguap. Selama ini pengusaha diminta menyetorkan 10 persen omzetnya per bulan yang akan dimasukkan untuk PAD kecamatan. Namun yang terjadi, pengutipan melebihi tarif yang ditetapkan dan tanpa kwitansi resmi. Menurut Suprianto (41), yang juga anak pengusaha Pengipanan Idola di Jalan Sisingamangaraja Perdagangan I, selama ini petugas kecamatan selalu mengutip uang pajak penginapan mereka sebesar Rp1,5

„ Baca Pajak ...Hal 10

SDN 122396 Di-regrouping

Orangtua Siswa Kesal, Tak Ada Pemberitahuan SIANTAR- Sejumlah orangtua siswa yang anaknya mengenyam pendidikan di SDN 122396 Jalan Rajawali, merasa kesal akibat sekolah tersebut di regrouping (digabungkan) ke SDN 12297 tak jauh dari lokasi. Apalagi proses pemindahan ini tanpa pemberitahuan resmi. Menurut wali siswa Holong Hutagaol (45) kepada METRO, Minggu (16/9), ia merasa kesal melihat tindakan pihak sekolah tersebut. “Kami selaku orangtua kesal melihat pihak sekolah yang tidak


TERABAIKAN- Keberadaan situs sejarah Simalungun di Kota Siantar terabaikan. Seperti situs yang berada di Jalan Pematang Kelurahan Simalungun, Siantar Selatan. Karena tak ada perhatian pemerintah, situs ini menjadi lokasi singgah para gepeng. Parahnya, beberapa hari lalu seorang pria ditemukan tewas di lokasi.

Pemko Abaikan Situs Sejarah Simalungun SIANTAR- Situs-situs sejarah Simalungun yang berada di Kota Pematangsiantar terkesan kurang mendapat perhatian dari pemerintah kota. Padahal situs-situs itu merupakan ciri khas dan ikon Kota ini. Hal ini disampaikan Dian Purba sebagai Sekretaris Himpunan Ma-

hasiswa dan Pemuda Simalungun (HIMAPSI) Cabang Kota Pematangsiantar. Dikatakannya, situs sejarah Simalungun juga merupakan ciri khas Kota Pematangsiantar yang tidak bisa diabaikan. “Apabila situs ini tidak diperhatikan, Kota Siantar akan kehilangan jati diri. Banyak sekali situs sejarah yang tidak men-

dapat perhatian pemerintah. Padahal itu merupakan aset yang sangat berharga,” sebut Dian. Contoh kecilnya menurut Dian, dengan ditemukannya seorang pria tewas di patung atau replika raja-raja Siantar di Jalan Pematang Kelurahan

„ Baca Pemko ...Hal 10

„ Baca Orangtua ...Hal 10

Aksi Pungli Masih Berlangsung Di Timbangan Dolok Merangir

SIMALUNGUN- Dugaan pungli (pungutan liar) yang dilakukan oknum Dinas Perhubungan (Dishub) Pemprovsu Unit Timbangan Dolok Merangir, masih tetap berlangsung. Menurut sejumlah supir, mereka kerap dipungli saat masuk ke timbangan yang berada di Jalinsum Siantar-Medan Nagori Dolok Merangir,

Kecamatan Dolok Batu Nanggar, Simalungun ini. Pungutan liar yang dilakukan para petugas timbangan ini diduga kuat dibekingi oknum pejabat di Simalungun. Pasalnya, aksi itu masih saja berlangsung seolah tak ada sanksi ataupun tindakan real

„ Baca Aksi ...Hal 10

„ Petugas memperbaiki lampu jalan yang rusak. Di Kecamatan Purba, lampu jalan padam bertahun-tahun.

Lampu Jalan Padam Bertahun-tahun PURBA- Mayoritas masyarakat Kecamatan Purba, Simalungun, tak menikmati penerangan lampu jalan yang mereka bayar tiap bulan. Sebab lampu-lampu jalan di sepanjang jalan umum di kecamatan tersebut, sudah bertahun-tahun padam. “Ke mana perginya pajak penerangan lampu jalan yang kami bayar tiap bulan,” kata warga Antonius Saragih. Menurut pria ini, meski lampu jalan di kampungnya sudah lama padam, tidak ada perhatian pemerintah. Pada-

„ Baca Lampu ...Hal 10


18 September 2012

Pajak Penginapan Diduga Menguap Sambungan Halaman 9 juta per bulan. Itu merupakan jumlah yang sangat besar baginya, dan sudah lebih dari 10 persen tarif yang ditetapkan pemerintah. Dituturkannya, omzet mereka selama ini hanya berkisar Rp5 juta sampai Rp6 juta per bulan. Jika dikalkulasikan 10 persen dari jumlah itu, pajak yang harus mereka bayar Cuma Rp600 ribu. ”Tadinya Kepala Seksi Pemerintahan Kecamatan Bandar bernama Samsul yang selalu mengutip pajak bulanan. Dia selalu meminta Rp1,5 juta meskipun tami di penginapan kami hanya beberapa orang saja,” ujarnya. Pengutipan itu jelas memberatkan. ”Sampai hari ini kami tidak tahu berapa sebenarnya tarif pajak bulanan untuk penginapan ini. Saat hendak mengutip pajak, petugas kecamatan itu hanya memberitahukannya melalui SMS, Pak Samsul datang menjemput uangnya. Terus kami hanya diberikan kwitansi biasa saja,”

katanya. Karena merasa diperlakukan tidak adil, belakangan ia mendatangi Pemkab Simalungun di Raya, serta melaporkan keluh kesahnya. Setelah itu, barulah tarif pajak penginapan yang dikelolanya berkurang. ”Sejak Bulan Agustus kemarin tarif pajaknya dikurangi dari Rp1,5 juta menjadi Rp700 ribu. Itupun kami sudah merasa keberatan, sebab setiap bulan kami harus membayar gaji karyawan dan biaya operasional lainnya,” tukasnya. Terpisah, Kepala Dinas Pendapatan Pengelolaan Keuangan dan Aset Daerah (PPKAD) Wilson Manihuruk yang dihubungi METRO, Senin (17/9) menjelaskan, Pemkab Simalungun sudah menetapkan pajak untuk penginapan per bulannya sebesar 10 persen. ”Perhitungannya hanya 10 persen dari keuntungan pengusaha penginapan ini. Pajak itu wajib disetorkan ke PAD, dan dikutip oleh petugas kecamatan secara langsung ke pengusahanya,” katanya.

Dilanjutkannya, besaran tarif itu dapat bertambah sesuai pendapatan dari pengusaha penginapan. Dasar dibentuknya aturan ini adalah untuk memudahkan penyesuaian hasil dan keuntungan pengusaha penginapan ini. ”Aturan ini dibuat untuk menjaga dan melindungi pengusaha dari kebangkrutan. Soalnya jika omzet pengusaha turun, pajak yang mereka setorkan juga akan dikurangi. Setiap melakukan pengutipan pajak bulanan, petugas kecamatan diwajibkan melihat data jumlah tamu yang masuk per hari, agar diketahui jumlahnya setiap bulan,” katanya. Pihaknya juga meminta agar pengusaha segera melaporkan keluhannya jika terjadi kecurangan pada petugas pengutip pajak. Sebab pajak yang wajib disetorkan hanya 10 persen dari omzet pengusaha ini per bulannya. ”Jika ada kecurangan, segera laporkan!” tegasnya. Sementara Samsul yang dihubungi METRO melalui telepon selulernya, membenar-

Aksi Pungli Masih Berlangsung Sambungan Halaman 9 yang dilakukan untuk menghentikannya. Informasi yang dihimpun METRO, dalam sehari berkisar 200 unit truk singgah ke timbangan ini. Saat itulah petugas timbangan meminta Rp50 ribu dari supir per unit truk. Diperkirakan omzet petugas timbangan mencapai Rp10 juta per hari. Jika dikalkulasikan selama setahun, keuntungan yang diraup petugas mencapai Rp3,6 miliar. Aksi pungli ini merupakan rutinitas harian petugas timbangan. Tujuannya adalah untuk melancarkan proses pemeriksaan angkutan yang diangkut truk. Menurut supir Anjas Siregar (46) warga Tanah Jawa, Simalungun, yang sedang mengangkut lima ton kayu rambung, Minggu (16/9), ia kerap menimbang muatan truk di Pos Dolok Melangir. Saat itulah petugas meminta sejumlah uang kepadanya. ”Tadinya saya sempat adu mulut dengan petugas di sana. Soalnya mereka memaksa dan

meminta Rp50 ribu. Alasan mereka adalah untuk uang menimbang, padahal setahu saya retribusinya hanya lima ribu saja. Ini kok menjadi sepuluh kali lipat?” katanya. Dijelaskannya, sebelumnya ia bekerja sebagai supir pengantar barang properti di kawasan Bandung. Jika dibandingkan dengan pos timbangan yang berada di sana, sama sekali tidak ada kutipan liar yang dilakukan petugas timbangan. ”Kalau di Bandung, tidak ada yang minta uang seperti di sini. Sangat jauh berbeda dengan kondisi di Timbangan Dolok Merangir ini. Tanpa dasar yang jelas, mereka langsung meminta uang kepada saya!” katanya. LPPKP Miliki Rekaman Pungli Ketua Lembaga Pengkajian Peningkatan Kapasitas Pemerintah (LPPKP) Simalungun, Sahrul, yang ditemui METRO, Minggu (16/9) mengatakan, selama ini pihaknya sudah berkoordinasi dengan Kejatisu di Medan untuk melengkapi adanya tindakan pungutan liar di jajaran Dishub unit Timbangan Dolok Merangir

ini. Namun lembaga ini juga akan meneruskan laporan kasus ini ke Kementrian Perhubungan (Kemenhub), agar pemerintah pusat mengetahui aksi mereka. ”Kita sudah koordinasi dengan Kejatisu Medan terkait masalah ini. Makanya kita akan melengkapi lagi berkas lainnya, termasuk rekaman pungli yang memang sudah kita miliki sebelumnya,” katanya. Hasil rekaman ini selanjutnya akan dilaporkan langsung pada Kejatisu Medan dan Kementrian Perhubungan ( Kemenhub) di Jakarta. Tujuannya, agar pemerintah secara penuh tidak dirugikan oleh aksi para petugas timbangan. ”Kebanyakan para pelaku pungli selalu melandaskan aksinya untuk setoran kepada pimpinan. Sementara dana kutipan tersebut pada dasarnya fiktif dan jelas melanggar aturan kerja yang berlaku. Makanya kita optimis tidak ada lagi pungli saat adanya sanksi dari instansi terkait. Apalagi ketika bukti rekaman itu kita kirim ke Kemenhub,” katanya. (mag-02/hez)

Orangtua Siswa Kesal, Tak Ada Pemberitahuan Sambungan Halaman 9 memberitahukan regrouping itu. Kami hanya mendengar dari mulut ke mulut bahwa pihak sekolah memanggil orangtua siswa untuk memindahkan anaknya masing-masing,” sebutnya. Dia menerangkan, mereka sendiri tidak tahu sampai sekarang apa alasan mengapa anak-anak mereka disuruh pindah dari sekolah tersebut. Bahkan pada Sabtu kemarin, siswa dan guru banyak yang menangis mendengar sekolah mereka akan ditutup dan digabungkan dengan SDN 12297. “Saya dulu alumni dari SDN 122396, dan sekolah itu sangat unggul dibandingkan sekolah lain yang berada di lokasi. Tapi mengapa gelar itu tidak bisa dipertahankan hingga harus di-regrouping,” paparnya.Yang paling aneh, meski sekolah mau ditutup, pihak sekolah khususnya

kepala sekolah tidak memberitahukan penggabungan itu kepada orangtua siswa. Justru Kepala SDN 12297 M Napitupulu yang lebih dulu mengajak orangtua agar anaknya dipindahkan ke sekolah itu. “Kami sangat kecewa dengan tindakan sekolah seperti ini. Mengapa mereka tidak bisa mempertahankan sekolah yang berdiri sudah berpuluh tahun. Apa sekolah itu tidak lagi memenuhi standar hingga harus di-regrouping seperti ini,” ujarnya. Menurut Hutagaol, melihat sikap pihak sekolah yang termasuk sepele dengan orangtua siswa, mereka sudah terlebih dulu meminta surat keluar. “Saya sudah langsung meminta surat pindah anaknya dengan rasa kekesalan dan kecewa. Anak saya banyak yang lulus dari sini. Bahkan alumni SDN itu sudah banyak yang berhasil, tapi mengapa bisa seperti ini,” jelasnya.

Katanya, mereka juga sudah menghubungi pegawai Bidang Perencanaan Dinas Pendidikan Siantar, Jhonson Sitinjak. Beliau menerangkan, regrouping sekolah sudah direncanakan sejak lama. Pihak Disdik sudah mengevaluasi perkembangan sekolah itu sejak setahun lalu dan katanya sudah tidak memenuhi syarat lagi. “Yang saya tahu di mana-mana sekolah berlomba untuk mempertahankan agar tetap berjalan.Tapiinimengapapihaksekolahtidakbisa mempertahankan sekolah yang selalu menghasilkansiswa-siwaberpretasidanberhasil,” jelas warga Jalan DI Panjaitan Gang Nauli tersebut. Sementara itu seorang siswa yang telah pindah dari sekolah tersebut, Keysa, menyebutkan bahwa untuk kelas VI jumlah siswanya sekitar 12 orang dan kelas VII sekitar 14 orang. Sementara itu Kepala SDN122396 N Siburian yang dihubungi via telepon selulernya, belum berhasil dikonfirmasi. (mua/hez)

kan dirinya yang kerap mengutip pajak penginapan Idola. Namun dikatakannya, pengutipan sudah sesuai tarif. “Kalau yang lama-lama itu, aku sudah tidak ingat lagi. Terakhir kali saya kutip Rp800 ribu dari penginapan itu. Soal omzet mereka, saya tidak tahu!” ujarnya. Sementara Ketua Lembaga Pengkajian Peningkatan Kapasitas Pemerintah (LPPKP) Sahrul mengatakan, pengutipan yang melebihi tarif itu jelas-jelas melanggar aturan. Sehingga kuat dugaan terjadi penguapan PAD dari sektor pajak penginapan ini. “Petugas pajak seharusnya jujur dan memberikan paparan yang jelas kepada pengusaha. Nah, jika pengutipan melebihi tarif ini terulang lagi, pengusaha sebaiknya langsung melaporkannya. Kita menduga ada permainan di sini. Ke mana uang pajak yang dikutip melebihi tarif itu dibuat? Apa benar menjadi PAD semua? Sedangkan kwitansi resmi pembayaran pajak saja tidak pernah diberikan kepada pengusaha tersebut,” ujarnya. (mag-02/hez)

Pemko Abaikan... Sambungan Halaman 9 Simalungun, Siantar Selatan, beberapa hari lalu. Itu merupakan bukti bahwa situs itu dibiarkan dan tidak dipelihara. Bahkan di lokasi terlihat beberapa pedagang bebas mendirikan tenda untuk berjualan. dengan demikian, orang juga bebas masuk ke lokasi tersebut. Dengan adanya kejadiankejadian ini, ia meminta agar pemerintah menertibkan pedagang di sekitar lokasi. Sebab situs itu termasuk hal yang sakral. “Inikan salah satu tempat wisata, tapi sayangnya pemerintah membiarkannya sehingga nilai situs tersebut terabaikan,” katanya. Ia menambahkan, sejauh ini HIMAPSI telah memberikan draf perda tentang situs sejarah Simalungun kepada Pemko Siantar. Namun hingga kini belum disahkan. Menurutnya, HIMAPSI akan kembali menyurati Pemko agar benar-benar memerhatikan keberadaan situs tersebut. Sementara menurut tokoh Simalungun Karmidin Sinaga, corak serta wajah Kota Siantar adalah adat atau suku Simalungun. Sebab Raja di Siantar ini adalah Raja Sangnaualuh Damanik yang merupakan putra Simalungun. Sementara ada banyak situs-situs sejarah Simalungun. Misalkan di Nagori Pamatang Simalungun di sekitar Kolam Detis Sari Indah. Di sana banyak situs-situs sejarah. Namun pemerintah sepertinya kurang memperdulikan keberadaannya. “Situs sejarah Simalungun memiliki nilai yang tak ternilai. Bagi warga Simalungun, situs merupakan tempat yang sakral dan tidak sembarangan,” sebut Karmidin yang juga mantan Sekjen Partuha Maujana Simalungun (PMS). Disebutkannya, pemerintah daerah wajib memelihara dan melestarikan situs-situs itu. “Di daerah lain, pemerintahnya selalu melestarikan corak budaya daerah tempat ia memimpin. Terlepaslah dulu siapa pemimpinnya! Siantar ini adalah tanah Simalungun, namun pemerintahnya kurang memberikan perhatian. Akibatnya situs-situs sejarah menjadi terabaikan,” tambah Karmidin. (pra/hez)

Jalan H Ulakma Sinaga Ancam Pengendara Sambungan Halaman 9 pada malam hari. Salah seorang warga, Boru Hutagaol, Minggu (16/9) mengatakan, kondisi badan jalan yang berlubang tersebut sudah berlangsung cukup lama. “Badan jalan yang rusak itu sudah hampir

setahun lebih. Tapi sampai saat ini pemerintah tak kunjung memperbaikinya,” terangnya. Dia mengaku, awalnya badan jalan yang berlubang itu kecil, namun karena dibiarkan terus menerus lubangnya semakin melebar dan dalam. Tidak itu saja, kondisi jalan yang rusak itu hampir terlihat di sepanjang Jalan H Ulakma Sinaga.

“Karena prihatin melihat lubang jalannya yang lebar dan dalam, sejumlah warga sering menimbun lubang tersebut dengan bebatuan dan tanah. Tapi timbunan itu tidak bisa bertahan lama, apalagi jika musim hujan seperti sekarang ini,” sebutnya. Sambungnya, kalau sudah malam, tidak jarang ada pengendara yang terjatuh karena

mengelakkan lubang. Apalagi lampu jalan di sekitar daerah itu cukup minim. Sehingga pengendara sering kurang memperhatikan jalan yang berlubang. “Kami berharap jalan ini segera diperbaiki. Inikan salah satu prasarana yang dibutuhkan seluruh masyarakat,” ujarnya. (mua/hez)

Lampu Jalan Padam Bertahun-tahun Sambungan Halaman 9 hal setiap bulan saat membayar rekening listrik, masyarakat dipungut pembayaran PPJ (pajak penerangan lampu jalan). Hal senada dikatakan Pak Apul, warga Dusun Purba Hinalang. Menurutnya, di tengah Kampung Purba Hinalang itu, ada dua unit lampu jalan dan sudah padam selama dua tahun. Tapi sampai sekarang tidak diperbaiki. Pantauan METRO, jalan dari Huta Tongah Kecamatan Purba sampai ke Bandar Raya yang berbatasan dengan Kecamatan Silimakuta, terdapat puluhan, bahkan ratusan lampu jalan yang padam. Dari jumlah itu, hanya beberapa saja yang masih menyala dan terbagi di beberapa titik. Menurut Ketua LSM Forum Pengembangan Masyarakat Desa Ronal Purba, pihaknya mendesak pemerintah dan PLN segera memperbaiki dan mengganti lampulampu yang sudah padam itu. “Apabila dalam waktu dekat masih dibiarkan tak menyala, kami akan segera melaporkannya. Masyarakat diwajibkan membayar lampu jalan, tapi masyarakat tidak diberikan hak untuk menikmati lampu jalan. Parahnya, keadaan itu berlangsung hingga bertahun-tahun. Inikan bisa dikategorikan pada tindakan semena-mena terhadap masyarakat,” katanya. (SP/hez)

Pengutipan Retribusi PKL Menyalahi Aturan Sambungan Halaman 9 Hal ini dikatakan oleh Fransiskus, seorang aktivis mahasiswa Fransiskus, Senin (17/9). Menurutnya, dinas pasar telah melanggar aturan karena menggunakan karcis dalam pengutipan retribusi kepada pedagang kaki lima yang tak memiliki KIB. “Karcis tersebut seharusnya dipergunakan kepada pedagang yang memiliki ijin tempat untuk berjualan (KIB). Ini sudah tindakan yang melanggar aturan,” katanya. Padahal selama ini pemerintah kesulitan dalam menertibkan pada pedagang yang tidak memiliki tempat. Namun dengan pengutipan retribusi itu, memungkinkan para pedagang merasa lapak yang dipakai berjualan itu adalah haknya. Tindakan pengutipan retribusi itu tidak memiliki dasar hukum, meskipun sebelumnya sesuai laporan yang disampaikan petugas dinas pasar, kutipan tersebut tetap dimasukkan ke PAD. Setiap pedagang dikutip Rp3 ribu per hari. Sesuai data dari pegawai dinas tersebut, jumlah pedagang yang tidak memiliki Karti Ijin Berjualan (KIB) berjumlah 300 pedagang untuk Pasar Horas dan Pasar Dwikora. Sementara sesuai penelusuran, diperkirakan jumlah pedagang di kedua pasar ini berkisar 1.500 orang. Dengan demikian, ada potensi penyelewengan retribusi Rp2 juta per hari. Kadis Pasar Kota Siantar Sertaulina Girsang yang hendak dikonfirmasi ulang, hingga kini belum masuk kantor. Menurut beberapa stafnya, ia masih mengikuti KKR di luar kota sejak seminggu lalu. Menurut pegawai di kantornya, surat ijin tidak masuk kerja yang dibuat Sertaulina, hanya sampai 18 September lalu. Humas Pemko Siantar Daniel Siregar kepada METRO mengatakan, pihaknya akan mempelajari dan menindaklanjuti dugaan manipulasi data dan retribusi itu kepada instansi terkait. “Kita tunggulah kadisnya pulang, sebab data-data pedagang itupun tidak ada sama saya. Hal ini akan saya sampaikan kepada Kadisnya,” ujar Daniel. (pra/hez)



„ Persiapan barisan prosesi yang diikuti panitia, pengurus Resort GKPS Siantar V, mewakili undangan pada Pesta Olob-olob GKPS Resort Siantar V, Minggu (16/7).


„ Panitia Pesta Olob-olob GKPS Resort Siantar V, Drs Joni Kardos Saragih,Andoharman Saragih SH, Purba menyampaikan laporan dihadapan seluruh jemaat, Minggu (16/9).


Bersukacita 109 Tahun Injil di Simalungun „ Pdt GKPS Resort Siantar V, Pdt Maijon Saragih

„ Utusan Pimpinan Pusat GKPS, Pdt Pendi Jasman Sinaga

„ Ketua 1 Panitia, Drs Joni Kardos Saragih

„ Sekretaris Resort Siantar V, St Ir Ali Umri Purba „ Barisan prosesi dipimpin utusan dari Kantor Pusat GKPS, Pdt Pendi Jasman Sinaga (kiri) dan Pdt Resort Siantar V, Pdt Maijon Saragih (kanan).

„ Barisan prosesi yang dipimpin utusan Kantor Pusat GKPS disambut Tor-tor Inang GKPS Peniel di depan pintu masuk Balai Bolon GKPS.

„ Pimpinan Jemaat GKPS se Resort Siantar V mengikuti kebaktian pada Pesta Olob-olob GKPS Resort Siantar V.

„ Pimpinan Jemaat GKPS se Resort Siantar V mengikuti kebaktian pada Pesta Olob-olob GKPS Resort Siantar V.

„ Jemaat GKPS Damei mengikuti kebaktian Pesta Olob-olob GKPS Resort Siantar V di Balai Bolon GKPS.

„ Inang GKPS Peniel mengikuti kebaktian pada Pesta Olob-olob GKPS Resort Siantar V di Balai Bolon GKPS.

„ Jemaat GKPS Exaudi Tengkoh mengikuti kebaktian Pesta Olob-olob GKPS Resort Siantar V di Balai Bolon GKPS.

„ Inang GKPS Sapangambei Sirpang Tolu mengikuti kebaktian Pesta Olobolob GKPS Resort Siantar V di Balai Bolon GKPS.

„ Inang GKPS Simbolon Panei mengikuti kebaktian Pesta Olob-olob GKPS Resort Siantar V di Balai Bolon GKPS.

„ Ketua 1 Panitia Drs Joni Kardos Saragih menyalami anggota jemaat GKPS Damei yang menerima bantuan Aksi Peduli kasih.

„ Koor Pemuda GKPS Resort Siantar V ikut menyemarakkan Pesta Olobolob GKPS Resort Siantar V di Balai Bolon GKPS.

„ Koor Seksi Bapa GKPS Peniel ikut menyemarakkan Pesta Olob-olob GKPS Resort Siantar V di Balai Bolon GKPS.

„ Song Leader dalam ibadah dibawakan Inang GKPS Peniel pada ibadah Pesta Olob-olob GKPS Resort Siantar V.

CM „ Koor Sekolah Minggu GKPS Resort Siantar V menyumbang koor pada Pesta Olob-olob GKPS Resort Siantar V.

„ Vocal group Inang GKPS Peniel ikut menyemarakkan Pesta Olob-olob GKPS Resort Siantar V di Balai Bolon GKPS.

Teks dan foto: Pholmer Saragih, Lokasi: Balai Bolon GKPS Jalan Pdt J Wismar Saragih, Minggu 16 September 2012

„ Pemuda GKPS Resort Siantar V memeriahkan pesta olob-olob dengan membuka stand menjual makanan dan minuman.


SELASA 18 September 2012




Jl. Jawa (Simpang Mayat) Pematangsiantar

HP 0813 7513 7016

Harga Mulai

Rp 15 Jt

Peluang Usaha

Mengadakan Segala Jenis Sparepart Depot Air Minum Ayo Buruan......................

• Depot Air Minum • RO & Mineral • Air Minum Dalam Kemasan (AMDK)

LOWONGAN PEKERJAAN LOWONGAN KERJA Syarat- Syarat : 1. Wanita Umur Maksimal 29 tahun (belum menikah) 2. Minimal Tamatan SMA/ Sederajat 3. Jujur, berkepribadian baik, dan ramah 4. Mau bekerja keras 5. Bisa mengendarai sepeda motor/ kereta 6. Menguasai Komputer (word /excel) Lamaran diantarkan langsung ke:

Dibutuhkan wanita tamatan SD, SMP, SMA sederajat, Akper untuk di didik dan di pekerjakan menjadi: • Baby Sister • KakakAsuh • Perawat Jompo

Gaji Rp 700 rb s.d 1.300 rb / bulan bersih

Tinta Printer Canon & Epson ( Beli 4 Gratis 1) Modem Gsm Flash, Xl,vodafone, Smartfren , Super Murah!! Printer Canon & Epson Tinta Infus Tabung Besar! Wowww!!!! Assesoris Komputer Dengan Harga Super Murah

Telp. 061 - 76220497; 0813 7707 4679

Kredit Komputer Dan Laptop (proses Cepat) Tanpa Dp !!!!!!!

(Depan Kantor Pos) Pematangsiantar

Cabang II : Lt. II Siantar Plaza, Pematangsiantar

Hp. 0852 5218 1000




dengan melampirkan : - Fotocopy KTP & KK - Pas Photo 3x4 1 lembar - Fotocopy Ijazah terakhir

Cabang I : Jl. Sutomo No. 5B

(Bergaransi Resmi Nasional)

Hubungi: YAYASAN MUTIARA HATI Jl. Binjai KM 10.8 Komp. Villa Mulia Mas Blok A 1/3 Medan

Toko Haritsa Kids Store

Toko Haritsa Kids Store



ACER E1 - 431


A. Untuk Refleksi dan Massage B. Umur 30-45 tahun (pria/wanita) C. Berpenampilan rapi, menarik, sopan, jujur dan rajin D. Pengalaman tidak diutamakn E. Mengikuti peraturan dan perintah dengan baik Kirim surat lamaran, photocopy KTP, daftar riwayat hidup dan pasphoto anda ke: RAJA OUKOP, Jl. Merdeka No. 118 P. Siantar. Telp. 0823 6765 9999; 0622 - 432993 (Tidak Melayani SMS)

DP 0%

• Wifi • Intel Core B820 • Webcamera • 2 GB DDR3 • 14.1” HD LED Display • 320 GB HDD • DVD Rw Super Multi • Battery 6 cell

Cicilan Rp. 393.000,Syarat : Fotocopy KTP & Slip Gaji

FINACOM SOLUTION Jl. Patuan Anggi No. 21 Pematangsiantar Call: 0622 – 5891902, HP. 082161843444 / 082364464487


Seorang wanita untuk jaga Counter Handphone. Syarat: • Pendidikan minimal SMA • Mengerti komputer • Yang berpengalaman dibidang ponsel dan ramah Bagi yang berminat lamaran diantar langsung kealamat:

KPM JAYA PONSEL Jl. Persatuaan No. 58 Parluasan Selambat-lambatnya 1 minggu setelah iklan ini terbit

DIJUAL RUMAH ount Disc Nokia 1280 Rp. 195.000

Nokia X1-01 Rp. 380.000 + MMC 2 Gb

Nokia X2-02 Rp. 705.000 + MMC 2 Gb

Nokia C1-01 Rp. 485.000 + MMC 2 Gb

Nokia C2-03 Rp. 820.000 + MMC 2 Gb

Nokia X2-01 Rp. 685.000 + MMC 2 Gb

Nokia N100 Rp. 240.000

Nokia X2.00 Rp. 890.000 + MMC 2 Gb

Nokia N101 Rp. 325.000 + MMC 2 Gb

% 10-20 Tanpa DP

lus aP a u n Sem erda si P an Gar Coy al ion s a N

Hanya 10 Unit

Harga Terjangkau, Lokasi Strategis dan Nyaman


0821 6331 7669 0852 9602 9651 0813 6230 3662

KESEMPATAN BERKARIER PT BUMIPUTERAMUDA 1967 (PT BUMIDA1967) mengundang tenaga-tenaga energik dan potensial untuk dididik dan berkarier sebagai:

1. MARKETTING 2. SUPERVISOR MARKETTTING 3. ACCOUNT OFFICER BANK (AO. BANK) Persyaratan Umum: a. Pendidikan min. SLTA sederajat (1) dan D3 (2,3) b. Usia minimal 23 tahun c. Mempunyai kendaraan sendiri min. roda 2 d. Komunikatif, ulet, dan pantang menyerah e. Dapat bekerjasama secara Team f. Dapat mengoperasikan komputer (3) g. Dibutuhkan Laki-laki, dengan pengalaman kerja di Perbankan maupun Leasing (perkreditan) (3) Lamaran lengkap disertai copy Ijazah, pas photo & Curiculum Vitae dikirim kepada:

PT BUMIDA 1967 Jl. Asahan (Sangnawaluh) Komplek Megaland Blok A No.12, Pematangsiantar

PT WESLY TOUR & TRAVEL Melayani Penjualan Tiket Pesawat dan Tiket Kapal Laut 37

Menjual HP baru, BlackBerry, Samsung, Nokia, Mito, Maxtron, Venera

Paket Holyland : Ziarah Tour 11 Hari 22 Sept, USD 2450 18,15, 22 Okt, USD 2450 6,19, 26 Nov, USD 2450 3 Des, USD 2550

20, 21 Des, USD 2850 21 Des, USD 3100 (12 Hr) 25 Des, USD 3100

Harga & tgl sewaktu2 dapat berubah Jl. Kesatria No. 18 BDB Simp. Lor. 21 P. Siantar Hub: Telp/Fax: 0622-7552525; 0878-92207468 HP 0813-6200-9333


DIJUAL RUKO Lokasi di jln. Kartini no. 14b (kompleks KDS) ukuran 4x15, 3 lantai e k s . C o ff e e S h o p , mewah & lokasi sangat strategis. Hubungi:


Obat kuat terbaru saat ini paten, membuat ereksi lebih lama, tanpa efek samping isi 10 tablet tanpa bekas


Terobosan terbaru obat VIMAX menambah ukuran alat vitl secara permanent sekaligus menambah kejantanan pria, isi 30 capsule

PUSAT PELANGSING HERBAL PELANGSING SUPER CEPAT Cukup 1 pak Fatloss langsung terbukti turun berat badan 8 - 12 Kg dalam jangka 1 Minggu, 100& alami dan tanpa efek samping, dijamin CREAM PYDR + VACUUM 100% original import 1 kali pakar langsung terbukti besar, kencang, padat dan mengembalikan payudara, baik gadis atau ibu-ibu dijamin PENINGGI BADAN SUPER

SinShe Aciu / Aling


Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0813 6017 0199; 0852 7695 4557

Melayani pengobatan Full Body Refleksi Khaki Terapi Lilin Kop / Bekam

Alamat Kantor

Jl. Melanthon Siregar No. 44 P. Siantar Telp. 0622 - 430946; HP 0888 0730 0863


Buka : Jam 09.00 - 21.00 WIB NB:Lagi membutuhkan beberapa anggota di peter refleksi yang berpengalaman di Bidang Refleksi





Spontan kuat keras dan tahan lama 3 X lebih kuat dari obat kuat lainnya, aman di konsumsi tanpa efek samping


Sekali semprot ampuh tambah gairah seks pria tanah lama, tanpa menimbulkan rasa kebas, panas, aman dan tanpa TERSEDIA: •Gemuk Badan •Obat Jerawat •Pemerah Bibir •Pembesar Pantat •Sedia aneka kondom antik r efek samping a Ant IS !Melayani pesanan luar kota dan kebutuhan sex P/W dewasa AT Via Transfer - Paket Kilat GR PIN BB 295597B6 Capsul USAtelah dan terbukti meninggikan badan dengan cepat, memperkuat daya ingat, 1-2 minggu bertambah tinggi 5 - 8 CM pasti (semua umur)

ASEN HP 0852 7558 7299 HERBAL

Jl. Sutomo No. 153 P. Siantar (Depan Bank NISP)

Peter Refleksi

Kantor Broker Properti


Harga Promosi

Jl. Tanah Jawa No. 83 (depan ruko baru, Simp Jl Cokro) ) P. Siantar Jl. Cokro No. 349 Simp. Malik Kisaran Jl. Sirandorung NO, 63 Simp. Jl. Pardamean Rantau Prapat

HILANG Telah hilang surat tanah An. Salmon Butar-butar, alamat Jl. Sekka Nauli P. Siantar, dengan nomor 648/04/KS-VI/2010, dengan luas 10 x 20 M. Hilang Jl. Sekka Nauli P. Siantar sekitarnya. Bagi yang menemukan hub: HP 0823 6935 2872 Tidak akan dituntut tapi diberi hadiah yang sepantasnya.


18 September 2012

etelah putus dari Anji eks personil ‘Drive’, Rini ‘Idol’ mengaku kapok berpacaran dengan pria yang memiliki profesi sama. Kalaupun nantinya dia memiliki kekasih baru, Rini ingin mencari yang bukan dari sesama artis. “Nggak usah seprofesi biar nggak ribet dan lain-lain. Bukan hanya enak karena


sama-sama dibidang entertainment. Tapi mandang pribadinya juga. Aku jalin hubungan yang beda-beda shift bukan karena pekerjaannnya aja,” ujar Rini diRCTI, Kawasan Kebon Jeruk, Jakarta Barat, Senin (17/9). Rini mengakui kini dia memiliki kekasih yang berprofesi sebagai pekerja kantoran.Pria yang bersuku

MENYANDANG status janda tak membuat Chantal Della Concetta merasa terbebani. Presenter dan model majalah dewasa ini mengaku tak perlu repot dengan statusnya itu. ”Nggak usah dibikin repot, santai aja. Kalau pikirannya repot, jadi repot. Kalau pikirannya ribet, bakal

MADONNA kembali menyulut permusuhan dengan Lady Gaga. Kali ini Madonna menyebut Gaga imitasi, dalam konser di Atlantic City, New Jersey, Amerika Serikat. Permusuhan Madonna dan Lady Gaga dimuali ketika lagu Born This Way’milik Madonna dibandingkan dengan lagu Madonna berjudul Express Yourself(1989). ”Aku aku akan mendedikasikan lagu berikut ini untuk Lady Gaga. Anda ingin tahu? Karena aku mencintainya. Aku sungguhsungguh mencintainya. Imitasi adalah bentuk sanjungan tertinggi untuknya,” kata Madonna di konsernya, seperti dikutip Contactmusic.Madonna juga sebelumnya bercanda kalau ia dengan senang hati membantu Gaga untuk menulis lagu. ”Suatu hari, secepatnya, kami akan berada di panggung bersamasama. Tunggu saja,” katanya. (idc)

Jawa ini sudah diperkenalkan kepada kedua orangtuanya. tapi menurut Rini, kedua orangtuanya tahu ia berpacaran. “ Yang jelas udah tahu kalau kitanya pacaran. Nggak mau nanya-nanya juga sih karena masih nyantai. Ini masih ditahap ini dulu,” ujarnya. Rini yang sudah berpacaraan hingga 3 tahun hingga kini

ribet. Kalau kita santai ya santai,” ujar Chantal. Misalnya ketika sang anak sedikit mengalami gangguan kesehatan, Chantal menyikapinya dengan tenang dan bijak. “Anak batuk sih wajar, ya namanya juga udara kayak gini. Kalau segala macam (kegiatan) nggak boleh, kasihan juga,” ujarnya. Chantal pernah menikah dengan Hans Lazuardi dan dikaruniai seorang putra, Nathaniel Trevor Lazuardi, pada 2004, dan seorang putri, Mazel Peach Lazuardi, pada 2009. Pernikahan mereka hanya bertahan beberapa tahun. Chantal juga tidak merasa keberatan dengan klaim dirinya jadi salah satu icon wanita terseksi di tanah air. “Emang image seksi ada yang salah? Buat aku image seksi itu confident. Seksi itu kita merasa nyaman untuk tubuh kita, kenapa kita takut ama tubuh kita,” ucap Chantal. Semua orang menurut Chantal berhak untuk menjadi seksi. Baik laki-laki ataupun perempuan. Karena setiap orang mempunyai tipikal keseksian yang tak sama. ”Kenapa kita harus takut jadi seksi terutama perempuan. Laki-laki juga belum tentu nggak seksi kan, ada faktor seksinya. Mungkin berbeda dengan perempuan. Mungkin bagi sebagian perempuan, laki-laki pakai kemeja putih udah seksi ataupun lainnya,” lanjut presenter acara dewasa Sexophone ini. Selain itu, seksi bukan hanya terpaku pada bentuk tubuh yang menawan. Sebuah intelektualitas bagi Chantal juga menunjang sebuah keseksian seseorang. “Perempuan yang pintar menurutku itu seksi, perempuan yang percaya diri juga seksi,” cetusnya. (BCG/jpnn)

belum memikirkan untuk menuju ke mahligai bahtera rumah tangga. Rupanya Rini masih ingin mengumpulkan pundi-pundi uang dan mengembangkan karirnya. “ Masih pengen menikmati masa yang sibuk kerja mencoba satu yang baru. Kerjaannya masih nyanyinyaanyi aja belum coba bidang lain,” tandasnya. (tr/int)

SUSAN Bachtiar phobia memakai sepatu tertutup. Karena memakai sepatu jenis ini, Susan harus menghirup aroma tidak sedap pada kakinya. Tidak hanya itu menurutnya sepatu tertutup dapat menimbulkan panas pada kakinya. Jadi jika berpergian Su-

san lebih nyaman pakai sepatu yang terbuka. “Lagipulajustmystyleaja.Pakesepatu tertutup itu kalau lagi terpaksa aja. Soalnya lebih ke negara yang memang pakai boots,” ujar Susan di Press conference OLAY Changing Life, Diva Reunion Concert, Hard Rock, Jl MH Thamrin, Jakarta Pusat, Senin (17/9). Bintangfilm‘PerempuanPunyaCerita’ ini mengaku lebih cocok pakai sepatu berbahan kain yang dapat menyerap keringat. “Seperti katun yang paling aman. Apalagi untuk perempuan, kondisi badannya kan lain dari pria Untuk kesehatan wanita, dokter juga banyak menyarankan untuk memang bisa memakai bahan katun,” ujarnya. Tetapi karena begitu banyak model, katun terbatas jadi diperlukan perpaduan bahan yang lain. ”Tapi memang perpaduan bahan membuat fashion menjadi lebih menonjol,” ujarnya. Sekedar diketahui mantan isteri Sunardi ini mengatakan khusus masalah fashion, biasanya ia memakai apa yang dianggap nyaman dan cocok dengan gayanya. “ Nggak peduli apa gaya bajunya atau mereknya apa, yang penting comfortable,” tandasnya. (tr/int)




18 September 2012

„ DR Capt Anthon Sihombing MM.

„ Janter Sirait SE

„ Gus irawan

„ DR Capt Anthon Sihombing MM, Janter Sirait SE, Binton Tindaon SPd, Timbul Jaya Sibarani SH, H Suyono, Ir Makmur Damanik dan Pantas Sitanggang memberikan hadiah utama 1 kulkas kepada pemenang saat acara halal bihalal Partai Golkar Simalungun di kantor Partai Golkar Jalan Asahan, Sabtu (15/9).

„ Binton Tindaon SPd.

„ Timbul Jaya Sibarani SH

„ H Suyono

„ DR Capt Anthon Sihombing MM, Janter Sirait SE serta Binton Tindaon SPd foto bersama dengan sesepuh Partai Golkar yang berasal dari beberapa kecamatan di Simalungun, sebelum menerima bingkisan.


„ Sekitar 1.200 warga hadir dalam acara halal bihalal bersama Partai Golkar Kabupaten Simalungun di sekretariat.

„ Bidner Butarbutar, Rustinem Girsang didampingi Periahken Tarigan SE serta panitia lainnya saat pencabutan kupon lucky draw.

„ Janter Sirait SE sedang bercanda bersama anak yatim piatu sebelum memberikan tali asih saat acara halal bihalal bersama Partai Golkar.

„ Anggota DPR RI Fraksi Partai Golkar DR Capt Anthon Sihombing MM menyerahkan bingkisan kepada sesepuh Partai Golkar.

„ Dari kiri: DR Capt Anthon Sihombing MM, Timbul Jaya Sibarani SH, Janter Sirait SE, Ir Makmur Damanik.

„ Ketua DPD II Partai Golkar Simalungun Janter Sirait SE didampingi Sekretaris Ir Makmur Damanik memberikan hadiah lucky draw kipas

„ Sekitar 1.200-an warga hadir dan serius mengikuti acara demi acara halal bihalal Partai Golkar Kabupaten Simalungun.

„ Ketua DPD II Partai Golkar Janter Sirait SE yang juga Anggota DPRD SU berjoget ria bersama masyarakat yang hadir .

„ Janter Sirait SE, DR Capt Anthon Sihombing MM, H Suyono saat akan memberikan hadiah lukcy draw .

„ DR Capt Anthon Sihombing MM ,Janter Sirait SE foto bersama dengan pengurus DPD AMPI Kabupaten Simalungun.

„ Janter Sirait SE, DR Capt Anthon Sihombing MM foto bersama dengan Ketua HWK Simalungun Tiarma Simbolon SPd dan pengurus.

„ Janter Sirait SE didampingi istri Tiarma Boru Simbolon SPd sedang bernyanyi didampingi trio Gabe Arta 2000.

„ Ketua DPD AMPI Kabupaten Simalungun Sahat Pardede memberikan hadiah kepada Togi Samosir sebagai pemenang.

„ Janter Sirait SE, DR Capt Anthon Sihombing MM duduk berdampingan dengan Gus Irawan Pasaribu.

„ Ketua AMPG Kabupaten Simalungun Benfri Sinaga memberikan hadiah undian lucky draw kepada pemenang.

Teks foto: Tohap Manurung SH

Lokasi: Sekretariat DPD II Partai Golkar Simalungun Jalan Asahan Sabtu,15/9.



18 September 2012

Lorenzo Juara, Pedrosa Sial, Rossi Hadiahkan Kado Manis

Pebalap Yamaha, Jorge Lorenzo, menjuarai GP San Marino, Minggu (16/9), ketika rival terberatnya dari tim Repsol Honda, Dani Pedrosa, mengalami nasib buruk. Dengan hasil ini, Lorenzo kembali menjauh dari kejaran Pedrosa, dengan keunggulan 38 poin atas kompatriotnya dari Spanyol itu, dan balapan tersisa lima seri lagi. Balapan di Sirkuit Misano ini pun menjadi arena pertunjukkan Valentino Rossi, yang sukses finis di posisi kedua. “The Doctor” membuktikan tekadnya, yang ingin mempersembahkan hasil bagus sebagai kado perpisahan dengan Ducati dalam balapan terakhir di depan publik Italia. Posisi ketiga ditempati pebalap Gresini Honda, Alvaro Bautista, yang berhasil mengatasi tekanan pebalap Yamaha Tech 3, Andrea Doviziso, menjelang akhir balapan. Pada tikungan terakhir sebelum menyentuh garis finis, Dovizioso nyaris melewati Bautista, tetapi pebalap Spanyol ini sukses mempertahankan posisi dengan keunggulan hanya 0,03 detik. Jalannya Balapan Saat lampu merah padam tanda balapan dimulai, Rossi melakukan start yang bagus karena dari urutan keenam, dia langsung menyodok ke posisi kedua, persis di belakang Lorenzo yang menjadi pebalap terdepan. Ini terjadi karena Pedrosa, yang meraih pole position, harus start dari posisi paling belakang akibat mengalami masalah mesin, sehingga harus mengganti motor. Namun di lap kedua, nasib buruk menimpa Pedrosa, yang mengalami kecelakaan. Ketika sedang berusaha merangsek ke depan untuk memperbaiki posisinya, dia dihantam pebalap Pramac Ducati, Hector Barbera, saat akan menikung ke kiri. Pedrosa pun harus melupakan impian untuk meraih poin di balapan seri ke-13 ini. Tanpa Pedrosa, Lorenzo tak mendapat perlawanan berarti. Rossi yang berusaha membuntutinya belum mampu bersaing karena hingga lap kelima, “The Doctor” tertinggal lebih dari 1 detik. Persaingan seru

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 LOWONGAN KERJA: Perusahaan yang bergerak dibidang distributor membutuhkan karyawan/ti, usia max 32 tahun, pendidikan SMA/ SMK sederajat, D1, D3 dan S1 (semua jurusan) untuk posisi Adm, Staf Gudang, Marketing, Pengawas, OB/OG, Asmen dan Kabag, bawa lamaran langsung test ke: CV Sentosa Abadi Jl. Medan KM 6.0 No. 58 (+ 5 M dari Simp. HKBP / Radio Diakoni Bongbongan) P. Siantar. Fasilitas: Gaji pokok, jenjang karir, komisi, mess (tempat tinggal) dan bonus YAYASAN SEPA HUSADA: Menerima tenaga kerja khusus wanita, baik gadis/janda, dengan usia 17 s/d 45 tahun, untuk dilatih & dipekerjakan sebagai perawat jompo/orang tua sakit, baby sitter. Syarat: Ijasah asli, KTP/Kartu Keluarga, gaji berkisar Rp. 1.000.000 s/d 1.700.000/bulan. Lamaran diantar langsung ke Jl. Pasar 3 no. 45 A Krakatau, Hub. 0811 602 145; 0852 6114 3441 DIBUTUHKAN SEGERA: Tukang jahit, tukang bordir, tukang sablon, tukang pola, berpengalaman atau tidak berpengalaman, alamat Jl. Ade Irma P. Siantar HP 0813 3814 0437; 0852 7006 6007 LOWONGAN KERJA: Kami perusahan Consumer Goods yang bergerak dibidang makanan ringan, Membutuhkan tenaga kerja dibidang 1,Kepala Gudang (LK). 2,Supir (LK). Dengan persyaratan sebagai berikut : -Berpengalaman dibidangnya min 2 tahun (1),-Pendidikan SMA/ Sederajat (1), -Rajin,Jujur,& Bertanggung jawab(1,2),-Mempunyai SIM B1(2),-Dapat bekerja sama dalam team work (1,2). Surat lamaran lengkap diantar langsung ke : SEDAP JAYA FOOD INDUSTRIES. Jln. Cipto No. 39 Pematangsiantar DIBUTUHKAN: 2 Orang pria tukang las listrik umur 25 - 45 tahun, berpengalaman 2 tahun dalam mengelas dan 1 Orang supir coltdiesel Umur 25-45 tahun berpengalaman bawa mobil 2 tahun. Langsung wawancara di Jl. Cipto No. 39 Pematangsiantar.

justru untuk memperebutkan posisi kedua, karena Stefan Bradl, Andrea Dovizioso, dan Alvaro Bautista terus membuntuti Rossi. Kecelakaan juga menimpa pebalap Yamaha Tech 3, Cal Crutchlow, yang jatuh di lap kelima, ketika berusaha melewati Dovizioso. Kegagalan ini membuat Crutchlow tak bisa membuka harapan untuk membuat sejarah sebagai pebalap Inggris pertama setelah Ron Haslam pada 1987, yang berhasil naik podium secara berturut-turut. Pada balapan di Brno, Ceko, Crutchlow berhasil finis di posisi ketiga. Di Misano ini, Crutchlow berpeluang melakukannya, apalagi Pedrosa sudah terlebih dahulu meninggalkan balapan. Sayang, impian membuat back-to-back itu sirna, karena mantan pebalap Superbike itu pun gagal melanjutkan lomba. Memasuki lap ke-14, Lorenzo terus membuat jarak dengan Rossi karena juara dunia 2010 tersebut sudah memimpin 4,587 detik. Sementara itu Rossi kian kuat mendapat tekanan dari Bradl, Dovizioso dan Bautista. Tetapi juara dunia tujuh kali MotoGP tersebut terus bertahan. Tampaknya, sasis dan lengan ayun baru yang dipakai dalam balapan ini bekerja dengan baik, sehingga sampai dengan separuh balapan, Rossi bisa bertahan di barisan depan. Pada lap ke-16, Bautista naik satu strip ke posisi keempat, setelah menyalip Dovizioso. Selanjutnya, pebalap Gresini Honda ini mulai mengincar Bradl di posisi ketiga. Benar saja, pada lap ke-19, Bautista, yang menjuarai GP San Marino pada 2008 ketika masih di kelas 250 cc, berhasil menyalip Bradl. Sementara itu Lorenzo kian jauh di depan dengan keunggulan 5,524 detik atas Rossi. Bautista, Bradl, dan Dovizioso bertarung ketat memperebutkan posisi ketiga. Tiga pebalap tersebut hanya berjarak sekitar 0,2 detik di antara mereka, sedangkan Rossi agak menjauh karena unggul lebih dari satu detik atas Bautista. Tampaknya “The Doctor” bisa mempertahankan posisinya karena kecepatan Desmosedici GP12 tunggangannya cukup konsisten. Saat balapan tersisa lima lap lagi, Ben Spies mulai merangsek ke depan untuk memberikan ancaman kepada Dovizioso. Rekan setim

DAIHATSU PAKET MURAH 100% DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar


• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

CAPELLA PEMATANGSIANTAR • All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15%(hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!




• All New Avanza ..Ready, Bonus Lengkap ! • All New Avanza VELOZ ...Bonus Lengkap !! • New Rush ..... Ready!! • Grand New Innova ...Ready!! • Grand New Fortuner VNTurbo ... Ready!! • Menangkan Lexus GS250, New Yaris, New iPad, Samsung Galaxy S III, dan hadiah lainnya. Hub : RICKY. M / Hp: 0812 6505 3191 – 0853 7199 MITSUBISHI 100% BARU Suku bungan 0% •9499 Pajero Sport • Outlander • Triton • Fuso • Colt SALES• L300 EXECUTIVE TOYOTA SIANTAR. Diesel • T120 Hub : Fernando Gultom, Data dijemput, Cash & Credit PROSES CEPAT..!! 0813 6169 4479 DIJUAL: TOYOTA KIJANG LGX TAHUN 2004 1.8 EFI, HUB. HP 0853 7078 6233 (NO SMS)

PROMO KHUSUS HONDA READY STOCK ALL TYPE HONDA • Honda Brio • Honda Jazz • Honda Freed • Honda CRV • Honda City • Honda Civic • Honda Accord • Honda Odyssey Dapatkan promo khusus Honda CRV bunga 0% sampai 3 tahun. Hub: (Sales Executive Honda Arista Perwakilan Siantar) 08529666 4487 (Donnie R).

Valentino Rossi (kiri) menyaksikan selebrasi kemenangan Lorenzo di San Marino. Pada balapan serupa, Dani Pedrosa mengalami kecelakaan. Lorenzo ini, yang musim depan akan memperkuat tim Pramac Ducati bersama dengan pebalap Moto2, Andrea Iannone, ikut dalam pertarungan memperebutkan posisi

keempat. Sementara itu Bautista mulai sedikit lepas dari tekanan. Satu lap berselang, Bradl harus terima kenyataan turun dua strip sekaligus karena

lebih dulu dilewati Dovizioso, sebelum Spies pun melakukan hal serupa. Dengan demikian, Dovizioso dan Spies yang bertarung untuk memperebutkan posisi keempat. Mereka juga kian merapat dengan Bautista di urutan ketiga. Di lap terakhir, Dovizioso, yang musim depan gantikan Rossi di Ducati, persis di belakang Bautista. Tetapi pebalap Italia ini tak mampu meraih posisi ketiga, karena dia sedikit lebih lambat menyentuh garis finis. Lorenzo dengan nyaman meraih kemenangan karena dia unggul 4,398 atas Rossi, yang finis di peringkat kedua. Tetapi bagi Rossi, hasil ini menjadi sebuah prestasi yang besar, karena sesuai janjinya, dia mampu memberikan hasil membanggakan sebagai kado perpisahan dengan Ducati di depan publik Italia. Ya, GP San Marino ini menjadi balapan terakhir Rossi bersama Ducati di rumah sendiri. Pasalnya, musim depan dia akan kembali bergabung dengan Yamaha, untuk menjadi tandem Lorenzo. Pengembangan Ducati di seri ini memberikan hasil yang memuaskan, karena Rossi bisa mengalahkan para lawan yang pada seri-seri sebelumnya sulit dikalahkan. Setelah balapan ini, para pebalap langsung mempersiapkan diri menghadapi seri ke-14 di Sirkuit Motorland Aragon. Balapan tersebut akan berlangsung pada 30 September mendatang. (int)

Penutupan PON Dijanjikan Lebih Meriah WAKILPresiden,Boediono,dipastIkanakanmenutupPONXVIII.Pihak penyelenggara menjamin kalau seremoni penutupan tersebut lebih meriahdibandingpestapembukaan. Hal itu disampaikan, event organizer penutupan PON, Helmi Yahyah dalamacarasilahtuhrahmiGubernur Riau, Rusli Zainal dengan wartawan, Minggu(16/9)malam. Menurut Helmi penutupan PON akan lebih banyak melibatkan artis ibukota. Misalkan, Ahmad Dhani, Ari Laso, Titi DJ dan Ruth Sahanaya. Selain itu akan ada juga penyanyi dangdut Cici Paramida yang akan

DIJUAL: Suzuki escudo tahun 2004, 1600 cc, warna hitam, komplit, mulus, mesin sehat, harga 125 jt/nego, hub. HP 0812 6414 499 DIJUAL: Daihatsu espas, pick up 2005, hitam, kondisi mulus dan sehat, harga 48 jt/nego, hub. HP 0812 6217 217

LESTARI MOTOR: Menjual segala jenis sepeda motor Honda, Suzuki, Yamaha dan second, cash n kredit: • Honda Absolute Revo • Honda SX 125 • Scoopy, Vario Techno • Mio, Mio Soul • Jupiter Z • Satria FU, Spin, hub. 0622 - 22305; 24077; HP 0853 7070 9507; 0852 7601 5848. Jl. Merdeka No. 330 P. Siantar

RUMAH DIKONTRAKKAN: Satu unit rumah di Jl. Pendidikan No.16, Kelurahan Suka Dame Kecamatan Siantar Utara dikontrakkan. Lokasi strategis cocok untuk hunian dan bisnis, 30 meter dari Wisma Musyawarah dan 250 meter dari SMPN 7 P Siantar. Hub: 081361470144. CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

Pasang Iklan Anda Hub. Hub.: 0622 -


CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

membawa tembang Melayu. “Acara penutupan akan lebih happy dibanding pembukaan. Karena penutupan ini lebih pada ucapan terimakasih kepada atlet, panitia dan wartawan,” kata Helmi. Helmi menjelaskan, hiburan penutupansudahdimilaipukul16.00 sore waktu setempat. Upacara penutupan PON oleh Wapres pada pukul 19.00 malam. “Penutupan nanti kita sudah mempersiapkan daya listrik tujuh MW. Kita masih memperkuat atraksi leser lewat ilusi laser terbaik di Asia,” kata Helmi. Sementara itu, Gubernur Riau

memastikan kalau penutupan akan tetap diberlakukan tiket masuk. Hanya saja harga tiket tidak semahal waktu pembukaan. “Pokoknya tiket nantipalingmahalcumaRp200ribu dan paling murah Rp 50. Ini sematamata untuk membatasi membludaknya penonton,” kata Rusli. Disinggung jumlah dana penutupan, Rusli mengenal untuk merincikan. Menurutnya dananya akan lebih murah di banding Sumatera Selatan (SEA Games). “Yang jelas, kita lebih murah dari Sumsel, malah dananya nanti tak sampaiseparohnya,”kataRusli.(int)

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800.

CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

JOVNI CELLULER: Menjual HP baru, dengan harga terjangkau mulai dari Rp 200 rb + Memori 2 Gb, dengan fitur lengkap seperti: •Kamera •Radio FM •Dual SIM GSM •MP3, dengan beragam model HP terbaru segera kunjungi: Jl. Cipto No. 59 P. Siantar (Lewat Simp. Surabaya)

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum • Air Pegunungan (Mineral) • Sistem RO Oxsygen dan Grosir Peralatan • Depot Air Minum GRACE WATER Jl. Cengkeh Raya P. Simalingkar HP. 081370107352 Melayani pemasangan dalam dan luar kota ULI DE ANGEL TOUR & TRAVEL: Melayani jasa penjualan online: •Tiket pesawat domestik dan internasional •Paket wisata dan hotel •Paket Ziarah Lourdes & holy land • Rental mobil (Avanza, Xenia, Innova dll), hub. Uli Gultom HP 0812 1059 0815; Daniel Samosir HP 0852 7565 0001.

DIJAUL: Sebidang tanah uk. 641 M2, posisi cantik hook (disudut), sertifikat lokasi HORISON PHOTO: Spesial: •Pengadaan mesin copy, servis spare parts Fotocopy Rp 125/ Jl. Makmur Ujung (dekat tanah lapang photo lbr •Pasphoto/cetak photo. Jl. Justin Sihombing Rambung Merah) , harga 600 rb/M2, (Simp. Jl. Pantai Timur) No. 7 B P. Siantar HP nego, HP 0853 5877 2629; 0852 7064 0813 6100 1200 (Jhon Purba) 0005 CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL: Tanah bersertifikat berikut bangunan rumah dengan luas tanah 18 x 48 M2 (+ 1000 M2) di Jl. Medan KM 9.5 Kel. Sinaksak (TP), hub. 061 - 7860686; HP 0813 7572 4472

Peter Refleksi SinShe Aciu / Aling: Mengobati segala penyakit •Asam lambung •Asam urat •Ambeian •Gula •Kolestrol dll Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0852 7695 4557; 0813 6017 0199 Buka : Jam 09.00 - 21.00 WIB PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 Pijat dan Luluran “ IBU RESTU” Jika anda capek, Pegel Linu , Lesuh, Lelah Kurang bergairah, turun perut,Menyegarkan badan,Urut bayi,terkilir,serta luluran. Jl. Simpang Viyata Yudha Komplek kelapa 2 dekat sekolah RK Katolik Asisi P. Siantar HP 0821 6681 7943. PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917

ARMADA SARANA TEHNIK: Service perbaikan, isi freon •AC •Kulkas •Dispenser •Frezer •Mesin cuci, hub. Armada Purba, HP 0812 6406 6568 Jl. Handayani No. 8 P. Siantar

HASMIDA SALON: Diskon besar-besaran: • Make up/sanggul 30 rb - 50 rb •Rias pengantin 500 rb - 700 rb •Perawatan rambut 25 rb - 50 rb • Smoting 100 rb = 150 rb • Bonding 80 rb - 100 rb dan menerima rangkaian bunga, bunga salib dan juga menerima anak kost wanita. Jl. Rakkuta Sembiring No. 156 P. Siantar hub. HP 0852 6203 4593 HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” TANAM GAHARU INVESTASI MELEBIHI EMAS! Jual bibit gaharu aquilaria malaccensis tinggi mulai 20-100 CM, sedia fusarium ingul dan teknik mokulasi, sedia bibit kemenyan toba dll. Jl. Viyata Yudha Pematangsiantar. hub. HP 0813 1476 2472; 0812 2756 8840 LA ROSS SALON & FLORIST: Menerima: Make up dan sanggul, Rias pengantin, perawatan rambut, shomoting rambut. Juga menerima Roncean melati, Bunga tangan, Bunga papan, Bunga saub, Dekorasi pelaminan dll. Jl. Sisingamangaraja No. 324 Telp.08126382759


SELASA 18 September 2012


Bentrok Anderlecht di San Siro mungkin dijadikan Massimiliano Allegri sebagai misi menyelamatkan dirinya dari pemecatan.


iga kali main dengan 2 kekalahan di kandang jelas tak bisa diterima buat klub sebesar AC Milan. Tak pelak, masa depan allenatore Massimiliano Allegri pun mulai dipertanyakan. Kekalahan 0-1 dari Atalanta, Sabtu (15/ 9), menjadikan musim 2012/2013 sebagai yang terburuk dalam 82 tahun sejarah Milan. Kali terakhir, I Rossoneri menderita 2 kekalahan beruntun di San Siro terjadi pada 1930 silam. Tak hanya itu. Legendaris Milan Zvonimir Boban pun menyindir pasukan Allegri sebagai yang terburuk yang pernah dimilik I Rossoneri dalam 25 tahun terakhir. Sontak, mencuat isu bahwa manajemen Milan memberi tenggat buat Allegri untuk menyelamatkan jabatannya dalam 2 partai ke depan. Dimulai dengan menjamu klub Belgia, Anderlecht, di San Siro pada Grup C Champions League, Selasa (18/9) atau Rabu (19/9) dinihari WIB. Allegri mungkin berpikir Anderlecht bakal jadi penyelamatnya. Anderlecht termasuk lawan relatif mudah buat Giampaolo Pazzini dkk. Dari 4 pertemuan sebelumnya, Milan menang dan seri masing-masing 2 kali. Pada benturan terakhir di San Siro, 1 November 2006, Milan bahkan membantai Anderlecht 4-1 lewat hattrick Ricardo Kaka dan 1 gol Alberto Gilardino. Yang menarik, setelah ke empat bentrokan dengan Anderlecht di 2 musim berbeda (1993/1994 dan 2006/2007), Milanselalujadijuaradiakhirkompetisi. Well, ini yang bikin Allegri berharap musim ini pertemuan dengan Anderlecht jadi berkah buat Milan di akhir



No 1 2 3 4 5

Borussia Dortmund VS

Gol 4 4 3


No 1 2 3 4 5

Borussia Dortmund 0:1/2 Ajax Amsterdam

Dortmund) di Liga Champions. Cruyff juga menilai, kesialan Ajax masuk grup maut lantaran timnya kini bukan lagi klub unggulan di Benua Biru, sehingga hanya berada di pot tiga saat pengundian grup Liga Champions beberapa waktu lalu. “Saat ini perasaan saya campur aduk di Liga Champions. Tentu saja menye-

nangkan Ajax akan melawan juara liga Spanyol, Inggris dan Jerman,” ujar Cruyff. “Tapi di saat bersamaan, anda sadar akan sangat sulit bagi klub lolos ke babak berikutnya.” “Situasi ini terutama disebabkan karena Ajax berada di pot ketiga saat undiandilakukan.Selama17tahunterakhir, ada sesuatu yang salah.” “BagaimanabisatimjuaraLigaChampions 1995 dan berada di final setahun berikutnya, justru menempati pot ketiga pada 2012 ini,” keluh Cruyff.

S 1 0 2 2 1

K 0 1 0 0 1

SG 8-2 10-5 8-1 9-6 10-4

Nilai 10 9 8 8 7

Nama Michu R van Persie J Defoe

Klub Swansea City Manchester United Tottenham Hotspur

Team Barcelona Málaga Mallorca Sevilla Atletico Madrid

M 4 4 4 4 3

M 4 3 2 2 2

S 0 1 2 2 1

K 0 0 0 0 0

SG 12-3 6-2 5-3 4-2 9-4

Nilai 12 10 8 8 7

AC Milan 0:0 Anderlecht

TOP SCORER Gol 6 4 4

Nama L Messi R Falcao T Hemed

Klub Barcelona Atlético Madrid Mallorca

ITALIAN SERIE A No 1 2 3 4 5

Team Juventus Napoli Lazio Sampdoria Internazionale

M 3 3 3 3 3

M 3 3 3 3 2

S 0 0 0 0 0

K 0 0 0 0 1

SG 9-2 8-2 7-1 6-3 6-3

Nilai 9 9 9 8 6

TOP SCORER Gol 4 3 3

Ajax Amsterdam


M 3 3 2 2 2


Nama S Jovetic Hernanes M Klose

Klub Fiorentina Lazio Lazio


Peluang Lubang Jarum Meski pelatih Ajax Amsterdam Johan Cruyffbanggatimnyatergabungdengan klubjuaradimasing-masingliga,namun di satu sisi dia mencemaskan peluang tim keluar dari lubang jarum. Ia mencemaskan peluang Ajax merebut satu tiket ke babak 16 Besar lantaran harus berjibaku melawan tim papan atas Eropa. Ajax Amsterdam tidak beruntung karena harus berada satu grup dengan tiga tim juara La Liga Spanyol [Real Madrid], Liga Primer Inggris (Manchester City) dan Bundesliga Jerman (Borussia

M 4 4 4 4 4



Pelatih: Van den Brom kompetisi Champions League nanti. “Untungnya, Champions League memberikan Milan peluang untuk bangkit lagi. Kami semua ada di satu Kouyate Proto a perahu (manajemen, pelatih, dan pezz Odoi ea 4-3 M main). Kami harus sedikit berbicara pe -3 ep n Biglia us la Deschacht Gi Mi dan banyak bekerja,” ucap Allegri. on i ad “Tapi, kami wajib berkembang St Wasilewski Mbokani Gillet danmelupakanhasil-hasillalu. Kljestan Selasa nanti jadi Pazzini Kanu kesempatan buat kami merapikan kepingan Sutter Emanuelson dan bergerak maEl Shawaary Boateng Antonini ju.” 4-3 Ambrosini Di kubu An-1-2 Acerbi derlecht, pasukan John van den De Jong Brom datang dengan Bonera Abbiati semangat dan optimisme tinggi. Mereka tak mau perjuaAbate ngan berat sejak Kualifikasi III AC MILAN Champions League sia-sia. Anderlecht Pelatih:Massimiliano Allegri menapakfasegrupusaimengempaskan klub Lithuania (kualifikasi III) dan klub Siprus AEL Limassol (playoff). HEAD TO HEAD: Dieumerci Mbokani Bezua jadi pemain yang harus diperhatikan barisan 24/11/93 Anderlecht 0-0 AC Milan belakang Milan. Striker Kongo berusia 30/3/94 AC Milan 0-0 Anderlecht 26 ini telah mengepak 4 gol di 4 partai 17/10/2006 Anderlecht 0-1 AC Milan Anderlecht menuju fase grup. 1/11/2006 AC Milan 4-1 Anderlecht Pada tiga pertandingan terakhir, AC 5 PERTANDINGAN TERAKHIR AC MILAN : Milanselalukemasukan1goldarilawan16 Sep 2012 AC Milan 0-1 Atalanta lawannya seperti Sampdoria, Bologna, 2 Sep 2012 Bologna 1-3 AC Milan dan Atalanta. Kini mereka berada dipo26 Agu 2012 AC Milan 0-1 Sampdoria sisi ke10 di Liga Italia, dan baru me9 Agu 2012 Real Madrid 5-1 AC Milan ngalami1kemenangan,2kalikalah,serta 5 Agu 2012 AC Milan 3-1 Olimpia mengumpulkan tiga 3 poin. Anderlecht sendiri baru meraih 1 5 PERTANDINGAN TERAKHIR ANDERLECHT : kemenangan dari 5 pertandingan ter15 Sep 2012 : Lierse 1-1 Anderlecht akhir. Mereka meraih 1 kemenangan, 2 Sep 2012 : Anderlecht 2-2 GENK tiga kali seri, dan satu kali kalah. Per29 Agu 2012 : Anderlecht 2-0 AEL tandingan terakhir mereka berakhir 25 Agu 2012 : OH Leuven 1-1 Anderlecht dengan skor 1-1 ketika menghadapi 23 Agu 2012 : AEL 2-1 Anderlecht Lierse. Anderlecht memiliki catatan yang berada di posisi ke 2 Liga Belgia dengan buruk ketika menghadapi tim Italia, poin 13 dari 7 pertandingan. Itu setelah mereka belum pernah menang. Anmereka mendapatkan 3 kemenangan, derlecht hanya bisa mencatat lima kali dan 4 kali seri. seri, dan sembilan kali kalah. Anderlecht

Team Chelsea Man United Arsenal Manc City Swansea City

No 1 2 3 4 5

Team München E. Frankfurt Hannover 96 Schalke 04 Dortmund

M 3 3 3 3 3

JERMAN M 3 3 2 2 2

S 0 0 1 1 1

K 0 0 0 0 0

SG 12-2 9-3 9-4 7-3 6-2

Rabu (19/9) Pukul 01.45 WIB TOP SCORER Gol 3 3 2

Nama M Mandžukic T Müller S Aigner

Klub Bayern München Bayern München Eintracht Frankfurt

Nilai 9 9 7 7 7





Edisi 63 Tahun IX







Petugas Satpol Air Sibolga dan petugas Adpel Sibolga saat mengevakuasi kedua jenazah korban di Pelabuhan Sibolga, Senin (17/9).

Etty Sihombing menangis sesunggukan ketika mengetahui suaminya telah tewas.

2 Nelayan Pamuge Tewas Mengapung di Laut SIBOLGA-Empat hari tak pulang ke rumah, dua warga Sibolga yang berprofesi sebagai nelayan pamuge (pembeli ikan di tengah laut) ditemukan jadi mayat. Kedua korban yakni Fasui Waruwu dan Suwarta Barita Bate’e (37). Informasi dihimpun METRO, kedua mayat nelayan pamuge itu pertama kalinya ditemukan oleh nelayan pukat cincin yang sedang melintas di kawasan perairan SilabuLabu Kecil Pulau Mursala, Senin (17/9) sekira pukul 13.00 WIB.

Foto Pernikahan Jatuh Berkeping-keping ETTY Diana Sihombing (33) istri Suwarta Barita Bate’e (37) mengaku, sebelum suaminya diketahui

Ribuan Simpatisan Setia Dukung Bonaran SIBOLGA- Ribuan massa pendukung dan simpatisan setia Bupati Ta p t e n g R a j a Bonaran Situmeang yang tergabung dalam Aliansi Masyarakat Tapanuli Tengah ( A L M A T A ) mendatangi kediaman Rantinus Manalu di Jalan Dr FL Tobing No 1 Sibolga, Senin (17/9) sekira 11.30 WIB. Sambil berorasi menyatakan dukungan terhadap Bonaran, ALMATA juga menyampaikan “Surat Cinta Pendukung Setia

Demo TPL, Massa Dihadang Kawat Berduri SIMALUNGUN- Demo ratusan masyarakat Kecamatan Dolok Panribuan, Kabupaten Simalungun, yang tergabung dalam forum masyarakat tolak Toba Pulp Lestari (TPL) di TPL sektor Aek Nauli, Senin (17/9), disambut kawat berduri dan puluhan satpam. Baca

Demo TPL..Hal 7

Rantinus: Saya Tak Akan Berhenti Mengkritisi



18 September 2012

Menunggak 3 Bulan, Listrik Diputus SIBOLGA-PT PLN (persero) Area Sibolga akan bertindak tegas dengan memutus aliran listrik pelanggan yang diketahui menunggak (TUL VI03) 3 bulan ke atas. Hal ini diperuntukan khusus kepada pelanggan Rayon Sibolga dan Rayon Barus. Demikian ditegaskan oleh PLH Manajer PT PLN Area Sibolga Denny Fitrianto, Senin (17/9) didampingi PLH Asmen Pelayanan & ADM Marfin Tanjung, Manajer Rayon Sibolga Kota Barisman Hutagalung, Pelayanan Pelanggan Ramlan Sitorus dan PLT spv Sekretariat/ Humas Safran Tanjung, di Kantor PLN Area Sibolga Jalan Sutoyo S Miharjo Sibolga. “Pelaksanaan ketegasan pembongkaran rampung untuk pelanggan yang menunggak 3 bulan ke atas akan diberikan kepada pihak kedua yaitu Petugas Pemutusan sesuai dengan surat perjanjian kerja sama. Dengan dasar sesuai surat PT PLN (Pesero) wilayah SUMUT no. 377/545/W.SU/2010 tanggal 11 Juni 2010,” katanya. Dan ditegaskan kembali, kepada pihak pelanggan untuk tidak menitipkan uang pelunasan rekening listrik kepada pihak kedua, dan juga disarankan agar pelanggan langsung membayar ke loket PPOB (Payment Point Online Bank) ATM, Kantor Pos di seluruh Indonesia. “Selain itu semua pegawai PLN Area Sibolga akan turun melaksanakan penagihan tung-

gakan rekening listrik ke lapangan setiap Kamis, guna membantu Rayon Sibolga Kota dan Rayon Barus yang tunggakannya cenderung tinggi. Dan perlu diketahui oleh para pelanggan yang belum membayar tunggakannya untuk segera melunasinya, karena kami akan konsisten untuk melaksanakan Peraturan no.377/545/W.SU/2010 dan Fungsi TUL VI-03 memutus aliran listrik yang menunggak 3 bulan ke atas,” ujarnya. Lanjutnya, bagi pelanggan yang telah dibongkar rampung, bila ingin menyambung kembali, akan dibebankan biaya penyambungan baru serta terlebih dahulu melunasi tunggakannya. “ Selain itu, PT PLN Area Sibolga juga akan melakanakan gerakan P2TL (Penertiban Pemakaian Tenaga Listrik) bekerja sama dengan pihak kepolisian yang membentuk Tim Pelaksana Operasi P2TL rutin, hal ini disebabkan masih banyaknya pelanggan maupun non pelanggan yang melakukan pelanggaran pemakaian tenaga listrik dengan nama Sandi, Operasi P2TL Sada tahun 2012,” ujarnya. (son/nasa)

Calhaj Tertua 95 Tahun Termuda 18 Tahun MADINA- Kepala Kantor Kementerian Agama Kabupaten Mandailing Natal Drs H Muksin Batubara MPd mengumumkan jumlah jamaah calon haji asal Madina sebanyak 639 orang. Dari jumlah itu, calon haji tertua berusia 95 tahun bernama Dur Ali Rangkuti dan calon haji termuda Yusriani berusia 18 tahun “Keduanya adalah warga kelurahan Dalan Lidang, Kecamatan Panyabungan. Tahun lalu jamaah tertua kita berusia 88 tahun dan termuda 22 tahun,” sebut Muksin Batubara usai memfasilitasi manasik akbar jamaah calon haji tahun 2012 Madina di Masjid Agung Nur Ala Nur Panyabungan, Senin (17/9). Disampaikan Muksin, meski dengan seusia itu Dur Ali Rangkuti masih dikategorikan mampu menjalankan ibadah. Ini sesuai hasil pemeriksaan kesehatan yang diberikan oleh pemerintah, meski demikian Muksin berharap kepada semua para jamaah agar saling tolong menolong dalam melaksanakan semua rukun dan ibadah wajib haji. “Kami berharap agar seluruhnya jangan saling membiarkan. Tolong saudara kita dibantu bagi yang membutuhkan apabila tidak sanggup membantu cepat laporkan kepada petugas haji kita,” pintanya Sementara itu, Kepala bagian kesejahteraan rakyat (Kesra) Pemkab Madina M Taufik Lubis SH kepada METRO mengatakan, pemkab Madina dalam hal ini telah memberikan sejumlah fasilitas bagi para jamaah calon haji Madina, misalnya menjalani pemeriksaan kesehatan dan memberikan pengobatan bagi calon haji yang sakit. “Kita sudah memberikan sejumlah fasilitas, dan rencananya hari ini, Selasa para jamaah akan menjalani suntikan agar lebih kebal terhadap penyakit, pemkab Madina juga telah mengutus Tim pendamping haji,” kata Taufik.(wan)


PERSYARATAN : 1. Mengajukan Lamaran Kerja yang ditujukan Kepada Pimpinan PT. Bank Muamalat Indonesia Sibolga 2. Usia maksimal 25 tahun 3. Berpenampilan Menarik, Tinggi Badan Min 165 cm 4. Belum Menikah 5. Bisa MembacaAl - Quran 6. Pendidikan minimal S – 1 dan IPK minimal 2,75 ( PTN ), 3,00 ( PTS) 7. Memiliki disiplin & inisiatif yang tinggi serta teliti & obyektif 8. Memiliki kejujuran dan integritas yang tinggi 9. Tidak memiliki hubungan kekeluargaan dengan karyawan / Direksi Bank Muamalat 10. Melampirkan Dokumen pendukung: CV, fotokopi ijasah pendidikan terakhir, fotokopi KTP, pas foto 4 x 6 sebanyak 2 lbr Kirimkan Lamaran Anda ke PT. Bank Muamalat Indonesia Sibolga d/a Jl. Imam Bonjol No. 55 Pasar Baru Sibolga. Paling Lambat Tanggal 25 September 2012 Tertanda PT. BANK MUAMALAT INDONESIA, Tbk. KCP SIBOLGA 01 Dzulqa’dah 1433 H 17 September 2012 M


PELANTIKAN, Kepala Kantor Bank Indonesia Perwakilan Sibolga yang lama Muhamad Nur bersama pejabat yang baru Yiyok Herlambang secara bergantian menandatangani naskah pelantikan, Senin (17/9) di Sibolga.

Yiyok Pimpin BI Sibolga „ Kantor PLN Cabang Sibolga.

Lurah Kalangan Lestarikan Budaya Gotong Royong KALANGAN-Lurah Kalangan MHD Gani Daulay didampingi Kepling 1, Dolok Pinapan Manullang bersama warga kembali melakukan gotong-royong membersihkan parit yang tersumbat di sepanjang Jalan Dangol, Minggu (16/9). Hal ini dilakukan mengingat seringnyaterjadibanjirsaatmusim hujan akibat parit yang telah tertutup total. MHD Gani Daulay menerangkan, parit yang tersumbat lumpur dan sampah sudah menutup saluran pembuangan tersebut. Sehingga setiap hujan turun, badan

jalan tergenang air, yang akhirnya menimbulkan tumpukan Lumpur.Untuk itu, atas inisiatif warga parit yang sudah tertimbun sedalam satu meter tersebut dikeruk dengan cara bergotong-royong. “Hal ini sudah yang ketiga kalinya dilakukan, dan rencananya gotong royong ini akan tetap dilakukan hingga parit kembali bersih hingga ke sungai ujung parit. Sebagai warga di Lingkungan 1 ini, kami juga merasa bertanggung jawab untuk menjaga kebersihan lingkungan. Terutama parit ini, karena bagaimana pun nantinya akan berpengaruh kepada diri kita


„ Lurah Kalangan MHD Gani Daulay bersama Kepling 1, Dolok P Manullang dan beberapa warga saat melakukan gotong royong.

sendiri,” tutur Julpan Ependi Caniago (38), salah seorang tokoh pemuda setempat di sela-sela gotong royong. Ahmad Saleh Dalimunte (46) yang juga warga Lingkungan 1 mengatakan hal senada. “Kita antusias dalam kegiatan gotong royong ini. Karena kebersihan dan keindahan lingkungan itu merupakantanggungjawabbersama. Bukan tanggung jawab pemerintah semata. Sedikit waktu tidak akan merugikan kita,” tuturnya. Dolok P Manullang, Kepala Lingkungan 1, Kelurahan Kalangan, menegaskan bahwa kegiatan itu merupakan inisiatif dari warga. “Saya pribadi sangat bangga dengan kegiatan ini. Selain untuk menjaga kenyamanan dan kebersihan lingkungan, kerja bakti ini juga bertujuan meningkatkan kepeduliandanperansertaaktifmasyarakat. Sekaligus untuk melestarikan nilai-nilai ke gotong royongan dan keswadayaan masyarakat. Artinya kepedulian warga terhadap lingkungan ini sudah terbuktidengankehadiranmereka dalam gotong royong ini. Saya ucapkan terimakasih banyak kepada mereka,” tukas Dolok P Manullang. Terlihat di lokasi kerja bakti dihadiri sekitar 20 orang warga. Parit yang sudah selesai dibersihkan sekitar 100 meter sebelah kiri dan kanan jalan. (Cr-1/nasa)

SIBOLGA- Yiyok T Herlambang dipercayakan sebagai Kepala Kantor Bank Indonesia Perwakilan Sibolga, menggantikan Muhamad Nur yang menduduki jabatan yang sama di Palangkaraya, Kalimantan Tengah. Acara serah terima sekaligus pelantikan tersebut berlangsung Senin (17/9), di Graha Aulia Kantor Bank Indonesia (KBI) Sibolga dipimpin Kepala kantor Bank Indonesia wilayah IX, Nasser Atorf. Sebelum dipercayakan sebagai Kepala Kantor Bank Indonesia Perwakilan Sibolga, Yiyok Herlambang menjabat sebagai pengawas bank senior di Departemen pengawasan. Sedangkan Muhamad Nur sudah tiga tahun lebih memimpin Bank Indonesia Sibolga. Nasser Atorf dalam sambutannya usai prosesi pelantikan mengatakan, pergantian pejabat Bank Indonesia merupakan hal yang rutin dan merupakan penyegaran organisasi dalam rangka memberikan kesempatan pengembangan diri bagi pejabat yang ditunjuk. Menjadi Kepala Perwakilan Bank Indonesia di daerah merupakan salah satu bentuk kaderisasi kepimpinan Bank Indonesia. “Menjadi Kepala Perwakilan Bank Indonesia di daerah dalam masa masa ini bukanlah tugas yang mudah. Salah satu tugas utama dalam jangka pendek adalah memastiklan pengalihan fungsi pengawasan bank di wilayah kerja Kantor Pewakilan Sibolga yang terdiri 16 Kabupaten/kota,” katanya. Pada akhir 2013, lanjut Nasser Atorf, sesuai dengan Undang-undang nomor 21 Tahun 2011, adanya penyatuan fungsi pengawasan bank

Selamat Berbahagia Atas kelahiran anak pertama (Putri) dari keluarga:



(Staf Keuangan METRO TAPANULI) Yang diberi nama ELLENA ANSIKA br GINTING, lahir di RS FL Tobing Sibolga, pukul 11.00 WIB Senin, 17 September 2012

"Semoga menjadi anak yang berbakti kepada orangtua dan selalu dalam lindungan Tuhan Yang Maha Esa" DARI:

Pimpinan, Staf, Karyawan/ti


dari Bank Indonesia. “Sebagaimana yang kita ketahui bersama perkembangan dinamika industri keuangan saat ini lebih terintegrasi. Untuk itulah Undangundang nomor 21 Tahun 2011 membahas tentang otoritas jasa keuangan yang mengamanatkan penyatuan berbagai fungsi pegawasan pasar modal dalam lembangan keuangan dari Bapepam LK ke dalam satu lembaga yang bernama Otoritas Jasa Keuangan (OJK). Sekaitan dengan itu, Kepala Perwakilan harus bisa memastikan tidak ada nasabah yang dirugikan dalam masamsa transisi tersebut,” jelasnya. Bahkan, sambungnya, krisis ekonomi di kawasan Eropa juga telah mulai dirasakan dampaknya pada perekonomian Sumut. Dimana dampaknya terjadi penurunan permintaan komoditas utama di Sumatera Utara yaitu, minyak kelapa sawit dan karet juga mulai terasa. “Total angka ekspor Sumut juga mulai terlihat mengalami penurunan pada periode Januari-Juli 2012 dan secara kumulatif tercacat sebesar USD 6,10 miliar atau turun sebesar 9,44% dari USD 6,74 miliar,” bebernya. Selain itu, katanya, menjaga stabilitas inflasi ke depan juga menjadi tantangan berat. Inflasi tahunan Sibolga yang pada khir tahun 2011 pernah mencapai level rendah yaitu, 3,71% (yoy) mulai merangkak naik di tahun 2012 hingga mencapai 7,12% (yoy) di bulan Juni. “Dengan tantangan yang sedemikian besar, saya masih menyimpan optimisme yang sangat tinggi bahwa Kepala Perwakilan Bank Indonesia Sibolga yang baru akan mampu mengemban amanah dengan baik. Tidak ada yang sulit selama kita solid,” tegasnya. Wali Kota Sibolga Drs HM Syarfi Hutauruk dalam sambutannya dibacakan Wakil Wali Kota Sibolga, Marudut Situmorang AP MSP mengungkapkan, Kepala Perwakilan BI yang lama Muhamad Nur, telah banyak berbuat di Kota Sibolga secara khusus dan di 16 kota lainnya sebagai wilayah pelayanan Bank Indonesia. Khusus di Sibolga, selalu dilakukan rapat besama dengan Muspida untuk memantau serta menjaga harga-harga dan juga kestabilan inflasi di Kota Sibolga. “Kami yakin Kepala Bank Indonesia Perwakilan Sibolga yang baru, juga bisa melakukan hal yang sama. Kami atas nama masyarakat dan juga Pemerintah Kota Sibolga menyambut kehadiran bapak Yiyok Herlambang di Kota Sibolga, Negeri Berbilang Kaum dan perekat umat beragama,” katanya. Kegiatan itu juga dirangkai penandatangan kerja sama tanggungjawab sosial, antara Kepala Bank Indonesia Perwakilan Sibolga Yiyok Herlambang dengan Korem 023 KS. (tob/nasa)



18 September 2012



„ Alim Kwok

PANCURBATU- Emosi Dewi (32), penghuni barak Hendri di Bandar Baru tiba-tiba memuncak ke salahseorang hidung belang. Pasalnya, usai indehoi di Bungalau Gemilang, Alim Kwok (33) Warga Jalan Belawan, Kelurahan Titi Papan, Kecamatan Medan Labuhan, tak mau membayar jasa seksnya. Akibatnya, Alim pun digiring ke Mapolsek Pancurbatu, Senin (17/ 9), sekira pukul 07.00 WIB. Informasi dihimpun di Mapolsek Pancurbatu menyebutkan, malam itu Alim datang ke Bandar Baru dengan mencarter Taxi Exspress BK 1547 HA yang dikemudikan Amir Hamzah Lubis (23), warga Desa Patumbak, Kecamatan Patumbak. Setibanya di sana, mereka pun memesan Bungalaw Gemilang yang ada di kawasan prostitusi tersebut. Selanjutnya, Alim pun memesan cewek ke salahseorang romboy. Tak berselang lama, Dewi yang merupakan warga Purwokerto Jawa Timur datang ke kamar yang ditempati keduanya. Begitu tiba di ruangan yang berisi dua tempat tidur tersebut, Alim dan Dewi pun negosiasi harga, dan mereka pun sepakat hingga siang hari Alim membayar sebesar Rp800 ribu. Karena telah mencapai kesepakatan, kedua insan berlainan jenis ini langsung naik bulan. Malam itu, Alim meniduri Dewi hingga dua kali. Setelah bercinta, Dewi pun meminta bayaran sesuai dengan yang telah disepakati tadi kepada Alim. Namun bukan jawaban yang didapat Dewi, melainkan sang hidung belang langsung bolak-balik masuk kamar mandi. Melihat itu, Dewi pun mengamuk sejadinya dan membuat Amir yang berada persis di kamar sebelah keluar, dan menanyakan permasalahannya. Ketika dijelaskan Dewi kalau Alim tak membayar uang jasa ngeseknya, Amir pun terkejut bukan main, karena sesaat sebelum pergi Alim mengaku sebagai pengusaha dan hendak menemui temannya di Bandar Baru. Pantauan di Mapolsek Pancurbatu terlihat kalau Dewi terus merepeti Alim dengan kata-kata kasar. “Dasar kau modal kon***mu aja, udah ngotori punyaku kau. Dua kali ‘nembak’, malah tidak bayar pula. Kau pikir ini milik Negara. Bolakbalik kamar mandi kau saat itu, mau larinya kau itu kan? Alasanmu mau ke kamar mandi, padahal kau mau lari, yang benar ajalah kau. Yang bayar kamarmu aja juga sopir taksimu itu. Manusia apa kau ini,” omel Dewi penuh emosi. Amir Hamzah saat diwawancarai mengatakan, saat itu Alim meminta dirinya untuk mengantarkan ke Bandar Baru. “Dia minta antarkan ke Bandar Baru dengan janji akan membayar Rp500 ribu pulang-pergi (PP). Karena yakin, aku pun mengantarkannya sampai tujuan dan aku pun menunggunya hingga pulang,” ujar Amir. Dikatakannya lagi, katanya jam 05.00 WIB, mereka harus pulang ke Medan, karena dia mau ke Bandara. Sebab pukul 07.00 WIB, dia sudah harus berangkat untuk urusan bisnis ke Jakarta. “Karena pengakuanya itu, aku pun jadi yakin dan aku tunggulah dia. Terus, pagi itu aku tiba-tiba dibangunkannya. Dia minta uangku Rp165 ribu, katanya mau dibayar di Bandara, karena di Bandar Baru tidak ada ATM. Aku kasilah, eh malah tak

lama, aku dengar suara gaduh dan ternyata dia gaduh sama cewek yang ada di kamarnya itu,” ungkap Amir, yang mengaku kalau istrinya lagi mengandung anak pertama mereka. Diceritakan Amir lagi, sekarang ia tidak bisa bilang apa-apa lagi, sebab dia sudah membayarkan uang kamar kepada pihak penginapan dari uangnya sendiri itu. Malam itu, ia sama sekali tidak ada membooking cewek. “Aku hanya tidur aja, itu pun karena di kamar itu ada dua ruangannya, kalau tidak aku mau tidur di taksiku saja,” ujar Hamzah sambil membuat pengaduan di Mapolsek Pancurbatu. Dewi sendiri mengaku tidak senang dengan ulah Alim tersebut. “Dia itu tidak punya otak, udah ditidurinya aku dua kali, eh malah mau lari dan tak mau bayar. Kurasa dia mau lari dari jendela kamar mandi, tapi karena tak ada jendela di kamar mandi itu, dia pun tak jadi lari,” ujar Dewi. Di Kantung Alim Cuma Ada Lima Ratus Perak Dikatakannya lagi, uang kamar aja sopir taksi itu yang bayar. Laki-laki apa seperti itu. Uang di kantongnya saja hanya 500 perak, tapi sok kali gayanya. Katanya mau bayar aku satu malam Rp800 ribu. Katanya dia punya usaha di kilometer 15 Tebing, banyak kalilah cakapnya. Memang saat main, dia pakai kondom,” ujar Dewi yang mengaku telah memiliki satu orang anak ini. Sementara Alim, saat diwawancarai mengatakan, ia sudah mengajak mereka untuk mengambil uang pembayarannya, namun si cewek itu tidak mau. Begitu juga dengan si supir itu dia juga mengaku sudah mengajak untuk bertemu dengan salahsatu keluarganya di Medan. “Tapi mereka enggak mau,” kilah pria turunan Tionghoa ini. Namun saat pembicaraan itu tiba-tiba Amir memotong pembicaraan kru koran ini dengan Alim dan mengatakan; ”dia memang mengajak saya ke Medan pak, tapi saya berpikir akan buang-buang waktu dan minyak saja. Lalu, saya menelepon temanku yang ada di Medan untuk mencari alamat yang diberikannya itu, dan saat ketemu dengan keluarganya itu mereka tidak mau bertanggungjawab atas ulahnya itu. Bahkan kata keluarganya itu, bukan kali ini saja dia berbuat tapi sudah berkali-kali, dan keluarganya itu tak mau lagi bertanggungjawab dan bukan urusan mereka lagi,” ujar Amir menjelaskan. Mendengar perkataan Amir tersebut, Alim pun langsung tertunduk lesu, dan terdiam saat ditanyai di mana-mana saja dia telah melancarkan aksinya itu. Kapolsek Pancurbatu Kompol Darwin Sitepu PB membenarkannya. “Saat ini, kita masih melakukan penyelidikan,”ujar Darwin singkat. (roy/pmg/ dro)


„ Edi Simarmata terbujur kaku di kamar jenajah akibat kecelakaan lalu lintas. Salahseorang saudarinya terlihat menangisi jasadnya, Senin (17/9).


SIANTAR- Edi Simarmata (48), warga Sirpang Sigodang, Kecamatan Panei, tewas ditabrak Kijang Innova BK 1968 T di jalan umum SiantarSaribudolok, Nagori Marjandi Embong, Panombeian Panei, Senin (17/ 9), sekira pukul 09.30 WIB. Pria yang sehari-hari menganyam keranjang (pengrajin keranjang dan biasa disebut parkaranjang, red) tewas di tempat dan batal sarapan pagi ke Marjandi Embong. Informasi dihimpun, korban melaju dengan kecepatan sedang dari arah Raya menuju Siantar mengendarai Honda GLPro BK 6083 TR. Korban berangkat dari rumahnya di Sirpang Sigodang dan berniat sarapan pagi di salahsatu warung di Nagori Marjandi Embong. Tiba di lokasi kejadian pada posisi jalan menurun, korban hendak berbelok ke kanan. Namun tiba-tiba Kijang Innova hitam BK 1968 T yang dikemudikan Maringan Butarbutar (49) langsung menabrak korban dari belakang hingga korban terpental dan kepalanya membentur ke jalan. Sesudah menabrak, Maringan langsung tancap gas disebabkan takut dimassa warga. Tak lama kemudian, Maringan menyerahkan diri ke kantor

polisi di Panei Tongah. Maringan merupakan warga Jalan Kabanjahe, Saribu Dolok, Kecamatan Silimakuta. Penuturan Lae (adik ipar) korban di RSU Djasamen Saragih, B Manurung (43), korban tinggal bersama istrinya di Sirpang Sigodang. Selama 20 tahun perkawinan mereka, hingga korban meninggal belum dikarunia anak. Keduanya juga tidak ada mengangkat anak sebagai penerus keturunan korban. Korban bekerja sebagai penganyam bambu yang dijual sebagai tempat sayuran dan buah-buahan kepada pedagang pengecer dari berbagai lokasi yang datang ke Sirpang Sigodang. Keluarga korban yang tinggal di kampung hanya satu orang, yaitu adik perempuan korban atau istrinya. Sedangkan saudara laki-laki korban yang lain merantau ke Kalimantan dan Pekanbaru. “Mau sarapan laeku ini tadi ke bawah, di Embong itu ada tempat sarapan yang selalu ramai dikunjungi warga. Baru dari rumah dia, itulah ditabrak dari belakang. Besok mau dikebumikan. Cuma masih kami tunggu saudaranya yang lain,” jelas lae korban ini. Amatan METRO di Ruang Instalasi Jenazah RSU Djasamen Saragih,

korban mengalami luka dan patah rusuk kanan. Lalu ada luka gugus di kaki kanan bawah korban. Salahseorang rekan korban bermarga Saragih kepada METRO menuturkan, pagi harinya korban masih melayat warga sekampungnya yang meninggal dunia. Kepada rekannya, korban sempat mengatakan dirinya ingin berangkat ke bengkel di Embong untuk memperbaiki jari-jari lingkar sepedamotornya. “Tadi di tempat orang meninggal itu dia (korban) bilang mau ke Embong perbaiki kretanya,” kata Saragih. Ditambahkannya selama ini korban bekerja sebagai pengrajin keranjang jeruk. Bahkan akhir-akhir ini usaha korban semakin lancar dan korban sudah memiliki anggota pengrajin keranjang untuk membantunya. Kanit Laka Lantas Ipda Alsem Sinaga ketika dikonfirmasi membenarkan kejadian tersebut. Kapolsek Panei Tongah AKP M Manik menambahkan meninggal di tempat. Sementara tersangka menyerahkan diri ke kantor polisi usai kejadian. Penyebab kecelakaan disebabkan pengemudi mobil Kijang Innova tidak hati-hati saat berkendara. (ral/ hot/dro)


Rupanya, Warga Merekraya

SIANTAR– Identitas pria yang ditemukan meregang nyawa di patung rumah adat Jalan Pematang, Kelurahan Pematang, Siantar Selatan, itu akhirnya terungkap, Minggu (16/9) pukul 17.00 WIB. Adalah Pasu Saragih Sumbayak (52), warga Huta Limak, Nagori Merekraya, Kecamatan Raya. Terungkapnya identitas korban itu setelah pihak keluarga Pasu di Kecamatan Raya membaca di media cetak tentang penemuan sesosok pria yang tidak bernyawa. Dengan memerhatikan fotonya, pihak keluarganya pun datang ke Ruang Forensik RS Umum Djasamen Saragih untuk memastikannya. Setelah memerhatikan, Barisman Saragih (57) memastikan bahwa pria tersebut merupakan adik kandungnya. Menurut keterangan Barisman, Pasu memiliki sakit keterbelakangan mental sejak usia muda. Akan tetapi Pasu sempat menikah dan sudah memiliki dua anak. Namun karena hubungan keluarga mereka tidak harmonis, Pasu dengan istrinya Paina Sinaga berpisah dan kedua anak mereka pun dibawa Paina ke daerah Bagan Batu. Sejak itu, kehidupan Pasu pun tidak menentu. Sementara kedua orangtuanya pun sudah lama meninggal, sehingga ia tinggal bersama abangnya yakni Barisman. “Dia ini anak ketiga dan kami semua enam bersaudara. Sejak kecil pun dia sudah ada sedikit gangguan mentalnya. Jadi selama ini, kehidupan Pasu pun tidak menentu kadang pergi ke Siantar beberapa lama dan pulang kembali ke kampung,” ujar Barisman, yang ditemani oleh Jatam Purba Pangulu Nagori Merekraya. Walau demikian, Pasu tidaklah suka mengganggu orang. Hanya saja dia lebih suka menyendiri dan jalan-jalan, sehingga kalau malam Pasu lebih sering tidur di lokasi patung tersebut. Menurut Barisman, penyebab kematian Pasu adalah karena memiliki sakit keterbelakangan mental, bukanlah karena narkoba atau lainnya akan tetapi karena terbawa sejak lahir. Akan tetapi setelah menikah penyakit Pasu semakin parah. Sementara itu, setelah dilakukan visum luar, pihak petugas Forensik tidak ada menemukan tanda-tanda adanya tindakan kekerasan sehingga pihak keluarga pun sepakat untuk tidak dilakukan outopsi terhadap korban. Pasu tersebut meninggal bukan karena ada tindakan pidana kekerasan. Surat pernyataan tersebut pun disampaikan kepada Polsek Siantar Selatan. Kapolsek Siantar Selatan AKP G Damanik menerangkan bahwa pihak keluarga tidak menuntut dan pihak keluarga Pasu telah membuat surat pernyataan. Menurut Barisman, rencananya Pasu akan dikebumikan hari ini Selasa (18/9) di Dusun Limak, Nagori Merek Raya. (pra/dro)

Capek jadi Kuli, Agus-Suheri Jadi Curanmor RAYA- Agus Pitoyo (26) dan Suheri (23), keduanya berprofesi sebagai kuli bangunannekadmencurisepedamotor(runmor) petani yang sedang diparkir di simpang perladangannya. Kedua pria tersebut berhasil ditangkap warga. Keduanya kemudian diserahkan ke polisi setelah sebelumnya babak belur dihajar massa. Kejadiannya bermula saat korban Kanariman Sinaga (37), warga Bah Pasussang, Nagori Siporkas, Kecamatan Raya, Simalungun hendak menuju ladangnya di Sinumpol Minggu (16/9). Seperti biasanya, sepedamotor Honda Mega Pro BK 6683 TW yang dikendarainya selalu diparkirkan di Simpang Sinumpol. Dua jam bekerja di ladangnya Kanariman hendak maragat (menyadap pohon aren). Saat tiba di lokasi tempat kretanya diparkirkan, Kanariman mendapati dua

orang yang tidak dikenalnya sedang mengutak-atik kunci kontak sepedamotornya. Dua pelaku yakni Agus Pitoyo dan Suheri, keduanya warga Pangkalan Budiman Sei Rampah kaget dan langsung kabur dengan menggunakan sepedamotor jenis bebek BK 5047 NZ ke arah Sindarraya. Kanariman yang baru sadar kedua pria yang tidak dikenalnya tersebut merupakan maling motor, kemudian berusaha mengejar pelaku dengan sepedamotornya yang tidak sempat dibawa pelaku tersebut. Hanya saja tidak berhasil karena sepedamotornya rusak dibuat pelaku. Kanariman kemudian menumpangi sepedamotor orang lain dan memberitahukan aksi percobaan pencurian tersebut ke warga Bah Pasussang. Bersama Pangulu Siporkas Jonaman Purba, Warga kemu-

dian mengejar pelaku sampai ke Raya Kahean. Pelaku kemudian ditemukan warga berada di Sindarraya. Pelaku yang emosi langsung menghajar keduanya hingga babak belur. Usai menghajarnya kedua pelaku kemudian diserahkan ke Polsek Raya. Kepada METRO, kedua pelaku mengaku nekad mencuri karena butuh uang. Pelaku juga mengaku bosan bekerja sebagai kuli bangunan. “Butuh uang bang, capek kerja bangunan trus,” katanya singkat. Kapolsek Raya AKP Sulaiman Simanjuntak ketika dikonfirmasi membenarkan penangkapan pelaku percobaan pencurian sepedamotor. Menurut dia, keduanya akan dikenakan pasal 363 KUHP tentang pencurian. (hot)


„ Sesosok mayat laki-laki itu rupanya Pasu Saragih.

Korban ‘Teroris‘ Rumahtangga

Wong Aminul (24), ini statusnya guru agama, kok malah jadi ‘teroris’ rumah tangga. Dipacarinyalah Ny Indri (28), ibu daripada salahseorang muridnya, sehingga suaminya pun kalap sampai main bunuh. Aminul jelas bukan terorisme, tapi maaf, dia sendiri malah jadi ‘teroris’ dalam sebuah rumah tangga. Bagaimana tidak, gara-gara dia jadi guru agama-

nya bocah, sang ibu klepegklepeg kasmaran dengan si guru. Rumahtangga Ny Indri jadi kacau, bahkan dengan Joko (34), suaminya sudah beberapa bulan ini tak akur, sampai kemudian mereka pisah ranjang. Keluarga Joko termasuk tinggi kesadaran agamanya. Ketimbang anaknya pintar tapi nantinya tak tahu agama, segeralah Ibnu (7), disuruh belajar agama

pada tetangganya, Aminul. Joko sangat khawatir, jika kelak putranya punya posisi di pemerintahan, jadi pejabat misalnya, tapi karena kurang pendidikan agama jadi berani korupsi. Maka sedia payung sebelum hujan, Ibnu pun disuruh belajar agama, termasuk mengenali batal dan haramnya sebuah masalah. Tapi sayang, maksud baik itu dikacau oleh menyusupnya setan. Setan yang rupanya sudah S2 dan sudah lulus sertifikasi dan uji kompetensi lewat internet, ditugaskan kelompoknya untuk mengganggu Aminul dan Ny Indri ibu daripada si murid Ibnu. Namanya saja sudah pakar, dengan cepat antara Aminul yang masih bujangan jadi kasmaran dengan Indri yang istrinya Joko. Logikanya, pak guru muda ini takkan tergoda bisikan setan. Tapi bagaimana lagi, setannya kan yang sudah pilihan. Pagi hari, bersama murid lain

Ibnu belajar agama pada Aminul. Tapi siang hari, giliran oknum guru ini belajar pacaran dengan ibunya Ibnu. Mereka sering jalan bareng dengan tanpa seizin Joko yang pegang otoritas. Lama-lama informasi itu masuk ke telinga suami. Celakanya, ketika Indri ditegur, malah ribut. Klimaksnya, Joko memilih tinggalkan rumah, sehingga sudah beberapa bulan ini mereka pisah ranjang dan rumah. Dengan tanpa suami, pacaran Indri–Aminul makin intensif, meski belum merambah daerah-daerah yang ‘sip’. Kalau pun ada, paling baru taraf PPD (pegang-pegang doang), belum sampai PTL (Pacaran Tembak Langsung). Maklum sejahat-jahatnya Aminul, dia masih tahu batas normal. Hubungan yang semakin intens antara keduanya, membuat Joko cemburu. Maksudnya dia pisah ranjang

adalah untuk memberi pelajaran istri, kok malah istri diajari yang nggak bener. Pedagang durian dari Kemiling Bandar Lampung ini ini jadi naik pitam. Dicarinyalah Aminul untuk klarifikasi, untuk mengetahui duduk masalah yang sebenarnya. Dalam pertemuan dari hati ke hati itu Joko mencoba bertanya tentang hubungan Aminul dengan istrinya. Tapi ternyata guru itu menjawab PD sekali. “Oh, ya. Kami memang pacaran, dan beberapa bulan lagi mau menikah. “Wah, ucapan ini membuat Joko kalap. Pisau untuk membelah duren itu langsung ditusukkan ke leher dan dada Aminul. Kontan saja sang guru wasalam di tempat. Dalam pemeriksaan, Joko mengaku bahwa semula tak bermaksud membunuh Aminul, tapi kok omongannya sengak dan tidak didengar. “Ya langsung saya beri….,” ujarnya. (int)



18 September 2012

2 Nelayan Pamuge Tewas Mengapung di Laut Sambungan Halaman 1 Lalu para awak kapal tersebut kemudian melaporkan penemuan mayat itu kepada pihak keluarganya agar dapat diteruskan kepada pihak berwajib. Kapolres Sibolga Kota AKBP Joas Feriko Panjaitan melalui Kasat Pol Air Sibolga AKP J Sitopu SH saat dikonfirmasi membenarkan adanya penemuan kedua (foto: dok)

Korban FG dipapah.


Polisi Buru Pelaku SIBOLGA- Aparat Polres Tapteng saat ini masih berupaya mencari pelaku pemukulan, pemerkosa dan perampok terhadap FG (23). “Petugas masih melakukan pencarian terhadap pelaku, sesuai keterangan korban,” kata Kapolres Tapteng AKBP Dicky Patrianegara melalui Kasat Reskrim AKP F Simatupang, Senin (17/9) melalui ponselnya. Diutarakan Simatupang, selain masih memburu pelaku, polisi juga saat ini sedang menunggu hasil visum dari pihak dokter rumah sakit. Sementara itu, AW saudara FG kepada METRO, Senin (17/9), mengaku telah mencari pria yang dideuga sebagai pelaku yakni NZ hingga ke luar kota seperti Sibabangun. Namun, NZ belum berhasil ditemukan. “Sebenarnya pelaku itu kami kenal, sebab biasanya dia mangkal di depan pintu keluar pelabuhan. Sudah dicari kemana-mana, tapi dia seolah-olah menghilang,” kata AW di kediamannya Jalan Horas Sibolga. Lebih lanjut disebutkan AW, mereka juga telah menemui istri NZ. Dan, istri NZ, br G mengakui bahwa suaminya sempat menceritakan melalui telepon bahwa dirinya yang melakukan perbuatan tersebut kepada FG. NZ Pendiam Di tempat terpisah, tetangga NZ di Kelurahan Angin Nauli, Kecamatan Sibolga Utara menuturkan, selama satu tahun keluarga NZ tinggal di rumah kontrakan tersebut bersama istrinya br G dan seorang anak angkatnya, jarang terdengar perselisihan. Mereka mengatakan, NZ yang sehari-hari berprofesi sebagai penarik betor, tipe orang pendiam dan tak banyak bicara. “NZ itu pendiam. Kadang ketika dia melintas saat kita ada di teras rumah, dia hanya sekedar melempar senyum. Mungkin karena NZ jarang di rumah dan tidak banyak pergaulan di lingkungan ini. Sedangkan istrinya kita tahu rajin beribadah,” tutur boru S (34), tetangga NZ saat diwawancarai, Senin (17/9). Boru S menerangkan, masalah yang menimpa keluarga NZ sudah banyak diketahui warga sekitar. “Tapi saya salut dengan istri NZ, boru G itu. Dia berani mengaku aib suaminya sendiri. Hal itu suatu kejujuran,” tambahnya. HH (37), saudara korban FG mengaku sudah lama mengenal NZ. “Saya kenal NZ sudah lama, dan sudah seperti teman dekat di pelabuhan ini. Tapi entah setan apa yang merasuki pikirannya saat itu. Padahal AM yang merupakan saudara FG juga kenal baik dengannya. Kita sangat kecewa mendengar kalau NZ diduga sebagai pelakunya,” terang HH. Katanya, kebayakan penarik betor yang sering mangkal di lokasi pelabuhan, sangat kenal baik dengan keluarga AM. Bahkan NZ sering singgah di warung AM. “Kalau NZ masih berpikir baik, seharusnya dia datang untuk menjelaskan masalah ini. Bukan malah menghindar. Berani berbuat, berani bertanggung jawab,” pungkas HH. Sementara itu, kondisi korban FG hingga Senin (17/9) terlihat masih belum pulih. Bahkan, kondisinya masih labil. Kaki kanannya belum bisa digerakkan, kepala belakang korban masih sangat sakit akibat dipukul pelaku. Bahkan, kondisi FG masih pucat. Seperti diberitakan sebelumnya, FG, gadis manis asal Kabupaten Nias Utara dipukuli, diperkosa, dirampok, hingga dibuang di pinggir jalan oleh seorang tukan becak bermotor, tak jauh dari lokasi Rindu Alam, Kelurahan Sibuluan Nalambok, Kecamatan Pandan, Tapteng, Sabtu (15/9) dini hari lalu. Saat ditemukan, kondisi FG terutama pakaian bawah penuh bercak darah, dan di kepala terlihat luka bekas pukulan benda keras, bibir, lutut, tangan kiri luka memar dan tergores. Selain itu, handphone korban serta uang Rp500 ribu raib diambil pelaku. (son/cr-1)

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

mayat tersebut. Kedua korban yakni Fasui Waruwu warga Jalan Kutilang, Kelurahan Aek Habil, dan Suwarta Barita Bate’e warga Lorong 7 Arah Laut, Pasir Bidang, ditemukan tengah mengapung di tengah laut. “Saat ditemukan, jarak kedua mayat itu berdekatan, dimana satu mayat dalam keadaan bugil, sedangkan satu mayat lagi hanya memakai celana dalam warna

hijau. Dari segi waktu, kedua korban diperkirakan telah meninggal antara 3 hingga 4 hari. Sebab jasad keduanya sudah membengkak serta mengeluarkan bau tidak sedap,” tukas Sitopu. Saat ditemukan, sambung Sitopu, kedua mayat nelayan pamuge itu ditemukan dalam posisi telentang di atas permukaan air. “Setelah beberapa saat, kita

langsung mengevakuasi kedua mayat itu bersama petugas Adpel Sibolga dengan menggunakan Kapal Patroli KNP 302 milik Kantor Adpel Sibolga dan tiba di pelabuhan sekira pukul 17.00 WIB,” tandasnya. Amatan METRO, sejak pukul 16.00 WIB, kawasan Pelabuhan Sibolga sendiri dipadati oleh masyarakat yang ingin menyaksikan proses evakuasi kedua

mayat pamuge tersebut. Plh Kepala Adpel Sibolga Agustina Waruwu yang dikonfirmasi METRO menuturkan, mengetahui adanya penemuan mayat itu, pihaknya langsung berkomunikasi dan berkoordinasi dengan aparat terkait, termasuk dari pihak kepolisian untuk segera berangkat menuju lokasi di sekitar perairan Labu-labu Pulau Mursala. (tob/ son)

Ribuan Simpatisan Setia Dukung Bonaran Foto Pernikahan Sambungan Halaman 1 BOSUR” dan sebuah “Kado Lambang Hati” yang berisi sikat dan pasta gigi, sabun, serta handuk kepada Rantinus. Dalam surat cinta tersebut, ALMATA mengecam aksi unjuk rasa sebelumnya yang ingin menjatuhkan Bonaran. Selain itu, mereka menyatakan bahwa suatu perbedaan pandangan adalah hal yang wajar, juga mengecam pernyataan atau orasi kelompok yang menghujat Bonaran dan pendukungnya tanpa memandang etika berbahasa yang santun. “Kami masih punya nyali serta hati untuk membela BOSUR (Bonaran-Sukran) sampai mati. Karena ini adalah masalah etika, marwah dan nurani,” teriak Winsa Eko Syahputra alias Koko, koordinator sekaligus salah satu orator ALMATA, membacakan isi ‘Surat Cinta’ tersebut di hadapan Rantinus Manalu. Sedangkan pemberian “Kado Lambang Hati”, menurut Koko, menyiratkan pesan peringatan agar sebelum menghujat pihak lain, terlebih dulu membersihkan diri. “Surat Cinta Pendukung Setia BOSUR” dan sebuah “Kado Lambang Hati” itu kemudian diserahkan kepada Rantinus. Keprihatinan terhadap orasi yang menghujat juga disampaikan aktifis Dedi Sutomo Simanjuntak. “Saya melihat hal menarik, bahwa ada dua aksi demo yang berbalas pantun. Tapi, satu hal yang saya sayangkan. Di mana ketika orator salah satu kelompok berorasi, saya lihat ada yang sok hebat dan menghujat pihak lain. Saya kecewa karena kebetulan saya menonton aksi itu,” tukas Dedi. Pada kesempatan itu, eks sekretaris tim pemenangan BOSUR, Safaruddin Simatupang alias Kapalo menegaskan, kinerja Bonaran dalam setahun memimpin Tapteng

belum bisa dikatakan gagal. Sebab, barometer penilaian yang seharusnya adalah berdasarkan realisasi pembangunan yang tertuang pada APBD Tapteng TA 2012. “APBD TA 2012 lah nanti yang murni dan langsung digodok oleh pemerintahan Bonaran. Mari samasama nanti di akhir tahun ini kita melihat apakah benar pemerintahan Bonaran gagal atau tidak. Kalau kemarin ada pihak yang menyatakan pemerintahan Bonaran gagal, itu terlalu dini,” tukas Safaruddin yang juga mantan anggota DPRD Tapteng. Perihal persoalan sengketa tanah di Tapteng, menurut Kapalo, itu adalah warisan pemerintahan sebelumnya. Namun kini itu menjadi PR (pekerjaan rumah) pemerintahan Bonaran. “Saya sarankan, mari kita bicara, bicara masalah di Tapteng, bagaimana pembangunan di Tapteng bisa lebih lebih baik di masa yang akan datang. Jangan terlalu dini memberikan penilaian. Berikan penilaian yang original, tidak mengedepankan kepentingan pribadi. Karena itu juga, saya meyampaikan kepada pendukung Bosur agar jangan mau diprovokasi. Kita masih setia kepada pemerintahan Bonaran,” teriak Kapalo. Sementara itu, dengan tenang Rantinus Manalu menerima dan menjawab kehadiran dan aspirasi serta tuntutan massa. Rantinus pada kesempatan itu menceritakan kisah perjuangannya mengusung Bonaran semasa pemilukada lalu. Tapi sayang, sebelum menyelesaikan kisahnya, massa malah balik meneriakkan yel-yel “Hidup BOSUR!”. “Kalau diukur semasa pemilukada, apakah memang cinta kalian, pengorbanan kalian, sikap dukungan kalian lebih besar kepada Bonaran dari pada kepada saya. Mari kita lihat, objektiflah,” tanya

Rantinus yang dijawab oleh massa dengan yel-yel “Hidup BOSUR!”. Rantinus melanjutkan, dia memiliki harapan saat memperjuangkan Bonaran menjadi Bupati Tapteng dengan berbagai konten. Tetapi, sambungnya, yang didahulukannya adalah masalah kemanusiaan. “Ini perjuangan saya. Permasalahan rakyat yang menyangkut hak-hak atas tanah agar diselesaikan. Saat itu dia (Bonaran) setuju untuk itu,” tukas Rantinus seraya menuding massa adalah massa bayaran. Pernyataan Rantinus itu kembali dijwab massa dengan teriakan yelyel “Hidup Bosur!”. “Kami mohon maaf, kami datang kemari bukan mau mendengar ceramah. Tapi kami mau menujukkan kepada BOSUR dan meminta pertanggungjawaban orang yang menghujat kami,” tukas Koko seraya menegaskan bahwa massa yang hadir bukanlah massa bayaran seperti dituduhkan. Sebelum membubarkan diri, massa membubuhkan tandatangan pada sehelai kain putih panjang yang dibentangkan, sebagai bentuk dukungan setia kepada Bonaran. Aksi unjuk rasa yang berlangsung sekitar 45 menit tersebut berjalan aman dan tertib dengan pengawalan petugas Polres Sibolga. Usai menggelar orasi dan menyampaikanaspirasi,dengantertibmassa bergerak kembali ke titik kumpul sebelumnya, yakni di simpang kantor Walikota Sibolga-rumah dinas Bupati Tapteng, sekitaran Lapangan Simaremare, Sibolga. Setibanya di titik kumpul, secara berangsur dan tertib, massa kemudian membubarkan diri. Ribuan massa pendukung setia Bosur itu datang dengan mengendarai sepedamotor, bus angkutan umum dan truk, dari berbagai kecamatan. (mora)

saya sikapi, biarkan saja begitu. Saya tidak perlu membela diri dengan itu. Tapi yang jelas, catat ini, saya tidak akan pernah berhenti untuk mengkritisi roda pemerintahan Bonaran karena ada perjanjian kami untuk menyelesaikan masalah tanah. Itu saja kepentingan saya,” ujar Rantinus seraya mengatakan dirinya memiliki bukti bahwa massa ALMATA adalah massa bayaran.

Rantinus juga membantah dirinya melontarkan hujatan saat berorasi seperti yang dimaksud. Rantinus justru berdalih, dia memiliki bahan orasi sendiri. “Saya tidak ada menyatakan itu dalam orasi saya. Saya hanya menagih janji Bonaran dan keadaan di Tapteng sekarang. Kalau ada di luar itu yang saya katakan, saya siap bertanggung jawab,” tukas Rantinus. Geram Batal Beraksi Sementaraitu,aksiunjukrasalanjutan

The Real Galacticos Sambungan Halaman 1 saja, Trofi Liga Champions masih gagal masuk lemari koleksi sudah satu dekade lamanya. Terakhir musim 2001-2002 mereka angkat trofi antar klub benua biru itu. Lalu edisi 2009 hingga kini, Real Madrid masih hobi mengoleksi pemain kelas satu dunia. Dimulai dari era perekrutan Cristiano Ronaldo hingga zaman Karim Benzema dkk. Bedanya usia bintang yang dihadirkan relatif lebih muda dibanding Los Galacticos edisi perdana. Di bawah kendali pelatih nyentrik bermental juara, Jose Mourinho, Florentino Perez sang presiden klub ingin Madrid kembali

jawara di Eropa. Dan musim inilah ambisinya. Konstelasinya? Oke. Lihat Manchester City masa kini. Disupport syeikh kaya raya, Mansour bin Zayed Al Nahyan, City menjelma jadi klub bertabur bintang. Mereka acap kali disebut media sebagai peniru ulah Real Madrid dengan Los Galacticos-nya. Dengan asupan dana melimpah, City mudah saja memboyong pemain yang diinginkan. Lihatlah sederet pemain ini: Mario Balotelli, Carlos Tevez, David Silva, Edin Dzeko, Sergio Aguero, Yaya Toure. Dan, siapa pun yang diiginkan sang syeikh sesuai kebutuhan Mancini, bisa dilobi lalu dibeli.

Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana:... Kordinator Liputan Ridwan Butarbutar, Asisten Kordinator Liputan (Bonapasogit): Horden Silalahi. Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe , Rinawati Marbun (koresponden barus), Jonter (Humbahas), Bernard Lumbangaol, Hengki Tobing (Taput), Hermanto Turnip, Brams Situmorang (Tobasa) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel),

Sambungan Halaman 1 tewas di tengah laut, dirinya sudah mendapat firasat buruk. “Hari Kamis malam (13/9) sekira pukul 21.00 WIB saat kami sedang menonton di rumah, tiba-tiba foto pernikahan kami terjatuh dan pecah berkeping-keping tanpa diketahui sebabnya. Saat itu tiba-tiba perasaanku jadi tidak enak, apalagi suamiku belum pulang ke rumah,” ujar Etty kepada METRO di ruang instalasi jenazah RSU dr FL Tobing Sibolga, Senin (17/9) malam. Karena perasaannya tak enak, sambung Etty, ia pun lantas meminjam handphone milik tetatangganya dan mencoba menghubungi nomor suaminya namun tidak berhasil, meskipun sudah dicoba berulangkali. “Habis kutelepon namun tak masuk, perasaanku semakin tak enak dan akupun menanyakan kepada kawan-kawannya untuk mengetahui keberadaannya. Namun dari beberapa kawannya yang kutanya, tidak ada yang mengetahuinya,” ujarnya lantas mengatakan kalau suaminya itu berangkat dari rumah hari Kamis (13/9) sekira pukul 10.00 WIB. Hingga keesokan harinya, sambung Etty, kabar keberadaan suaminya, juga tak kunjung diketahuinya. Berulang kali dicoba dihubungi ke nomor handphone Suwarta, tidak pernah bisa ter-

sambung. “Sejak itu, aku selalu menanyakan keberadaan suamiku kepada setiap orang, baik yang baru pulang dari laut atau menitipkan pesan kepada nelayan yang akan berangkat untuk memberikan kabar jika menemukan suamiku di laut. Itupun hasilnya nihil,” terang ibu empat anak ini. Saat mendengar ditemukannya mayat di laut, ujarnya, Etty pun langsung secepatnya menuju ruang instalasi jenazah RSU Sibolga. “Waktu aku datang pertama, aku sempat berharap kalau dia bukan suamiku, sebab tatto yang ada di tangannya sebelah kanan setahuku tidak sebesar tatto yang ada di tangan salah satu mayat. Sehingga aku sempat pulang ke rumah dan memberitahukan kalau mayat yang ditemukan bukan suamiku,” tukasnya. Sekitar dua jam kemudian, sambung Etty, ada pihak keluarga yang memberitahukan kepadanya kalau salah satu dari mayat yang ditemukan adalah suaminya sesuai dengan ciri-cirinya. “Akupun datang lagi ke RSU Sibolga untuk memastikannya. Dan saat aku datang, ternyata selain di tangan kanan, di bagian dada kanan juga ada tatto naga, gigi bagian atasnya rompel serta ada bentuk tulisan di punggungnya. Tandatanda itulah yang membuatku yakin kalau itu adalah suamiku,” ucapnya terisak. (tob)

Belum Ada Pemeriksaan Saksi Tambahan

yang rencananya dilakukan Geram (GerakanRakyatMengugat)padaSenin (17/9) ke kantor DPRD Tapteng di Pandan serta ke rumah dinas Bupati TaptengdiSibolga,bataldigelar. “Batal karena pertimbangan keamanan umum,” ujar Kapolres Sibolga AKBP Joas Feriko Panjaitan membenarkan bahwa sebelumnya sudah ada surat pemberitahuan untuk melakukan unjuk rasa yang disampaikan Geram ke pihaknya. (mora)

keluarga almarhum. Sebelumnya, Edi mengungkapkan pihaknya belum bisa mempublikasikan penyelidikan lebih jauh. “Kami belum bisa mempublikasikan hasil penyelidikan lebih jauh, itu demi menjaga fokusnya penyelidikan itu sendiri. Kami juga masih menunggu hasil otopsi dari tim dokter Labfor Poldasu. Pada saatnya nanti pasti akan kami ungkapkan,” tukas Kapolsek di Pantai Kalangan, Pandan, Kamis (13/9) lalu. Seperti diberitakan sebelumnya, jasad Wanda ditemukan tewas tergantung di jendela kamar 304 lantai III Hotel Bumi Asih Pandan, Tapteng, Jumat (31/8) siang lalu. Kamar itu sebelumnya ditempati Rudolf Situmeang yang juga Ketua Partai Hanura Tapteng.

Saat ditemukan, korban mengenakan baju tank top warna merah garis-garis hitam dan celana jeans pendek sepaha warna biru. Sementara posisi kaki kiri korban tergantung hampir mengenai lantai. Namun, bokong korban masih menyentuh sandaran kursi tamu hotel yang ada di dalam kamar tersebut. Sedangkan kaki kanannya masih tertekuk di atas dudukan kursi. Jasadnya belum begitu kaku karena diperkirakan baru meninggal sekitar enam jam sebelum ditemukan. Tapi lidahnya dalam kondisi sedikit menjulur keluar. Jasad Wanda kemudian dibawa ke RSU Pirngadi Medan untuk diotopsi pada malam hari ditemukan. Sebelumnya, hasil visum luar RSUD Pandan, tak didapati bekas kekerasan di tubuh korban, dan penyebab kematiannya diperkirakan karena tersumbatnya jalan nafas. (mora)

Bahkan, anekdot di kalangan pundit menyebutkan jika saja Lionel Messi dijual Barcelona bertriliun harganya, maka sang syeikh siap membayar. Begitulah konstelasinya. Sama-sama berstatus klub bertabur bintang. Hanya itu. Jika menilik prestasi, sudah jelas jawabnya. Madrid sudah punya sembilan trofi Liga Champions di lemarinya, sedangkan The Citizen nihil. Apa kata para juru racik strategi untuk laga ini? Kita mulai dari cuapcuap Mancini. Di Soccernet diberitakan jika Mancini berencana membangun sejarah layaknya Real Madrid. Bukan sekarang, tapi 10 tahun lagi. Wartawan usil bertanya yang lebih kepada menyindir soal uang yang dimiliki City. Menurut analisa awak media, uang tak akan

mampu membeli sejarah. Tapi Mancini yang doyan senyum menjawab santai. “Sudah jelas, kami memang tidak memiliki sejarah seperti Real Madrid. Tapi kami sudah memenangkan beberapa piala kok,” bebernya. “Kami ingin menang sekarang. Dan dalam 10 tahun ke depan kami akan menjadi tim top seperti Real,” lanjut pelatih yang menggantikan Mourinho di Inter Milan 2010 silam. Isu Ronaldo yang sedang galau di Bernabeu juga diamati pelatih asli Italia itu. Bahkan, dia berharap Ronaldo tak dimainkan. “Lebih baik jika mereka meninggalkan Ronaldo di rumah. Ronaldo adalah pemain terbaik dunia,” sebutnya. Kalau Mou yang minta dipanggil The Only One tampak lebih santai

menatap laga ini. Baginya yang utama adalah menang dan lolos dari grup maut ini. Grup D memang neraka. Dihuni empat klub jawara empat liga berbeda. Madrid wakili Spanyol, City wakili Inggris serta Ajax sang juara Belanda plus Dortmund yang angkat trofi di Jerman. Jadi bagaimana ambisi menggenapkan gelar juara Eropa jadi 10? “Itu sangat menarik. Kalau kami mencapai angka 10 dalam raihan trofi itu akan menjadi satu-satunya. Cara merebutnya ya dengan motivasi untuk terus menang, bermain baik dan juara.” “Tapi sepak bola itu indah karena tak kerap terduga. Kadang-kadang tim terbaik pun bisa tidak menang,” tutup Mourinho. So, siapa yang layak disebut The Real Galacticos? (*)

Rantinus: Saya Tak Akan Berhenti Mengkritisi Sambungan Halaman 1

Jatuh Berkeping-keping

Sambungan Halaman 1

Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan

Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli: Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



18 September 2012

Bupati Tapteng Sesalkan Lambannya Kinerja Poldasu Sambungan Halaman 8 serius,” ujar Bupati Tapteng, Raja Bonaran Situmeang, Senin (17/9) malam. Disebutkannya, meski pihak Polres Tapteng dan Polres Sibolga langsung melakukan pengamanan terhadap rumah dinasnya sejak laporan ke Poldasu dilakukan, namun hingga kini untuk penanganan kasusnya sangat lamban. Bahkan Bonaran menilai Poldasu suka bertele-tele dalam menerima laporan dari masyarakat . “Memang saya sudah diperiksa. Sejak laporan saya ke Poldasu, rumah dinas saya juga diamankan. Tapi kenapa penanganan kasusnya lamban? Polisi suka bertele-tele, jangan karena rumah dinas saya diberi penanganan yang secukupnya, lantas penyelesaian kasusnya menjadi lamban. Kalaupun ada suatu tindak pidana, di negara ini hukumlah yang harusnya ditegakkan,” tegasnya. Seperti diketahui, Raja Bonaran Situmeang SH telah melaporkan Anggota DPRD Kota Sibolga dari Komisi I, Muchtar Nababan ke Poldasu pada Senin (3/9) lalu sekitar pukul 14.30 WIB. Anggota dewan dari fraksi Golkar itu dituding mengancam Bonaran yang dimuat salah satu media massa beberapa waktu lalu. Laporan itu sesuai dengan nomor polisi LP/924/IX/2012/SPKT II.Raja Bonaran mengaku, ancaman tersebut dilontarkan oleh Muchtar Nababan di surat kabar harian yang terbit di Tapteng tertanggal Kamis (30/ 8) yang isinya Muchtar Nababan mengajak masyarakat Kota Sibolga mengkapling rumah dinasnya bila tetap diperintahkan Satpol PP Tapteng untuk menghentikan Pembangunan Kantor Dinas Pendidikan (Disdik) di Kota Sibolga. “Dalam surat kabar itu, oknum tersebut mengancam saya dengan mengatakan, dia harus ingat kalau dia masih tinggal di Kota Sibolga, bukan Tapteng. Jadi, kalau memang dia masih tetap melanjutkan tindakannya, maka saya bersama masyarakat akan mengkapling rumah dinasnya. Dan ingat jangan pancing harimau yang sedang tidur, kau,” ucap Bonaran menirukan perkataan Muchtar Nababan. Meski menjadi Bupati dari partai berlambang pohon ber-

ingin, namun, Bonaran mengaku tidak mengenal Muchtar Nababan. Bahkan, Bonaran mengaku, karena takut dengan ancaman oknum tersebut, dirinya terpaksa meminta pengamanan lebih ketat dari Poldasu dan organisasi Angkatan Muda Pembaharuan Indonesia AMPI Kota Sibolga. Bukan itu saja, lanjut Bonaran, oknum anggota DPRD Sibolga tersebut juga menyebutkan akan terjadi perang antara Pemko Sibolga dan Tapteng. Menurut Bonaran, ancaman yang diterimanya dari Muchtar Nababan, berawal dari asset Pemkab Tapanuli Tengah (Tapteng) di Sibolga yang akan dibangun oleh Dinas Pendidikan Kota Sibolga. Karena bangunan tersebut adalah aset Pemkab Tapteng, maka aset tersebut juga tertulis dalam laporan keuangan Pemkab Tapteng. Jika akan diambil alih pihak lain, maka harus melalui dua cara yaitu ruislagh dan ganti rugi. “Jadi sebenarnya aset ini terdaftar di buku besar Pemkab Tapteng. Oleh mereka asset ini mau dibangun menjadi Dinas Pendidikan Kota Sibolga. Tapi kita tidak memperbolehkan. Karna ini aset Pemkab Tapteng. Memang mereka ada ajukan prmohonan kepada saya, tapi belum saya proses, mereka sudah kuasai bangunan itu tanpa sepengetahuan kita. Kan nggak boleh dong, Ini harus dipertahankan. Kalau pun mau diserahkan harus ada prosedurnya yang diikuti,” jelasnya. Dalam kesempatan tersebut, Bonaran Situmeang juga kembali membuat laporan ke Poldasu dengan nomor LP/ 984/IX/2012 SPKT 1 diterima oleh Brigadir Aziz Simangunsong. Dimana dalam laporan itu, Bonaran menyesalkan salah satu media lokal yang menurutnya melakukan pencemaran nama baik atas dirinya. “Jadi saya buat laporan ke Poldasu, dimana dalam berita itu nama baik saya dicemarkan dengan menuduh bahwa saya telah korupsi, membuat pemalsuan terhadap berkas calon PNS. Kalau memang saya melanggar hukum kenapa mereka tidak laporkan kepolisi? kenapa malah meng-iklankannya di koran, inikan pencemaran nama baik secara tertulis. Saya harap laporan saya ini segera ditindak Poldasu,” bebernya. (far/smg)

Pemko Kirim Surat Permohonan ke Pemkab Sambungan Halaman 8 pengalihan aset daerah yang dipimpin Sekdaprovsu H Nurdin Lubis, Selasa (11/9) lalu di ruang rapat Melati, Lantai 9 Kantor Gubsu. “Artinya, Pemerintah Provinsi Sumatera Utara (Pempropsu) telah berupaya menjembatani sekaligus mencarikan solusi yang terbaik terhadap persoalan yang terjadi antara Pemko Sibolga dengan Pemkab Tapteng terkait penggunaan aset milik Pemkab Tapteng berupa lahan seluas 11 m x 28 m untuk pemban-

gunan gedung kantor Disdik Sibolga yang baru. Serta penggunaan bangunan eks Akper sebagai kantor sementara Disdik Sibolga,” tutur Sugeng kepada METRO usai menyampaikan surat tersebut di Kantor Bupati Tapteng. Setelah menerima surat tersebut, sambung Sugeng, Sekdakab Tapteng Baharuddin Manik berjanji segera melaporkannya kepada Bupati Tapteng Raja Bonaran Situmeang SH MHum. Kadis Pendidikan Sibolga Alpian Hutauruk menambahkan, surat Wali Kota Sibolga berno-

mor 420/1450/2012 tertanggal 17 September 2012, tentang permohonan izin menempati gedung eks SPK/Akper/Akbid Kabupaten Tapteng tersebut ditujukan langsung kepada Bupati Tapteng dan ditandatangani oleh Wali Kota Sibolga Drs HM Syarfi Hutauruk. “Berdasarkan hasil rapat pembahasan pengalihan asset daerah di kantor Gubsu pada 11 September 2012 lalu yang dihadiri Sekdakot Sibolga M Sugeng, Sekdakab Tapteng Baharuddin Manik dan sejumlah pejabat terkait lainnya, telah berhasil diperoleh beberapa

KPU Umumkan Penerimaan PPS Sambungan Halaman 8 Sementara untuk panitia pemungutan suara (PPS) dilakukan mulai tanggal 15 September hingga tanggal 29 September 2012. “Berkaitan dengan hal itu, dimohon kepada lurah se-Kota Sibolga mengusulkan namanama calon anggota PPS bersama–sama dengan lembaga permasyarakatan kelurahan kepada KPU kabupaten/kota. Persyaratannya, warga negara Indonesia, berusia minimal 25 tahun, setia pada Pancasila, UUD 1945, dan cita-cita Proklamasi 17 Agustus 1945, mempunyai integritas, pribadi yang kuat, jujur, dan adil,” terang Syam Suharmi. Persyaratan lain dikatakannya yakni, tidak menjadi anggota partai politik yang dinyatakan dengan surat yang sah atau sekurang-kurangnya dalam jangka 5 tahun tidak lagi men-

jadi anggota partai politik. “Soal ini, harus dibuktikan dengan surat keterangan dari pengurus partai politik yang bersangkutan. Syarat lainnya ialah berdomisili dalam wilayah kerja PPS, sehat jasmani dan rohani, pendidikan paling rendah SLTA atau sederajat, tidak pernah dipidana penjara berdasarkan putusan pengadilan yang telah memperoleh kekuatan tindak pidana dengan hukuman 5 tahun atau lebih,” tambahnya. Masih kata Syam Suharmi, jumlah calon anggota PPS yang dikirim kepada KPU Kota Sibolga sekurang-kurangnya 2 kali kebutuhan yaitu 6 orang dari tiap-tiap kelurahan dengan melampirkan persyaratan pada poin 4. Pengiriman namanama calon PPS Pilgubsu 2013 paling lambat 19 September 2012 pukul 16.00 WIB. Sedangkan terkait dengan penerimaan anggota sekretariat PPK dan PPS, Syam Suharmi mengata-

kan, sesuai dengan surat pembentukan Sekretariat PPK dan PPS sebagaimana dimaksud dimohon kepada camat dan lurah se- Kota Sibolga agar memfasilitasinya. “Kepada para camat agar mengusulkan 3 calon sekretaris PPK kepada Walikota Sibolga, secara kolektif melalui KPU Kota Sibolga dengan terlebih dahulu berkonsultasi dengan Sekretaris Daerah. Selanjutnya dipilih dan ditetapkan 1 nama sebagai sekretaris PPK dengan keputusan Walikota Sibolga. Kedua mengangkat 3 orang PNS untuk ditugaskan menjadi staf sekretariat PPK melalui usulan PPK, untuk selanjutnya ditetapkan dengan keputusan camat yang bersangkutan,” urainya. Terakhir katanya, lurah agar mengangkat 3 pegawai negeri sipil yang terdiri dari seorang sekretaris, seorang staf urusan teknis, dan seorang staf urusan tata usaha keuangan. (son/nasa)

Tepung Tawari 8 Calon Jamaah Haji Sambungan Halaman 8 Pelaksanaan tepung tawar clon haji ini, sambungnya, juga bertujuan untuk memberikan semangat kepada calhaj untuk ikhlas dalam menjalankan ibadah yang sakral, sehingga menjadi haji yang mabrur serta semakin mendekatkan diri kepada Allah SWT. “Kami juga mengharapkan bagi para calon haji dan hajjah saat berada di ka’bah mendoakan agar warga yang tergabung dalam STM Haholongan lainnya nantinya mendapat kesempatan dari Allah SWT menunaikan ibadah haji,” ujarnya seraya berharap supaya warga Sibolga lainnya juga mendapat ridho Allah, dan melakukan yang terbaik dan yang patut untuk dilakukan.

Wali Kota Sibolga Drs HM Syarfi Hutauruk pada kesempatan itu berharap kepada para calhaj, sekembali dari tanah suci Mekkah nantinya kiranya dapat menjadi sosok pemimpin, pioneer (terdepan) dan tauladan di tengah-tengah mayarakat. “Karena dengan kepergian ke tanah suci, kita semakin dapat mengintropeksi diri, dan tahu apa yang patut dan tidak untuk dilakukan,” tukas Syarfi. Bagi umat muslim yang mendapat kesempatan berangkat naik haji, sambung Syarfi, harus betul-betul melaksanakannya dengan niat tulus dan ikhlas sehingga mendapat gelar haji yang mabrur. “Sebab ibadah haji yang tiap tahunnya dilaksanakan umat muslim merupakan rukun islam yang ke lima dan barang siapa yang te-

lah mampu ekonominya, maka segeralah berangkat menunaikannya dan jangan menundanunda,” ujar Syarfi. Syarfi juga meminta kepada calhaj untuk betul-betul menyiapkan sikap secara mental dan fisik untuk berangkat ke tanah suci, terutama kesiapan untuk meninggalkan semua urusan, baik urusan rumah, seperti urusan keluarga dan harta benda. “Sebab kita harus bisa mengikhlaskan semua yang harus ditinggalkan, saat menjalankan ibadah haji. Dan kegiatan kekeluargaan yang dilaksanakan saat ini merupakan gambaran kegiatan STM Haholongan dalam mempererat tali silaturahmi, sekaligus merajut terus semangat kekeluargaan dan persaudaraan,” tandasnya. (tob/nasa)

kesepakatan,” ungkap Alpian. Kesepakatan itu, lanjut Alpian, diantaranya terkait permintaan Wali Kota Sibolga untuk bisa menggunakan asset berupa lahan seluas 11 m x 28 m milik Pemkab Tapteng. “Pemko Sibolga siap melakukan ketentuan apakah berbentuk ganti rugi, ruislag atau hibah sesuai dengan ketentuan yang berlaku. Sepanjang proses pengalihan aset belum selesai, maka proses pembangunan di atas lahan tersebut dihentikan terlebih dahulu,” tukas Alpian. Kemudian, sambungnya, Bupati Tapteng juga berkenan

meminjamkan asset berupa gedung eks SPK untuk kantor sementara Dinas Pendidikan Sibolga, maka itu Walikota Sibolga segera membuat surat kepada Bupati Tapteng dengan referensi hasil rapat yang digelar pada tanggal 11 September 2012 tersebut. “Dari rapat tersebut juga disepakati, bahwa dalam waktu dekat akan diadakan pertemuan Pimpinan yaitu, antara Bupati Tapteng Raja Bonaran Situmeang SH MHum dan Wali Kota Sibolga Drs HM Syarfi Hutauruk dengan Plt Gubernur Sumut,” tandas Alpian. (tob/nasa)

Sumbang Sembako ke Panti Asuhah Sion Sambungan Halaman 8 bantuan juga sebagai momen mempererat hubungan silaturahmi dengan sesama yang kurang beruntung. “Secara nilai materinya bantuan ini memang tidak seberapa nilainya. Tapi, inilah ketulusan kami untuk berbagi kasih kepada adik-adik yang dirawat, dibina dan disekolahkan di panti asuhan ini. Kami berharap, adik-adik kami yang di sini dapat tersenyum seperti yang kami rasakan,” terangnya. Pada kesempatan itu, panitia

juga menyampaikan terimakasih kepada seluruh anggota dan alumni tim PS Anugrah yang turut berpartisipasi dalam kegiatan pemberian bantuan. Puncak perayaan HUT sendiri digelar di Puncak GM Panggabean, Bonan Dolok, Kecamatan Sitahuis, Tapteng pada hari Minggu (16/9). Acara yang mengusung tema “Aku mau bernyanyi bagi Tuhan, bermazmur bagi Tuhan” dari Kitab Hakim-hakim 5:3B itu diisi dengan kebaktian rohani, penampilan koor, pemotongan kue ulang tahun, dan makan bersama. (kris/nasa)

Telkomsel Undi 2 Unit Mobil KIA Sportage M/T Sambungan Halaman 8 Customer Care Regional Sumbagut Division Telkomsel – Filin Yulia, sesaat setelah pengundian berlangsung. Menurut Head Of Telkomsel Sumatera Group – Gilang Prasetya “Program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA merupakan salahsatu program yang diperuntukan bagi pelanggan yang telah setia menggunakan produk Telkomsel serta mitra outlet yang telah setia menjaga loyalitas pelanggan Telkomsel melalui ketersediaan produk di outlet hingga membantu Telkomsel dalam melakukan edukasi keunggulan produk Telkomsel kepada pelanggan di outletnya”. Program Rejeki Isi Ulang adalah program yang dikhususkan untuk pelanggan prabayar Telkomsel di Sumatera (kecuali nomor HLR Aceh), baik pelanggan baru maupun pelanggan yang sudah lama meng-

gunakan kartu simPATI, Kartu AS dan Kartu Facebook. Untuk mengikuti program ini tidak diperlukan registrasi khusus, caranya pelanggan prabayar cukup melakukan isi ulang pulsa pada periode program yang berlaku mulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Jika selama periode program telah mencapai total isi ulang minimal Rp.60ribu, secara otomatis pelanggan tersebut akan berpeluang mendapatkan salahsatu hadiah. Bagi pelanggan yang melakukan isi ulang pulsa selama periode program, mencapai total isi ulang pulsa minimum Rp.300.000, secara otomatis berpeluang mendapatkan salahsatu dari seluruh hadiah yang disediakan berupa 30 (tiga puluh) HP Android, 30 (tiga puluh) Tas Trolley, 9 (sembilan) unit Samsung Galaxy Tab 8.9”, 9 (sembilan) unit Sepeda Motor Honda Vario, dan hadiah utama undian berupa 1 (satu) Mobil KIA Sportage M/T. (leo)

Demo TPL, Massa Dihadang Kawat Berduri Sambungan Halaman 1 Para pendemo yang mendapat pendampingan dari mahasiswa Sahabat Lingkungan (Saling) ini, nyaris terlibat bentrok dengan pihak TPL. Itu terjadi ketika demonstran mencoba merubuhkan blokade TPL yang terbuat dari kayu berlapis pagar berduri yang dibentangkan di jalan masuk TPL. Namun, bentrok yang terjadi dengan satpam TPL tidak berlangsung lama, sebab langsung dilerai aparat Polres Simalungun. Selanjutnya, demonstran diizinkan masuk ke dalam. Dan enam perwakilan warga dipersilakan bermediasi dengan pimpinan TPL. Pertemuan tersebut tetap tidak membuahkan hasil. Pasalnya, tuntutan warga terhadap TPL tidak bisa direalisasikan. Perwakilan TPL, Tagor Manik (pimpinan TPL sektor Aek Nauli) dan didampingi Lambertus Siregar (Humas) memberikan jawaban tidak memuaskan. Massa yang berang langsung menyudahi pertemuan. “Kami tidak mau mendengarkan retorika bapak. Kami mau mendengar jawaban bapak terkait keluhan warga. Kalau tidak bisa diputuskan hari ini, kami berikan waktu 1x24 jam. Kalau juga tidak bisa diputuskan, aksi ini akan lebih besar,” ujar aktivis lingkungan, Rado Damanik. Adapun tuntutan warga antara lain; kembalikan lahan pertanian warga yang diserobot seperti di Nagori Naga Hulambu. Jangan lagi terjadi intimidasi dari oknum aparat atas suruhan TPL seperti yang pernah dialami warga. Lalu, hentikan

(foto: tonggo)

Massa pengunjuk rasa TPL yang dihadang pagar kawat berduri. penimbunan anak-anak sungai demi kepentingan jalan pengangkut kayu sehingga persawahan warga kering. “Keberadaan TPL di Simalungun menyengsarakan masyarakat. Pupuk yang digunakan TPL adalah pupuk bersubsidi dan BBM bersubsidi. Akibatnya masyarakat harus mengalami kelangkaan pupuk dan BBM. Insfratruktur jalan rusak dan penyebab utama banjir,” tegas Rado yang juga pembina Saling. Koordinator Saling, Johannes Sakti Sembiring menambahkan, berdirinya suatu perusahaan harus

berdampak positif bagi suatu daerah, khususnya masyarakat sekitar. Perekrutan tenaga kerja perusahaan tersebut juga harus melibatkan putra daerah, karena kehadiran perusahaan di sana untuk kesejahteraan masyarakat. Tetapi tidak dengan TPL yang hanya menjadi momok menakutkan bagi masyarakat Kabupaten Simalungun. Sebab, sejak keberadaan TPL banyak hak-hak warga yang dirampas demi kepentingan perusahaan. Tutup TPL Harga Mati Massa dalam orasinya menegaskan

bahwa tutup TPL adalah harga mati, sebagaimana juga terpampang dalam spanduk yang mereka usung. Menurut mereka, masyarakat sudah terlampau lama menderita dengan keberadaan TPL di Simalungun. Menurut Ketua Gapoktan Pondok Bulu Dongan Silalahi, pihaknya sangat kecewa ketika PT TPL melarang masyarakat lewat dari jalan umum yang sudah dibuatkan palang. Palang tersebut setiap hari dijaga dua sampai tiga satpam. “Kami mau masuk kampung sendiri harus melapor kepada satpam

TPL. Padahal jalan yang mereka palang adalah jalan umum yang setiap hari dilewati masyarakat. Tiga kampung yang berada di dalam terpaksa mencari jalan alternatif,” katanya. Ia menambahkan, pada tahun 1999 PT TPL sempat ditutup. Saat itu, masyarakat merasa senang karena bisa mendapatkan hasil panen yang memuaskan. Tetapi beberapa tahun terakhir sejak TPL berdiri kembali, masyarakat petani sawah banyak beralih fungsi menanam jagung karena air dari anak sungai mengering.

Menurutnya, itu terjadi karena sejumlah anak sungai di dalam TPL ditutup demi kebutuhan jalan mobil pengangkut kayu. Menyikapi hal tersebut, Rado Damanik dengan tegas mengatakan PT TPL sudah menghina masyarakat Simalungun karena melarang masuk ke kampung halamannya sendiri. Maka kesimpulannya, PT TPL harus angkat kaki dari Kabupaten Simalungun. “Sudah banyak budaya yang dilupakan PT TPL. Selama ini masyarakat diam, sehingga mereka bebas melakukan apa saja. Sekarang kami melakukan perlawanan sampai titik darah penghabisan,” tegas Rado. Camat Dolok Panribuan James Siahaan SSTP yang hadir dalam kesempata tersebut mengatakan, perwakilan TPL tidak bisa memberikan keputusan terkait tuntutan masyarakat. Solusinya, masyarakat menyampaikan tuntutannya, lalu oleh camat diminta tanggapannya dari TPL. “Satu kali 24 jam diberikan kesempatan menjawab tuntutan masyarakat. Tetapi kalau tuntutan tidak terealisasi, maka aksi besarbesaran akan dilakukan sebagaimana tertuang dalam surat izin Polres,” katanya. Sementara itu, Pimpinan PT TPL sektor Aek Nauli Tagor Manik mengatakan cerita akhir dari aksi tersebut adalah seluruh tuntutan masyarakat akan dituangkan dalam surat, dan diserahkan kepada camat, dan camat menyerahkannya ke PT TPL. “Itu sudah merupakan bagian keputusan. Tetapi pada prinsipnya, PT TPL bekerja sudah sesuai tupoksi dan peraturan perundang-undangan yang berlaku,” katanya. (osi)


18 September 2012


Pemko Kirim Surat Permohonan ke Pemkab „ Syam Suharmi

KPU Umumkan Penerimaan PPS SIBOLGA- Menghadapi Pemilihan Gubernur Sumatera Utara mendatang, Komisi Pemilihan Umum Kota Sibolga mengumumkan penerimaan PPS (Panitia Pemungutan Suara). Hal ini sesuai surat KPU Sibolga No 274 / 286/KPU/2012, tanggal 14 September 2012, perihal perekrutan anggota PPS. Surat tersebut ditanda tangani oleh Ketua KPU Kota Sibolga Nazran SE. Ketua KPU Kota Sibolga Nazran SE melalui Sekretaris KPU Syam Suharmi, Senin (17/9) mengatakan, sesuai tahapan pilgubsu disampaikannya bahwa berdasarkan ketentuan pasal 10 ayat (3) huruf d UU Nomor 15 tahun 2011 tentang penyelenggaraan Pemilihan Umum, untuk membentuk PPK, PPS dan KPPS, dan berdasarkan lampiran KPU Provinsi Sumut No.01/KPTS/KPU– Prov–002/2012 tentang Tahapan Pilgubsu 2013, pembentukan panitia pemilihan kecamatan (PPK) diberlakukan mulai tanggal 5 September hingga 19 September 2012. ‹ ‹ Baca

SIBOLGA- Pemko Sibolga secara resmi melayangkan surat permohonan izin kepada Pemkab Tapteng untuk menempati gedung eks Akademi Keperawatan (dulu Sekolah Perawat Kesehatan/SPK) milik Pemkab Tapteng yang beralamat di Jalan Tuanku Dorong Hutagalung, Kota Sibolga sebagai kantor sementara Dinas Pendidikan (Disdik) Kota Sibolga. Surat permohonan izin tersebut diantar dan diserahkan secara langsung oleh Sekadakot Sibolga

Drs Mochamad Sugeng didampingi Asisten I Ir Basar SM Sibarani MSi,

Kadis Pendidikan Drs Alpian Hutauruk MPd, dan Kadis PKAD Januar Effendy Siregar SSos, kepada Sekdakab Tapteng Baharuddin Manik, Senin (17/9) di Kantor Bupati Tapteng di Pandan. Menurut Sekdakot Sibolga M Sugeng, penyampaian surat permohonan izin tersebut merujuk hasil rapat pembahasan tentang ‹ ‹ Baca

„ Sekdakot Pemko Siboolga Drs Mochamad Sugeng (dua dari kanan)

Pemko ...Hal 7

Bupati Tapteng Sesalkan Lambannya Kinerja Poldasu TERKAIT LAPORANNYA TERHADAP MUCHTAR NABABAN

KPU ...Hal 7

SIBOLGA- Bupati Tapteng Raja Bonaran Situmeang SH menyesalkan lambatnya pihak Poldasu dalam menangani kasus pencemaran nama baik dan ancaman yang dilakukan oleh Anggota DPRD Kota Sibolga dari Komisi I, Muchtar Nababan terhadap dirinya. “Terhadap kasus ini, saya menyesalkan lambannya petugas Poldasu menanganinya. Karena sudah dua minggu lebih kasus ini berjalan, tapi pelakunya tidak pernah dipanggil untuk diperiksa. Harusnya Poldasu melihat ancaman ini


Tepung Tawari 8 Calon Jamaah Haji SIBOLGA- Masyarakat asal Tapanuli Bagian Selatan se Kota Sibolga dan Kabupaten Tapteng yang tergabung dalam Serikat Tolong Menolong (STM) Haholongan menepung tawari sekaligus melakukan upahupah terhadap 8 calon jamaah haji, Sabtu (15/9) di Gedung Nasional Kota Sibolga. Acara yang dirangkai dengan halal bi halal 1433 H itu juga dihadiri Wali Kota Sibolga Drs HM Syarfi Hutauruk, Wakil Wali Kota Sibolga Marudut Situmorang AP MSP, pimpinan SKPD Kota Sibolga, tokoh agama, tokoh masyarakat beserta undangan lainnya. Drs SP Pasaribu, selaku pembina STM Haholongan mengatakan tepung tawar dan upah-upah bagi calon jamaah haji keluarga besar STM Haholongan Sibolga dan Tapteng merupakan tradisi dan program kerja organisasi yang setiap tahunnya dilaksanakan. “Dengan acara tepung tawar dan upahupah ini kita berharap agar para jamaah calon haji tetaplah terjaga kesehatannya dalam melaksanakan ibadah haji rukun Islam yang kelima. Kemudian melaksanakan dengan baik seluruh rukun haji dan semoga menjadi haji yang mabrur setelah kembali ke tanah air,” kata SP Pasaribu. ‹ ‹ Baca

Tepung Tawari ...Hal 7

‹ ‹ Baca

Bupati Tapteng ...Hal 7


BANTUAN- PS Anugrah HKBP Sibolga Kota bersama anak-anak yatim PS Sion Sibolga, saat penyerahan bantuan paket sembako, kemarin.


Sumbang Sembako ke Panti Asuhah Sion SIBOLGA- Paduan Suara Anugrah HKBP Sibolga Kota menyerahkan bantuan paket sembako kepada 25 anak yatim penghuni Panti Asuhan Sion di Jalan Sisingamangaraja, Sibolga, Sabtu (15/9). Aksi sosial itu adalah salah satu rangkaian kegiatan dalam menye-

marakkan HUT ke-13 paduan suara gerejawi tersebut. “Pemberian bantuan ini merupakan wujud kepedulian kepada sesama umat manusia. Kita diajarkan untuk selalu berbagi kasih dalam nama Tuhan. Melalui perayaaan ulang tahun PS Anugrah kali ini, anak-

anak yatim yang ada di Panti Asuhan Sion juga bisa ikut merasakan kebahagiaan yang kami rasakan,” ucap Ketua Panitia Roy Hutapea. Sekretaris Panitia, Freddy Tambunan menambahkan, pemberian ‹ ‹ Baca

Sumbang ...Hal 7

„ Bupati Tapteng, Raja Bonaran Situmeang


Telkomsel Undi 2 Unit Mobil KIA Sportage M/T PENGUNDIAN- Pengundian program loyalti bagi pelanggan dan mitra outlet di Sumatra.

MEDAN- Hari ini Telkomsel melakukan penarikan undian pemenang utama program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA. Masing-masing pemenang utama program ini

mendapat hadiah berupa 1 Unit Mobil KIA Sportage M/T. Periode program dilakukan mulai tanggal 1 Mei 2012 hingga 31 Juli 2012. Penarikan undian dilakukan secara transparan di hadapan pi-

hak Dinas Sosial, Notaris dan Kepolisian. Pemenang hadiah utama program Rezeki Isi Ulang adalah Hendriko pelanggan Telkomsel di Palembang dan pemenang utama program Jutawan Outlet Sumatera adalah Mutiara Telkomsel outlet dari Binjai. Para pemenang langsung dihubungi oleh Head of Sales and ‹ ‹ Baca

Telkomsel ...Hal 7




Teraktual dari Tarutung, Balige, Humbahas dan Samosir

Selasa 18 September 2012

Edisi 62 „ Tahun IX



DPRD Janji Panggil Kadis Pertanian BALIGE- DPRD Toba Samosir berjanji memanggil Kepala Dinas Pertanian Parlindungan Simanjuntak. Pemanggilan itu terkait keberadaan sapi perahan yang dpelihara di lahan milik pribadi Bupati Tobasa Kasmin Pandapotan Simanjuntak. Demikian dikatakan Anggota DPRD Komisi C yang membidangi Kesejahteraan Sosial, Monang Naipospos kepada METRO didampingi Ketua LSM Mapetos Walsa Tampubolon dan Ketua LSM Gerakan Abdi Tuhan Allah (Gatal) Jhony Tambunan di rumahnya di Desa Huta Tinggi, Laguboti, Senin

(17/9). ”Besok kita akan panggil Kepala Dinasnya untuk menjelaskan hal itu semua. Setelah itu kita baru bisa memberi komentar,” kata Monang. Ketika didesak siapa penerima bantuan sosial (bansos) tersebut, lagi-lagi Monang menolak mengomentarinya. ”Ya, besok saja datang ke kantor biar Kepala Dinas Pertaniannya yang memberikan penjelasan, darimana sumber dan siapa ketua kelompok yang menerima,” ujarnya.

Foto:Bram Situmorang

„) Baca DPRD ..Hal 10

SAPI: Dua ekor sapi bantuan sosial yang dipelihara di lahan milik Bupati Tobasa. Keberadaan sapi perahan ini dipertanyakan masyarakat karena kelompok tani yang menerimanya diduga tak jelas. Masyarakat meminta agar penegak hukum segera mengusut apabila terjadi kesalahan dalam kasus ini.

Elakkan Kreta, Avanza Terbalik Lalu Seruduk Rumah Sianturi PENUMPANG DAN SUPIR LUKA-LUKA


PELEBARAN JALAN: Tiang listrik di Simpang Bakkara, Dolok Sanggul yang menghambat proyek pelebaran jalan.

Tiang Listrik Hambat Pelebaran Jalan PLN JANJI SEGERA DIPINDAHKAN DOLOK SANGGUL- Pihak Perusahaan Listrik Negara (PLN) Ranting Dolok Sanggul akan memindahkan dua tiang listrik yang masih bercokol dipinggir pelebaran jalan menuju Kota Dolok Sanggul dekat Simpang Bakkara.

TARUTUNG- Mobil Toyota Avanza warna hitam bernomor polisi BK 1209 ZL yang dikendarai Samuel Tobing (30), warga Tarutung, Minggu (16/9) sekira pukul 22.00 terbalik dan menghantam teras rumah milik B Sianturi di Jalan Dr Ferdinan Lumbantobing (HKI) Tarutung. Peristiwa itu terjadi akibat supir berusaha mengelakkan sepedamotor. Akibatnya, seorang penumpang Frengki Simorangkir (30) Warga Desa Simorangkir, Kecamatan Siatas Barita, dan supir terpaksa dilarikan ke Rumah Sakit Umum (RSU) Tarutung karena mengalami luka-luka.

(Foto Hermanto Turnip)

PARKIR: Mobil Jenis Toyota Camry sedang parkir di depan gedung dewan dengan menggunakan plat hitam. Mobil tersebut sehari hari digunakan oleh Ketua DPRD Tobasa.

221.150 Warga Taput Terdaftar di DP4 Pilgubsu „) Baca 221.150 Warga ..Hal 10

FOTO Bernad L Gaol

„ Ketua KPU Taput Lamtagon Manalu didampingi Anggota KPU Taput Erids Aritonang.

„) Baca Elakkan ..Hal 10

Mobil Dewan Gunakan Plat NR

„) Baca Tiang Listrik ..Hal 10

TARUTUNG- Ketua KPU Taput Lamtagon Manalu telah menerima Daftar Penduduk Potensial Pemilih Pemilukada (DP4) untuk penyelenggaraan pemilihan Gubernur Sumatera Utara, Maret 2013 mendatang. Dari hasil pendataan, tercatat 221.150 jiwa mempunyai hak

Informasi yang dihimpun METRO di sekitar TKP (tempat kejadian perkara) menyebutkan, mobil tersebut diduga melaju dengan kecepatan tinggi dari arah Desa Hutabarat Partali Toruan menuju Kota Tarutung. Namun setiba-

nya di Jalan HKI Tarutung, mobil yang dikemudikan Samuel tiba-tiba kehilangan kendali saat berusaha mengelak sepedamotor dan langsung jungkir balik hingga menghantam teras rumah milik B Sianturi. Akibat benturan keras mobil yang menabrak teras rumah B Sianturi, warga sekitar terkejut dan langsung mengerumuni lokasi. “Semula mobil Avanza datang dari

TOBASA- Beberapa mobil pimpinan Dewan Toba Samosir kerap menggunakan plat NR (nomor rahasia). Meski mobil tersebut digunakan saat menghadiri undangan resmi pemkab dan sidang sidang resmi, namun sudah menjadi bahan pembicaraan masyarakat. Apalagi para wakil rakyat itu terlihat bangga menaiki mobil plat merah itu. Ferdy Sianipar, warga Balige mengatakan bahwa apa yang dilakukan para anggota dewan tersebut telah mencederai hari rakyat. Mobil dinas yang dibeli menggunakan uang rakyat itu


SERUDUK: Masyarakat mengerumuni rumah B Sianturi yang diseruduk mobil Avanza BK 1209 ZL.


Siap Bantu Penanggulangan Bencana TARUTUNG- Jajaran TNI di Markas Komando Distrik Militer (Kodim) 0210/TU bersama jajaran Komando Resor Militer (Korem) 023 Kawal Samudra, siap mendukung penanggulangan bencana yang ada di wilayah NKRI khususnya di wilayah Korem 023/KS. Bhakti TNI dalam melaksanakan tugas kemanusiaan prajurit itu akan disimulasikan saat

gelaran gladi posko I Tahun 2012. Gelaran tersebut mengambil tema “Melalui latihan gladi Posko I, Kodim 0210/TU siap membantu Pemerintah Daerah (Pemda) dalam menangani bencana alam” yang dilaksanakan, Senin (17/9) di Makodim 0210/TU di Tarutung. Acara itu, diawali upacara

„) Baca Siap ..Hal 10

„) Baca Mobil ..Hal 10

KPU Seleksi 200 Calon PPK Pilgubsu TAPUT- Hari ini, Selasa (18/9), Komisi Pemilihan Umum (KPU) Tapanuli Utara mulai melakukan seleksi tes wawancara terhadap 200 calon Panitia Pemilihan Kecamatan (PKK) untuk Pemilihan Gubernur Sumatra Utara (pilgubsu) yang akan dilaksanakan 2013 mendatang. Ketua KPUD Taput Lamtagon Manalu saat dikonfirmasi di kantornya mengatakan, KPU sebelumnya telah menerima 203 pendaftar untuk menjadi PPK. Namun setelah proses pemeriksaan administrasi, tiga pelamar

tidak lolos masuk ke proses seleksi wawancara. “Kita sudah umumkan nama-nama yang akan mengikuti testing. Para peserta yang ikut testing akan diwawancarai langsung oleh lima anggota KPU. Nantinya yang akan memberikan penilaian adalah kelima anggota KPU untuk menentukan siapa saja pemenangnya,” ujar Lamtagon. Dijelaskan, untuk penentuan pemenang, seorang calon harus memiliki pengetahuan tentang pemilihan umum. Selain itu, memiliki kualitas

dalam berkomunikasi, serta pengalaman kepemimpinan dalam berorganisasi, mempunyai komitmen, integritas dan motivasi. Sedangkan usia peserta yang mendaftar sebagai calon PPK minimal 25 tahun dengan pendidikan minimal setingkat SLTA, serta tidak masuk dalam pengurus partai politik. Ia menyebut, bahwa proses seleksi dijadwalkan akan berlangsung selama tiga hari.

„) Baca KPU ..Hal 10

Foto : Bernad L Gaol

GLADI: Kasrem 023/KS Letkol Inf Martohap Simorangkir memasangkan atribut kepada salahsatu prajurit TNI yang mengikuti gladi posko I di Makodim 0210/TU.


18 September 2012

LUMBANLOBU- Rumah Belajar di Kecamatan Lumbanlobu, Kabupaten Toba Samosir, memperolehpaketkirimanduaboksbukubacaandariKing’s CollegeLondonsebagaibantuan,untukmelengkapi koleksibukudiperpusatakaantersebut. “Kirimanberbagaibukupelajaransertasejumlah kamusBahasaInggrisituatasprakarsaNellyAndon Sitorus, seorang warga Negara Indonesia yang bekerja di Royal Bank of Scotland dan telah tinggal menetapdiLondonsejakpuluhantahunlalu,”kata pengelola rumah belajar, Hendra Hutabarat di Lumbanlobu,Senin(17/9). Menurutdia,paketkirimangelombangpertama berbagaibukubacaananak-anakusialimahingga16 tahunyangditerimarumahbelajarberlokasidisalah satudesaterpencilKecamatanLumbanlobuberjarak sekitar 40 kilometer dari Balige, Ibu Kota KabupatenTobaSamosiritu,jugaataspartisipasisejumlah donatur dari berbagai Lembaga Swadaya Masyarakat(LSM)diUSA,Inggris,German&Perancisyang khusus menangani pengedaran buku-buku ke negaraberkembang,termasukIndonesia. Dalam waktu dekat, kata Hendra, donasi bukubukupendidikanlainyaakanmenyusuldariLSMUSA Based, yang diangkut dari UK serta sejumlah buku yang akan dikirimkan dari Jakarta, setelah mereka menyuratiberbagaiLSMdimaksud,gunamelakukan kampanyepengumpulanbukusejakduabulanlalu. “Semoga dengan partisipasi dan pengiriman buku-bukutersebut,dapatmembantumemperbaiki kemajuan dunia pendidikan di huta (kampung halaman),lewatkepedulianyangperluterusdipupuk dandikembangkan,”ujarnya. Hendra menyebutkan, pendidikan merupakan salah satu fondasi untuk kelangsungan hidup yang layak. Sebab melalui pelajaran yang diperoleh, ilmunya dapat digunakan dalam menopang kehidupansehari-hari. Dikatakannya,semakinbanyakilmuyangdiraih, tentunya kian banyak hal yang bisa dilakukan, namunsemuanyatergantungdarihal-halyangtelah dipelajarisertapantasuntukdikerjakan. Memang,katadia,pendidikanterusdigalakkandi kabupaten berpenduduk sekitar 175.277 jiwa tersebut.dansebagianbesardesatelahmemilikitaman kanak-kanakyangdisebutPendidikanAnakUsiaDini (PAUD)yangdisponsoripihakpemerintahsetempat. Pendidikanformalhinggamelahirkanjutaansarjana danpejabattinggi,sudahmerupakanhalyangbiasadi tanahBatak,denganfilosophyyangsejakdulumereka sebut“anakkonhidohamoraondiau”(anakadalah hartaterbesarbagiku),yangditunjukkanparaorang tua melalui berbagai usaha guna menyekolahkan anak-anaknyahinggabisakuliahdiperguruantinggi. Untukitu,kataHendra,pihaknyainginmempromosikankemajuanduniapendidikanmelaluiprogram“TobasaPastiBisa”,lewatjalurpendidikaninformal dengan belajar bersama warga yang belum pernahmengecappendidikanformal. “Kamiakanmenerapkanmetodebelajarbersama melalui diskusi, agar saling menopang satu sama lainnya, guna perbaikan untuk hal yang lebih maju dalam mencapai kemakmuran dengan menyumbangkanyangterbaikdariilmuyangkami miliki,”katanya.(ant/int)

221.150 Warga Taput.. Sambungan Halaman 9 untukmelakukanpencoblosan. “DP4 di Pilgubsu untuk daerah Taput diketahui berjumlah 221.150 jiwa. Jumlah tersebut nantinya akandiolahmenjadiDaftarPemilihSementara(DPS) dankemudiandiverifikasiuntukditetapkanmenjadi DaftarPemilihTetap(DPT),”jelasLamtagonkepada METRO,Senin(17/9). Katanya,setelahDP4tersebutditerimaKPUdari KPU Provinsi, langkah selanjutnya, KPU akan melakukanverifikasiataupemutakhirandata.Untuk tahapanini,dibutuhkanwaktumencapaisatubulan penuh. Lamtagonmenyebut,pihaknyatidakakanmentolerirjikanantinyadilapangandidapatipemilihganda, sudah meninggal, atau yang hilang hak pilihnya karena suatu hal. Misalnya, karena bergabung menjadiTNI/Polri. “Kalauadayangganda,meninggalduniaakankita coret.Termasukpemilihyangsebelumnyamasyarakatsipilkemudianditerimasaatmendaftardimiliter danpolisi,”terangnya. UntukmenentukanDP4,menurutdia,pihaknya tidakterlibatdalammenentukandatatersebut.“DP4 itudatangdaripemerintahdalamhaliniGubernurke KPU Provinsi, kemudian KPU dibentuk tim untuk menjadikanya DPS dan kemudian dimutahirkan menjadiDPT,”paparnya.(cr-01)

LOWONGAN KERJA Daerah operasional : Tobasa, Taput, Humbahas, Sibolga dan Tapteng. Dibutuhkan beberapa orang untuk ditempatkan pada posisi : 1. Sales 3. Sales Promotion Girl 2. Merchandiser 4. Sales Representative Persyaratan : 1. Pria (1, 2, 4) wanita (3, 4) 2. Berorientasi target (1, 2, 3, 4) 3. Pendidikan min. SMA sederajat (1, 2, 3) D3 (4) 4. Usia max 30 tahun (1, 2, 3, 4) 5. Memiliki sepeda motor (1, 2, 4) 6. Memiliki SIM C (1, 2, 4) 7. Bersedia menjalani masa training (1, 2, 3, 4) 8. Jujur dan Bertanggung Jawab (1, 2, 3, 4) 9. Berpenampilan menarik (3, 4) 10. Menguasai Ms. Office dan Internet (4)


Jl. Suprapto No. 74 B Sibolga - Jl. Pemuda No. 8 G Balige Informasi lebih lanjut hubungi Bpk. Siswandi HP 0819 880 881

TOYOTA P. SIANTAR Authorized Toyota Dealer

• All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar = Harga Medan

Elakkan Kreta, Avanza Terbalik Lalu Seruduk Rumah Sianturi FOTO: BERNAD L GAOL

TERBALIK: Mobil Avanza BK 1209 ZL yang menabrak teras rumah B Sianturi.

Sambungan Halaman 9 arah Hutabarat menuju Kota Tarutung dengan kecepatan tinggi. Diduga saat mengelakkan pengendara sepedamotor tiba-

tiba mobil kehilangan kendali dan kemudian terbalik hingga menghantam teras rumah Sianturi,” kata sejumlah saksi mata yang menyaksikan kejadian tersebut. Selanjutnya, sambung warga, saat melihat

ke dalam mobil yang terbalik itu, terdapat Samuel dan Frengki masih hidup, warga langsung menolong dan mengevakuasi keduanya ke rumah penduduk. “Keduanya langsung ditolong warga dan melarikannya ke rumah sakit,” tmpal saksi mata lainnya S Hutauruk. Ia menyebut, usai mengevakuasi kedua korban, warga langsung sigap membawa para korban ke rumah sakit untuk mendapatkan perawatan. “Untung saja warga sigap menolong korban, kalau tidak bisa saja korban tewas,” ujarnya. Informasi yang dihimpun METRO dari Polres Taput menyebut, semula mobil yang dikemudikan Samuel datang dari arah Kota Tarutung melaju dengan kecepatan tinggi melintas di Jalan HKI. Diduga supir kurang hati-hati dan tidak menguasai kendaraan, hingga mobil oleng dan terbalik. “Mobil itu datang dari arah Kota Tarutung (bukan dari arah Hutabarat), kemudian

Mobil Dewan Gunakan Plat NR Sambungan Halaman 9 sudah sepantasnya digunakan untuk membela kepentingan rakyat, bukan kepentingan pribadi. Mobil dinas, menurut Ferdy, bukan untuk keperluan pribadi yang memakainya. Apalagi mobil tersebut dipergunakan dalam tugas tugasnya sebagai anggota dewan. “Apa mereka malu menggunakan mobil plat merah ke kantor. Kalau malu, tak usah dipakai. Mobil tersebut diberikan saja kepada camat atau aparat pemerintah terbawah, mereka juga sangat membutuhkan mobil dinas,” kata Ferdy menanggapi plat nomor rahasia yang digunakan anggota dewan, Senin (17/9) di Balige. Amatan METRO, mobil dinas Ketua DPRD Tobasa sedang parkir di depan gedung dewan dengan menggunakan plat yang sudah dirubah. Tidak diketahui pasti berapa nomor plat mobil tersebut. Karena plat mobil dinas sering menggunakan plat hitam dengan kode “NR” dengan nomor polisi BK 1419 NR. Mobil tersebut digunakan saat menghadiri sidang paripurna pada acara HUT ke-67 RI. Penggunaan mobil dinas berplat hitam juga disesalkan salahse-

orang warga Balige lainnya. Andi Napitupulu, warga Sangkar Nihuta mengatakan mengganti plat mobil dinas dengan plat hitam telah melukai perasaan masyarakat Tobasa. Apalagi mobil tersebut dipakai sewaktu menjalankan tugas tugasnya sebagai anggota dewan. “Kalau diganti (plat) pun, ketika digunakan dalam perjalanan keluar daerah, kami maklum. Tapi inikan, ruang lingkupnya di Tobasa saja, tak perlu diganti,” ketus Andi. Terpisah, Erwin Panggabean, Bendahara Bagian Umum Toba Samosir mengatakan, saat ini, pihaknya belum ada mengajukan penggunaan plat seri NR. “Mau akan kita ajukan,” kata Erwin. Terkait mobil dinas dewan, kata dia, pengurusan plat seri NR dilakukan oleh anggota dewan itu sendiri. Namun demikian, penggunaan plat NR untuk mobil dinas dibenarkan jika dalam situasi hal hal tertentu. “Tapi sebaiknya kalau untuk keperluan dinas tak perlu ganti plat agar masyarakat bisa mengawasi kinerja aparat. Apalagi kalau sudah ketentuan protokoler seperti iringiringan,” jelasnya. Penggunaan mobil dinas deng-

an plat hitam atau seri NR, jelas Erwin, terkait dengan masalah etika saja. Artinya, pengguna mobil dinas harus bisa menempatkan kapan dipakai plat hitam atau plat merah. Sesuai Pasal 280 Undang undang RI No 29 Tahun 2009 tentang lalu lintas dan angkutan jalan, setiap orang yang mengemudikan Kendaraan Bermotor di jalan yang tidak dipasangi Tanda Nomor Kendaraan Bermotor yang ditetapkan oleh Kepolisian Negara Republik Indonesia sebagaimana dimaksud dalam Pasal 68 ayat (1) dipidana dengan pidana kurungan paling lama 2 (dua) bulan atau denda paling banyak Rp500.000,00 (lima ratus ribu rupiah). Berdasarkan ketentuan kepolisian untuk warna plat kendaraan pribadi, warna dasar hitam dengan tulisan putih. Mobil umum, warna dasar kuning dengan tulisan hitam. Milik pemerintah, warna dasar merah dengan tulisan putih. Transportasi dealer, warna dasar putih dengan tulisan merah. Corps Diplomatik, warna dasar putih dengan tulisan hitam. Staff Operasional Corps Diplomatik, warna dasar hitam dengan tulisan putih berformat khusus. (cr-03)

DPRD Janji Panggil Kadis Pertanian Sambungan Halaman 9 Sebelumnya Kadis Pertanian, Paternakan dan Perikanan Tobasa Parlindungan Simanjuntak ditemui kedua LSM di kantornya menmgaku bahwa Kadis Pertanian tidak bersedia memberi nama-nama kelompok tani penerima bantuan pusat tersebut. Kadis menyarankan agar mereka membuat surat resmi ke dinasnya jika menginginkan data nama kelompok tani. Atas penolakan Kadis tersebut, Walsa mengatakan, dugaan ketidakjelasan penerima bantuan sosial tersebut semakin terbuka. “Pihak berwajib harusnya bertindak cepat untuk mengusutnya.Jika benar kelompok tani ada menerima, apa susahnya memberikan data itu ke kita. Bukan malah menutup-nutupinya. Kalau sudah begini, kita makin penasaran dan mengarah ke hal-hal pemikiran negatif,” pungkasnya. Diberitakan sebelumnya, beberapa pemimpin Lembaga Swadaya MasyarakatdiTobaSamosirmeminta dan mendesak aparat penegak hukum untuk mengusut realisasi program-program bantuan sosial (bansos) yang dikucurkan pemerintah pusat maupun provinsi untuk Kabupaten Tobasa. Mereka yang mewakili masyarakat ini antara lain Walsa Tampubolon dari LSM Mapetos (Masyarakat Peduli Tobasa), Jonny Tambunan dari LSM Gatal (Gerakan Abdi Tuhan Allah), Mansur Pardede dari LSM BIN (Ba-

TERCECER Telah tercecer sebuah SK Pensiun An. Tiarisa Simanjuntak dengan no. 882.4/ 281/ / 2003. Hilang pada hari Senin, 11 September 2012 sekitar Jl. Sibolga Barus Desa Mela 1 Sibolga pukul 09.30 wib. Bagi yang menemukan harap dikembalikan ke alamat: Jl. Sibolga Barus Desa Mela 1 kec.Tapian Nauli kab. Tapteng. Tidak akan dituntut tapi diberi hadiah yang sepantasnya.

dan Investigasi Nasional), dan Amir Manurung dari LSM LMPBPRI (Lembaga Mitra Pembangunan Bona Pasogit Republik Indonesia). “Dari laporan yang kita terima, beberapa bantuan sosial pada tahun lalu dan tahun anggaran berjalan banyak yang tidak terealisasi, dan bahkan kelompok penerima diduga fiktif dan direkayasa,” kata Walsa Tampubolon pada pertemuan aliansi LSM di Balige, Sabtu (14/9). Dikatakan Walsa, mereka yang tergabung dalam beberapa LSM dalam waktu dekat akan membuat laporan dugaan penyelewengan-penyelewengan bansos di Tobasa kepada pihak yang berwenang. “Kami berharap indikasi penyelewengan ini diusut hingga tuntas,” tegas Walsa sembari merahasiakan bansos seperti apa yang dilaporkan masyarakat itu. Sementara, Jonny Tambunan mengatakan, pihaknya mencurigai keberadaan sapi perahan yang berada di Salib Holong Desa Ombur Kecamatan Silaen, Tobasa yang mana lahan tersebut merupakan lahan pribadi ‘penguasa’ Tobasa. “Kami menerima laporan masyarakat, sapi jenis perahan dari bantuan sosial pusat ditempatkan di Salib Holong. Bagaimana bisa? itukan lahan pribadi milik Bupati Tobasa. Apakah Bupati juga punya kelompok tani,” ujar Jonny dengan nada bertanya. Jonny pun mengharapkan aparat


Rumah Belajar Lumbanlobu Peroleh Buku dari London

Pertama & Nomor 1 di Indonesia



MNC LIFE (MNC GROUP) media terbesar di Indonesia, membutuhkan beberapa FINANCIAL CONSULTANT/ AGENCY MANAGER yang handal untuk berkarir dan berpenghasilan lebih. Jika anda serius dan membutuhkan informasi tentang syarat- syarat dan proses selanjutnya, segera hubungi bagian Rekruitmen kami :

Dealer Elpiji Pertamina Sibolga

Ibu Wati HP 0823 6888 4343

Paling lambat tanggal 22 September 2012

Membutuhkan karyawan PRIA / WANITA Persyaratan: - Pendidikan minimal D3 - Menguasai komputer - Bersedia ditempatkan di luar kota Lamaran dikirim langsung ke: PT TAPTENG JAYA Jl. Mesjid no 10,kelurahan pasar baru kota sibolga.

penegak hukum untuk mengusut dengan segera keberadaan sapi-sapi tersebut. Terpisah, Kepala Dinas Pertanian Perikanan Peternakan Tobasa, Parlindungan Simanjuntak, menjelaskan bahwa bansos di Tobasa adalah bantuan yang langsung diterima masyarakat dari si pemberi bantuan. “Bansos itukan langsung diterima oleh kelompok-kelompok tani, kami hanyasebatasmemfasilitasi,”katanya. Mengenai sapi-sapi yang berada di Salib Holong tersebut, Kadis mengakui bahwa itu merupakan bantuan sosial milik kelompok tani. “Ya benar sapi-sapi itu adalah dari bantuan pusat melalui provinsi. Jangan diributilah, kalau diributi ke depan Tobasa akan susah mendapatkan bantuan-bantuan sejenis,” pintanya. Mengenai lahan tempat sapi-sapi itu dipiara adalah milik Bupati Tobasa, Parlindungan Simanjuntak mengatakan bisa-bisa saja kelompok tani menyewa lahan tersebut kepada si pemilik. Dan untuk sapi perahan, penerimanya memang harus orangorang yang mampu. “Memelihara sapi-sapi itu dibutuhkan kemampuan finansial,” jelasnya. Ketika ditanya tentang tudingan bahwa sapi-sapi itu milik Bupati Tobasa, Parlindungan membantah. “Tidak benar itu, itu punya kelompok tani yang ketuanya marga Sinambela,” jawabnya sembari mengaku lupa nama kelompok tani tersebut. (brams)

PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum • Air Pegunungan (Mineral) • Sistem RO Oxsygen dan Grosir Peralatan • Depot Air Minum GRACE WATER Jl. Cengkeh Raya P. Simalingkar HP 081370107352 Melayani pemasangan dalam dan luar kota YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 /bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari

melintas dari Jalan HKI. Setibanya di TKP langsung oleng dan terbalik. Diduga supir kurang hati-hati dan tidak menguasai kendaraan yang dikemudikan,” kata Kasubbag Humas Polres Taput Aipda W Baringbing. Baringbing menjelaskan, pada peristiwa itu tidak ada korban jiwa. Namun supir dan seorang temannya di dalam mobil Frengky Simorangkir mengalami luka-luka. “Samuel dan Frengky mengalami memar pada bagian tangan sebelah kiri dan kaki sebelah kiri, saat ini sedang dirawat intensif di RSU Tarutung,” ucapnya. Sedangkan terkait insiden itu, Polres kini masih melakukan penyelidikan untuk proses hukum selanjutnya. Sedangkan mobil Toyota Avanza BK 1209 ZL kini diamankan sebagai barang bukti. “Kita masih melakukan penyelidikan untuk proses hukum selanjutnya, sedangkan mobil sudah kita amankan,” pungkasnya. (cr-01/ hsl)

KPU Seleksi 200 Calon..

Sambungan Halaman 9 “Minggu depan kita perkirakan pengumuman siapa pemenang sudah akan keluar. Untuk setiap kecamatan kita membutuhkan 5 orang PPK,” katanya. Terkait proses seleksi calon PPK Pilgubsu tersebut, Hotbin Purba (37) salah satu aktifis pemuda Taput kepada METRO, Senin (17/9) meminta ke KPU selaku yang melakukan seleksi

agar melaksanakan proses secara profesional dan proporsional tanpa adanya unsur nepotisme dan titipan oknum-oknum tertentu. “Harus professional dan proporsional. KPU dalam melaksanakan proses seleksi harus mengedepankan itu. Jangan meloloskan orang-orang yang karena titipan oknum-oknum tertentu, sehingga mengabaikan kualitas pelamar. Kita akan mengawal proses seleksi ini,” jelasnya. (cr-02/hsl)

Siap Bantu Penanggulangan.. Sambungan Halaman 9 dengan inspektur upacara Kasrem 023/ KS Letkol Inf Martohap Simorangkir mewakili Danrem 023 Kawal Samudra KolonelInfAndikaPerkasa.Usaiupacara, para prajurit TNI dikenakan atribut gladi posko.GladiposkoIini,akandilaksanakan selamatigaharimulai,Senin(17/9)hingga Rabu (19/9) yang melibatkan semua perwiradanstafdijajaranKodim0210/TU. “Latihan geladi posko ini, merupakan latihan yang telah diprogramkan oleh Korem 023/KS dalam rangka menguji kerjasama dan koordinasi antar instansi terkait tingkat komando kewilayahan dengan pemerintah daerah. Selanjutnya, meningkatkan kemampuan di bidang komando dan pengendalian,” kata Martohap. Ditegaskannya, tujuan yang ingin dicapai dari kegiatan Gladi Posko I 2012 tersebut adalah untuk menanamkan kesiapan masyarakat dan aparat pemerintah untuk antisipasi dan penyelamatan diri dari bencana. Pasalnya, letak topografi wilayah tugas Korem 023/KS memiliki banyak potensi bencana. Sehingga, semua pihak harus terlibat khususnya TNI yang memiliki kemampuan menguasai wilayah

teritorialnya. Disebutkan, pengalaman dan kenyataan di lapangan dalam upaya penanganan dan penanggulangan bencana alam masih menemui kendala, seperti kondisi medan yang sulit. ”Untuk mengatasinya, Korem 023/KS sebagai satuan kewilayahan perlu mengambil langkah dan tindakan kesiapan jajarannya dengan melaksanakan latihan secara terprogram dan terukur,” papar Martohap. Ia menjelaskan, dalam kegiatan itu, prajurit juga diberi pemahaman garis komando pengendalian serta tehnik penanggulangan bencana. ”Dalam kegiatan ini akan diberikan pemahaman mengenai komando pengendalian dan tehnik yang lebih mengambarkan kesiapan satuan tugas posko di lapangan,” ujarnya. Terakhir, kepada semua jajaran yang terlibat dalam gladi posko tersebut, Danrem berharap dapat menggunakan wahana gladi itu sebagai sebuah kesempatan untuk berlatih dan menerapkankemampuan,keterampilan sertakemampuanperorangandansatuan untuk mendapat gambaran yang jelas dalam setiap penanganan dampak yang ditimbulkan akibat bencana.(cr-01/hsl)

Tiang Listrik Hambat.. Sambungan Halaman 9 Dimana sebelumnya, pihak kontraktor proyekpelebaranjalanitusempatmengusulkanpembongkarankepadapihakPLN. Manager PLN Ranting Dolok Sanggul RialsonTambunan,kepadaMETRO,Senin (17/9)mengatakan,pihaknyabukantidak bersediamemindahkantianglistriktersebut. “PLNsiapmemindahkantianglistrikitu, PLNRantingDolokSanggulhanyasebagai pihak yang mengetahui saja. Tapi yang merekomendasikan untuk mengerjakan pemindahan tiang listrik itu adalah PLN CabangSibolgakepadapihakAKLI,”tukas Rialson. Dikatakannya,suratmasukdarirekanan yangmengerjakanproyektersebutkePLN sudahdiproses.Hanyasaja,sebutRialson, Dinas Tata Ruang dan Pemukiman Humbahasbelumada kesepakatandenganpihak AKLI terkait biaya pemindahan tiang tersebut. “Kita tidak berani langsung menunjuk siapa orang yang akan mengerjakan pemindahantiangitu.Karenaitutidaketis, sehinggakitaarahkanlangsungpihakDinas Tarukim berhubungan dengan AKLI Sibolga demi transparansi dalam urusan

geser menggeser tiang PLN. Jadi jangan disebutPLNtidakmaumemindahkantiang listrikitu,”tandasnya. KadisTarukimHumbahasmelaluistafnya Michael Simamora mengatakan, dalam waktu dekat tiang listrik tersebut akan dipindahkanAKLIdariSibolga. “BarutadikamibicaradenganpihakAKLI marga Manalu, kalau sudah diel dengan mereka (AKLI-red). Dalam waktu dekat akansegeradipindah(keduatianglistrik,red) itu,”ujarMichael. Iamenyebut,pihaknyabarumengetahui prosespemindahantianglistrikmilikPLN terkaitpemindahantiangakibatpengerjaan proyekharusmelaluimekanisme. ”Sebelumnyakamibelumtahubekerja samasiapa,beruntungpihakPLNRanting Dolok Sanggul menginformasikan orang AKLI untuk menyelesaikan pemindahan kedua tiang listrik di Simpang Bakkara,” paparnya. Ia juga meyakinkan, minggu depan, pengerjaanproyekpelebaranruasjalanKota DolokSanggulituakandapatdilanjutkan. ”Minggudepansudahpastipemindahan tianglistrikitu,kontraktorpunsudahdapat melanjutkan pelebaran dan perkerasan pinggiran jalan yang diperlebar,” pungkasnya.(jona/hsl)


18 September 2012

Diumumkan Serentak 19 September HASIL UJIAN CPNS

Taliban Serang Markas NATO KABUL- Para gerilyawan Afganistan yang melakukan serangan terencana dan berani ke Camp Bastion, pangkalan militer di mana Pangeran Harry dari Inggris ditempatkan, mengenakan seragam Angkatan Darat AS, kata NATO sehari setelah serangan itu. Gerilyawan Afganistan sangat langka menggunakan seragam militer AS dalam serangan mereka. Menurut data CNN, terakhir hal itu dilakukan lebih dari dua tahun lalu, ketika NATO membalas serangan terhadap dua pangkalan di Provinsi Khost pada Agustus 2010. Tidak ada tentara koalisi yang tewas dalam serangan itu, kata Pasukan Keamanan Bantuan Internasional (ISAF NATO) ketika itu. Setidaknya dua marinir AS tewas dalam serangan yang tergolong sangat berani pada Jumat (14/9) malam lalu itu, dan enam jet tempur hancur, kata ISAF ketika merilis rincian lebih lanjut tentang serangan tersebut. Para petempur yang terlatih, melakukan dengan baik serangan di Provinsi Helmand, kata ISAF. Sekitar 15 gerilyawan dibagi dalam tiga tim menerobos pagar markas itu dan melakukan kerusakan, menghancurkan enam stasiun pengisian bahan bakar dan merusak hanggar enam pesawat. Para penyerang menenteng senapan otomatis, roket peluncur granat dan memakai rompi bunuh diri. Mereka menghancurkan enam jet AV-8B Harrier dan merusak dua lainnya sebelum serangan itu berakhir, kata pihak koalisi. Empat belas gerilyawan tewas dan satu orang terluka lalu ditangkap, kata ISAF. Delapan personel militer koalisi dan satu kontraktor sipil juga terluka. Juru bicara ISAF, James Graybeal, mengatakan terlalu dini untuk mengatakan apakah para penyerang punya “pengetahuan tentang kondisi di dalam (markas),”. ISAF tidak mengungkapkan bagaimana para penyerang itu mendapat seragam, tetapi menurut laporan CNN seragam semacam itu dijual di pasar-pasar di sana. (kmc/int)

JAKARTA- Panitia Nasional Tes Kompetensi Dasar Calon Pegawai Negeri Sipil (CPNS) akan mengumumkan hasil ujian tulis pada 19 September 2012 mendatang. Hasil penerimaan ujian CPNS itu akan diumumkan serentak melaui website Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (PAN dan RB).

„ Ribuan peserta ujian CPNS di Jakarta tampak serius mengisi lembar jawaban.

Menkeu Setuju Koruptor Dihukum Mati JAKARTA- Menteri Keuangan Agus bayar pajak,” ungkap Agus di Jakarta, Martowardojo setuju jika Senin (17/9). undang-undang (UU) Di pemerintah, Agus yang mengatur hukuman mengaku masih banyak mati bagi koruptor. Denkoruptor yang berkeliaran gan demikian, masyarakat termasuk di kementeriantidak perlu sampai berhennya. Pemerintah sendiri ti membayar pajak. terus bergerak untuk mem”Harus kita yakinkan berantas korupsi di setiap pengadilan nanti memkementerian dan lembaga. berikan hukuman mati ke”Sekarang begitu banyak pada koruptor. Kalau dayang ditindak, tidak hanya pat persetujuan UU memdi pemerintah pusat, di beri hukuman mati, ya kita „ Agus Martowardojo pemda (pemerintah daerhukum mati tapi jangan ah) berapa banyak yang kemudian kita mengatakan berhenti harus terkena masalah hukum terkait

korupsi, bekas menteri segala macam banyak yang kena, dan pengusaha besar yang tidak tersentuh juga kena,” tambahnya. Untuk itu, Agus meminta masyarakat tetap membayar pajak untuk pembangunan negara. Apalagi pemerintah berkomitmen untuk menjalankan transparansi dan akuntabilitas. ”Sudah banyak para pejabat terkena kasus hukum akibat dari adanya transparansi. Kalau transparansi masyarakat jadi tahu jika ada penyimpangan, tolong direspon dengan mendukung agar kita semakin baik,” ujarnya. (dtc/int)

”Kita akan umumkan namanama yang lolos Rabu (19/9) sore, yang memenuhi ambang batas kelulusan dipilih dan dibuat ranking. Akan kita pos di website kita,” kata Menteri Menteri PAN dan RB, Azwar Abubabakar, dalam jumpa pers di kantornya, Jl Sudirman, Bundaran Senayan, Jakarta Pusat, Senin (17/9). Azwar mengatakan pada Rabu (19/9) pagi kementerian-kementerian akan diundang untuk diberi tahu hasil ujuan CPNS yang sudah dilaksanakan. Soal ujian CPNS itu dibuat oleh konsorsium. Kemudian sampai di daerah soal-soal ini dicetak oleh perusahaan yang menang tender. Pencetakan ujian ini tetap diawasi polisi dan LSM. ”Selesai ujian lembar jawaban dikumpulkan ke BPPT nanti ada alat untuk scaning, diawasi oleh 10 PTN yang tergabung dalam konsorsium, terus di proses semuanya dengan komputer,” sambungnya. Azwar menjamin hasil pemeriksaan ujian CPNS ini sangat akurat. “Ini pakai komputer, bukan pakai orang lagi,” imbuhnya. Azwar mengatakan untuk tahun ini ada 15.800 posisi yang tersedia. Menurutnya posisi ini tergolong kecil karena tahun ini masih ada moratorium PNS. Sebelumnya Deputi SDM Aparatur Kementerian PAN-RB, Ramli E Naibaho, mengatakan hasil ujian CPNS akan diumumkan pada 17 September 2012.

Tetapi ternyata tanggal 17 September adalah hari diselesaikannya koreksi jawaban tes. ”Ini selesai dikoreksinya 17 September dan diumumkan tanggal 19 September, jadi tidak ada yang mundur,” kata Deputi SDM Aparatur Kementerian PAN-RB, Ramli E Naibaho, saat mendampingi Menteri Azwar Abubabakar dalam jumpa pers tersebut. Pemerintah Evaluasi Seleksi CPNS Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (Kemenpan dan Rebiro) akan mengevaluasi proses seleksi penerimaan calon pegawai negeri sipil (CPNS) 2012. ”Penerimaan CPNS pada tahun ini berbeda dengan tahun sebelumnya. Meskipun demikian, kami akan melakukan evaluasi terhadap pelaksanaannya,” ujar Menpan dan Rebiro Azwar Abubakar di Jakarta, Senin (17/9). Seleksi CPNS yang dilangsungkan pada 8 September berbeda dengan penerimaan sebelumnya. Jika pada proses sebelumnya, tanggung jawab pembuatan soal diserahkan pada daerah, pada tahun ini melibatkan perguruan tinggi. Kemudian, pelaksanaannya juga dilangsungkan serentak di seluruh Indonesia. Kemenpan juga menggandeng sejumlah pihak dalam seleksi CPNS itu seperti perguruan tinggi, polisi, dan lembaga swadaya masyarakat. (dtc/int)

KPK Siapkan Penyidik Independen

Selamat & Sukses Atas Dilantiknya

Pdt Willem TP Simarmata MA Ephorus HKBP

Pdt Mori Sihombing MTh Sekjen HKBP

Pdt Welman Tampubolon STh Kepala Departemen Koinonia

JAKARTA- KPK masih akan tetap memperjuangkan 20 penyidiknya yang mendadak ditarik Mabes Polri. Namun, Lembaga antikorupsi ini juga sudah siap dengan opsi penyidik independen. Jubir KPK Johan Budi mengatakan pihaknya tengah menempuh opsi utama, yakni melakukan koordinasi lanjutan dengan Kapolri agar 20 penyidik tidak ditarik dalam waktu dekat ini. ”Karena load di KPK ini sedang tinggi,” kata Johan di kantornya, Senin (17/9). Namun jika upaya itu gagal, KPK sudah memiliki opsi lain. “Kalau nanti jalan buntu, penyidik tidak bisa dipertahankan, opsi melakukan rekrutmen penyidik di luar polisi dan jaksa akan jadi salah satu opsi yang akan dipilih KPK,” ujar Johan. Mengenai opsi terakhir ini, lanjut Johan, sudah dalam tahap pembahasan di tingkat pimpinan. Namun Johan menegaskan, pihaknya akan menempuh opsi pertama terlebih dahulu. ”Opsi awal kita tetap untuk memperjuangkan 20 penyidik. Karena untuk rekrutmen itu juga perlu waktu, sekitar dua bulan. Nah selama dua bulan ini kerja KPK jadi terhambat,”

„ Wakil Ketua KPK hadir di pembahasan persiapan penyidik independen. pungkasnya. Komisi III Kaji Penyidik Independen KPK Komisi III Dewan Perwakilan Rakyat akan mengkaji wacana perlu tidaknya perekrutan penyidik independen untuk mengisi Komisi Pemberantasan Korupsi (KPK) di masa depan. “Perlu ruang untuk mendalami ini, misalnya kita pelajari lagi Undang-Undang KPK. Kita kaji lagi apa sisi positif dan negatifnya,” kata Ketua Komisi III DPR I Gede Pasek Suardika seusai rapat dengan KPK, Kepolisian, dan Kejaksaan di Gedung Kompleks Parlemen Senayan, Jakarta, Senin (17/9/2012). Pasek mengatakan, perlu dipikirkan bagaimana jenjang karir dan nasib para penyidik inde-

penden di KPK nantinya. Pasalnya, kata dia, tidak mungkin orang yang direkrut itu selamanya menjadi penyidik. Pasek menambahkan, wacana itu tidak bisa dibahas dengan cepat lantaran banyak hal yang perlu dipikirkan. Politisi Partai Demokrat itu meminta kepada semua pihak jangan langsung menyimpulkan bahwa penyidik independen adalah solusi dari ketergantungan KPK atas insititusi lain perihal sumber daya manusia. Pasek memberi contoh reaksi berbagai pihak pascapenarikan 20 penyidik oleh Polri bahwa KPK harus mulai merekrut penyidik independen. “Jangan buru-buru, kita memang perlu duduk bareng,” pungkas Pasek. (kmc/int)

Pdt Drs Bihelman DF Sidabutar STh

114 WNI Ditangkap Polisi Kamboja

Kepala Departemen Diakonia


Pdt Marolop P Sinaga MTh Kepala Departemen Marturia


BANJIR SIMANJUNTAK Ketua DPC Partai Hanura Tapanuli Utara

Beserta Seluruh Pengurus

JAKARTA- Sebanyak 114 WNI ditangkap polisi Kamboja. Mereka terbukti terlibat dalam perbuatan pidana di Negeri 1.000 Pagoda itu. 114 WNI tersebut terlibat praktik judi online. ”25 WNI telah dipulangkan ke Indonesia hari Jumat 14 September 2012, dan 80 WNI dipulangkan hari ini 15 September 2012. Sisanya 9 WNI belum dipulangkan guna pemeriksaan,” kata Direktur Perlindungan WNI, Tatang Razak, saat berbincang, Senin (17/9). Tatang menjelaskan para WNI tersebut hanya direkrut dan bu-

kan sebagai pelaku utama. Sepertinya mereka pun sudah ada yang mengatur segalanya, termasuk tiket kepulangan mereka. ”Mereka terdiri dari 90 laki-laki dan 24 wanita yang berasal dari berbagai daerah seperti Jakarta, Medan, Batam, dan sebagainya yang direkrut secara rahasia,” jelas Tatang. Polisi Kamboja menangkap mereka di sebuah rumah pada 10 September lalu. Dari tangan mereka ditemukan 72 paspor, di mana selebihnya diperkirakan masih ada di rumah yang dikontrak atau dipegang oleh mana-

jer mereka yang juga WNI. ”Mereka didakwa melanggar hukum Kamboja yang melarang judi online ilegal, walaupun terdapat kasino secara resmi. Apabila terbukti, mereka bisa dijatuhi hukuman penjara tergantung keterlibatan dengan maksimal 3-4 tahun penjara,” urainya. KBRI telah menemui mereka di tahanan Imigrasi. Mereka diperlakukan dengan baik. “KBRI akan menemui mereka lagi hari ini untuk pendampingan dan membantu mencarikan pengacara apabila dibutuhkan,” tutur Tatang. (dtc/int)

arus Ambil Alih Pelabuhan Lama


18 September 2012

Tor Simarbarimbing Butuh Perbaikan SIBOLGA- Ikon Kota Sibolga yang berada di lerang bukit sebelah utara dengan bertuliskan “Tor Simarbarimbing” terabaikan. Tulisan yang dipajang di lereng bukit tersebut sudah berantakan, bahkan hurufnya yang sebelumnya lengkap terlihat tak beraturan lagi. Tulisan “Tor Simarbarimbing” yang artinya Bukit Simarbarim-

bing dibuat dari bahan seng dan dipajang di lereng pebukitan se-

suai nama perbukitan itu Tor Simarbarimbing. Bukit yang berada di sebelah utara Kota Sibolga itu dan tulisan tersebut merupakan satu ikon lokasi wisata Sibolga. Karena itu sangat disayangkan apabila dibiarkan rusak begitu saja tanpa diperbaiki. Padahal, ikon itu menambah nilai jual wisata Sibolga. Hal ini diha-

rapkan menjadi perhatian pemerintah melalui dinas terkait. Informasi yang dihimpun, rusaknya sebagian huruf tulisan Tor Simarbarimbing diakibatkan seringnya badai kencang yang melanda Sibolga khususnya di daerah pebukitan itu. Namun bagaimana pun juga, biaya perawatan akan lebih

sedikit dibanding biaya untuk membangun kembali. Harapan warga Sibolga, tulisan tersebut semestinya cepat diperbaiki, jangan menunggu setelah tulisan tersebut benarbenar hancur. Sebagaimana kita perhatikan, tulisan tersebut jelas terlihat apabila kita berada di pusat Kota Sibolga. (***)

Interaktif Tapanuli Tinggikan Jalan di Aek Muara Pinang Tolong Pak Wali Kota pertinggikan jalan kami di Kelurahan Aek Muara Pinang karena sering terjadi banjir bandang setinggi lutut orang dewasa dan membanjiri rumah-rumah warga lainnya. Terima kasih. Pengirim: 081263646XXX

Mobil Dinas Jadi Mobil Pribadi Bapak Bupati dan Kasat Lantas yang terhormat, mohon mobil dinas Pemkab Tapteng yang platnya diganti jadi plat hitam ditindak. Kami masyarakat sangat prihatin akan hal tersebut karena mobil tersebut adalah mobil dinas, dan jangan dipakai untuk kepentingan pribadi. Terima kasih. Pengirim: 085260601XXX

Pembangunan Jalan di Tempat Bapak Wali Kota dan Wakil Wali Kota Sibolga yang terhormat, pembangunan di Sibolga sepertinya hanya berjalan di tempat. Tolong Pak ciptakan lapangan kerja atau manusianya dijadikan berprestasi di bidang pengolahan badan usaha tersendiri. Dari sudut pandang Kota Sibolga, masih banyak ingin dibenahi. Ciptakanlah, Terima kasih. Pengirim: 082162962XXX

SEBAGIAN besar Warga Sibolga dan juga orang yang pernah datang ke Sibolga pastinya sudah tahu bahwa nama bukit tersebut adalah Tor Simarbarimbing. Dan hal itu diketahui setelah adanya tulisan bertuliskan ‘Tor Simarbarimbing’. Artinya tulisan tersebut mempunyai nilai jual pastinya di mata pengunjung yang mengingatkan mereka akan nama Tor Simarbarimbing. Namun bila kita pikir sebaliknya lagi, akibat rusaknya tulisan tersebut, bagaimana pandangan pengunjung yang datang ke Sibolga ini? Pastinya mereka akan berpikir bahwa bukit dan tulisan itu terabaikan. Dan mungkin mereka akan berpikir banyak hal yang kurang diperhatikan lagi dari Sibolga ini, karena tulisan tersebut nampak jelas dari pusat Kota Sibolga. Yang kita harapkan, pemerintah melalui dinas terkait sebaiknya memperhatikan kondisi tersebut. Toga Sianturi, Warga Sibolga

Penerimaan CPNS D3 Statistik Yang saya hormati Bapak Wali Kota Sibolga dan Bapak Bupati Tapteng, kami alumni D-3 Statistik berharap penerimaan CPNS nanti jurusan kami dibutuhkan formasi teknisi. Kami ingin mengabdikan diri kami. Terima kasih. Pengirim: 081375132XXX


Anjing Ini Dinobatkan Sebagai Anjing Tertinggi MICHIGAN- Dari kejauhan, anjing berwarna hitam bernama Zeus yang berasal dari Michigan, AS ini, mungkin dikira seekor kambing.

Tidak Bekerja, Pria Ini Timbun Emas Batangan WASHINGTON- Bagaimana mungkin seseorang yang tidak bekerja sejak berpuluh-puluh tahun lalu dapat memiliki harta kekayaan berlimpah. Namun hal itu ternyata mungkin saja bagi Walter Samasko Jr. Pria yang ditemukan tak bernyawa di kediamannya di Kota Carson, Amerika Serikat (AS) ini diketahui tidak bekerja sejak tahun 1968.

Namun ketika tubuhnya yang sudah tidak bernyawa itu ditemukan, sejumlah tetangga Samasko Jr terkejut menyaksikan timbunan emas batangan senilai USD7 juta atau sekira Rp66 miliar (Rp9.458 per USD) ditemukan di garasi rumah. Demikian diberitakan Las Vegas dan dikutip Upi, Senin (17/9). Pihak keamanan pun terpaksa

menggunakan truk khusus untuk mengangkut batangan emas itu. Selain batangan emas juga ditemukan koin emas dari sejumlah negara seperti Meksiko, Inggris, Austria dan Afrika Selatan. Setelah diselidiki Samasko ternyata selama ini hidup dari hasil investasinya. Termasuk saham senilai USD140 ribu atau sekira Rp1,3 miliar dan USD25 ribu atau sekira Rp236 juta yang dimilikinya.“Namun selama ini tidak ada yang tahu bahwa ia menimbun emas,” ujar salah seorang petugas polisi. Samasko awalnya dikabarkan tidak memiliki kerabat dekat. Namun pihak kepolisian berhasil menyelidiki bahwa ia memiliki sepupu jauh, Arlene Magdanz yang bermukim di San Rafael, California. Magdanz yang diberitahukan mengenai peninggalan sepupunya itu pun hanya bisa terperangah tak percaya. Satu-satunya yang terucapkan darinya adalah, “Ya Tuhan.” (ok/int)

Anjing tersebut baru berusia 3 tahun, namun tinggi badannya sudah mencapai 1,11 meter jika dihitung dari kaki hingga bagian teratas kepalanya. Kakinya yang panjang membuatnya berbeda dari anjing-anjing kebanyakan. Karena keunikannya ini, Zeus kemudian dinobatkan sebagai anjing tertinggi di dunia, versi The Guinness World of Record. Sebuah foto yang dilansir di Huffingtonpost memperlihatkan Zeus dengan kaki yang panjang sedang melihat keluar jendela, dengan posisi kepala yang lebih tinggi dari wastafel tempat mencuci piring di rumah majikannya. Jika Zeus berdiri dengan

kedua kaki belakangnya, ia akan setinggi 2,22 meter dan ia akan lebih tinggi dari pemiliknya, Denise Doorlag. Keunikan Zeus ini mengalahkan anjing tertinggi di dunia sebelumnya, Giant George, yang tingginya hanya berbeda sekitar 1 inci atau sekitar 2,5 cm lebih pendek dari Zeus. Doorlag mengatakan bahwa Zeus yang memiliki berat badan 77,5 kg ini bisa menghabiskan 15 kilogram kantong makanan selama dua minggu. Ia juga mengatakan bahwa saaat ini ia membutuhkan sebuah mobil van sebagai alat transportasi yang bisa membawa Zeus ke manapun. (kc/int)

Pria Buang Lotere Berhadiah Rp213 M AUCKLAND- Saran untuk membaca sesuatu dengan cermat danhati-hatimemangbukannasihat yang salah. Apalagi jika dikaitkan dengan kisah ini. Seorang laki-laki di Selandia Baru dikabarkan membuang tiket lotere bernilai 22,5 juta dolar AS atau sekitar Rp213 miliar hanya karena tidak cermat membaca. Laki-lakiituternyatasalahmembaca hasil undian lotere dan kemudian membuang tiketnya karena dianggap sudah tak berguna lagi. Laki-laki berusia 20-an yang tak ingin disebutkan identitas dirinya itu sebenarnya sekadar iseng waktu membeli tiket lotere tersebut. Dia sebenarnya akan menggunakan uang itu untuk memotong rambutnya. Namun sesampainya di tempat potong rambut, tempat langganannya itu tutup. “Saya memeriksa hasilnya lewat telepon seluler saya, namun saya pasti salah membaca hingga me-

ngira tiket saya tak berguna,” katanya kepada kantor berita Fairfax. “Saya kemudian menaruhnya begitu saja,” tambah dia. Dan laki-laki itu baru mengetahui ‘kebodohannya’ setelah sehari kemudian dia mendengar banyak orang berbicara soal hadiah utama lotere yang tak diambil pemenangnya. “Setelah mendengar pembicaraan itu saya kemudian mengecek ulang tiket saya,” tambah dia. Beruntung laki-laki itu masih menemukan tiket loterenya yang sempat diabaikannya. Hadiah sebesar Rp213 miliar itu berbentuk uang tunai sebesar Rp200,6miliar,sebuahmobilLamborghini Gallardo, sebuah mobil Audi Q7, sebuah kapal motor cepat dan kartu kredit dengan batas pemakaian hampir Rp400 juta. Selain itu masih ada Rp400 juta berbentuk paket liburan ditambah uang saku liburan sebesar lebih dari Rp5 miliar. (kc/int)

Tak Bisa Menahan Pipis,

Bocah 2 Tahun Ini Ditilang SURAT tilang dan denda umumnya diberikan saat kita melanggar peraturan. Menerobos lampu merah, melebihi kecepatan, atau membuang sampah pada tempatnya. Namun, hal ini tidak terjadi pada seorang ibu dan anaknya yang berusia dua tahun. Caroline Robboy asal Philadelphia merasa dirugikan saat dirinya diberikan surat tilang dan denda sebesar $50. Tilang ini diberikan oleh polisi setempat karena dirinya dianggap melanggar peraturan publik yang telah ditetapkan. Peristiwa ini bermula saat Nathaniel Robboy, 2 tahun yang tak dapat menahan diri saat membuang air kecil. Setelah makan di sebuah restoran Johnny Rockets, lima blok dari

rumahnya, Caroline dan keluarganya berkunjung ke sebuah toko pakaian. Namun, dua anaknya mengatakan b a h w a dirinya harus pergi ke kamar kecil. Saat akan pergi ke toilet, operator toko tak mengizinkan anak-anaknya menggunakan toilet karena alasan tertentu. Saat akan kembali ke restoran, si kecil Nathaniel yang masih menggunakan pispot tak dapat menahan air kecilnya. Ia pun mengambil inisiatif untuk

kencing di lampu merah di pinggir trotoar. N B C Philadelphia melaporkan, Robboy sang ibu mencoba mengelak kejadian tersebut. Menurutnya, ia menyuruh anaknya di sebuah taman bukan di depan publik, seperti yang tertulis dalam surat penilangan. Atas peristiwa ini, Robboy tak hanya mendapatkan denda dan surat tilang, tapi juga penyuluhan untuk menjadi orangtua yang baik. (int)


18 September 2012

etelah putus dari Anji eks personil ‘Drive’, Rini ‘Idol’ mengaku kapok berpacaran dengan pria yang memiliki profesi sama. Kalaupun nantinya dia memiliki kekasih baru, Rini ingin mencari yang bukan dari sesama artis. “Nggak usah seprofesi biar nggak ribet dan lain-lain. Bukan hanya enak karena


MADONNA kembali menyulut permusuhan dengan Lady Gaga. Kali ini Madonna menyebut Gaga imitasi, dalam konser di Atlantic City, New Jersey, Amerika Serikat. Permusuhan Madonna dan Lady Gaga dimuali ketika lagu Born This Way’milik Madonna dibandingkan dengan lagu Madonna berjudul Express Yourself(1989). ”Aku aku akan mendedikasikan lagu berikut ini untuk Lady Gaga. Anda ingin tahu? Karena aku mencintainya. Aku sungguh-sungguh mencintainya. Imitasi adalah bentuk sanjungan tertinggi untuknya,” kata Madonna di konsernya, seperti dikutip Contactmusic.Madonna juga sebelumnya bercanda kalau ia dengan senang hati membantu Gaga untuk menulis lagu. ”Suatu hari, secepatnya, kami akan berada di panggung bersama-sama. Tunggu saja,” katanya. (idc)

sama-sama dibidang entertainment. Tapi mandang pribadinya juga. Aku jalin hubungan yang beda-beda shift bukan karena pekerjaannnya aja,” ujar Rini diRCTI, Kawasan Kebon Jeruk, Jakarta Barat, Senin (17/9). Rini mengakui kini dia memiliki kekasih yang berprofesi sebagai pekerja kantoran.Pria yang bersuku

Jawa ini sudah diperkenalkan kepada kedua orangtuanya. tapi menurut Rini, kedua orangtuanya tahu ia berpacaran. “ Yang jelas udah tahu kalau kitanya pacaran. Nggak mau nanya-nanya juga sih karena masih nyantai. Ini masih ditahap ini dulu,” ujarnya. Rini yang sudah berpacaraan hingga 3 tahun hingga kini

Syahrini ikut hadir di konser Noah. Syahrini yang duduk di barisan paling depan terlihat menikmati lagu-lagu yang dibawakan Ariel. Mantan duet Anang Hermansyah ini pun mengucapkan selamat atas kembalinya Ariel bersama teman-temannya. “Congratulation untuk Noah yang sudah konser, suatu pencapaian yang patut dibanggakan dan diacungi jempol. Dan patut diapresisi oleh semua seniman Indoensia,” ucapnya saat ditemui di Gandaria City, Jakarta Selatan, Senin (17/9)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Peruntungan: Tidak ada salahnya jika di hari ini Anda mulai membuka agenda-agenda yang ada dan segera menyusun langkahlangkah yang harus dilakukan di masa mendatang agar pada saatnya nanti bisa lebih santai dan ringan berjalan. Asmara: Tidak perlu mengusik hatinya yang lagi kacau sebab sudah cukup banyak yang menjadi beban pikirannya.


dini hari. Sebagai sesama musisi, Syahrini selalu mendukung kehadiran Noah. Menurutnya, Noah patut mendapat apresiasi sesama musisi. “Akhirnya dia kembali lagi ke industri musik Indonesia. Aku

(21 Desember -19 Januari)

Peruntungan: Selesaikan tugas-tugas yang masih menjadi beban Anda selama ini. Jangan terlalu asyik apalagi meremehkan persoalan yang ada, mumpung di hari ini perbintangan Anda lagi mujur-mujurnya. Asmara: Konsekuensi Anda dalam berbicara akan dibuktikan olehnya, maka dari itu berhatihatilah. Jangan sampai dicap pembual besar.


(20 Januari - 18 Februari)

Peruntungan: Peluang yang muncul secara tiba-tiba sebaiknya bisa disikapi dengan positive thinking dan segera ditindaklanjuti. Jangan buang waktu percuma. Asmara: Tak perlu tersinggung dulu dengan kata-katanya itu. Jika Anda renungkan maka Anda pasti bisa menemukan kebenaran dalam perkataannya itu.


19 Februari - 20 Maret

Peruntungan: Ada baiknya bersikap lebih tegas dan hilangkan dulu segala pikiran-pikiran yang ngambang dan tidak punya keyakinan itu. Cobalah berpikir dengan lebih optimis lagi sehingga bila ada peluang yang lewat tidak sampai berlalu begitu saja. Asmara: Hilangkan sikap egois. Cobalah Anda lebih bisa mengalah padanya.


(21 Maret - 20 April)

Peruntungan: Kalau permasalahan ini terus dibiarkan dan tidak segera ditindaklanjuti, maka keuntungan besar yang sudah di depan mata itu akan hilang lenyap begitu saja. Asmara: Keresahan hati kini terjawab sudah dan kenyataannya tidak seburuk apa yang Anda bayangkan.


(21 April - 20 Mei)

Peruntungan: Masih cukup ada rintangan yang harus diwaspadai, walau begitu tak perlu berkecil hati dan tak perlu risau akan ejekan yang muncul. Asmara: Jagalah selalu keserasiannya. Kalau ada pihak yang ingin mengacaukan suasana jangan dibiarkan saja.


(21 Mei - 20 Juni)

Peruntungan: Masalah berat sudah mereda dan menyingkir sehingga tak perlu cemas lagi. Di hari ini tidak ada salahnya jika Anda berani membuat keputusan penting karena itu memang sangat mendesak dan perlu gerak cepat, yang penting hati harus selalu yakin dengan keputusan yang telah dibuat. Asmara: Jangan ragu untuk bicara apa adanya kepada pasangan Anda karena itu akan lebih baik dan kesalahpahaman bisa terhindarkan.


(21 Juni- 20 Juli)

Peruntungan: Di hari ini jangan sembrono, terutama dalam memutuskan untuk menjalankan suatu rencana sebaiknya dipikirkan secara matang. Meskipun peluang cukup banyak, jika Anda tidak pAndai-pAndai mengolahnya maka hanya akan terbuang percuma saja. Asmara: Perhatian adalah nomor satu, maka dari itu luangkan waktu Anda walau sedikit untuk menelpon dia supaya komunikasi tetap terjalin baik.


(21 Juli-21 Agustus)

Peruntungan: Di hari ini aturlah waktu seefisien mungkin. Jangan seenaknya sendiri walaupun itu hanya sepele saja, akan tetapi jika tidak ditanggapi dan dipikirkan secara serius maka akan bisa menjadi problem yang cukup sulit untuk dipecahkan. Asmara: Apa sih enaknya backstreet kalau Anda masih punya pacar yang bisa diAndalkan?


(23 Agustus-22 September)

.Peruntungan: Berusahalah untuk lebih terkoordinasi dan terkonsep, walau untuk permulaaannya memang terasa berat dan menjemukan akan tetapi untuk langkah ke depannya akan benar-benar terasa manfaatnya. Asmara: Bersabar dan yakinlah bahwa semua ini pasti akan berlalu, untuk itu yang tenang saja.


(23 Oktober - 22 November)

Peruntungan: Kerjasama dengan pihak luar sebaiknya benar-benar dipikirkan secara mendalam. Jangan hanya berlandaskan faktor perasaan saja sehingga sikap baik Anda ini tak disalahgunakan oleh mereka untuk mengambil keuntungan sendiri. Asmara: Jadilah orang yang pandai mensyukuri nikmat sehingga tak perlu punya pikiran yang macammacam.


( 23 November - 20 Desember)

Peruntungan: Manfaatkan kesempatan yang ada di hari Sabtu ini walaupun kecil karena jika dikerjakan dengan sungguhsungguh maka akan besar hasilnya. Asmara: Jangan negative thinking kepadanya. Itu tidak ada untungnya, hanya akan menambah kacau suasana saja.

MENYANDANG status janda tak membuat Chantal Della Concetta merasa terbebani. Presenter dan model majalah dewasa ini mengaku tak perlu repot dengan statusnya itu. ”Nggak usah dibikin repot, santai aja. Kalau pikirannya repot, jadi repot. Kalau pikirannya ribet, bakal ribet. Kalau kita santai ya santai,” ujar Chantal. Misalnya ketika sang anak sedikit mengalami gangguan kesehatan, Chantal menyikapinya dengan tenang dan bijak. “Anak batuk sih wajar, ya namanya juga udara kayak gini. Kalau segala macam (kegiatan) nggak boleh, kasihan juga,” ujarnya. Chantal pernah menikah dengan Hans Lazuardi dan dikaruniai seorang putra, Nathaniel Trevor Lazuardi, pada 2004,

dan seorang putri, Mazel Peach Lazuardi, pada 2009. Pernikahan mereka hanya bertahan beberapa tahun. Chantal juga tidak merasa keberatan dengan klaim dirinya jadi salah satu icon wanita terseksi di tanah air. “Emang image seksi ada yang salah? Buat aku image seksi itu confident. Seksi itu kita merasa nyaman untuk tubuh kita, kenapa kita takut ama tubuh kita,” ucap Chantal. Semua orang menurut Chantal berhak untuk menjadi seksi. Baik laki-laki ataupun perempuan. Karena setiap orang mempunyai tipikal keseksian yang tak sama. ”Kenapa kita harus takut jadi seksi terutama perempuan. Lakilaki juga belum tentu nggak seksi kan, ada faktor seksinya. Mungkin berbeda dengan perempuan. Mungkin bagi sebagian perempuan, laki-laki pakai kemeja putih udah seksi ataupun lainnya,” lanjut presenter acara dewasa Sexophone ini. Selain itu, seksi bukan hanya terpaku pada bentuk tubuh yang menawan. Sebuah intelektualitas bagi Chantal juga menunjang sebuah keseksian seseorang. “Perempuan yang pintar menurutku itu seksi, perempuan yang percaya diri juga seksi,” cetusnya. Tatto di mata Chantal juga dianggapnya karya seni manusia yang indah. Dia sengaja menatto beberapa bagian tubuhnya agar indah dilihat orang lain. Tetapi sayang, ia tidak mau menyebut jumlah tatto yang ada di tubuhnya dan bagian-bagian tubuhnya yang ditatto. (BCG/jpnn)

belum memikirkan untuk menuju ke mahligai bahtera rumah tangga. Rupanya Rini masih ingin mengumpulkan pundi-pundi uang dan mengembangkan karirnya. “ Masih pengen menikmati masa yang sibuk kerja mencoba satu yang baru. Kerjaannya masih nyanyinyaanyi aja belum coba bidang lain,” tandasnya. (tr/int)

salah satu yang mensupport dan mengapresiasi karyakarya mereka,” katanya. Lantas bagaimana tanggapan Syahrini perihal konser 5 negara 2 benua yang berhasil dilaksanakan Noah? “Luar biasa keren, lagu-lagu barunya aku juga suka,” ucapnya. (nov)

KRISTEN Stewart sepertinya tak tanggung-tanggung dalam melepas image Bella Swan yang sudah melekat kepadanya bertahun-tahun. Bahkan untuk beradegan topless di film terbarunya ‘On the Road’ Kristen tampak tak canggung. ”Itu tak menggangguku (adegan topless),” ujarnya seperti dilansir MTV News, Senin (17/9). ”Ketika sampai di lokasi syuting, hanya ambil napas dan biarkan itu terjadi,” tambahnya. Kristen merasa ia sudah cukup dewasa untuk melakukan adegan tersebut. Menurut aktris kelahiran 9 April 1990 itu, ia tak akan berani melakukannya jika usianya baru 17 tahun. Di film itu, Stewart berperan sebagai Marylou, istri Dean Moriarty (Hedlund) yang masih berusia 16 tahun. Dia adalah gadis yang memiliki semangat kebebasan, dan sangat menyukai mariyuana dan seks. Pasangan pengantin muda itu kemudian bertemu dengan Sal Paradise yang mengajak mereka unutk melakukan perjalanan setelah ayahnya meninggal dunia. Haus akan kebebasan, mereka menemukan ‘dunia lain’ yang cukup gila. Untuk perannya sebagai Marylou di film itu, Stewart juga rela mengecat rambutnya yang gelap menjadi pirang. “On the Road” akan terlebih dahulu diputar di Toronto International Film Festival 2012 bulan ini, sebelum tayang di bioskop AS pada 21 Desember mendatang. (dtc/int)

SUSAN Bachtiar phobia memakai sepatu tertutup. Karena memakai sepatu jenis ini, Susan harus menghirup aroma tidak sedap pada kakinya. Tidak hanya itu menurutnya sepatu tertutup dapat menimbulkan panas pada kakinya. Jadi jika berpergian Susan lebih nyaman pakai sepatu yang terbuka. “ Lagipula just my style aja. Pake sepatu tertutup itu kalau lagi terpaksa aja. Soalnya lebih ke negara yang memang pakai boots,” ujar Susan di Press conference OLAY Changing Life, Diva Reunion Concert, Hard Rock, Jl MH Thamrin, Jakarta Pusat, Senin (17/9). Bintang film ‘Perempuan Punya Cerita’ ini mengaku lebih cocok pakai sepatu berbahan kain yang dapat menyerap keringat. “Seperti katun yang paling aman. Apalagi untuk perempuan, kondisi badannya kan lain dari pria Untuk kesehatan wanita, dokter juga banyak menyarankan untuk memang bisa memakai bahan katun,” ujarnya. Tetapi karena begitu banyak model, katun terbatas jadi diperlukan perpaduan bahan yang lain. ”Tapi memang perpaduan bahan membuat fashion menjadi lebih menonjol,” ujarnya. Sekedar diketahui mantan isteri Sunardi ini mengatakan khusus masalah fashion, biasanya ia memakai apa yang dianggap nyaman dan cocok dengan gayanya. “ Nggak peduli apa gaya bajunya atau mereknya apa, yang penting comfortable,” tandasnya. (tr/int)



18 September 2012

Lorenzo Juara, Pedrosa Sial, Rossi Hadiahkan Kado Manis

Pebalap Yamaha, Jorge Lorenzo, menjuarai GP San Marino, Minggu (16/9), ketika rival terberatnya dari tim Repsol Honda, Dani Pedrosa, mengalami nasib buruk. Dengan hasil ini, Lorenzo kembali menjauh dari kejaran Pedrosa, dengan keunggulan 38 poin atas kompatriotnya dari Spanyol itu, dan balapan tersisa lima seri lagi. Balapan di Sirkuit Misano ini pun menjadi arena pertunjukkan Valentino Rossi, yang sukses finis di posisi kedua. “The Doctor” membuktikan tekadnya, yang ingin mempersembahkan hasil bagus sebagai kado perpisahan dengan Ducati dalam balapan terakhir di depan publik Italia. Posisi ketiga ditempati pebalap Gresini Honda, Alvaro Bautista, yang berhasil mengatasi tekanan pebalap Yamaha Tech 3, Andrea Doviziso, menjelang akhir balapan. Pada tikungan terakhir sebelum menyentuh garis finis, Dovizioso nyaris melewati Bautista, tetapi pebalap Spanyol ini sukses mempertahankan posisi dengan keunggulan hanya 0,03 detik. Jalannya Balapan Saat lampu merah padam tanda balapan dimulai, Rossi melakukan start yang bagus karena dari urutan keenam, dia langsung menyodok ke posisi kedua, persis di belakang Lorenzo yang menjadi pebalap terdepan. Ini terjadi karena Pedrosa, yang

meraih pole position, harus start dari posisi paling belakang akibat mengalami masalah mesin, sehingga harus mengganti motor. Namun di lap kedua, nasib buruk menimpa Pedrosa, yang mengalami kecelakaan. Ketika sedang berusaha merangsek ke depan untuk memperbaiki posisinya, dia dihantam pebalap Pramac Ducati, Hector Barbera, saat akan menikung ke kiri. Pedrosa pun harus melupakan impian untuk meraih poin di balapan seri ke-13 ini. Tanpa Pedrosa, Lorenzo tak mendapat perlawanan berarti. Rossi yang berusaha membuntutinya belum mampu bersaing karena hingga lap kelima, “The Doctor” tertinggal lebih dari 1 detik. Persaingan seru justru untuk memperebutkan posisi kedua, karena Stefan Bradl, Andrea Dovizioso, dan Alvaro Bautista terus membuntuti Rossi. Kecelakaan juga menimpa pebalap Yamaha Tech 3, Cal Crutchlow, yang jatuh di lap kelima, ketika berusaha melewati Dovizioso. Kegagalan ini membuat Crutchlow tak bisa membuka harapan untuk membuat sejarah sebagai pebalap Inggris pertama setelah Ron Haslam pada 1987, yang berhasil naik podium secara berturut-turut. Pada balapan di Brno, Ceko, Crutchlow berhasil finis di posisi ketiga. Di Misano ini, Crutchlow berpeluang melakukannya, apalagi Pedrosa sudah terlebih dahulu meninggalkan balapan. Sayang, impian membuat back-to-back itu sirna, karena mantan pebalap Superbike itu pun gagal melanjutkan lomba. Memasuki lap ke-14, Lorenzo terus membuat jarak dengan Rossi karena juara dunia 2010 tersebut sudah memimpin 4,587 detik. Sementara itu Rossi kian kuat mendapat tekanan dari

Valentino Rossi (kiri) menyaksikan selebrasi kemenangan Lorenzo di San Marino. Pada balapan serupa, Dani Pedrosa mengalami kecelakaan. Bradl, Dovizioso dan Bautista. Tetapi juara dunia tujuh kali MotoGP tersebut terus bertahan. Tampaknya, sasis dan lengan ayun baru yang dipakai dalam balapan ini bekerja dengan baik, sehingga sampai dengan separuh balapan, Rossi bisa bertahan di barisan depan. Pada lap ke-16, Bautista naik satu strip ke posisi keempat, setelah menyalip Dovizioso. Selanjutnya, pebalap Gresini Honda ini mulai mengincar Bradl di posisi ketiga. Benar saja, pada lap ke-19, Bautista, yang menjuarai GP San Marino pada 2008 ketika masih di kelas 250 cc, berhasil menyalip Bradl. Sementara itu

Penutupan PON Dijanjikan Lebih Meriah Wakil Presiden, Boediono, dipastukan akan menutup PON XVIII. Pihak penyelenggara menjamin kalau seremoni penutupan tersebut lebih meriah dibanding pesta pembukaan. Hal itu disampaikan, event organizer penutupan

PON, Helmi Yahyah dalam acara silahtuhrahmi Gubernur Riau, Rusli Zainal dengan wartawan, Minggu (16/9) malam. Menurut Helmi penutupan PON akan lebih banyak melibatkan artis ibukota. Misalkan, Ahmad Dhani, Ari Laso, Titi DJ dan Ruth Sahanaya. Selain itu akan ada juga penyanyi dangdut Cici Paramida yang akan membawa tembang Melayu. “Acara penutupan akan lebih happy dibanding pembukaan. Karena penutupan ini lebih pada ucapan terimakasih kepada atlet,

Missy Franklin

Perenang Terbaik PERENANG muda Amerika Serikat asal Colorado, Missy Franklin yang berhasil merebut empat emas dan satu perunggu dalam debutnya di Olimpiade London 2012, dinobatkan sebagai atlet renang terbaik AS tahun ini. Sayangnya, Missy Franklin tak bisa menerima sendiri penghargaan yang diperolehnya itu dalam acara di US Aquatic Sports Convention akhir pekan lalu. Gadis berusia 17 tahun itu tengah sibuk mempersiapkan ujian akhir sekolah menengah atasnya sejak kembali dari London. Pekan lalu dia juga tidak hadir di Gedung Putih, saat para atlet Olimpiade dan Paralimpiade dijamu Presiden Barack Obama. “Saya tak menyangka hidup saya bisa sehebat ini,” kata Franklin. “Menjadi bagian dari tim Olimpiade adalah sebuah pengalaman yang luar biasa. Kami di tim renang sangat akrab. Kami bersenang-senang bersama dan saya menyayangi mereka semua,” tambah dia. Di London, Missy Franklin mendapatkan emas di nomor 100m dan 200m gaya punggung, 4x200 meter gaya bebas dan 4x100 meter gaya campuran. Dan di nomor 200 meter gaya punggung serta di gaya campuran, Franklin juga memecahkan rekor dunia. Dan dia masih meraih perunggu untuk nomor 4x100 meter gaya bebas. Prestasinya itu sebenarnya bisa mendatangkan banyak keuntungan finansial bagi Franklin. Namun kepada harian USA Today, Franklin mengatakan belum terpikir untuk beralih menjadi profesional. “Saya ingin menjadi profesional suatu hari nanti. Tetapi untuk saat ini menjadi bagian tim renang di universitas adalah salah satu yang paling saya inginkan,” tegasnya. (int)

Evander Holyfield Missy Franklin

Lorenzo kian jauh di depan dengan keunggulan 5,524 detik atas Rossi. Bautista, Bradl, dan Dovizioso bertarung ketat memperebutkan posisi ketiga. Tiga pebalap tersebut hanya berjarak sekitar 0,2 detik di antara mereka, sedangkan Rossi agak menjauh karena unggul lebih dari satu detik atas Bautista. Tampaknya “The Doctor” bisa mempertahankan posisinya karena kecepatan Desmosedici GP12 tunggangannya cukup konsisten. Saat balapan tersisa lima lap lagi, Ben Spies mulai merangsek ke depan untuk memberikan

ancaman kepada Dovizioso. Rekan setim Lorenzo ini, yang musim depan akan memperkuat tim Pramac Ducati bersama dengan pebalap Moto2, Andrea Iannone, ikut dalam pertarungan memperebutkan posisi keempat. Sementara itu Bautista mulai sedikit lepas dari tekanan. Satu lap berselang, Bradl harus terima kenyataan turun dua strip sekaligus karena lebih dulu dilewati Dovizioso, sebelum Spies pun melakukan hal serupa. Dengan demikian, Dovizioso dan Spies yang bertarung untuk memperebutkan posisi keempat. Mereka juga kian merapat dengan Bautista di urutan ketiga. Di lap terakhir, Dovizioso, yang musim depan gantikan Rossi di Ducati, persis di belakang Bautista. Tetapi pebalap Italia ini tak mampu meraih posisi ketiga, karena dia sedikit lebih lambat menyentuh garis finis. Lorenzo dengan nyaman meraih kemenangan karena dia unggul 4,398 atas Rossi, yang finis di peringkat kedua. Tetapi bagi Rossi, hasil ini menjadi sebuah prestasi yang besar, karena sesuai janjinya, dia mampu memberikan hasil membanggakan sebagai kado perpisahan dengan Ducati di depan publik Italia. Ya, GP San Marino ini menjadi balapan terakhir Rossi bersama Ducati di rumah sendiri. Pasalnya, musim depan dia akan kembali bergabung dengan Yamaha, untuk menjadi tandem Lorenzo. Pengembangan Ducati di seri ini memberikan hasil yang memuaskan, karena Rossi bisa mengalahkan para lawan yang pada seri-seri sebelumnya sulit dikalahkan. Setelah balapan ini, para pebalap langsung mempersiapkan diri menghadapi seri ke-14 di Sirkuit Motorland Aragon. Balapan tersebut akan berlangsung pada 30 September mendatang. (int)

panitia dan wartawan,” kata Helmi. Helmi menjelaskan, hiburan penutupan sudah dimilai pukul 16.00 sore waktu setempat. Upacara penutupan PON oleh Wapres pada pukul 19.00 malam. “Penutupan nanti kita sudah mempersiapkan daya listrik tujuh MW. Kita masih memperkuat atraksi leser lewat ilusi laser terbaik di Asia,” kata Helmi. Sementara itu, Gubernur Riau memastikan kalau penutupan akan tetap diberlakukan tiket masuk. Hanya saja harga tiket tidak semahal

KLASEMEN 1. DKI Jakarta 2. Jawa Barat 3. Jawa Timur 4. Jawa Tengah 5. Riau 6. Kalimantan Timur 7. Lampung 8. Sumatera Utara 9. Sulawesi Selatan 10. Sumatera Selatan 11. Nusa Tenggara Barat 12. Sumatera Barat 13. PAPUA 14. Di Yogyakarta 15. Bali 16. Kalimantan Selatan 17. Kalimantan Barat 18. Kalimantan Tengah 19. Banten 20. Maluku 21. Jambi 22. Sulawesi Tenggara 23. Sulawesi Utara 24. Kep. Bangka Belitung 25. Gorontalo 26. Nusa Tenggara Timur 27. ACEH 28. Papua Barat 29. Sulawesi Tengah 30. BENGKULU 31. Kep. Riau 32. Maluku Utara

66 65 61 35 29 27 15 13 13 9 8 8 6 6 5 4 4 4 4 3 3 3 2 2 2 1 1 1 1 0 0 0

70 53 60 28 25 28 7 17 11 11 5 4 10 9 9 8 4 4 3 9 5 0 5 3 1 4 3 2 1 1 0 0

76 734 55 44 39 29 8 17 12 19 7 19 12 10 23 11 11 3 9 4 12 2 1 4 0 2 13 5 0 4 1 1

waktu pembukaan. “Pokoknya tiket nanti paling mahal cuma Rp 200 ribu dan paling murah Rp 50. Ini sematamata untuk membatasi membludaknya penonton,” kata Rusli. Disinggung jumlah dana penutupan, Rusli mengenal untuk merincikan. Menurutnya dananya akan lebih murah di banding Sumatera Selatan (SEA Games). “Yang jelas, kita lebih murah dari Sumsel, malah dananya nanti tak sampai separohnya,” kata Rusli. (int)

DKI Jakarta Tetap Puncaki Klasemen DKI Jakarta sejauh ini masih memuncaki klasemen sementara Pekan Olahraga Nasional (PON) XVIII Riausejak mengambil alih tampuk pimpinan dari Jawa Barat. Jakarta dan Jabar mengumpulkan emas sama banyak, Minggu (16/9). Mereka masing-masing menambah koleksi delapan emas. Emas Jakarta diraih dari beberapa cabang seperti senam ritmik dan taekwondo. Sedangkan Jabar menyabetnya dari Judo dan Kempo. Hasil itu belum mengubah posisi DKI Jakarta yang ada di posisi pertama diikuti Jabar. Komposisi di posisi lima besar klasemen tidak mengalai perubahan. Jawa Timur, Jawa Tengah, dan tuan rumah, Riau, berturut-turut ada di posisi tiga, empat, dan lima. Posisi Riau di peringkat lima klasemen sementara mulai dibayangi oleh Kalimantan Timur. Tuan rumah PON lalu itu kini hanya berjarak dua emas dari Riau. Berikut ini adalah daftar perolehan medali PON XVIII, Senin (17/9), hingga pukul 8.30 WIB. (int)

Evander Holyfield

Menelantarkan Anak Gadisnya EVANDER Holyfield belum terbebas dari masalah finansial. Mantan juara dunia tinju kelasberatinidiketahuimenelantarkansalah satu anak perempuannya, Emani. Holyfield seharusnya memberikan uang tunjangankepadagadis18tahunitusebesar $2.950 atau setara Rp28 juta per bulan. Namun,mantanmusuhbebuyutan Mike Tyson itu menunggaknya hingga berjumlah total Rp5,3 miliar. Seperti dilansir Daily M a i l , Holyfield bahkan h a r u s meng-

habiskan pendapatannya hanya untuk melunasi utang-utangnya. Padahal, pria kelahiran Alabama, Amerika Serikat ini termasuk dalam daftar 20 petinju dengan bayaran termahal. Holyfield pernah meraup $30 juta atau setara Rp285 miliar untuk sekali tanding melawan Tyson. Sayangnya, hasil jerih payah di atas ring yang mencapai Rp2,37 triliun tak mampu menutupi biaya kehidupan pria 49 tahun itu. Masalah Holyfield berawal pada 1999, ketika istrinya kala itu, Janice mengajukan gugatan cerai. Seperti dilaporkan Houston Press, Janice tidak bisa menerima pengakuan pria berkepala plontos itu yang memiliki dua anak di luar nikah. Selain seorang putra hasil pernikahannya dengan Janice, Holyfield ternyata harus membiayai11oranganaklainnya.Sehingga, pemegang rekor 44 kali menang (29 KO), 10 kali kalah dan 2 kali seri ini memiliki 12 anak dari 6 wanita berbeda. Pada 2008, Holyfield secara terbuka mendeklarasikan kebangkrutan dirinya. Lalu, 2 tahunkemudian,JanicemenuntutHolyfield melalui Pengadilan Texas untuk membayar tunjangan anaknya senilai Rp2,3 miliar. Pada Juli 2012, Holyfield akhirnya melepas rumah mewahnya di Atlanta. Rumah tersebut terjual seharga Rp71 miliar lewat proses pelelangan. (int)



18 September 2012

Sumut Melaju ke Final

„ Torres

PEKANBARU- Tim sepakbola Sumatera Utara (Sumut) secara mengejutkan berhasil menumbangkan favorit juara Papua di babak semifinal PON XVIII, Senin (17/9). Mereka menang dengan skor 2-0.


eperti di pertandinganpertandingan sebelumnya, Papua mengandalkan trio penyerangnya, Ronald Setmot, Yohanes Nabar dan Permens Iwanggen. Namun Sumut sepertinya telah siap mengantisipasi, dan pasukan Rudi Saari terlihat berhasil mematikan pergerakan ketiga pemain tersebut. Sumut bahkan mendominasi 25 menit pertama pertandingan. Permainan taktis serta efisien berhasil diperagakan Safri Koto dan kawan-kawan. Lini pertahanan Sumut yang digalang Hardiantono juga disiplin dan membuat para penyerangPapuacukupsulitmenembus pertahanan. Di menit 41, gelandang sayap Sumut Aidun Sastria Utami melakukan tendangan melambung yang ternyata tak mampu dijangkau penjaga gawang Papua, Mario Reyaan. Bola yang masuk ke sudut kanan atas gawang mengubah kedudukan menjadi 1-0 di penghujung babak pertama itu. Di babak kedua, Papua mencoba menggempur pertahanan Sumut. Berkali-kali serangan yangdimotoriNelsonAlomdan Yohanes Nabar selalu gagal.

SedangkanSumutyangsudah unggulmengandalkanserangan balik. Setiap serangan yang merekalalukanlebihefisien. Di menit 76, Sumut mampu menambah keunggulan menjadi 2-0 melalui gol spektakuler Mohammad Irfan. Sisa sepuluh menit terakhir dilakukan Papua dengan permainan menyerang total. Tapi, kokohnya lini belakang Sumut serta sigapnya penjaga gawang Ahmad Fauzi membuat Sumut tetap tidak kebobolan gol. “Anak-anak menjalankan instruksi yang saya inginkan. Alhamdulillah, di lapangan berhasil diterapkan,” ujar pelatih Sumut Rudi Saari, usai pertandingan. Mantan pelatih PSMS tersebutsaatinimengakuinginfokus ke pertandingan final melawan pemenang antara Jawa Tengah (Jateng) melawan Kalimantan Timur (Kaltim). “Hari ini maksimal, selanjutnya final,” katanya. TimPapua Keluhkan Panpel Mengakui permainan bagus Sumatera Utara, tim Papua mengeluhkan kinerja panpel cabang sepakbola. WakilmanagertimPapuaNicko

Dimo, menuding jadwal yang tidakidealmembuatpasukannya takmaksimaltampilhariini.Secara keseluruhan, ia menilai manajemencabangsepakboladi PONkaliinikacaubalau. “Kami melawan tiga tim ISL. Jawa Barat sudah jadi korban. Sekarang yang merasakan adalah kami. Anda lihat saja, mulai babak enam besar sampai semifinal,jadwalkamiselalumain di panas terik jam 4 sore. Panpel seperti wasit, kan dari ISL semua,” ujar Nicko usai pertandingan kepada wartawan di Stadion Kaharuddin Nasution, Senin (17/9). Meski demikian, Nicko mengakui permainan Sumut memang lebih bagus dan konsisten sepanjang 90 menit. Ia pun akan mengoptimalkan sisa

waktu yang ada untuk istirahat mempersiapkan partai perebutan perunggu. “Terlepas dari itu, kami harus akui Sumut memang main bagus,” ujarnya. Hal senada dikatakan kapten Tim Papua Jorgen Wayega. Menurut pemain berusia 20 tahun itu, Sumut memang tampil agresif dan cepat. Ia menekankan, jadwal yang padat serta keharusan bermain di panas terikmatahariikutmempengaruhi performa ia dan temantemannya. Apalagi dua pilar Papua yaitu Hendrick Makuba serta Elvis Harewan juga masih cedera. “Ya, dua teman kami juga cedera. Selain itu, fisik kami ikut terkuras karena padatnya jadwal,” sebutnya. (int)

Kepergian RVP Bikin Arsenal Lebih Baik

Di Matteo Tak Khawatirkan Performa Torres Fernando Torres sudah absen mencetak gol di dua laga kompetitif yang dijalani Chelsea. Meski demikian, Roberto Di Matteo mengaku tak khawatir. Sejak hengkangnya Didier Drogba, Torres menjadi andalan Di Matteo di lini depan The Blues. Dia selalu diturunkansejakmenitpertamadi empat laga Premier League yang sudah dijalani Chelsea. Tapi sudah dua laga kompetitif dilewati Torres tanpa mencetakgol.Setelahtakbikin

gol saat lawan Atletico Madrid di Piala Super Eropa, Torres kembali absen mencetak gol saat Chelsea diimbangi Queens Park Rangers di laga Premier League akhir pekan lalu. Dalam laga di Loftus Road itu, performa Torres bahkan mengecewakan. Dia akhirnya ditarik keluar di menit ke-81 dan digantikan oleh Daniel Sturridge. Hal itu sempat dikhawatirkan akan membawa Torres kembali ke ‘mimpi buruknya’ ketika kesulitan mencetak gol

di awal kariernya bersama Chelsea. Tapi Di Matteo menampik hal itu. “Tidak, tentu tidak. Kami tidak bisa menaruh tekanan terlalu besar pada satu pemain,” ujar Di Matteo seperti diwartakan Sky Sports. “Kamiadalahtimdansetiap pemain punya tanggung jawab. Kami juga mencari pemainlainuntukmencetakgol. Saya pikir ini adalah olahraga tim. Saya tidak akan melihat pemain secara individu,” tuntas pria asal Italia itu. (int)

‘Lampard Inspirasiku, Kaka Idolaku’ FRANK Lampard dan Ricardo Kaka merupakan dua pesepakbola favorit Oscar dos Santos. Pemain anyar Chelsea ini mengaku telah lama menjadikan Lampard dan Kaka sebagai panutannya di lapangan hijau. Seperti diketahui, Oscar diboyong ke Stamford Bridge sejak bursatransfermusimlalu,dengan nilai transfer sebesar 25 juta pounds. Pemain internasional Brasil itu akhirnya bisa bertemu dengan inspiratornya di lapangan, Frank Lampard. “Saya selalu menonton permainannya, ketika saya tumbuh dewasa. Saya pun selalu berpikir bahwa dia merupakan pemain yang luar biasa. Saya selalu tidak sabar untuk

„ Oscar dos Santos bermain bersama Lampard,” kata Oscar, Senin (17/9).

Selain Lampard, mantan pemain Internacional itu juga mengidolakan Kaka. Punggawa Real Madriditutelahmenjadiidolanya sejak kecil. Selain Kaka adalah pemainhebat,rekansenegaranya itu juga bermain di posisi yang sama dengan Oscar. “Sejak kecil, idola saya adalah Kaka. Dia bermain di posisi yang sama dengan saya. Dia juga tergolong sebagai pemain luar biasa,” tandas pemain 21 tahun ini. Sejauh ini, Oscar telah turun membelaChelseadalamdualaga awal Premier League musim 2012/2013 ini, saat The Blues kontra Wigan Athletic dan Reading. Dari bangku cadangan, mantan pemain Sao Paulo ini menggantikan Eden Hazard dan Ramires. (int)

Kepergian Robin van Persie boleh jadi akan membuat kehilangan besar untuk Arsenal. Tapi Arsene Wenger justru mengambil sisi positifnya, di mana The Gunnerskinilebihbermainsebagaitim. Dalamduamusimterakhir,ketergantungan Arsenal pada Van Persie begitu besar. Terkhusus musim lalu saat Van Persie menyumbang 30 gol atau nyaris setengah dari total 74 gol yang dicetak Arsenal selama semusim. Maka Arsenal pun kerap diplesetkan menjadi Van Persie FC karena terlalu bergantung pada golgol Van Persie dan tak ada satupun pemainArsenalyangmampumencetakgolmencapaiangkaduadigit. Ketika Van Persie dijual ke Manchester United, maka Arsenal pun diramalkan akan kesulitan musim ini karena kualitas Lukas Podolski dan Olivier Giroud yang didatangkan oleh Wenger tak sepadan

dengan pemain asal Belanda itu. Setidaknya prediksi itu terbukti ketika di dua laga awal Liga Inggris, Arsenal dua kali bermain imbang tanpa gol. Namun, klub asal London Utara itu cepat bangkit dan dia dua laga terakhir mereka mencetak delapan gol serta jadi tim

dengan produktivitas gol terbaik di empat laga sejauh ini. Terkait fakta ini, Wenger menilai kepergian Van Persie membantu Arsenal bermain sebagai tim dan tak lagi bergantung pada satu pemain. Sumber gol Arsenal kini bisa dari lini mana pun dan sejauh ini

baru Podolski yang mencetak lebih dari satu gol, sisanya dibagi rata ke empat pemain dan dua gol bunuh diri. “Terkadang ketika ada satu pemain yang menonjol dan menjadi pusatperhatiansertajaditumpuan tim lalu orang-orang hanya akan menganggapdia,”tukasWengerdi Soccernet. “Robin van persie mencetak 30 gol, dan ketika Anda mencetak gol sebanyak itu, maka semuanya akan memberi bola pada Anda. Mudahnya seperti itu. Permainan kami saat ini sedikit lebih bervariasi,” lanjutnya. “Kami punya semangat, keinginan untuk bermain secara tim dan kekuatan dari kedalaman pemain kami. Hasilnya kami lebih terlihat sebagai tim dan kami menikmati bermain secara tim. Itu adalah dasar yang baik dan menarik,” pungkasnya. (int)

Neuer Optimistis Bayern Sukses MUNICH- Bayern Munich bersemangat untuk meraih kesuksesan di gelaran Liga Champions musim 2012/2013 ini. Kendati sulit menghilangkan kekecewaan musim lalu di laga final Liga Champions, Manuel Neuer optimistis timnyaberpeluanguntuksuksesdi musimini. Seperti diketahui, Bayern berhasilmelajuhinggababakfinalLiga Champions musim lalu. Namun, harapan The Bavarians untuk meraih gelar juara Eropa itu harus pupus, setelah Chelsea mampu unggul lewat adu penalti. “Normal jika kami selalu ingin

mencapaikesuksesansemaksimal mungkin. Sayangnya, kami tidak mampu memanfaatkan kesempatan itu musim lalu. Kali ini, kami akanmelihatkedepan,”ujarNeuer, Senin (17/9). Bayern dijadwalkan akan melakoni laga perdananya di babak penyisihan grup, dengan menjamu Valencia pada Kamis (20/9) mendatang. Kiper 26 tahun ini menganggap,lagainiakanmenjadi laga pembuka yang tidak mudah bagi The Bavarians. “Kamimemulaikompetisiinidari awallagi.Dilagapertama,kamiharus menghadapi lawan yang sangat

kuat.Kamitidakakanmudahmendapatkantigapoindarilagaini,”kata kiperberkebangsaanJermanini. “Kami pasti punya keberuntungan lebih, ketimbang musim lalu.Meskibegitu,kamiakanmemberikan perlawanan serius ke lawan-lawankamidigrupini.Sebab, mereka merupakan tim berkualitas dan layak untuk bermain di Liga Champions,” pungkasnya. Selain Valencia, Bayern akan bertemu dengan klub asal Prancis Lille, dan klub asal Belarusia BATE. Empat tim ini tergabung dalam grup F Liga Champions musim 2012/2013. (int)

„ Manuel Neuer

Busquets Terkejut Sukses di Barca BARCELONA- Sergio Busquets mengaku terkejut dengan kesuksesannya di Barcelona. Punggawa LosBlaugranainitidakmenyangka bahwa dia akan menjadi pemain kuncidiskuadtimKatalan,bahkan memenangi banyak trofi. Busquets memulai debutnya bersama tim utama Barcelona pada 2008 lalu. Sejak saat itu, pemain 24 tahun ini menjadi pemain kunci di lini tengah Los Blaugrana dan mengantarkan timnya meraih tiga gelar La Liga dan trofi Liga Champions musim 2010/11 lalu. “Semuanyaterjadidengancepat.

„ Sergio Busquets

Dansebenarnya,sayatidakpernah membayangkan bahwa saya akan memenangkanbanyakgelarbersamaBarca,”kataBusquets,sebagaimanadilansirGoal,Senin(17/9). Busquets juga mengungkapkan kebahagiaannya, sebab pemain internasional Spanyol ini punya peran penting di skuad Los Blaugrana. Hal inilah yang membuatnya mengukir harapan di Barcelona, yaitu keinginannya untuk bermain lebih lama lagi bersama klub raksasa asal Spanyol itu. “Saya tentunya sangat bahagia. Sebab, saya berperan penting di

sini. Saya juga memiliki jatah bermain banyak dan saya tidak membayangkan ini terjadi. Saya berharap, saya akan punya waktu lebih bersama Barca dan memenangi lebih banyak gelar lagi di sini,” tandasnya. Busquets termasuk salah satu pemain yang setia merumput bersama Barcelona. Sebelum masuk tim utama Barca, pemain bertubuh jangkung ini bermain bersama tim Barcelona B. Hingga saat ini, Busquets tercatat telah tampil di 120 laga bersama tim Katalan, dengan torehan tiga gol. (int)


SELASA 18 September 2012


Bentrok Anderlecht di San Siro mungkin dijadikan Massimiliano Allegri sebagai misi menyelamatkan dirinya dari pemecatan.


iga kali main dengan 2 kekalahan di kandang jelas tak bisa diterima buat klub sebesar AC Milan. Tak pelak, masa depan allenatore Massimiliano Allegri pun mulai dipertanyakan. Kekalahan 0-1 dari Atalanta, Sabtu (15/ 9), menjadikan musim 2012/2013 sebagai yang terburuk dalam 82 tahun sejarah Milan. Kali terakhir, I Rossoneri menderita 2 kekalahan beruntun di San Siro terjadi pada 1930 silam. Tak hanya itu. Legendaris Milan Zvonimir Boban pun menyindir pasukan Allegri sebagai yang terburuk yang pernah dimilik I Rossoneri dalam 25 tahun terakhir. Sontak, mencuat isu bahwa manajemen Milan memberi tenggat buat Allegri untuk menyelamatkan jabatannya dalam 2 partai ke depan. Dimulai dengan menjamu klub Belgia, Anderlecht, di San Siro pada Grup C Champions League, Selasa (18/9) atau Rabu (19/9) dinihari WIB. Allegri mungkin berpikir Anderlecht bakal jadi penyelamatnya. Anderlecht termasuk lawan relatif mudah buat Giampaolo Pazzini dkk. Dari 4 pertemuan sebelumnya, Milan menang dan seri masing-masing 2 kali. Pada benturan terakhir di San Siro, 1 November 2006, Milan bahkan membantai Anderlecht 4-1 lewat hattrick Ricardo Kaka dan 1 gol Alberto Gilardino. Yang menarik, setelah ke empat bentrokan dengan Anderlecht di 2 musim berbeda (1993/1994 dan 2006/2007), Milanselalujadijuaradiakhirkompetisi. Well, ini yang bikin Allegri berharap musim ini pertemuan dengan Anderlecht jadi berkah buat Milan di akhir



No 1 2 3 4 5

Borussia Dortmund VS

Gol 4 4 3


No 1 2 3 4 5

Borussia Dortmund 0:1/2 Ajax Amsterdam

Dortmund) di Liga Champions. Cruyff juga menilai, kesialan Ajax masuk grup maut lantaran timnya kini bukan lagi klub unggulan di Benua Biru, sehingga hanya berada di pot tiga saat pengundian grup Liga Champions beberapa waktu lalu. “Saat ini perasaan saya campur aduk di Liga Champions. Tentu saja menye-

nangkan Ajax akan melawan juara liga Spanyol, Inggris dan Jerman,” ujar Cruyff. “Tapi di saat bersamaan, anda sadar akan sangat sulit bagi klub lolos ke babak berikutnya.” “Situasi ini terutama disebabkan karena Ajax berada di pot ketiga saat undiandilakukan.Selama17tahunterakhir, ada sesuatu yang salah.” “BagaimanabisatimjuaraLigaChampions 1995 dan berada di final setahun berikutnya, justru menempati pot ketiga pada 2012 ini,” keluh Cruyff.

S 1 0 2 2 1

K 0 1 0 0 1

SG 8-2 10-5 8-1 9-6 10-4

Nilai 10 9 8 8 7

Nama Michu R van Persie J Defoe

Klub Swansea City Manchester United Tottenham Hotspur

Team Barcelona Málaga Mallorca Sevilla Atletico Madrid

M 4 4 4 4 3

M 4 3 2 2 2

S 0 1 2 2 1

K 0 0 0 0 0

SG 12-3 6-2 5-3 4-2 9-4

Nilai 12 10 8 8 7

AC Milan 0:0 Anderlecht

TOP SCORER Gol 6 4 4

Nama L Messi R Falcao T Hemed

Klub Barcelona Atlético Madrid Mallorca

ITALIAN SERIE A No 1 2 3 4 5

Team Juventus Napoli Lazio Sampdoria Internazionale

M 3 3 3 3 3

M 3 3 3 3 2

S 0 0 0 0 0

K 0 0 0 0 1

SG 9-2 8-2 7-1 6-3 6-3

Nilai 9 9 9 8 6

TOP SCORER Gol 4 3 3

Ajax Amsterdam


M 3 3 2 2 2


Nama S Jovetic Hernanes M Klose

Klub Fiorentina Lazio Lazio


Peluang Lubang Jarum Meski pelatih Ajax Amsterdam Johan Cruyffbanggatimnyatergabungdengan klubjuaradimasing-masingliga,namun di satu sisi dia mencemaskan peluang tim keluar dari lubang jarum. Ia mencemaskan peluang Ajax merebut satu tiket ke babak 16 Besar lantaran harus berjibaku melawan tim papan atas Eropa. Ajax Amsterdam tidak beruntung karena harus berada satu grup dengan tiga tim juara La Liga Spanyol [Real Madrid], Liga Primer Inggris (Manchester City) dan Bundesliga Jerman (Borussia

M 4 4 4 4 4



Pelatih: Van den Brom kompetisi Champions League nanti. “Untungnya, Champions League memberikan Milan peluang untuk bangkit lagi. Kami semua ada di satu Kouyate Proto a perahu (manajemen, pelatih, dan pezz Odoi ea 4-3 M main). Kami harus sedikit berbicara pe -3 ep n Biglia us la Deschacht Gi Mi dan banyak bekerja,” ucap Allegri. on i ad “Tapi, kami wajib berkembang St Wasilewski Mbokani Gillet danmelupakanhasil-hasillalu. Kljestan Selasa nanti jadi Pazzini Kanu kesempatan buat kami merapikan kepingan Sutter Emanuelson dan bergerak maEl Shawaary Boateng Antonini ju.” 4-3 Ambrosini Di kubu An-1-2 Acerbi derlecht, pasukan John van den De Jong Brom datang dengan Bonera Abbiati semangat dan optimisme tinggi. Mereka tak mau perjuaAbate ngan berat sejak Kualifikasi III AC MILAN Champions League sia-sia. Anderlecht Pelatih:Massimiliano Allegri menapakfasegrupusaimengempaskan klub Lithuania (kualifikasi III) dan klub Siprus AEL Limassol (playoff). HEAD TO HEAD: Dieumerci Mbokani Bezua jadi pemain yang harus diperhatikan barisan 24/11/93 Anderlecht 0-0 AC Milan belakang Milan. Striker Kongo berusia 30/3/94 AC Milan 0-0 Anderlecht 26 ini telah mengepak 4 gol di 4 partai 17/10/2006 Anderlecht 0-1 AC Milan Anderlecht menuju fase grup. 1/11/2006 AC Milan 4-1 Anderlecht Pada tiga pertandingan terakhir, AC 5 PERTANDINGAN TERAKHIR AC MILAN : Milanselalukemasukan1goldarilawan16 Sep 2012 AC Milan 0-1 Atalanta lawannya seperti Sampdoria, Bologna, 2 Sep 2012 Bologna 1-3 AC Milan dan Atalanta. Kini mereka berada dipo26 Agu 2012 AC Milan 0-1 Sampdoria sisi ke10 di Liga Italia, dan baru me9 Agu 2012 Real Madrid 5-1 AC Milan ngalami1kemenangan,2kalikalah,serta 5 Agu 2012 AC Milan 3-1 Olimpia mengumpulkan tiga 3 poin. Anderlecht sendiri baru meraih 1 5 PERTANDINGAN TERAKHIR ANDERLECHT : kemenangan dari 5 pertandingan ter15 Sep 2012 : Lierse 1-1 Anderlecht akhir. Mereka meraih 1 kemenangan, 2 Sep 2012 : Anderlecht 2-2 GENK tiga kali seri, dan satu kali kalah. Per29 Agu 2012 : Anderlecht 2-0 AEL tandingan terakhir mereka berakhir 25 Agu 2012 : OH Leuven 1-1 Anderlecht dengan skor 1-1 ketika menghadapi 23 Agu 2012 : AEL 2-1 Anderlecht Lierse. Anderlecht memiliki catatan yang berada di posisi ke 2 Liga Belgia dengan buruk ketika menghadapi tim Italia, poin 13 dari 7 pertandingan. Itu setelah mereka belum pernah menang. Anmereka mendapatkan 3 kemenangan, derlecht hanya bisa mencatat lima kali dan 4 kali seri. seri, dan sembilan kali kalah. Anderlecht

Team Chelsea Man United Arsenal Manc City Swansea City

No 1 2 3 4 5

Team München E. Frankfurt Hannover 96 Schalke 04 Dortmund

M 3 3 3 3 3

JERMAN M 3 3 2 2 2

S 0 0 1 1 1

K 0 0 0 0 0

SG 12-2 9-3 9-4 7-3 6-2

Rabu (19/9) Pukul 01.45 WIB TOP SCORER Gol 3 3 2

Nama M Mand•ukic T Müller S Aigner

Klub Bayern München Bayern München Eintracht Frankfurt

Nilai 9 9 7 7 7







SELASA, 18 September 2012 Edisi 250

Hari Ini Nasib Tambang Emas Martabe Dibahas MEDAN- Nasib tambang emas Martabe tampaknya akan menemukan titik terang. Hari ini, Selasa (18/9), kelanjutan tambang tersebut akan dibincangkan Pemprovsu dengan pihak perusahaan tambang emas yang beroperasi di Kecamatan Batangtoru, Kabupaten Tapanuli Selatan (Tapsel), PT Agincourt Resources di Kantor Gubsu Jalan Diponegoro, Medan. Itu dikemukakan Kepala Bidang (Kabid) Pertambangan dan Energi. Dinas Pertambangan dan Energi (Distamben) Sumatera Utara (Sumut), Baca

DEMO TPL, MASSA Dihadang Kawat Berduri SIMALUNGUN- Demo ratusan masyarakat Kecamatan Dolok Pangribuan, Kabupaten Simalungun yang tergabung dalam forum masyarakat tolak Toba Pulp Lestari (TPL) di TPL sektor Aek Nauli, Senin (17/9), disambut kawat berduri dan puluhan satpam.

Pasukan Semut untuk Target Balas Dendam Bulog

Hari Ini ...Hal 6

Calhaj Tertua 95 Tahun

Oleh Dahlan Iskan Menteri BUMN

Termuda 18 Tahun MADINA- Kepala Kantor Kementerian Agama Kabupaten Mandailing Natal Drs H Muksin Batubara MPd mengumumkan jumlah jamaah calon haji asal Madina sebanyak 639 orang. Dari jumlah itu, calon haji tertua berusia 95 tahun bernama Dur Ali Rangkuti dan calon haji termuda Yusriani berusia 18 tahun “Keduanya adalah warga kelurahan Dalan Lidang, Kecamatan Panyabungan. Tahun lalu jamaah tertua kita berusia 88 tahun dan termuda 22 tahun,” sebut Muksin Batubara Baca

Calhaj ...Hal 7

Soal Protes Film Innocence of Muslims

MUI Imbau Masyarakat Jangan Terprovokasi MADINA- Ketua Majelis Ulama Indonesia Mandailing Natal Drs H Syamsir Batubara megimbau seluruh masyarakat khususnya umat Islam di Madina agar tidak melakukan aksi-aksi anarkis atas produksi film Innocence of Muslims yang dianggap melecehkan agama Islam. “MUI megimbau seluruh masyarakat agar jangan mau terprovokasi apalagi melakukan aksi anarkis atas perlakuan sejumlah okum dalam pembuaBaca

MUI ...Hal 6

Tahun IV

Meski pengadaan beras tahun ini sudah mencapai 3,1 juta ton, Dirut Perum Bulog Sutarto Alimoeso masih terus keliling daerah. Hari Minggu kemarin, misalnya, Sutarto masih “liburan” di sawah-sawah di sekitar FOTO:TONGGO SIBARANI

Rado Damanik berorasi di hadapan massa, polisi, dan pihak TPL saat berunjuk rasa menuntut TPL ditutup, Senin (17/9).

REAL Madrid mempopulerkan istilah Los Galacticos, atau The Galaxy pada 2003 ketika David Beckham pindah ke Bernabeu dari Old Trafford. Lalu 2009 mereka mendesain lagi Los Galacticos edisi dua ketika sukses membayar Cristiano Ronaldo dari Old Trafford pula dengan budget Rp1,2 triliun. So, apa konstelasi istilah Los Galacticos dengan partai penyisihan Grup D Liga Champions kontra Manchester City ini? Los Galacticos arti sederhananya adalah galaksi. Ya, Baca

The Real ...Hal 7


Pasukan ...Hal 6

Dedi Bantu Honor Guru Madrasah Nurul Huda SIDIMPUAN- Calon Walikota Padangsidimpuan (Psp) nomor urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP mengunjungi Madrasah Nurul Huda di Jalan Nusa Indah, Kelurahan WEK V, Kecamatan Psp Selatan, Kota Psp, sekaligus bertatap muka dengan seratusan masyarakat Lingkungan 8. Ketua Yayasan Madrasah Nurul Huda Baca

Dedi ...Hal 6


Dedi Jaminsyah Putra foto bersama ibu-ibu di Jalan Nusa Indah usai menyerahkan bantuan honor untuk guru madrasah Nurul Huda Jalan Nusa Indah dan paket buku untuk siswa, Senin (17/9).

Bashaer Othman, Walikota Termuda di Dunia

Saya Mengidolakan Soekarno Cantik, muda, semangat tinggi. Itulah kesan perdana saat mewawancarai mantan walikota termuda di dunia, Bashaer Othman. Di usia 16 tahun, Othman dipercaya memimpin kota kecil di Tepi Barat Palestina, Allar. Aktivitasnya yang menonjol di organisasi kepemudaan membawanya menjadi delegasi untuk duduk di kursi nomor satu pemerintahan Allar.

Banyak prestasi diraih siswi kelas dua sekolah menengah atas ini saat menjabat walikota. Meski cuma dua bulan, Othman mampu mendatangkan investor. Berikut wawancara dengan Bashaer Othman di Hotel Ambhara, Jakarta Selatan, didampingi penerjemah, belum lama ini; Bagaimana proses Anda sampai terpilih sebagai walikota? Pertama, saya mengajukan sebagai ketua dari majelis pemuda di sana. Kemudian setelah terpilih, saya mengajukan diri kepada walikota untuk diberikan kesempatan memimpin kota selama satu minggu. Setelah mereka yakin saya mampu dan puas dengan kinerja saya selama satu minggu, akhirnya oleh walikota, saya diperpanjang menjadi dua bulan. Kenapa demikian? Dia Baca

Saya ...Hal 7






18 September 2012

Jadilah Haji dan Hajjah Mabrur 639 Calhaj Ikuti Manasik dan Zikir Akbar MADINA-Sebanyak 639 jamaah calon haji (calhaj) asal kabupaten Mandailing Natal (Madina), Senin (17/9) mengikuti manasik akbar serta zikir dan doa bersama di Masjid Agung Nur ala Nur desa Parbangunan kecamatan Panyabungan. Zikir dan doa meminta kepada Allah SWT agar calon jamaah haji diberikan kesehatan dan kemudahan dalam melaksanakan segala ibadah haji di tanah suci dan menjadi haji yang mabrur. Hadir dalam kegiatan itu Wakil Bupati Madina, Dahlan Hasan Nasution, Kepala Kantor Kementerian Agama, Drs H Muksin Batubara MPd, mewakili DPRD Madina, Ketua MUI Drs H Syamsir Batubara, Kajari Satimin SH dan sejumlah undangan lainnya Drs H Muksin Batubara menyampaikan, tahun ini jumlah jamaah calhaj dari Madina sebanyak 639 orang dari jumlah 8.270 orang calhaj asal Sumatera Utara. Jumlah ini lebih banyak dibandingkan tahun lalu, yaitu 472 orang. Jumlah calhaj Madina dibagi 2 kelompok terbang (Kloter), yaitu kloter 13 atau kloter terakhir untuk gelombang pertama dan sebagian lagi masuk ke dalam kloter 17 bergabung dengan jamah calon

haji asal Kabupaten Padang Lawas (Palas). ”Untuk kloter 13 akan diberangkatkan tanggal 2 Oktober dari Panyabungan menuju Medan, dan tanggal 4 dari Medan menuju Jeddah. sedangkan kloter 17 yang bergabung dengan jamaah dari Palas, berangkat dari Panyabungan menuju Medan pada tanggal 7 Oktober dan dari Medan ke Jeddah pada tanggal 9 oktober,” kata Muksin Batubara. Dijelaskannya lagi, untuk kloter 13 akan menempati maktab Azijiyah sedangkan kloter 17 menempati maktab jumaiziyah, kemudian pemondokan di Makkah berada sekitar 2,5 kilometer diukur dari sudut Masjidil haram, sedangkan pemondokan di Madinah sekitar 650 meter dari Masjid Nabawi. ”Kita berharap semua jamaah saling membantu dan jangan membiarkan calhaj yang lain dalam kondisi apapun. Semoga jumlah calhaj yang berangkat

sama ketika sudah tiba di tanah air dan menjadi jamaah haji dan hajjah yang mabrur,” ucapnya. Wakil Bupati Madina, Dahlan Hasan Nasution menyampaikan, Pemkab Madina akan memfasilitasi jamaah calon haji dalam hal pemberangkatan dari Panyabungan menuju Asrama haji Medan. Juga dalam perjalanan pulang ke Madina, dengan berbagai fasilitas sehingga kualitas ibadah keagamaan di madina lebih meningkat. Upaya ini terus dilakukan dalam mewujudkan salah satu visi Pemkab Madina, yaitu mewujudkan masyarakat yang lebih religious. ”Kita patut bersyukur kepada Allah SWT, tahun ini diberikan kesempatan menunaikan ibadah ini. Tentunya, belum semua umat Islam diberikan Allah kesempatan untuk melaksanakan ibadah ini,” ucap Dahlan. Dia mengimbau calhaj agar selalu menjaga kesehatan, agar lebih mudah melaksanakan semua rukun dan sunanah haji dan semoga diberikan kekuatan. Kegiatan manasik akbar ini diakhiri dengan zikir dan doa bersama yang diimami oleh H Abdul Kholid, H Zulkarnain Lubis dan sejumlah ulama lainnya. (wan/mer)

CALHAJ-Para jamaah calhaj asal Madina melakukan zikir dan doa bersama Wakil Bupati dan Muspida Plus Madina di Masjid Agung Nur Ala Nur.

PNS harus Berdisiplin Setiap Waktu T E R B A K A R-Salahsatu contoh kebakaran hutan.

Dishutbun: Jangan Bakar Lahan Perkebunan PALAS-Masyarakat diimbau, agar tidak melakukan pembakaran dalam membuka lahan baru di wilayah hutan lindung. Pasalnya, dikhawatirkan akan menimbulkan kebakaran hutan lindung dan kerugian lainnya. Imbauan ini disampaikan, Dinas Kehutanan dan Perkebunan (Dishutbun) Kabupaten Padang Lawas (Palas), Ir Soleman Harahap, Senin (17/9). Katanya, selama ini pola warga yang membuka lahan dengan membakar sering menimbulkan persoalan, baik antara warga sendiri begitu juga dengan kawasan hutan yang berbatasan. “Apalagi saat ini sedang musim kemarau, peluang merebaknya api sangat mudah terjadi, bahkan sudah banyak menimbulkan konflik ditengah-tengah masyarakat itu sendiri,” ucap Kadis,” Ir Soleman Harahap.

Kemudian katanya, kenyamanan hewan liar berupa gajah sangat terganggung dengan sistem membuka lahan perkebunan dengan membakar. Sehingga tidak heran, banyak gajah dan binatang lainnya mendatangi pekampungan warga yang berada di wilayah hutan. “Di wilayah Siali-Ali juga sering gajah muncul, begitu juga di daerah Kecamatan Barumun Tengah. Makanya agar hewan yang dilindungi ini tidak terganggu pola membakar dengan membuka lahan jangan dilakukan, karena jika terjadi kebakaran hutan yang bertanggung jawab tidak ada,” ucap Kadis. Untuk itu, pihaknya berharap agar meninggalkan pola membakar hutan dalam membuka lahan perkebunan. Karena sudah sering menimbulkan konflik ditengah-tengah masyarakat itu sendiri, apalagi cuaca yang tidak menentu saat ini. (amr/mer)

PALAS-Seluruh pegawai negeri sipil (PNS) di Pemkab Padang Lawas (Palas) harus disiplin setiap waktu. Pasalnya, selama ini banyak ditemukan PNS yang bolos di saat jam kerja. Bahkan sistem disiplinnya masih mengacu kepada pimpinan masing-masing PNS. Hal ini disampaikan Pelaksana Tugas (Plt) Bupati Padang Lawas (Palas), H Ali Sutan Harahap (TSO) di sela-sela acara apel hari Kesadaran Nasional, Senin (17/ 9). Dijelaskannya, sebagai abdi negara tetaplah menunjukkan etos kerja yang baik, bukan sebaliknya hanya mau

menerima gaji saja. Ditegaskan Plt Bupati, peringatan Hari Kesadaran Nasional (HKN) yang digelar satu kali sebulan jangan hanya simbol saja, tapi harus direalisasikan dalam kerja setiap harinya. “PNS tidak boleh berpatokan bahwa berdisiplin untuk masuk kerja ada, jika pimpinan yang baru sudah ada, tapi harus berdisiplin setiap waktu. Karena, hal ini „ H Ali Sutan

akan menjadi barometer pelayanan kepada masyarakat,” terangnya. “Marilah dengan ikhlas melayani masyarakat, laksanakanlah apa yang menjadi tanggung jawab kita sebagai abd negara, tunjukkanlah bakti kita kepada bangsa ini,” pesannya. Begitu juga sebut Plt Bupati kepada pimpinan SKPD, agar menjadi contoh yang baik kepada bawahan, jangan

BKD Diminta Seleksi Ijazah Kelas Jauh ULB RANTAU-Badan Kepegawaian Daerah (BKD) di Kabupaten Labura dan Labusel diminta untuk menyeleksi setiap ijazah pegawai negeri sipil (PNS) lulusan kelas jauh Yayasan Universitas Labuhan Batu yang digunakan untuk pengangkatan maupun pembinaan jenjang karir. ”Ijazah yang dikeluarkan kelas jauh ULB itu ilegal. Jadi, para PNS yang kuliah di sana itu tidak sah menggunakan ijazahnya untuk kenaikan pangkat. Makanya kita minta BKD khusus di Labura dan Labusel untuk menyeleksi dan melakukan blacklist jika mendapati ijazah ilegal itu,” Kata Ketua Open Your Eyes Community (OYEC) Labuhanbatu, M Q Rudhy, Minggu (16/9). Selain itu, Rudhy juga meminta kepada BKD di dua kabupaten itu nantinya juga

melakukan blacklist terhadap setiap ijazah lulusan kelas jauh ULB yang digunakan untuk penerimaan CPNS. “Itu juga sesuai imbauan kopertis wilayah I, guna menertibkan perguruan tinggi swasta ilegal dan memberikan sanksi kepada mahasiswa yang kuliah di sana,” tambahnya. Dijelaskan Rudhy lebih lanjut, Koordinator Perguruan Tinggi Swasta (Kopertis) I Sumatera Utara- NAD baru-baru ini melalui Kepala Bagian Kelembagaan dan Kerjasama Kopertis wilayah I, Rahmayati, Rabu (12/9), disela mengikuti acara wisuda 898 Sarjana Strata -1 dan Diploma III angkatan ke -XI YULB tahun 2012 di Lapangan Ika Bina Rantauprapat mengatakan, kelas jauh yang dibuka Yayasan Universitas Labuhanbatu menyalahi izin.

Sesuai aturan, Direktur Jenderal Pendidikan Tinggi sejak tahun 1997 telah melarang penyelenggaraan pendidikan model kelas jauh dan menetapkan ijazah yang dikeluarkan tidak sah dan tidak dapat digunakan terhadap pengangkatan maupun pembinaan jenjang karir/penyetaraan bagi PNS, TNI, dan Polri. Larangan perkuliahan metode kelas jauh karena diduga dapat mengakibatkan terjadinya berbagai pelanggaran terhadap kaidah, norma dan hakekat perguruan tinggi. Ijazah yang diperoleh dari perkuliahan kelas jauh juga tidak dapat digunakan atau tidak memiliki “civil effect” terhadap pengangkatan maupun pembinaan jenjang karir atau penyetaraan bagi pegawai negeri. Sementara Ketua Yayasan Universitas

Siswa & Guru Gunakan Titi Darurat man menuju sekolah walau harus hati-hati dan bergiliran. “Tetapi kalau musim hujan seperti ini, kami khawatir air naik dan menghambat siswa menuju sekolah. Kami mohon perhatian pemerintahlah, agar pendidikan kami tidak terkendala,” katanya berharap. Sementara Kepala SMKN Aek Kanopan Abdul Hamid Sembiring membenarkan keluhan para siswa dan guru terkait jalan menuju sekolah. Dijelaskannya, persoalan dan kendala di SMKN 1 Aek Kanopan bukan hanya jalan menuju sekolah, tetapi termasuk ruangan kelas yang minim. Kapasitas ruang hanya untuk 4 rombongan belajar, tetapi saat ini 700 siswa dibagi dalam 14 rombongan belajar, sehingga diberlakukan kelas siang dan kelas pagi. “Kelas X masuk siang dan kelas XI masuk pagi, sedang untuk kelas XII sedang PKL. Jadi selesai nanti kelas XII PKL, maka menyusul kelas XI yang PKL ,” katanya. Ditambahkannya, saat ini sedang dikerjakan pembangunan ruang kelas baru sebanyak 4 ruangan yang dijadwal selesai akhir Desember 2012. (ST)

Labuhanbatu, DR Amarullah Nasution, SE MBA, mengakui adanya perkuliahan di luar kabupaten Labuhanbatu. Namun, menurutnya hal itu tidak bermasalah dan sudah mendapatkan izin karena sudah berdiri sejak Kabupaten Labuhanbatu belum dimekarkan menjadi tiga kabupaten. “Memang ada di Labura dan Labusel. Tapi itu bukan kelas jauh. Itu sudah berdiri lama dan sudah ada izinnya karena termasuk dalam kabupaten Labuhanbatu Raya,” jelas Amarullah. Dijelaskan Amarullah, ULB sudah mendapatkan akreditas yang sesuai hingga tidak bermasalah memiliki kampus, serta fasilitas kampus di luar kampus induk sudah sesuai dengan yang dimiliki oleh kampus induk yang berada di Rantauprapat. (niko)

Penyaluran Dana Hibah Dipertanyakan

SKMN Aek Kanopan Terisolir LABURA- Setelah beroperasi dan menerima siswa baru pada tahun 2009, fasilitas di Sekolah Menengah Kejuruaan Negeri 1 (SMKN) Aek Kanopan terutama fasilitas jalan masuk, belum memadai. Bahkan jika hujan dan banjir datang, sekitar 700 siswa dan guru harus rela melewati genangan air dan lumpur dengan cara membuka sepatu dan alas kaki lainnya. Kepada METRO, Sabtu (15/9), Murini, siswa kelas XI SMKN 1 Aek Kanopan menjelaskan, untuk melewati 100 meter jalan menuju sekolah yang menjadi langganan banjir, pihak sekolah membangun jembatan darurat berupa papan agar dapat dilewati siswa dan guru. “Jalan menuju sekolah itu, rawa-rawa dan berlumpur. Sampai tahun 2011, kami harus membuka sepatu kalau mau ke sekolah, selanjutnya di sekolah dipakai kembali. Kalau tak begitu, sepatu akan kotor,” katanya, mengingat kenangan sebelum jembatan darurat dibangun. Dijelaskannya, genangan air yang disepanjang jalan mencapai selutut dewasa. Sementara setelah jembatan darurat dibangun, siswa telah lebih nya-

kalau dirinya tidak ada di Palas lantas kinerjanya merosot. “Jangan hanya seremoni saja kita lakukan hari kesadaran ini, tapi tetaplah menjadi motivasi agar tingkat disiplin PNS semakin baik,” ucapnya. Sekedar untuk diketahui, disiplin PNS di Pemkab Palas selama ini masih berpatokan pada tingkat kehadiran pimpinan. Jika pimpinan masuk kerja maka tingkat disiplin akan baik, tapi ada juga yang sebaliknya, kedisiplinan jika ada pimpinan masuk kerja. (amr/ mer)


B A N T U A N-Pasiter 0206 Labuhan Batu Kapten Sulaiman didampingi Danramil 08 Rantau Prapat Kapten Hotman mewakili Dandim Letkol Inf Dwi Bagus Nugraha menyerahkan bantuan sembako kepada para korban kebakaran di Gang Sahabat, Jumat (14/9).

Dandim 0206 Bantu Korban Kebakaran RANTAU-Bantuan kepada korban kebakaran di Jalan Dewi Sartika Gang Sahabat, Jumat (14/9) lalu terus berdatangan. Komandan Kodim 0206 Labuhan Batu Letkol Inf Dwi Bagus Nugraha juga menyerahkan bantuan berupa sembako kepada korban kebakaran. “Kami menyampaikan amanah dari Pak Dandim untuk menyerahkan sembako kepada para korban kebakaran, sebab beliau masih tugas di luar kota,” kata Perwira Seksi Teritorial (Pasiter) Kodim 0206 Kapten Sulaiman kepada METRO di lokasi kebakaran mengatakan, bantuan sembako merupakan wujud kepedulian dari Dandim 0206 kepada masyarakat yang ada di

wilayah kerjanya. “Komandan (Dandim 0206 Labuhan Batu), berpesan agar keluarga yang tertimpa musibah kebakaran dapat bersabar dan tabah dalam menghadapi cobaan tersebut. Pak Dandim turut bersedih dan prihatin atas musibah ini,” kata Sulaiman. Sementara Danramil 08 Rantau Prapat Kapten Hotman yang turut mendampingi penyerahan bantuan itu menambahkan, sebelumnya ia melaporkan kepada Dandim 0206 Labuhan Batu adanya kejadian bencana kebakaran yang terjadi di Jalan Dewi Sartika Gang Sahabat. “Dandim langsung menanyakan kondisi para korban, dan setelah saya

menjelaskan bahwa dalam kejadian itu tidak ada korban jiwa, namun hanya kerugian material. Dandim langsung memerintahkan untuk melihat kondisi para korban sekaligus untuk memberikan semangat serta memberikan bantuan kepada para warga yang tertimpa musibah,” terang Kapten Hotman. Said, Ulong dan Mila, mewakili korban kebakaran mengucapkan terimakasih kepada Dandim 0206 Labuhan Batu atas bantuan yang diserahkan. “Kami berterimakasih, kepedulian dan bantuan ini diharapkan menjadi amal baik kepada pak Dandim 0206 ,” kata mereka. (riz)

RANTAU PRAPAT- Penyaluran dana hibah APBD Pemkab Labuhanbatu tahun 2011 sebesar Rp12 miliar dipertanyakan, sesuai laporan telah direalisasikan sebesar 98 persen dan total dana. Aktivis Barisan Pemuda Labuhanbatu Bersih (BPLB) Rendi Harahap kepada METRO, Minggu (16/9) mengatakan, pihaknya menduga penyaluran dana hibah dan bantuan sosial sebesar Rp1,6 miliar sarat korupsi. “Sesuai laporan Badan Pemeriksaan Keuangan (BPK)Sumutyangmelakukanauditkeuangan,ditemukan banyak kejanggalan,” kata Rendi Harahap. Dijelaskannya, bantuan sosial sebesar Rp1,6 miliar tidak sesuai peruntukkannya dan sebagian tidak dapat dipertanggungjawabkan. Bantuan hibah untukHUTPemkabLabuhanbatuRp150juta,bantuan kepada panitia pemberangkatan dan pemulangan haji Rp350 juta, bantuan sosial kepada kepanitiaan hari besar keagamaan Rp94 juta lebih, pengadaan wayang kulit Rp75 juta, bantuan kepada panitia HUT RI Rp158 juta, panitia hari Sumpah Pemuda dan lomba karoke Rp19 juta lebih dinilai tidak sesuai peruntukannya, termasuk hibah kepada instansi vertikal kepada KPUD Labuhanbatu Rp150 juta, kepada pangkalan TNI Angakatan Laut Rp383juta,kepadaPolresLabuhanbatuRp100juta, bantuan rehab kantor Kodim Rp120 juta, kepada badan narkotika Labuhanbatu Rp60 juta. “BPK Sumut menilai bahwa pemberian bantuan hibah dan bantuan sosial tersebut telah melanggar peraturan yang ada khususnya peraturan terkait pemberian bantuan sosial yang seharusnya pemberian bantuan tersebut untuk kepentingan kesejahteraan masyarakat,” kata Rendi. Ditambahkan Rendi, yang paling membingungkan sebagian bantuan hibah kepada instansi vertikal tidak disertai tanda bukti penggunaan serta belum dilaporkan kepada Menteri Dalam Negeri. “Indikasi kerugian negara sangat besar, sehingga kita berinsiatif langsung menyampaikan hasil temuan BPK Sumut kepada Komisi Pemberantasan Korupsi (KPK) di Jakarta. Kita berharap KPK dapat mengungkab dan mengusut dugaan praktik korupsi di Pemkab Labuhanbatu,” tambah Rendi. (riz)



18 September 2012


DEWI: EMANGNYA INI MILIK NEGARA PANCURBATU- Emosi Dewi (32), penghuni barak Hendri di Bandar Baru tiba-tiba memuncak ke salahseorang hidung belang. Pasalnya, usai indehoi di Bungalau Gemilang, Alim Kwok (33) Warga Jalan Belawan, Kelurahan Titi Papan, Kecamatan Medan Labuhan, tak mau membayar jasa seksnya. Akibatnya, Alim pun digiring ke Mapolsek Pancurbatu, Senin (17/ 9), sekira pukul 07.00 WIB. InformasidihimpundiMapolsek Pancurbatumenyebutkan,malam itu Alim datang ke Bandar Baru denganmencarterTaxiExspressBK 1547 HA yang dikemudikan Amir HamzahLubis(23),wargaDesaPatumbak, Kecamatan Patumbak. Setibanyadisana,merekapunmemesan Bungalaw Gemilang yang ada di kawasan prostitusi tersebut. Selanjutnya,Alimpunmemesan cewekkesalahseorangromboy.Tak berselang lama, Dewi yang merupakan warga Purwokerto Jawa Timur datang ke kamar yang ditempati keduanya. Begitu tiba di ruangan yang berisi dua tempat tidur tersebut, Alim dan Dewi pun negosiasi harga, dan mereka pun sepakat hingga siang hari Alim membayar sebesar Rp800 ribu. Karena telah mencapai kesepakatan, kedua insan berlainan jenis inilangsungnaikbulan.Malamitu, Alim meniduri Dewi hingga dua kali. Setelah bercinta, Dewi pun meminta bayaran sesuai dengan yang telah disepakati tadi kepada Alim.Namunbukanjawabanyang didapat Dewi, melainkan sang hidung belang langsung bolakbalik masuk kamar mandi. Melihat itu, Dewi pun mengamuk sejadinya dan membuat Amir yang berada persis di kamar sebelah keluar, dan menanyakan permasalahannya. Ketika dijelaskan Dewi kalau Alim tak membayar uang jasa ngeseknya, Amir pun terkejut bukan main, karena sesaat sebelum pergi Alim mengaku sebagai pengusaha dan hendak menemui temannya di Bandar Baru. Pantauan di Mapolsek Pancurbatu terlihat kalau Dewi terus merepetiAlimdengankata-katakasar. “Dasar kau modal kon***mu aja, udah ngotori punyaku kau. Dua kali ‘nembak’, malah tidak bayar pula. Kau pikir ini milik Negara. Bolak-balik kamar mandi kau saat itu, mau larinya kau itu kan? Alasanmu mau ke kamar mandi, padahal kau mau lari, yang benar ajalahkau.Yangbayarkamarmuaja

jugasopirtaksimuitu.Manusiaapa kau ini,” omel Dewi penuh emosi. Amir Hamzah saat diwawancarai mengatakan, saat itu Alim meminta dirinya untuk mengantarkan ke Bandar Baru. “Dia minta antarkan ke Bandar Baru dengan janji akan membayar Rp500 ribu pulang-pergi (PP). Karena yakin, aku pun mengantarkannya sampai tujuan dan aku pun menunggunya hingga pulang,” ujar Amir. Dikatakannya lagi, katanya jam 05.00WIB,merekaharuspulangke Medan, karena dia mau ke Bandara. Sebab pukul 07.00 WIB, dia sudahharusberangkatuntukurusan bisnis ke Jakarta. “Karena pengakuanya itu, aku pun jadi yakin dan aku tunggulah dia. Terus, pagi itu aku tiba-tiba dibangunkannya. Dia minta uangku Rp165 ribu, katanya mau dibayar di Bandara, karena di Bandar Baru tidak ada ATM. Aku kasilah, eh malah tak lama, aku dengar suara gaduh dan ternyata dia gaduh sama cewek yang adadikamarnyaitu,”ungkapAmir, yang mengaku kalau istrinya lagi mengandung anak pertama mereka. Diceritakan Amir lagi, sekarang ia tidak bisa bilang apa-apa lagi, sebab dia sudah membayarkan uang kamar kepada pihak penginapan dari uangnya sendiri itu. Malam itu, ia sama sekali tidak ada membooking cewek. “Aku hanya tidur aja, itu pun karena di kamar itu ada dua ruangannya, kalau tidak aku mau tidur di taksiku saja,” ujar Hamzah sambil membuat pengaduan di Mapolsek Pancurbatu. Dewi sendiri mengaku tidak senang dengan ulah Alim tersebut. “Dia itu tidak punya otak, udah ditidurinya aku dua kali, eh malah mau lari dan tak mau bayar. Kurasa dia mau lari dari jendela kamar mandi, tapi karena tak ada jendela di kamar mandi itu, dia pun tak jadi lari,” ujar Dewi.(roy/pmg/dro)


„ Edi Simarmata terbujur kaku di kamar jenajah akibat kecelakaan lalu lintas. Salahseorang saudarinya terlihat menangisi jasadnya, Senin (17/9).


SIANTAR- Edi Simarmata (48), warga Sirpang Sigodang, Kecamatan Panei, tewas ditabrak Kijang Innova BK 1968 T di jalan umum Siantar-Saribudolok, Nagori Marjandi Embong, Panombeian Panei, Senin (17/9), sekira pukul 09.30 WIB. Pria yang sehari-hari menganyam keranjang (pengrajin keranjang dan biasa disebut parkaranjang, red) tewas di tempat dan batal sarapan pagi ke Marjandi Embong. Informasi dihimpun, korban melaju dengan kecepatan sedang dari arah Raya menuju Siantar mengendarai Honda GLPro BK 6083 TR. Korban berangkat dari rumahnya di Sirpang Sigodang dan berniat sarapan pagi di salahsatu warung di Nagori Marjandi Embong. Tiba di lokasi kejadian pada posisi jalan menurun, korban hendak berbelok ke kanan. Namun tiba-tiba Kijang Innova hitam BK 1968 T yang dikemudikan Maringan Butarbutar (49) langsung menabrak korban dari belakang hingga korban terpental dan kepalanya membentur ke jalan. Sesudah menabrak, Maringan langsung tancap gas disebabkan takut dimassa warga. Tak lama kemudian, Maringan menyerahkan

diri ke kantor polisi di Panei Tongah. Maringan merupakan warga Jalan Kabanjahe, Saribu Dolok, Kecamatan Silimakuta. Penuturan Lae (adik ipar) korban di RSU Djasamen Saragih, B Manurung (43), korban tinggal bersama istrinya di Sirpang Sigodang. Selama 20 tahun perkawinan mereka, hingga korban meninggal belum dikarunia anak. Keduanya juga tidak ada mengangkat anak sebagai penerus keturunan korban. Korban bekerja sebagai penganyam bambu yang dijual sebagai tempat sayuran dan buah-buahan kepada pedagang pengecer dari berbagai lokasi yang datang ke Sirpang Sigodang. Keluarga korban yang tinggal di kampung hanya satu orang, yaitu adik perempuan korban atau istrinya. Sedangkan saudara laki-laki korban yang lain merantau ke Kalimantan dan Pekanbaru. “Mau sarapan laeku ini tadi ke bawah, di Embong itu ada tempat sarapan yang selalu ramai dikunjungi warga. Baru dari rumah dia, itulah ditabrak dari belakang. Besok mau dikebumikan. Cuma masih kami tunggu saudaranya yang lain,” jelas lae korban ini. Amatan METRO di Ruang Instalasi Jenazah RSU Djasamen

Saragih, korban mengalami luka dan patah rusuk kanan. Lalu ada luka gugus di kaki kanan bawah korban. Salahseorang rekan korban bermarga Saragih kepada METRO menuturkan, pagi harinya korban masih melayat warga sekampungnya yang meninggal dunia. Kepada rekannya, korban sempat mengatakan dirinya ingin berangkat ke bengkel di Embong untuk memperbaiki jari-jari lingkar sepedamotornya. “Tadi di tempat orang meninggal itu dia (korban) bilang mau ke Embong perbaiki kretanya,” kata Saragih. Ditambahkannya selama ini korban bekerja sebagai pengrajin keranjang jeruk. Bahkan akhir-akhir ini usaha korban semakin lancar dan korban sudah memiliki anggota pengrajin keranjang untuk membantunya. Kanit Laka Lantas Ipda Alsem Sinaga ketika dikonfirmasi membenarkan kejadian tersebut. Kapolsek Panei Tongah AKP M Manik menambahkan meninggal di tempat. Sementara tersangka menyerahkan diri ke kantor polisi usai kejadian. Penyebab kecelakaan disebabkan pengemudi mobil Kijang Innova tidak hati-hati saat berkendara. (ral/hot/dro)


Rupanya, Warga Merekraya

SIANTAR– Identitas pria yang ditemukan meregang nyawa di patung rumah adat Jalan Pematang, Kelurahan Pematang, Siantar Selatan, itu akhirnya terungkap, Minggu (16/9) pukul 17.00 WIB. Adalah Pasu Saragih Sumbayak (52), warga Huta Limak, Nagori Merekraya, Kecamatan Raya. Terungkapnya identitas korban itu setelah pihak keluarga Pasu di Kecamatan Raya membaca di media cetak tentang penemuan sesosok pria yang tidak bernyawa. Dengan memerhatikan fotonya, pihak keluarganya pun datang ke Ruang Forensik RS Umum Djasamen Saragih untuk memastikannya. Setelah memerhatikan, Barisman Saragih (57) memastikan bahwa pria tersebut merupakan adik kandungnya. Menurut keterangan Barisman, Pasu memiliki sakit keterbelakangan mental sejak usia muda. Akan tetapi Pasu sempat menikah dan sudah memiliki dua anak. Namun karena hubungan keluarga mereka tidak harmonis, Pasu dengan istrinya Paina Sinaga berpisah dan kedua anak mereka pun dibawa Paina ke daerah Bagan Batu. Sejak itu, kehidupan Pasu pun tidak menentu. Sementara kedua orangtuanya pun sudah lama meninggal, sehingga ia tinggal bersama abangnya yakniBarisman.“Diainianakketigadankamisemua enam bersaudara. Sejak kecil pun dia sudah ada sedikit gangguan mentalnya. Jadi selama ini, kehidupan Pasu pun tidak menentu kadang pergi ke Siantar beberapa lama dan pulang kembali ke kampung,” ujar Barisman, yang ditemani oleh Jatam Purba Pangulu Nagori Merekraya. Walau demikian, Pasu tidaklah suka mengganggu orang. Hanya saja dia lebih suka menyendiri dan jalan-jalan, sehingga kalau malam Pasu lebih sering tidur di lokasi patung tersebut. Menurut Barisman, penyebab kematian Pasu adalah karena memiliki sakit keterbelakangan mental, bukanlah karena narkoba atau lainnya akan tetapi karena terbawa sejak lahir. Akan tetapi setelah menikah penyakit Pasu semakin parah. Sementara itu, setelah dilakukan visum luar, pihak petugas Forensik tidak ada menemukan tanda-tanda adanya tindakan kekerasan sehingga pihak keluarga pun sepakat untuk tidak dilakukan outopsi terhadap korban. Pasu tersebut meninggal bukan karena ada tindakan pidana kekerasan. Surat pernyataan tersebut pun disampaikan kepada Polsek Siantar Selatan. Kapolsek Siantar Selatan AKP G Damanik menerangkan bahwa pihak keluarga tidak menuntut dan pihak keluarga Pasu telah membuat surat pernyataan. Menurut Barisman, rencananya Pasu akan dikebumikan hari ini Selasa (18/9) di Dusun Limak, Nagori Merek Raya. (pra/dro)


„ Sesosok mayat laki-laki itu rupanya Pasu Saragih.

YAYASAN SEPA HUSADA : Menerima tenaga kerja khusus wanita, baik gadis/janda, dengan usia 17 s/d 45 tahun, untuk dilatih & dipekerjakan sebagai perawat jompo/orang tua sakit, baby sitter. Syarat: Ijasah asli, KTP/Kartu Keluarga, gaji berkisar Rp. 1.000.000 s/d 1.700.000/bulan. Lamaran diantar langsung ke Jl. Pasar 3 no. 45 A Krakatau Medan. PELUANG0811 USAHA MINUM Hubungi: 602AIR 145; 0852 Pemasangan 6114 3441 Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota RIZKI PONSEL Jalan Merdeka, Kota Padangsidimpuan. Menerima HP bekas dengan harga tinggi. Blackberry, Nokia, Samsung, Sony Erikson, dll. Dengan syarat lengkap dan baik. Hubungi IRWANTO: Hp 0813 6215 1119


18 September 2012

Diumumkan Serentak 19 September HASIL UJIAN CPNS


Pengaruhi Ekonomi Jepang TOKYO- Perusahaan elektronik Jepang, Panasonics terpaksa menghentikan sementara operasinya di China setelah para pengunjuk rasa anti-Jepang menyerang dua pabriknya di Qingdao, Senin (17/9). Serangan itu adalah bagian dari aksi protes anti Jepang yang terjadi di seluruh China. Aksi ini juga mempengaruhi operasional perusahaan Jepang lainnya, antara lain Toyota. Terdapat sejumlah laporan yang mengatakan sejumlah dealer Toyota di China juga dirusak massa pengunjuk rasa. Tak hanya Toyota dan Panasonics yang terimbas aksi anti-Jepang ini, Bloomberg melaporkan Canon juga menghentikan operasi pabriknya di China untuk sementara waktu. Sementara itu sejumlah media massa China dalam tajuk-tajuknya mengatakan ekonomi Jepang bisa menderita hingga 20 tahun jika Beijing memutuskan untuk menerapkan sanksi ekonomi terhadap Jepang. Sebuah tajuk harian People’s Daily menyebut perekonomian Jepang sebenarnya sudah kehilangan dua dekade sejak 1990-an. Dan ekonomi Jepang semakin jatuh usai krisis finansial dunia dan bencana gempa dahsyat 2011 lalu. Meski demikian, tajuk harian ini mengakui penerapan sanksi ekonomi China terhadap Jepang bisa menjadi pedang bermata dua untuk China. Sebab perekonomian kedua negara itu saling terkait. (kmc/int)

Taliban Serang Markas NATO KABUL- Para gerilyawan Afganistan yang melakukan serangan terencana dan berani ke Camp Bastion, pangkalan militer di mana Pangeran Harry dari Inggris ditempatkan, mengenakan seragam Angkatan Darat AS, kata NATO sehari setelah serangan itu. Gerilyawan Afganistan sangat langka menggunakan seragam militer AS dalam serangan mereka. Menurut data CNN, terakhir hal itu dilakukan lebih dari dua tahun lalu, ketika NATO membalas serangan terhadap dua pangkalan di Provinsi Khost pada Agustus 2010. Tidak ada tentara koalisi yang tewas dalam serangan itu, kata Pasukan Keamanan Bantuan Internasional (ISAF NATO) ketika itu. Setidaknya dua marinir AS tewas dalam serangan yang tergolong sangat berani pada Jumat (14/9) malam lalu itu, dan enam jet tempur hancur, kata ISAF ketika merilis rincian lebih lanjut tentang serangan tersebut. Para petempur yang terlatih, melakukan dengan baik serangan di Provinsi Helmand, kata ISAF. Sekitar 15 gerilyawan dibagi dalam tiga tim menerobos pagar markas itu dan melakukan kerusakan, menghancurkan enam stasiun pengisian bahan bakar dan merusak hanggar enam pesawat. Para penyerang menenteng senapan otomatis, roket peluncur granat dan memakai rompi bunuh diri. Mereka menghancurkan enam jet AV-8B Harrier dan merusak dua lainnya sebelum serangan itu berakhir, kata pihak koalisi. (kmc/int)

17 Jenazah DIMUTILASI Ditemukan di Meksiko JALISCO- Sebanyak 17 jenazah yang termutilasi ditemukan di wilayah tengah Meksiko, area yang selama ini diperebutkan kartel-kartel narkoba. Jaksa negara bagian Jalisco Thomas Coronado Olmos mengatakan jenazahjenazah itu dibuang di sebuah jalan raya di Kota Tizapan el Alto dekat perbatasan antara negara bagian Jalisco dan Michoagan. Coronado Olmos tidak mengungkapkan identitas ke-17 korban pembunuhan itu namun mengatakan seluruhnya dalam keadaan telanjang, termutilasi, dan diikat menggunakan rantai. Sebanyak 47 ribu orang telah tewas dalam kekerasan terkait narkoba di Meksiko sejak Desember 2006 ketika Presiden Felipe Calderon meluncurkan kampanye perang melawan kartel narkoba. (dtc/int)

JAKARTA- Panitia Nasional Tes Kompetensi Dasar Calon Pegawai Negeri Sipil (CPNS) akan mengumumkan hasil ujian tulis pada 19 September 2012 mendatang. Hasil penerimaan ujian CPNS itu akan diumumkan serentak melaui website Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (PAN dan RB).

„ Ribuan peserta ujian CPNS di Jakarta tampak serius mengisi lembar jawaban.

Menkeu Setuju Koruptor Dihukum Mati JAKARTA- Menteri Keuangan Agus bayar pajak,” ungkap Agus di Jakarta, Martowardojo setuju jika Senin (17/9). undang-undang (UU) Di pemerintah, Agus yang mengatur hukuman mengaku masih banyak mati bagi koruptor. Denkoruptor yang berkeliaran gan demikian, masyarakat termasuk di kementeriantidak perlu sampai berhennya. Pemerintah sendiri ti membayar pajak. terus bergerak untuk mem”Harus kita yakinkan berantas korupsi di setiap pengadilan nanti memkementerian dan lembaga. berikan hukuman mati ke”Sekarang begitu banyak pada koruptor. Kalau dayang ditindak, tidak hanya pat persetujuan UU memdi pemerintah pusat, di beri hukuman mati, ya kita „ Agus Martowardojo pemda (pemerintah daerhukum mati tapi jangan ah) berapa banyak yang kemudian kita mengatakan berhenti harus terkena masalah hukum terkait

korupsi, bekas menteri segala macam banyak yang kena, dan pengusaha besar yang tidak tersentuh juga kena,” tambahnya. Untuk itu, Agus meminta masyarakat tetap membayar pajak untuk pembangunan negara. Apalagi pemerintah berkomitmen untuk menjalankan transparansi dan akuntabilitas. ”Sudah banyak para pejabat terkena kasus hukum akibat dari adanya transparansi. Kalau transparansi masyarakat jadi tahu jika ada penyimpangan, tolong direspon dengan mendukung agar kita semakin baik,” ujarnya. (dtc/int)

Miranda Nilai Tuntutan Jaksa Tak Sesuai Fakta

„ Miranda membacakan pledoi dalam persidangan. JAKARTA- Pihak terdakwa akan membacakan yang isinya mengupas surat Komisi Pemberantasan Korupsi (KPK). Pledoi tersebut dibacakan dalam persidangan di Pengadilan Tindak Pidana Korupsi Jakarta, Senin (17/9). Salah seorang pengacara Miranda, Andi S Simangunsong mengatakan, tuntutan jaksa tidak berdasarkan fakta persidangan. ”Intinya begini, kita akan mengupas tuntutan yang diajukan penuntut umum tidak berdasarkan fakta-fakta persidangan,” kata Andi, saat dihubungi pagi ini. Ia mengungkapkan, bagi mereka yang mengikuti persidangan Miranda pasti mengetahui fakta persidangan bahwa pertemuan di rumah Nunun Nurbaeti yang dijadikan pertimbangan jaksa dalam menyusun tuntutan, tidak pernah ada. Lebih dari tiga orang saksi, kata Andi, mengatakan bahwa pertemuan di rumah Nunun sebelum uji kelayakan dan kepatutan calon Deputi Gubernur Senior Bank Indonesia tersebut tidak pernah terjadi. ”Ada juga saksi lain yang mengatakan

bahwa pertemuan itu tidak pernah ada. Penuntut umum memaksakan dirinya dengan mengatakan pertemuan itu ada,” kata Andi. Selain itu, lanjutnya, pledoi Miranda juga akan membantah soal ucapan “Ini bukan proyek thank you” yang dijadikan penuntut umum sebagai salah satu dasar menyusun tuntutan. Menurut Andi, tidak pernah ada saksi selain Nunun Nurbaeti yang mengungkapkan soal pernyataan tersebut. ”Saksi-saksi menyatakan tidak ada pertemuan di rumah Nunun, apalagi kata-kata itu. Karena ini kan katanya diucapkan di rumah Nunun. Tapi kan tidak pernah ada pertemuan di rumah Nunun tersebut,” ujarnya. Dalam surat tuntutan yang dibacakan di persidangan sebelumnya, tim jaksa KPK mengatakan bahwa benar ada pertemuan di rumah Nunun yang diikuti Miranda dengan , yakni Endin Soefihara, Hamka Yandhu, dan Paskah Suzetta. Pertemuan tersebut, menurut jaksa, menjadi awal rangkaian peristiwa Miranda dan Nunun bekerjasama

dalam memuluskan langkah Miranda sebagai Deputi Gubernur Senior Bank Indonesia 2004. Seusai pertemuan yang difasilitasi Nunun itu, menurut jaksa, Nunun mendengar ada yang mengatakan “Ini bukan ya.” Andi juga mengatakan, dalam pledoinya, pihak Miranda akan kembali menegaskan bahwa pertemuan Miranda dengan anggota Komisi IX DPR fraksi PDIPerjuangan dan fraksi TNI/Polri bukanlah suatu hal yang menyalahi ketentuan. ”Itu wajar-wajar saja, tapi penuntut umum ngotot,” tambah Andi. Dalam tuntutannya, penjara ditambah denda Rp 150 juta kepada Miranda. Tim jaksa penuntut umum Komisi Pemberantasan Korupsi meyakini Miranda terbukti melakukan tindak pidana korupsi dengan bersama-sama menyuap anggota Dewan Perwakilan Rakyat 1999-2004 untuk memuluskan langkahnya menjadi Deputi Gubernur Senior Bank Indonesia 2004. Menurut jaksa, berdasarkan fakta persidangan selama ini, dapat disimpulkan bahwa Miranda terbukti melanggar Pasal 5 Ayat 1 Huruf b Undang-Undang Pemberantasan Tindak Pidana Korupsi juncto Pasal 55 Ayat 1 Ke 1 KUHP sebagaimana dalam dakwaan pertama. Fakta persidangan selama ini, menurut jaksa, menunjukkan adanya rangkaian fakta hukum yang membuktikan perbuatan Miranda memberikan sesuatu, yakni cek perjalanan kepada anggota DPR 1999-2004 melalui Nunun Nurbaeti. Sementara Miranda menilai tuntutan jaksa dipaksakan dan banyak yang tidak benar. Miranda sempat tertawa saat tim jaksa KPK membacakan surat tuntutan dalam persidangan sebelumnya. (kmc/int)

114 WNI Ditangkap Polisi Kamboja TERLIBAT PRAKTIK JUDI ONLINE JAKARTA- Sebanyak 114 WNI ditangkap polisi Kamboja. Mereka terbukti terlibat dalam perbuatan pidana di Negeri 1.000 Pagoda itu. 114 WNI tersebut terlibat praktik judi online. ”25 WNI telah dipulangkan ke Indonesia hari Jumat 14 September 2012, dan 80 WNI dipulangkan hari ini 15 September 2012. Sisanya 9 WNI belum dipulangkan guna pemeriksaan,” kata Direktur Perlindungan WNI, Tatang Razak, saat berbincang, Senin (17/9). Tatang menjelaskan para WNI tersebut hanya direkrut dan bukan sebagai

pelaku utama. Sepertinya mereka pun sudah ada yang mengatur segalanya, termasuk tiket kepulangan mereka. ”Mereka terdiri dari 90 laki-laki dan 24 wanita yang berasal dari berbagai daerah seperti Jakarta, Medan, Batam, dan sebagainya yang direkrut secara rahasia,” jelas Tatang. Polisi Kamboja menangkap mereka di sebuah rumah pada 10 September lalu. Dari tangan mereka ditemukan 72 paspor, di mana selebihnya diperkirakan masih ada di rumah yang dikontrak atau dipegang oleh manajer mereka

yang juga WNI. ”Mereka didakwa melanggar hukum Kamboja yang melarang judi online ilegal, walaupun terdapat kasino secara resmi. Apabila terbukti, mereka bisa dijatuhi hukuman penjara tergantung keterlibatan dengan maksimal 3-4 tahun penjara,” urainya. KBRI telah menemui mereka di tahanan Imigrasi. Mereka diperlakukan dengan baik. “KBRI akan menemui mereka lagi hari ini untuk pendampingan dan membantu mencarikan pengacara apabila dibutuhkan,” tutur Tatang. (dtc/int)

”Kita akan umumkan namanama yang lolos Rabu (19/9) sore, yang memenuhi ambang batas kelulusan dipilih dan dibuat ranking. Akan kita pos di website kita,” kata Menteri Menteri PAN dan RB, Azwar Abubabakar, dalam jumpa pers di kantornya, Jl Sudirman, Bundaran Senayan, Jakarta Pusat, Senin (17/9). Azwar mengatakan pada Rabu (19/9) pagi kementerian-kementerian akan diundang untuk diberi tahu hasil ujuan CPNS yang sudah dilaksanakan. Soal ujian CPNS itu dibuat oleh konsorsium. Kemudian sampai di daerah soal-soal ini dicetak oleh perusahaan yang menang tender. Pencetakan ujian ini tetap diawasi polisi dan LSM. ”Selesai ujian lembar jawaban dikumpulkan ke BPPT nanti ada alat untuk scaning, diawasi oleh 10 PTN yang tergabung dalam konsorsium, terus di proses semuanya dengan komputer,” sambungnya. Azwar menjamin hasil pemeriksaan ujian CPNS ini sangat akurat. “Ini pakai komputer, bukan pakai orang lagi,” imbuhnya. Azwar mengatakan untuk tahun ini ada 15.800 posisi yang tersedia. Menurutnya posisi ini tergolong kecil karena tahun ini masih ada moratorium PNS. Sebelumnya Deputi SDM Aparatur Kementerian PAN-RB, Ramli E Naibaho, mengatakan hasil ujian CPNS akan diumumkan pada 17 September 2012. Tetapi ternyata tanggal 17 September adalah hari diselesaikannya koreksi jawaban tes. ”Ini selesai dikoreksinya 17 September dan diumumkan tanggal 19 September, jadi tidak ada yang mundur,” kata Deputi SDM Aparatur Kementerian PAN-RB, Ramli E Naibaho, saat

mendampingi Menteri Azwar Abubabakar dalam jumpa pers tersebut. Pemerintah Evaluasi Seleksi CPNS Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (Kemenpan dan Rebiro) akan mengevaluasi proses seleksi penerimaan calon pegawai negeri sipil (CPNS) 2012. ”Penerimaan CPNS pada tahun ini berbeda dengan tahun sebelumnya. Meskipun demikian, kami akan melakukan evaluasi terhadap pelaksanaannya,” ujar Menpan dan Rebiro Azwar Abubakar di Jakarta, Senin (17/9). Seleksi CPNS yang dilangsungkan pada 8 September berbeda dengan penerimaan sebelumnya. Jika pada proses sebelumnya, tanggung jawab pembuatan soal diserahkan pada daerah, pada tahun ini melibatkan perguruan tinggi. Kemudian, pelaksanaannya juga dilangsungkan serentak di seluruh Indonesia. Kemenpan juga menggandeng sejumlah pihak dalam seleksi CPNS itu seperti perguruan tinggi, polisi, dan lembaga swadaya masyarakat. “Pengumumannya dilakukan transparan, diperlihatkan berapa nilainya. Jadi mereka tahu nilai mereka sebenarnya,” kata Azwar. Begitu juga bagi kementerian ataupun pemerintah daerah yang mengajukan penerimaan CPNS, terlebih dahulu melakukan analisa jabatan. Sehingga nantinya, PNS yang baru itu jelas akan ditempatkan di posisi apa. “Pemda yang belanja pegawainya lebih 20% dari APBD tidak boleh lagi mengajukan,” tambah Azwar. (dtc/int)

„ Wakil Ketua KPK hadir di pembahasan persiapan penyidik independen.

KPK Siapkan Penyidik Independen JAKARTA- KPK masih akan tetap memperjuangkan 20 penyidiknya yang mendadak ditarik Mabes Polri. Namun, Lembaga antikorupsi ini juga sudah siap dengan opsi penyidik independen. Jubir KPK Johan Budi mengatakan pihaknya tengah menempuh opsi utama, yakni melakukan koordinasi lanjutan dengan Kapolri agar 20 penyidik tidak ditarik dalam waktu dekat ini. ”Karena load di KPK ini sedang tinggi,” kata Johan di kantornya, Senin (17/9). Namun jika upaya itu gagal, KPK sudah memiliki opsi lain. “Kalau nanti jalan buntu, penyidik tidak bisa dipertahankan, opsi melakukan rekrutmen penyidik di luar polisi dan jaksa akan jadi salah satu opsi yang akan dipilih KPK,” ujar Johan. Mengenai opsi terakhir ini, lanjut Johan, sudah dalam tahap pembahasan di tingkat pimpinan. Namun Johan menegaskan, pihaknya akan menempuh opsi pertama terlebih dahulu. ”Opsi awal kita tetap untuk memperjuangkan 20 penyidik. Karena untuk rekrutmen itu juga perlu waktu, sekitar dua bulan. Nah selama dua bulan ini kerja KPK jadi terhambat,” pungkasnya. Komisi III Kaji Penyidik Independen KPK Komisi III Dewan Perwakilan Rakyat akan mengkaji wacana

perlu tidaknya perekrutan penyidik independen untuk mengisi Komisi Pemberantasan Korupsi (KPK) di masa depan. “Perlu ruang untuk mendalami ini, misalnya kita pelajari lagi Undang-Undang KPK. Kita kaji lagi apa sisi positif dan negatifnya,” kata Ketua Komisi III DPR I Gede Pasek Suardika seusai rapat dengan KPK, Kepolisian, dan Kejaksaan di Gedung Kompleks Parlemen Senayan, Jakarta, Senin (17/9/2012). Pasek mengatakan, perlu dipikirkan bagaimana jenjang karir dan nasib para penyidik independen di KPK nantinya. Pasalnya, kata dia, tidak mungkin orang yang direkrut itu selamanya menjadi penyidik. Pasek menambahkan, wacana itu tidak bisa dibahas dengan cepat lantaran banyak hal yang perlu dipikirkan. Politisi Partai Demokrat itu meminta kepada semua pihak jangan langsung menyimpulkan bahwa penyidik independen adalah solusi dari ketergantungan KPK atas insititusi lain perihal sumber daya manusia. Pasek memberi contoh reaksi berbagai pihak pascapenarikan 20 penyidik oleh Polri bahwa KPK harus mulai merekrut penyidik independen. “Jangan buru-buru, kita memang perlu duduk bareng,” pungkas Pasek. (kmc/int)


18 September 2012

Hari Ini Nasib Tambang Emas Martabe Dibahas Sambungan Halaman 1 Zubaidi. “Kami (Distamben, Red) dan Badan Lingkungan Hidup (BLH) Sumut beberapa hari lalu, sudah turun ke lapangan untuk meneliti apa yang sebenarnya terjadi di sana. Selasa (18/9) nanti, akan ada pertemuan di Kantor Gubsu membahas itu,” ungkap Zubaidi. Dijelaskannya, dari hasil tim yang turun ke lokasi terjadi ketidaksepahaman antara perusahaan tambang dan masyarakat. “Makanya BLH yang diminta untuk turun karena berkaitan dengan limbah. Sebenarnya, perusahaan itu belum beroperasi dan belum membuang limbahnya. Soal izin operasional perusahaan itu, tidak ada masalah lagi,” tambahnya. Secara terpisah, Wakil Ketua DPRD Sumut, Kamaluddin Harahap yang merupakan putra daerah Tapsel, menyatakan konflik terjadi karena tidak maksimal dalam melakukan sosialisasi terkait limbah perusahaan. Sehingga, persepsi yang muncul antara kedua belah pihak tidak sinkron. “Harus maksimal sosialisasi yang dilakukan. Bagaimana soal

limbah dan sebagainya. Berarti tidak maksimal apa yang dilakukan perusahaan,” tegas politisi dari Fraksi Partai Amanat Nasional (PAN) DPRD Sumut ini. Kamaluddin juga mengatakan, dirinya sempat mendengar soal saham yang diberikan PT Agincourt Resources kepada Pemprovsu dan Pemerintah Kabupaten (Pemkab) Tapsel bukan lima persen. “Saya dengar sendiri dari pihak Distamben Sumut kalau golden share saham yang diterima pemerintah daerah, dalam hal ini Pemprovsu dan Pemkab Tapsel hanya satu persen,” tukasnya. Lebih lanjut, Kamaluddin mengatakan dalam hal ini dibutuhkan adanya peran serta DPRD Sumut, untuk turut serta menyelesaikan masalah yang ada. “Saya pikir dibutuhkan adanya Pansus dari DPRD Sumut, menyelesaikan persoalan ini,” imbuhnya. Kembali ke persoalan saham, Zubaidi menjelaskan tidak benar yang diberikan hanya satu persen. “Kita menerima lima persen. 70 persen dari lima persen golden share saham itu untuk Pemkab Tapsel, dan 30 persennya untuk Pemprovsu,” tuturnya. (smg)


„ Dalam teks foto kemarin tertulis Sariaman Sihaloho saat berada di kamar mayat, korban diduga dibunuh, Selasa (119). Seharusnya (dari kiri) Sekretaris Dedi-Affan Center, Borkat SSos, Ami, Dedi Jaminsyah Putra.

Dedi Bantu Honor Guru Madrasah Nurul Huda Sambungan Halaman 1 Lingkungan 8, Zainuddin Tanjung dalamsambutannyamengucapkan terima kasih atas kedatangan Dedi JaminsyahPutraHarahapyangingin berjumpa dan bersilaturahmi dengan masyarakat. Apalagi sebelumnya, Dedi sudah merencanakan ingin datang dan membantu madrasah masyarakat tersebut. Diungkapkannya, Dedi datanginginmelihatlangsungkondisirilmadrasahsetempat.Dengan begitu,diaberharapmasyarakatbisa bersama-samadenganDedi-Affandi pemilukada ini. Hatobangon masyarakat setempat, A Jalar Pulungan juga mengaku gembira atas kunjungan Dedi Jaminsyah tersebut. Di kesempatan itu, dia memintakesiapanmasyarakatyang hadiruntukmendukungDedi-Affan dipemilukadaini. Raja di daerah setempat, Musa Harahap dalam sambutannya menyampaikan terima kasih atas kedatanganDediyangbisalangsung bertatapmukadenganmasyarakatdi JalanNusaIndahtersebut. Diajuga mengucapkanterimakasihatasniat Dedi yang ingin membantu biaya prosesbelajar-mengajarmadrasah tersebut. Dalam kesempatan itu, Musa mengajak masyarakat untuk sama-sama mengingat niat DediAffan,danberharapDedi-Affanbisa terus-menerusbisamembantumasyarakat setempat. “Mudah-mudahanapaniatkandidatagarsamasamakitadoakan.Kamidisinisudah satu doa agar apa yang diniatkan kandidatagarbisatercapai,”tuturnya. DediJaminsyahPutraHarahapdi hadapan masyarakat menyampaikan kedatangan mereka datang selain untuk bersilaturahmi, juga untuk berinfaq untuk membantu honor guru madrasah daerah setempat dan memberikan paket bukukepadasiswanya. Dia meminta masyarakat men-

Koran Kebanggaan Orang Tabagsel

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh : Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tabagsel : Pj. Pimred Metro Tapanuli : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Muhiddin Hasibuan Pandapotan MT Siallagan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Sambungan Halaman 1 Para pendemo yang mendapat pendampingan dari mahasiswa Sahabat Lingkungan (Saling)ini,jugasempatterlibatbentrokdengan pihak TPL. Itu terjadi ketika demonstran mencoba merubuhkan blokade TPL yang terbuat dari kayu berlapis pagar berduri yang dibentangkandijalanmasukTPL. Namun,bentrokyangterjadidengansatpam TPL tidak berlangsung lama, sebab langsung dileraiaparatPolresSimalungun.Selanjutnya, demonstran diizinkan masuk ke dalam. Dan enamperwakilanwargadipersilahkanmediasi denganpimpinanTPL. Pertemuan tersebut tetap tidak membuahkanhasil.Pasalnya,tuntutanwarga terhadap TPL tidak bisa direalisasikan. PerwakilanTPL,TagorManik(pimpinanTPL sektorAekNauli)dandidampingiLambertus Siregar (Humas) memberikan jawaban tidak memuaskan. Massa yang berang langsung menyudahipertemuan. “Kami tidak mau mendengarkan retorika bapak.Kamimaumendengarjawabanbapak terkait keluhan warga. Kalau tidak bisa

diputuskanhariini,kamiberikanwaktu1x24jam. Kalaujugatidakbisadiputuskan,aksiiniakan lebih besar,” ujar aktivis lingkungan, Rado Damanik. Adapun tuntutan warga antara lain; kembalikan lahan pertanian warga yang diserobot seperti di Nagori Naga Hulambu. Janganlagiterjadiintimidasidarioknumaparat atassuruhanTPLsepertiyangpernahdialami warga.Lalu,hentinkanpenimbunananak-anak sungai demi kepentingan jalan pengangkut kayusehinggapersawahanwargakering. “Keberadaan TPL di Simalungun menyengsarakan masyarakat. Pupuk yang digunakanTPLadalahpupukbersubsididan BBMbersubsidi.Akibatnyamasyarakatharus mengalami kelangkaan pupuk dan BBM. Insfratrukturjalanrusakdanpenyebabutama banjir,”tegasRadoyangjugapembinaSaling. Koordinator Saling, Johannes Sakti Sembiring menambahkan, berdirinya suatu perusahaanharusberdampakpositifbagisuatu daerah, khususnya masyarakat sekitar. Perekrutan tenaga kerja perusahaan tersebut juga harus melibatkan putra daerah, karena kehadiran perusahaan di sana untuk

kesejahteraanmasyarakat. TetapitidakdenganTPLyanghanyamenjadi momok menakutkan bagi masyarakat KabupatenSimalungun.Sebab,sejakkeberadaan TPLbanyakhak-hakwargayangdirampasdemi kepentinganperusahaan. TutupTPLHargaMati Massadalamorasinyamenegaskanbahwa tutupTPLadalahhargamati.Masyarakatsudah terlampaumenderitadengankeberadaanTPL diKabupatenSimalungun. Menurut Ketua Gapoktan Pondok Bulu DonganSilalahi,pihaknyasangatkecewaketika PT TPL melarang masyarakat lewat dari jalan umumyangsudahdibuatkanpalang.Palang tersebut setiap hari dijaga dua sampai tiga satpam. “Kamimaumasukkampungsendiriharus melapor kepada satpam TPL. Padahal jalan yangmerekapalangadalahjalanumumyang setiapharidilewatimasyarakat.Tigakampung yang berada di dalam terpaksa mencari jalan alternatif,” katanya. Ia menambahkan, pada tahun 1999 PT TPL sempat ditutup. Saat itu, masyarakat merasa senang karena bisa mendapatkanhasilpanenyangmemuaskan.

TetapibeberapatahunterakhirsejakTPLberdiri kembali, masyarakat petani sawah banyak beralihfungsimenanamjagungkarenaairdari anak sungai mengering. Alasannya sejumlah anak sungai di dalam TPL ditutup demi kebutuhan jalan mobil pengangkut kayu. Menyikapihaltersebut,RadoDamanikdengan tegas mengatakan bahwa PT TPL sudah menghina masyarakat Simalungun karena melarang masuk ke kampung halamannya sendiri. Maka kesimpulannya, PT TPL harus angkatkakidariKabupatenSimalungun. “SudahbanyakbudayayangdilupakanPT TPL. Selama ini masyarakat diam, sehingga mereka bebas melakukan apa saja. Sekarang kamimelakukanperlawanansampaititikdarah penghabisan,” tegas Rado. Sementara itu, PimpinanPTTPLsektorAekNauli,TagorManik mengatakanceritaakhirdariaksitersebutadalah seluruhtuntutanmasyarakatakandituangkan dalamsurat,dandiserahkankepadacamat,dan camatmenyerahkannyakePTTPL. “Itu sudah merupakan bagian keputusan. Tetapipadaprinsipnya,PTTPLbekerjasudah sesuai tupoksi dan peraturan perundangundanganyangberlaku,”pungkasnya.(osi)

MUI Imbau Masyarakat Jangan Terprovokasi Sambungan Halaman 1 tan film yang telah melecehkan agamaIslam. Kita yakin itu berupa provokasi untuk memancing amarah umat muslim. Mari lah kitaperkuatpersatuandankesatuankitadan meningkatkan silaturahmi dan kita anggap itu sebagai ujian agar kita tetap dalam kesabaran,” sebut Syamsir. Wakil Bupati juga mengingatkan agar masyarakat Madina tetap bersatu dalam menjaga akidah agama Islam dan tidak membiarkan kebebasan dalam beragama dilecehkan apalagi dengan pelecehan Nabi panutan agama Islam. Namun aksi penolakanterhadapaksi-aksisepertiitutidak harusdenganmelakukanperbuatananarkis dan arogansi karena agama Islam diajarkan akhlak dan etika. Untuk itu Dahlan mengimbau agar masyarakat lebih memperbanyak zikir dan doa agar agama Allah ini tetap bisa selamar dari segala bentuk pelecehan. “Kita sangat tidakmenerimaperlakukanmerekatersebut, maka melalui doa dan zikir kita mendoakan kiranya pembuat video pelecehan itu dibukakanAllahkiranyakembalikejalanyang benar. Dan inilah cara yang paling baik sehingga tidak perlu melakukan

pertumpahan darah, dan masayarakat Madinamelaluizikir,”kataDahlan. Diajugamengimbaukepadaseluruhumat Muslim di Madina pada khususnya agar menjalankanajaranagamadenganbaikdan turut serta mendoakan agar Allah memberikankesadarandankembalikejalan yang benar bagi setiap hambanya yang melecehkan agama. “Madina adalah mayoritas Islam. Jadi dengan jumah umat yang cukup besar kita agar tidak ada lagi orang yang berbuat seperti ini di dunia ini,” pungkasnya. Dari Los Angeles, meluasnya protes dan kerusuhandiberbagaibelahanduniasebagai reaksiatasperedaranfilmInnocenceofMuslims tidak hanya bikin pusing pemerintah AmerikaSerikat(AS).Produserfilmanti-Islam tersebut, Nakoula Basseley Nakoula, saat ini juga tidak bisa hidup tenang. Bahkan, pria 55 tahun itu akhirnya memutuskan tidak lagi kembali ke rumahnya di Cerritos, pinggiran Kota Los Angeles, Negara Bagian California. Pria yang punya banyak nama lain atau alias (termasuk Sam Bacile, nama yang digunakan saat memproduksi film InnocenceofMuslims),tersebutmerasahidupnya tak aman lagi setelah secara sukarela menjalani pemeriksaan pada Sabtu lalu (15/

9).Lantas,diatidakpulangkerumahnyadan memilih untuk mencari tempat persembunyian. Nakouladiperiksapenyidikfederalselama sekitar satu setengah jam Sabtu siang lalu waktu setempat atau dini hari kemarin WIB (16/9). Pemeriksaan berlangsung di kantor Cerritos County”s Sheriff. Juru Bicara Cerritos County”s Sheriff Steve Whitmore menuturkan bahwa setelah pemeriksaan selesai, beberapa personelnya mengantarkan Nakoula ke sebuah lokasi yangtidakdisebutkanaliasrahasia.“Diapergi. Kami tidak tahu ke mana perginya,” ujar Whitmore. “Yang jelas, dia bilang tidak akan kembali ke rumahnya,” tambahnya. TakhanyaNakoulayangmerasahidupnya tidakaman.Penasihatpenulisanskenariofilm Innocence of Muslims, Steven Klein, juga mengaku sering kali menerima ancaman pembunuhan.Kleintelahlamadikenalsejak lama sebagai tokoh anti-Islam. “Sayabenar-benarlelah,”ujarKleinkepada koran lokal Press-Enterprise yang datang ke rumahpriaasalRiverside Countyitukemarin. Saat menerima tamu, Klein terlihat menggenggam pistol dan hanya mengenakan celana pendek putih dengan bercak-bercak tinta di beberapa bagian.

Biro Penyelidik Federal (FBI) mengidentifikasi Nakoula sebagai produser film Innocence of Muslims. Film yang isinya anti-Islam dan melecehkan Nabi Muhammad SAW itu memicu reaksi luas. Sejumlah kedutaan besar (Kedubes) atau perwakilan AS di Timur Tengah didemo dan diserang. Sebagian besar lokasi syuting film berlangsungdidalamkantorMediaforChrist, lembaga nirlaba yang bermarkas di Duarte, Los Angeles. Sebagian dananya didapat dari kegiatan amal tahun lalu hingga lebih dari USD1juta. FilmtersebutdisutradaraiAlanRoberts,65, veterandiindustriperfilman.Selamainikaryakaryanyadidominasifilm-filmsemipornodan aksi yang berlebihan. Menurut situs Gawker, sejumlah film karya Roberts adalah Young Lady Chatterley II dan Karate Cop. Gawker juga mewawancarai sejumlah pemain Innocence of Muslims yang mengakutertipukarenaditawarifilmepikfiksi. Roberts memilih pemain untuk beberapa karakter atau tokoh, seperti George, Condalisa, dan Hillary. Namun, saat versi filmnya beredar, tokoh-tokoh tersebut diubah menjadi sosok Muhammad dan sejumlah tokoh dalam Alquran. (AP/ Dailymail/cak/dwi)

Pasukan Semut untuk Target Balas Dendam Bulog Sambungan Halaman 1

doakan mereka jika diamanahkan rakyat memimpin Psp ini nantinya atas ridho Allah SWT, bukan pemimpin yang lupa akan tugasnya, namunbisamembawaperubahan yang jelas bagi Kota Psp ini ke arah yanglebihbaik. AlumniSTPDNinimenyebutkan kalaumasyarakatsaatinisudahcerdas dan sudah tahu siapa pilihannya di pemilukada ini. Dia sebagai putra kelahiran di Psp ini berkewajiban untukikutmembangunPspini. “Gunakanlah hak pilih dengan cerdas,jangangolput,”pungkasnya sembariberharapkedatanganDediAffan dipemilukada ini bisa membawa perubahan Kota Psp ke arahyanglebihbaikkedepan. Saat menyerahkan bantuan honorgurumadrasahdaerahsetempat, kepada ketua yayasan Madrasah NurulHuda,Dedimengungkapkan, guru mengaji sebagai penyebar agamaIslam,sehinggaanak-anakkita tahu akan agamanya. “Sehingga menjadi anak yang taat kepada agamanya dan patuh kepada orangtua,”pungkasnya. Ketua Yayasan Madrasah Nurul Huda Lingkungan 8, Zainuddin kepadaMETROmenuturkan,kalau selama ini untuk biaya operasional madrasah termasuk honor guru madrasah sebanyak 6 orang dipungut dari masyarakat Lingkungan I sekitar Rp5.000 per rumahtangga.Namunkarenadalam kurun 3 bulan ini perekonomian masyarakat tergolong terpuruk, sekitar 85 persen masyarakatnya berekonomi lemah. Terakhir kali sebelum mereka mengelola madrasah tersebut, honor guru di madrasah tersebut yang bisa diberikanrata-ratasebesarRp150ribu per orang yang dikumpul dari masyarakat.Saatiniuntukhonorguru madrasah hingga Oktober 2012 ditanggulangiDediJaminsyahPutra. Kitaberharapseterusnyanantinya,” pungkasnya.(neo)


Demo TPL, Massa Dihadang Kawat Berduri

Jogja. “Tahun ini, target kami 3,6 juta ton,” katanya. Sebuah target yang ambisius yang membuatseluruhjajaranBulogkerjakerastanpa weekend. Bulog memang seperti sedang “balas dendam”: target satu tahun itu dibuat sama denganhasilpengadaanberasselamaduatahun sebelumnya dijadikan satu. Bulog pun mengerahkan“pasukansemut”yangmerayap ke desa-desa dan ke sawah-sawah di seluruh Indonesia. Seluruhjajaranpemerintahmemangterlihat all-outtahunini.Besarnyaimporberastahunlalu (dan tahun sebelumnya) memang cukup membuat kita malu. Menko Perekonomian HattaRajasahampirtiapminggumengadakan rapatpengadaanberas.MenteriKeuanganAgus Martowardojo tahun ini mencairkan uang muka pengadaan beras lebih cepat dari biasanya. DanTuhanmemberikaniklimyangluarbiasa. Tahun ini iklim sangat bagus bagi seluruh petaniberas,tebu,dantembakau.Hujantahun ini sangat deras di awal tahun, berkurang di pertengahan, dan kering di musim kemarau. Panenpadimelimpahdimana-mana.Panen tembakaumencapaipuncakpanenrayanya. Danpanentebumenghasilkanrendemenyang luarbiasa. Ditengahkrisispanganduniasaatini,iklim yangbegitubagusyangdiberikanTuhantahun inimemangharusdisyukuridengankerjakeras. Apalagi kalau bulan depan Tuhan sudah memberikanhujanuntukJawa.Saatinihujan memang sudah sampai di Sumatera dan semoga,sepertidiramalkanahlicuaca,bulan depansudahtibadiJawa. “Kalau sampai akhir Oktober belum ada hujan, kita memang harus waspada. Pengadaanberasbisa-bisatidakmencapaitarget,”kataSutarto. Itukarenapetanisudahsangatpandai.Begitu pertengahanOktoberbelumadahujan,petani tidakakanjualgabahlagi.Gabahtersebutakan ditahan di rumah masing-masing untuk cadanganpangan.Itukarenapetanitahu,kalau hujannyamundur,musimtanamnyajugaakan mundur,yangberartimusimpanenberikutnya jugamundur.Merekaperlucadanganpangan lebihbanyakdirumahmasing-masing. SaatiniseluruhgudangBulogpenuhdengan

beras.“Hariini,beraskamiyangadadigudang mencapai 2,1 juta ton,” ujar Sutarto. Angka tersebut perlu dikemukakan karena Bulog belum pernah memiliki beras dari pengadaannya sendiri sebanyak itu. “Entah sudah berapa tahun kami belum pernah mencapaiangkarata-ratasetinggiini,”katanya. Kalau begitu, apakah tahun ini Indonesia sudah terbebas dari keharusan impor beras? Teoretis,berasmemangsudahcukup.Impor tidakperlulagi.Namun,keputusanuntuktidak imporberassebaiknyajugatidakperlukesusu. Kalaupun Indonesia perlu impor beras, tujuannya tidak lagi untuk mencukupi kebutuhan, melainkan sekadar untuk “jagajaga”. Jumlahnyapuntentutidakakanbesar.“Jagajaga” itu juga penting mengingat kecukupan berastidakbisadisepelekan,misalnya,sekadar karenauntukgagah-gagahan. Semangatpetanimenanampadimemang menyala-nyala.Denganhargaberassekarang ini,petani“lupa”menanamyanglain.Misalnya, kedelai.Sepanjanghargakedelaihanyasedikit diatashargaberas(apalagisamadenganharga beras), tidak akan ada petani yang mau menanamkedelai. Saatinitanamanyangbisabersaingdengan padi hanyalah tebu. Dengan perbaikan manajemendiseluruhpabrikgulaBUMN,hasil gula yang diraih petani saat ini sangat memuaskan. BUMN sendiri akan terus meningkatkan bantuannyauntukduakomoditasitu.Bahkan, pada musim tanam mendatang, program BUMN yang disebut Gerakan Peningkatan ProduksiPanganBerbasisKorporasi(GP3K), dengan program yarnen alias bayar setelah panen,dinaikkanduakalilipat.Dalamprogram yarnenitu,BUMNmemberikanpinjamanbibit ungguldanpupukyangsemuanyatepatwaktu. Dengandemikian,petanitidakasalmembeli benih(misalnya,caribenihyangmurahyang disesuaikandengankemampuankeuangannya).Demikianjuga,petanitidakasalmembeli pupuk,bahkankadangtertipupupukpalsu. Mengingat hasil program yarnen tahun ini sangat menggembirakan, BUMN meningkatkanprogramyarnenhingga3,2juta hektare. Dengan program itu, sawah yang semula hanya menghasilkan 5,5 ton/ha bisa menghasilkan7ton/ha.Diataskertas,program tersebut akan menyumbangkan kenaikan produksiberashingga1,5jutatonsetahun(dua

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN

kalipanen). Seluruh BUMN bidang pangan (PT Sang HyangSeri,PTPertani,PTPupukIndonesia,dan Perum Bulog) terjun secara “total-football”. Masing-masing mendapat jatah “yarnen” sekian ratus ribu hektare. Lengkap dengan kewajibanpembinaannya. Manajemendimasing-masingperusahaan itu(termasukanak-anakperusahaanmereka) memangsudahselesaiditata.Sudahsiapterjun kesawahlebihdalam.Konsepdreamteamtidak hanya berlaku untuk masing-masing perusahaan, tapi juga untuk seluruh klaster BUMNbidangpangan. Tidakbolehlagiadadiantaraperusahaanitu yang, misalnya, senggol-senggolan. Apalagi sikut-sikutan. Semua harus menyatu untuk kesuksesan program pemerintah di bidang pangan. Bentukkekompakanitujugaharusbisadilihat dilapangan.Merekasudahmemutuskanuntuk melakukanrayonisasi.Tidakakanadalagiistilah “rebutan”lahan.Kalaudisatukecamatansudah adaPTSangHyangSeri,misalnya,tidakboleh lagiPTPertanimasukkekecamatanitu.Apalagi dengan program yang berbeda. Itu akan membuatpetanibingung. Maka,minggu-mingguiniakanada“serah terima”wilayah.Siapayangharusmundurdari kecamatantertentudansiapayangharusmaju dikecamatantersebut.Satuperusahaanpunya tanggungjawabwilayahyangjelas. Pemetaansudahselesai.Terkomputerisasi. Bagiyangingintahukecamatanapadibawah binaanperusahaanyangmana,bisadilihatdi database BUMN bidang pangan. Lengkap dengandatakios-kiospertaniannya. Perkiosanitujugaditataulang.Tidakberjalan sendiri-sendiri dengan modelnya sendirisendiri.KiosmilikPTSangHyangSeri,misalnya, harusjugamenjualprodukPTPertani,PTPupuk Indonesia, dan Perum Bulog. Demikian juga sebaliknya. Tidak boleh lagi petani dibuat mondarmandir.Misalnya,untukmembelibibitunggul harusmencarikiosSHS.Lalu,untukmembeli pembasmihamaharuslarikekiosPTPertani. Danuntukmembelipupukharusmencarikios PTPupukIndonesia.Semuabarangharusada disemuakios.BUMNmanapunpemiliknya. Karena penataan tersebut menyangkut seluruh infrastruktur di seluruh kabupaten di Indonesia,pelaksanaannyaperlujugadikontrol. Mana yang sudah sempurna dan mana yang

Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotland Dolok Saribu, Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

masihbelumberjalan.SeluruhdireksiBUMN pangansudahall-outmengusahakannya,tapi siapatahumasihadayangterlena. ArifinTasrif,DirutPTPupukIndonesiayang menjadi“ketuakelas”kelompokitu,jugasudah menyiapkanpasukankhusus:brigadehama.Di setiapkabupatendisiapkansatubrigadehama. Dilengkapidengansaranadanbahan-bahan yang diperlukan. Termasuk, data jenis-jenis hamayangbiasamunculdisuatukawasan. Brigadehamatersebutsudahterlatih.Namanamaanggotabrigadepunsudahditentukan untuksetiapkabupatenlengkapdengannomor handphonemereka.Merekajugawajibtinggal dikabupatenitudanaktifmemonitorlapangan. Pembagian yang jelas tidak hanya menyangkutwilayahbinaan,tapijugabidang usaha. Dirut Sang Hyang Seri yang baru, Kaharuddin,memilihmengkhususkandiridi bidangpenyediaanbenihunggul.Titik.Tidak akan main-main di pupuk. Untuk 3,2 juta hektare program yarnen tersebut, misalnya, semuabenihnyadicukupiSHS. PTPertanikonsentrasidibidangpascapanen. DirutPTPertaniyangbaru,EddyBudiono,tidak perlu lagi berebut dan jegal-jegalan untuk memenangi proyek benih, misalnya. Atau memenangi proyek pupuk. PT Pertani akan konsentrasi pada penanganan gabah. GedungnyayangbarudidaerahPasarMinggu nanti pun diberi nama Graha Gabah. Sedangkan PT Pupuk Indonesia akan sepenuhnya bertanggung jawab atas penyediaanpupukdanbrigadehamanya. Ditingkatkannya program yarnen secara drastis itu sekalian untuk mengompensasi kemungkinan mundurnya program pencetakan sawah baru karena lahan yang dicadangkandiKaltimternyatatidaktersedia. Program pangan ini memang besar, menantang, dan mulia. Manajemen yang diperlukanjugaamatkhasdannjelimet.Tapi, pengalaman menarik dalam menangani yarnentahuninitelahmenimbulkanoptimisme yangbesaruntukmampumelipatduakannya tahundepan. Melihatsenangnyaparapetaniyangterlibat dalamprograminimenimbulkangairahuntuk terus dan terus meningkatkannya. Deputi menteriBUMNbidangitu,MZamkhani,juga masih sangat muda dan energik untuk mengoordinasisemuaitu.Musimtanamyang akandatang,insyaAllahduabulanlagi,adalah kickoffyangsebenarnya.(*)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


18 September 2012

PD Sosialisasikan 4 Pilar Kebangsaan SIDIMPUAN-Untuk lebih memahami wawasan kebangsaan, bisa dipelajar dari 4 pilar kebangsaan salahsatunya, Undang-Undang Dasar (UUD) 1945. MPR memasyarakatkan materi dan status hukum ketetapan MPR sebagaimana terdapat pada ketetapan MPR Nomor I/MPR/ 2003 tentang peninjauan terhadap materi dan status hukum. Dengan hal tersebut, melalui DPC Partai Demokrat (PD) Kota Padangsidimpuan (Psp) mengadakan diskusi bersama anggota DPRRI Komisi XI, Drs Saidi Butar-butar, di aula Hotel Bumi Asih, Minggu (16/9). Acara digelar melalui rekomendasi MPR-RI dalam mensosialisasikan 4 Pilar Kebangsaan yaitu Pancasila, Undang-Undang Dasar Republik Indonesia 1945, Negara Kesatuan Republik Indonesia (NKRI) dan Bhinneka Tunggal Ika kepada masyarakat. Dalam sambutannya, Saidi Butar-butar mengatakan, bahwa 4 pilar yang disosialisasikan pada dasarnya tidak terlepas dari dalam kehidupan yang terdapat di masyarakat Indonesia. Walaupun berbeda suku dan bahasa, tapi masih menjunjung tinggi nilai budayanya. Sepantasnya warga negara yang baik harus dapat menerapkan Pancasila, UUD 1945, NKRI dan Bhinneka Tunggal Ika. Ketua DPC PD Kota Psp yang juga Ketua Fraksi DPRD Kota Psp, Khoiruddin Nasution SE dalam sambutannya mengatakan, dengan kehadiran Demokrat memasyarakatkan 4 pilar kebangsaan dapat berguna bagi masyarakat Kota Psp. Dimana, PD akan terus melakukan pendekatan dan pemantapan terhadap masyarakat dengan harapan dapat terus dilaksanakan. Juga, dalam waktu dekat program partai kepada masyarakat masih banyak yang akan dilaksanakan seperti operasi gratis bagi penyandang bibir sumbing dapat dilaksanakan dengan baik agar tercipta masyarakat sejahtera sesuai dengan program partai. (tan/neo)

Sampah... Sambungan halaman 8 membuat lingkungan pemukiman menjadi kotor dan jorok. Pantauan METRO Senin (17/9) di Pasar Sipirok Kabupaten Tapsel, sampah berserakan di badan jalan dan mengeluarkan bau busuk. Kondisi ini sangat membutuhkan penanganan dari instansi terkait, untuk terciptanya lingkungan pemukiman yang bersih, dan juga upaya pencegahan penularan berbagai penyakit di tengah-tengah masyarakat yang bermukim di sekitar lokasi penumpukan sampah. Salah seorang warga setempat bermarga Nasution kepada METRO, Kamis (17/9) mengatakan, pemerintah sudah perlu memanfaatkan sampah dan mengolahnya menjadi barang yang bernilai tinggi terutama untuk pupuk organik. Selain membuka lapangan, kerja, juga mengurangi ketergantungan pada pupuk kimia bagi patani dan tentunya juga terjaga dan terpeliharanya kebersihan lingkungan dan kesejatan masyarakat sekitar. “Sebenarnya sudah pernah ada rumah kompos di bangun di pasar ini untuk mengolah sampah menjadi berharga dan bernilai ekonomis, namun tak tahu lagi apakah masih beroperasi atau bagaimana. yang jelas sampah belum ditangi dengan baik, bahkan Tempat Pembuangan Akhir (TPA) sampah tersebut juga belum ada,” katanya. Kepala Dinas (Kadis) Tata ruang Pemukiman (Tarukim) Kabupaten Tapsel, Ir Syahril yang dimintai keterangan dan upayanya mengatasi hal tersebut melalui SMS namun tak ada jawaban. (ran/mer)

Beram Jalan Undang Bahaya Sambungan halaman 8 Bahkan, di lokasi tersebut tak jarang terjadi kecelakaan, dan yang terakhir pada Kamis (13/9) lalu. Satu unit truk pengangkut produk Mayora terguling ke jurang karena

putus rem dan tak bisa mengendalikan kendaraannya. Ketua Fraksi Demokrat DPRD Kota Psp, H Khoiruddin Nasution SE menanggapi hal tersebut kepada METRO Senin (17/9) menyebutkan, dirinya juga telah melihat kondisi bahanyanya jalinsum

Simirik. Bahkan, berbagai laporan masyarakat juga telah diterima pihaknya sebagai perwakilan masyarakat di legislatif Kota Psp untuk menyuarakan aspirasi masyarakat tersebut, sehingga terciptanya lalu lintas yang aman dan lancar di Kota Psp.

Dukungan Murni, Tanpa Iming-Iming tuk terus ditumbuhkembangkan dan dilestarikan di Bumi Dalihan Na Tolu demi tegaknya harmonisasi hubungan adat dan kekerabatan. “Tidak ada dalihan (tungku) na (yang) dua atau empat. yang ada hanya dalihan na tolu (tiga tungku). Kalau dalam adat Tabagsel ini disebutlah itu mora, kahanggi dohot anakboru,” jelas Rival dengan mantap yang didampingi panitia Gebyar Music Festival Nofrianti Harahap. Kemudian kata Rival, dirinya juga sangat mengidolakan gaya kepemimpinan Walikota Psp sekarang ini Drs H Zulkarnaen Nasution MM yang pro rakyat dan kerap turun ke bawah melihat realitas yang dialami warganya serta mendengarkan keluh kesah dan menampung aspirasi warga. “Gaya kepemimpinan seperti itu jelas

Sambungan halaman 8 “Kami memilih nomor urut 3 AMIN pada Pemilukada nanti, murni dan ikhlas karena keterpanggilan hati nurani tanpa terbujuk dengan iming-iming atau pemberian sesuatu. Karena ami ingin hadirnya perubahan di Kota Psp. Jadi sosok yang pas dan pantas untuk menjadi walikota dan wakil walikota adalah Andar-Isnan,” tutur Presdir CV OPS, Rival Sandy Ritonga, usai pembukaan Gebyar Music Festival tahun 2012 se-Tabagsel di Gedung eks Presiden Theatre, Kota Psp, Sabtu (15/9) lalu kepada sejumlah wartawan. Lebih jauh dikatakan Rival, keterpanggilan pihaknya untuk memilih Andar-Isnan karena visi dan misi serta slogan dalihan na tolu yang diusungnya sangat tepat un-

sekali dimiliki oleh Andar Amin dan Isnandar yang selalu menyapa warganya dengan lembut, santun dan bersahaja,” ujarnya seraya mengatakan sekali nomor 3 tetap nomor 3. Terkait dengan pagelaran Gebyar Music Festival yang dilaksanakan oleh OPS, Rival menampik kalau ada yang mengkaitkannya dengan Pemilukada, tapi yang jelas katanya even ini merupakan kegiatan tahunan OPS yang sudah berjalan selama 10 tahun lebih. “Kehadiran Andar Amin dan Isnandar dalam acara Gebyar Music Festival atas undangan kami. Dan hanya merekalah pasangan calon walikota dan calon wakil walikota yang kami undang. Meski begitu, kami tidak meminta bantuan sepeserpun dari AMIN karena ini murni atas dasar kesukaan kami pada AMIN,” pungkasnya. (phn/mer)

Bisa Jadi Sumber Inspirasi dan Motivasi Sambungan halaman 8 Bupati Tapsel, H Syahrul M Pasaribu usai menerima laporan secara resmi dari Kepala Badan (Kaban) Pemberdayaan Masyarakat Desa Dan Pemerintah Desa (Kaban Bapemas dan Pemdes) Kabupaten Tapsel, Drs H RE Hasibuan MM, atas hasil Jambore TTG tingkat Sumut, Senin (17/9). Disampaikan Bupati didampingi Kaban Bapemas dan Pemdes, H RE Hasibuan MM dan Kabag Humas Tapsel, Anwar Efendi Simanungkalit, Pemkab Tapsel terus melakukan pembinaan terhadap kelompokkelompok masyarakat melalui Posyantek di kecamatan yang ada. “Masyarakat di desa dan kecamatan harus bisa berinovasi dengan memberdayakan dan mendayagunakan setiap potensi di masing-masing daerah,” tutur Bupati. Dikatakan politisi Partai Golkar (PG) ini, tahun 2010 lalu Tapsel juga berhasil meraih

juara umum dan menjadi utusan Sumut ke Jambore TTG Nasional di Kalbar. Lalu, tahun 2011 lalu hanya meraih juara 2, tapi juga ikut menjadi utusan Sumut di Jambore TTG Nasional di Sidorejo. Dan tahun 2012 ini, berhasil meraih juara umum lagi dan menjadi utusan Sumut di Jambore TTG Nasional yang akan digelar di Batam Oktober tahun 2012 ini. Diungkapkan Bupati, ada 4 hal yang membuat Tapsel berhasil meraih juara umum Jambore TTG tingkat Propinsi Sumut tahun ini yaitu TTG berhasil meraih juara 1, Bidang Penyajian Stand yaitu stand Tapsel minimalis dengan balutan daun pandan, bidang kesenian berhasil meraih juara 1 setelah menampilkan Tor-Tor dan lagu-lagu Tapsel yang sesuai dengan tema Jambore TTG tahun ini yakni pemberdayaan Posyantek Desa serta bidang inovasi berhasil meraih juara 1 berupa inovasi souvenir boneka berbahan baku biji salak dan lainnya.

Dalam laporannya, Rustam Efendi menyampaikan beragam alat-alat tekhnologi tepat guna yang dipamerkan di Jambore TTG tersebut yaitu alat pengukir tripleks dan gabus berbahan fiber glass dan dinamo, alat fermentasi coklat berbahan kayu broti dan papan, alat penggiling kopi dan pengangkat air berbahan baku kayu broti, papan dan bahan-bahan bekas, dan yang lainnya. “Saat ini khusus briket berbahan baku kulit duriang sedang kita coba,” pungkasnya. Diungkapkannya, pihaknya telah memberdayakan 3 Posyantek di tiga Kecamatan yaitu Kecamatan Batang Toru, Sipirok dan Batang Angkola untuk tiga zona di Tapsel ini. Dan tiga posyantek inilah yang mengembangkannya ke kecamatan lain di wilayah zona masing-masing. Dikatakannya, ada hasil inovasi kelompok tersebut yang masih sebatas percontohan dan ada juga yang sudah menyebar di masyarakat. (neo/mer)

“Aspirasi mesyarakat tentang kondisi jalan itu telah kita terima dan akan menyuarakan agar ke depan diperhatikan pemerintah. Tujuannya jelas, untuk meminimalisir terjadinya kecelakaan lalu-lintas dan lainnya,” tuturnya. (ran/mer)

Pemandu... Sambungan halaman 8 wisatanya, masih dalam bimbingan relawan dari Forum DAS yaitu Andi Lubis yang jabatannya membidangi pengembangan ekowisata. Ketua Forum DAS Batanggadis, Awaluddin Pulungan saat mendampingi wisatawan asal Belanda, Amerika dan Norwegia Minggu (16/9) mengatakan, paket promo wisata yang dikemas seharga 75 US per orang. Paket Tour meliputi Jungle Tour yaitu Trekking dan mengunjungi industri kreatif tradisional masyarakat pada Kawasan Hutan Batangtoru dan Taman Nasional Batanggadis. Kegitan Jungle Trekking Tour (jalan jalan ke dalam hutan secara bertanggungjawab) dengan harapan dapat melihat orang utan dan harimau Mandailing di habitatnya di alam liar. Katanya, AFTAS merupakan satu-satunya lokal tour operator di daerah ini. Dijelaskannya, kebutuhan pemandu wisata saat ini sangat tinggi, karena semakin banyaknya wisatawan yang datang. “Kami tidak bisa fokus lagi dalam kegiatan utama yaitu pendidikan konservasi dan lingkungan untuk masyarakat, kalau harus jadi pemandu wisata juga,” kata Awal Pulungan panggilan akrabnya. Pemandu wisata lokal di Tapsel dan Madina kendalanya kata Awal adalah, bahasa Inggris. Salah satunya dan juga pengetahuan tentang aneka ragam flora dan fauna di dalam kawasan TNBG. Dan mereka para pemandu lokal harus tahu titik-titik penting yang menjadi daya tarik bagi wisatawan, mereka harus bisa menjelaskan, meski dengan cara sederhana kepada turis domestik dan manca negara sebagai sumber pendapatan baru bagi masyarakat sekitar objek wisata. “Untuk ini, kita akan coba buat standar uji kompetensinya bekerja sama dengan stake holder terkait. Planning untuk harus segera disusun karena kebutuhannya sangat tinggi,” kata Awal. (ran/mer)

Telkomsel Undi 2 Unit Mobil KIA Sportage M/T Sambungan halaman 8 “Program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA merupakan salahsatu program yang diperuntukan bagi pelanggan yang telah setia menggunakan produk Telkomsel serta mitra outlet yang telah setia menjaga loyalitas pelanggan Telkomsel melalui ketersediaan produk di outlet hingga membantu Telkomsel dalam melakukan edukasi keunggulan produk Telkomsel kepada pelanggan di outletnya”. Program Rejeki Isi Ulang adalah program yang dikhususkan untuk pelanggan prabayar Telkomsel di Sumatera (kecuali nomor HLR Aceh), baik pelanggan baru maupun pelanggan yang sudah lama menggunakan kartu simPATI, Kartu AS dan Kartu Facebook.

Untuk mengikuti program ini tidak diperlukan registrasi khusus, caranya pelanggan prabayar cukup melakukan isi ulang pulsa pada periode program yang berlaku mulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Jika selama periode program telah mencapai total isi ulang minimal Rp.60ribu, secara otomatis pelanggan tersebut akan berpeluang mendapatkan salahsatu hadiah. Bagi pelanggan yang melakukan isi ulang pulsa selama periode program, mencapai total isi ulang pulsa minimum Rp300.000, secara otomatis berpeluang mendapatkan salahsatu dari seluruh hadiah yang disediakan berupa 30 (tiga puluh) HP Android, 30 (tiga puluh) Tas Trolley, 9 (sembilan) unit Samsung Galaxy Tab 8.9”, 9 (sembilan) unit Sepeda Motor Honda Vario,

dan hadiah utama undian berupa 1 (satu) Mobil KIA Sportage M/T. Melengkapi program Rejeki Isi Ulang, Telkomsel juga menyelenggarakan program JUTAWAN OUTLET SUMATERA (JUARA). Program apresiasi ini dikhususkan bagi seluruh mitra outlet yang juga berada diwilayah Sumatera. Program ini juga menyediakan hadiah undian berupa 1 (satu) unit Mobil KIA Sportage M/T, Honda Vario, Tablet Cyrus TV Pad, Blackberry Apollo. Program yang diperuntukkan khusus untuk mitra outlet diseluruh willayah Sumatera ini, dimulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Bagi mitra outlet yang ingin mengikuti program JUARA, akan mendapatkan informasi lengkap tentang mekanisme program melalui petugas Sales Force yang

berada dimasing-masing wilayah cluster mitra outlet. Pada kesempatan ini, Gilang Prasetya menghimbau kepada pelanggannya agar tetap berhati-hati terhadap penipuan yang mengatasnamakan Telkomsel. Jika pelanggan menerima informasi menjadi pemenang salahsatu program undian Telkomsel, sebaiknya melakukan konfirmasi ke nomor layanan Call Center bebas pulsa Telkomsel yaitu 133 dari kartuHALO dan 155 dari kartu simPATI dan Kartu As. Selain itu pelanggan juga dapat mendatangi kantor layanan GraPARI Telkomsel terdekat. Hal terpenting adalah, Telkomsel tidak pernah mengenakan biaya apapun kepada pelanggan yang menjadi pemenang undian berhadiah dari Telkomsel, baik dalam bentuk uang tunai maupun pulsa. (rel/leo)

SAMBUNGAN METRO TABAGSEL Saya Mengidolakan Soekarno Sambungan Halaman 1 melihat saya mampu menjadi referensi bagai anak muda di kota itu. Alasan Anda dipilih? Karena saya sudah memenangkan pemilihan di tingkat dewan pemuda. Kenapa saya terpilih sebagai ketua, karena saya sering pidato. Memang leadership saya sudah terbentuk dan terlihat. Jadi tidak ragu berbicara di depan orang. Dalam dua bulan menjabat, apa saja yang Anda lakukan? Prestasi saya yang berhasil dicapai di antaranya mampu mendatangkan tiga investor. Salah satunya adalah investor pabrik bahan bangunan. Prestasi kedua, saya bisa menggalang kekuatan untuk memperkuat lingkungan dan keamanan. Ketiga, saya mampu menjadi role model, bahwa seorang pemuda itu memiliki kapasitas memimpin ketika dia diberikan kesempatan. Anda mengidolakan Soekarno dan Hitler? Bung Karno itu seorang figur yang dikenal di seluruh Palestina. Alasan saya mengidolakan dia karena Soekarno termasuk seorang pemimpin yang memulai untuk berani mengakui Palestina sebagai sebuah negara. Paling tidak Bung Karno

mengakui Palestina yang memiliki hak-hak sebagai sebuah negara. Kalau Hitler, yang saya kagumi, dia memiliki pribadi yang kuat. Walaupun ide-ide dia ditentang banyak orang, tapi kepribadian yang kuat membuat dia selalu optimis. Itu yang saya kagumi dari Hitler. Bisa gambarkan kehidupan pemuda di Tepi Barat? Pemuda Palestina selalu siap sedia berdiri membela negaranya dengan berbagai cara, apakah fisik maupun nonfisik. Seperti cara-cara memberdayakan kebudayaan yang selama ini berkembang di masyarakat. Bagaimana pandangan politisi dan pemuda di sana saat Anda menjabat sebagai walikota? Mereka senang sekali dengan pengalaman saya seperti ini. Dan kini mereka tertarik terlibat aktif dalam proses pengajuan diri sebagai pemimpin. Dulu mereka yang takut dipilih maupun memilih, sekarang jadi berani. Jadi dampak keberadaan saya sebagai walikota termuda sangat positif bagi pemuda di sana. Anda sudah punya pacar? Belum punya pacar. Karir dulu. Pemuda di Palestina hidup dalam kesulitan dan tekanan.

The Real Galacticos Sambungan Halaman 1

susunan bintang-bintang di angkasa. Diartikan ke sepak bola, Los Galacticos bisa diumpamakan kumpulan bintang-bintang nomor wahid yang didatangkan dalam satu klub. 2003 lalu, Real Madrid mengerikanskuadnya.MulaiDavidBeckham,Ronaldo, Luis Figo, Zidane, Raul Gonzales dan lainnya. Dengan kekuatan maksimal itu, plus uang yang dikeluarkan untuk gaji dan sebagainya, Real Madrid memang berbicara di kancah Eropa. Apalagi di kompetisi domestik.Hanyasaja,TrofiLigaChampionsmasihgagal masuk lemari koleksi sudah satu dekade lamanya. Terakhir musim 2001-2002 mereka angkat trofi antar klubbenuabiruitu. Lalu edisi 2009 hingga kini, Real Madrid masih hobi mengoleksi pemain kelas satu dunia. Dimulai dari era perekrutan Cristiano Ronaldo hingga zaman Karim Benzema dkk. Bedanya usia bintang yang dihadirkan relatif lebih muda dibanding Los Galacticos edisi

perdana.Dibawahkendalipelatihnyentrikbermental juara, Jose Mourinho, Florentino Perez sang presiden klubinginMadridkembalijawaradiEropa.Danmusim inilah ambisinya. Konstelasinya dong? Oke. Lihat ManchesterCitymasakini.Disupportsyeikhkayaraya, MansourbinZayedAlNahyan,Citymenjelmajadiklub bertabur bintang. Mereka acap kali disebut media sebagaipeniruulahRealMadriddenganLosGalacticosnya.Denganasupandanatakberseri,ManchesterCity mudah saja memboyong pemain yang diinginkan. Lihatlah sederet pemain ini: Mario Balotelli, Carlos Tevez, David Silva, Edin Dzeko, Sergio Aguero, Yaya Toure.DanSiapapunyangdiiginkansangsyeikhsesuai kebutuhan Mancini, bisa dilobi lalu dibeli. Bahkan anekdot di kalangan pundit menyebutkan jika saja LionelMessidijualBarcelonabertriliunharganya,maka sang syeikh siap membayar. Begitulah konstelasinya. Sama-samaberstatusklubbertaburbintang.Hanyaitu. Jika menilik prestasi, sudah jelas jawabnya. Madrid

Tidak terpikir main-main, tidak terpikir pacaran. Jadi memikirkan solusi untuk keluar dari tekanan saja sudah mengeluarkan banyak energi. Yang dipikirkan adalah bagaimana membentuk karakter pemuda menjadi seorang pemimpin. Apa kendala menjadi walikota? Permasalahan yang pertama kali dihadapi adalah ketika saya berhadapan dengan orangorang yang menentang program seperti ini, karena saya seorang perempuan di sebuah komunitas yang mayoritas laki-laki. Itu yang terberat. Pekerjaan apa saja yang ditangani? Saya melakukan semua tugas yang dilakukan oleh walikota sebelumnya, dan saya juga selalu berkonsultasi dengan walikota yang sebenarnya. Jadi ini merupakan rutinitas saya sehari. Melaksanakan tugas dan selalu berkonsultasi. Anda ingin total terjun ke politik atau mengutamakan pendidikan dulu? Ke depan, saya ingin menjadi seorang diplomat, dan saya ingin membantu kasus-kasus hukum dan hubungan internasional. Itu salah satu ambisi saya. Jadi memang saya tertarik di dunia politik. Setelah saya lulus dari universitas, saya ingin masuk ke sekolah hukum. Apakah Anda mendukung kemerdekaan

Palestina? Saya mendukung apapun itu untuk kemerdekaan Palestina Bagaimana pendapat Anda soal dukungan Indonesia terhadap kemerdekaan Palestina? Saya tidak tertarik untuk menjawab soal politik tingkatan atas. Apa pandangan Anda terhadap Indonesia? Saya berpandangan, Indonesia sebagai sebuah negara yang sangat besar dan punya potensi yang luar biasa. Dan saya lebih memilih datang ke Indonesia ketimbang ke Italia. Karena undangan datang dari dua negara datang secara bersamaan. Saya memilih Indonesia karena Indonesia adalah negara strategis. Pertama penduduknya mayoritasnya muslim, dan selalu membela isuisu Palestina di kancah internasional. Demonstrasi-demonstrasi yang dilakukan pemuda Indonesia itu sudah menjadi berita keseharian di kalangan pemuda Palestina. Jadi mereka seperti punya ikatan batin dengan Indonesia. (int)

sudah punya sembilan trofi Liga Champions di lemarinya, sedangkan The Citizen nihil adanya. Apa kata para juru racik strategi untuk laga ini? Kita mulai daricuap-cuapMancini.DiSoccernetdiberitakanjika ManciniberencanamembangunsejarahlayaknyaReal Madrid. Bukan sekarang, tapi 10 tahun lagi. Wartawan usil bertanya yang lebih kepada menyindir soal uang yang dimiliki City. Menurut analisa awak media, uang takakanmampumembelisejarah.TapiManciniyang doyansenyummenjawabsantai. “Sudah jelas, kami memang tidak memiliki sejarah seperti Real Madrid. Tapi kami sudah memenangkan beberapa piala kok,” bebernya. “Kami ingin menang sekarang. Dan dalam 10 tahun ke depan kami akan menjadi tim top seperti Real,” lanjut pelatih yang menggantikanMourinhodiInterMilan2010silam. Isu Ronaldo yang sedang galau di Bernabeu juga diamati pelatih asli Italia itu. Bahkan dia berharap Ronaldo tak dimainkan. “Lebih baik jika mereka meninggalkan Ronaldo di rumah. Ronaldo adalah

pemain terbaik dunia,” sebutnya. Kalau Mou yang minta dipanggil The Only One tampak lebih santai menataplagaini.Baginyayangutamaadalahmenang dan lolos dari grup maut ini. Grup D memang neraka. Dihuniempatklubjawaraempatligaberbeda.Madrid wakili Spanyol, City wakili Inggris serta Ajax sang juara BelandaplusDortmundyangangkattrofidiJerman. “Kita berbicara tentang sebuah kelompok dengan empatjuaraligadariempatnegarabesar.TerutamaCity danBorussiaDortmund,” “Ajaxjugaberat,lihatsajasejarahnyadiEropa.Sangat sulitmerebutpoindarigrupini,”lanjutOrangPortugal itu. Jadibagaimanaambisimenggenapkangelarjuara Eropa jadi 10? “Itu sangat menarik. Kalau kami mencapaiangka10dalamraihantrofiituakanmenjadi satu-satunya. Cara merebutnya ya dengan motivasi untukterusmenang,bermainbaikdanjuara.” “Tapi sepak bola itu indah karena tak kerap terduga. Kadang-kadang tim terbaik pun bisa tidak menang,” tutupMourinho. So,siapayanglayakdisebutTheReal Galacticos?(*)

Calhaj Tertua 95 Tahun

Sambungan Halaman 1

usai memfasilitasi manasik akbar jamaah calon haji tahun 2012 Madina di Masjid Agung Nur Ala Nur Panyabungan, Senin (17/9). Disampaikan Muksin, meski dengan seusia itu Dur Ali Rangkuti masih dikategorikan mampu menjalankan ibadah. Ini sesuai hasil pemeriksaan kesehatan yang diberikan oleh pemerintah, meski demikian Muksin berharap kepada semua para jamaah agar saling tolong menolong dalam melaksanakan semua rukun dan ibadah wajib haji. “Kami berharap agar seluruhnya jangan saling membiarkan. Tolong saudara kita dibantu bagi yang membutuhkan apabila tidak sanggup membantu cepat laporkan kepada petugas haji kita,” pintanya Sementara itu, Kepala bagian kesejahteraan rakyat (Kesra) Pemkab Madina M Taufik Lubis SH kepada METRO mengatakan, pemkab Madina dalam hal ini telah memberikan sejumlah fasilitas bagi para jamaah calon haji Madina, misalnya menjalani pemeriksaan kesehatan dan memberikan pengobatan bagi calon haji yang sakit. “Kita sudah memberikan sejumlah fasilitas, dan rencananya hari ini, Selasa para jamaah akan menjalani suntikan agar lebih kebal terhadap penyakit, pemkab Madina juga telah mengutus Tim pendamping haji,” kata Taufik.(wan)


18 September 2012

Jalinsum Simirik Butuh Perbaikan

Beram Jalan Undang Bahaya SIDIMPUAN-Jalan Lintas Sumatera (Jalinsum) Simirik, di Kota Padangsidimpuan (Psp) membutuhkan perhatian pemerintah melalui pihak terkait untuk memperbaikinya. Kondisi jalan semakin hari semakin membahayakan bagi masyarakat pengguna jalan.


DUKUNGAN-Presdir CV OPS, Rival Sandy Ritonga dan panitia pelaksana Gebyar Music Festival, Nofrianti Harahap mengacungkan tiga jari tangan kanan sebagai ungkapan dukungan terhadap pasangan Nomor Urut 3 AMIN, Sabtu (16/9).

500 Anggota OPS Bulatkan Tekad Pilih AMIN

Dukungan Murni, Tanpa Iming-Iming SIDIMPUAN-Sebanyak 500 pecinta seni musik di Bumi Dalihan Na Tolu Kota Padangsidimpuan (Psp) menyatakan kebulatan tekadnya untuk memilih pasangan nomor urut 3 Andar Amin Harahap SSTPMuhammad Isnandar Nasution SSos (Andar-Isnan) populer disebut pasangan AMIN pada Pemilukada nanti. Statemen menarik dilontarkan Presiden Direktur (Presdir), CV Organisasi Pecinta Seni (OPS) Kota Psp berkaitan dengan sikap politiknya menghadapi Pemilihan Umum Kepala Daerah (Pemilukada) tanggal 18 Oktober 2012 ini.

BUTUH PERBAIKAN: Jalan Lintas Sumatera (Jalinsum) Simirik, di Kota Padangsidimpuan (Psp) membutuhkan perhatian pemerintah melalui pihak terkait untuk memperbaikinya.

Keberadaan jalan yang menurun dan berkelok tersebut, menjadi salah satu titik rawan terjadinya kecelakaan lalu-lintas. Jika masyarakat pengendara semua jenis kendaraan tidak hati-hati melintas, bisa berbahaya bagi nyawa, apalagi beram jalannya dalam. Beberapa warga setempat Harahap (34) kepada METRO mengatakan, keberadaan fasilitas jalan umum tersebut sangat mengancam masyarakat pengguna jalan. Apalagi ketika berpapasan. “Keasdaan jalan ini sangat berbahaya, apalagi ketika berpapasan. Karena beram jalan sangat dalam dan tak mungkin kendaraan berani memasukkan roda ke dalam beram itu,” katanya. Amatan METRO, suasana jalan yang menurun dan berkelok tersebut kerab terjadi antrean ketika kendaraan besar sedang berpapasan yang diakibatkan pengendara tak melintasi beram jalan yang cukup dalam.

Baca Beram Jalan... Hal 7

Baca Dukungan ... Hal 7

Pemandu Wisata Lokal Belum Berstandart

Raih Juara Umum Jambore TTG

Bisa Jadi Sumber Inspirasi dan Motivasi SIDIMPUAN-Keberhasilan Kabupaten Tapanuli Selatan (Tapsel) menjadi juara umum pada Jambore Tekhnologi Tepat Guna (TTG) Kader Pos Pelayanan Tekhnologi (Posyantek) Tingkat Sumut ke-XII di Pantai Indah Kalangan, Tapteng 13-16 September lalu, harus menjadi sumber inspirasi dan motivasi bagi seluruh PNS di Pemkab Tapsel dan masyarakat. “Di samping disiplin, PNS jangan cepat berpuas diri, bekerjalah dengan totalitas, memberikan pembinaan dan pelayanan kepada masyarakat,” ujar

Baca Bisa Jadi ... Hal 7


PENGHARGAAN-Bupati Tapsel, Drs H Syahrul Pasaribu dan stafnya, menunjukkan penghargaan juara umum pada TTG Kader Pos Pelayanan Tekhnologi (Posyantek) Tingkat Sumut ke-XII.

Sampah Terus Menumpuk di Tengah Pasar SIPIROK-Sebagai ibukota Kabupaten Tapsel, penanganan sampah pasar di Sipirok, Kecamatan Sipirok masih perlu ditingkatkan. Untuk menciptakan lingkungan yang bersih dan terpeliharanya kesehatan warga masih jauh dari harapan. Pasalnya, keberadaan sampah kerab menjadi tempat persembunyian berbagai jenis bibit penyakit. Penanganan sampah terkesan diabaikan dan sampah dibiarkan berserakan di beberapa lokasi yang

Baca Sampah ...Hal 7

SIPIROK-Kualitas dan kompetensi pemandu wisata lokal di Kabupaten Tapanuli Selatan (Tapsel) belum memenuhi standar. Hal ini disebabkan belum ada proses sertifikasi dan juga faktor Sumber Daya Manusia (SDM) yang membutuhkan sentuhan. Selama ini, untuk memenuhi kebutuhan pemandu masih mengandalkan dan mePENGUNDIAN: Pengundian program loyalti bagi pelanggan dan mitra outlet di Sumatera

Telkomsel Undi 2 Unit Mobil KIA Sportage M/T MEDAN- Hari ini Telkomsel melakukan penarikan undian pemenang utama program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA. Masing-masing pemenang utama program ini mendapat hadiah berupa 1 Unit Mobil KIA Sportage M/T. Periode program dilakukan mulai tanggal 1 Mei 2012 hingga 31 Juli 2012. Penarikan undian dilakukan secara transparan dihadapan Dinas Sosial, Notaris dan Kepolisian. Pemenang hadiah utama program

Rezeki Isi Ulang adalah Hendriko pelanggan Telkomsel di Palembang, dan pemenang utama program Jutawan Outlet Sumatera adalah M u t i a r a Telkomsel outlet dari Binjai. Para pemenang langsung dihubungi oleh Head of Sales and Customer Care Regional Sumbagut Division Telkomsel – Filin Yulia, sesaat setelah pengundian berlangsung. Menurut Head Of Telkomsel Sumatera Group – Gilang Prasetya

Baca Telkomsel ... Hal 7

manfaatkan warga masyarakat sekitar objek wisata, seperti di Kawasan daerah aliran sungai (DAS) Batanggadis Lintas Kabupaten (Tapsel, Madina dan Kota Psp). Promosi paket wisatanya adalah Trekking di Kawasan Hutan Tropis Batangtoru dan Taman Nasional Batanggadis. Pemandu

Baca Pemandu Wisata...Hal 7


18 September 2012

Chaidir Ritonga Diyakini Mampu Sejahterakan Petani SIDIMPUAN-Sejumlah petani di Kecamatan Padangsidimpuan (Psp) Angkola Julu siap mendukung dan memilih calon Walikota Ir Chaidir Ritonga MM. Karena Chaidir merupakan sarjana pertanian dan diyakini dapat mengangkat harkat dan martabat para petani dimasa mendatang.


„ Adnan Buyung Nasution saat memberikan dukungan kepada Calon Walikota Psp nomor urut 2, Rusydi Nasution dalam acara halal bi halal dan juga pelantikan pengurus Ikanas Pusat di Hotel Golden, Jakarta, Sabtu (15/9) malam.

IKANAS Pusat Akan Menangkan 2R SIDIMPUAN-Ikatan Keluarga Nasution (Ikanas) Pusat menyatakan memberi doa restu, mendukung dan akan memenangkan salah satu anggotanya yang juga Ketua Pemuda Ikanas Pusat, Rusydi Nasution STP MM yang maju di

pilkada Psp 18 Oktober mendatang. Tekad bulat ini disampaikan seluruh pengurus Ikanas Pusat dalam acara halal bi halal dan juga


‹ Baca IKANAS...Hal 10

Partai Demokrat Siap Menangkan 2R SIDIMPUAN-Partai menurut masyarakat terDemokrat (PD), salah sahadap pasangan calon tu partai pengusung payang diusung, bahwa sesangan calon walikota genap 6 pengurus PAC dan wakil walikota Rusydi dan 79 pengurus ranting Nasution STP MM-Ir Risserta kader yang tersebar wan Daulay MM dengan di Kota Psp akan berjuang nomor urut 2 (2R) siap bersama memenangkan memenangkan pasangan pasangan Jokowi Ala Sidengan ciri khasnya baju dimpuan ini. kemeja kotak-kotak biru Berbagai strategi positf ini atau populer dengan merupakan kunci keber(FOTO: IST) Jokowi Ala Sidimpuan. hasilan tim, juga pendu„ Pertama Yul Demikian disampaikan kung nantinya sudah diAsmara Pane. ketua tim pemenangan laksanakan dan terus diyang juga wakil ketua I PD Psp, lakukan sesuai dengan visi-misi Pertama Yul Asmara Pane SE kepasangan untuk Sidimpuan yang pada METRO, Minggu (16/9) lalu. ‹ Baca Partai...Hal 10 Dikatakannya, terlepas dari apa

Demikian disampaikan beberapa petani Desa Rimba Soping Kecamatan Psp Angkola Julu, Sabtu (15/9). Nurhalimah Br Simanjuntak dan Erna Br Simamora ketika di jumpai di persawahan mereka mengatakan, mereka berharap kiranya Walikota nantinya adalah orang yang mengerti pertanian dan memahami kesulitan para petani serta mampu mengambil tindakan cepat saat petani


„ Dua petani Psp, Nurhalimah Br Simanjuntak (kiri) dan Erna Br Simamora, warga Desa Rimba Soping Kecamatan Psp Angkola Julu Psp.

Jelang Pencoblosan, Marak Pembagian Sembako Gratis FOTO : M ADIL/JPNN

„ Kupon sembako yang ditemukan Panwaslu DKI Jakarta.

JAKARTA - Panitia Pengawas Pemilu (Panwaslu) DKI Jakarta menemukan praktik pembagian sembako kepada warga jelang pemungutan suara Pilkada DKI 2012 putaran kedua. Pembagian sembako itu dengan cara menukarkan kupon bergambar logo

‹ Baca Jelang...Hal 10

CHAIDIR hal 10

N POLDA JAMI idat nd KeselamataniaKkaan Bodyguard

ed Jelang CoblosanriSlagi (20/09) pilkada DKI

ha JAKARTA-Tiga kedua akan dilaksanakan. ng ba m siko dalam Jakarta gelo k mau ambil re rtarung, ta ya Ja ro et M Polda yang be n dua kandidat mli dan Joko mengamanka i ra ow hr ac N wo “ yakni Fauzi Bo al 10

a...H ‹ Baca Pold

Ponsel Dilarang Masuk Bilik Suara JAKARTA - Jelang pemungutan suara putaran kedua, 20 September 2012 mendatang, KPU DKI Jakarta gencar melakukan sosialisasi aturan kepada Panitia Pemungutan Suara (PPS). Salah satunya aturan larangan membawa ponsel atau handphone tak boleh dibawa masuk ke dalam bilik suara. Ketua Pokja Pendataan Pemilih KPU DKI Jakarta, Aminullah mengatakan bahwa aturan tersebut untuk mencegah terjadinya politik paska bayar. Modus politik uang dengan memotret hasil pencoblosan surat suara untuk mendapat bayaran uang dari pihak yang mengarahkan memilih pasangan tertentu. “Kami sudah buat dalam surat edaran. Bunyinya seperti itu, tidak boleh membawa kamera atau handphone ke dalam bilik suara,” kata Aminullah saat ditemui di kantor KPU DKI Jakarta, Senin (17/9).

‹ Baca Ponsel...Hal 10


„ Calon Walikota Psp nomor urut 2, Rusydi Nasution foto bersama dengan anggota Ikapada sambil menunjukkan jari dua.

Ikapada Siap Menangkan Rusydi-Riswan SIDIMPUAN-Ikatan Pelajar Alumni Padangsidimpuan (Ikapada) yang merupakan kumpulan alumni pelajar asal Kota Psp di

Jakarta menyatakan tekad memenangkan pasangan Rusydi

‹ Baca Ikapada...Hal 10


18 September 2012

KPU Siapkan TPS Khusus di Rumah Sakit JAKARTA - KPU DKI Jakarta memastikan bahwa logistik Pilkada DKI putaran kedua sudah disiapkan. Ketua Pokja Pendataan Pemilih KPU DKI Jakarta, Aminullah mengatakan kotak suara sudah ada di kelurahan dan kecamatan. Amin -sapaan akrab Aminullahmenjelaskan, mulai besok, kotak-kotak suara itu akan disegel dan akan diambil oleh

panitia pemungutan suara (PPS) pada tanggal 19 September 2012 atau sehari sebelum pemungutan suara dilakukan. “Hampir semuanya selesai. Untuk beberapa kelurahan besok sudah bisa menutup kotak menggembok dan menyegel untuk diambil H1 untuk digunakan petugas TPS,” kata Amin saat ditemui di kantor KPU DKI, Jalan Budi Kemuliaan, Jakarta Pusat, Senin (17/9).

Fenomena Jokowi-Basuki, Peringatan Partai Anti Regenerasi JAKARTA - Sekretaris Majelis Nasional Partai Nasional Demokrat (NasDem), Jeffrie Geovanie, menegaskan, fenomena munculnya figur baru yang dipercayai masyarakat seperti kandidat Gubernur DKI Jakarta Joko Widodo (Jokowi)-Basuki Tjahaja Purnama, harusnya menjadi peringatan bagi partai yang tidak menginginkan adanya regenerasi. Karenanya, dia mengingatkan, partai-partai yang masih memertahankan status quo seperti tokoh-tokoh lama untuk maju di pentas politik 2014, harus belajar dari fenomena kepercayaan masyarakat pada Jokowi-Basuki tersebut. “Apa yang terjadi pada Pemilukada di Jakarta, di mana seorang Jokowi dan Basuki tiba-tiba menjadi figur yang sangat dicintai oleh masyarakat Jakarta, seharusnya menjadi pelajaran penting buat partai-partai menatap Pilpres 2014,” kata Jeffrie, dalam keterangan persnya, Senin (17/9). Menurutnya, partai-partai yang tidak bisa membaca tanda-tanda zaman dan masih memertahankan figur lama dalam politik serta tidak memberi kesempatan pada figur muda, maka mereka akan merugi. “Masyarakat butuh figur baru yang inovatif,” tegasnya.

Menurut Jeffrie, masyarakat pasti memberikan apresiasi kepada partai-partai yang berani memunculkan figur-figur baru untuk 2014 nanti. Misalnya, tegas dia, Partai NasDem yang melalui tokoh senior Surya Paloh sudah berani memulai menampilkan wajah-wajah baru dan masih muda sebagai top pimpinan di Partai NasDem. “Figur-figur seperti Patrice Rio Capella, Ahmad Rofiq, Saiful Haq, Endang Tirtana, sebelumnya tidak dikenal di pentas politik nasional, namun lihat saat ini, mereka sudah bisa duduk sama rendah dan berdiri sama tinggi dengan Aburizal Bakrie, Surya Darma Ali, Hatta Rajasa,” katanya. Dia menegaskan, itu semua bisa terjadi karena kebesaran hati Surya Paloh. Karenanya, Jeffrie mengusulkan beberapa partai lain segera membaca keinginan publik. Kemudian, segera membangun suksesi kepemimpinan di negeri ini. Menurutnya, negeri ini harus bebas dari kartel politik yang didominasi figur tua. “Akan terjadi begitu menarik. Jadi sudah sepantasnya figur-figur senior seperti Surya Paloh, Taufik Kiemas, akan dikenang sebagai tokohtokoh yang mewariskan keteladanan dalam kepemimpinannya,” pungkasnya. (boy/jpnn)

Amin menambahkan, logistik pemilu untuk TPS khusus juga sudah disiapkan. TPS khusus itu terdapat di sejumlah rumah sakit. Amin menegaskan, TPS khusus ini tidak berpindah-pindah dan hanya ditempatkan di lokasi tertentu saja. “UU mengatakan tidak ada TPS keliling. Jadi TPS itu kami menamakannya TPS khusus,” ujar Amin. Amin menambahkan, pegawai dan pasien

rumah sakit bisa ikut menyoblos di TPS terdekat jika tidak ada fasilitas TPS khusus. Keluarga pasien yang menunggui pasien juga bisa ikut menggunakanhaksuaradiTPSdekatrumahsakit. “Kalau di dekat rumah sakit ada TPS (khusus), dia ke sana. Tapi kalau nggak ada keluarganya harus berhubungan dengan TPS terdekat agar si pasien bisa memilih,” pungkas Amin. (dil/jpnn)

Fauzi Dominasi Pemberitaan di Media JAKARTA- Pasangan calon gubernur DKI Jakarta Fauzi Bowo-Nachrowi Ramli mendominasi pemberitaan di media massa dalam putaran kedua Pilkada. Hal tersebut berdasarkan riset yang dilakukan Aliansi Jurnalis Independen (AJI) Jakarta. Jumlah berita Fauzi-Nara di putaran kedua 1 Agustus-13 September 2012 mencapai 557 berita, atau lebih banyak dibandinggakan periode pertama 1-31 Juli 2012, yakni 471 berita. Sedangkan pemberitaan tunggal terhadap Jokowi-Ahok di periode kedua berjumlah 477 berita. Konsultan Riset AJI, Ignatius Hariyanto, mengatakan riset yang dilakukannya merupakan penelitian kuantitatif yang menggunakan analisis isi sederhana dengan sampel 16 media. Meliputi, empat media online yakni,, Vivanews dan Okezone. Kemudian empat media cetak nasional yakni Kompas, Koran Tempo, Republika dan Suara Pembaruan, serta empat media cetak lokal yakni Pos Kota, Warta Kota, Indopos dan Koran Jakarta. Lalu, empat televisi yakni RCTI, Metro TV, TV One dan Jak TV. “Mereka (Fauzi-Nara) mendominasi pemberitaan media di putaran kedua Pilkada DKI,” kata Ignatius, saat diskusi tentang Pilkada DKI di Gedung Jakarta Media Center (JMC) Jl. Kebon Sirih, Jakarta Pusat, kemarin (16/9).

Ignatius mengatakan, menjelang putaran kedua Fauzi Bowo-Nachrowi Ramli lebih unggul dalam perolehan berita foto, berita bernada positif sekaligus bernada negatif. “Hanya saja, jika seluruh periode penelitian digabungkan (1 Juni 2012-13 September 2012), Joko Widodo masih unggul tipis dalam perolehan berita foto dan peliputan kandidat secara tunggal,” ujarnya. Koordinator Kompartemen Surat Kabar Indopos, Ariyanto, yang menjadi salah satu pembicara dalam diskusi itu mengakui, pemberitaan mengenai Fauzi Bowo di Indopos memang meningkat selama Pilkada DKI Jakarta. Hal itu tidak lain karena sosok Fauzi yang cukup menarik untuk diberitakan. Sebagai seorang calon gubernur incumbent, setiap gerak-gerik dan kebijakkan Fauzi Bowo memiliki nilai berita. “Atas dasar itulah Indopos memberikan porsi pemberitaan yang lebih kepada Fauzi Bowo,” ungkapnya. Ariyanto menampik, Indopos memberikan porsi pemberitaan lebih karena adanya keberpihakan. Menurutnya, Indopos independen dalam mengelola redaksi. Karena secara perusahaan Indopos adalah perusahaan umum, tidak dimiliki oleh salah satu calon. “Ada 10 rukun iman di Indopos dalam menilai sebuah berita. Salah satunya soal menarik tidaknya berita. Semakin banyak rukun iman yang masuk, itu yang akan dipilih untuk diangkat,” tuturnya.(wok)

Chaidir Ritonga Diyakini Mampu Sejahterakan Petani Sambungan Halaman 9 dalam kesulitan. ‘Kami mendukung Chaidir Ritonga menjadi Walikota pada pemilihan ini, karena ia sarjana pertanian. Tentunya ia mengerti bagaimana kondisi para petani. Ia juga mengerti apa yang harus dilakukan agar penghasilan para petani dapat meningkat. Hanya orang yang berpengetahuan tentang pertanianlah yang mengerti permasalahan petani,” ujar Nurhalimah. Senada dengan itu, Erna Br Simamora mengatakan, dirinya sangat mendukung

Jelang Pencoblosan... Sambungan Halaman 9 Partai Keadilan Sejahtera (PKS) dan pasangan Fauzi Bowo-Nachrowi. Anggota Panwaslu DKI Jakarta, M.Jufri mengatakan bahwa pembagian sembako ditemukan di sejumlah daerah di Jakarta Barat. Sembako yang dibagikan tidak gratis tetapi dijual sangat murah. Warga hanya perlu membayar Rp2 ribu untuk mendapat paket sembako senilai Rp50 ribu. “Tadi malam ada pembagian sembako, saya perintahkan ke PPL untuk cek ke lapangan. Di Jakbar, sembako murah dengan 2 ribu padahal nilainya 50 ribu. Sudah kami antisipasi,” kata Jufri kepada wartawan di kantor Panwaslu DKI, Jalan Suryopranoto, Jakarta Pusat, Senin (17/9). Selain sembako, ada juga laporan pembagian jilbab dan sarung di beberapa wilayah lain di Jakarta. Jufri juga mendapat laporan bahwa ada dugaan yang membagikan sembako adalah istri salah satu pasangan calon gubernur. “Yang membagikan sembako diduga istri pasangan calon. Tapi itu hanya sebatas dugaan dan ada kaitannya dengan pilkada. Kalau hanya mmberi wajar tapi yang msalah kalau ada kaitannya dengan pikada,” paparnya. Menurut Jufri, anggota Panwaslu tingkat kota dan kecamatan telah melakukan pengecekan sudah turun ke lapangan. Namun ketika dicek Panwaslu, aksi pembagian sembako sudah dihentikan. “Ini baru laporan masyarakat kami minta Panwascam, Panwas kota untuk mengecek, sampai di sana sudah berhenti,” imbuh Jufri.(dil/jpnn)

bapak Chaidir jadi walikota, karena sebagai sarjana pertanian ia akan menuntun dan membantu para petani agar hidupnya sejahtera. ‘’Kalau yang bukan orang pertanian, tentu tidak akan memahami masalah pertanian dan kesulitan para petani,” papar petani penggarap ini secara lugu. Mereka menjelaskan, dalam mengelola sawah masih memakai sistim tradisional tanpa sentuhan tekhnologi dan bimbingan tehnis. Sehingga hasil yang mereka dapatkan belum maksimal. Untuk itu mereka berharap agar kepala daerah yang akan datang benar-

benar memahami pertanian khususnya tanaman padi. Sementara itu, S Nasution yang juga petani penggarap di Desa Rimba Soping mengatakan, ia belum bisa meningkatkan hasil panen pada sawah yang dikerjakannya, karena persawahan itu terdapat banyak bebatuan. ”Inilah yang menjadi kendala bagi kami, karena pada sawah yang ada di sekitar ini banyak bebatuan. Sampai saat ini belum ada bimbingan bagi kami bagaimana cara meningkatkan penghasilan sawah ini,“ keluhnya. Dalam konteks pemilihan kepala daerah di

Kota Psp, S Nasution sepakat dengan apa yang disampaikan teman sesama petani, bahwa harapan mereka Chaidir Ritonga yang sarjana pertanian menjadi Walikota Psp. Selain itu dari yang mereka dengar, bahwa Chaidir Ritonga sudah cukup mengerti seluk beluk pertanian, karena ia juga seorang pengusaha di bidang pertanian, terutama perkebunan. Sebagai petani, mereka berharap agar kehidupan para petani di bawah kepemimpinan walikota yang akan datang dapat meningkat. Pada intinya mereka akan mendukung walikota yang dapat meningkatkan tarap hidup petani. (ran)

IKANAS Pusat Akan Menangkan 2R Sambungan Halaman 9 pelantikan pengurus Ikanas yang dihadiri sekitar 400-an warga Ikanas Pusat di Hotel Golden, Jakarta, Sabtu (15/9) malam. Calon Walikota Psp, Rusydi Nasution kepada METRO menuturkan, dukungan yang diberikan Ikanas selain kepada dirinya juga diberikan kepada Letjen (purn) AY Nasution yang akan maju di pilgubsu nanti. Hatobangon Ikanas, Prof DR Adnan Buyung Nasution menegaskan, dukungan itu harus dilakukan dalam bentuk nyata dan harus diikuti oleh seluruh keluarga nasution dan anak boruna. “Berjuang dengan ikhlas, jujur, no money politics, berjalan dengan terhormat. Kita akan bantu dengan segenap potensi yang ada,” tutur advokat senior yang akrab dipanggil bang Buyung ini dihadapan keluarga Ikanas dan anak boruna. Hal ini kata Rusydi yang berpasangan dengan Ir Riswan Daulay dengan nomor urut 2 (2R) dan populer dimasyarakat Kota Psp dengan panggilan Jokowi Ala Sidimpuan ini menambah semangat dan daya juangnya untuk meraih simpati masyarakat Kota Psp dalam memenangi pilkada Kota Psp 18

Oktober mendatang. “Dukungan dan penegasan akan memenangkan kami di pilkada ini menambah dan menjadi suntikan moral bagi kami untuk mantap menatap pilkada ini,” tuturnya. Ketua Ikanas Pusat, Dr Mulia P Nasution menambahkan, dukungan ini bukan hanya dari Ikanas saja, tetapi juga masyarakat Tabagsel yang ada di Jakarta yang jauh-jauh hari sebelumnya sudah memutuskan untuk mendukung sepenuhnya Rusydi Nasution dalam pilkada Kota Psp. Menurut mantan Sekjen Depkeu, dari sejumlah calon yang sudah muncul, nama Rusydi Nasution adalah orang yang paling cocok dan layak memimpin Kota Psp 5 tahun. Alasannya, Rusydi Nasution memiliki kemampuan managerial dan wawasan yang luas serta hubungan yang terjalin dengan baik dengan tingkat pusat. Sehingga menjadi potensi Rusydi untuk bisa membangun Kota Psp kearah yang lebih baik lagi dimasa mendatang. Kemudian ditambah sosok wakilnya yang berasal dari kalangan birokrat murni dan memiliki jiwa petarung kuat dan tidak gila jabatan. “Untuk itu marilah kita semua dengan

potensi yang ada untuk memenangkan anggota Ikanas yang maju di pilkada, baik di pilkada Psp maupun Pilgubsu,” ucapnya. “Harapan kita semoga Rusydi mampu membangun Kota Psp semakin baik. Tentunya ini akan terwujud dengan dukungan sian koum-koum sasudena na adong di Sidimpuan. Salah satu cara bentuk dukungan kita secara konkrit adalah menyampaikannya kepada family untuk mendukung Rusydi pada 18 Oktober mendatang,” tegasnya. Hadir pada acara itu yang dihibur dengan acara musik gordang sambilan, lagu daerah dibawakan oleh Ucok Baba dan Endang S Taurina antara lain Gubernur BI, Dr Darmin Nasution, Letjen (purn) AY Nasution (mantan Pangkostrad), Dr Muslimin Nasution (mantan Menteri Kehutanan), Dr Mulia P Nasution, Drs Lokot Zein Nasution (Depkeu), Ir Rusydi Nasution MM, Mayjen (Purn) AA Nasution, Irjen Pol, Saud Usman Nasution, Ir Mansyur Nasution (executive vice president Bank Mandiri) dan tausiah oleh Dr Riawan Amin Nasution (yang juga putra Gubenur Sumut pertama, Mantan Dirut Bank Muamalat) dan seluruh keluarga besar Ikanas Pusat dan anak boruna. (phn)

Partai Demokrat Siap Menangkan 2R Sambungan Halaman 9 Madani, Asri dan Sejahtera (MAS). Meski waktu tinggal beberapa hari lagi, selaku pengurus juga mesin PD, ia tetap optimis dapat menangkan pasangan santun dan ramah senyum ini. Sementara tim pemenangan dari partai masih terus melakukan sosialisasi kepada masyarakat dengan sembari membagi-bagikan brosur dan kartu nama

serta memberikan pencerahan kepada masyarakat Psp bahwa 2R adalah pasangan yang tidak haus jabatan yang siap memberi harapan baru bagi warga dan anak cucu nantinya. Hingga sampai saat ini, lanjutnya, timnya tetap solid melakukan pendekatan dan silaturahmi kepada masyarakat dan unsur elemen lainnya. Dimana ini merupakan program-program partai dapat terlaksana dan dapat dirasakan segenap lapisan masyarakat.

“Kader partai yang berada di kecamatan kiranya dapat merekrut relawan setiap desa dan kelurahan, serta dapat menampung aspirasi masyarakat. Kemudian dapat menyampaikan secara lugas apa yang diharapkan, juga yang dibutuhkan masyarakat kota Psp saat ini dan seterusnya,” katanya Melalui penyebaran brosur oleh tim dan relawan partai, dirinya berharap masyarakat dapat mendukung apa yang dibutuhkan Psp

demi kemajuan bersama. Karena program yang diusung pasangan profesional ekonom dan birokrat ini bukanlah sekedar janji belaka, bahkan bisa dijabarkan melalui kontrak politik dengan masyarakat. “Kami yakni pasangan anak guru dan anak pedagang ini menjadi pilihan masyarakat Kota Psp berdasarkan hati nurani untuk kemajuan Kota Psp dimasa mendatang,” ujarnya optimis. (phn)

Ikapada Siap Menangkan Rusydi-Riswan Sambungan Halaman 9 Nasution STP MM-Ir Riswan Daulay MM (2R) di pilkada Psp 18 Oktober mendatang. Demikian dikatakan Ketua Ikapada, Ir Djangga Lubis pada cara Halal Bi Halal Ikapada Kota Psp yang dihadiri sekitar 500an anggota Ikapada dari berbagai daerah yang dilaksanakan di Wisma Bhayangkari Mabes Polri, Minggu (16/9) lalu. Ir Djangga Lubis dengan tegas menyampaikan, Ikapada mendukung penuh dan

meminta agar segala potensi keluarga yang berada di Kota Psp mendukung RusydiRiswan yang telah diketahui kredibilitasnya, kemampuannya dan integritasnya. “Kita orang perantauan tidak punya motif kepentingan apa-apa. Kita hanya ingin melihat Kota Psp jauh lebih baik lagi. Kita tidak mungkin mendukung dan mengirimkan orang yang akan merusak kota kelahiran kita sendiri. Kita bekerja diluar Psp dan kita punya kewajiban membangun kota kelahiran kita dan peduli akan pem-

banagunan Kota Psp dan masyarakatnya,” jelas Djangga. Sementara itu, Calon Walikota Psp, Rusydi Nasution STP MM dengan nomor urut 2 yang pada hari itu bertindak sebagai ketua panitia acara dalam sambutannya memohon doa restu dan dukungan dalam Pilkada Kota Psp ini. Dikatakannya, keinginannya maju di pilkada KOta Psp juga atas dasar pertimbangan dari seluruh keluarga besar Ikapada, Ikanas, dan juga masyarakat perantauan lainnya di Jakarta dengan tujuan untuk membangun Kota Psp

kearah yang lebih baik lagi. Ditambahkan anak mantan guru rendahan ini dengan latar belakang dirinya sebagai profesional ekonom dan pasangannya birokrat yang tidak gila jabatan ini, mereka mengharapkan dukungan dari seluruh pihak, sehingga nantinya dengan izin dan ridho Allah SWT diamanahkan warga Kota Psp untuk menjadi pemimpin di Kota Psp dan bersama-sama membangun Kota Psp menjadi lebih baik dari yang sekarang ini. (phn)

Pendiri PKS Prediksikan Jokowi Unggul 10 Persen JAKARTA - Salah satu tokoh pendiri Partai Keadilan Sejahtera (PKS), Yusuf Supendi, memperkirakan pasangan Joko WidodoBasuki T Purnama akan unggul dari Fauzi Bowo-Nachrowi Ramli pada Pemilukada DKI Jakarta. Yusuf memprediksikan selisih antara Jokowi -panggilan Joko Widododengan Foke -sapaan Fauzi Bowo- sekitar 10 persen. Hal itu disampaikan Supendi saat ditemui di sela-sela acara halal bihalal masyarakat Garut dan Sunda di Taman Mini Indonesia Indah (TMII), Minggu (16/9). Menurut Supendi, prediksinya itu bukan asal-asalan. “Saya bukan sebagai pendukung Jokowi, tapi sebagai politisi saya sudah menghitung sejak putaran pertama. Dukungan baru ke Foke dari PKS, bekas pendukung Alex-Nono maupun PPP itu maksimal cuma 16,39 persen,” kata Supendi. Menurutnya, keputusan PKS mendukung Foke juga tak serta-merta diikuti kader di tingkat bawah. Meski mesin PKS bergerak, kata Supendi, namun belum tentu kader dan simpatisan partai yang sebelumnya bernama Partai Keadilan itu mau mengikuti instruksi untuk memilih Foke. “PKS itu itu yang jalan paling strukturnya, sementara di bawah sangat mungkin apatis dan golput. Suara PKS hanya tingga 1/3 dari 2004. Lihat saja saat suara Zulkieflimansyah maju di Pilkada Banten, atau Jazuli Juwaini di Tangerang dan kemarin Doktor Hidayat (Hidayat Nur Wahid) di DKI. Sudah 2/3 suara hilang,” ucapnya. Supendi juga mengatakan, Jokowi bisa saja menang mudah meski tetap ada syaratnya. Syarat pertama, katanya, 42,6 persen pendukung Jokowi pada putaran pertama tetap konsisten. Syarat lainnya, Jokowi bisa membangun koalisi besarbesaran bersama rakyat. Supendi melihat ada tanda-tanda tentang konsistensi pemilih Jokowi maupun upaya membangun koalisi besar meski tanpa disadari. Selain itu, Jokowi juga masih bisa mendapat limpahan suara dari pemilih golput. “Yang golput itu kan biasa coba-coba, ingin perubahan. Sangat mungkin ke Jokowi. Hitungan saya, ada selisih 10 persen antara Jokowi dengan Foke,” kata Supendi yang pernah memperkirakan pasangan HidayatDidik meraih suara 527 ribu namun dalam kenyatannya meraih 508.123 suara. Apakah dengan demikian Supendi mendukung Jokowi? Pria kurus berambut dan berjanggut putih itu hanya memberi jawaban diplomatis. “Saya bukan pendukungnya, tapi seharusnya realistis saja,” kata pria asal Bogor yang sejak 1985 memegang KTP DKI Jakarta itu.(ara/jpnn)

Polda Jamin Keselamatan Kandidat Sambungan Halaman 9 Widodo- Basuki Tjahaya Purnama. “Kita sudah siapkan personel di setiap tempat pemungutan suara, persiapan sudah final 95 persen,” ujar Kabidhumas Polda Metrp jaya Kombes Rikwanto di Jakarta kemarin. Mantan Kapolres Klaten itu menjelaskan, hingga H-3 tidak ditemukan gangguan keamanan yang rawan. Menurut Rikwanto, masing-masing kandidat akan dikawal oleh lima petugas. “Ada pengamanan tertutup dan terbuka, yang tertutup disesuaikan dengan keinginan masing-masing kandidat supaya tidak menganggu aktivitas,” katanya. Alumni Akpol 1988 itu menjamin aparat akan netral dalam pengamanan. “Tidak mungkin berpihak. Termasuk yang di TPS nanti di luar lokasi pencoblosan,” katanya. Jika diperlukan, tambahnya, ada 2200 anggota TNI dari Kodam Jaya yang siap digerakkan. “Kita yakin akan damai dan lancar,” ujarnya. Secara terpisah, Neta Sanusi Pane dari Indonesia Police Watch menilai potensi gangguan keamanan saat pilkada masih tinggi. “Ada ancaman tawuran atau bentrok antar kelompok masyarakat yang harus diantisipasi sejak sekarang,” katanya. Polisi, kata Neta, harus mewaspadai para pendukung yang mungkin tidak puas dengan hasil pilkada Kamis nanti. “Kalau dari kandidatnya saya yakin akan menerima, tapi massa yang dibawah ini yang harus dipetakan dan dicermati,” ujar penulis buku Jangan Bosan Kritik Polisi ini.(rdl)

Ponsel Dilarang Masuk Bilik Suara Sambungan Halaman 9 Menurut Amin, KPU DKI juga sudah mengatur larangan membawa ponsel ini dalam putaran pertama Pilkada DKI bulan Julli 2012. Hanya saja, pihaknya alpa mengingatkan kembali jelang hari pemungutan suara. Komisioner KPU DKI itu menegaskan, tidak ada sanksi bagi pemilih yang melanggar aturan membawa ponsel ke dalam bilik suara. Oleh karenanya, PPS yang ada di tempat pemungutan suara (TPS) harus selalu mengingatkan agar pemilih berlangsung secara adil. “Itu diingatkan. Tidak ada sanksi, tapi supaya fair,” imbuhnya. Aminullah juga mengingatkan agar PPS mewaspadai penyobekan surat suara. Surat suara yang dirobek akan membuat suara menjadi tidak sah. “Kalau ada penandaan pada kertas suara dengan cara merobek itu juga dinyatakan tidak sah. Merobek kertasnya juga tidak sah. Ini upaya-upaya kita supaya tidak ada kecurigaan-kecurigaan ada politik uang dari berbagai pihak,” papar Aminullah. (dil/jpnn)


18 September 2012

Koordinator Kontras Haris Azhar.

“Terus terang aja, saat ini hingga kedepannya nanti sedang berlangsung penguatan untuk rezim security. Indikasi paling kuatnya dengan terkesan dipaksakannya pengajuan RUU Kamnas ini masuk ke dalam pembahasan undangundang,”

“(Penyidik KPK dari TNI) Itu tidak benar. Kalau mau tentu harus melepaskan dulu militernya, kalau dia melepaskannya, siapa-siapa saja boleh,” Juru Bicara KPK, Johan Budi.

Menteri Keuangan Agus Martowardojo.

“Banyak pelanggar hukum yang tidak ketahuan. Sekarang kita yakinkan ke pengadilan bahwa mereka harus diproses. Jadi, tidak hanya cukup diproses di pengadilan saja. Harus diyakinkan bahwa pengadilan nanti memberikan hukuman mati kepada koruptor,”

Kirim Opini Anda ke email: metrotabagsel Maksimal tulisan 5.000 karakter

Sikap Kami Penyidik Independen untuk KPK SINYALEMENbahwaupayapemberantasankorupsi di negeri ini penuh tantangan dan bagai jalan mendaki bukanlahisapanjempol.Penegakhukumtidaksekadar menghadapi risiko berat arus balik perlawanan para koruptor, tetapi juga harus menerima gangguangangguan sporadis yang datang dari berbagai penjuru. Salah satu gangguan itu ialah ditariknya 20 penyidik Polri dari institusi Komisi Pemberantasan Korupsi (KPK), pekan lalu. Penarikan penyidik Polri sebanyak itu merupakan peristiwa pertama kalinya sejak KPK berdiri.Penarikansebelumnyamemangpernahterjadi, tetapi jumlah yang ditarik paling banyak hanya tiga orang. Polri beralasan penarikan itu dilakukan karena masa kerja mereka sudah habis. Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal Boy Rafli Amar mengatakan kepolisian menyadari penarikan tersebut membuat komisi antikorupsi tersebut kekurangan sumberdayamanusia.Terkaitdenganhalitu,kepolisian mengaku siap memberikan pengganti. Bagi KPK, penarikan dalam jumlah besar tersebut jelas mengagetkan dan mengganggu. Mengagetkan karena beberapa penyidik yang ditarik itu baru bertugas satu tahun hingga dua tahun di KPK. Padahal, Peraturan Pemerintah Nomor 63 Tahun 2005 tentang Sistem Manajemen Manusia Sumber Daya KPK menyebutkan seorang penyidik Polri bisa bertugas di KPK selama empat tahun dan kontraknya bisa diperpanjang hingga empat tahun lagi. Itu artinya beberapa penyidik yang ditarik tersebut belum habis benar masa kerja mereka di KPK. Penarikan itu juga mengganggu karena dilakukan di tengah upaya gencar KPK menyidik kasus-kasus kakap seperti kasus Bank Century, Hambalang, dan Wisma Atlet. Juru bicara KPK Johan Budi memberikan gambaran bahwa satu penyidik di KPK bisa menangani tiga hingga empat kasus korupsi. Dengan hilangnya 20 penyidik, berarti nasib 80 kasus korupsi terancam terkatung-katung. Karena itulah, kita menyesalkan penarikan penyidik secara besar-besaran dari Polri itu. Penarikan itu menjelaskan kepada publik secara terang-benderang bahwa ada yang tidak mulus dalam koordinasi dua institusi penegak hukum tersebut. Namun, di sisi yang lain, penarikan 20 penyidik Polri dari KPK itu semakin menunjukkan KPK sangat membutuhkan penyidik milik sendiri, yang melekat secara organis di tubuh KPK. KPK tidak boleh bergantung pada penyidik dari kepolisian. Selain itu, KPK pun harus memiliki penyidik yang independen. Dengan memiliki penyidik independen, secara substantif penanganan perkara di KPK tidak bisa diintervensi pihak lain. Perang melawan korupsi memang bukan pekerjaan menyenangkan. Berkali-kali kita ingatkan dalam forum ini bahwa perang melawan korupsi butuh napas panjang, bahkan amat panjang karena ia merupakan perang tiada akhir.Karena itu, gangguan atas perang melawan korupsi itu mesti dipahami sebagai keniscayaan yang sudah diperhitungkan. Jadi, tidak ada alasan bagi KPK untuk menyerah hanya karena kehilangan sejumlah penyidik. (**)

Belajar dari Matsushita Beberapa hari yang lalu, ramai diberitakan oleh banyak media, di Jepang terjadi sebuah cerita yang mengenaskan yakni Menteri Jasa Keuangan, Tadahiro Matsushita, ditemukan tewas di kediamannya, di Tokyo, Jepang. Matsushita tewas diduga karena bunuh diri. Bunuh diri itu dilakukan dikarenakan dua hari sebuah tabloid di negeri Saudara Tua kita itu akan membongkar skandal Matsushita dengan seorang perempuan lain. : Ardi Kepergian Matsushita selama-lamanya itu tentu berpengaruh terhadap pemerintahan eksekutif Jepang sebab banyak rekannya menganggap ia adalah politisi berpengalaman dan kualitas kerjanya tinggi. Matsushita melakukan demikian, untuk menebus dosa. Hal demikian untuk menunjukan sebuah kehormatan bagi dirinya. Ia berpikir lebih baik mati berkalang tanah daripada hidup menanggung malu. Langkah yang dilakukan Matsushita di Jepang sendiri bukan suatu hal yang baru dan pertama. Bunuh diri dengan alasan kesalahan yang dilakukan dianggap sebagai sebuah kehormatan. Dengan tindakan yang disebut harakiri, kematian untuk menembus kesalahan, atau kamikaze yang artinya kematian untuk persembahan kepada Kaisar demi kemulyaan negara dan bangsa Jepang, merupakan tradisi turun

Winangun temurun yang terjadi di Jepang hingga saat ini. Dengan hal-hal demikianlah maka dosa yang dialami bisa ditembus atau kemulyaan roh di Gunung Fujiyama bisa tercapai. Kejadian bunuh diri karena malu atas kesalahan yang dilakukan sepertinya hanya terjadi di Jepang, kalaupun ada di tempat yang lain, seperti menembakan pistol di kepala, itu hanya sesekali terjadi. Dengan sikap demikianlah maka pejabat di Jepang selalu dituntut untuk hidup dan bersikap yang baik, sesuai dengan hukum maupun norma dan etika Shinto atau agama asli Jepang. Dengan tradisi seperti itu, maka dari Jepang kita nyaris tidak pernah mendengar apa yang namanya korupsi, kolusi, atau nepotisme yang dilakukan pejabat. Bila kita mendengar hal yang demikian, maka tidak lama lagi, pelaku akan melakukan hal bunuh

diri. Dengan tindakan satria itulah maka pejabat di negeri matahari terbit itu berlomba-lomba untuk menunjukan kebaikannya. Sayangnya tradisi yang baik itu, mundur atau bila perlu bunuh diri bila melakukan kesalahan, tidak menular ke banyak negara, apalagi di Indonesia. Sayang selama Jepang menjajah Indonesia, tradisi itu tidak ditularkan. Mungkin kalau menjajah selama 350 tahun, tradisi itu bisa hidup di masyarakat, sayangnya cuma 3,5 tahun. Bagi pejabat di Indonesia apa yang dilalukan Matsushita itu disebut tindakan yang konyol dan bodoh. Pejabat di Indonesia beranggapan mengapa sudah menjabat enak-enak menjadi menteri harus melakukan bunuh diri. Pendapat pejabat di Indonesia demikian, sebab tindakan seperti korupsi, kolusi, nepotisme, bahkan selingkuh merupakan hal yang biasa. Justru ada ada anggapan, kalau tidak melakukan seperti demikian sebuah kebodohan sebab tidak bisa menggunakan jabatan yang ada untuk mengeruk uang negara atau bersenang-senang dengan menggunakan fasilitas negara. Bahkan di Indonesia, seorang pejabat yang sudah nyata-nyata melakukan tindakan korupsi, kolusi, nepotisme, dan selingkuh, masih bisa berkoar-koar di depan orang banyak, bahkan masih sem-

pat-sempatnya ikut pilkada atau pileg. Mereka berdalih tidak merasa bersalah meski pengadilan sudah memutus salah. Pejabat itu selalu berdalih mengatakan, saya menjadi korban politik. Maraknya pejabat yang tidak mundur apalagi bunuh diri di Indonesia bisa jadi karena kultur Indonesia dan Jepang berbeda. Jepang memiliki budaya kesatriaan yang tinggi, tanggung jawab adalah nomer satu. Sedang di Indonesia tradisi seperti itu, yakni tegas dan tanpa toleransi bila melakukan kesalahan tidak terbangun. Perbedaan inilah yang membuat banyak pejabat berlindung di balik budaya Indonesia yang sangat toleransi kepada korupsi, kolusi, nepotisme, dan skandal sex. Hal demikianlah yang membuat banyak pejabat di Indonesia mengatakan bahwa mundur bukan budaya Indonesia. Bahkan ada yang mengatakan mundur sebuah bentuk tindakan yang tidak bertanggungjawab. Meski soal keyakinan kematian antara orang Jepang dan Indonesia ada persamaan, namun dalam penerapannya berbeda. Kalau keyakinan orang Jepang mati dengan bunuh diri untuk kehormatan diri, Kaisar, dan negaranya, itu syah dan wajib. Lain dengan keyakinan yang ada di tengah masyarakat kita. Keyakinan di tengah masyarakat, bunuh diri dilarang keras. Toh kalaupun rela mati untuk

kepentingan yang lain, itu masih terjadi perdebatan boleh atau tidaknya. Hal inilah yang membuat mengapa bunuh jarang terjadi di tengah masyarakat. Di Indonesia orang bunuh diri karena mengalami gangguan jiwa. Tak ada budaya mundur inilah yang membuat pemerintahan berjalan tidak efektif. Orang yang sudah benar-benar tak mampu bekerja dan sering gagal masih saja bertahan memimpin sebuah lembaga, institusi, atau pemerintahan. Matsushita yang bunuh diri disebabkan media mau membongkar skandal sex-nya, sedang di Indonesia seorang pejabat yang dari hari ke hari, bahkan dari bulan ke bulan, sudah dikupas oleh koran, majalah, televisi, radio, dan media massa, akan tindak korupsinya, tetap saja bertahan sebagai pimpinan. Akibat dari tak mau mundur akibat kesalahan inilah yang membuat energi menjadi terkuras karena serangan dari kelompok oposisi dan masyarakat, akibatnya pemerintahan berjalan tidak efektif. Lain dengan di Jepang, mundur akibat kesalahan membuat pemerintahan menjadi efektif, sebab batu sandungan yakni pejabat yang melakukan kesalahan itu hilang, sehingga oposisi berhenti menyerang. (**) Penulis adalah Pengamat Politik


18 September 2012

etelah putus dari Anji eks personil ‘Drive’, Rini ‘Idol’ mengaku kapok berpacaran dengan pria yang memiliki profesi sama. Kalaupun nantinya dia memiliki kekasih baru, Rini ingin mencari yang bukan dari sesama artis. “Nggak usah seprofesi biar nggak ribet dan lain-lain. Bukan hanya enak karena


MADONNA kembali menyulut permusuhan dengan Lady Gaga. Kali ini Madonna menyebut Gaga imitasi, dalam konser di Atlantic City, New Jersey, Amerika Serikat. Permusuhan Madonna dan Lady Gaga dimuali ketika lagu Born This Way’milik Madonna dibandingkan dengan lagu Madonna berjudul Express Yourself(1989). ”Aku aku akan mendedikasikan lagu berikut ini untuk Lady Gaga. Anda ingin tahu? Karena aku mencintainya. Aku sungguh-sungguh mencintainya. Imitasi adalah bentuk sanjungan tertinggi untuknya,” kata Madonna di konsernya, seperti dikutip Contactmusic.Madonna juga sebelumnya bercanda kalau ia dengan senang hati membantu Gaga untuk menulis lagu. ”Suatu hari, secepatnya, kami akan berada di panggung bersama-sama. Tunggu saja,” katanya. (idc)

sama-sama dibidang entertainment. Tapi mandang pribadinya juga. Aku jalin hubungan yang beda-beda shift bukan karena pekerjaannnya aja,” ujar Rini diRCTI, Kawasan Kebon Jeruk, Jakarta Barat, Senin (17/9). Rini mengakui kini dia memiliki kekasih yang berprofesi sebagai pekerja kantoran.Pria yang bersuku

Jawa ini sudah diperkenalkan kepada kedua orangtuanya. tapi menurut Rini, kedua orangtuanya tahu ia berpacaran. “ Yang jelas udah tahu kalau kitanya pacaran. Nggak mau nanya-nanya juga sih karena masih nyantai. Ini masih ditahap ini dulu,” ujarnya. Rini yang sudah berpacaraan hingga 3 tahun hingga kini

Syahrini ikut hadir di konser Noah. Syahrini yang duduk di barisan paling depan terlihat menikmati lagu-lagu yang dibawakan Ariel. Mantan duet Anang Hermansyah ini pun mengucapkan selamat atas kembalinya Ariel bersama teman-temannya. “Congratulation untuk Noah yang sudah konser, suatu pencapaian yang patut dibanggakan dan diacungi jempol. Dan patut diapresisi oleh semua seniman Indoensia,” ucapnya saat ditemui di Gandaria City, Jakarta Selatan, Senin (17/9)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Peruntungan: Tidak ada salahnya jika di hari ini Anda mulai membuka agenda-agenda yang ada dan segera menyusun langkahlangkah yang harus dilakukan di masa mendatang agar pada saatnya nanti bisa lebih santai dan ringan berjalan. Asmara: Tidak perlu mengusik hatinya yang lagi kacau sebab sudah cukup banyak yang menjadi beban pikirannya.


dini hari. Sebagai sesama musisi, Syahrini selalu mendukung kehadiran Noah. Menurutnya, Noah patut mendapat apresiasi sesama musisi. “Akhirnya dia kembali lagi ke industri musik Indonesia. Aku

(21 Desember -19 Januari)

Peruntungan: Selesaikan tugas-tugas yang masih menjadi beban Anda selama ini. Jangan terlalu asyik apalagi meremehkan persoalan yang ada, mumpung di hari ini perbintangan Anda lagi mujur-mujurnya. Asmara: Konsekuensi Anda dalam berbicara akan dibuktikan olehnya, maka dari itu berhatihatilah. Jangan sampai dicap pembual besar.


(20 Januari - 18 Februari)

Peruntungan: Peluang yang muncul secara tiba-tiba sebaiknya bisa disikapi dengan positive thinking dan segera ditindaklanjuti. Jangan buang waktu percuma. Asmara: Tak perlu tersinggung dulu dengan kata-katanya itu. Jika Anda renungkan maka Anda pasti bisa menemukan kebenaran dalam perkataannya itu.


19 Februari - 20 Maret

Peruntungan: Ada baiknya bersikap lebih tegas dan hilangkan dulu segala pikiran-pikiran yang ngambang dan tidak punya keyakinan itu. Cobalah berpikir dengan lebih optimis lagi sehingga bila ada peluang yang lewat tidak sampai berlalu begitu saja. Asmara: Hilangkan sikap egois. Cobalah Anda lebih bisa mengalah padanya.


(21 Maret - 20 April)

Peruntungan: Kalau permasalahan ini terus dibiarkan dan tidak segera ditindaklanjuti, maka keuntungan besar yang sudah di depan mata itu akan hilang lenyap begitu saja. Asmara: Keresahan hati kini terjawab sudah dan kenyataannya tidak seburuk apa yang Anda bayangkan.


(21 April - 20 Mei)

Peruntungan: Masih cukup ada rintangan yang harus diwaspadai, walau begitu tak perlu berkecil hati dan tak perlu risau akan ejekan yang muncul. Asmara: Jagalah selalu keserasiannya. Kalau ada pihak yang ingin mengacaukan suasana jangan dibiarkan saja.


(21 Mei - 20 Juni)

Peruntungan: Masalah berat sudah mereda dan menyingkir sehingga tak perlu cemas lagi. Di hari ini tidak ada salahnya jika Anda berani membuat keputusan penting karena itu memang sangat mendesak dan perlu gerak cepat, yang penting hati harus selalu yakin dengan keputusan yang telah dibuat. Asmara: Jangan ragu untuk bicara apa adanya kepada pasangan Anda karena itu akan lebih baik dan kesalahpahaman bisa terhindarkan.


(21 Juni- 20 Juli)

Peruntungan: Di hari ini jangan sembrono, terutama dalam memutuskan untuk menjalankan suatu rencana sebaiknya dipikirkan secara matang. Meskipun peluang cukup banyak, jika Anda tidak pAndai-pAndai mengolahnya maka hanya akan terbuang percuma saja. Asmara: Perhatian adalah nomor satu, maka dari itu luangkan waktu Anda walau sedikit untuk menelpon dia supaya komunikasi tetap terjalin baik.


(21 Juli-21 Agustus)

Peruntungan: Di hari ini aturlah waktu seefisien mungkin. Jangan seenaknya sendiri walaupun itu hanya sepele saja, akan tetapi jika tidak ditanggapi dan dipikirkan secara serius maka akan bisa menjadi problem yang cukup sulit untuk dipecahkan. Asmara: Apa sih enaknya backstreet kalau Anda masih punya pacar yang bisa diAndalkan?


(23 Agustus-22 September)

.Peruntungan: Berusahalah untuk lebih terkoordinasi dan terkonsep, walau untuk permulaaannya memang terasa berat dan menjemukan akan tetapi untuk langkah ke depannya akan benar-benar terasa manfaatnya. Asmara: Bersabar dan yakinlah bahwa semua ini pasti akan berlalu, untuk itu yang tenang saja.


(23 Oktober - 22 November)

Peruntungan: Kerjasama dengan pihak luar sebaiknya benar-benar dipikirkan secara mendalam. Jangan hanya berlandaskan faktor perasaan saja sehingga sikap baik Anda ini tak disalahgunakan oleh mereka untuk mengambil keuntungan sendiri. Asmara: Jadilah orang yang pandai mensyukuri nikmat sehingga tak perlu punya pikiran yang macammacam.


( 23 November - 20 Desember)

Peruntungan: Manfaatkan kesempatan yang ada di hari Sabtu ini walaupun kecil karena jika dikerjakan dengan sungguhsungguh maka akan besar hasilnya. Asmara: Jangan negative thinking kepadanya. Itu tidak ada untungnya, hanya akan menambah kacau suasana saja.

MENYANDANG status janda tak membuat Chantal Della Concetta merasa terbebani. Presenter dan model majalah dewasa ini mengaku tak perlu repot dengan statusnya itu. ”Nggak usah dibikin repot, santai aja. Kalau pikirannya repot, jadi repot. Kalau pikirannya ribet, bakal ribet. Kalau kita santai ya santai,” ujar Chantal. Misalnya ketika sang anak sedikit mengalami gangguan kesehatan, Chantal menyikapinya dengan tenang dan bijak. “Anak batuk sih wajar, ya namanya juga udara kayak gini. Kalau segala macam (kegiatan) nggak boleh, kasihan juga,” ujarnya. Chantal pernah menikah dengan Hans Lazuardi dan dikaruniai seorang putra, Nathaniel Trevor Lazuardi, pada 2004,

dan seorang putri, Mazel Peach Lazuardi, pada 2009. Pernikahan mereka hanya bertahan beberapa tahun. Chantal juga tidak merasa keberatan dengan klaim dirinya jadi salah satu icon wanita terseksi di tanah air. “Emang image seksi ada yang salah? Buat aku image seksi itu confident. Seksi itu kita merasa nyaman untuk tubuh kita, kenapa kita takut ama tubuh kita,” ucap Chantal. Semua orang menurut Chantal berhak untuk menjadi seksi. Baik laki-laki ataupun perempuan. Karena setiap orang mempunyai tipikal keseksian yang tak sama. ”Kenapa kita harus takut jadi seksi terutama perempuan. Lakilaki juga belum tentu nggak seksi kan, ada faktor seksinya. Mungkin berbeda dengan perempuan. Mungkin bagi sebagian perempuan, laki-laki pakai kemeja putih udah seksi ataupun lainnya,” lanjut presenter acara dewasa Sexophone ini. Selain itu, seksi bukan hanya terpaku pada bentuk tubuh yang menawan. Sebuah intelektualitas bagi Chantal juga menunjang sebuah keseksian seseorang. “Perempuan yang pintar menurutku itu seksi, perempuan yang percaya diri juga seksi,” cetusnya. Tatto di mata Chantal juga dianggapnya karya seni manusia yang indah. Dia sengaja menatto beberapa bagian tubuhnya agar indah dilihat orang lain. Tetapi sayang, ia tidak mau menyebut jumlah tatto yang ada di tubuhnya dan bagian-bagian tubuhnya yang ditatto. (BCG/jpnn)

belum memikirkan untuk menuju ke mahligai bahtera rumah tangga. Rupanya Rini masih ingin mengumpulkan pundi-pundi uang dan mengembangkan karirnya. “ Masih pengen menikmati masa yang sibuk kerja mencoba satu yang baru. Kerjaannya masih nyanyinyaanyi aja belum coba bidang lain,” tandasnya. (tr/int)

salah satu yang mensupport dan mengapresiasi karyakarya mereka,” katanya. Lantas bagaimana tanggapan Syahrini perihal konser 5 negara 2 benua yang berhasil dilaksanakan Noah? “Luar biasa keren, lagu-lagu barunya aku juga suka,” ucapnya. (nov)

KRISTEN Stewart sepertinya tak tanggung-tanggung dalam melepas image Bella Swan yang sudah melekat kepadanya bertahun-tahun. Bahkan untuk beradegan topless di film terbarunya ‘On the Road’ Kristen tampak tak canggung. ”Itu tak menggangguku (adegan topless),” ujarnya seperti dilansir MTV News, Senin (17/9). ”Ketika sampai di lokasi syuting, hanya ambil napas dan biarkan itu terjadi,” tambahnya. Kristen merasa ia sudah cukup dewasa untuk melakukan adegan tersebut. Menurut aktris kelahiran 9 April 1990 itu, ia tak akan berani melakukannya jika usianya baru 17 tahun. Di film itu, Stewart berperan sebagai Marylou, istri Dean Moriarty (Hedlund) yang masih berusia 16 tahun. Dia adalah gadis yang memiliki semangat kebebasan, dan sangat menyukai mariyuana dan seks. Pasangan pengantin muda itu kemudian bertemu dengan Sal Paradise yang mengajak mereka unutk melakukan perjalanan setelah ayahnya meninggal dunia. Haus akan kebebasan, mereka menemukan ‘dunia lain’ yang cukup gila. Untuk perannya sebagai Marylou di film itu, Stewart juga rela mengecat rambutnya yang gelap menjadi pirang. “On the Road” akan terlebih dahulu diputar di Toronto International Film Festival 2012 bulan ini, sebelum tayang di bioskop AS pada 21 Desember mendatang. (dtc/int)

SUSAN Bachtiar phobia memakai sepatu tertutup. Karena memakai sepatu jenis ini, Susan harus menghirup aroma tidak sedap pada kakinya. Tidak hanya itu menurutnya sepatu tertutup dapat menimbulkan panas pada kakinya. Jadi jika berpergian Susan lebih nyaman pakai sepatu yang terbuka. “ Lagipula just my style aja. Pake sepatu tertutup itu kalau lagi terpaksa aja. Soalnya lebih ke negara yang memang pakai boots,” ujar Susan di Press conference OLAY Changing Life, Diva Reunion Concert, Hard Rock, Jl MH Thamrin, Jakarta Pusat, Senin (17/9). Bintang film ‘Perempuan Punya Cerita’ ini mengaku lebih cocok pakai sepatu berbahan kain yang dapat menyerap keringat. “Seperti katun yang paling aman. Apalagi untuk perempuan, kondisi badannya kan lain dari pria Untuk kesehatan wanita, dokter juga banyak menyarankan untuk memang bisa memakai bahan katun,” ujarnya. Tetapi karena begitu banyak model, katun terbatas jadi diperlukan perpaduan bahan yang lain. ”Tapi memang perpaduan bahan membuat fashion menjadi lebih menonjol,” ujarnya. Sekedar diketahui mantan isteri Sunardi ini mengatakan khusus masalah fashion, biasanya ia memakai apa yang dianggap nyaman dan cocok dengan gayanya. “ Nggak peduli apa gaya bajunya atau mereknya apa, yang penting comfortable,” tandasnya. (tr/int)


18 September 2012

Penyelundup TTelan elan Uang 40.000 Dolar MEDELLIN- Dua orang yang menelan uang tunai masingmasing 40.000 dolar AS atau sekitar Rp378 juta sebelum memasuki Kolombia ditangkap kepolisian setempat. Kedua orang ini ditangkap secara terpisah selama akhir pekan lalu di bandara internasional Medellin saat tengah mencoba terbang ke Kosta Rika. Di masa lalu, para ‘kurir’ ini menggunakan cara yang sama untuk menyelundupkan narkoba ke luar Kolombia. Mereka menelan paket narkoba bernilai ribuan dolar Amerika untuk dijual di pasaran luar negeri. Namun, pemerintah Kolombia mengatakan mereka belum pernah menemukan cara seperti ini untuk menyelundupkan uang ke negeri itu. “Tipe pencucian uang seperti ini di Kolombia relatif baru,” kata Direktur Imigrasi Provinsi Antioquia, Kolombia, Wilson Patino. Kedua tersangka, seorang warga Kolombia dan seorang lainnya warga Venezuela, disebut sebagai ‘kelas berat’ karena


MICHIGAN- Dari kejauhan, anjing berwarna hitam bernama Zeus yang berasal dari Michigan, AS ini, mungkin dikira seekor kambing. Anjing tersebut baru berusia 3 tahun, namun tinggi badannya sudah mencapai 1,11 meter jika dihitung dari kaki hingga bagian teratas kepalanya. Kakinya yang panjang membuatnya berbeda dari anjing-anjing kebanyakan. Karena keunikannya ini, Zeus kemudian

dinobatkan sebagai anjing tertinggi di dunia, versi The Guinness World of Record. Sebuah foto yang dilansir di Huffingtonpost memperlihatkan Zeus dengan kaki yang panjang sedang melihat keluar jendela, dengan posisi kepala yang lebih tinggi dari wastafel tempat mencuci piring di rumah majikannya. Jika Zeus berdiri dengan kedua kaki belakangnya, ia akan setinggi 2,22 meter dan ia akan lebih tinggi dari pemiliknya, Denise Doorlag. Keunikan Zeus ini mengalahkan anjing

perut mereka seolah tak kesulitan menampung benda-benda itu. Pejabat setempat tak memberikan penjelasan rinci soal bagaimana uang tersebut dikeluarkan dari perut kedua penyelundup itu. Namun, mereka membeberkan bagaimana salah satu penyelundup bisa ditangkap. Tersangka warga Kolombia menarik perhatian aparat keamanan ketika terlihat gugup dan tertekan saat harus melewati sistem keamanan bandara. Dia kemudian diminta untuk melalui pemeriksaan sinar X yang kemudian mendeteksi adanya benda tak lazim di dalam perutnya. Benda-benda itu ternyata 40 kapsul yang di tiap kapsul berisi uang 1.000 dolar Amerika Serikat. Pemerintah Kolombia yakin para penyelundup narkoba berada di belakang upaya aneh ini meski tak menutup kemungkinan organisasi kejahatan lain seperti penyelundup senjata atau manusia yang mendalangi penyelundupan uang ini. (kc/int)

tertinggi di dunia sebelumnya, Giant George, yang tingginya hanya berbeda sekitar 1 inci atau sekitar 2,5 cm lebih pendek dari Zeus. Doorlag mengatakan bahwa Zeus yang memiliki berat badan 77,5 kg ini bisa menghabiskan 15 kilogram kantong makanan selama dua minggu. Ia juga mengatakan bahwa saaat ini ia membutuhkan sebuah mobil van sebagai alat transportasi yang bisa membawa Zeus ke manapun. (kc/int)

Demam Gangnam Style yang Mendunia

Gerakan dansanya yang kocak membuat orang terbahak. Virus Gangnam Style pun mendunia. Tak lebih dari dua bulan, videonya di situs YouTube berhasil mendapat lebih dari 190 juta hit! Psy merilis lagu Korean pop (K-pop) dalam single bertajuk ‘Gangnam Style’ pada 15 Juli 2012. Humor dalam lirik lagu ini serta gaya dansa Psy yang kocak, menggelitik setiap orang yang melihat. Gayanya ditiru, tidak hanya di seantero negerinya, namun juga ke seluruh dunia. Lagunya pun segera merajai tangga lagu Korsel, Gaon Chart. Bahkan, hanya butuh waktu dua bulan, video Gangnam Style di situs YouTube mendapatkan lebih dari 190 juta hit! Gangnam Style sebenarnya merupakan istilah Korea untuk gaya hidup mewah di sebuah distrik di Ibukota Seoul, Gangnam. Di tempat itulah berkumpul orang-orang trendi, hip dan memiliki gaya khas. Dalam sebuah wawancara, musisi berusia 35 tahun ini menyatakan Gangnam bisa disebut

Beverly Hills-nya Korsel. Di Los Angeles, Amerika Serikat (AS), Beverly Hills merupakan salah satu distrik orang kaya. “Gangnam terhormat di siang hari dan menggila saat malam. Saya suka membandingkan gadis-gadis di tempat itu. Jadi lagu ini mengenai saya sebagai pria yang tepat untuk mereka,” ujar Psy, yang nama aslinya Park Jae-sang. Video musiknya juga amat kocak. Psy berdansa bak mengendarai kuda khayalan dan muncul di berbagai kegiatan yang dilakukan warga Gangnam. Seperti di tengah latihan yoga hingga dalam jakuzi. Ketika pertama kali dilansir, tentu saja Psy menujukannya untuk penikmat K-pop dalam negeri. Ia berkata, tak pernah bermaksud membuat lagu ini untuk orang asing, alih-alih penikmat musik Barat. Penggemar K-pop amat menyukai Gangnam Style dan mulai menyebarkannya lewat berbagai jejaring sosial seperti Facebook dan

Twitter. Tentu saja, penikmat K-pop di luar negeri langsung memperhatikannya. Video ini langsung mendunia begitu masuk ke AS, kiblat musik dunia. Akhirnya, bak efek bola salju, Psy dan gaya dansa lucunya langsung dikenal publik Amerika. Di dalam negeri, ia menduduki posisi puncak di berbagai tangga lagu. Awal Agustus, media memperhatikannya. Adalah The Los Angeles Times dalam edisi 4 Agustus 2012 menyatakan, Gangnam Style tak bisa dihentikan dan segera mengambil alih dunia. Akhir Agustus, lagu ini sudah masuk ke majalah musik ternama, Billboard, dan langung melompat delapan peringkat sekaligus di Billboard Social 50, sebuah tangga lagu mingguan. Psy diundang ke berbagai acara televisi. Salah satunya acara bincang-bincang milik komedian Ellen DeGeneres, The Ellen DeGeneres Show, saat Psy diminta untuk langung mengajarkan dansa Gangnam kepada penyanyi pop Britney Spears. Sebelumnya, Britney sudah menyatakan ia tergila-gila dengan Gangnam Style. ‘Bantuan’ Britney ini kian melambungkan Psy dan Gangnam Style. Apalagi, sensasi pop Justin Bieber juga tertular. Gelombang K-pop yang sekian lama digemari muda-mudi Indonesia, merasuk kian dalam ke Amerika. Washington Post menulis, Gangnam Style membuat gaya dansa unik yang terlihat bodoh menjadi keren. Lalu apa kata Psy yang saat ini berada di puncak? “Semuanya luar biasa. Setiap hari rasanya seperti tak nyata,” kata pria tembem yang sedang menikmati puncak singgasana iTunes, media pengunduhan untuk seluruh gadget Apple.(int)

„ Nathaniel menunjukkan surat tilangnya.

pakaian. Namun, dua anaknya mengatakan bahwa dirinya harus pergi ke kamar kecil. Saat akan pergi ke toilet, operator toko tak mengizinkan anak-anaknya menggunakan toilet karena alasan tertentu. Saat akan kembali ke restoran, si kecil Nathaniel yang masih menggunakan pispot tak dapat menahan air kecilnya. Ia pun mengambil inisiatif untuk kencing di lampu merah di pinggir trotoar. NBC Philadelphia melaporkan, Robboy sang ibu mencoba mengelak kejadian tersebut. Menurutnya, ia menyuruh anaknya di sebuah taman bukan di depan publik, seperti yang tertulis dalam surat penilangan. Atas peristiwa ini, Robboy tak hanya mendapatkan denda dan surat tilang, tapi juga penyuluhan untuk menjadi orangtua yang baik. (int)

WASHINGTON- Bagaimana mungkin seseorang yang tidak bekerja sejak berpuluh-puluh tahun lalu dapat memiliki harta kekayaan berlimpah. Namun hal itu ternyata mungkin saja bagi Walter Samasko Jr. Pria yang ditemukan tak bernyawa di kediamannya di Kota Carson, Amerika Serikat (AS) ini diketahui tidak bekerja sejak tahun 1968. Namun ketika tubuhnya yang sudah tidak bernyawa itu ditemukan, sejumlah tetangga Samasko Jr terkejut menyaksikan timbunan emas batangan senilai USD7 juta atau sekira Rp66 miliar (Rp9.458 per USD) ditemukan di garasi rumah. Demikian diberitakan Las Vegas dan dikutip Upi, Senin (17/9). Pihak keamanan pun terpaksa menggunakan truk khusus untuk mengangkut batangan emas itu. Selain batangan emas juga ditemukan koin emas dari sejumlah negara seperti Meksiko, Inggris, Austria dan Afrika Selatan. Setelah diselidiki Samasko ternyata selama ini hidup dari hasil investasinya. Termasuk saham senilai USD140 ribu atau sekira Rp1,3 miliar dan USD25 ribu atau sekira Rp236 juta yang dimilikinya. “Namun selama ini tidak ada yang tahu bahwa ia menimbun emas,” ujar salah seorang petugas polisi. Samasko awalnya dikabarkan tidak memiliki kerabat dekat. Namun pihak kepolisian berhasil menyelidiki bahwa ia memiliki sepupu jauh, Arlene Magdanz yang bermukim di San Rafael, California. Magdanz yang diberitahukan mengenai peninggalan sepupunya itu pun hanya bisa terperangah tak percaya. Satu-satunya yang terucapkan darinya adalah, “Ya Tuhan.” (ok/int)

Pria Buang Lotere Berhadiah Rp213 M

Tak Bisa Menahan Pipis, Bocah 2 Tahun Ini Ditilang Surat tilang dan denda umumnya diberikan saat kita melanggar peraturan. Menerobos lampu merah, melebihi kecepatan, atau membuang sampah pada tempatnya. Namun, hal ini tidak terjadi pada seorang ibu dan anaknya yang berusia dua tahun. Caroline Robboy asal Philadelphia merasa dirugikan saat dirinya diberikan surat tilang dan denda sebesar $50. Tilang ini diberikan oleh polisi setempat karena dirinya dianggap melanggar peraturan publik yang telah ditetapkan. Peristiwa ini bermula saat Nathaniel Robboy, 2 tahun yang tak dapat menahan diri saat membuang air kecil. Setelah makan di sebuah restoran Johnny Rockets, lima blok dari rumahnya, Caroline dan keluarganya berkunjung ke sebuah toko

Tidak Bekerja, Pria Ini Timbun Emas Batangan

„ Perempuan Arab Saudi


Tutup 100 Toko Pakaian Dalam PEMERINTAH Arab Saudi menutup sekitar 100 toko pakaian dalam di ibukota Riyadh. Penutupan dilakukan karena toko-toko tersebut masih mempekerjakan lelaki sebagai pegawai. Diberitakan Telegraph yang mengutip harian Al-Eqtisadiah, Minggu 16 September 2012, Kementerian Tenaga Kerja Arab Saudi mengatakan bahwa toko-toko tersebut melanggar peraturan pemerintah soal feminisasi dan nasionalisasi pekerjaan. Menurut laporan salah seorang staf kementerian, penutupan bertujuan untuk memberikan lingkungan yang aman bagi konsumen dan pekerja wanita. Aturan pemerintah soal larangan pekerja pria bekerja di toko pakaian dalam wanita diberlakukan sejak awal tahun ini. Langkah ini kemudian diikuti oleh toko-toko kosmetik yang mulai hanya mempekerjakan kaum Hawa. Raja Abdullah mendukung aturan baru tersebut yang menurutnya juga berguna membuka lapangan pekerjaan bagi wanita. Menurut data terbaru, angka pengangguran di kalangan wanita di Saudi mencapai 30 persen. (int)

AUCKLAND- Saran untuk membaca sesuatu dengan cermat dan hatihati memang bukan nasihat yang salah. Apalagi jika dikaitkan dengan kisah ini. Seorang laki-laki di Selandia Baru dikabarkan membuang tiket lotere bernilai 22,5 juta dolar AS atau sekitar Rp213 miliar hanya karena tidak cermat membaca. Laki-laki itu ternyata salah membaca hasil undian lotere dan kemudian membuang tiketnya karena dianggap sudah tak berguna lagi. Laki-laki berusia 20-an yang tak ingin disebutkan identitas dirinya itu sebenarnya sekadar iseng waktu membeli tiket lotere tersebut. Dia sebenarnya akan menggunakan uang itu untuk memotong rambutnya. Namun sesampainya di tempat potong rambut, tempat langganannya itu tutup. “Saya memeriksa hasilnya lewat telepon seluler saya, namun saya pasti salah membaca hingga mengira tiket saya tak berguna,” katanya kepada kantor berita Fairfax. “Saya kemudian menaruhnya begitu saja,” tambah dia. Dan laki-laki itu baru mengetahui ‘kebodohannya’ setelah sehari kemudian dia mendengar banyak orang berbicara soal hadiah utama lotere yang tak diambil pemenangnya. “Setelah mendengar pembicaraan itu saya kemudian mengecek ulang tiket saya,” tambah dia. Beruntung laki-laki itu masih menemukan tiket loterenya yang sempat diabaikannya. „ Tiket lotere H a d i a h sebesar Rp213 miliar itu berbentuk uang tunai sebesar Rp200,6 miliar, sebuah mobil Lamborghini Gallardo, sebuah mobil Audi Q7, sebuah kapal motor cepat dan kartu kredit dengan batas pemakaian hampir Rp400 juta. (kc/int)


SULIT untuk mengubah kebiasaan makan kue di pagi hari menjadi Pilates setiap Minggu pagi, hanya dalam satu langkah. Jadi saya melakukan beberapa langkah kecil dan mudah agar merasa lebih baik dan lebih sehat. Tidak diperlukan banyak resep, tapi hanya hal-hal kecil yang baik untuk tubuh:

Ups, Bubble Tea Berbahaya? JIKA diperhatikan, blended ice tea atau coffee yang ditambahkan bubble hitam, sedang marak-maraknya dijual di mal atau pusat pembelanjaan. Sayangnya, penelitian terbaru dari peneliti University Hospital Aachen menunjukkan bahwa bubble atau bola-bola kecil berwarna hitam dalam minuman bubble ice tea bersifat karsinogen (racun). Para peneliti Jerman mengingatkan pecinta bubble tea bahwa bola-bola hitam yang terbuat dari tepung tapioka ini diduga mengandung polychlorinated biphenyls (PCB), seperti stirena, asetofenon dan zat brominated. Menurut peneliti sekaligus ilmuwan Manfred Moller, sebenarnya zat-zat berbahaya tersebut tidak boleh dimasukkan kedalam makanan sedikitpun. PCB yang terdapat dalam makanan terbukti menyebabkan kanker serta menimbulkan berbagai efek kesehatan lainnya yang merugikan pada sistem kekebalan tubuh, sistem reproduksi, sistem saraf dan sistem endokrin, bahkan risiko tersedak pada anakanak.(int)

1.Minum satu teko teh hijau atau putih setiap hari Saya sering mengalami dehidrasi beberapa bulan terakhir, dan saya merasa lebih baik ketika minum teh setiap hari. Teh dengan kafein bisa berfungsi sebagai sebuah diuretic (zat yang membuat kita mengeluarkan banyak cairan/kencing), tapi saya selalu merasa teh hijau atau putih sangat bermanfaat. Ketika saya rutin mengonsumsi teh, saya merasakan efek yang baik: saya merasa lebih seimbang dan kulit saya menjadi lebih bercahaya. 2. Mengonsumsi protein setiap pagi Saya orang yang suka sarapan — dan tentu saja suka minum kopi setiap pagi — tapi saya tidak melakukan rutinitas itu lagi. Namun, saya mengetahui akan merasa lebih baik sepanjang hari jika mengonsumsi cukup protein ketika bangun tidur. Itu membuat saya bisa bertahan tidak mengonsumsi snack sepanjang hari dan menjaga hormon tetap stabil. Saya memulai pelan-pelan, dengan telur rebus dan yoghurt atau kacangkacangan, tapi saya berharap akan semakin kreatif ke depannya. 3. Pergi ke gym setidaknya dua kali sepekan Hari-hari yang tidak saya gunakan untuk pergi ke gym, harus saya ganti dengan berjalan kaki minimal 45 menit atau bersepeda minimal 30 menit. Saya mencoba melakukan hal-hal yang saya sukai — bersepeda statis sambil

membaca, berjalan di treadmill, berenang di kolam renang dan duduk di ruang uap — bekerja dengan pemikiran bahwa melakukan sesuatu lebih baik daripada tidak sama sekali. 4. Mengonsumsi sayuran hijau setiap hari Saya kembali pada kebiasaan membuat jus setiap siang, dan saya selalu menggunakan buah segar ditambah dengan bayam atau peterseli. Itu adalah penganan yang bergizi dan baik, sehingga mood dan energi saya menjadi lebih konsisten. Entah Anda membuatnya di tempat kerja atau di rumah, pastikan memiliki tempat yang cukup besar dan bisa dibawa kemana-mana untuk dinikmati sepanjang hari. 5. Jangan lupa untuk memanjakan diri Saya tidak bisa bekerja dengan baik dalam kondisi lapar, sehingga saya memastikan memberikan penghargaan kepada diri saya karena mencoba hidup dengan lebih sehat. Saya suka menyimpan kue buatan sendiri di rumah, dan memakannya setiap hari. Saya minum segelas anggur saat makan malam dan menikmati hidangan penutup ketika perut masih sanggup menampungnya dan saya tidak bisa membayangkan akan menolak ayam goreng. Saya mencoba untuk hidup dengan seimbang yang akan mempertahankan kebahagiaan saya tapi juga tidak akan terlalu memaksakannya setiap hari.(int)

Perbedaan Fantasi Seks Pria dan Wanita PARA wanita berfantasi dilamar Ryan Gosling, sementara para pria berfantasi berkencan dengan gadis sampul majalah “Maxim” edisi terbaru. Bukankah begitu? Tampaknya memang demikian! Penelitian terbaru dari Universitas Granda yang dipublikasikan dalam jurnal berbahasa Spanyol “Anales de Psicologia” menemukan, baik pria dan wanita memiliki fantasi seksual yang intim dan romantis yang sama, bukan dengan para selebriti dan para model Victoria Secret, namun bercinta dengan kekasihnya! Para peneliti yang melakukan survei terhadap pertanyaan yang dijawab oleh 2500 pria dan wanita Spanyol yang sedang menjalani hubungan heteroseksual setidaknya selama enam bulan, menemukan bahwa para pria dan wanita banyak berfantasi mengenai hal yang sama. Ditambah, hampir 100 persen responden memiliki fantasi seksual. Ini artinya bukan cuma pria yang berfantasi mengenai seks. “Ketika seks merasuki wanita, kita tahu bahwa kita sangat mudah terpengaruh secara visual,” kata Amy Levine, praktisi seks dan pendiri Ignite Your Pleasure kepada HealtySELF, sembari menambahkan bahwa dirinya tidak terkejut oleh hasil tersebut. “Para wanita dapat dan sering berfantasi tentang seks.” Levine mengatakan ada sebuah kesan yang berbeda dari tiap jenis

bersama pasangan Anda,” kata Levine. “Fantasi meningkatkan gairah Anda, meningkatkan sensasi pada kehidupan nyata dan membawa Anda ke puncak kenikmatan,” katanya.

Orang Gemuk Lebih Puas Soal Seks

fantasi para pria dan wanita, namun penelitian tersebut tidak membahasnya. Namun, tampaknya para pria menghabiskan lebih banyak waktunya untuk berfantasi daripada wanita, seperti yang dilaporkan oleh para peneliti tersebut, yang menemukan sejumlah perbedaan lain di antara para pria dan wanita: para wanita memiliki “fantasi asmara yang romantis” lebih sering

daripada para pria, sementara para pria lebih sering berfantasi mengenai petualangan seksual, seperti hubungan seks berkelompok atau menjadi seorang “pelaku seks bebas.” Tidak peduli apa yang Anda fantasikan, itu sehat, kegiatan itu wajar dan menurut Levine dapat membantu kehidupan seks Anda. “Merupakan hal yang wajar memiliki fantasi seksual, baik saat Anda sendiri atau

Memiliki tubuh gemuk tentu membuat minder. Tak heran jika penelitian di Inggris baru-baru ini menunjukkan bahwa tubuh gemuk bikin perempuan menghindari seks. Namun, meskipun minder dengan bentuk tubuh, orang gemuk ternyata lebih bisa mendapatkan seks yang menggairahkan. Rebecca Jane Weinstein dalam bukunya "Fat Sexy: The Naked Truth" mengungkapkan bahwa ukuran tubuh tidak menghalau keintiman seseorang. "Ukuran besar terlihat tidak menarik bagi setiap orang dan mengira mereka aseksual di mana mereka tak tertarik pada seks. Namun, sebenarnya tidak ada perbedaan antara ukuran tubuh besar atau kecil sejauh mereka mendapatkan seks. Setiap orang akan tertarik pada apa yang membuat mereka tertarik," tutur Weinstein, dikutip melalui Mediaite (20/7). Menurut Weistein, orang gemuk lebih mendapatkan seks yang memuaskan dibandingkan dengan orang bertubuh kecil. Orang gemuk akan berhubungan seks dengan pasangan yang bisa menerima tubuh berbalut lemak berlebihan mereka. Pada akhirnya, mereka lebih mudah menikmati aktivitas seksnya. Riset lain di tahun 2010 juga menunjukkan bahwa perempuan gemuk lebih 'panas' dibandingkan perempuan bertubuh kurus. Penelitian tersebut menemukan kalau perempuan maupun pria dengan tubuh berisi akan lebih berusaha memuaskan pasangannya di ranjang. Mereka tak malu dan lebih terbuka mengenai eksplorasi seks demi kepuasaan bersama.(int)

Warna dan Cahaya Ruangan Berpengaruh Pada Mood Bekerja Di ruang atau meja kerja anda banyak file menumpuk? Apakah semua file penting? Atau tidak sempat membereskannya? Anda harus menyempatkan waktu untuk membereskan file atau barang-barang yang menumpuk dan berantakan di meja kerja anda. Pasalnya hal itu mempengaruhi mood ketika bekerja. "Terlalu banyak file di ruang atau meja kerja, memang perlu waktu untuk membuang file nggak penting, tapi kondisi yang bersih berpengaruh pada mood," ucap Prapanca Muchtar, pemilik Q Space, sebuah studio desain interior di Jakarta, Sabtu (8/9/ 2012) malam. Panca, panggilannya, memiliki tips agar ruang kerja Anda tetap bersih dan nyaman, sehingga mood ketika bekerja tetap terjaga. Berikut ini penjelasannya bagi anda: - Warna Jika Anda berniat merenovasi atau mengubah interior ruang kerja, meskipun sedikit, jangan takut bermain warna. Kalau Anda selalu memakai warna "aman" seperti warna-warna soft (peach, biru laut, hijau muda, abu-abu, putih, krem, dan lajnnya) terkesan pucat, tak bersemangat. Jika ruang kecil, Anda dapat mengaplikasikan satu

"Hati-hati menggunakan warna yang colorful, salah bisa jadi kacau, berpengaruh pada mood," kata Panca. - Hiasan Anda juga bisa menghias ruangan atau meja dengan dengan lukisan, tanaman, akuarium, atau aksesoris. Namun jangan terlalu banyak. Cukup satu sampai tiga item saja. Tetapi jika ruang kerja kecil satu pun sudah cukup. "Jangan lakukan pasang foto dengan pacar, foto mantan juga masih ada, belum lagi foto-foto dengan teman, dan boneka yang berserakan. Kalau banyak hiasan

warna cerah, ruang besar dapat colorful. Tetapi Anda harus berhati-hati, karena

ruang colorful dapat membuat pikiran atau perasaan kacau.

membuat pikiran kacau," ujar Panca. - Pencahayaan Warna cahaya berpengaruh terhadap kinerja. Menurut Panca, cahaya yang paling bagus adalah putih, karena memberikan efek yang lebih segar, terlebih jika karyawan baru tiba di kantor. Jika cahaya lampu kuning, membuat seseorang tidak bersemangat. "Kalau istirajat pasang cahaya sedikit kuning, dua jam setelah makan siang biasanya ngantuk, kasih warna putih, pulang kantor cahaya agak kuning, tetapi kalau tidur sebaiknya gelap atau cahayanya kuning, lampu teduh juga nggak masalah," jelasnya. Panca melanjutkan bahwa setengah hidup kita dihabiskan di kantor, jadi desain yang menarik dan nyaman, menjaga seseorang agar tetap sehat, kinerja meningkat. "Itu yang diinginkan perusahaan kan? Kalau desain kantor bagus, kerja semangat, perusahaan untung. Kalau nggak bisa dikerjakan sendiri, minta bantuan interior desinger," tutup tips darinya. • Betapa Pintarnya Manfaatkan Tangga untuk Rak Buku • Betapa Pintarnya Siasati Ruang Sempit Jadi Berkesan Luas • Sendok Tengkorak Ini Lucu Sekaligus Menyeramkan.(int)



18 September 2012

Lorenzo Juara, Pedrosa Sial, Rossi Hadiahkan Kado Manis

Pebalap Yamaha, Jorge Lorenzo, menjuarai GP San Marino, Minggu (16/9), ketika rival terberatnya dari tim Repsol Honda, Dani Pedrosa, mengalami nasib buruk. Dengan hasil ini, Lorenzo kembali menjauh dari kejaran Pedrosa, dengan keunggulan 38 poin atas kompatriotnya dari Spanyol itu, dan balapan tersisa lima seri lagi. Balapan di Sirkuit Misano ini pun menjadi arena pertunjukkan Valentino Rossi, yang sukses finis di posisi kedua. “The Doctor” membuktikan tekadnya, yang ingin mempersembahkan hasil bagus sebagai kado perpisahan dengan Ducati dalam balapan terakhir di depan publik Italia. Posisi ketiga ditempati pebalap Gresini Honda, Alvaro Bautista, yang berhasil mengatasi tekanan pebalap Yamaha Tech 3, Andrea Doviziso, menjelang akhir balapan. Pada tikungan terakhir sebelum menyentuh garis finis, Dovizioso nyaris melewati Bautista, tetapi pebalap Spanyol ini sukses mempertahankan posisi dengan keunggulan hanya 0,03 detik. Jalannya Balapan Saat lampu merah padam tanda balapan dimulai, Rossi melakukan start yang bagus karena dari urutan keenam, dia langsung menyodok ke posisi kedua, persis di belakang Lorenzo yang menjadi pebalap terdepan. Ini terjadi karena Pedrosa, yang

meraih pole position, harus start dari posisi paling belakang akibat mengalami masalah mesin, sehingga harus mengganti motor. Namun di lap kedua, nasib buruk menimpa Pedrosa, yang mengalami kecelakaan. Ketika sedang berusaha merangsek ke depan untuk memperbaiki posisinya, dia dihantam pebalap Pramac Ducati, Hector Barbera, saat akan menikung ke kiri. Pedrosa pun harus melupakan impian untuk meraih poin di balapan seri ke-13 ini. Tanpa Pedrosa, Lorenzo tak mendapat perlawanan berarti. Rossi yang berusaha membuntutinya belum mampu bersaing karena hingga lap kelima, “The Doctor” tertinggal lebih dari 1 detik. Persaingan seru justru untuk memperebutkan posisi kedua, karena Stefan Bradl, Andrea Dovizioso, dan Alvaro Bautista terus membuntuti Rossi. Kecelakaan juga menimpa pebalap Yamaha Tech 3, Cal Crutchlow, yang jatuh di lap kelima, ketika berusaha melewati Dovizioso. Kegagalan ini membuat Crutchlow tak bisa membuka harapan untuk membuat sejarah sebagai pebalap Inggris pertama setelah Ron Haslam pada 1987, yang berhasil naik podium secara berturut-turut. Pada balapan di Brno, Ceko, Crutchlow berhasil finis di posisi ketiga. Di Misano ini, Crutchlow berpeluang melakukannya, apalagi Pedrosa sudah terlebih dahulu meninggalkan balapan. Sayang, impian membuat back-to-back itu sirna, karena mantan pebalap Superbike itu pun gagal melanjutkan lomba. Memasuki lap ke-14, Lorenzo terus membuat jarak dengan Rossi karena juara dunia 2010 tersebut sudah memimpin 4,587 detik. Sementara itu Rossi kian kuat mendapat tekanan dari

Valentino Rossi (kiri) menyaksikan selebrasi kemenangan Lorenzo di San Marino. Pada balapan serupa, Dani Pedrosa mengalami kecelakaan. Bradl, Dovizioso dan Bautista. Tetapi juara dunia tujuh kali MotoGP tersebut terus bertahan. Tampaknya, sasis dan lengan ayun baru yang dipakai dalam balapan ini bekerja dengan baik, sehingga sampai dengan separuh balapan, Rossi bisa bertahan di barisan depan. Pada lap ke-16, Bautista naik satu strip ke posisi keempat, setelah menyalip Dovizioso. Selanjutnya, pebalap Gresini Honda ini mulai mengincar Bradl di posisi ketiga. Benar saja, pada lap ke-19, Bautista, yang menjuarai GP San Marino pada 2008 ketika masih di kelas 250 cc, berhasil menyalip Bradl. Sementara itu

Penutupan PON Dijanjikan Lebih Meriah Wakil Presiden, Boediono, dipastukan akan menutup PON XVIII. Pihak penyelenggara menjamin kalau seremoni penutupan tersebut lebih meriah dibanding pesta pembukaan. Hal itu disampaikan, event organizer penutupan

PON, Helmi Yahyah dalam acara silahtuhrahmi Gubernur Riau, Rusli Zainal dengan wartawan, Minggu (16/9) malam. Menurut Helmi penutupan PON akan lebih banyak melibatkan artis ibukota. Misalkan, Ahmad Dhani, Ari Laso, Titi DJ dan Ruth Sahanaya. Selain itu akan ada juga penyanyi dangdut Cici Paramida yang akan membawa tembang Melayu. “Acara penutupan akan lebih happy dibanding pembukaan. Karena penutupan ini lebih pada ucapan terimakasih kepada atlet,

Missy Franklin

Perenang Terbaik PERENANG muda Amerika Serikat asal Colorado, Missy Franklin yang berhasil merebut empat emas dan satu perunggu dalam debutnya di Olimpiade London 2012, dinobatkan sebagai atlet renang terbaik AS tahun ini. Sayangnya, Missy Franklin tak bisa menerima sendiri penghargaan yang diperolehnya itu dalam acara di US Aquatic Sports Convention akhir pekan lalu. Gadis berusia 17 tahun itu tengah sibuk mempersiapkan ujian akhir sekolah menengah atasnya sejak kembali dari London. Pekan lalu dia juga tidak hadir di Gedung Putih, saat para atlet Olimpiade dan Paralimpiade dijamu Presiden Barack Obama. “Saya tak menyangka hidup saya bisa sehebat ini,” kata Franklin. “Menjadi bagian dari tim Olimpiade adalah sebuah pengalaman yang luar biasa. Kami di tim renang sangat akrab. Kami bersenang-senang bersama dan saya menyayangi mereka semua,” tambah dia. Di London, Missy Franklin mendapatkan emas di nomor 100m dan 200m gaya punggung, 4x200 meter gaya bebas dan 4x100 meter gaya campuran. Dan di nomor 200 meter gaya punggung serta di gaya campuran, Franklin juga memecahkan rekor dunia. Dan dia masih meraih perunggu untuk nomor 4x100 meter gaya bebas. Prestasinya itu sebenarnya bisa mendatangkan banyak keuntungan finansial bagi Franklin. Namun kepada harian USA Today, Franklin mengatakan belum terpikir untuk beralih menjadi profesional. “Saya ingin menjadi profesional suatu hari nanti. Tetapi untuk saat ini menjadi bagian tim renang di universitas adalah salah satu yang paling saya inginkan,” tegasnya. (int)

Evander Holyfield Missy Franklin

Lorenzo kian jauh di depan dengan keunggulan 5,524 detik atas Rossi. Bautista, Bradl, dan Dovizioso bertarung ketat memperebutkan posisi ketiga. Tiga pebalap tersebut hanya berjarak sekitar 0,2 detik di antara mereka, sedangkan Rossi agak menjauh karena unggul lebih dari satu detik atas Bautista. Tampaknya “The Doctor” bisa mempertahankan posisinya karena kecepatan Desmosedici GP12 tunggangannya cukup konsisten. Saat balapan tersisa lima lap lagi, Ben Spies mulai merangsek ke depan untuk memberikan

ancaman kepada Dovizioso. Rekan setim Lorenzo ini, yang musim depan akan memperkuat tim Pramac Ducati bersama dengan pebalap Moto2, Andrea Iannone, ikut dalam pertarungan memperebutkan posisi keempat. Sementara itu Bautista mulai sedikit lepas dari tekanan. Satu lap berselang, Bradl harus terima kenyataan turun dua strip sekaligus karena lebih dulu dilewati Dovizioso, sebelum Spies pun melakukan hal serupa. Dengan demikian, Dovizioso dan Spies yang bertarung untuk memperebutkan posisi keempat. Mereka juga kian merapat dengan Bautista di urutan ketiga. Di lap terakhir, Dovizioso, yang musim depan gantikan Rossi di Ducati, persis di belakang Bautista. Tetapi pebalap Italia ini tak mampu meraih posisi ketiga, karena dia sedikit lebih lambat menyentuh garis finis. Lorenzo dengan nyaman meraih kemenangan karena dia unggul 4,398 atas Rossi, yang finis di peringkat kedua. Tetapi bagi Rossi, hasil ini menjadi sebuah prestasi yang besar, karena sesuai janjinya, dia mampu memberikan hasil membanggakan sebagai kado perpisahan dengan Ducati di depan publik Italia. Ya, GP San Marino ini menjadi balapan terakhir Rossi bersama Ducati di rumah sendiri. Pasalnya, musim depan dia akan kembali bergabung dengan Yamaha, untuk menjadi tandem Lorenzo. Pengembangan Ducati di seri ini memberikan hasil yang memuaskan, karena Rossi bisa mengalahkan para lawan yang pada seri-seri sebelumnya sulit dikalahkan. Setelah balapan ini, para pebalap langsung mempersiapkan diri menghadapi seri ke-14 di Sirkuit Motorland Aragon. Balapan tersebut akan berlangsung pada 30 September mendatang. (int)

panitia dan wartawan,” kata Helmi. Helmi menjelaskan, hiburan penutupan sudah dimilai pukul 16.00 sore waktu setempat. Upacara penutupan PON oleh Wapres pada pukul 19.00 malam. “Penutupan nanti kita sudah mempersiapkan daya listrik tujuh MW. Kita masih memperkuat atraksi leser lewat ilusi laser terbaik di Asia,” kata Helmi. Sementara itu, Gubernur Riau memastikan kalau penutupan akan tetap diberlakukan tiket masuk. Hanya saja harga tiket tidak semahal

KLASEMEN 1. DKI Jakarta 2. Jawa Barat 3. Jawa Timur 4. Jawa Tengah 5. Riau 6. Kalimantan Timur 7. Lampung 8. Sumatera Utara 9. Sulawesi Selatan 10. Sumatera Selatan 11. Nusa Tenggara Barat 12. Sumatera Barat 13. PAPUA 14. Di Yogyakarta 15. Bali 16. Kalimantan Selatan 17. Kalimantan Barat 18. Kalimantan Tengah 19. Banten 20. Maluku 21. Jambi 22. Sulawesi Tenggara 23. Sulawesi Utara 24. Kep. Bangka Belitung 25. Gorontalo 26. Nusa Tenggara Timur 27. ACEH 28. Papua Barat 29. Sulawesi Tengah 30. BENGKULU 31. Kep. Riau 32. Maluku Utara

66 65 61 35 29 27 15 13 13 9 8 8 6 6 5 4 4 4 4 3 3 3 2 2 2 1 1 1 1 0 0 0

70 53 60 28 25 28 7 17 11 11 5 4 10 9 9 8 4 4 3 9 5 0 5 3 1 4 3 2 1 1 0 0

76 734 55 44 39 29 8 17 12 19 7 19 12 10 23 11 11 3 9 4 12 2 1 4 0 2 13 5 0 4 1 1

waktu pembukaan. “Pokoknya tiket nanti paling mahal cuma Rp 200 ribu dan paling murah Rp 50. Ini sematamata untuk membatasi membludaknya penonton,” kata Rusli. Disinggung jumlah dana penutupan, Rusli mengenal untuk merincikan. Menurutnya dananya akan lebih murah di banding Sumatera Selatan (SEA Games). “Yang jelas, kita lebih murah dari Sumsel, malah dananya nanti tak sampai separohnya,” kata Rusli. (int)

DKI Jakarta Tetap Puncaki Klasemen DKI Jakarta sejauh ini masih memuncaki klasemen sementara Pekan Olahraga Nasional (PON) XVIII Riausejak mengambil alih tampuk pimpinan dari Jawa Barat. Jakarta dan Jabar mengumpulkan emas sama banyak, Minggu (16/9). Mereka masing-masing menambah koleksi delapan emas. Emas Jakarta diraih dari beberapa cabang seperti senam ritmik dan taekwondo. Sedangkan Jabar menyabetnya dari Judo dan Kempo. Hasil itu belum mengubah posisi DKI Jakarta yang ada di posisi pertama diikuti Jabar. Komposisi di posisi lima besar klasemen tidak mengalai perubahan. Jawa Timur, Jawa Tengah, dan tuan rumah, Riau, berturut-turut ada di posisi tiga, empat, dan lima. Posisi Riau di peringkat lima klasemen sementara mulai dibayangi oleh Kalimantan Timur. Tuan rumah PON lalu itu kini hanya berjarak dua emas dari Riau. Berikut ini adalah daftar perolehan medali PON XVIII, Senin (17/9), hingga pukul 8.30 WIB. (int)

Evander Holyfield

Menelantarkan Anak Gadisnya EVANDERHolyfield belum terbebas dari masalah finansial. Mantan juara dunia tinju kelasberatinidiketahuimenelantarkansalah satu anak perempuannya, Emani. Holyfield seharusnya memberikan uang tunjangankepadagadis18tahunitusebesar $2.950 atau setara Rp28 juta per bulan. Namun,mantanmusuhbebuyutan Mike Tyson itu menunggaknya hingga berjumlah total Rp5,3 miliar. Seperti dilansir Daily M a i l , Holyfield bahkan h a r u s meng-

habiskan pendapatannya hanya untuk melunasi utang-utangnya. Padahal, pria kelahiran Alabama, Amerika Serikat ini termasuk dalam daftar 20 petinju dengan bayaran termahal. Holyfield pernah meraup $30 juta atau setara Rp285 miliar untuk sekali tanding melawan Tyson. Sayangnya, hasil jerih payah di atas ring yang mencapai Rp2,37 triliun tak mampu menutupi biaya kehidupan pria 49 tahun itu. Masalah Holyfield berawal pada 1999, ketika istrinya kala itu, Janice mengajukan gugatan cerai. Seperti dilaporkan Houston Press, Janice tidak bisa menerima pengakuan pria berkepala plontos itu yang memiliki dua anak di luar nikah. Selain seorang putra hasil pernikahannya dengan Janice, Holyfield ternyata harus membiayai11oranganaklainnya.Sehingga, pemegang rekor 44 kali menang (29 KO), 10 kali kalah dan 2 kali seri ini memiliki 12 anak dari 6 wanita berbeda. Pada 2008, Holyfield secara terbuka mendeklarasikan kebangkrutan dirinya. Lalu, 2 tahunkemudian,JanicemenuntutHolyfield melalui Pengadilan Texas untuk membayar tunjangan anaknya senilai Rp2,3 miliar. Pada Juli 2012, Holyfield akhirnya melepas rumah mewahnya di Atlanta. Rumah tersebut terjual seharga Rp71 miliar lewat proses pelelangan. (int)


SELASA 18 September 2012




No 1 2 3 4 5

Team Chelsea Man United Arsenal Manc City Swansea City

M 4 4 4 4 4

M 3 3 2 2 2

S 1 0 2 2 1

K 0 1 0 0 1

SG 8-2 10-5 8-1 9-6 10-4

Nilai 10 9 8 8 7

TOP SCORER Bentrok Anderlecht di San Siro mungkin dijadikan Massimiliano Allegri sebagai misi menyelamatkan dirinya dari pemecatan.


iga kali main dengan 2 kekalahan di kandang jelas tak bisa diterima buat klub sebesar AC Milan. Tak pelak, masa depan allenatore Massimiliano Allegri pun mulai dipertanyakan. Kekalahan 0-1 dari Atalanta, Sabtu (15/ 9), menjadikan musim 2012/2013 sebagai yang terburuk dalam 82 tahun sejarah Milan. Kali terakhir, I Rossoneri menderita 2 kekalahan beruntun di San Siro terjadi pada 1930 silam. Tak hanya itu. Legendaris Milan Zvonimir Boban pun menyindir pasukan Allegri sebagai yang terburuk yang pernah dimilik I Rossoneri dalam 25 tahun terakhir. Sontak, mencuat isu bahwa manajemen Milan memberi tenggat buat Allegri untuk menyelamatkan jabatannya dalam 2 partai ke depan. Dimulai dengan menjamu klub Belgia, Anderlecht, di San Siro pada Grup C Champions League, Selasa (18/9) atau Rabu (19/9) dinihari WIB. Allegri mungkin berpikir Anderlecht bakal jadi penyelamatnya. Anderlecht termasuk lawan relatif mudah buat Giampaolo Pazzini dkk. Dari 4 pertemuan sebelumnya, Milan menang dan seri masing-masing 2 kali. Pada benturan terakhir di San Siro, 1 November 2006, Milan bahkan membantai Anderlecht 4-1 lewat hattrick Ricardo Kaka dan 1 gol Alberto Gilardino. Yang menarik, setelah ke empat bentrokan dengan Anderlecht di 2 musim berbeda (1993/1994 dan 2006/2007), Milanselalujadijuaradiakhirkompetisi. Well, ini yang bikin Allegri berharap musim ini pertemuan dengan Anderlecht jadi berkah buat Milan di akhir kompetisi Champions League nanti. “Untungnya, Champions League memberikanMilanpeluanguntukbangkit lagi. Kami semua ada di satu perahu (manajemen, pelatih, dan pemain).

Kami harus sedikit berbicara dan banyak bekerja,” ucap Allegri. “Tapi, kami wajib berkembang dan melupakanhasil-hasillalu.Selasananti jadi kesempatan buat kami merapikan kepingan dan bergerak maju.” Di kubu Anderlecht, pasukan John van den Brom datang dengan a semangat dan optimisme tinggi. zz ea M Mereka tak mau perjuangan pe ep n us la berat sejak Kualifikasi III Gi Mi n io Champions League sia-sia. ad St Anderlecht menapak fase grup usai mengempaskan klub Lithuania (kualifikasi III) Emanuelson dan klub Siprus Antonini

4-3 -1-2

Gol 4 4 3

ANDERLECHT Pelatih: Van den Brom

Nama Michu R van Persie J Defoe

Klub Swansea City Manchester United Tottenham Hotspur







Deschacht Wasilewski




No 1 2 3 4 5

Team Barcelona Málaga Mallorca Sevilla Atletico Madrid

M 4 4 4 4 3

M 4 3 2 2 2

S 0 1 2 2 1

K 0 0 0 0 0

SG 12-3 6-2 5-3 4-2 9-4

Nilai 12 10 8 8 7

AC Milan 0:0 Anderlecht Kljestan Pazzini

Kanu Sutter El Shawaary

Boateng Ambrosini

Acerbi De Jong

AEL Limassol Abbiati (playoff). Dieumerci Mbokani Bezua jadi pemain yang harus diperhatikan barisan belakang Milan. Striker Kongo berusia 26 ini telah mengepak 4 gol di 4 partai Anderlecht menuju fase grup. Pada tiga pertandingan terakhir, AC Milanselalukemasukan1goldarilawanlawannya seperti Sampdoria, Bologna, dan Atalanta. Kini mereka berada diposisi ke10 di Liga Italia, dan baru mengalami1kemenangan,2kalikalah,serta mengumpulkan tiga 3 poin. Anderlecht sendiri baru meraih 1 kemenangan dari 5 pertandingan terakhir. Mereka meraih 1 kemenangan, tiga kali seri, dan satu kali kalah. Pertandingan terakhir mereka berakhir dengan skor 1-1 ketika menghadapi Lierse.Anderlechtmemilikicatatanyang buruk ketika menghadapi tim Italia, mereka belum pernah menang. Anderlecht hanya bisa mencatat lima kali seri, dan sembilan kali kalah. Anderlecht berada di posisi ke 2 Liga Belgia dengan poin 13 dari 7 pertandingan. Itu setelah mereka mendapatkan 3 kemenangan, dan 4 kali seri.



Gol 6 4 4



Pelatih:Massimiliano Allegri

Anderlecht AC Milan Anderlecht AC Milan

Klub Barcelona Atlético Madrid Mallorca

ITALIAN SERIE A No 1 2 3 4 5

HEAD TO HEAD: 24/11/93 30/3/94 17/10/2006 1/11/2006

Nama L Messi R Falcao T Hemed

0-0 0-0 0-1 4-1

AC Milan Anderlecht AC Milan Anderlecht

Team Juventus Napoli Lazio Sampdoria Internazionale

M 3 3 3 3 3

M 3 3 3 3 2

S 0 0 0 0 0

5 PERTANDINGAN TERAKHIR AC MILAN : 16 Sep 2012 2 Sep 2012 26 Agu 2012 9 Agu 2012 5 Agu 2012

AC Milan Bologna AC Milan Real Madrid AC Milan

0-1 1-3 0-1 5-1 3-1

Atalanta AC Milan Sampdoria AC Milan Olimpia

5 PERTANDINGAN TERAKHIR ANDERLECHT : 15 Sep 2012 : 2 Sep 2012 : 29 Agu 2012 : 25 Agu 2012 : 23 Agu 2012 :

Lierse Anderlecht Anderlecht OH Leuven AEL

1-1 2-2 2-0 1-1 2-1

Anderlecht GENK AEL Anderlecht Anderlecht

Rabu (19/9) Pukul 01.45 WIB

TOP SCORER Gol 4 3 3

Nama S Jovetic Hernanes M Klose

Klub Fiorentina Lazio Lazio

K 0 0 0 0 1

SG 9-2 8-2 7-1 6-3 6-3

Nilai 9 9 9 8 6




Selasa, 18 September 2012

REAL Madrid mempopulerkan istilah Los Galacticos, atau The Galaxy pada 2003 ketika David Beckham pindah ke Bernabeu dari Old Trafford. Lalu 2009 mereka mendesain lagi Los Galacticos edisi dua ketika sukses membayar Cristiano Ronaldo dari Old Trafford pula dengan budget Rp1,2 miliar. So, apa konstelasi istilah Los Galacticos dengan partai penyisihan Grup D Liga Champions kontra Manchester City ini? Los Galacticos arti sederhananya adalah galaksi. Ya, susunan bintangbintang di angkasa. Diartikan ke sepak bola, Los Galacticos bisa diumpamakan kumpulan bintang-bintang nomor wahid yang didatangkan dalam satu

Nelson Ngaku Bantai Orangtuanya Pakai Golok PULAURAJA-Nelson Hutapea (27) setelah diperiksa secara intesif, akhirnya mengaku melakukan pembunuhan terhadap orangtuanya Bangga Hutapea (58) dan Marsaulina (55), warga Dusun VII Desa Rawasari Kecamatan Aek Kuasan Kabupaten Asahan.

sek Pulau Raja AKP SM Sitanggang menerangkan, pihaknya sudah mendapat pengakuan dari Nelson yang menyebutkan, bahwa tersangka membunuh orangtuanya dengan menggunakan sebilah golok. Bahkan, pihak kepolisian sudah mendapatkan golok yang sempat dibuang tersangka usai menghabisi nyawa orangtunya.

‹‹ Baca Nelson Ngaku ...Hal 6

Kepada METRO, Senin (17/9) Kapolres Asahan AKBP Yustan Alpiani melalui Kapol-


„ Nelson

MAYAT BAYI LAKI-LAKI Terapung di Sungai

‹‹ Baca The Real...Hal 6

Siswa SMA Tewas Ditabrak Truk Simpang Desa Padang Mahondang hendak masuk ke jalinsum menuju arah Aek Loba. Tanpa memperhatikan situasi jalan, korban langsung hendak masuk ke jalinsum. Tiba-tiba, dari arah Aek Loba muncul Truk Colt Diesel BK 8358 VV bermuatan sawit dan tabrakan tidak bisa dielakkan. Tubuh Fransiskus langsung terpental di badan jalan, dan kondisi tubuhnya bersimbah darah. Warga yang mendengar

MEDAN-Warga sekitar Jalan Pelajar Ujung Gang Benteng, Kelurahan Binjai Kecamatan Medan Denai mendadak heboh. Pasalnya, di bantaran sungai tepatnya di belakang sekolah Amaliyah ditemukan mayat bayi jenis kelamin laki-laki mengapung dalam keadaan telanjang, Senin (17/9) sekira 16.00 Wib.

‹‹ Baca Siswa SMA ...Hal 6

‹‹ Baca Mayat Bayi...Hal 6


„ Mayat bayi laki-laki yang ditemukan di sungai.

Lulusan SMA Masih Berpeluang jadi CPNS JAKARTA- Lulusan SMA masih mendapatkan kesempatan besar untuk mengikuti seleksi Calon Pegawai Negeri Sipil (CPNS) tahun 2013. Pasalnya, untuk jabatanjabatan tertentu seperti tenaga sipir masih membutuhkan lulusan SMA. “Lulusan SMA masih diberikan kesempatan. Tadinya saya ingin yang „ Azwar Abubakar

di lapas itu lulusan S1 agama atau psikolog. Tapi dari Kementerian Hukum dan HAM mengatakan, untuk tenaga lapas masih masuk golongan II jadi harus SMA,” terang Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi

‹‹ Baca Lulusan ...Hal 6

Bashaer Othman, Walikota Termuda di Dunia FOTO:TONGGO SIBARANI

„ Masyarakat sekitar TPL berunjuk rasa ke kantor sektor TPL meminta TPL ditutup, Senin (17/9).


Tutup TPL Harga Mati! SIMALUNGUN-Demo ratusan masyarakat Kecamatan Dolok Pangribuan, Kabupaten Simalungun yang tergabung dalam forum masyarakat tolak Toba Pulp Lestari (TPL) di TPL sektor Aek Nauli, Senin (17/9), disambut kawat berduri dan puluhan satpam. Para pendemo yang mendapat pendampingan dari mahasiswa Sahabat


Edisi 217 „ Tahun V

klub. 2003 lalu, Real Madrid mengerikan skuadnya. Mulai David Beckham, Ronaldo, Luis Figo, Zidane, Raul Gonzales dan lainnya. Dengan kekuatan maksimal itu, plus uang yang dikeluar-

PULAURAKYAT-Siswa SMA Yaspenda Pulau Raja Fransiskus Sigalingging (16), warga Dusun Balam Jaya, Desa Sungai Akar, Kecamatan Indragiri Hilir Hulu Kabupaten Batang Kansal Provinsi Riau, tewas seketika setelah ditabrak truk di Simpang Desa Padang Mahondang Kecamatan Pulau Rakyat Asahan, Senin (17/9) sekitar pukul 19.30 WIB. Data dihimpun di lokasi kejadian, sebelum peristiwa kejadian itu, korban yang diketahui tinggal bersama M Sinaga di Dusun II Desa Orika Kecamatan Pulau Rakyat, mengendarai sepedamotor Astrea Grand BK 5525 QB, melintas dari arah


Lingkungan (Saling) ini, juga sempat terlibat bentrok dengan pihak TPL. Itu terjadi ketika demonstran mencoba merubuhkan blokade TPL yang terbuat dari kayu berlapis pagar berduri yang dibentangkan di jalan masuk TPL. Namun, bentrok yang terjadi dengan

‹‹ Baca Tutup ...Hal 7



Cantik, muda, semangat tinggi. Itulah kesan perdana saat mewawancarai mantan walikota termuda di dunia, Bashaer Othman. Di usia 16 tahun, Othman dipercaya memimpin kota kecil di Tepi Barat Palestina, Allar. Aktivitasnya yang menonjol di organisasi kepemudaan membawanya menjadi delegasi untuk duduk di kursi nomor satu pemerintahan Allar.

Banyak prestasi diraih siswi kelas dua sekolah menengah atas ini saat menjabat walikota. Meski cuma dua bulan, Othman mampu mendatangkan investor. Berikut wawancara dengan Bashaer Othman di Hotel Ambhara, Jakarta Selatan, didampingi penerjemah, belum lama ini; Bagaimana proses Anda sampai terpilih sebagai walikota? Pertama, saya mengajukan sebagai ketua dari majelis pemuda di sana. Kemudian setelah terpilih,

Soekarno saya mengajukan diri kepada waliikota untuk diberikan kesempatan memimpin kota selama satu minggu. Setelah mereka yakin saya mampu dan puas dengan kinerja saya selama satu minggu, akhirnya oleh walikota, saya diperpanjang menjadi dua bulan. Kenapa demikian? Dia melihat saya mampu menjadi referensi bagai anak muda di kota itu.

‹‹ Baca Saya...Hal 7



18 September 2012

Diumumkan Serentak 19 September HASIL UJIAN CPNS


Pengaruhi Ekonomi Jepang TOKYO- Perusahaan elektronik Jepang, Panasonics terpaksa menghentikan sementara operasinya di China setelah para pengunjuk rasa anti-Jepang menyerang dua pabriknya di Qingdao, Senin (17/9). Serangan itu adalah bagian dari aksi protes anti Jepang yang terjadi di seluruh China. Aksi ini juga mempengaruhi operasional perusahaan Jepang lainnya, antara lain Toyota. Terdapat sejumlah laporan yang mengatakan sejumlah dealer Toyota di China juga dirusak massa pengunjuk rasa. Tak hanya Toyota dan Panasonics yang terimbas aksi anti-Jepang ini, Bloomberg melaporkan Canon juga menghentikan operasi pabriknya di China untuk sementara waktu. Sementara itu sejumlah media massa China dalam tajuk-tajuknya mengatakan ekonomi Jepang bisa menderita hingga 20 tahun jika Beijing memutuskan untuk menerapkan sanksi ekonomi terhadap Jepang. Sebuah tajuk harian People’s Daily menyebut perekonomian Jepang sebenarnya sudah kehilangan dua dekade sejak 1990-an. Dan ekonomi Jepang semakin jatuh usai krisis finansial dunia dan bencana gempa dahsyat 2011 lalu. Meski demikian, tajuk harian ini mengakui penerapan sanksi ekonomi China terhadap Jepang bisa menjadi pedang bermata dua untuk China. Sebab perekonomian kedua negara itu saling terkait. (kmc/int)

JAKARTA- Panitia Nasional Tes Kompetensi Dasar Calon Pegawai Negeri Sipil (CPNS) akan mengumumkan hasil ujian tulis pada 19 September 2012 mendatang. Hasil penerimaan ujian CPNS itu akan diumumkan serentak melaui website Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (PAN dan RB).

„ Ribuan peserta ujian CPNS di Jakarta tampak serius mengisi lembar jawaban.

Miranda Nilai Tuntutan Jaksa Tak Sesuai Fakta

Taliban Serang Markas NATO KABUL- Para gerilyawan Afganistan yang melakukan serangan terencana dan berani ke Camp Bastion, pangkalan militer di mana Pangeran Harry dari Inggris ditempatkan, mengenakan seragam Angkatan Darat AS, kata NATO sehari setelah serangan itu. Gerilyawan Afganistan sangat langka menggunakan seragam militer AS dalam serangan mereka. Menurut data CNN, terakhir hal itu dilakukan lebih dari dua tahun lalu, ketika NATO membalas serangan terhadap dua pangkalan di Provinsi Khost pada Agustus 2010. Tidak ada tentara koalisi yang tewas dalam serangan itu, kata Pasukan Keamanan Bantuan Internasional (ISAF NATO) ketika itu. Setidaknya dua marinir AS tewas dalam serangan yang tergolong sangat berani pada Jumat (14/9) malam lalu itu, dan enam jet tempur hancur, kata ISAF ketika merilis rincian lebih lanjut tentang serangan tersebut. Para petempur yang terlatih, melakukan dengan baik serangan di Provinsi Helmand, kata ISAF. Sekitar 15 gerilyawan dibagi dalam tiga tim menerobos pagar markas itu dan melakukan kerusakan, menghancurkan enam stasiun pengisian bahan bakar dan merusak hanggar enam pesawat. Para penyerang menenteng senapan otomatis, roket peluncur granat dan memakai rompi bunuh diri. Mereka menghancurkan enam jet AV-8B Harrier dan merusak dua lainnya sebelum serangan itu berakhir, kata pihak koalisi. (kmc/int)

„ Miranda membacakan pledoi dalam persidangan. JAKARTA- Pihak terdakwa akan membacakan yang isinya mengupas surat Komisi Pemberantasan Korupsi (KPK). Pledoi tersebut dibacakan dalam persidangan di Pengadilan Tindak Pidana Korupsi Jakarta, Senin (17/9). Salah seorang pengacara Miranda, Andi S Simangunsong mengatakan, tuntutan jaksa tidak berdasarkan fakta persidangan. ”Intinya begini, kita akan mengupas tuntutan yang diajukan penuntut umum tidak berdasarkan fakta-fakta persidangan,” kata Andi, saat dihubungi pagi ini. Ia mengungkapkan, bagi mereka yang mengikuti persidangan Miranda pasti mengetahui fakta persidangan bahwa pertemuan di rumah Nunun Nurbaeti yang dijadikan pertimbangan jaksa dalam menyusun tuntutan, tidak pernah ada. Lebih dari tiga orang saksi, kata Andi, mengatakan bahwa pertemuan di rumah Nunun sebelum uji kelayakan dan kepatutan calon Deputi Gubernur Senior Bank Indonesia tersebut tidak pernah terjadi. ”Ada juga saksi lain yang mengatakan

bahwa pertemuan itu tidak pernah ada. Penuntut umum memaksakan dirinya dengan mengatakan pertemuan itu ada,” kata Andi. Selain itu, lanjutnya, pledoi Miranda juga akan membantah soal ucapan “Ini bukan proyek thank you” yang dijadikan penuntut umum sebagai salah satu dasar menyusun tuntutan. Menurut Andi, tidak pernah ada saksi selain Nunun Nurbaeti yang mengungkapkan soal pernyataan tersebut. ”Saksi-saksi menyatakan tidak ada pertemuan di rumah Nunun, apalagi kata-kata itu. Karena ini kan katanya diucapkan di rumah Nunun. Tapi kan tidak pernah ada pertemuan di rumah Nunun tersebut,” ujarnya. Dalam surat tuntutan yang dibacakan di persidangan sebelumnya, tim jaksa KPK mengatakan bahwa benar ada pertemuan di rumah Nunun yang diikuti Miranda dengan , yakni Endin Soefihara, Hamka Yandhu, dan Paskah Suzetta. Pertemuan tersebut, menurut jaksa, menjadi awal rangkaian peristiwa Miranda dan Nunun bekerjasama

dalam memuluskan langkah Miranda sebagai Deputi Gubernur Senior Bank Indonesia 2004. Seusai pertemuan yang difasilitasi Nunun itu, menurut jaksa, Nunun mendengar ada yang mengatakan “Ini bukan ya.” Andi juga mengatakan, dalam pledoinya, pihak Miranda akan kembali menegaskan bahwa pertemuan Miranda dengan anggota Komisi IX DPR fraksi PDIPerjuangan dan fraksi TNI/Polri bukanlah suatu hal yang menyalahi ketentuan. ”Itu wajar-wajar saja, tapi penuntut umum ngotot,” tambah Andi. Dalam tuntutannya, penjara ditambah denda Rp 150 juta kepada Miranda. Tim jaksa penuntut umum Komisi Pemberantasan Korupsi meyakini Miranda terbukti melakukan tindak pidana korupsi dengan bersama-sama menyuap anggota Dewan Perwakilan Rakyat 1999-2004 untuk memuluskan langkahnya menjadi Deputi Gubernur Senior Bank Indonesia 2004. Menurut jaksa, berdasarkan fakta persidangan selama ini, dapat disimpulkan bahwa Miranda terbukti melanggar Pasal 5 Ayat 1 Huruf b Undang-Undang Pemberantasan Tindak Pidana Korupsi juncto Pasal 55 Ayat 1 Ke 1 KUHP sebagaimana dalam dakwaan pertama. Fakta persidangan selama ini, menurut jaksa, menunjukkan adanya rangkaian fakta hukum yang membuktikan perbuatan Miranda memberikan sesuatu, yakni cek perjalanan kepada anggota DPR 1999-2004 melalui Nunun Nurbaeti. Sementara Miranda menilai tuntutan jaksa dipaksakan dan banyak yang tidak benar. Miranda sempat tertawa saat tim jaksa KPK membacakan surat tuntutan dalam persidangan sebelumnya. (kmc/int)

114 WNI Ditangkap Polisi Kamboja TERLIBAT PRAKTIK JUDI ONLINE JAKARTA- Sebanyak 114 WNI ditangkap polisi Kamboja. Mereka terbukti terlibat dalam perbuatan pidana di Negeri 1.000 Pagoda itu. 114 WNI tersebut terlibat praktik judi online. ”25 WNI telah dipulangkan ke Indonesia hari Jumat 14 September 2012, dan 80 WNI dipulangkan hari ini 15 September 2012. Sisanya 9 WNI belum dipulangkan guna pemeriksaan,” kata Direktur Perlindungan WNI, Tatang Razak, saat berbincang, Senin (17/9). Tatang menjelaskan para WNI tersebut hanya direkrut dan bukan sebagai pelaku utama. Sepertinya mereka pun sudah ada yang mengatur segalanya, termasuk tiket kepulangan mereka. ”Mereka terdiri dari 90 lakilaki dan 24 wanita yang berasal dari berbagai daerah seperti Jakarta, Medan, Batam, dan sebagainya yang direkrut secara

rahasia,” jelas Tatang. Polisi Kamboja menangkap mereka di sebuah rumah pada 10 September lalu. Dari tangan mereka ditemukan 72 paspor, di mana selebihnya diperkirakan masih ada di rumah yang dikontrak atau dipegang oleh manajer mereka yang juga WNI. ”Mereka didakwa melanggar hukum Kamboja yang melarang judi online ilegal, walaupun terdapat kasino secara resmi. Apabila terbukti, mereka bisa dijatuhi hukuman penjara tergantung keterlibatan dengan maksimal 3-4 tahun penjara,” urainya. KBRI telah menemui mereka di tahanan Imigrasi. Mereka diperlakukan dengan baik. “KBRI akan menemui mereka lagi hari ini untuk pendampingan dan membantu mencarikan pengacara apabila dibutuhkan,” tutur Tatang. (dtc/int)

”Kita akan umumkan namanama yang lolos Rabu (19/9) sore, yang memenuhi ambang batas kelulusan dipilih dan dibuat ranking. Akan kita pos di website kita,” kata Menteri Menteri PAN dan RB, Azwar Abubabakar, dalam jumpa pers di kantornya, Jl Sudirman, Bundaran Senayan, Jakarta Pusat, Senin (17/9). Azwar mengatakan pada Rabu (19/9) pagi kementerian-kementerian akan diundang untuk diberi tahu hasil ujuan CPNS yang sudah dilaksanakan. Soal ujian CPNS itu dibuat oleh konsorsium. Kemudian sampai di daerah soal-soal ini dicetak oleh perusahaan yang menang tender. Pencetakan ujian ini tetap diawasi polisi dan LSM. ”Selesai ujian lembar jawaban dikumpulkan ke BPPT nanti ada alat untuk scaning, diawasi oleh 10 PTN yang tergabung dalam konsorsium, terus di proses semuanya dengan komputer,” sambungnya. Azwar menjamin hasil pemeriksaan ujian CPNS ini sangat akurat. “Ini pakai komputer, bukan pakai orang lagi,” imbuhnya. Azwar mengatakan untuk tahun ini ada 15.800 posisi yang tersedia. Menurutnya posisi ini tergolong kecil karena tahun ini masih ada moratorium PNS. Sebelumnya Deputi SDM Aparatur Kementerian PAN-RB, Ramli E Naibaho, mengatakan hasil ujian CPNS akan diumumkan pada 17 September 2012. Tetapi ternyata tanggal 17 September adalah hari diselesaikannya koreksi jawaban tes. ”Ini selesai dikoreksinya 17 September dan diumumkan tanggal 19 September, jadi tidak ada yang mundur,” kata Deputi SDM Aparatur Kementerian PAN-RB, Ramli E Naibaho, saat

mendampingi Menteri Azwar Abubabakar dalam jumpa pers tersebut. Pemerintah Evaluasi Seleksi CPNS Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (Kemenpan dan Rebiro) akan mengevaluasi proses seleksi penerimaan calon pegawai negeri sipil (CPNS) 2012. ”Penerimaan CPNS pada tahun ini berbeda dengan tahun sebelumnya. Meskipun demikian, kami akan melakukan evaluasi terhadap pelaksanaannya,” ujar Menpan dan Rebiro Azwar Abubakar di Jakarta, Senin (17/9). Seleksi CPNS yang dilangsungkan pada 8 September berbeda dengan penerimaan sebelumnya. Jika pada proses sebelumnya, tanggung jawab pembuatan soal diserahkan pada daerah, pada tahun ini melibatkan perguruan tinggi. Kemudian, pelaksanaannya juga dilangsungkan serentak di seluruh Indonesia. Kemenpan juga menggandeng sejumlah pihak dalam seleksi CPNS itu seperti perguruan tinggi, polisi, dan lembaga swadaya masyarakat. “Pengumumannya dilakukan transparan, diperlihatkan berapa nilainya. Jadi mereka tahu nilai mereka sebenarnya,” kata Azwar. Begitu juga bagi kementerian ataupun pemerintah daerah yang mengajukan penerimaan CPNS, terlebih dahulu melakukan analisa jabatan. Sehingga nantinya, PNS yang baru itu jelas akan ditempatkan di posisi apa. “Pemda yang belanja pegawainya lebih 20% dari APBD tidak boleh lagi mengajukan,” tambah Azwar. (dtc/int)

„ Wakil Ketua KPK hadir di pembahasan persiapan penyidik independen.

KPK Siapkan Penyidik Independen JAKARTA- KPK masih akan tetap memperjuangkan 20 penyidiknya yang mendadak ditarik Mabes Polri. Namun, Lembaga antikorupsi ini juga sudah siap dengan opsi penyidik independen. Jubir KPK Johan Budi mengatakan pihaknya tengah menempuh opsi utama, yakni melakukan koordinasi lanjutan dengan Kapolri agar 20 penyidik tidak ditarik dalam waktu dekat ini. ”Karena load di KPK ini sedang tinggi,” kata Johan di kantornya, Senin (17/9). Namun jika upaya itu gagal, KPK sudah memiliki opsi lain. “Kalau nanti jalan buntu, penyidik tidak bisa dipertahankan, opsi melakukan rekrutmen penyidik di luar polisi dan jaksa akan jadi salah satu opsi yang akan dipilih KPK,” ujar Johan. Mengenai opsi terakhir ini, lanjut Johan, sudah dalam tahap pembahasan di tingkat pimpinan. Namun Johan menegaskan, pihaknya akan menempuh opsi pertama terlebih dahulu. ”Opsi awal kita tetap untuk memperjuangkan 20 penyidik. Karena untuk rekrutmen itu juga perlu waktu, sekitar dua bulan. Nah selama dua bulan ini kerja KPK jadi terhambat,” pungkasnya. Komisi III Kaji Penyidik Independen KPK Komisi III Dewan Perwakilan Rakyat akan mengkaji wacana

perlu tidaknya perekrutan penyidik independen untuk mengisi Komisi Pemberantasan Korupsi (KPK) di masa depan. “Perlu ruang untuk mendalami ini, misalnya kita pelajari lagi Undang-Undang KPK. Kita kaji lagi apa sisi positif dan negatifnya,” kata Ketua Komisi III DPR I Gede Pasek Suardika seusai rapat dengan KPK, Kepolisian, dan Kejaksaan di Gedung Kompleks Parlemen Senayan, Jakarta, Senin (17/9/2012). Pasek mengatakan, perlu dipikirkan bagaimana jenjang karir dan nasib para penyidik independen di KPK nantinya. Pasalnya, kata dia, tidak mungkin orang yang direkrut itu selamanya menjadi penyidik. Pasek menambahkan, wacana itu tidak bisa dibahas dengan cepat lantaran banyak hal yang perlu dipikirkan. Politisi Partai Demokrat itu meminta kepada semua pihak jangan langsung menyimpulkan bahwa penyidik independen adalah solusi dari ketergantungan KPK atas insititusi lain perihal sumber daya manusia. Pasek memberi contoh reaksi berbagai pihak pascapenarikan 20 penyidik oleh Polri bahwa KPK harus mulai merekrut penyidik independen. “Jangan buru-buru, kita memang perlu duduk bareng,” pungkas Pasek. (kmc/int)


18 September 2012

Koordinator Kontras Haris Azhar.

“Terus terang aja, saat ini hingga kedepannya nanti sedang berlangsung penguatan untuk rezim security. Indikasi paling kuatnya dengan terkesan dipaksakannya pengajuan RUU Kamnas ini masuk ke dalam pembahasan undangundang,”

“(Penyidik KPK dari TNI) Itu tidak benar. Kalau mau tentu harus melepaskan dulu militernya, kalau dia melepaskannya, siapa-siapa saja boleh,” Juru Bicara KPK, Johan Budi.

Menteri Keuangan Agus Martowardojo.

“Banyak pelanggar hukum yang tidak ketahuan. Sekarang kita yakinkan ke pengadilan bahwa mereka harus diproses. Jadi, tidak hanya cukup diproses di pengadilan saja. Harus diyakinkan bahwa pengadilan nanti memberikan hukuman mati kepada koruptor,”

Kirim Opini Anda ke email: metrotasahan Maksimal tulisan 5.000 karakter

Sikap Kami Penyidik Independen untuk KPK SINYALEMEN bahwa upaya pemberantasan korupsi di negeri ini penuh tantangan dan bagai jalan mendaki bukanlah isapan jempol. Penegak hukum tidak sekadar menghadapi risiko berat arus balik perlawanan para koruptor, tetapi juga harus menerima gangguan-gangguan sporadis yang datang dari berbagai penjuru. Salah satu gangguan itu ialah ditariknya 20 penyidik Polri dari institusi Komisi Pemberantasan Korupsi (KPK), pekan lalu. Penarikan penyidik Polri sebanyak itu merupakan peristiwa pertama kalinya sejak KPK berdiri. Penarikan sebelumnya memang pernah terjadi, tetapi jumlah yang ditarik paling banyak hanya tiga orang. Polri beralasan penarikan itu dilakukan karena masa kerja mereka sudah habis. Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal Boy Rafli Amar mengatakan kepolisian menyadari penarikan tersebut membuat komisi antikorupsi tersebut kekurangan sumber daya manusia. Terkait dengan hal itu, kepolisian mengaku siap memberikan pengganti. Bagi KPK, penarikan dalam jumlah besar tersebut jelas mengagetkan dan mengganggu. Mengagetkan karena beberapa penyidik yang ditarik itu baru bertugas satu tahun hingga dua tahun di KPK. Padahal, Peraturan Pemerintah Nomor 63 Tahun 2005 tentang Sistem Manajemen Manusia Sumber Daya KPK menyebutkan seorang penyidik Polri bisa bertugas di KPK selama empat tahun dan kontraknya bisa diperpanjang hingga empat tahun lagi. Itu artinya beberapa penyidik yang ditarik tersebut belum habis benar masa kerja mereka di KPK. Penarikan itu juga mengganggu karena dilakukan di tengah upayagencarKPKmenyidikkasus-kasuskakapsepertikasusBank Century, Hambalang, dan Wisma Atlet. Juru bicara KPK Johan Budi memberikan gambaran bahwa satu penyidik di KPK bisa menangani tiga hingga empat kasus korupsi. Dengan hilangnya 20 penyidik, berarti nasib 80 kasus korupsi terancam terkatungkatung. Karena itulah, kita menyesalkan penarikan penyidik secara besar-besaran dari Polri itu. Penarikan itu menjelaskan kepada publik secara terang-benderang bahwa ada yang tidak mulus dalam koordinasi dua institusi penegak hukum tersebut. Namun, di sisi yang lain, penarikan 20 penyidik Polri dari KPK itu semakin menunjukkan KPK sangat membutuhkan penyidik milik sendiri, yang melekat secara organis di tubuh KPK. KPK tidak boleh bergantung pada penyidik dari kepolisian. Selain itu, KPK pun harus memiliki penyidik yang independen. Dengan memiliki penyidik independen, secara substantif penanganan perkara di KPK tidak bisa diintervensi pihak lain. Perang melawan korupsi memang bukan pekerjaan menyenangkan. Berkali-kali kita ingatkan dalam forum ini bahwa perang melawan korupsi butuh napas panjang, bahkan amat panjang karena ia merupakan perang tiada akhir. Karena itu, gangguan atas perang melawan korupsi itu mesti dipahami sebagai keniscayaan yang sudah diperhitungkan. Jadi, tidak ada alasan bagi KPK untuk menyerah hanya karena kehilangan sejumlah penyidik. (**)

Belajar dari Matsushita Beberapa hari yang lalu, ramai diberitakan oleh banyak media, di Jepang terjadi sebuah cerita yang mengenaskan yakni Menteri Jasa Keuangan, Tadahiro Matsushita, ditemukan tewas di kediamannya, di Tokyo, Jepang. Matsushita tewas diduga karena bunuh diri. Bunuh diri itu dilakukan dikarenakan dua hari sebuah tabloid di negeri Saudara Tua kita itu akan membongkar skandal Matsushita dengan seorang perempuan lain.


Ardi Winangun

KEPERGIAN Matsushita selama-lamanya itu tentu berpengaruh terhadap pemerintahan eksekutif Jepang sebab banyak rekannya menganggap ia adalah politisi berpengalaman dan kualitas kerjanya tinggi. Matsushita melakukan demikian, untuk menebus dosa. Hal demikian untuk menunjukan sebuah kehormatan bagi dirinya. Ia berpikir lebih baik mati berkalang tanah daripada hidup menanggung malu. Langkah yang dilakukan Matsushita di Jepang sendiri bukan suatu hal yang baru dan pertama. Bunuh diri dengan alasan kesalahan yang dilakukan dianggap sebagai sebuah kehormatan. Dengan tindakan yang disebut harakiri, kematian untuk menembus kesalahan, atau kamikaze yang artinya kematian untuk persembahan kepada Kaisar demi kemulyaan negara dan bangsa Jepang, merupakan tradisi turun temurun yang terjadi di Jepang hingga saat ini. Dengan halhal demikianlah maka dosa yang dialami bisa ditembus atau kemulyaan roh di Gunung Fujiyama bisa tercapai. Kejadian bunuh diri karena malu atas kesalahan yang dilakukan sepertinya hanya terjadi di Jepang, kalaupun ada di tempat yang lain, seperti menembakan pistol di kepala, itu hanya sesekali terjadi. Dengan sikap demikianlah maka pejabat di Jepang selalu dituntut untuk hidup dan bersikap yang baik, sesuai dengan hukum maupun norma dan etika Shinto atau agama asli Jepang. Dengan tradisi seperti itu, maka dari Jepang kita nyaris tidak pernah mendengar apa yang namanya korupsi, kolusi, atau nepotisme yang dilakukan pejabat. Bila kita mendengar hal yang demikian, maka tidak lama lagi, pelaku akan melakukan hal bunuh diri. Dengan tindakan

satria itulah maka pejabat di negeri matahari terbit itu berlomba-lomba untuk menunjukan kebaikannya. Sayangnya tradisi yang baik itu, mundur atau bila perlu bunuh diri bila melakukan kesalahan, tidak menular ke banyak negara, apalagi di Indonesia. Sayang selama Jepang menjajah Indonesia, tradisi itu tidak ditularkan. Mungkin kalau menjajah selama 350 tahun, tradisi itu bisa hidup di masyarakat, sayangnya cuma 3,5 tahun. Bagi pejabat di Indonesia apa yang dilalukan Matsushita itu disebut tindakan yang konyol dan bodoh. Pejabat di Indonesia beranggapan mengapa sudah menjabat enakenak menjadi menteri harus melakukan bunuh diri. Pendapat pejabat di Indonesia demikian, sebab tindakan seperti korupsi, kolusi, nepotisme, bahkan selingkuh merupakan hal yang biasa. Justru ada ada anggapan, kalau tidak melakukan seperti demikian sebuah kebodohan sebab tidak bisa menggunakan jabatan yang ada untuk mengeruk uang negara atau bersenang-senang dengan menggunakan fasilitas negara. Bahkan di Indonesia, seorang pejabat yang sudah nyatanyata melakukan tindakan korupsi, kolusi, nepotisme, dan selingkuh, masih bisa berkoar-koar di depan orang banyak, bahkan masih sempat-sempatnya ikut pilkada atau pileg. Mereka berdalih tidak merasa bersalah meski pengadilan sudah memutus salah. Pejabat itu selalu berdalih mengatakan, saya menjadi korban politik. Maraknya pejabat yang tidak mundur apalagi bunuh diri di Indonesia bisa jadi karena kultur Indonesia dan Jepang berbeda. Jepang memiliki budaya kesatriaan yang tinggi, tanggung jawab adalah nomer satu. Sedang di Indonesia

tradisi seperti itu, yakni tegas dan tanpa toleransi bila melakukan kesalahan tidak terbangun. Perbedaan inilah yang membuat banyak pejabat berlindung di balik budaya Indonesia yang sangat toleransi kepada korupsi, kolusi, nepotisme, dan skandal sex. Hal demikianlah yang membuat banyak pejabat di Indonesia mengatakan bahwa mundur bukan budaya Indonesia. Bahkan ada yang mengatakan mundur sebuah bentuk tindakan yang tidak bertanggungjawab. Meski soal keyakinan kematian antara orang Jepang dan Indonesia ada persamaan, namun dalam penerapannya berbeda. Kalau keyakinan orang Jepang mati dengan bunuh diri untuk kehormatan diri, Kaisar, dan negaranya, itu syah dan wajib. Lain dengan keyakinan yang ada di tengah masyarakat kita. Keyakinan di tengah masyarakat, bunuh diri dilarang keras. Toh kalaupun rela mati untuk kepentingan yang lain, itu masih terjadi perdebatan boleh atau tidaknya. Hal inilah yang membuat mengapa bunuh jarang terjadi di tengah masyarakat. Di Indonesia orang bunuh diri karena mengalami gangguan jiwa. Tak ada budaya mundur inilah yang membuat pemerintahan berjalan tidak efektif. Orang yang sudah benarbenar tak mampu bekerja dan sering gagal masih saja bertahan memimpin sebuah lembaga, institusi, atau pemerintahan. Matsushita yang bunuh diri disebabkan media mau membongkar skandal sex-nya, sedang di Indonesia seorang pejabat yang dari hari ke hari, bahkan dari bulan ke bulan, sudah dikupas oleh koran, majalah, televisi, radio, dan media massa, akan tindak korupsinya, tetap saja bertahan sebagai pimpinan. Akibat dari tak mau mundur akibat kesalahan inilah yang membuat energi menjadi terkuras karena serangan dari kelompok oposisi dan masyarakat, akibatnya pemerintahan berjalan tidak efektif. Lain dengan di Jepang, mundur akibat kesalahan membuat pemerintahan menjadi efektif, sebab batu sandungan yakni pejabat yang melakukan kesalahan itu hilang, sehingga oposisi berhenti menyerang. (**) Penulis adalah Pengamat Politik



18 September 2012





„ Dewi

„ Alim Kwok

PANCURBATU- Emosi Dewi (32), penghuni barak Hendri di Bandar Baru tiba-tiba memuncak ke salahseorang hidung belang. Pasalnya, usai indehoi di Bungalau Gemilang, Alim Kwok (33) Warga Jalan Belawan, Kelurahan Titi Papan, Kecamatan Medan Labuhan, tak mau membayar jasa seksnya. Akibatnya, Alim pun digiring ke Mapolsek Pancurbatu, Senin (17/ 9), sekira pukul 07.00 WIB. Informasi dihimpun di Mapolsek Pancurbatu menyebutkan, malam itu Alim datang ke Bandar Baru dengan mencarter Taxi Exspress BK 1547 HA yang dikemudikan Amir Hamzah Lubis (23), warga Desa Patumbak, Kecamatan Patumbak. Setibanya di sana, mereka pun memesan Bungalaw Gemilang yang ada di kawasan prostitusi tersebut. Selanjutnya, Alim pun memesan cewek ke salahseorang romboy. Tak berselang lama, Dewi yang merupakan warga Purwokerto Jawa Timur datang ke kamar yang ditempati keduanya. Begitu tiba di ruangan yang berisi dua tempat tidur tersebut, Alim dan Dewi pun negosiasi harga, dan mereka pun sepakat hingga siang hari Alim membayar sebesar Rp800 ribu. Karena telah mencapai kesepakatan, kedua insan berlainan jenis ini langsung naik bulan. Malam itu, Alim meniduri Dewi hingga dua kali. Setelah bercinta, Dewi pun meminta bayaran sesuai dengan yang telah disepakati tadi kepada Alim. Namun bukan jawaban yang didapat Dewi, melainkan sang hidung belang langsung bolak-balik masuk kamar mandi. Melihat itu, Dewi pun mengamuk sejadinya dan membuat Amir yang berada persis di kamar sebelah keluar, dan menanyakan permasalahannya. Ketika dijelaskan Dewi kalau Alim tak membayar uang jasa ngeseknya, Amir pun terkejut bukan main, karena sesaat sebelum pergi Alim mengaku sebagai pengusaha dan hendak menemui temannya di Bandar Baru. Pantauan di Mapolsek Pancurbatu terlihat kalau Dewi terus merepeti Alim dengan kata-kata kasar. “Dasar kau modal kon***mu aja, udah ngotori punyaku kau. Dua kali ‘nembak’, malah tidak bayar pula. Kau pikir ini milik Negara. Bolakbalik kamar mandi kau saat itu, mau larinya kau itu kan? Alasanmu mau ke kamar mandi, padahal kau mau lari, yang benar ajalah kau. Yang bayar kamarmu aja juga sopir taksimu itu. Manusia apa kau ini,” omel Dewi penuh emosi. Amir Hamzah saat diwawancarai mengatakan, saat itu Alim meminta dirinya untuk mengantarkan ke Bandar Baru. “Dia minta antarkan ke Bandar Baru dengan janji akan membayar Rp500 ribu pulang-pergi (PP). Karena yakin, aku pun mengantarkannya sampai tujuan dan aku pun menunggunya hingga pulang,” ujar Amir. Dikatakannya lagi, katanya jam 05.00 WIB, mereka harus pulang ke Medan, karena dia mau ke Bandara. Sebab pukul 07.00 WIB, dia sudah harus berangkat untuk urusan bisnis ke Jakarta. “Karena pengakuanya itu, aku pun jadi yakin dan aku tunggulah dia. Terus, pagi itu aku tiba-tiba dibangunkannya. Dia minta uangku Rp165 ribu, katanya mau dibayar di Bandara, karena di Bandar Baru tidak ada ATM. Aku kasilah, eh malah tak

lama, aku dengar suara gaduh dan ternyata dia gaduh sama cewek yang ada di kamarnya itu,” ungkap Amir, yang mengaku kalau istrinya lagi mengandung anak pertama mereka. Diceritakan Amir lagi, sekarang ia tidak bisa bilang apa-apa lagi, sebab dia sudah membayarkan uang kamar kepada pihak penginapan dari uangnya sendiri itu. Malam itu, ia sama sekali tidak ada membooking cewek. “Aku hanya tidur aja, itu pun karena di kamar itu ada dua ruangannya, kalau tidak aku mau tidur di taksiku saja,” ujar Hamzah sambil membuat pengaduan di Mapolsek Pancurbatu. Dewi sendiri mengaku tidak senang dengan ulah Alim tersebut. “Dia itu tidak punya otak, udah ditidurinya aku dua kali, eh malah mau lari dan tak mau bayar. Kurasa dia mau lari dari jendela kamar mandi, tapi karena tak ada jendela di kamar mandi itu, dia pun tak jadi lari,” ujar Dewi. Di Kantung Alim Cuma Ada Lima Ratus Perak Dikatakannya lagi, uang kamar aja sopir taksi itu yang bayar. Laki-laki apa seperti itu. Uang di kantongnya saja hanya 500 perak, tapi sok kali gayanya. Katanya mau bayar aku satu malam Rp800 ribu. Katanya dia punya usaha di kilometer 15 Tebing, banyak kalilah cakapnya. Memang saat main, dia pakai kondom,” ujar Dewi yang mengaku telah memiliki satu orang anak ini. Sementara Alim, saat diwawancarai mengatakan, ia sudah mengajak mereka untuk mengambil uang pembayarannya, namun si cewek itu tidak mau. Begitu juga dengan si supir itu dia juga mengaku sudah mengajak untuk bertemu dengan salahsatu keluarganya di Medan. “Tapi mereka enggak mau,” kilah pria turunan Tionghoa ini. Namun saat pembicaraan itu tiba-tiba Amir memotong pembicaraan kru koran ini dengan Alim dan mengatakan; ”dia memang mengajak saya ke Medan pak, tapi saya berpikir akan buang-buang waktu dan minyak saja. Lalu, saya menelepon temanku yang ada di Medan untuk mencari alamat yang diberikannya itu, dan saat ketemu dengan keluarganya itu mereka tidak mau bertanggungjawab atas ulahnya itu. Bahkan kata keluarganya itu, bukan kali ini saja dia berbuat tapi sudah berkali-kali, dan keluarganya itu tak mau lagi bertanggungjawab dan bukan urusan mereka lagi,” ujar Amir menjelaskan. Mendengar perkataan Amir tersebut, Alim pun langsung tertunduk lesu, dan terdiam saat ditanyai di mana-mana saja dia telah melancarkan aksinya itu. Kapolsek Pancurbatu Kompol Darwin Sitepu PB membenarkannya. “Saat ini, kita masih melakukan penyelidikan,”ujar Darwin singkat. (roy/pmg/ dro)


„ Edi Simarmata terbujur kaku di kamar jenajah akibat kecelakaan lalu lintas. Salahseorang saudarinya terlihat menangisi jasadnya, Senin (17/9).


SIANTAR- Edi Simarmata (48), warga Sirpang Sigodang, Kecamatan Panei, tewas ditabrak Kijang Innova BK 1968 T di jalan umum SiantarSaribudolok, Nagori Marjandi Embong, Panombeian Panei, Senin (17/ 9), sekira pukul 09.30 WIB. Pria yang sehari-hari menganyam keranjang (pengrajin keranjang dan biasa disebut parkaranjang, red) tewas di tempat dan batal sarapan pagi ke Marjandi Embong. Informasi dihimpun, korban melaju dengan kecepatan sedang dari arah Raya menuju Siantar mengendarai Honda GLPro BK 6083 TR. Korban berangkat dari rumahnya di Sirpang Sigodang dan berniat sarapan pagi di salahsatu warung di Nagori Marjandi Embong. Tiba di lokasi kejadian pada posisi jalan menurun, korban hendak berbelok ke kanan. Namun tiba-tiba Kijang Innova hitam BK 1968 T yang dikemudikan Maringan Butarbutar (49) langsung menabrak korban dari belakang hingga korban terpental dan kepalanya membentur ke jalan. Sesudah menabrak, Maringan langsung tancap gas disebabkan takut dimassa warga. Tak lama kemudian, Maringan menyerahkan diri ke kantor

polisi di Panei Tongah. Maringan merupakan warga Jalan Kabanjahe, Saribu Dolok, Kecamatan Silimakuta. Penuturan Lae (adik ipar) korban di RSU Djasamen Saragih, B Manurung (43), korban tinggal bersama istrinya di Sirpang Sigodang. Selama 20 tahun perkawinan mereka, hingga korban meninggal belum dikarunia anak. Keduanya juga tidak ada mengangkat anak sebagai penerus keturunan korban. Korban bekerja sebagai penganyam bambu yang dijual sebagai tempat sayuran dan buah-buahan kepada pedagang pengecer dari berbagai lokasi yang datang ke Sirpang Sigodang. Keluarga korban yang tinggal di kampung hanya satu orang, yaitu adik perempuan korban atau istrinya. Sedangkan saudara laki-laki korban yang lain merantau ke Kalimantan dan Pekanbaru. “Mau sarapan laeku ini tadi ke bawah, di Embong itu ada tempat sarapan yang selalu ramai dikunjungi warga. Baru dari rumah dia, itulah ditabrak dari belakang. Besok mau dikebumikan. Cuma masih kami tunggu saudaranya yang lain,” jelas lae korban ini. Amatan METRO di Ruang Instalasi Jenazah RSU Djasamen Saragih,

korban mengalami luka dan patah rusuk kanan. Lalu ada luka gugus di kaki kanan bawah korban. Salahseorang rekan korban bermarga Saragih kepada METRO menuturkan, pagi harinya korban masih melayat warga sekampungnya yang meninggal dunia. Kepada rekannya, korban sempat mengatakan dirinya ingin berangkat ke bengkel di Embong untuk memperbaiki jari-jari lingkar sepedamotornya. “Tadi di tempat orang meninggal itu dia (korban) bilang mau ke Embong perbaiki kretanya,” kata Saragih. Ditambahkannya selama ini korban bekerja sebagai pengrajin keranjang jeruk. Bahkan akhir-akhir ini usaha korban semakin lancar dan korban sudah memiliki anggota pengrajin keranjang untuk membantunya. Kanit Laka Lantas Ipda Alsem Sinaga ketika dikonfirmasi membenarkan kejadian tersebut. Kapolsek Panei Tongah AKP M Manik menambahkan meninggal di tempat. Sementara tersangka menyerahkan diri ke kantor polisi usai kejadian. Penyebab kecelakaan disebabkan pengemudi mobil Kijang Innova tidak hati-hati saat berkendara. (ral/ hot/dro)


Rupanya, Warga Merekraya

SIANTAR– Identitas pria yang ditemukan meregang nyawa di patung rumah adat Jalan Pematang, Kelurahan Pematang, Siantar Selatan, itu akhirnya terungkap, Minggu (16/9) pukul 17.00 WIB. Adalah Pasu Saragih Sumbayak (52), warga Huta Limak, Nagori Merekraya, Kecamatan Raya. Terungkapnya identitas korban itu setelah pihak keluarga Pasu di Kecamatan Raya membaca di media cetak tentang penemuan sesosok pria yang tidak bernyawa. Dengan memerhatikan fotonya, pihak keluarganya pun datang ke Ruang Forensik RS Umum Djasamen Saragih untuk memastikannya. Setelah memerhatikan, Barisman Saragih (57) memastikan bahwa pria tersebut merupakan adik kandungnya. Menurut keterangan Barisman, Pasu memiliki sakit keterbelakangan mental sejak usia muda. Akan tetapi Pasu sempat menikah dan sudah memiliki dua anak. Namun karena hubungan keluarga mereka tidak harmonis, Pasu dengan istrinya Paina Sinaga berpisah dan kedua anak mereka pun dibawa Paina ke daerah Bagan Batu. Sejak itu, kehidupan Pasu pun tidak menentu. Sementara kedua orangtuanya pun sudah lama meninggal, sehingga ia tinggal bersama abangnya yakni Barisman. “Dia ini anak ketiga dan kami semua enam bersaudara. Sejak kecil pun dia sudah ada sedikit gangguan mentalnya. Jadi selama ini, kehidupan Pasu pun tidak menentu kadang pergi ke Siantar beberapa lama dan pulang kembali ke kampung,” ujar Barisman, yang ditemani oleh Jatam Purba Pangulu Nagori Merekraya. Walau demikian, Pasu tidaklah suka mengganggu orang. Hanya saja dia lebih suka menyendiri dan jalan-jalan, sehingga kalau malam Pasu lebih sering tidur di lokasi patung tersebut. Menurut Barisman, penyebab kematian Pasu adalah karena memiliki sakit keterbelakangan mental, bukanlah karena narkoba atau lainnya akan tetapi karena terbawa sejak lahir. Akan tetapi setelah menikah penyakit Pasu semakin parah. Sementara itu, setelah dilakukan visum luar, pihak petugas Forensik tidak ada menemukan tanda-tanda adanya tindakan kekerasan sehingga pihak keluarga pun sepakat untuk tidak dilakukan outopsi terhadap korban. Pasu tersebut meninggal bukan karena ada tindakan pidana kekerasan. Surat pernyataan tersebut pun disampaikan kepada Polsek Siantar Selatan. Kapolsek Siantar Selatan AKP G Damanik menerangkan bahwa pihak keluarga tidak menuntut dan pihak keluarga Pasu telah membuat surat pernyataan. Menurut Barisman, rencananya Pasu akan dikebumikan hari ini Selasa (18/9) di Dusun Limak, Nagori Merek Raya. (pra/dro)

Capek jadi Kuli, Agus-Suheri Jadi Curanmor RAYA- Agus Pitoyo (26) dan Suheri (23), keduanya berprofesi sebagai kuli bangunannekadmencurisepedamotor(runmor) petani yang sedang diparkir di simpang perladangannya. Kedua pria tersebut berhasil ditangkap warga. Keduanya kemudian diserahkan ke polisi setelah sebelumnya babak belur dihajar massa. Kejadiannya bermula saat korban Kanariman Sinaga (37), warga Bah Pasussang, Nagori Siporkas, Kecamatan Raya, Simalungun hendak menuju ladangnya di Sinumpol Minggu (16/9). Seperti biasanya, sepedamotor Honda Mega Pro BK 6683 TW yang dikendarainya selalu diparkirkan di Simpang Sinumpol. Dua jam bekerja di ladangnya Kanariman hendak maragat (menyadap pohon aren). Saat tiba di lokasi tempat kretanya diparkirkan, Kanariman mendapati dua

orang yang tidak dikenalnya sedang mengutak-atik kunci kontak sepedamotornya. Dua pelaku yakni Agus Pitoyo dan Suheri, keduanya warga Pangkalan Budiman Sei Rampah kaget dan langsung kabur dengan menggunakan sepedamotor jenis bebek BK 5047 NZ ke arah Sindarraya. Kanariman yang baru sadar kedua pria yang tidak dikenalnya tersebut merupakan maling motor, kemudian berusaha mengejar pelaku dengan sepedamotornya yang tidak sempat dibawa pelaku tersebut. Hanya saja tidak berhasil karena sepedamotornya rusak dibuat pelaku. Kanariman kemudian menumpangi sepedamotor orang lain dan memberitahukan aksi percobaan pencurian tersebut ke warga Bah Pasussang. Bersama Pangulu Siporkas Jonaman Purba, Warga kemu-

dian mengejar pelaku sampai ke Raya Kahean. Pelaku kemudian ditemukan warga berada di Sindarraya. Pelaku yang emosi langsung menghajar keduanya hingga babak belur. Usai menghajarnya kedua pelaku kemudian diserahkan ke Polsek Raya. Kepada METRO, kedua pelaku mengaku nekad mencuri karena butuh uang. Pelaku juga mengaku bosan bekerja sebagai kuli bangunan. “Butuh uang bang, capek kerja bangunan trus,” katanya singkat. Kapolsek Raya AKP Sulaiman Simanjuntak ketika dikonfirmasi membenarkan penangkapan pelaku percobaan pencurian sepedamotor. Menurut dia, keduanya akan dikenakan pasal 363 KUHP tentang pencurian. (hot)



SIMALUNGUN– Muhammad Arif, rekan terdakwa Syahfitri Oktaviani Napitupulu (28) mengaku bahwa ia diberi upah saat disuruh membeli sabu. Sebelumnya, pelayanan Kafe Gagak Hitam di lokalisasi Adian Padang, Kecamatan Girsang Sipangan Bolon tersebut terlebih dahulu memberikan uang Rp800 ribu pada saksi. Hal itu diungkapkan M Arif (terdakwa berkas terpisah) saat menjadi saksi dalam perkara Syahfitri di Pengadilan Negeri Simalungun, Senin (17/9). “Saya baru kenal dengan terdakwa sekitar sebulan sebelum kejadian. Saat itu, kami hanya kenal-kenal gitu saja hingga terdakwa menyuruh saya untuk mencarikan sabu,” sebut saksi di hadapan hakim Monalisa dan Siti Hajar. Lebih lanjut ia menerangkan, saat itu tepatnya Rabu (16/5) terdakwa memberikan uang padanya sebesar Rp800 ribu. Dari uang sebanyak itu

digunakan untuk membeli sabu sebanyak Rp700 ribu dan sisanya untuk dirinya sebagai upah. “Selanjutnya, saya membeli sabu itu dari Dedek. Kemudian saya menyerahkan sabu itu kepada terdakwa di tempat dia bekerja. Saat saya bertanya untuk apa sabu itu digunakan, terdakwa mengaku hanya untuk dipakai saja,” jelas Muhammad Arif. Menurut dia, saat sabu itu diberikan hanya satu paket saja bukan sembilan paket. Selain itu ia hanya mengetahui bahwa sabu itu untuk dipakai terdakwa. Sementara terdakwa meminta tolong padanya masih satu kali saja. Mendengar keterangan itu, hakim Monalisa sempat bertanya mengapa bisa bungkusan sabu yang diberikan antara saksi dan

terdakwa berbeda. “Si terdakwa membeli sabu bukan untuk dipakai. Sebab saat menerima sabu dari saksi masih satu paket, tapi mengapa saat dilakukan penangkapan bisa menjadi sembilan paket. Berarti si terdakwa mau menjual sabu itu lagi kan,” paparnya. Katanya, terdakwa dan saksi jangan main-main dan berbohong tentang perkara tersebut. Sebab mereka adalah jaringan dan saling berkaitan tentang peredaran barang haram tersebut. Bila saksi tidak memberikan keterangan yang sejujurnya, maka dalam perkaranya akan diungkap semua tentang sabu tersebut. Usai mendengar perkataan hakim lagi-lagi saksi Muhammad Arif mengaku bahwa ia hanya disuruh oleh terdakwa. Ia baru saja mengenal terdakwa dan katanya sabu itu hanya untuk dipakai saja. Kalau untuk dijual atau lainnya saksi mengaku tidak mengetahuinya. (mua)


„ Sesosok mayat laki-laki itu rupanya Pasu Saragih.

Pengancam Ibu Kandung Dituntut Setahun Penjara SILOU KAHEAN– Terdakwa AliandoPurba(33)wargaJalanSarang Panei,NagoriTani,KecamatanSilou Kaheantertunduklesusetelahdituntutsetahunpenjara.Terdakwamelakukan pengancaman terhadap ibu kandungnyaNurmilahSaragihdan melanggar pasal 335 ayat 1 KUHPidana. HalitudisampaikanJaksaPenuntutUmum(JPU)BilinSinagadihadapan majelis hakim Ramses Pasaribu beranggotakanMonalisadanAdria DwiAfanti,Senin(17/9).Menurutnya, berdasarkan keterangan di persidangan peristiwa itu berlangsung padaSenin(23/4)sekirapukul07.00 WIB. “Awalnya terdakwa meminta uangRp6jutakepadaibunya.Akan tetapiibunyamengakutidakmemiliki uang karena kesehariannya hanya berjualansarapanpagi,”sebutnya. Iamenerangkan,akhirnyaibunya hanya mampu memberikan uang sebesar Rp1,5 juta. Akan tetapi terdakwa merasa tidak senang dan tidak mau menerimanya uang tersebut. Terdakwa langsung menendang rumah mereka dan mengambil pipa besi dan hendak memukul ibu beserta dua orang adiknya. “Saat terdakwa hendak

memukul ibunya, langsung kedua adiknya Riduan Purba dan Wilma Purbamengambilkanbesitersebut. Sementaraibunyamengakubahwa mereka sudah tidak sanggup lagi dengan tingkah dan perilaku terdakwa, sebab terdakwa sering marah-marahdenganalasansepele,” ungkapJaksa. Sambungnya, sementara keterangan terdakwa di persidangan membantah meminta uang pada ibunya. Terdakwa kesal lantaran seluruh tetangga dan temannya menyebut dirinya sebagai layanglayang. Sehingga dengan berbagai pertimbangan tersebut agar majelis hakim yang mengadili perkara itu menyatakan terdakwa terbukti secarasahmelakukantindakpidana. Selanjutnya JPU memutuskan menuntut terdakwa satu tahun penjara dikurangi selama masa tahanan. Usaimendengarkantuntutanitu, terdakwa meminta kepada hakim agar diberikan hukum seringanringannya.Terdakwajugamengaku sangatmenyesaliperbuatannyadan berjanjitidakmengulangihaltersebut kembali.(mua)


18 September 2012

Nelson Ngaku Bantai Orangtuanya Pakai Golok Sambungan Halaman 1

Tiba di rumah korban, Adil lantas mengetuk pintu, seraya mengucapkan salam. Namun, berulangkali diketuk, tak ada jawaban dari dalam. Tak ingin berlama-lama di rumah itu, Adil lantas mengintip isi dalam rumah melalui jendela sekadar memastikan bahwa penghuni rumah ada di dalam. Bukannya melihat pemilik rumah, Adil malah melihat, banyak bercak darah berceceran di lantai. “Jadi tadi Si Adil, anak warga di sini mau ngantar nasi among-among. Karena waktu pintu diketuk nggak ada jawaban, Adil mengintip dari jendela. Terus, lihat ada ceceran darah. Si Adil lari, dan cerita sama beberapa warga di sini,” kata seorang pria yang disapa To saat berbincang-bincang dengan METRO di halaman rumah korban. Masih cerita warga, laporan Adil lantas ditindaklanjuti warga dengan mendatangi rumah korban, dan menghubungi pengetua kampung untuk bersama mengecek apa yang terjadi di rumah korban. Di luar perkiraan warga, saat pintu rumah dibuka, mereka mendapati pasutri itu sudah tewas bermandi darah, dalam posisi berdampingan. Tubuh keduanya dipenuhi luka bacok. Bahkan, tangan kedua korban nyaris putus. “Dari lukanya, sepertinya dibacok parang. Parah lukanya dek, kepala, kaki, badannya juga penuh luka. Sadislah,” kata warga lainnya. Temuan itu, kemudian dilaporkan warga

“Tersangka sudah mengakui perbuatannya, dan alat bukti berupa golok yang digunakan sudah ditemukan,” katanya. Dia menambahkan, walau pun tersangka sudah memberikan pengakuan, pihaknya akan tetap membawa Nelson ke ahli kejiwaan. “Memang suda ada pengakuan, tapi kita akan bawa tersangka ke ahli kejiwaan,” kata AKP SM Sitanggang. Seperti diberitakan sebelumnya, Minggu (9/9) lalu, peristiwa menghebohkan terjadi di Dusun VII, Desa Rawasari Kecamatan Aek Kuasan. Pasangan suami istri (pasutri) Bangga Hutapea (58) dan Marsaulina Br Simanjuntak (55), ditemukan tewas bersimbah darah di dalam rumahnya. Selidik punya selidik, ternyata pasutri itu meregang nyawa karena dibacoki dengan golok oleh anaknya Nelson Hutapea (27). Bahkan, sankin sadisnya, tangan dan kaki kedua korban ditemukan nyaris putus. Data dihimpun METRO di lokasi kejadian, penemuan tubuh pasutri itu dengan kondisi mengenaskan, kali pertama oleh Adil (11), seorang bocah yang masih terbilang tetangga kedua korban. Pagi itu, Adil oleh orangtuanya diminta mengantarkan nasi among-among (undangan hajatan berupa makanan) ke rumah kedua korban. Ketepatan, orangtua Adil, dalam pekan ini, akan mengadakan hajatan.

Azwar Abubakar dalam konpres di kantornya, Senin (17/9). Dijelaskannya, Kemenhum dan HAM telah memintakan 19 ribu tenaga sipir (golongan II) untuk ditempatkan di seluruh lapas yang ada. Hanya saja yang baru dipenuhi sekitar dua ribu tenaga lapas. Itu berarti masih kekurangan 17 ribu orang. “Masih sangat banyak tenaga lapas yang dibutuhkan. Untuk memenuhinya kami akan lakukan secara bertahap. Kalau tidak, kekuatan anggaran tidak mencukupi,” ujarnya. Meski masih menerima lulusan SMA, tambah Deputi SDM KemenPAN&RB Ramli Naibaho, syaratnya harus plus. Artinya lulusan SMA yang memiliki keahlian serta syarat yang dibutuhkan sebagai tenaga lapas. “Arahnya nanti tenaga lapas akan dinaikkan statusnya ke S1. Jadi nantinya, lulusan SMA yang sudah lolos akan dilatih dan disekolahkan sehingga standar yang kita harapkan dapat tercapai,” tuturnya. Dia menegaskan, lulusan SMA hanya akan diterima untuk formasi tertentu saja. Sedangkan formasi administrasi tidak diberikan. “Formasi administrasi tidak akan kita berikan lagi, baik lulusan SMA maupun sarjana. Kalau instansi membutuhkan tenaga administrasi bisa memberdayakan pegawai yang ada atau merekrut outsourching,” tandasnya. Pengumuman Hasil Tes CPNS Ditunda Pengumuman hasil tes CPNS yang rencananya dilakukan Senin (17/9) dibatalkan. Pemerintah beralasan, yang punya kewenangan mengumumkan adalah pimpinan instansi masing-masing. “Pada dasarnya proses pemeriksaan lembaran jawaban kerja (LJK) sudah selesai. Hasilnya juga sudah disegel dan siap diserahkan ke panitia pelaksana nasional (Pansel),” ungkap Azwar Abubakar, Senin (17/9). Dijelaskannya, konsorsium perguruan tinggi negeri (PTN) tadinya sudah akan menyerahkan hasilnya ke Pansel. Hanya saja Pansel maunya langsung diserahkan ke pimpinan instansi masing-masing dan enggan menahan lama-lama. “Karena itu, pengumumannya ditunda Rabu (19/9). Sebab, masih menunggu yang dari daerah datang mengambil hasilnya,” sambungnya. Meski tertunda dua hari, politisi PAN ini optimis hasilnya tidak akan berubah. Lantaran, LJK-nya disimpan pada tempat khusus di Gedung BPPT dan dalam posisi tersegel. “Hasilnya masih disimpan di tempat khusus yang hanya diketahui orang tertentu saja. Jadi Insya Allah tidak akan berubah hasilnya,” tandasnya. Dia menambahkan, setelah konsorsium menyerahkan hasil pemeriksaan LJK ke pansel. Di hari yang sama, Pansel nasional langsung menyerahkan kepada pansel masing-masing instansi untuk kemudian diumumkan. “KemenPAN&RB akan mengumumkan hasilnya sore di website setelah masingmasing instansi menerima hasilnya,” terangnya. (esy/jpnn)

Sambungan Halaman 1 kan untuk gaji dan sebagainya, Real Madrid memang berbicara di kancah Eropa. Apalagi di kompetisi domestik. Hanya saja, Trofi Liga Champions masih gagal masuk lemari koleksi sudah satu dekade lamanya. Terakhir musim 2001-2002 mereka angkat trofi antar klub benua biru itu. Lalu edisi 2009 hingga kini, Real Madrid masih hobi mengoleksi pemain kelas satu dunia. Dimulai dari era perekrutan Cristiano Ronaldo hingga zaman Karim Benzema dkk. Bedanya usia bintang yang dihadirkan relatif lebih muda dibanding Los Galacticos edisi perdana. Di bawah kendali pelatih nyentrik bermental juara, Jose Mourinho, Florentino Perez sang presiden klub ingin Madrid kembali jawara di Eropa. Dan musim inilah ambisinya. Konstelasinya dong? Oke. Lihat Manchester City masa kini. Disupport syeikh kaya raya, Mansour bin Zayed Al Nahyan, City menjelma jadi klub bertabur bintang. Mereka acap kali disebut media sebagai peniru ulah Real Madrid dengan Los Galacticos-nya. Dengan asupan dana tak berseri, Manchester City mudah saja

menanyai Nelson tentang kebenaran itu. Tetapi, Nelson tidak menyebutkan orangtuanya tewas karena dia yang membunuh. Bahkan Nelson menuturkan, ketika dia keluar rumah, dia suah melihat orangtuanya telah tewas. Selanjutnya, Lambok menelepon keluarganya di Aek Kuasan untuk mecaritahu keberadaan kedua mertuanya. Akan tetapi pihak keluarga mengatakan rumahnya terkunci dan tidak bisa dibuka. Lalu Lambok menyarankan, agar membawa pemerintah setempat supaya pintu rumahnya didobrak untuk memastikan pengakuan Nelson.

Sementara, sembari menghubungi keluarga yang berada di Aek Kuasan, Lisna dan Lambok melihat celana pendek yang dipakai Nelson ada bercak darah, semakin diperhatikan ternyata bercak darah juga ada di kepala Nelson. Melihat itu, Lambok dan Lisna curiga bahwa Nelson yang membunuh orangtua mereka. Kecurigaan mereka semakin kuat, karena ketika Nelson ditanyai, jawaban nelson berbelit-belit. Akhirnya, Lambok dan Lisna menghubungi petugas Polresta Siantar meminta supaya Nelson untuk sementara diamankan karena mereka curiga, adiknya itulah yang membunuh orangtua mereka. (sus/dok)

memboyong pemain yang diinginkan. Lihatlah sederet pemain ini: Mario Balotelli, Carlos Tevez, David Silva, Edin Dzeko, Sergio Aguero, Yaya Toure. Dan Siapa pun yang diiginkan sang syeikh sesuai kebutuhan Mancini, bisa dilobi lalu dibeli. Bahkan anekdot di kalangan pundit menyebutkan jika saja Lionel Messi dijual Barcelona bertriliun harganya, maka sang syeikh siap membayar. Begitulah konstelasinya. Samasama berstatus klub bertabur bintang. Hanya itu. Jika menilik prestasi, sudah jelas jawabnya. Madrid sudah punya sembilan trofi Liga Champions di lemarinya, sedangkan The Citizen nihil adanya. Apa kata para juru racik strategi untuk laga ini? Kita mulai dari cuap-cuap Mancini. Di Soccernet diberitakan jika Mancini berencana membangun sejarah layaknya Real Madrid. Bukan sekarang, tapi 10 tahun lagi. Wartawan usil bertanya yang lebih kepada menyindir soal uang yang dimiliki City. Menurut analisa awak media, uang tak akan mampu membeli sejarah. Tapi Mancini yang doyan senyum menjawab santai. “Sudah jelas, kami memang tidak memiliki sejarah seperti Real Madrid. Tapi kami sudah memenangkan beberapa piala

kok,” bebernya. “Kami ingin menang sekarang. Dan dalam 10 tahun ke depan kami akan menjadi tim top seperti Real,” lanjut pelatih yang menggantikan Mourinho di Inter Milan 2010 silam. Isu Ronaldo yang sedang galau di Bernabeu juga diamati pelatih asli Italia itu. Bahkan dia berharap Ronaldo tak dimainkan. “Lebih baik jika mereka meninggalkan Ronaldo di rumah. Ronaldo adalah pemain terbaik dunia,” sebutnya. Kalau Mou yang minta dipanggil The Only One tampak lebih santai menatap laga ini. Baginya yang utama adalah menang dan lolos dari grup maut ini. Grup D memang neraka. Dihuni empat klub jawara empat liga berbeda. Madrid wakili Spanyol, City wakili Inggris serta Ajax sang juara Belanda plus Dortmund yang angkat trofi di Jerman. “Kita berbicara tentang sebuah kelompok dengan empat juara liga dari empat negara besar. Terutama City dan Borussia Dortmund,” kata Mourinho di “Ajax juga berat, lihat saja sejarahnya di Eropa. Sangat sulit merebut poin dari grup ini,” lanjut Orang Portugal itu. Jadi bagaimana ambisi menggenapkan gelar juara Eropa jadi 10? “Itu sangat

Real Madrid (4-2-3-1) : 1-Casillas (g/c); 17-Arbeloa, 3-Pepe, 4-Ramos, 5Coentrao; 6-Khedira, 14-Alonso; 22-Di Maria, 19-Modric, 7-Ronaldo; 9Benzema Pelatih : Jose Mourinho Man City (4-2-3-1): 1-Hart (g); 3Maicon, 4-Kompany, 6-Lescott, 22Clichy; 14-Javi Garcia, 18-Barry; 21Silva, 42-Yaya Toure, 8-Nasri, 32-Tevez Pelatih : Roberto Mancini Stadion : Santiago Bernabeu, Madrid Wasit : Damir Skomina (Slovenia) menarik. Kalau kami mencapai angka 10 dalam raihan trofi itu akan menjadi satusatunya. Cara merebutnya ya dengan motivasi untuk terus menang, bermain baik dan juara.” “Tapi sepak bola itu indah karena tak kerap terduga. Kadang-kadang tim terbaik pun bisa tidak menang,” tutup Mourinho. So, siapa yang layak disebut The Real Galacticos? (*)

MAYAT BAYI LAKI-LAKI Sambungan Halaman 1


„ Paramedis Klinik Harapan Kita membersihkan jenazah Fransiskus Sigalingging yang tewas ditabrak truk di Simpang Desa Padang Mahondang Kecamatan Pulau Rakyat, Senin (17/9).

Siswa SMA Tewas Ditabrak Truk Sambungan Halaman 1 suara dentuman keras atas peristiwa itu, langsung menuju lokasi berusaha memberikan pertolongan dengan membawanya ke Klinik Harapan Kita. Sementara, sepedamotor dan truk diamankan ke Polsek Pulau Raja. Supir truk bernama Ewin (25), warga Desa Aek Loba Pekan Kecamatan Pulau Rakyat

Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :


„ Foto semasa hidup Bangga Hutapea dan Marsaulina br Simanjuntak.

The Real Galaticos

Lulusan SMA Masih Berpeluang... Sambungan Halaman 1

kepada Kepala Dusun VII Saikun (60). Saikun lantas menghubungi pihak kepolisian, dan melaporkan penemuan itu. Menjelang tengah hari, Kanit Reskrim Polsek Pulau Raja, Ipda W Siregar bersama sejumlah personil tiba di lokasi, dan melakukan oleh TKP. Sayangnya, olah TKP yang dilakukan sangat tertutup. Tak seorang pun dibiarkan masuk ke dalam rumah, selain kepala dusun dan sejumlah tokoh masyarakat setempat. Pantauan METRO, rumah papan berukuran 5 x 15 meter milik korban langsung dipasang police line, sehingga membuat ratusan warga yang berdatangan dari berbagai tempat, hanya bisa puas melihatlihat polisi yang tengah bekerja dari luar. Oleh polisi, setelah melakukan olah TKP yang menghabiskan waktu 3 jam lebih, kedua jenazah dimasukkan ke plastik berwarna gelap dan dibawa menuju RSUD dr Djasamen Pematangsiantar menggunakan ambulance milik Puskesmas Aek Kuasan untuk dilakukan otopsi. Selanjutnya, Nelson yang sempat melarikan diri. Akhirnya ditangkap dari rumah kakaknya di Pematangsiantar. Diketahui, Nelson yang mengenakan celana pendek dan kaos warna ungu tiba di Siantar, Minggu (9/9) pukul 11.00 WIB. Kepada kakaknya Lisna dan abang iparnya Lambok Situmorang, Nelson mengaku orangtua mereka tewas di dalam rumah. Mendengar itu, Lambok dan Lisna

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

kepada METRO menuturkan, dia melintas dari arah Aek Loba hendak menuju Pabrik Kelapa Sawit PTPN IV Kebun Pulau Raja. Sesampai di simpang Desa Padang Mahondang, tiba-tiba muncul sepedamotor yang langsung mengarah ke jalan raya. Ewin mengaku, sudah memberikan aba-aba kepada pengendara sepedamotor dengan cara membunyikan klakson. Namun, pengendara

Departemen Redaksi METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin PurbaEva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput)

sepedamotor tidak menghiraukan sehingga terjadi tabrakan. Kaposlantas Pulau Raja Aiput Mariadun didampingi Aiptu R Purba ketika dikonfirmasi, membenarkan peristiwa kecelakaan yang menewaskan Fransiskus Silalahi. Dan pihaknya sedang melakukan pemeriksaan dan sudah mengamankan sepedamotor dan truk di Polsek Pulau Raja.(sof)

METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ardi, Roy Amarta, Ferdinan. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Data dihimpun di lokasi penemuan, mayat bayi itu kali pertama ditemukan oleh warga yang sedang memancing di pinggiran sungai. Merasa curiga, dia pun langsung memberitahukan penemuan mayat bayi itu kepada anak-anak yang kebetulan sedang mandi di sungai. Selanjutnya, anak-anak tersebut langsung mengangkat mayat bayi itu ke atas dan memberitahukannya ke warga sekitar. Menurut Yudha (11), saat itu dia sedang mandi di sungai dengan beberapa orang temannya, dan melihat mayat bayi itu dalam posisi telungkup mengapung terbawa arus sungai. “Kami lagi mandi-mandi Bang, ada uwakuwak bilangkan ke kami kalau ada mayat. Kami lihat lah dekat, rupanya anak bayi ngapung telungkup dan telanjang. kami angkat lah ke atas, terus kami bilang sama orang-orang,” ujarnya. Kepala Lingkungan 17 Kelurahan Binjai Priyatno di lokasi kejadian menyebutkan, di daerah itu sepengetahuannya tidak ada wanita yang mengandung. Sehingga, dia berpendapat mayat bayi laki-laki itu bukan dari daerah lingkungan yang dpimpimpinnya.”Saya yakin ini mayat terbawa arus dari atas sana, inikan udah alirannya yang ke bawah terus sangkutlah kemari,” jelasnya. Pantauan di lokasi, terlihat kerumunan warga yang membuat lokasi menjadi sangat ramai karena ingin melihat mayat bayi itu. Sempat warga sekitar berinisiatif untuk langsung menguburkan mayat bayi itu karena kasihan, namun Priyatno mengatakan kalau hal ini diserahkan ke pihak kepolisian dan pihak kepolisian dari Polsek Medan Area pun tiba di lokasi kejadian dan kemudian mayat tersebut dibawa ke RS Pirngadi Medan untuk keperluan otopsi. (Bay/Gus/pmg)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


SELASA 18 September 2012

PengurusDPDGerindraSumut LakukanVerifikasiFaktual

Sambungan Halaman 1 Gerindra Sumut untuk Sambungan Halaman 8 melakukan lansung verifikasi Pantauan METRO, para sekaligus silaturahmi ketingkat pengurus PAC Partai Gerindra kecamatan. di kecamatan di Batubara telah Selain itu, seluruh kader menyiapkan berkas dan adpartai dimintakan untuk siap ministrasi. Ketua DPC Gerindra memenangkan Prabowo pada Batubara, M Arafig mengatapelaksanaan Pemilu 2014 kan, turunnya pengurus DPD mendatang. (js)

Pembangunan Irigasi di Sei Balai ‘Tambal Sulam’ Sambungan Halaman 8

Senin (17/9) saat dikonfirmasi mengaku ia hanya sebagai buruh. “Kami disuruh seperti ini ya kami kerjakan lah bang. Mengenai berapa besar dananya kami nggak tahu,” katanya. Sementara data dihimpun METRO, pengerjaan proyek ini dikerjakan oleh perusahaan dari Medan dan anggaran men-

capai Rp449 juta untuk membangun 300 meter bangunan irigasi. Terpisah, Kepala UPT Dinas Pertanian Kecamatan Seibalai, Hamidah membenarkan bahwa bangunan tersebut milik provinsi dan bukan proyek kabupaten. Itu sebabnya pembangunan irigasi tersebut tanpa melibatkan pihak Dinas Pertanian Batubara. (js)

Saksi Ngaku Tak Lihat Terdakwa Bunuh Korban Sambungan Halaman 1

Sambungan Halaman 8

melihat langsung peristiwa kekerasan dan penganiayaan terhadap korban. Resta mengaku dalam kasus itu dirinya hanya mendengar keterangan dari Asman Silalahi. Sementara Yusbar Manurung mengaku dalam kasus pembunuhan Poridin dirinya hanya mendengar keterangan dari Hasanuddin Harahap alis Buyung yang didengarnya melalui telepon. Di mana saat Hasanuddin mengatakan kepada Yusbar Manurung kalau Poridin tewas dibunuh ketiga terdakwa. Sementara penasehat hukum ketiga terdakwa yakni M Taufik

Umar Dhani Harahap SH dan Bahren Samosir SH dalam persidangan mengatakan, kasus tersebut diawali perebutan lahan yang terletak di Dusun I Desa Bangun Kecamatan Pulo Rakyat Kabupaten Asahan tepatnya di sekitar Posko Kelompok Tani Serikat Petani Indonesia (SPI) areal kebun kelapa sawit koperasi Bina Tani Mandoge. Kuasa hukum terdakwa juga mengaku, berdasarkan keterangan para saksi diperoleh suatu fakta bahwa benar telah terjadi tindakan kekerasan penyaniayaan terhadap diri almarhum Poridin Sipakar hingga meninggal dunia. Namun kasus ini harus

dibuktikan apakah para terdakwa telah terbukti melakukan penganiayaan hingga membuat korban meninggal dunia. Menurut kuasa hukum para terdakwa, sesuai keterangan saksi lainnya, Asman Silalahi mengaku datang bersama polisi ke lokasi kejadian dan menemukan korban sudah terkapar di tanah. Begitu juga dengan saksi lainya Edi Jailani alias Edi. Di mana dalam persidangan sebelumnya Edi mengaku tidak melihat peristiws pembunuhan tersebut secara langsung. Oleh kerna itu, penasehat hukum terdakwa melalui nota pembelaan yang dibacakan pada persidangan mengatakan,

Hindari Banjir, Orangtua Murid Timbun Jalan Sambungan Halaman 8

tergenang air. Yunus menambahkan, setelah para orang tua murid dan guru sepakat, akhirnya dilakukan penimbunan pasir di sepanjang jalan menuju ke sekolah itu yang sering tergenang air. “Kita harapkan dengan adanya penimbunan ini mudahmudahan para guru dan murid tidak lagi membuka sepatu mereka saat pergi ke sekolah atau pun pulang sekolah,” katanya. Sementara Eka (30) mengatakan, kondisi jalan menuju

nasional. Selain itu, kegiatan ini juga untuk meningkatkan rasa persaudaraan dan peningkatan mutu persepakbolaan Asahan. Menurut Armen, panitiapelaksanapertandingansaat inisedangmelakukanpendataansecaraakurattimOldCrackmanasaja yang akan diundang serta tim SSB yang nantinya akan berlaga pada kejuaraan sepakbola piala ketua DPRD Kabupaten Asahan yang

akandigelardistadionMutiaraKisaran. “Kita sedang mempersiapkan segalasesuatunyadenganrapiserta sebaikmungkin.Sehinggakejuaraan sepakbolaitunantinyaakanmenjadi agendatahunandankalendertetap untukdigelar,”katanya. Armen menambahkan, panitia pelaksana pertandingan akan mengundang tim-tim mana saja yang akan berlaga pada kejuaraan sepakbolamemeperebutkanpiala Ketua DPRD Kabupaten Asahan.(mar)

PNS Disdik Batubara Main Games saat Jam Kerja Sambungan Halaman 8

jelas-jelas sangat tidak etis. Menurutnya,seharusnyaparaPNStidak bermaingamesaatjamkerja. Sementara Kadis Pendidikan Batubara Zainal Alwi saat

dikonfirmasi mengatakan, jika kegiatan para pegawainya yang bermain game jangan dipermasalahkan. “Sudalahbangjangandipermasalahkan,”katanyasambilmeninggalkanwartawan.(js)


„ Salah seorang warga sedang menunjuk ke arah pohon yang diduga sebagai tempat pembuangan limbah parik ke Sungai Silau, Senin (17/9).

Tangani Persoalan Limbah Pabrik Sambungan Halaman 8

sudah berulang kali melaporkan masalah ini, namun hingga sekarang belum ada penyelesaiannya. Kami menduga Pemkab Asahan tak mampu mengatasi masalah pembuangan limbah di aliran Sungai Silau,” kata Mulia (40), Heri (32), Senin (17/9). Oleh sebab itu warga meminta kepada Pemkab Asahan

untuk menertibkan pabrik yang ada di sepanjang Sungai Silau. Sementara Leni (28), warga Lingkungan VIII, Kelurahan Teladan, Kisaran mengaku dirinya sering mencium aroma yang tidak sedap dari sungai, dan diduga kuat pabrik yang ada di wilayah itu membuang limbah ke sungai. “Apa lagi hari hujan, aroma itu sangat tercium keras,”

katanya. Terpisah Raden tokoh pemuda di Kabupaten Asahan mengatakan, Pemkab Asahan seakan tidak serius menangani persoalan limbah. Hal itu terlihat hingga saat ini instansi yang menangani persoalan limbah baru setingkat kantor. “Pemkab Asahan seperti macan ompong yang tidak mempu mengambiltindakan,”katanya.(sus)

Taufik Umar. Sementara Jaksa Penuntut Umum Johari Siregar SH mengatakan terdakwa terbukti bersalah telah membunuh korban. Akhirnya Majelis Hakim memutuskan menunda persidangan hingga Senin 21 September mendatang. Pantauan METRO, puluhan petani tampak berkumpul di halaman kantor Pengadilan Negeri Tanjungbalai. Kedatangan mereka untuk mengikuti jalannya persidangan. Mereka berharap agar hakim dan jaksa tidak main-main dalam menangani persidangan tersebut. (ilu)

Orangtua Siswa Kesal, Tak Ada Pemberitahuan Sambungan Halaman 8

sekolah itu sudah beberapa kali disampaikannya kepada Pemko Tanjungbalai, namun hingga sekarang tidak ada tindak lanjut dari laporan warga. Terpisah, Drs H Haryono anggota DPRD Tanjungbalai mengaku merasa prihatian terhadap murid-murid yang berangkat dan pulang sekolah terpaksa mengangkat sepatu akibat banjir. Haryono berjanji dirinya akan membicarakan masalah itu kepada rekanrekannya di DPRD agar membahas masalah tersebut dan diharapkan nantinya akan dibangun jalan menuju ke sekolah tersebut. (ilu)

19 Tim Akan Berlaga Sambungan Halaman 8

karena tidak terdapat keterangan saksi yang memiliki nilai pembuktian menyatakan para terdakwa telah melakukan tindakan kekerasan terhadap korban Poridin Sipaker dan para terdakwa tidak ada melakukan kekerasan dikuatkan oleh fakta yang diterangkan saksi dan dikuatkan keterangan ketiga terdakwa, maka berdasarkan alasan tersebut diminta kepada Majelis Hakim untuk dapat melepaskan para terdakwa. “Untuk itu kami berharap agar Majelis Hakim agar dapat mempertimbangkan pembebasan ketiga terdakwa,” kata M

Menurut wali siswa Holong Hutagaol (45) kepada METRO, Minggu (16/9), ia merasa kesal melihat tindakan pihak sekolah tersebut. “Kami selaku orangtua kesal melihat pihak sekolah yang tidak memberitahukan regrouping itu. Kami hanya mendengar dari mulut ke mulut bahwa pihak sekolah memanggil orangtua siswa untuk memindahkan anaknya masing-masing,” sebutnya. Dia menerangkan, mereka sendiri tidak tahu sampai sekarang apa alasan mengapa anak-anak mereka disuruh pindah dari sekolah tersebut. Bahkan pada Sabtu kemarin, siswa dan guru banyak yang menangis mendengar sekolah mereka akan ditutup dan digabungkan dengan SDN 12297. “Saya dulu alumni dari SDN 122396, dan sekolah itu sangat unggul dibandingkan sekolah lain yang berada di lokasi. Tapi mengapa gelar itu tidak bisa dipertahankan hingga harus diregrouping,” paparnya.Yang paling aneh, meski sekolah mau ditutup, pihak sekolah khususnya kepala sekolah tidak memberitahukan penggabungan itu kepada orangtua siswa. Justru Kepala SDN 12297 M Napitupulu yang lebih dulu mengajak orangtua agar anaknya dipindahkan ke sekolah itu. “Kami sangat kecewa dengan tindakan sekolah seperti ini. Mengapa mereka tidak bisa mempertahankan sekolah yang berdiri sudah berpuluh tahun. Apa sekolah itu tidak lagi

memenuhi standar hingga harus di-regrouping seperti ini,” ujarnya. Menurut Hutagaol, melihat sikap pihak sekolah yang termasuk sepele dengan orangtua siswa, mereka sudah terlebih dulu meminta surat keluar. “Saya sudah langsung meminta surat pindah anaknya dengan rasa kekesalan dan kecewa. Anak saya banyak yang lulus dari sini. Bahkan alumni SDN itu sudah banyak yang berhasil, tapi mengapa bisa seperti ini,” jelasnya. Katanya, mereka juga sudah menghubungi pegawai Bidang Perencanaan Dinas Pendidikan Siantar, Jhonson Sitinjak. Beliau menerangkan, regrouping sekolah sudah direncanakan sejak lama. Pihak Disdik sudah mengevaluasi perkembangan sekolah itu sejak setahun lalu dan katanya sudah tidak memenuhi syarat lagi. “Yang saya tahu di manamana sekolah berlomba untuk mempertahankan agar tetap berjalan. Tapi ini mengapa pihak sekolah tidak bisa mempertahankan sekolah yang selalu menghasilkan siswa-siwa berpretasi dan berhasil,” jelas warga Jalan DI Panjaitan Gang Nauli tersebut. Sementara itu seorang siswa yang telah pindah dari sekolah tersebut, Keysa, menyebutkan bahwa untuk kelas VI jumlah siswanya sekitar 12 orang dan kelas VII sekitar 14 orang. Sementara itu Kepala SDN122396 N Siburian yang dihubungi via telepon selulernya, belum berhasil dikonfirmasi. (mua/hez)

Sambungan Metro Asahan Saya Mengidolakan Soekarno Sambungan Halaman 1 Alasan Anda dipilih? Karena saya sudah memenangkan pemilihan di tingkat dewan pemuda. Kenapa saya terpilih sebagai ketua, karena saya sering pidato. Memang leadership saya sudah terbentuk dan terlihat. Jadi tidak ragu berbicara di depan orang. Dalam dua bulan menjabat, apa saja yang Anda lakukan? Prestasi saya yang berhasil dicapai di antaranya mampu mendatangkan tiga investor. Salah satunya adalah investor pabrik bahan bangunan. Prestasi kedua, saya bisa menggalang kekuatan untuk memperkuat lingkungan dan keamanan. Ketiga, saya mampu menjadi role model, bahwa seorang pemuda itu memiliki kapasitas memimpin ketika dia diberikan kesempatan. Anda mengidolakan Soekarno dan Hitler? Bung Karno itu seorang figur yang dikenal di seluruh Palestina. Alasan saya mengidolakan dia karena Soekarno termasuk seorang pemimpin yang memulai untuk berani mengakui Palestina sebagai sebuah negara. Paling tidak Bung Karno mengakui Palestina yang memiliki hak-hak sebagai sebuah negara. Kalau Hitler, yang saya kagumi, dia memiliki pribadi yang kuat. Walaupun ide-ide dia ditentang banyak orang, tapi kepribadian yang kuat membuat dia selalu optimis. Itu yang saya kagumi dari Hitler. Bisa gambarkan kehidupan pemuda di Tepi Barat? Pemuda Palestina selalu siap sedia berdiri membela negaranya dengan

berbagai cara, apakah fisik maupun nonfisik. Seperti cara-cara memberdayakan kebudayaan yang selama ini berkembang di masyarakat. Bagaimana pandangan politisi dan pemuda di sana saat Anda menjabat sebagai walikota? Mereka senang sekali dengan pengalaman saya seperti ini. Dan kini mereka tertarik terlibat aktif dalam proses pengajuan diri sebagai pemimpin. Dulu mereka yang takut dipilih maupun memilih, sekarang jadi berani. Jadi dampak keberadaan saya sebagai walikota termuda sangat positif bagi pemuda di sana. Anda sudah punya pacar? Belum punya pacar. Karir dulu. Pemuda di Palestina hidup dalam kesulitan dan tekanan. Tidak terpikir main-main, tidak terpikir pacaran. Jadi memikirkan solusi untuk keluar dari tekanan saja sudah mengeluarkan banyak energi. Yang dipikirkan adalah bagaimana membentuk karakter pemuda menjadi seorang pemimpin. Apa kendala menjadi walikota? Permasalahan yang pertama kali dihadapi adalah ketika saya berhadapan dengan orang-orang yang menentang program seperti ini, karena saya seorang perempuan di sebuah komunitas yang mayoritas laki-laki. Itu yang terberat. Pekerjaan apa saja yang ditangani? Saya melakukan semua tugas yang dilakukan oleh walikota sebelumnya, dan saya juga selalu berkonsultasi dengan walikota yang sebenarnya. Jadi ini merupakan rutinitas saya sehari. Melaksanakan tugas dan selalu berkonsultasi.

Anda ingin total terjun ke politik atau mengutamakan pendidikan dulu? Ke depan, saya ingin menjadi seorang diplomat, dan saya ingin membantu kasus-kasus hukum dan hubungan internasional. Itu salah satu ambisi saya. Jadi memang saya tertarik di dunia politik. Setelah saya lulus dari universitas, saya ingin masuk ke sekolah hukum. Apakah Anda mendukung kemerdekaan Palestina? Saya mendukung apapun itu untuk kemerdekaan Palestina Bagaimana pendapat Anda soal dukungan Indonesia terhadap kemerdekaan Palestina? Saya tidak tertarik untuk menjawab soal politik tingkatan atas. Apa pandangan Anda terhadap Indonesia? Saya berpandangan, Indonesia sebagai sebuah negara yang sangat besar dan punya potensi yang luar biasa. Dan saya lebih memilih datang ke Indonesia ketimbang ke Italia. Karena undangan datang dari dua negara datang secara bersamaan. Saya memilih Indonesia karena Indonesia adalah negara strategis. Pertama penduduknya mayoritasnya muslim, dan selalu membela isu-isu Palestina di kancah internasional. Demonstrasi-demonstrasi yang dilakukan pemuda Indonesia itu sudah menjadi berita keseharian di kalangan pemuda Palestina. Jadi mereka seperti punya ikatan batin dengan Indonesia. (int)

Tutup TPL Harga Mati! Sambungan Halaman 1 satpam TPL tidak berlangsung lama, sebab langsung dilerai aparat Polres Simalungun. Selanjutnya, demonstran diizinkan masuk ke dalam. Dan enam perwakilan warga dipersilahkan mediasi dengan pimpinan TPL. Pertemuan tersebut tetap tidak membuahkan hasil. Pasalnya, tuntutan warga terhadap TPL tidak bisa direalisasikan. Perwakilan TPL, Tagor Manik (pimpinan TPL sektor Aek Nauli) dan didampingi Lambertus Siregar (Humas) memberikan jawaban tidak memuaskan. Massa yang berang langsung menyudahi pertemuan. “Kami tidak mau mendengarkan retorika bapak. Kami mau mendengar jawaban bapak terkait keluhan warga. Kalau tidak bisa diputuskan hari ini, kami berikan waktu 1x24 jam. Kalau juga tidak bisa diputuskan, aksi ini akan lebih besar,” ujar aktivis lingkungan, Rado Damanik. Adapun tuntutan warga antara lain; kembalikan lahan pertanian warga yang diserobot seperti di Nagori Naga Hulambu. Jangan lagi terjadi intimidasi dari oknum aparat atas suruhan TPL seperti yang pernah dialami warga. Lalu, hentinkan penimbunan anak-anak sungai demi kepentingan jalan pengangkut kayu sehingga persawahan warga kering. “Keberadaan TPL di Simalungun menyengsarakan masyarakat. Pupuk yang digunakan TPL adalah pupuk bersubsidi dan BBM bersubsidi. Akibatnya masyarakat harus mengalami kelangkaan pupuk dan

BBM. Insfratruktur jalan rusak dan penyebab utama banjir,” tegas Rado yang juga pembina Saling. Koordinator Saling, Johannes Sakti Sembiring menambahkan, berdirinya suatu perusahaan harus berdampak positif bagi suatu daerah, khususnya masyarakat sekitar. Perekrutan tenaga kerja perusahaan tersebut juga harus melibatkan putra daerah, karena kehadiran perusahaan di sana untuk kesejahteraan masyarakat. Tetapi tidak dengan TPL yang hanya menjadi momok menakutkan bagi masyarakat Kabupaten Simalungun. Sebab, sejak keberadaan TPL banyak hak-hak warga yang dirampas demi kepentingan perusahaan. Tutup TPL Harga Mati Massa dalam orasinya menegaskan bahwa tutup TPL adalah harga mati. Masyarakat sudah terlampau menderita dengan keberadaan TPL di Kabupaten Simalungun. Menurut Ketua Gapoktan Pondok Bulu Dongan Silalahi, pihaknya sangat kecewa ketika PT TPL melarang masyarakat lewat dari jalan umum yang sudah dibuatkan palang. Palang tersebut setiap hari dijaga dua sampai tiga satpam. “Kami mau masuk kampung sendiri harus melapor kepada satpam TPL. Padahal jalan yang mereka palang adalah jalan umum yang setiap hari dilewati masyarakat. Tiga kampung yang berada di dalam terpaksa mencari jalan alternatif,” katanya. Ia menambahkan, pada tahun 1999 PT TPL sempat ditutup. Saat itu, masyarakat merasa senang karena bisa mendapatkan hasil panen yang

memuaskan. Tetapi beberapa tahun terakhir sejak TPL berdiri kembali, masyarakat petani sawah banyak beralih fungsi menanam jagung karena air dari anak sungai mengering. Alasannya sejumlah anak sungai di dalam TPL ditutup demi kebutuhan jalan mobil pengangkut kayu. Menyikapi hal tersebut, Rado Damanik dengan tegas mengatakan bahwa PT TPL sudah menghina masyarakat Simalungun karena melarang masuk ke kampung halamannya sendiri. Maka kesimpulannya, PT TPL harus angkat kaki dari Kabupaten Simalungun. “Sudah banyak budaya yang dilupakan PT TPL. Selama ini masyarakat diam, sehingga mereka bebas melakukan apa saja. Sekarang kami melakukan perlawanan sampai titik darah penghabisan,” tegas Rado. Sementara itu, Pimpinan PT TPL sektor Aek Nauli, Tagor Manik mengatakan cerita akhir dari aksi tersebut adalah seluruh tuntutan masyarakat akan dituangkan dalam surat, dan diserahkan kepada camat, dan camat menyerahkannya ke PT TPL. “Itu sudah merupakan bagian keputusan. Tetapi pada prinsipnya, PT TPL bekerja sudah sesuai tupoksi dan peraturan perundang-undangan yang berlaku,” pungkasnya. (osi)

SELASA Edisi 216 th V

18 September 2012


Berangkat (Tanjung) Tiba (Medan)

KA Putri Deli

I. 06.50 WIB

11.17 WIB

KA Putri Deli

II. 12.50 WIB

17.27 WIB

KA Putri Deli III. 17.50 WIB

22.15 WIB

Sumber: Stasiun Kereta Api Tanjungbalai

Hindari Banjir, Orangtua Murid Timbun Jalan TANJUNGBALAI- Puluhan wali murid Sekolah Dasar Negeri (SDN) 138434 Pantai Elang di Lingkungan III Kelurahan Sirantau Kecamatan Datuk Bandar, Kota Tanjungbalai, Senin (17/9) menimbun jalan menuju sekolah itu dengan pasir yang dimasukkan ke dalam goni.



Pasir yang dibeli secara swadaya dari tangkahan itu dilansir menggunakan becak bermotor milik warga, kemudian dipikul dan disusun agar warga bisa menggunakannya untuk melintas. Muhammad Yunus Panjaitan (40) salah seorang wali murid mengatakan, penimbunan jalan dengan menggunakan pasir yang dimasukkan ke dalam goni mereka lakukan, karena jalan menuju ke sekolah tempat anaknya menimba ilmu selalu tergenang air. Selamainimuriddanparagurudisekolahituharusmembuka sepatu mereka jika ingin ke sekolah atau pun pulang sekolah. Pasalnya sepanjang 150 meter jalan menuju ke sekolah itu merupakan daerah dataran rendah dan sering

„) Baca Hindari ....Hal 7


„ Wali murid dibantu para murid dan para guru bergotong-royong menimbun jalan menuju ke SD Negeri 138434 Pantai Elang yang sering terendam air, Senin (17/9).

Cut Ratu Meyriska atau yang lebih dikenal sebagai Cut Meyriska (lahir di Medan, 26 Mei 1993; umur 19 tahun) adalah seorang pendatang baru di dunia sinetron Indonesia. Cut Meyriska dikenal setelah membintangi sinetron Kepompong sebagai Beverly, dan Arti Sahabat sebagai Vita. Chika, panggilan akrab Cut Meyriska, mengaku sebagai fans d’Masiv dan Harry Potter, sebelum melakoni peran dalam kedua sinetron tersebut, Chika sendiri telah sempat memainkan beberapa peran dalam sinetron yang tayang di stasiun televisi swasta seperti Suci, Cinta Maia, Cucu Menantu, dan Cinta Bunga. (int)

B a k ombur

PengurusDPD Gerindra Sumut Lakukan Verifikasi Faktual

Pembangunan Irigasi di Sei Balai ‘Tambal Sulam’ Dinas Pertanian Batubara Tak Dilibatkan

BATUBARA- Pengurus Dewan Pimpinan Daerah (DPD) Partai Partai Gerakan Indonesia Raya (Gerindra) Sumut turun ke kecamatan di Batubara, Senin (17/9). Tujuannya untuk lebih mendekatkan diri dan siap memenangkan Gerindra 2014 dan mengusung Prabowo Subianto menjadi Predisen RI pada pemilu 2014 mendatang.

„) Baca Pengurus....Hal 7

SDN 122396 Di-regrouping

Orangtua Siswa Kesal, Tak Ada Pemberitahuan SIANTAR- Sejumlah orangtua siswa yang anaknya mengenyam pendidikan di SDN 122396 Jalan Rajawali, merasa kesal akibat sekolah tersebut di regrouping (digabungkan) ke SDN 12297 tak jauh dari lokasi. Apalagi proses pemindahan ini tanpa pemberitahuan resmi.

„) Baca Orangtua....Hal 7


„ Plank proyek pembangunan irigasi di Kecamatan Sei Balai


„ Para pekerja sedang menempel semen di bangunan irigasi di Kecamatan Seibalai, Batubara, Senin (17/9).

BATUBARA- Pembangunan proyek irigasi di Kecamatan Seibalai Batubara yang merupakan proyek Dinas Perairan Sumatera Utara diduga dikerjakan asal jadi. Pasalnya pengerjaan proyek hanya memplaster/menempel/tambal sulam bangunan irigasi yang lama dengan semen sehingga tampak baru. Pekerja proyek irigasi yang meminta namanya jangan di korankan,

„) Baca Pembangunan....Hal 7

pulang mereka harus melepas sepatu karena jalan ke sekolah mereka tergenang air. Wak Ongah: Itu karena kurangnyo perhatian pemko pada mereka. (**)

„ Armen Margolang

KISARAN- Kejuaraan sepakbola memperebutkan trofi bergilir dan tetap serta uang pembinaan Ketua DPRD Kabupaten Asahan H Benteng Panjaitan diikuti 10 tim Old Crack & 9 tim Sekolah Sepak-

bola (SSB) se Kabupaten Asahan. Wakil Ketua DPRD Asahan Armen Margolang yang juga Ketua Panitia Pelaksana kejuaraan sepakbola Old Crack dan SSB DPRD Asahan, Senin

BATUBARA- Untuk mengisi waktu luang, para Pegawai Negeri Sipil (PNS) di jajaran Pemkab Batubara khususnya di Dinas Pendidikan bermain game, Senin (17/9). Pantauan METRO, banyaknya PNS yang bermain game membuktikan jika para PNS tersebut kurang disiplin. Karena komputer yang digunakan mereka untuk bermain game adalah fasilitas pemerintah. Robert Simanjuntak aktivis LSM Penjara, Senin (17/ 9) mengatakan, tindakan yang dilakukan para PNS itu

„) Baca PNS ....Hal 7

Pemkab Dinilai Tidak Mampu

Tangani Persoalan Limbah Pabrik

(17/9) mengatakan, kegiatan ini digelar untuk mencari atlet berprestasi yang nantinya bisa mengharumkan nama Asahan di ajang provinsi dan

„) Baca 19 Tim....Hal 7

„) Baca Tangani....Hal 7

19 Tim Akan Berlaga

murid-murid di SD Negeri 138434 Pantai Elang itu. Setiap mau masuk sekolah dan

PNS Disdik Batubara Main Games saat Jam Kerja

KISARAN- Pemerintah Kabupaten Asahan dinilai tidak mampu menangani persoalan limbah pabrik yang dibuang secara bebas di aliran Sungai Silau. Akibatnya warga serta ekosistemnya terancam terkena dampaknya. “Warga yang tinggal di kawasan Kelurahan Kisaran Naga, Teladan, Kedai Leidang, dan Mutiara pernah terjangkit penyakit gatal-gatal dan kami pernah mendesak pemerintah untuk menertibkan limbah pabrik yang ada di wilayah pemukiman warga, Karena diduga pabrik yang berdiri di sepanjang Sungai Silau telah mencemari air sungai yang setiap hari digunakan masyarakat untuk keperluah sehari-hari. Meski kami

Perebutkan Piala Ketua DPRD Asahan Wak Alang: Wak Alang: Kasihan kali lah


„ Seorang pegawai di Dinas Pendidikan Batubara tampak bermain games, Senin (17/9).

Sidang Pembunuhan di Desa Bangun

Saksi Ngaku Tak Lihat Terdakwa Bunuh Korban TANJUNGBALAI- Pengadilan Negeri Tanjungbalai kembali menggelar sidang kasus pembunuhan yang dilakukan tiga terdakwa Suryanto alias Nasib (41), Sapri alias Supri (18), dan Suwarno (47) terhadap Poridin Sipakkar (37), Senin (17/9). Dalam persidangan kedua saksi yang dihadirkan mengaku tidak melihat ketiga terdakwa membunuh korban. Saksi Resta br Nainggolan dan H Yusbar Manurung dalam persidangan di hadapan Majelis Hakim yang dipimpin Mian SH, Risda SH, dan Albon Damamik SH, mengaku tidak


„) Baca Saksi ....Hal 7

„ Puluhan petani yang ingin menyaksikan persidangan kasus pembunuhan tampak berkumpul di halaman kantor Pengadilan Negeri Tanjungbalai, Senin (17/9).

Selasa, 18 September 2012


Siswa & Guru Gunakan Titi Darurat LABURA- Setelah beroperasi dan menerima siswa baru pada tahun 2009, fasilitas di Sekolah Menengah Kejuruaan Negeri 1 (SMKN) Aek Kanopan terutama fasilitas jalan masuk, belum memadai. Bahkan jika hujan dan banjir datang, sekitar 700 siswa dan guru harus rela melewati genangan air dan lumpur dengan cara membuka sepatu dan alas kaki lainnya. Kepada METRO, Sabtu (15/9), Murini, siswa kelas XI SMKN 1 Aek Kanopan menjelaskan, untuk melewati 100 meter jalan menuju sekolah yang menjadi langganan banjir, pihak sekolah membangun jembatan darurat berupa papan agar dapat dilewati siswa dan guru. “Jalan menuju sekolah itu, rawa-rawa dan berlumpur. Sampai tahun 2011, kami harus membuka sepatu kalau mau ke sekolah, selanjutnya di sekolah dipakai kembali. Kalau tak begitu, sepatu akan kotor,” katanya, mengingat „) Baca Siswa & Guru ....Hal 10


JEMBATAN DARURAT- Puluhan siswa SMKN 1 Aek Kanopan melewati jembatan yang terbuat dari papan, untuk melewati sekitar 100 meter jalan menuju sekolah yang sering banjir dan berlumpur.

Pemilik Gudang Jackpot Ancam Pindahkan Polisi RANTAU PRAPATRumah toko di Jalan Sunusi No: 54 Kecamatan Rantau Prapat digerebek, Minggu (16/ 9) malam „ Sidong sekira pukul 21.00 WIB. 60 mesin jackpot dan ribuan koin diamankan polisi, dan Pho Sie Dong alias Sidong, yang diduga pemilik mesin jackpot serta dua anggotanya Apoi (31) dan Susando (34), ketiganya warga Binjai, turut diamankan.


SAAT DIPERIKSA PENYIDIK POLSEK KUALUH HULU AEKKANOPAN- Dengan posisi tangan masih diborgol, tahanan Polsek Kualuh Hulu, Dedek (21) yang ditangkap atas kasus jambret di depan SPBU Aek Kanopan, sekira 2 minggu lalu, Senin (17/9) sekira pukul 09.00 WIB melarikan diri ketika digiring penyidik ke ruang pemeriksaan. Informasi yang dihimpun, Dedek yang telah beberapa kali tersangkut kasus kriminal melarikan diri ketika seorang penyidik

„) Baca Pemilik Gudang ....Hal 10 FOTO: NIKO

„ Kapolres Labuhan AKBP Hirbak Wahyu Setiawan menunjukkan pemilik mesin jackpot dan 60-an mesin sebagai barang bukti.

„) Baca Tahahan Kabur ....Hal 10


Aktivis dan DPRD akan Bawa ke KPK KOTA PINANG- Wakil Ketua DPRD Labuhanbatu Selatan H Zainal Harahap mengatakan, pihaknya sedang melakukan pengumpulan data terkait dugaan penyelewengan penggunaan anggaran oleh Pemkab Labusel di bawah kepemimpinan Bupati Wildan Aswan Tanjung. “Kami telah meminta BPK Sumut untuk melakukan tindaklanjut pemutakhiran data, persoalan ini akan kami bawa ke BPK Pusat „) Baca Aktivis dan DPRD ....Hal 10

Penyaluran Dana Hibah Dipertanyakan RANTAU PRAPAT- Penyaluran dana hibah APBD Pemkab Labuhanbatu tahun 2011 sebesar Rp12 miliar dipertanyakan, sesuai laporan telah direalisasikan sebesar 98 persen dan total dana. Aktivis Barisan Pemuda Labuhanbatu Bersih (BPLB) Rendi Harahap kepada METRO, Minggu (16/9) mengatakan, pihaknya menduga penyaluran dana hibah dan bantuan sosial sebesar Rp1,6 miliar sarat korupsi. „) Baca Penyaluran ....Hal 10

Musik Metal Guncang Lapangan Ika Bina FOTO: EFENDI

RANTAU PRAPAT- Musik Metal yang digelar di Lapangan Ikan Bina Rantau Prapat, Sabtu (15/9) dihadiri ribuan warga Rantau Prapat yang didominasi pelajar dan mahasiswa. Konser dengan thema Rantau Prapat Bisink II merupakan agenda rutin Rumah Seni Labuhanbatu yang biasa digelar bulan September. Selain dimeriahkan band metal asal Labuhanbatu, konser tersebut juga dimeriahkan oleh

„ Mitsubishi Pajero yang nyungsep ke parit usai menabrak Honda Vario.

Tabrak Vario, Pajero Masuk Parit

band dari Pekan Baru dan Medan. Ketua Panitia Pandu Maura, kepada METRO menjelaskan, program tahunan Rumah Seni dalam bidang musik modern dengan nama Rantau Prapat Bisink ditujukan, dan dari pelajar dan mahasiswa untuk menyatukan seluruh kalangan pemuda agar dapat berkreasi di bidang musik.

„) Baca Tabrak Vario....Hal 10

„ Ribuan anak metal memadati lapangan Ika Rantauprapat, pada konser Metal, Sabtu (15/9).

„) Baca Musik Metal ....Hal 10


Telkomsel Undi 2 Unit Mobil KIA Sportage M/T MEDAN- Hari ini Telkomsel melakukan penarikan undian pemenang utama program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA. Masing-masing pemenang utama program ini mendapat hadiah berupa 1 Unit Mobil KIA Sportage M/T. Periode program dilakukan mulai tanggal 1 Mei 2012 hingga 31 Juli 2012.


RANTAU PRAPAT- Sebuah mobil Pajero BK 444 YP masuk ke dalam selokan (parit) di Jalan By Pass, Senin (17/9) sekira pukul 11.30 WIB setelah bertabrakan dengan sepedamotor Honda Vario BK 3902 ZU. Pengendara Vario yang belum diketahui identitasnya, mengalami luka-luka dan dibawa untuk mendapatkan perawatan. Informasi yang dihimpun dari warga di sekitar lokasi, Pajero yang dikemudikan Ahmad Siregar, warga Jalan Mesjid Rantau Utara, melintas


„ Filin Yulia disaksikan pihak Dinsos, Notaris dan Kepolisian , melakukan penarikan undian hadiah utama program Rezeki.

Penarikan undian dilakukan secara transparan di hadapan pihak Dinas Sosial, Notaris dan Kepolisian. Pemenang hadiah utama program Rezeki Isi Ulang adalah Hendriko pelanggan Telkomsel di Palembang dan pemenang utama program Jutawan Out„) Baca Telkomsel ....Hal 10

Korban ‘Teroris‘ Rumahtangga Wong Aminul (24), ini statusnya guru agama, kok malah jadi ‘teroris’ rumah tangga. Dipacarinyalah Ny Indri (28), ibu daripada salahseorang muridnya, sehingga suaminya pun kalap sampai main bunuh. Aminul jelas bukan terorisme, tapi maaf, dia sendiri malah jadi ‘teroris’ dalam sebuah rumah tangga. Bagai-

mana tidak, gara-gara dia jadi guru agamanya bocah, sang ibu klepeg-klepeg kasmaran dengan si guru. Rumahtangga

Ny Indri jadi kacau, bahkan dengan Joko (34), suaminya sudah beberapa bulan ini tak akur, sampai kemudian mere-

ka pisah ranjang. Keluarga Joko termasuk tinggi kesadaran agamanya. Ketimbang anaknya pintar tapi nantinya tak tahu agama, segeralah Ibnu (7), disuruh belajar agama pada tetangganya, Aminul. Joko sangat khawatir, jika kelak putranya punya posisi di pemerintahan, jadi pejabat misalnya, tapi karena kurang pendidikan agama jadi berani korupsi. Maka sedia payung sebelum hujan, Ibnu pun disuruh belajar agama, termasuk mengenali batal dan haramnya sebuah masalah. „) Baca Korban ....Hal 10


18 September 2012


Beram Jalan Undang Bahaya SIDIMPUAN-Jalan Lintas Sumatera (Jalinsum) Simirik, di Kota Padangsidimpuan (Psp) membutuhkan perhatian dari pemerintah melalui pihak terkait untuk memperbaikinya. Kondisi jalan semakin hari semakin membahayakan bagi masyarakat pengguna jalan. Keberadaan jalan yang menurun dan berkelok tersebut, menjadi salah satu titik rawan terjadinya kecelakaan lalu-lintas. Jika masyarakat pengendara semua jenis kendaraan tidak hati-hati melintas, bisa berbahaya bagi nyawa, apalagi beram jalannya dalam. Beberapa warga setempat Harahap (34) kepada METRO mengatakan, keberadaan fasilitas jalan umum tersebut sangat mengancam masyarakat pengguna jalan. Apalagi ketika berpapasan. “Keasdaan jalan ini sangat berbahaya, apalagi ketika berpapasan. Karena beram jalan sangat dalam dan tak mungkin kendaraan berani memasukkan roda ke dalam beram itu,” katanya. Amatan METRO, suasana jalan yang menurun dan berkelok tersebut kerab terjadi antrean ketika kendaraan besar sedang berpapasan yang diakibatkan pengendara tak melintasi beram jalan yang cukup dalam. Bahkan, di lokasi tersebut tak jarang terjadi kecelakaan, dan yang terakhir pada Kamis (13/9) lalu. Satu unit truk pengangkut produk Mayora terguling ke jurang karena putus rem dan tak bisa mengendalikan kendaraannya. Ketua Fraksi Demokrat DPRD Kota Psp, H Khoiruddin Nasution SE menanggapi hal tersebut kepada METRO Senin (17/9) menyebutkan, dirinya juga telah melihat kondisi bahanyanya jalinsum Simirik. Bahkan, berbagai laporan masyarakat juga telah diterima pihaknya sebagai perwakilan masyarakat di legislatif Kota Psp untuk menyuarakan aspirasi masyarakat tersebut, sehingga terciptanya lalu lintas yang aman dan lancar di Kota Psp. “Aspirasi mesyarakat tentang kondisi jalan itu telah kita terima dan akan menyuarakan agar ke depan diperhatikan pemerintah. Tujuannya jelas, untuk meminimalisir terjadinya kecelakaan lalulintas dan lainnya,” tuturnya. (ran/mer)

Pemilik Gudang Jackpot Ancam Pindahkan Polisi

Sambungan Halaman 9

Pemandangan menarik terjadi ketika personil Sabara Polres Labuhanbatu akan melakukan penggerebekan, Sidong, pria Tionghoa yang diduga pemilik mesin judi tersebut menghalang-halangi polisi menjalankan tugas. Bahkan Sidong sempat mengancam akan memindahkan tugas salah seorang oknum polisi yang akan memeriksa isi gudang ruko. “Kucatat namamu ya, biar pindah kau,”teriak Sidong, kepada salah seorang polisi


Dishutbun: Jangan Bakar Lahan Perkebunan PALAS- Masyarakat diimbau, agar tidak melakukan pembakaran dalam membuka lahan baru di wilayah hutan lindung. Pasalnya, dikhawatirkan akan menimbulkan kebakaran hutan lindung dan kerugian lainnya. Imbauan ini disampaikan, Dinas Kehutanan dan Perkebunan (Dishutbun) Kabupaten Padang Lawas (Palas), Ir Soleman Harahap, Senin (17/9). Katanya, selama ini pola warga yang membuka lahan dengan membakar sering menimbulkan persoalan, baik antara warga sendiri begitu juga dengan kawasan hutan yang berbatasan. “Apalagi saat ini sedang musim kemarau, peluang merebaknya api sangat mudah terjadi, bahkan sudah banyak menimbulkan konflik ditengah-tengah masyarakat itu sendiri,” ucap Kadis,” Ir Soleman Harahap. Kemudian katanya, kenyamanan hewan liar berupa gajah sangat terganggung dengan sistem membuka lahan perkebunan dengan membakar. Sehingga tidak heran, banyak gajah dan binatang lainnya mendatangi pekampungan warga yang berada di wilayah hutan. “Di wilayah Siali-Ali juga sering gajah muncul, begitu juga di daerah Kecamatan Barumun Tengah. Makanya agar hewan yang dilindungi ini tidak terganggu pola membakar dengan membuka lahan jangan dilakukan, karena jika terjadi kebakaran hutan yang bertanggung jawab tidak ada,” ucap Kadis. Untuk itu, pihaknya berharap agar meninggalkan pola membakar hutan dalam membuka lahan perkebunan. Karena sudah sering menimbulkan konflik ditengah-tengah masyarakat itu sendiri, apalagi cuaca yang tidak menentu saat ini. (amr/mer)

ruko yang kita kontrak. Tidak ada yang tinggal di dalam ruko, boleh tanya tetangga,” kata Sidong. Sidong menambahkan, rencananya mesin jacpot akan dibawa kembali ke Binjai, namun ketika akan dimuat ke dalam truk, polisi datang. Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan membenarkan adanya penggrebekan gudang penyimpanan mesin jackpot di Jalan Sanusi. Sekitar 60 unit mesin jackpot diamankan dalam penggerebekan.

Siswa & Guru Gunakan Titi Darurat Sambungan Halaman 9 kenangan sebelum jembatan darurat dibangun. Dijelaskannya, genangan air yang disepanjang jalan mencapai selutut dewasa. Sementara setelah jembatan darurat dibangun, siswa telah lebih nyaman menuju sekolah walau harus hati-hati dan bergiliran. “Tetapi kalau musim hujan seperti ini, kami khawatir air naik dan menghambat siswa

menuju sekolah. Kami mohon perhatian pemerintahlah, agar pendidikan kami tidak terkendala,” katanya berharap. Sementara Kepala SMKN Aek Kanopan Abdul Hamid Sembiring membenarkan keluhan para siswa dan guru terkait jalan menuju sekolah. Dijelaskannya, persoalan dan kendala di SMKN 1 Aek Kanopan bukan hanya jalan menuju sekolah, tetapi termasuk ruangan kelas yang minim. Kapasitas ruang hanya untuk 4 rombongan belajar, tetapi saat ini

700 siswa dibagi dalam 14 rombongan belajar, sehingga diberlakukan kelas siang dan kelas pagi. “Kelas X masuk siang dan kelas XI masuk pagi, sedang untuk kelas XII sedang PKL. Jadi selesai nanti kelas XII PKL, maka menyusul kelas XI yang PKL ,” katanya. Ditambahkannya, saat ini sedang dikerjakan pembangunan ruang kelas baru sebanyak 4 ruangan yang dijadwal selesai akhir Desember 2012. (ST)

Tahahan Kabur dengan Tangan Diborgol Sambungan Halaman 9 sedang akan meminta keterangan untuk melengkapi berkas. Tersangka melarikan diri ketika berjalan dari ruang tahanan menuju ruang pemeriksaan, melarikan diri ke halan Mapolsek Kualuh Hulu dan menyeberang jalinsum di depan Mapolsek dan menghilang di sekitar Lingkungan II. Kejadian tersebut membuat juru periksa panik dan melakukan pengejaran, tetapi tidak berhasil sehingga beberapa personil polisi dikerahkan untuk melakukan pengejeran. Setelah 8 jam, Dudek ditemukan bersemubunyi di rumah warga di Lingkungan II Kelurahan Aekkanopan Timur dengan posisi tangan tetap diborgol. Amatan METRO di Mapolsek Kualuh Hulu, pasca kaburnya seorang tahanan jambret bernama Dudek, tampak lengang hanya 3

petugas jaga piket yang menjaga kantor sedangkan yang lainnya melakukan pengejaran terhadap tersangka Dedek. Wajah ketiga petugas jaga terlihat tegang, bahkan Kapolsek Kualuh Hulu AKP Arifin Marpaung yang hendak dikonfirmasi wartawan tampak kalut, tak terkecuali siswa PKL dikantor tersebut juga memilih bungkam soal kejadian itu. “Kami tidak tahu menahu tentang kejadian itu pak, tapi informasinya memang begitu,” sebut seorang siswi PKL berjilbab putih. Sementara Kapolsek Kualuh Hulu AKP Arifin Marpaung ketika dikonfirmasi di ruangannya meminta agar soal tahanan melarikan diri jangan diberitakan. “Kalau bisa minta tolong saya jangan lah kalian buat beritanya nanti saya kasi uang beli rokok,” kata Arifin, kepada beberapa wartawan yang hendak konfirmasi.

Ketika ditanya soal kronologis pelarian tersangka dedek, Arifin berkilah dan mengaku tidak tahu persis karena sedang berada di Rantau Prapat. Setelah Dedek tertangkap, suasana di Mapolsek Kualuh Hulu tampak ramai, wajah gembira terpancar dari wajah personil yang berhasil kembali menemukan Dedek, namun tak seorang pun pihak luar yang boleh mendekati dedek untuk mengabadikan gambarnya. “Awas awas jangan dekati tersangka, karena sebentar lagi pak Kapolres akan segera tiba,” kata petugas yang menjaga. Setelah ditangkap kembali, Dedek dimasukkan ke ruang tahanan, namun tidak digabungkan dengan tahanan lainya. Dedek memakai celana pendek dengan telanjang badan bagian atas, dilihat dari jarak 5 meter, Dedek seperti menutupi wajahnya sambil meringis menahan sakit. (put)

Aktivis dan DPRD akan Bawa ke KPK Sambungan Halaman 9

„ Salahsatu contoh kelalaian manusia yang mengakibatkan hutan terbakar.

yang berada di dekatnya. Tapi, walau diancam polisi tetap memaksa masuk ke ruko berlantai tiga tersebut dan menemukan 60 mesin jackpot yang tersusun rapi dalam ruangan. Mendapat barang bukti, polisi akhirnya menggelandang Sidong dan dua anak buahnya ke Mapolres Labuhanbatu. Kepada penyidik di Mapolres Labuhanbatu, Sidong mengaku mesin jackpot tersebut sengaja didatangkan dari Kota Binjai pada awal Agustus 2012. “Sudah 2 bulan mesin itu disimpan dalam

dan KPK. Karena kami mendapatkan laporan, seluruh SKPD pengguna anggaran ditemukan kejanggalandandugaanpenyalahgunaananggaran,” kata Zainal Harahap, Minggu (16/9). Terpisah, Aktivis Masyarakat Fahruddin Hasibuan mengatakan, berdasarkan temuan BPK Sumut, pengelolaan anggaran APBD Pemkab Labusel tahun 2011 ditemukan kelebihan pembayaran volume fisik sebesar Rp414 juta lebih untuk beberapa proyek yang dikerjakan oleh rekanan tidak tepat waktu dan sesuai spesifikasi. Bahkan di Dinas Pekerjaan Umum dan Pertambangan Energi (PUPE) Labusel, ada pembayaran yang tidak sesuai dengan kondisi (volume) fisik sebesar Rp1,8 miliar lebih. Dijelaskannya, untuk tahun 2011 Dinas PUPE Labusel telah menganggarkan belanja modal sebesar Rp105 miliar lebih, dan terealisasi sebesar Rp69 miliar lebih. Sementara dari 12 kontrak pekerjaan senilai Rp13 lebih diketahui terdapat kelebihan pembayaran menelan biaya sebesar Rp418 juta lebih, bahkan tidak sesuai speksifikasi sebesar Rp1,8 miliar. 12 kontrak pekerjaan volume fisik itu antara lain pengaspalan Jalan Dusun Cinta Damai menuju Dusun Karya Makmur Pasir

Tuntung Kecamatan Kotapinang yang dilaksanakan CV DM, pengaspalan dari Simpang Cikampak ke Perumahan Griya Nusa III Desa Aek Batu Kecamatan Torgamba dilaksanakan CV LMB, pengaspalan Jalan Nusantara di Dusun Blok Songo Desa Sisumut Kecamatan Kotapinang dilaksanakan UD MK, pengaspalan Jalan Dusun Gelanggang Desa Hadundung Kecamatan Kotapinang dilaksanakan UD MK, lanjutan pengaspalan Jalan Ujung Padang menuju Selangkitang Desa Ulumahuam Kecamatan Selangkitang dilaksanakan PT RO, pemeliharaan periodik Jalan Jurusan Silangkitang-Aek Tinga Desa Binanga Dua Kecamatan Selangkitang dilaksanakan CV KJU, lanjutan pengaspalan Jalan Desa Tanjung Selamat menuju Desa Perlabian Kecamatan Kampung Rakyat dilaksanakan CV SDR, peningkatan jalan Jurusan Tanjung MedanPardomuan Desa Tanjung Medan Kecamatan Kampung Rakyat dilaksanakan CV NP, lanjutan pengaspalan jalan Dusun VI Sei Kalam menuju Dusun Sidodadi Desa Teluk Panji Kecamatan Kampung Rakyat dilaksanakan CV DUS, lanjutan pengaspalan jalan Dusun Sumber Sari Barat menuju Dusun Cabang Dua Desa Suka Dame Kecamatan Selangkitang dilaksanakan CV DP, pengaspalan jalan Dusun Air Sedang menuju

Dusun Bis II Tolan Pekan Kecamatan Kampung Rakyat dan lanjutan pengaspalan jalan Tanjung Beringin menuju Tandikat Desa Binanga Dua Kecamatan Selangkitang dilaksanakan UD PM. “Banyak anggaran yang terbuang percuma karena tidak sesuai spesifikasi, dan kelebihan pembayaran sebagai bukti Pemkab Labusel tidak serius untuk mensejahterakan rakyat melalui pembangunan infrastruktur,” katanya. Ditambahkannya, dengan data dan laporan yang ada, seharusnya penegak hukum di Labusel segera melakukan tindaklanjut agar kejadian serupa tidak terulang pada masa mendatang. Hal senada disampaikan oleh Nanang Harahap. Ditambahkannya, Bupati Wildan Tanjung, mau atau tidak mau tidak lepas tanggungjawab atas penggunaan APBD di seluruh SKPD Pemkab Labusel. Karena Bupati merupakan penanggungjawab kinerja kepala dinas, PPK, PPTK hingga pengawas lapangan seluruh proyek yang didanai oleh APBD Labusel. Sementara beberapa waktu lalu, Humas Pemkab Labusel Bahdrul Karim Hasibuan mengatakan,BupatiLabuselWildanTanjungtelah memberikansanksiadministrasikepadasejumlah rekananyangbermasalah,termasukrekananyang tidak menyelesaikan proyek tepat waktu. (mhr)

“Kasusnya masih dalam proses lidik,” kata Hirbak Wahyu. Ditambahkannya, pihaknya masih melakukan pengembangan, dugaan masih beredarnya mesin permainan judi jackpot di wilayah hukumnya. Sejak awal September 2012 pihaknya juga telah menangani 7 kasus judi jenis togel dengan 11 orang tersangka, 3 kasus judi kim dengan 3 orang tersangka, 1 kasus judi kartu dengan 3 orang tersangka dan 2 kasus judi jackpot dengan 1 orang tersangka. (CR-01)

TABRAK VARIO, PAJERO... Sambungan Halaman 9 dari arah Kota menuju Sigambal, sedangkan sepeda motor Vario melintas dari arah sebaliknya. Afriandi dan Lumban Nainggolan, warga Paindoan mengatakan, dirinya berjalan satu arah dengan mobil Pajero yang masuk ke selokan. Kejadiannya, Pajero mendahului kendaraannya, tetapi tiba-tiba Pajero banting setir ke kiri dan masuk ke parit. “Saya juga nggak nyangka, karena saya telah ada dibelakangnya. Terpaksa saya merem mendadak, “ kata pengemudi becak bermotor ini. Personil Lantas Polres Labuhanbatu yang ada dilokasi setelah kejadian, Margono HS mengaku tidak berani banyak memberikan keterangan. “Barang bukti kita bawa dan nanti diperiksa lebih lanjut,” katanya. (CR-2)

PENYALURAN DANA HIBAH... Sambungan Halaman 9 “Sesuai laporan Badan Pemeriksaan Keuangan (BPK) Sumut yang melakukan audit keuangan, ditemukan banyak kejanggalan,” kata Rendi Harahap. Dijelaskannya, bantuan sosial sebesar Rp1,6 miliar tidak sesuai peruntukkannya dan sebagian tidak dapat dipertanggungjawabkan. Bantuan hibah untuk HUT Pemkab Labuhanbatu Rp150 juta, bantuan kepada panitia pemberangkatan dan pemulangan haji Rp350 juta, bantuan sosial kepada kepanitiaan hari besar keagamaan Rp94 juta lebih, pengadaan wayang kulit Rp75 juta, bantuan kepada panitia HUT RI Rp158 juta, panitia hari Sumpah Pemuda dan lomba karoke Rp19 juta lebih dinilai tidak sesuai peruntukannya, termasuk hibah kepada instansi vertikal kepada KPUD Labuhanbatu Rp150 juta, kepada pangkalan TNI Angakatan Laut Rp383 juta, kepada Polres Labuhanbatu Rp100 juta, bantuan rehab kantor Kodim Rp120 juta, kepada badan narkotika Labuhanbatu Rp60 juta. “BPK Sumut menilai bahwa pemberian bantuan hibah dan bantuan sosial tersebut telah melanggar peraturan yang ada khususnya peraturan terkait pemberian bantuan sosial yang seharusnya pemberian bantuan tersebut untuk kepentingan kesejahteraan masyarakat,” kata Rendi. Ditambahkan Rendi, yang paling membingungkan sebagian bantuan hibah kepada instansi vertikal tidak disertai tanda bukti penggunaan serta belum dilaporkan kepada Menteri Dalam Negeri. “Indikasi kerugian negara sangat besar, sehingga kita berinsiatif langsung menyampaikan hasil temuan BPK Sumut kepada Komisi Pemberantasan Korupsi (KPK) di Jakarta. Kita berharap KPK dapat mengungkab dan mengusut dugaan praktik korupsi di Pemkab Labuhanbatu,” tambah Rendi. (riz)

Telkomsel Undi 2 Unit Mobil KIA Sportage M/T MUSIK METAL GONCANG... Sambungan Halaman 9 let Sumatera adalah Mutiara Telkomsel outlet dari Binjai. Para pemenang langsung dihubungi oleh Head of Sales and Customer Care Regional Sumbagut Division Telkomsel – Filin Yulia, sesaat setelah pengundian berlangsung. Menurut Head Of Telkomsel Sumatera Group – Gilang Prasetya “Program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA merupakan salahsatu program yang diperuntukan bagi pelanggan yang telah setia menggunakan produk Telkomsel serta mitra outlet yang telah setia menjaga loyalitas pelanggan Telkomsel melalui ketersediaan produk di outlet hingga membantu Telkomsel dalam melakukan edukasi keunggulan produk Telkomsel kepada pelanggan di outletnya”. Program Rejeki Isi Ulang adalah program yang dikhususkan untuk pelanggan prabayar Telkomsel di Sumatera (kecuali nomor HLR Aceh), baik pelanggan baru maupun pelanggan yang sudah lama menggunakan kartu simPATI, Kartu AS dan Kartu Facebook.

Untuk mengikuti program ini tidak diperlukan registrasi khusus, caranya pelanggan prabayar cukup melakukan isi ulang pulsa pada periode program yang berlaku mulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Jika selama periode program telah mencapai total isi ulang minimal Rp.60ribu, secara otomatis pelanggan tersebut akan berpeluang mendapatkan salahsatu hadiah. Bagi pelanggan yang melakukan isi ulang pulsa selama periode program, mencapai total isi ulang pulsa minimum Rp.300.000, secara otomatis berpeluang mendapatkan salahsatu dari seluruh hadiah yang disediakan berupa 30 (tiga puluh) HP Android, 30 (tiga puluh) Tas Trolley, 9 (sembilan) unit Samsung Galaxy Tab 8.9”, 9 (sembilan) unit Sepeda Motor Honda Vario, dan hadiah utama undian berupa 1 (satu) Mobil KIA Sportage M/T. Melengkapi program Rejeki Isi Ulang, Telkomsel juga menyelenggarakan program JUTAWAN OUTLET SUMATERA (JUARA). Program apresiasi ini dikhususkan bagi seluruh mitra outlet yang juga berada diwilayah Sumatera. Program ini juga menyediakan hadiah undian be-

rupa 1 (satu) unit Mobil KIA Sportage M/T, Honda Vario, Tablet Cyrus TV Pad, Blackberry Apollo. Program yang diperuntukkan khusus untuk mitra outlet diseluruh willayah Sumatera ini, dimulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Bagi mitra outlet yang ingin mengikuti program JUARA, akan mendapatkan informasi lengkap tentang mekanisme program melalui petugas Sales Force yang berada dimasingmasing wilayah cluster mitra outlet. Pada kesempatan ini, Gilang Prasetya menghimbau kepada pelanggannya agar tetap berhati-hati terhadap penipuan yang mengatasnamakan Telkomsel. Jika pelanggan menerima informasi menjadi pemenang salahsatu program undian Telkomsel, sebaiknya melakukan konfirmasi ke nomor layanan Call Center bebas pulsa Telkomsel yaitu 133 dari kartuHALO dan 155 dari kartu simPATI dan Kartu As. Selain itu pelanggan juga dapat mendatangi kantor layanan GraPARI Telkomsel terdekat. Hal terpenting adalah, Telkomsel tidak pernah mengenakan biaya apapun kepada pelanggan yang menjadi pemenang undian berhadiah dari Telkomsel, baik dalam bentuk uang tunai maupun pulsa. (leo)

Sambungan Halaman 9 Yudha (20), salah seorang penonton mengatakan, dengan adanya kegiatan konser metal, para pemuda dan pelajar dapat mengembangkan bakatnya dalam bermain musik, sehingga diharapkan dapat menghindari kegiatan-kegiatan yang merusak masa depan. “Kami mengucapkan terimakasih banyak kepada panitia yang mengadakan acara ini. Selain acara ini merupakan hiburan, juga dapat mengasah bakat kepada musisi lokal,” kata Yudha. Sementara Seketaris Rumah Seni Labuhanbatu Aidil SyahFitra menambahkan, konser musik modern beraliran musik Underground (metal) diminati kawula muda. “Wajar jika ribuan orang datang menyaksikan acara kami, karena acara ini sangat ditunggu-tunggu tiap tahunnya,” ucap Aidil. Pantauan METRO, tampak ribuan anak metal dengan menggunakan baju warna hitam memadati lapangan Ika Bina Rantauprapat dan berjoget ala Metal di bawah panggung. (CR-2)

Korban ‘Teroris‘ Rumahtangga Sambungan Halaman 9 Tapi sayang, maksud baik itu dikacau oleh menyusupnya setan. Setan yang rupanya sudah S2 dan sudah lulus sertifikasi dan uji kompetensi lewat internet, ditugaskan kelompoknya untuk mengganggu Aminul dan Ny Indri ibu daripada si murid Ibnu. Namanya saja sudah pakar, dengan cepat antara Aminul yang masih bujangan jadi kasmaran dengan Indri yang istrinya Joko. Logikanya, pak guru muda ini takkan tergoda bisikan setan. Tapi bagaimana lagi, setannya kan yang sudah pilihan.

Pagi hari, bersama murid lain Ibnu belajar agama pada Aminul. Tapi siang hari, giliran oknum guru ini belajar pacaran dengan ibunya Ibnu. Mereka sering jalan bareng dengan tanpa seizin Joko yang pegang otoritas. Lamalama informasi itu masuk ke telinga suami. Celakanya, ketika Indri ditegur, malah ribut. Klimaksnya, Joko memilih tinggalkan rumah, sehingga sudah beberapa bulan ini mereka pisah ranjang dan rumah. Dengan tanpa suami, pacaran Indri–Aminul makin intensif, meski belum merambah daerah-daerah yang ‘sip’. Kalau pun ada, pal-

ing baru taraf PPD (pegang-pegang doang), belum sampai PTL (Pacaran Tembak Langsung). Maklum sejahat-jahatnya Aminul, dia masih tahu batas normal. Hubungan yang semakin intens antara keduanya, membuat Joko cemburu. Maksudnya dia pisah ranjang adalah untuk memberi pelajaran istri, kok malah istri diajari yang nggak bener. Pedagang durian dari Kemiling Bandar Lampung ini ini jadi naik pitam. Dicarinyalah Aminul untuk klarifikasi, untuk mengetahui duduk masalah yang sebenarnya.

Dalam pertemuan dari hati ke hati itu Joko mencoba bertanya tentang hubungan Aminul dengan istrinya. Tapi ternyata guru itu menjawab PD sekali. “Oh, ya. Kami memang pacaran, dan beberapa bulan lagi mau menikah. “Wah, ucapan ini membuat Joko kalap. Pisau untuk membelah duren itu langsung ditusukkan ke leher dan dada Aminul. Kontan saja sang guru wasalam di tempat. Dalam pemeriksaan, Joko mengaku bahwa semula tak bermaksud membunuh Aminul, tapi kok omongannya sengak dan tidak didengar. “Ya langsung saya beri….,” ujarnya. (int)


18 September 2012

Penyelundup TTelan elan Uang 40.000 Dolar MEDELLIN- Dua orang yang menelan uang tunai masingmasing 40.000 dolar AS atau sekitar Rp378 juta sebelum memasuki Kolombia ditangkap kepolisian setempat. Kedua orang ini ditangkap secara terpisah selama akhir pekan lalu di bandara internasional Medellin saat tengah mencoba terbang ke Kosta Rika. Di masa lalu, para ‘kurir’ ini menggunakan cara yang sama untuk menyelundupkan narkoba ke luar Kolombia. Mereka menelan paket narkoba bernilai ribuan dolar Amerika untuk dijual di pasaran luar negeri. Namun, pemerintah Kolombia mengatakan mereka belum pernah menemukan cara seperti ini untuk menyelundupkan uang ke negeri itu. “Tipe pencucian uang seperti ini di Kolombia relatif baru,” kata Direktur Imigrasi Provinsi Antioquia, Kolombia, Wilson Patino. Kedua tersangka, seorang warga Kolombia dan seorang lainnya warga Venezuela, disebut sebagai ‘kelas berat’ karena


MICHIGAN- Dari kejauhan, anjing berwarna hitam bernama Zeus yang berasal dari Michigan, AS ini, mungkin dikira seekor kambing. Anjing tersebut baru berusia 3 tahun, namun tinggi badannya sudah mencapai 1,11 meter jika dihitung dari kaki hingga bagian teratas kepalanya. Kakinya yang panjang membuatnya berbeda dari anjing-anjing kebanyakan. Karena keunikannya ini, Zeus kemudian

dinobatkan sebagai anjing tertinggi di dunia, versi The Guinness World of Record. Sebuah foto yang dilansir di Huffingtonpost memperlihatkan Zeus dengan kaki yang panjang sedang melihat keluar jendela, dengan posisi kepala yang lebih tinggi dari wastafel tempat mencuci piring di rumah majikannya. Jika Zeus berdiri dengan kedua kaki belakangnya, ia akan setinggi 2,22 meter dan ia akan lebih tinggi dari pemiliknya, Denise Doorlag. Keunikan Zeus ini mengalahkan anjing

perut mereka seolah tak kesulitan menampung benda-benda itu. Pejabat setempat tak memberikan penjelasan rinci soal bagaimana uang tersebut dikeluarkan dari perut kedua penyelundup itu. Namun, mereka membeberkan bagaimana salah satu penyelundup bisa ditangkap. Tersangka warga Kolombia menarik perhatian aparat keamanan ketika terlihat gugup dan tertekan saat harus melewati sistem keamanan bandara. Dia kemudian diminta untuk melalui pemeriksaan sinar X yang kemudian mendeteksi adanya benda tak lazim di dalam perutnya. Benda-benda itu ternyata 40 kapsul yang di tiap kapsul berisi uang 1.000 dolar Amerika Serikat. Pemerintah Kolombia yakin para penyelundup narkoba berada di belakang upaya aneh ini meski tak menutup kemungkinan organisasi kejahatan lain seperti penyelundup senjata atau manusia yang mendalangi penyelundupan uang ini. (kc/int)

tertinggi di dunia sebelumnya, Giant George, yang tingginya hanya berbeda sekitar 1 inci atau sekitar 2,5 cm lebih pendek dari Zeus. Doorlag mengatakan bahwa Zeus yang memiliki berat badan 77,5 kg ini bisa menghabiskan 15 kilogram kantong makanan selama dua minggu. Ia juga mengatakan bahwa saaat ini ia membutuhkan sebuah mobil van sebagai alat transportasi yang bisa membawa Zeus ke manapun. (kc/int)

Demam Gangnam Style yang Mendunia

Gerakan dansanya yang kocak membuat orang terbahak. Virus Gangnam Style pun mendunia. Tak lebih dari dua bulan, videonya di situs YouTube berhasil mendapat lebih dari 190 juta hit! Psy merilis lagu Korean pop (K-pop) dalam single bertajuk ‘Gangnam Style’ pada 15 Juli 2012. Humor dalam lirik lagu ini serta gaya dansa Psy yang kocak, menggelitik setiap orang yang melihat. Gayanya ditiru, tidak hanya di seantero negerinya, namun juga ke seluruh dunia. Lagunya pun segera merajai tangga lagu Korsel, Gaon Chart. Bahkan, hanya butuh waktu dua bulan, video Gangnam Style di situs

SUZUKI PROMO LEBARAN • Carry Pick Up Dp. 15,7Jt Angs 2Jt • APV Mega Carry Pick Up Dp. 23Jt angs 2Jt • APV Dp. 29Jt angs 3Jt • Ertiga Dp. 35Jt angs 3Jt • Swift Dp. 35Jt angs 4Jt • SX4 Dp. 40Jt angs 4Jt • Grand Vitara Dp. 70Jt angs 5Jt Proses Cepat, Angsuran Ringan dan data bisa di Oslan Lu bis dijemput.Hub: Ar Ardi Lubis 0812 6582 0292


Dp 25 %, angsuran 2 Jt-an Dp 25 %, angsuran 3 Jt-an Dp 25 %, angsuran 3 Jt-an Dp 20 %, angsuran 2 Jt-an Dp 25 %, angsuran 3 Jt-an

Proses cepat data dijemput

Hub: L. Rivai Sembiring 0812 6457 0000

MENTARI MOTOR Melayani servis, cas batre (basah ~ kering). Menjual alat2 sepeda motor, Asessoris, Oli, & alat2 mesin gendong. Alamat: Jl. Jalinsum Simpang Kebun kopi, Indrapura MITSUBISHI RANTO “PROMO” LEBARAN: Pajero Sport, Triton, Colt Diesel Dump Truck, Chasis, L-300, & Colt T120SS PickUp. DP 11% atau bunga mulai 0%. Hubungi: UNAS 0813 6333 3000 DIJUAL CEPAT: Yamaha VIXION warna Hitam tahun 2008. Body dan Mesin mulus. Hub: 0813 7015 5910; 0813 6163 1463 NEW NISSAN: Grand Livina, Juke, X-Trail. Navara, Murano. Ready Stock, cash/credit. Hub: Mili 0852 7033 7739

YouTube mendapatkan lebih dari 190 juta hit! Gangnam Style sebenarnya merupakan istilah Korea untuk gaya hidup mewah di sebuah distrik di Ibukota Seoul, Gangnam. Di tempat itulah berkumpul orang-orang trendi, hip dan memiliki gaya khas. Dalam sebuah wawancara, musisi berusia 35 tahun ini menyatakan Gangnam bisa disebut Beverly Hills-nya Korsel. Di Los Angeles, Amerika Serikat (AS), Beverly Hills merupakan salah satu distrik orang kaya. “Gangnam terhormat di siang hari dan menggila saat malam. Saya suka membandingkan gadis-gadis di tempat itu. Jadi

lagu ini mengenai saya sebagai pria yang tepat untuk mereka,” ujar Psy, yang nama aslinya Park Jae-sang. Video musiknya juga amat kocak. Psy berdansa bak mengendarai kuda khayalan dan muncul di berbagai kegiatan yang dilakukan warga Gangnam. Seperti di tengah latihan yoga hingga dalam jakuzi. Ketika pertama kali dilansir, tentu saja Psy menujukannya untuk penikmat K-pop dalam negeri. Ia berkata, tak pernah bermaksud membuat lagu ini untuk orang asing, alih-alih penikmat musik Barat. Penggemar K-pop amat menyukai Gangnam Style dan mulai menyebarkannya lewat berbagai jejaring sosial seperti Facebook dan Twitter. Tentu saja, penikmat K-pop di luar negeri langsung memperhatikannya. Video ini langsung mendunia begitu masuk ke AS, kiblat musik dunia. Akhirnya, bak efek bola salju, Psy dan gaya dansa lucunya langsung dikenal publik Amerika. Di dalam negeri, ia menduduki posisi puncak di berbagai tangga lagu. Awal Agustus, media memperhatikannya. Adalah The Los Angeles Times dalam edisi 4 Agustus 2012 menyatakan, Gangnam Style tak bisa dihentikan dan segera mengambil alih dunia. Akhir Agustus, lagu ini sudah masuk ke majalah musik ternama, Billboard, dan langung melompat delapan peringkat sekaligus di Billboard Social 50, sebuah tangga lagu mingguan. (int)




Menjual sepeda motor honda, yamaha, suzuki Viar, baru dan bekas; Cash & Credit; Tukar tambah; Urus Perpanjang STNK, BBN. Alamat: • Jl. Jend. Sudirman No. 389 ABCD, Indrapura ( 0622-31788) • Jl. Acces Road, Simp. Durian, Kuala Tanjung.

Ganti oli, pispot, balancing ban, tubeless, angin hidrogen, cot, dan ban luar radial. Masih membutuhkan beberapa tenaga Doorsmer (Tukang Cuci Mobil). Alamat: Jl. A. Yani No.6/8, Kisaran.

Jaya Motor jaminan hanya BPKB Sepeda motor anda persyarat ringan, 1 jam cair. Juga melayani j u a l b e l i s e p e d a m o t o r. H u b : alamat Cabang kami di Jl. Lintas S i a n t a r, S i m p Ta n g s i . H P : 085373430808. Alamat Unit kami: Jl. Lintas Sei Mati, Ds Mekar Sari. HP : 085361450914

DIJUAL: Tanah kapling uk 6x12M, harga mulai 35jt-an, bisa nego. Lokasi strategus sebelah kolam renang Wahyu. Hub alamat: Kolam Renang Wahyu, Jl. St. Alisyah Bana, d e n g a n B p k I RWA N E D W I N (Buyung) Hp: 0813 7596 2988. *Juga menerima pelatihan renang yg diasuh ole h Pelatih bersertifikat & berpengalaman. DIJUAL KEBUN KELAPA SAWIT: seluas 2 Hektar, umur tanam 12 & 5 tahun, dengan penghasilan 5 ton 1 bln. Ta n a h r a t a , l o k a s i : K a m p u n g Tempel, Kec. Tinggi Raja. Harga Rp. 300 juta (NEGO). Hub: BAHARUDDIN S. HP: 0813 6200 5227

Telah Hadir di Kisaran, “RUMAH JAMUR” menyediakan menu masakan ala jamur, Lontong sate jamur, Bakso jamur, Sop jamur Ayam kampung, Mie jamur ayam kampong, Krispy jamur, es jamur, Dll. Buka setiap hari Kecuali “Jumat” mulai jam 12.00 siang sampai malam. Kunjungi alamat kami : Jl. Budi Utomo No. 116 Siumbut-umbut Kisaran. HP : 0877 4878 2775 DINA DOORSMER: Menyediakan doorsmeer Hidrolik sistem. Servis AC mobil, Assesoris, Cat Ketok, bengkel Injeksi, ganti oli, Tune-Up, Over Haul, dan cat duko. Alamat: Jl. Jalinsum, Kuala Tanjung, Indrapura, Batubara (0622-632832)

EXCELCISE COMPUTER Lembaga kursus pelatihan Komputer. Kami melayani dan menerima murid baru serta menerima ketikan surat , kantor, pengetikan skripsi, majalah, proposal & surat lainnya. Kunjungi alamat kami : Jl. Malik Ibrahim No. 27 Kisaran. HP: 0813 6112 9333 ; 0812 6053 8000 “MARI SALON SANGGUL” Cab. Medan & Jakarta. Menerima: Gunting rambut, rebonding, hair spa, lulur, facial, merias pengantin (Sanggul + Make Up), dan menerima siswa/i yang ingin belajar dan punya keahlian khusus dgn biaya terjangkau. Hub: MARI SALON SANGGUL, Pajak Gelugur Lt.2 Blok B No. 43&44, Rantauprapat. HP: 0821 6547 7080; 0852 6277 2884

APOTIK & CLINIK AULIA FARMA: menyediakan berbagai macam obat yg bermutu dan harga terjangkau. Menerima rawat inap., Pemeriksaan ibu hamil, Bersalin, Sunat, Imunisasi, EKG, USG. Tersedia,LAB, CLINIK, & ambulan. DAPAT KONSULTASI GRATIS dgn apoteker. Alamat: Desa Tanjung Gading Sei Suka, Indrapura, Kab. Batubara. Hub: 0622-632088 PERCETAKAN & ADVERTISING “BIMA”: Menerima segala jenis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7586). Jl. Jend. Sudirman No. 288, Indrapura, Batubara. COLOUMBIA, CASH & CREDIT FURNITURE & ELEKTRONIK h a r g a t e r j a n g k a u , p a k e t m u r ah meriah (cicilan ringan). P a s a r 8, Jl. Jend. Sudirman, Indrapura, Batubara

BUTUH DANA TUNAI: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda, persyaratan ringan, 1 jam cair, juga melayani jual beli sepeda motor. Hubungi alamat Pusat: Jl Diponogoro No.149, Kisaran.Telp 0623 43921 Hp : 081361505214 A P O T I K K A R YA : M e n j u a l berbagai obat dan Lengkap. Dengan harga terjangkau. M e n e r i m a pa s i e n d a n k o n s u l t a s i k e s e h a t a n . hub: J l . J a l i n s u m , D e s a T j . G a d i n g , Simpang Kuala Ta n j u n g , I n d r a p u r a , Batubara. Te l p : 0 6 2 2 - 6 3 2 7 5 1 UD. JANNAH:

Menjual alat2 pancing, Kantor, Olahraga, Sekolah, K o m p u t e r, d a n P e r l e n g k a p a n S h o l a t , d e n g a n h a r g a G r o s i r. Alamat: Jl. Lintas Medan-Kisaran, Simpang Kebun Kopi, Batubara. HP: 0852 7680 942


Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar). Alamat:Jl.A. Yani/Psr. Mereng Simp. 4 Talawi - Batu Bara.

TOKO CANTIKA COLLECTION :Menjual jilbab, busana muslim, pakaian pria & wanita, pakaian serta perlengkapan baby, accesoris jilbab, mukena,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No.40 (Depan Pajak Tanjung Tiram) Batu Bara. Hub:(Jonni Hendra, S.pd.) HP:0823 6269 4535

Tidak Bekerja, Pria Ini Timbun Emas Batangan WASHINGTON- Bagaimana mungkin seseorang yang tidak bekerja sejak berpuluh-puluh tahun lalu dapat memiliki harta kekayaan berlimpah. Namun hal itu ternyata mungkin saja bagi Walter Samasko Jr. Pria yang ditemukan tak bernyawa di kediamannya di Kota Carson, Amerika Serikat (AS) ini diketahui tidak bekerja sejak tahun 1968. Namun ketika tubuhnya yang sudah tidak bernyawa itu ditemukan, sejumlah tetangga Samasko Jr terkejut menyaksikan timbunan emas batangan senilai USD7 juta atau sekira Rp66 miliar (Rp9.458 per USD) ditemukan di garasi rumah. Demikian diberitakan Las Vegas dan dikutip Upi, Senin (17/9). Pihak keamanan pun terpaksa menggunakan truk khusus untuk mengangkut batangan emas itu. Selain batangan emas juga ditemukan koin emas dari sejumlah negara seperti Meksiko, Inggris, Austria dan Afrika Selatan. Setelah diselidiki Samasko ternyata selama ini hidup dari hasil investasinya. Termasuk saham senilai USD140 ribu atau sekira Rp1,3 miliar dan USD25 ribu atau sekira Rp236 juta yang dimilikinya. (ok/int)

“AA” Fashion: Menjual berbagai

BROKOLI CERIA: sajian spaghetti

jenis pakaian muslim, wanita, pria, anak2, dan dewasa, berbagai merek dan ternama, dan terbaru. Melayani eceran dan grosir. Jl. Jend. Sudirman, Kota Indrapura, Kab. Batubara. HP: 0813 6154 2640

sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Alamat: Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP: 0812 6217 910


Pemasangan Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota

Menjual aneka pakaian batik, Tas batik, Kaos, Sabun Herbal, mainan kunci dan accessories lainnya. Dapat kan produknya di: Jl.SM.Raja No. 35 B, Kisaran. Dekat Rel KA. AKAN DIBUKA DI KISARAN PUJASERA (Pusat Jajanan Serba Ada): anda berminat segera hubungi, Tempat terbatas, Alamat: Jl. Imam Bonjol No. 366 Kisaran (Doorsmeer Pondok Keluarga). Siapa Cepat Dia Dapat. HP. 0852 7059 6434 (Faisal).


Toko Mas CAHAYA BARU: Menjual berbagai macam mas dan perak dgn berbagai bentuk tempahan: cincin, kalung, gelang rante, anting2, mutu memuaskan, kunjungi kami di: Pajak Pagi Kebun Kopi, Indrapura, Batubara

O G E Ts St i k e r & Aksessories: Penjualan & Pemasangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177 ; Telp. 0622 - 646 144.

"CV. ANUGRAH JAYA" Kontraktor, Lepelasir, Biro Jasa, Dagang umum, Pertanian, Serta menyediakan & menjual barang-barang serta peralatan bangunan,dll. Alamat : Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram. Batu Bara. hub:(Ibu Ani) HP : 0853 6067 1005


"Balai Pengobatan ELLY”


Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Berbagai minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Alamat: Simpang Kuala Tanjung, Indrapura, Batubara


Khas masakan Minang, terkenal masakannya lezat. Menunya tersedia kopi susu, teh susu, & Juice. Menerima Pesanan nasi kotak. Jl. Jend. Sudirman No. 72, Indrapura, Kab. Batubara. (HP 0813 9782 3094) (TUKANG BURUNG) RAHMAT KT: Menjual berbagai macam jenis burung pilihan, dan menerima tempahan berbagai jenis Kandang (sangkar burung). Hub. HP: 0823 6403 5666 . Alamat: Jl. Simpang Kuala Tanjung, Indrapura, Batubara.

Izin No : 800/3244/DINKES SOS/2008, Penanggung Jawab: Dr. HIDAYAT, M. Kes. Menyediakan berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda dan keluarga, serta bersedia datang ke rumah anda untuk panggilan pengobatan di rumah anda dalam waktu 24 Jam. Alamat: Empat Negri, Kec. Lima Puluh, Kab.Batu Bara, Hub: IBU ELLY, HP : 0852 7668 2236

“RAGHIB JAYA ALUMINIUM” Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165-166 Batu Bara, Hubungi : DICKY BUDIANTO, HP : 0812 655 3575 - 0812 6536 6166.


SULIT untuk mengubah kebiasaan makan kue di pagi hari menjadi Pilates setiap Minggu pagi, hanya dalam satu langkah. Jadi saya melakukan beberapa langkah kecil dan mudah agar merasa lebih baik dan lebih sehat. Tidak diperlukan banyak resep, tapi hanya hal-hal kecil yang baik untuk tubuh:

Ups, Bubble Tea Berbahaya? JIKA diperhatikan, blended ice tea atau coffee yang ditambahkan bubble hitam, sedang marak-maraknya dijual di mal atau pusat pembelanjaan. Sayangnya, penelitian terbaru dari peneliti University Hospital Aachen menunjukkan bahwa bubble atau bola-bola kecil berwarna hitam dalam minuman bubble ice tea bersifat karsinogen (racun). Para peneliti Jerman mengingatkan pecinta bubble tea bahwa bola-bola hitam yang terbuat dari tepung tapioka ini diduga mengandung polychlorinated biphenyls (PCB), seperti stirena, asetofenon dan zat brominated. Menurut peneliti sekaligus ilmuwan Manfred Moller, sebenarnya zat-zat berbahaya tersebut tidak boleh dimasukkan kedalam makanan sedikitpun. PCB yang terdapat dalam makanan terbukti menyebabkan kanker serta menimbulkan berbagai efek kesehatan lainnya yang merugikan pada sistem kekebalan tubuh, sistem reproduksi, sistem saraf dan sistem endokrin, bahkan risiko tersedak pada anakanak.(int)

1.Minum satu teko teh hijau atau putih setiap hari Saya sering mengalami dehidrasi beberapa bulan terakhir, dan saya merasa lebih baik ketika minum teh setiap hari. Teh dengan kafein bisa berfungsi sebagai sebuah diuretic (zat yang membuat kita mengeluarkan banyak cairan/kencing), tapi saya selalu merasa teh hijau atau putih sangat bermanfaat. Ketika saya rutin mengonsumsi teh, saya merasakan efek yang baik: saya merasa lebih seimbang dan kulit saya menjadi lebih bercahaya. 2. Mengonsumsi protein setiap pagi Saya orang yang suka sarapan — dan tentu saja suka minum kopi setiap pagi — tapi saya tidak melakukan rutinitas itu lagi. Namun, saya mengetahui akan merasa lebih baik sepanjang hari jika mengonsumsi cukup protein ketika bangun tidur. Itu membuat saya bisa bertahan tidak mengonsumsi snack sepanjang hari dan menjaga hormon tetap stabil. Saya memulai pelan-pelan, dengan telur rebus dan yoghurt atau kacangkacangan, tapi saya berharap akan semakin kreatif ke depannya. 3. Pergi ke gym setidaknya dua kali sepekan Hari-hari yang tidak saya gunakan untuk pergi ke gym, harus saya ganti dengan berjalan kaki minimal 45 menit atau bersepeda minimal 30 menit. Saya mencoba melakukan hal-hal yang saya sukai — bersepeda statis sambil

membaca, berjalan di treadmill, berenang di kolam renang dan duduk di ruang uap — bekerja dengan pemikiran bahwa melakukan sesuatu lebih baik daripada tidak sama sekali. 4. Mengonsumsi sayuran hijau setiap hari Saya kembali pada kebiasaan membuat jus setiap siang, dan saya selalu menggunakan buah segar ditambah dengan bayam atau peterseli. Itu adalah penganan yang bergizi dan baik, sehingga mood dan energi saya menjadi lebih konsisten. Entah Anda membuatnya di tempat kerja atau di rumah, pastikan memiliki tempat yang cukup besar dan bisa dibawa kemana-mana untuk dinikmati sepanjang hari. 5. Jangan lupa untuk memanjakan diri Saya tidak bisa bekerja dengan baik dalam kondisi lapar, sehingga saya memastikan memberikan penghargaan kepada diri saya karena mencoba hidup dengan lebih sehat. Saya suka menyimpan kue buatan sendiri di rumah, dan memakannya setiap hari. Saya minum segelas anggur saat makan malam dan menikmati hidangan penutup ketika perut masih sanggup menampungnya dan saya tidak bisa membayangkan akan menolak ayam goreng. Saya mencoba untuk hidup dengan seimbang yang akan mempertahankan kebahagiaan saya tapi juga tidak akan terlalu memaksakannya setiap hari.(int)

Perbedaan Fantasi Seks Pria dan Wanita PARA wanita berfantasi dilamar Ryan Gosling, sementara para pria berfantasi berkencan dengan gadis sampul majalah “Maxim” edisi terbaru. Bukankah begitu? Tampaknya memang demikian! Penelitian terbaru dari Universitas Granda yang dipublikasikan dalam jurnal berbahasa Spanyol “Anales de Psicologia” menemukan, baik pria dan wanita memiliki fantasi seksual yang intim dan romantis yang sama, bukan dengan para selebriti dan para model Victoria Secret, namun bercinta dengan kekasihnya! Para peneliti yang melakukan survei terhadap pertanyaan yang dijawab oleh 2500 pria dan wanita Spanyol yang sedang menjalani hubungan heteroseksual setidaknya selama enam bulan, menemukan bahwa para pria dan wanita banyak berfantasi mengenai hal yang sama. Ditambah, hampir 100 persen responden memiliki fantasi seksual. Ini artinya bukan cuma pria yang berfantasi mengenai seks. “Ketika seks merasuki wanita, kita tahu bahwa kita sangat mudah terpengaruh secara visual,” kata Amy Levine, praktisi seks dan pendiri Ignite Your Pleasure kepada HealtySELF, sembari menambahkan bahwa dirinya tidak terkejut oleh hasil tersebut. “Para wanita dapat dan sering berfantasi tentang seks.” Levine mengatakan ada sebuah kesan yang berbeda dari tiap jenis

bersama pasangan Anda,” kata Levine. “Fantasi meningkatkan gairah Anda, meningkatkan sensasi pada kehidupan nyata dan membawa Anda ke puncak kenikmatan,” katanya.

Orang Gemuk Lebih Puas Soal Seks

fantasi para pria dan wanita, namun penelitian tersebut tidak membahasnya. Namun, tampaknya para pria menghabiskan lebih banyak waktunya untuk berfantasi daripada wanita, seperti yang dilaporkan oleh para peneliti tersebut, yang menemukan sejumlah perbedaan lain di antara para pria dan wanita: para wanita memiliki “fantasi asmara yang romantis” lebih sering

daripada para pria, sementara para pria lebih sering berfantasi mengenai petualangan seksual, seperti hubungan seks berkelompok atau menjadi seorang “pelaku seks bebas.” Tidak peduli apa yang Anda fantasikan, itu sehat, kegiatan itu wajar dan menurut Levine dapat membantu kehidupan seks Anda. “Merupakan hal yang wajar memiliki fantasi seksual, baik saat Anda sendiri atau

Memiliki tubuh gemuk tentu membuat minder. Tak heran jika penelitian di Inggris baru-baru ini menunjukkan bahwa tubuh gemuk bikin perempuan menghindari seks. Namun, meskipun minder dengan bentuk tubuh, orang gemuk ternyata lebih bisa mendapatkan seks yang menggairahkan. Rebecca Jane Weinstein dalam bukunya "Fat Sexy: The Naked Truth" mengungkapkan bahwa ukuran tubuh tidak menghalau keintiman seseorang. "Ukuran besar terlihat tidak menarik bagi setiap orang dan mengira mereka aseksual di mana mereka tak tertarik pada seks. Namun, sebenarnya tidak ada perbedaan antara ukuran tubuh besar atau kecil sejauh mereka mendapatkan seks. Setiap orang akan tertarik pada apa yang membuat mereka tertarik," tutur Weinstein, dikutip melalui Mediaite (20/7). Menurut Weistein, orang gemuk lebih mendapatkan seks yang memuaskan dibandingkan dengan orang bertubuh kecil. Orang gemuk akan berhubungan seks dengan pasangan yang bisa menerima tubuh berbalut lemak berlebihan mereka. Pada akhirnya, mereka lebih mudah menikmati aktivitas seksnya. Riset lain di tahun 2010 juga menunjukkan bahwa perempuan gemuk lebih 'panas' dibandingkan perempuan bertubuh kurus. Penelitian tersebut menemukan kalau perempuan maupun pria dengan tubuh berisi akan lebih berusaha memuaskan pasangannya di ranjang. Mereka tak malu dan lebih terbuka mengenai eksplorasi seks demi kepuasaan bersama.(int)

Warna dan Cahaya Ruangan Berpengaruh Pada Mood Bekerja Di ruang atau meja kerja anda banyak file menumpuk? Apakah semua file penting? Atau tidak sempat membereskannya? Anda harus menyempatkan waktu untuk membereskan file atau barang-barang yang menumpuk dan berantakan di meja kerja anda. Pasalnya hal itu mempengaruhi mood ketika bekerja. "Terlalu banyak file di ruang atau meja kerja, memang perlu waktu untuk membuang file nggak penting, tapi kondisi yang bersih berpengaruh pada mood," ucap Prapanca Muchtar, pemilik Q Space, sebuah studio desain interior di Jakarta, Sabtu (8/9/ 2012) malam. Panca, panggilannya, memiliki tips agar ruang kerja Anda tetap bersih dan nyaman, sehingga mood ketika bekerja tetap terjaga. Berikut ini penjelasannya bagi anda: - Warna Jika Anda berniat merenovasi atau mengubah interior ruang kerja, meskipun sedikit, jangan takut bermain warna. Kalau Anda selalu memakai warna "aman" seperti warna-warna soft (peach, biru laut, hijau muda, abu-abu, putih, krem, dan lajnnya) terkesan pucat, tak bersemangat. Jika ruang kecil, Anda dapat mengaplikasikan satu

"Hati-hati menggunakan warna yang colorful, salah bisa jadi kacau, berpengaruh pada mood," kata Panca. - Hiasan Anda juga bisa menghias ruangan atau meja dengan dengan lukisan, tanaman, akuarium, atau aksesoris. Namun jangan terlalu banyak. Cukup satu sampai tiga item saja. Tetapi jika ruang kerja kecil satu pun sudah cukup. "Jangan lakukan pasang foto dengan pacar, foto mantan juga masih ada, belum lagi foto-foto dengan teman, dan boneka yang berserakan. Kalau banyak hiasan

warna cerah, ruang besar dapat colorful. Tetapi Anda harus berhati-hati, karena

ruang colorful dapat membuat pikiran atau perasaan kacau.

membuat pikiran kacau," ujar Panca. - Pencahayaan Warna cahaya berpengaruh terhadap kinerja. Menurut Panca, cahaya yang paling bagus adalah putih, karena memberikan efek yang lebih segar, terlebih jika karyawan baru tiba di kantor. Jika cahaya lampu kuning, membuat seseorang tidak bersemangat. "Kalau istirajat pasang cahaya sedikit kuning, dua jam setelah makan siang biasanya ngantuk, kasih warna putih, pulang kantor cahaya agak kuning, tetapi kalau tidur sebaiknya gelap atau cahayanya kuning, lampu teduh juga nggak masalah," jelasnya. Panca melanjutkan bahwa setengah hidup kita dihabiskan di kantor, jadi desain yang menarik dan nyaman, menjaga seseorang agar tetap sehat, kinerja meningkat. "Itu yang diinginkan perusahaan kan? Kalau desain kantor bagus, kerja semangat, perusahaan untung. Kalau nggak bisa dikerjakan sendiri, minta bantuan interior desinger," tutup tips darinya. • Betapa Pintarnya Manfaatkan Tangga untuk Rak Buku • Betapa Pintarnya Siasati Ruang Sempit Jadi Berkesan Luas • Sendok Tengkorak Ini Lucu Sekaligus Menyeramkan.(int)


18 September 2012

etelah putus dari Anji eks personil ‘Drive’, Rini ‘Idol’ mengaku kapok berpacaran dengan pria yang memiliki profesi sama. Kalaupun nantinya dia memiliki kekasih baru, Rini ingin mencari yang bukan dari sesama artis. “Nggak usah seprofesi biar nggak ribet dan lain-lain. Bukan hanya enak karena


MADONNA kembali menyulut permusuhan dengan Lady Gaga. Kali ini Madonna menyebut Gaga imitasi, dalam konser di Atlantic City, New Jersey, Amerika Serikat. Permusuhan Madonna dan Lady Gaga dimuali ketika lagu Born This Way’milik Madonna dibandingkan dengan lagu Madonna berjudul Express Yourself(1989). ”Aku aku akan mendedikasikan lagu berikut ini untuk Lady Gaga. Anda ingin tahu? Karena aku mencintainya. Aku sungguh-sungguh mencintainya. Imitasi adalah bentuk sanjungan tertinggi untuknya,” kata Madonna di konsernya, seperti dikutip Contactmusic.Madonna juga sebelumnya bercanda kalau ia dengan senang hati membantu Gaga untuk menulis lagu. ”Suatu hari, secepatnya, kami akan berada di panggung bersama-sama. Tunggu saja,” katanya. (idc)

sama-sama dibidang entertainment. Tapi mandang pribadinya juga. Aku jalin hubungan yang beda-beda shift bukan karena pekerjaannnya aja,” ujar Rini diRCTI, Kawasan Kebon Jeruk, Jakarta Barat, Senin (17/9). Rini mengakui kini dia memiliki kekasih yang berprofesi sebagai pekerja kantoran.Pria yang bersuku

Jawa ini sudah diperkenalkan kepada kedua orangtuanya. tapi menurut Rini, kedua orangtuanya tahu ia berpacaran. “ Yang jelas udah tahu kalau kitanya pacaran. Nggak mau nanya-nanya juga sih karena masih nyantai. Ini masih ditahap ini dulu,” ujarnya. Rini yang sudah berpacaraan hingga 3 tahun hingga kini

Syahrini ikut hadir di konser Noah. Syahrini yang duduk di barisan paling depan terlihat menikmati lagu-lagu yang dibawakan Ariel. Mantan duet Anang Hermansyah ini pun mengucapkan selamat atas kembalinya Ariel bersama teman-temannya. “Congratulation untuk Noah yang sudah konser, suatu pencapaian yang patut dibanggakan dan diacungi jempol. Dan patut diapresisi oleh semua seniman Indoensia,” ucapnya saat ditemui di Gandaria City, Jakarta Selatan, Senin (17/9)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Peruntungan: Tidak ada salahnya jika di hari ini Anda mulai membuka agenda-agenda yang ada dan segera menyusun langkahlangkah yang harus dilakukan di masa mendatang agar pada saatnya nanti bisa lebih santai dan ringan berjalan. Asmara: Tidak perlu mengusik hatinya yang lagi kacau sebab sudah cukup banyak yang menjadi beban pikirannya.


dini hari. Sebagai sesama musisi, Syahrini selalu mendukung kehadiran Noah. Menurutnya, Noah patut mendapat apresiasi sesama musisi. “Akhirnya dia kembali lagi ke industri musik Indonesia. Aku

(21 Desember -19 Januari)

Peruntungan: Selesaikan tugas-tugas yang masih menjadi beban Anda selama ini. Jangan terlalu asyik apalagi meremehkan persoalan yang ada, mumpung di hari ini perbintangan Anda lagi mujur-mujurnya. Asmara: Konsekuensi Anda dalam berbicara akan dibuktikan olehnya, maka dari itu berhatihatilah. Jangan sampai dicap pembual besar.


(20 Januari - 18 Februari)

Peruntungan: Peluang yang muncul secara tiba-tiba sebaiknya bisa disikapi dengan positive thinking dan segera ditindaklanjuti. Jangan buang waktu percuma. Asmara: Tak perlu tersinggung dulu dengan kata-katanya itu. Jika Anda renungkan maka Anda pasti bisa menemukan kebenaran dalam perkataannya itu.


19 Februari - 20 Maret

Peruntungan: Ada baiknya bersikap lebih tegas dan hilangkan dulu segala pikiran-pikiran yang ngambang dan tidak punya keyakinan itu. Cobalah berpikir dengan lebih optimis lagi sehingga bila ada peluang yang lewat tidak sampai berlalu begitu saja. Asmara: Hilangkan sikap egois. Cobalah Anda lebih bisa mengalah padanya.


(21 Maret - 20 April)

Peruntungan: Kalau permasalahan ini terus dibiarkan dan tidak segera ditindaklanjuti, maka keuntungan besar yang sudah di depan mata itu akan hilang lenyap begitu saja. Asmara: Keresahan hati kini terjawab sudah dan kenyataannya tidak seburuk apa yang Anda bayangkan.


(21 April - 20 Mei)

Peruntungan: Masih cukup ada rintangan yang harus diwaspadai, walau begitu tak perlu berkecil hati dan tak perlu risau akan ejekan yang muncul. Asmara: Jagalah selalu keserasiannya. Kalau ada pihak yang ingin mengacaukan suasana jangan dibiarkan saja.


(21 Mei - 20 Juni)

Peruntungan: Masalah berat sudah mereda dan menyingkir sehingga tak perlu cemas lagi. Di hari ini tidak ada salahnya jika Anda berani membuat keputusan penting karena itu memang sangat mendesak dan perlu gerak cepat, yang penting hati harus selalu yakin dengan keputusan yang telah dibuat. Asmara: Jangan ragu untuk bicara apa adanya kepada pasangan Anda karena itu akan lebih baik dan kesalahpahaman bisa terhindarkan.


(21 Juni- 20 Juli)

Peruntungan: Di hari ini jangan sembrono, terutama dalam memutuskan untuk menjalankan suatu rencana sebaiknya dipikirkan secara matang. Meskipun peluang cukup banyak, jika Anda tidak pAndai-pAndai mengolahnya maka hanya akan terbuang percuma saja. Asmara: Perhatian adalah nomor satu, maka dari itu luangkan waktu Anda walau sedikit untuk menelpon dia supaya komunikasi tetap terjalin baik.


(21 Juli-21 Agustus)

Peruntungan: Di hari ini aturlah waktu seefisien mungkin. Jangan seenaknya sendiri walaupun itu hanya sepele saja, akan tetapi jika tidak ditanggapi dan dipikirkan secara serius maka akan bisa menjadi problem yang cukup sulit untuk dipecahkan. Asmara: Apa sih enaknya backstreet kalau Anda masih punya pacar yang bisa diAndalkan?


(23 Agustus-22 September)

.Peruntungan: Berusahalah untuk lebih terkoordinasi dan terkonsep, walau untuk permulaaannya memang terasa berat dan menjemukan akan tetapi untuk langkah ke depannya akan benar-benar terasa manfaatnya. Asmara: Bersabar dan yakinlah bahwa semua ini pasti akan berlalu, untuk itu yang tenang saja.


(23 Oktober - 22 November)

Peruntungan: Kerjasama dengan pihak luar sebaiknya benar-benar dipikirkan secara mendalam. Jangan hanya berlandaskan faktor perasaan saja sehingga sikap baik Anda ini tak disalahgunakan oleh mereka untuk mengambil keuntungan sendiri. Asmara: Jadilah orang yang pandai mensyukuri nikmat sehingga tak perlu punya pikiran yang macammacam.


( 23 November - 20 Desember)

Peruntungan: Manfaatkan kesempatan yang ada di hari Sabtu ini walaupun kecil karena jika dikerjakan dengan sungguhsungguh maka akan besar hasilnya. Asmara: Jangan negative thinking kepadanya. Itu tidak ada untungnya, hanya akan menambah kacau suasana saja.

MENYANDANG status janda tak membuat Chantal Della Concetta merasa terbebani. Presenter dan model majalah dewasa ini mengaku tak perlu repot dengan statusnya itu. ”Nggak usah dibikin repot, santai aja. Kalau pikirannya repot, jadi repot. Kalau pikirannya ribet, bakal ribet. Kalau kita santai ya santai,” ujar Chantal. Misalnya ketika sang anak sedikit mengalami gangguan kesehatan, Chantal menyikapinya dengan tenang dan bijak. “Anak batuk sih wajar, ya namanya juga udara kayak gini. Kalau segala macam (kegiatan) nggak boleh, kasihan juga,” ujarnya. Chantal pernah menikah dengan Hans Lazuardi dan dikaruniai seorang putra, Nathaniel Trevor Lazuardi, pada 2004,

dan seorang putri, Mazel Peach Lazuardi, pada 2009. Pernikahan mereka hanya bertahan beberapa tahun. Chantal juga tidak merasa keberatan dengan klaim dirinya jadi salah satu icon wanita terseksi di tanah air. “Emang image seksi ada yang salah? Buat aku image seksi itu confident. Seksi itu kita merasa nyaman untuk tubuh kita, kenapa kita takut ama tubuh kita,” ucap Chantal. Semua orang menurut Chantal berhak untuk menjadi seksi. Baik laki-laki ataupun perempuan. Karena setiap orang mempunyai tipikal keseksian yang tak sama. ”Kenapa kita harus takut jadi seksi terutama perempuan. Lakilaki juga belum tentu nggak seksi kan, ada faktor seksinya. Mungkin berbeda dengan perempuan. Mungkin bagi sebagian perempuan, laki-laki pakai kemeja putih udah seksi ataupun lainnya,” lanjut presenter acara dewasa Sexophone ini. Selain itu, seksi bukan hanya terpaku pada bentuk tubuh yang menawan. Sebuah intelektualitas bagi Chantal juga menunjang sebuah keseksian seseorang. “Perempuan yang pintar menurutku itu seksi, perempuan yang percaya diri juga seksi,” cetusnya. Tatto di mata Chantal juga dianggapnya karya seni manusia yang indah. Dia sengaja menatto beberapa bagian tubuhnya agar indah dilihat orang lain. Tetapi sayang, ia tidak mau menyebut jumlah tatto yang ada di tubuhnya dan bagian-bagian tubuhnya yang ditatto. (BCG/jpnn)

belum memikirkan untuk menuju ke mahligai bahtera rumah tangga. Rupanya Rini masih ingin mengumpulkan pundi-pundi uang dan mengembangkan karirnya. “ Masih pengen menikmati masa yang sibuk kerja mencoba satu yang baru. Kerjaannya masih nyanyinyaanyi aja belum coba bidang lain,” tandasnya. (tr/int)

salah satu yang mensupport dan mengapresiasi karyakarya mereka,” katanya. Lantas bagaimana tanggapan Syahrini perihal konser 5 negara 2 benua yang berhasil dilaksanakan Noah? “Luar biasa keren, lagu-lagu barunya aku juga suka,” ucapnya. (nov)

KRISTEN Stewart sepertinya tak tanggung-tanggung dalam melepas image Bella Swan yang sudah melekat kepadanya bertahun-tahun. Bahkan untuk beradegan topless di film terbarunya ‘On the Road’ Kristen tampak tak canggung. ”Itu tak menggangguku (adegan topless),” ujarnya seperti dilansir MTV News, Senin (17/9). ”Ketika sampai di lokasi syuting, hanya ambil napas dan biarkan itu terjadi,” tambahnya. Kristen merasa ia sudah cukup dewasa untuk melakukan adegan tersebut. Menurut aktris kelahiran 9 April 1990 itu, ia tak akan berani melakukannya jika usianya baru 17 tahun. Di film itu, Stewart berperan sebagai Marylou, istri Dean Moriarty (Hedlund) yang masih berusia 16 tahun. Dia adalah gadis yang memiliki semangat kebebasan, dan sangat menyukai mariyuana dan seks. Pasangan pengantin muda itu kemudian bertemu dengan Sal Paradise yang mengajak mereka unutk melakukan perjalanan setelah ayahnya meninggal dunia. Haus akan kebebasan, mereka menemukan ‘dunia lain’ yang cukup gila. Untuk perannya sebagai Marylou di film itu, Stewart juga rela mengecat rambutnya yang gelap menjadi pirang. “On the Road” akan terlebih dahulu diputar di Toronto International Film Festival 2012 bulan ini, sebelum tayang di bioskop AS pada 21 Desember mendatang. (dtc/int)

SUSAN Bachtiar phobia memakai sepatu tertutup. Karena memakai sepatu jenis ini, Susan harus menghirup aroma tidak sedap pada kakinya. Tidak hanya itu menurutnya sepatu tertutup dapat menimbulkan panas pada kakinya. Jadi jika berpergian Susan lebih nyaman pakai sepatu yang terbuka. “ Lagipula just my style aja. Pake sepatu tertutup itu kalau lagi terpaksa aja. Soalnya lebih ke negara yang memang pakai boots,” ujar Susan di Press conference OLAY Changing Life, Diva Reunion Concert, Hard Rock, Jl MH Thamrin, Jakarta Pusat, Senin (17/9). Bintang film ‘Perempuan Punya Cerita’ ini mengaku lebih cocok pakai sepatu berbahan kain yang dapat menyerap keringat. “Seperti katun yang paling aman. Apalagi untuk perempuan, kondisi badannya kan lain dari pria Untuk kesehatan wanita, dokter juga banyak menyarankan untuk memang bisa memakai bahan katun,” ujarnya. Tetapi karena begitu banyak model, katun terbatas jadi diperlukan perpaduan bahan yang lain. ”Tapi memang perpaduan bahan membuat fashion menjadi lebih menonjol,” ujarnya. Sekedar diketahui mantan isteri Sunardi ini mengatakan khusus masalah fashion, biasanya ia memakai apa yang dianggap nyaman dan cocok dengan gayanya. “ Nggak peduli apa gaya bajunya atau mereknya apa, yang penting comfortable,” tandasnya. (tr/int)



18 September 2012

Lorenzo Juara, Pedrosa Sial, Rossi Hadiahkan Kado Manis

Pebalap Yamaha, Jorge Lorenzo, menjuarai GP San Marino, Minggu (16/9), ketika rival terberatnya dari tim Repsol Honda, Dani Pedrosa, mengalami nasib buruk. Dengan hasil ini, Lorenzo kembali menjauh dari kejaran Pedrosa, dengan keunggulan 38 poin atas kompatriotnya dari Spanyol itu, dan balapan tersisa lima seri lagi. Balapan di Sirkuit Misano ini pun menjadi arena pertunjukkan Valentino Rossi, yang sukses finis di posisi kedua. “The Doctor” membuktikan tekadnya, yang ingin mempersembahkan hasil bagus sebagai kado perpisahan dengan Ducati dalam balapan terakhir di depan publik Italia. Posisi ketiga ditempati pebalap Gresini Honda, Alvaro Bautista, yang berhasil mengatasi tekanan pebalap Yamaha Tech 3, Andrea Doviziso, menjelang akhir balapan. Pada tikungan terakhir sebelum menyentuh garis finis, Dovizioso nyaris melewati Bautista, tetapi pebalap Spanyol ini sukses mempertahankan posisi dengan keunggulan hanya 0,03 detik. Jalannya Balapan Saat lampu merah padam tanda balapan dimulai, Rossi melakukan start yang bagus karena dari urutan keenam, dia langsung menyodok ke posisi kedua, persis di belakang Lorenzo yang menjadi pebalap terdepan. Ini terjadi karena Pedrosa, yang

meraih pole position, harus start dari posisi paling belakang akibat mengalami masalah mesin, sehingga harus mengganti motor. Namun di lap kedua, nasib buruk menimpa Pedrosa, yang mengalami kecelakaan. Ketika sedang berusaha merangsek ke depan untuk memperbaiki posisinya, dia dihantam pebalap Pramac Ducati, Hector Barbera, saat akan menikung ke kiri. Pedrosa pun harus melupakan impian untuk meraih poin di balapan seri ke-13 ini. Tanpa Pedrosa, Lorenzo tak mendapat perlawanan berarti. Rossi yang berusaha membuntutinya belum mampu bersaing karena hingga lap kelima, “The Doctor” tertinggal lebih dari 1 detik. Persaingan seru justru untuk memperebutkan posisi kedua, karena Stefan Bradl, Andrea Dovizioso, dan Alvaro Bautista terus membuntuti Rossi. Kecelakaan juga menimpa pebalap Yamaha Tech 3, Cal Crutchlow, yang jatuh di lap kelima, ketika berusaha melewati Dovizioso. Kegagalan ini membuat Crutchlow tak bisa membuka harapan untuk membuat sejarah sebagai pebalap Inggris pertama setelah Ron Haslam pada 1987, yang berhasil naik podium secara berturut-turut. Pada balapan di Brno, Ceko, Crutchlow berhasil finis di posisi ketiga. Di Misano ini, Crutchlow berpeluang melakukannya, apalagi Pedrosa sudah terlebih dahulu meninggalkan balapan. Sayang, impian membuat back-to-back itu sirna, karena mantan pebalap Superbike itu pun gagal melanjutkan lomba. Memasuki lap ke-14, Lorenzo terus membuat jarak dengan Rossi karena juara dunia 2010 tersebut sudah memimpin 4,587 detik. Sementara itu Rossi kian kuat mendapat tekanan dari

Valentino Rossi (kiri) menyaksikan selebrasi kemenangan Lorenzo di San Marino. Pada balapan serupa, Dani Pedrosa mengalami kecelakaan. Bradl, Dovizioso dan Bautista. Tetapi juara dunia tujuh kali MotoGP tersebut terus bertahan. Tampaknya, sasis dan lengan ayun baru yang dipakai dalam balapan ini bekerja dengan baik, sehingga sampai dengan separuh balapan, Rossi bisa bertahan di barisan depan. Pada lap ke-16, Bautista naik satu strip ke posisi keempat, setelah menyalip Dovizioso. Selanjutnya, pebalap Gresini Honda ini mulai mengincar Bradl di posisi ketiga. Benar saja, pada lap ke-19, Bautista, yang menjuarai GP San Marino pada 2008 ketika masih di kelas 250 cc, berhasil menyalip Bradl. Sementara itu

Penutupan PON Dijanjikan Lebih Meriah Wakil Presiden, Boediono, dipastukan akan menutup PON XVIII. Pihak penyelenggara menjamin kalau seremoni penutupan tersebut lebih meriah dibanding pesta pembukaan. Hal itu disampaikan, event organizer penutupan

PON, Helmi Yahyah dalam acara silahtuhrahmi Gubernur Riau, Rusli Zainal dengan wartawan, Minggu (16/9) malam. Menurut Helmi penutupan PON akan lebih banyak melibatkan artis ibukota. Misalkan, Ahmad Dhani, Ari Laso, Titi DJ dan Ruth Sahanaya. Selain itu akan ada juga penyanyi dangdut Cici Paramida yang akan membawa tembang Melayu. “Acara penutupan akan lebih happy dibanding pembukaan. Karena penutupan ini lebih pada ucapan terimakasih kepada atlet,

Missy Franklin

Perenang Terbaik PERENANG muda Amerika Serikat asal Colorado, Missy Franklin yang berhasil merebut empat emas dan satu perunggu dalam debutnya di Olimpiade London 2012, dinobatkan sebagai atlet renang terbaik AS tahun ini. Sayangnya, Missy Franklin tak bisa menerima sendiri penghargaan yang diperolehnya itu dalam acara di US Aquatic Sports Convention akhir pekan lalu. Gadis berusia 17 tahun itu tengah sibuk mempersiapkan ujian akhir sekolah menengah atasnya sejak kembali dari London. Pekan lalu dia juga tidak hadir di Gedung Putih, saat para atlet Olimpiade dan Paralimpiade dijamu Presiden Barack Obama. “Saya tak menyangka hidup saya bisa sehebat ini,” kata Franklin. “Menjadi bagian dari tim Olimpiade adalah sebuah pengalaman yang luar biasa. Kami di tim renang sangat akrab. Kami bersenang-senang bersama dan saya menyayangi mereka semua,” tambah dia. Di London, Missy Franklin mendapatkan emas di nomor 100m dan 200m gaya punggung, 4x200 meter gaya bebas dan 4x100 meter gaya campuran. Dan di nomor 200 meter gaya punggung serta di gaya campuran, Franklin juga memecahkan rekor dunia. Dan dia masih meraih perunggu untuk nomor 4x100 meter gaya bebas. Prestasinya itu sebenarnya bisa mendatangkan banyak keuntungan finansial bagi Franklin. Namun kepada harian USA Today, Franklin mengatakan belum terpikir untuk beralih menjadi profesional. “Saya ingin menjadi profesional suatu hari nanti. Tetapi untuk saat ini menjadi bagian tim renang di universitas adalah salah satu yang paling saya inginkan,” tegasnya. (int)

Evander Holyfield Missy Franklin

Lorenzo kian jauh di depan dengan keunggulan 5,524 detik atas Rossi. Bautista, Bradl, dan Dovizioso bertarung ketat memperebutkan posisi ketiga. Tiga pebalap tersebut hanya berjarak sekitar 0,2 detik di antara mereka, sedangkan Rossi agak menjauh karena unggul lebih dari satu detik atas Bautista. Tampaknya “The Doctor” bisa mempertahankan posisinya karena kecepatan Desmosedici GP12 tunggangannya cukup konsisten. Saat balapan tersisa lima lap lagi, Ben Spies mulai merangsek ke depan untuk memberikan

ancaman kepada Dovizioso. Rekan setim Lorenzo ini, yang musim depan akan memperkuat tim Pramac Ducati bersama dengan pebalap Moto2, Andrea Iannone, ikut dalam pertarungan memperebutkan posisi keempat. Sementara itu Bautista mulai sedikit lepas dari tekanan. Satu lap berselang, Bradl harus terima kenyataan turun dua strip sekaligus karena lebih dulu dilewati Dovizioso, sebelum Spies pun melakukan hal serupa. Dengan demikian, Dovizioso dan Spies yang bertarung untuk memperebutkan posisi keempat. Mereka juga kian merapat dengan Bautista di urutan ketiga. Di lap terakhir, Dovizioso, yang musim depan gantikan Rossi di Ducati, persis di belakang Bautista. Tetapi pebalap Italia ini tak mampu meraih posisi ketiga, karena dia sedikit lebih lambat menyentuh garis finis. Lorenzo dengan nyaman meraih kemenangan karena dia unggul 4,398 atas Rossi, yang finis di peringkat kedua. Tetapi bagi Rossi, hasil ini menjadi sebuah prestasi yang besar, karena sesuai janjinya, dia mampu memberikan hasil membanggakan sebagai kado perpisahan dengan Ducati di depan publik Italia. Ya, GP San Marino ini menjadi balapan terakhir Rossi bersama Ducati di rumah sendiri. Pasalnya, musim depan dia akan kembali bergabung dengan Yamaha, untuk menjadi tandem Lorenzo. Pengembangan Ducati di seri ini memberikan hasil yang memuaskan, karena Rossi bisa mengalahkan para lawan yang pada seri-seri sebelumnya sulit dikalahkan. Setelah balapan ini, para pebalap langsung mempersiapkan diri menghadapi seri ke-14 di Sirkuit Motorland Aragon. Balapan tersebut akan berlangsung pada 30 September mendatang. (int)

panitia dan wartawan,” kata Helmi. Helmi menjelaskan, hiburan penutupan sudah dimilai pukul 16.00 sore waktu setempat. Upacara penutupan PON oleh Wapres pada pukul 19.00 malam. “Penutupan nanti kita sudah mempersiapkan daya listrik tujuh MW. Kita masih memperkuat atraksi leser lewat ilusi laser terbaik di Asia,” kata Helmi. Sementara itu, Gubernur Riau memastikan kalau penutupan akan tetap diberlakukan tiket masuk. Hanya saja harga tiket tidak semahal

KLASEMEN 1. DKI Jakarta 2. Jawa Barat 3. Jawa Timur 4. Jawa Tengah 5. Riau 6. Kalimantan Timur 7. Lampung 8. Sumatera Utara 9. Sulawesi Selatan 10. Sumatera Selatan 11. Nusa Tenggara Barat 12. Sumatera Barat 13. PAPUA 14. Di Yogyakarta 15. Bali 16. Kalimantan Selatan 17. Kalimantan Barat 18. Kalimantan Tengah 19. Banten 20. Maluku 21. Jambi 22. Sulawesi Tenggara 23. Sulawesi Utara 24. Kep. Bangka Belitung 25. Gorontalo 26. Nusa Tenggara Timur 27. ACEH 28. Papua Barat 29. Sulawesi Tengah 30. BENGKULU 31. Kep. Riau 32. Maluku Utara

66 65 61 35 29 27 15 13 13 9 8 8 6 6 5 4 4 4 4 3 3 3 2 2 2 1 1 1 1 0 0 0

70 53 60 28 25 28 7 17 11 11 5 4 10 9 9 8 4 4 3 9 5 0 5 3 1 4 3 2 1 1 0 0

76 734 55 44 39 29 8 17 12 19 7 19 12 10 23 11 11 3 9 4 12 2 1 4 0 2 13 5 0 4 1 1

waktu pembukaan. “Pokoknya tiket nanti paling mahal cuma Rp 200 ribu dan paling murah Rp 50. Ini sematamata untuk membatasi membludaknya penonton,” kata Rusli. Disinggung jumlah dana penutupan, Rusli mengenal untuk merincikan. Menurutnya dananya akan lebih murah di banding Sumatera Selatan (SEA Games). “Yang jelas, kita lebih murah dari Sumsel, malah dananya nanti tak sampai separohnya,” kata Rusli. (int)

DKI Jakarta Tetap Puncaki Klasemen DKI Jakarta sejauh ini masih memuncaki klasemen sementara Pekan Olahraga Nasional (PON) XVIII Riausejak mengambil alih tampuk pimpinan dari Jawa Barat. Jakarta dan Jabar mengumpulkan emas sama banyak, Minggu (16/9). Mereka masing-masing menambah koleksi delapan emas. Emas Jakarta diraih dari beberapa cabang seperti senam ritmik dan taekwondo. Sedangkan Jabar menyabetnya dari Judo dan Kempo. Hasil itu belum mengubah posisi DKI Jakarta yang ada di posisi pertama diikuti Jabar. Komposisi di posisi lima besar klasemen tidak mengalai perubahan. Jawa Timur, Jawa Tengah, dan tuan rumah, Riau, berturut-turut ada di posisi tiga, empat, dan lima. Posisi Riau di peringkat lima klasemen sementara mulai dibayangi oleh Kalimantan Timur. Tuan rumah PON lalu itu kini hanya berjarak dua emas dari Riau. Berikut ini adalah daftar perolehan medali PON XVIII, Senin (17/9), hingga pukul 8.30 WIB. (int)

Evander Holyfield

Menelantarkan Anak Gadisnya EVANDER Holyfield belum terbebas dari masalah finansial. Mantan juara dunia tinju kelasberatinidiketahuimenelantarkansalah satu anak perempuannya, Emani. Holyfield seharusnya memberikan uang tunjangankepadagadis18tahunitusebesar $2.950 atau setara Rp28 juta per bulan. Namun,mantanmusuhbebuyutan Mike Tyson itu menunggaknya hingga berjumlah total Rp5,3 miliar. Seperti dilansir Daily M a i l , Holyfield bahkan h a r u s meng-

habiskan pendapatannya hanya untuk melunasi utang-utangnya. Padahal, pria kelahiran Alabama, Amerika Serikat ini termasuk dalam daftar 20 petinju dengan bayaran termahal. Holyfield pernah meraup $30 juta atau setara Rp285 miliar untuk sekali tanding melawan Tyson. Sayangnya, hasil jerih payah di atas ring yang mencapai Rp2,37 triliun tak mampu menutupi biaya kehidupan pria 49 tahun itu. Masalah Holyfield berawal pada 1999, ketika istrinya kala itu, Janice mengajukan gugatan cerai. Seperti dilaporkan Houston Press, Janice tidak bisa menerima pengakuan pria berkepala plontos itu yang memiliki dua anak di luar nikah. Selain seorang putra hasil pernikahannya dengan Janice, Holyfield ternyata harus membiayai11oranganaklainnya.Sehingga, pemegang rekor 44 kali menang (29 KO), 10 kali kalah dan 2 kali seri ini memiliki 12 anak dari 6 wanita berbeda. Pada 2008, Holyfield secara terbuka mendeklarasikan kebangkrutan dirinya. Lalu, 2 tahunkemudian,JanicemenuntutHolyfield melalui Pengadilan Texas untuk membayar tunjangan anaknya senilai Rp2,3 miliar. Pada Juli 2012, Holyfield akhirnya melepas rumah mewahnya di Atlanta. Rumah tersebut terjual seharga Rp71 miliar lewat proses pelelangan. (int)

SELASA 18 September 2012

Sumut Melaju ke Final

„ Torres

PEKANBARU- Tim sepakbola Sumatera Utara (Sumut) secara mengejutkan berhasil menumbangkan favorit juara Papua di babak semifinal PON XVIII, Senin (17/9). Mereka menang dengan skor 2-0.


eperti di pertandinganpertandingan sebelumnya, Papua mengandalkan trio penyerangnya, Ronald Setmot, Yohanes Nabar dan Permens Iwanggen. Namun Sumut sepertinya telah siap mengantisipasi, dan pasukan Rudi Saari terlihat berhasil mematikan pergerakan ketiga pemain tersebut. Sumut bahkan mendominasi 25 menit pertama pertandingan. Permainan taktis serta efisien berhasil diperagakan Safri Koto dan kawan-kawan. Lini pertahanan Sumut yang digalang Hardiantono juga disiplin dan membuat para penyerangPapuacukupsulitmenembus pertahanan. Di menit 41, gelandang sayap Sumut Aidun Sastria Utami melakukan tendangan melambung yang ternyata tak mampu dijangkau penjaga gawang Papua, Mario Reyaan. Bola yang masuk ke sudut kanan atas gawang mengubah kedudukan menjadi 1-0 di penghujung babak pertama itu. Di babak kedua, Papua mencoba menggempur pertahanan Sumut. Berkali-kali serangan yangdimotoriNelsonAlomdan Yohanes Nabar selalu gagal.

SedangkanSumutyangsudah unggulmengandalkanserangan balik. Setiap serangan yang merekalalukanlebihefisien. Di menit 76, Sumut mampu menambah keunggulan menjadi 2-0 melalui gol spektakuler Mohammad Irfan. Sisa sepuluh menit terakhir dilakukan Papua dengan permainan menyerang total. Tapi, kokohnya lini belakang Sumut serta sigapnya penjaga gawang Ahmad Fauzi membuat Sumut tetap tidak kebobolan gol. “Anak-anak menjalankan instruksi yang saya inginkan. Alhamdulillah, di lapangan berhasil diterapkan,” ujar pelatih Sumut Rudi Saari, usai pertandingan. Mantan pelatih PSMS tersebutsaatinimengakuinginfokus ke pertandingan final melawan pemenang antara Jawa Tengah (Jateng) melawan Kalimantan Timur (Kaltim). “Hari ini maksimal, selanjutnya final,” katanya. TimPapua Keluhkan Panpel Mengakui permainan bagus Sumatera Utara, tim Papua mengeluhkan kinerja panpel cabang sepakbola. WakilmanagertimPapuaNicko

Dimo, menuding jadwal yang tidakidealmembuatpasukannya takmaksimaltampilhariini.Secara keseluruhan, ia menilai manajemencabangsepakboladi PONkaliinikacaubalau. “Kami melawan tiga tim ISL. Jawa Barat sudah jadi korban. Sekarang yang merasakan adalah kami. Anda lihat saja, mulai babak enam besar sampai semifinal,jadwalkamiselalumain di panas terik jam 4 sore. Panpel seperti wasit, kan dari ISL semua,” ujar Nicko usai pertandingan kepada wartawan di Stadion Kaharuddin Nasution, Senin (17/9). Meski demikian, Nicko mengakui permainan Sumut memang lebih bagus dan konsisten sepanjang 90 menit. Ia pun akan mengoptimalkan sisa

waktu yang ada untuk istirahat mempersiapkan partai perebutan perunggu. “Terlepas dari itu, kami harus akui Sumut memang main bagus,” ujarnya. Hal senada dikatakan kapten Tim Papua Jorgen Wayega. Menurut pemain berusia 20 tahun itu, Sumut memang tampil agresif dan cepat. Ia menekankan, jadwal yang padat serta keharusan bermain di panas terikmatahariikutmempengaruhi performa ia dan temantemannya. Apalagi dua pilar Papua yaitu Hendrick Makuba serta Elvis Harewan juga masih cedera. “Ya, dua teman kami juga cedera. Selain itu, fisik kami ikut terkuras karena padatnya jadwal,” sebutnya. (int)

Kepergian RVP Bikin Arsenal Lebih Baik

Di Matteo Tak Khawatirkan Performa Torres Fernando Torres sudah absen mencetak gol di dua laga kompetitif yang dijalani Chelsea. Meski demikian, Roberto Di Matteo mengaku tak khawatir. Sejak hengkangnya Didier Drogba, Torres menjadi andalan Di Matteo di lini depan The Blues. Dia selalu diturunkansejakmenitpertamadi empat laga Premier League yang sudah dijalani Chelsea. Tapi sudah dua laga kompetitif dilewati Torres tanpa mencetakgol.Setelahtakbikin

gol saat lawan Atletico Madrid di Piala Super Eropa, Torres kembali absen mencetak gol saat Chelsea diimbangi Queens Park Rangers di laga Premier League akhir pekan lalu. Dalam laga di Loftus Road itu, performa Torres bahkan mengecewakan. Dia akhirnya ditarik keluar di menit ke-81 dan digantikan oleh Daniel Sturridge. Hal itu sempat dikhawatirkan akan membawa Torres kembali ke ‘mimpi buruknya’ ketika kesulitan mencetak gol

di awal kariernya bersama Chelsea. Tapi Di Matteo menampik hal itu. “Tidak, tentu tidak. Kami tidak bisa menaruh tekanan terlalu besar pada satu pemain,” ujar Di Matteo seperti diwartakan Sky Sports. “Kamiadalahtimdansetiap pemain punya tanggung jawab. Kami juga mencari pemainlainuntukmencetakgol. Saya pikir ini adalah olahraga tim. Saya tidak akan melihat pemain secara individu,” tuntas pria asal Italia itu. (int)

‘Lampard Inspirasiku, Kaka Idolaku’ FRANK Lampard dan Ricardo Kaka merupakan dua pesepakbola favorit Oscar dos Santos. Pemain anyar Chelsea ini mengaku telah lama menjadikan Lampard dan Kaka sebagai panutannya di lapangan hijau. Seperti diketahui, Oscar diboyong ke Stamford Bridge sejak bursatransfermusimlalu,dengan nilai transfer sebesar 25 juta pounds. Pemain internasional Brasil itu akhirnya bisa bertemu dengan inspiratornya di lapangan, Frank Lampard. “Saya selalu menonton permainannya, ketika saya tumbuh dewasa. Saya pun selalu berpikir bahwa dia merupakan pemain yang luar biasa. Saya selalu tidak sabar untuk

„ Oscar dos Santos bermain bersama Lampard,” kata Oscar, Senin (17/9).

Selain Lampard, mantan pemain Internacional itu juga mengidolakan Kaka. Punggawa Real Madriditutelahmenjadiidolanya sejak kecil. Selain Kaka adalah pemainhebat,rekansenegaranya itu juga bermain di posisi yang sama dengan Oscar. “Sejak kecil, idola saya adalah Kaka. Dia bermain di posisi yang sama dengan saya. Dia juga tergolong sebagai pemain luar biasa,” tandas pemain 21 tahun ini. Sejauh ini, Oscar telah turun membelaChelseadalamdualaga awal Premier League musim 2012/2013 ini, saat The Blues kontra Wigan Athletic dan Reading. Dari bangku cadangan, mantan pemain Sao Paulo ini menggantikan Eden Hazard dan Ramires. (int)

Kepergian Robin van Persie boleh jadi akan membuat kehilangan besar untuk Arsenal. Tapi Arsene Wenger justru mengambil sisi positifnya, di mana The Gunnerskinilebihbermainsebagaitim. Dalamduamusimterakhir,ketergantungan Arsenal pada Van Persie begitu besar. Terkhusus musim lalu saat Van Persie menyumbang 30 gol atau nyaris setengah dari total 74 gol yang dicetak Arsenal selama semusim. Maka Arsenal pun kerap diplesetkan menjadi Van Persie FC karena terlalu bergantung pada golgol Van Persie dan tak ada satupun pemainArsenalyangmampumencetakgolmencapaiangkaduadigit. Ketika Van Persie dijual ke Manchester United, maka Arsenal pun diramalkan akan kesulitan musim ini karena kualitas Lukas Podolski dan Olivier Giroud yang didatangkan oleh Wenger tak sepadan

dengan pemain asal Belanda itu. Setidaknya prediksi itu terbukti ketika di dua laga awal Liga Inggris, Arsenal dua kali bermain imbang tanpa gol. Namun, klub asal London Utara itu cepat bangkit dan dia dua laga terakhir mereka mencetak delapan gol serta jadi tim

dengan produktivitas gol terbaik di empat laga sejauh ini. Terkait fakta ini, Wenger menilai kepergian Van Persie membantu Arsenal bermain sebagai tim dan tak lagi bergantung pada satu pemain. Sumber gol Arsenal kini bisa dari lini mana pun dan sejauh ini

baru Podolski yang mencetak lebih dari satu gol, sisanya dibagi rata ke empat pemain dan dua gol bunuh diri. “Terkadang ketika ada satu pemain yang menonjol dan menjadi pusatperhatiansertajaditumpuan tim lalu orang-orang hanya akan menganggapdia,”tukasWengerdi Soccernet. “Robin van persie mencetak 30 gol, dan ketika Anda mencetak gol sebanyak itu, maka semuanya akan memberi bola pada Anda. Mudahnya seperti itu. Permainan kami saat ini sedikit lebih bervariasi,” lanjutnya. “Kami punya semangat, keinginan untuk bermain secara tim dan kekuatan dari kedalaman pemain kami. Hasilnya kami lebih terlihat sebagai tim dan kami menikmati bermain secara tim. Itu adalah dasar yang baik dan menarik,” pungkasnya. (int)

Neuer Optimistis Bayern Sukses MUNICH- Bayern Munich bersemangat untuk meraih kesuksesan di gelaran Liga Champions musim 2012/2013 ini. Kendati sulit menghilangkan kekecewaan musim lalu di laga final Liga Champions, Manuel Neuer optimistis timnyaberpeluanguntuksuksesdi musimini. Seperti diketahui, Bayern berhasilmelajuhinggababakfinalLiga Champions musim lalu. Namun, harapan The Bavarians untuk meraih gelar juara Eropa itu harus pupus, setelah Chelsea mampu unggul lewat adu penalti. “Normal jika kami selalu ingin

mencapaikesuksesansemaksimal mungkin. Sayangnya, kami tidak mampu memanfaatkan kesempatan itu musim lalu. Kali ini, kami akanmelihatkedepan,”ujarNeuer, Senin (17/9). Bayern dijadwalkan akan melakoni laga perdananya di babak penyisihan grup, dengan menjamu Valencia pada Kamis (20/9) mendatang. Kiper 26 tahun ini menganggap,lagainiakanmenjadi laga pembuka yang tidak mudah bagi The Bavarians. “Kamimemulaikompetisiinidari awallagi.Dilagapertama,kamiharus menghadapi lawan yang sangat

kuat.Kamitidakakanmudahmendapatkantigapoindarilagaini,”kata kiperberkebangsaanJermanini. “Kami pasti punya keberuntungan lebih, ketimbang musim lalu.Meskibegitu,kamiakanmemberikan perlawanan serius ke lawan-lawankamidigrupini.Sebab, mereka merupakan tim berkualitas dan layak untuk bermain di Liga Champions,” pungkasnya. Selain Valencia, Bayern akan bertemu dengan klub asal Prancis Lille, dan klub asal Belarusia BATE. Empat tim ini tergabung dalam grup F Liga Champions musim 2012/2013. (int)

„ Manuel Neuer

Busquets Terkejut Sukses di Barca BARCELONA- Sergio Busquets mengaku terkejut dengan kesuksesannya di Barcelona. Punggawa LosBlaugranainitidakmenyangka bahwa dia akan menjadi pemain kuncidiskuadtimKatalan,bahkan memenangi banyak trofi. Busquets memulai debutnya bersama tim utama Barcelona pada 2008 lalu. Sejak saat itu, pemain 24 tahun ini menjadi pemain kunci di lini tengah Los Blaugrana dan mengantarkan timnya meraih tiga gelar La Liga dan trofi Liga Champions musim 2010/11 lalu. “Semuanyaterjadidengancepat.

„ Sergio Busquets

Dansebenarnya,sayatidakpernah membayangkan bahwa saya akan memenangkanbanyakgelarbersamaBarca,”kataBusquets,sebagaimanadilansirGoal,Senin(17/9). Busquets juga mengungkapkan kebahagiaannya, sebab pemain internasional Spanyol ini punya peran penting di skuad Los Blaugrana. Hal inilah yang membuatnya mengukir harapan di Barcelona, yaitu keinginannya untuk bermain lebih lama lagi bersama klub raksasa asal Spanyol itu. “Saya tentunya sangat bahagia. Sebab, saya berperan penting di

sini. Saya juga memiliki jatah bermain banyak dan saya tidak membayangkan ini terjadi. Saya berharap, saya akan punya waktu lebih bersama Barca dan memenangi lebih banyak gelar lagi di sini,” tandasnya. Busquets termasuk salah satu pemain yang setia merumput bersama Barcelona. Sebelum masuk tim utama Barca, pemain bertubuh jangkung ini bermain bersama tim Barcelona B. Hingga saat ini, Busquets tercatat telah tampil di 120 laga bersama tim Katalan, dengan torehan tiga gol. (int)

SELASA 18 September 2012


Bentrok Anderlecht di San Siro mungkin dijadikan Massimiliano Allegri sebagai misi menyelamatkan dirinya dari pemecatan.


iga kali main dengan 2 kekalahan di kandang jelas tak bisa diterima buat klub sebesar AC Milan. Tak pelak, masa depan allenatore Massimiliano Allegri pun mulai dipertanyakan. Kekalahan 0-1 dari Atalanta, Sabtu (15/ 9), menjadikan musim 2012/2013 sebagai yang terburuk dalam 82 tahun sejarah Milan. Kali terakhir, I Rossoneri menderita 2 kekalahan beruntun di San Siro terjadi pada 1930 silam. Tak hanya itu. Legendaris Milan Zvonimir Boban pun menyindir pasukan Allegri sebagai yang terburuk yang pernah dimilik I Rossoneri dalam 25 tahun terakhir. Sontak, mencuat isu bahwa manajemen Milan memberi tenggat buat Allegri untuk menyelamatkan jabatannya dalam 2 partai ke depan. Dimulai dengan menjamu klub Belgia, Anderlecht, di San Siro pada Grup C Champions League, Selasa (18/9) atau Rabu (19/9) dinihari WIB. Allegri mungkin berpikir Anderlecht bakal jadi penyelamatnya. Anderlecht termasuk lawan relatif mudah buat Giampaolo Pazzini dkk. Dari 4 pertemuan sebelumnya, Milan menang dan seri masing-masing 2 kali. Pada benturan terakhir di San Siro, 1 November 2006, Milan bahkan membantai Anderlecht 4-1 lewat hattrick Ricardo Kaka dan 1 gol Alberto Gilardino. Yang menarik, setelah ke empat bentrokan dengan Anderlecht di 2 musim berbeda (1993/1994 dan 2006/2007), Milanselalujadijuaradiakhirkompetisi. Well, ini yang bikin Allegri berharap musim ini pertemuan dengan Anderlecht jadi berkah buat Milan di akhir



No 1 2 3 4 5

Pelatih: Van den Brom

Borussia Dortmund VS

Gol 4 4 3


No 1 2 3 4 5

Borussia Dortmund 0:1/2 Ajax Amsterdam

Dortmund) di Liga Champions. Cruyff juga menilai, kesialan Ajax masuk grup maut lantaran timnya kini bukan lagi klub unggulan di Benua Biru, sehingga hanya berada di pot tiga saat pengundian grup Liga Champions beberapa waktu lalu. “Saat ini perasaan saya campur aduk di Liga Champions. Tentu saja menye-

nangkan Ajax akan melawan juara liga Spanyol, Inggris dan Jerman,” ujar Cruyff. “Tapi di saat bersamaan, anda sadar akan sangat sulit bagi klub lolos ke babak berikutnya.” “Situasi ini terutama disebabkan karena Ajax berada di pot ketiga saat undiandilakukan.Selama17tahunterakhir, ada sesuatu yang salah.” “BagaimanabisatimjuaraLigaChampions 1995 dan berada di final setahun berikutnya, justru menempati pot ketiga pada 2012 ini,” keluh Cruyff.

S 1 0 2 2 1

K 0 1 0 0 1

SG 8-2 10-5 8-1 9-6 10-4

Nilai 10 9 8 8 7

Nama Michu R van Persie J Defoe

Klub Swansea City Manchester United Tottenham Hotspur

Team Barcelona Málaga Mallorca Sevilla Atletico Madrid

M 4 4 4 4 3

M 4 3 2 2 2

S 0 1 2 2 1

K 0 0 0 0 0

SG 12-3 6-2 5-3 4-2 9-4

Nilai 12 10 8 8 7

AC Milan 0:0 Anderlecht

TOP SCORER Gol 6 4 4

Nama L Messi R Falcao T Hemed

Klub Barcelona Atlético Madrid Mallorca

ITALIAN SERIE A No 1 2 3 4 5

Team Juventus Napoli Lazio Sampdoria Internazionale

M 3 3 3 3 3

M 3 3 3 3 2

S 0 0 0 0 0

K 0 0 0 0 1

SG 9-2 8-2 7-1 6-3 6-3

Nilai 9 9 9 8 6

TOP SCORER Gol 4 3 3

Ajax Amsterdam


M 3 3 2 2 2


Nama S Jovetic Hernanes M Klose

Klub Fiorentina Lazio Lazio


Peluang Lubang Jarum Meski pelatih Ajax Amsterdam Johan Cruyffbanggatimnyatergabungdengan klubjuaradimasing-masingliga,namun di satu sisi dia mencemaskan peluang tim keluar dari lubang jarum. Ia mencemaskan peluang Ajax merebut satu tiket ke babak 16 Besar lantaran harus berjibaku melawan tim papan atas Eropa. Ajax Amsterdam tidak beruntung karena harus berada satu grup dengan tiga tim juara La Liga Spanyol [Real Madrid], Liga Primer Inggris (Manchester City) dan Bundesliga Jerman (Borussia

M 4 4 4 4 4



kompetisi Champions League nanti. “Untungnya, Champions League memberikan Milan peluang untuk bangkit lagi. Kami semua ada di satu Kouyate Proto a perahu (manajemen, pelatih, dan pezz Odoi ea 4-3 M e main). Kami harus sedikit berbicara p -3 ep n Biglia us la Deschacht Gi Mi dan banyak bekerja,” ucap Allegri. on i ad “Tapi, kami wajib berkembang St Wasilewski Mbokani Gillet danmelupakanhasil-hasillalu. Kljestan Selasa nanti jadi Pazzini Kanu kesempatan buat kami merapikan kepingan Sutter Emanuelson dan bergerak maEl Shawaary Boateng Antonini ju.” 4 Ambrosini Di kubu An-31-2 Acerbi derlecht, pasukan John van den De Jong Brom datang dengan Bonera Abbiati semangat dan optimisme tinggi. Mereka tak mau perjuaAbate ngan berat sejak Kualifikasi III AC MILAN Champions League sia-sia. Anderlecht Pelatih:Massimiliano Allegri menapakfasegrupusaimengempaskan klub Lithuania (kualifikasi III) dan klub Siprus AEL Limassol (playoff). HEAD TO HEAD: Dieumerci Mbokani Bezua jadi pemain yang harus diperhatikan barisan 24/11/93 Anderlecht 0-0 AC Milan belakang Milan. Striker Kongo berusia 30/3/94 AC Milan 0-0 Anderlecht 26 ini telah mengepak 4 gol di 4 partai 17/10/2006 Anderlecht 0-1 AC Milan Anderlecht menuju fase grup. 1/11/2006 AC Milan 4-1 Anderlecht Pada tiga pertandingan terakhir, AC 5 PERTANDINGAN TERAKHIR AC MILAN : Milanselalukemasukan1goldarilawan16 Sep 2012 AC Milan 0-1 Atalanta lawannya seperti Sampdoria, Bologna, 2 Sep 2012 Bologna 1-3 AC Milan dan Atalanta. Kini mereka berada dipo26 Agu 2012 AC Milan 0-1 Sampdoria sisi ke10 di Liga Italia, dan baru me9 Agu 2012 Real Madrid 5-1 AC Milan ngalami1kemenangan,2kalikalah,serta 5 Agu 2012 AC Milan 3-1 Olimpia mengumpulkan tiga 3 poin. Anderlecht sendiri baru meraih 1 5 PERTANDINGAN TERAKHIR ANDERLECHT : kemenangan dari 5 pertandingan ter15 Sep 2012 : Lierse 1-1 Anderlecht akhir. Mereka meraih 1 kemenangan, 2 Sep 2012 : Anderlecht 2-2 GENK tiga kali seri, dan satu kali kalah. Per29 Agu 2012 : Anderlecht 2-0 AEL tandingan terakhir mereka berakhir 25 Agu 2012 : OH Leuven 1-1 Anderlecht dengan skor 1-1 ketika menghadapi 23 Agu 2012 : AEL 2-1 Anderlecht Lierse. Anderlecht memiliki catatan yang berada di posisi ke 2 Liga Belgia dengan buruk ketika menghadapi tim Italia, poin 13 dari 7 pertandingan. Itu setelah mereka belum pernah menang. Anmereka mendapatkan 3 kemenangan, derlecht hanya bisa mencatat lima kali dan 4 kali seri. seri, dan sembilan kali kalah. Anderlecht

Team Chelsea Man United Arsenal Manc City Swansea City

No 1 2 3 4 5

Team München E. Frankfurt Hannover 96 Schalke 04 Dortmund

M 3 3 3 3 3

JERMAN M 3 3 2 2 2

S 0 0 1 1 1

K 0 0 0 0 0

SG 12-2 9-3 9-4 7-3 6-2

Rabu (19/9) Pukul 01.45 WIB TOP SCORER Gol 3 3 2

Nama M Mandžukic T Müller S Aigner

Klub Bayern München Bayern München Eintracht Frankfurt

Nilai 9 9 7 7 7


